data_2GER
# 
_entry.id   2GER 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2GER         
RCSB  RCSB037027   
WWPDB D_1000037027 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2GER 
_pdbx_database_status.recvd_initial_deposition_date   2006-03-20 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Meng, Z.' 1 
'Lou, Z.'  2 
'Liu, Z.'  3 
'Rao, Z.'  4 
# 
_citation.id                        primary 
_citation.title                     'Crystal structure of human pyrroline-5-carboxylate reductase' 
_citation.journal_abbrev            J.Mol.Biol. 
_citation.journal_volume            359 
_citation.page_first                1364 
_citation.page_last                 1377 
_citation.year                      2006 
_citation.journal_id_ASTM           JMOBAK 
_citation.country                   UK 
_citation.journal_id_ISSN           0022-2836 
_citation.journal_id_CSD            0070 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   16730026 
_citation.pdbx_database_id_DOI      10.1016/j.jmb.2006.04.053 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Meng, Z.'    1 
primary 'Lou, Z.'     2 
primary 'Liu, Z.'     3 
primary 'Li, M.'      4 
primary 'Zhao, X.'    5 
primary 'Bartlam, M.' 6 
primary 'Rao, Z.'     7 
# 
_cell.entry_id           2GER 
_cell.length_a           207.607 
_cell.length_b           123.805 
_cell.length_c           120.790 
_cell.angle_alpha        90.00 
_cell.angle_beta         121.76 
_cell.angle_gamma        90.00 
_cell.Z_PDB              20 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         2GER 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Pyrroline-5-carboxylate reductase 1' 33630.891 5   1.5.1.2 ? ? ? 
2 water   nat water                                 18.015    597 ?       ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'P5CR 1, P5C reductase 1' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;RAMSVGFIGAGQLAFALAKGFTAAGVLAAHKIMASSPDMDLATVSALRKMGVKLTPHNKETVQHSDVLFLAVKPHIIPFI
LDEIGADIEDRHIVVSCAAGVTISSIEKKLSAFRPAPRVIRCMTNTPVVVREGATVYATGTHAQVEDGRLMEQLLSSVGF
CTEVEEDLIDAVTGLSGSGPAYAFTALDALADGGVKMGLPRRLAVRLGAQALLGAAKMLLHSEQHPGQLKDNVSSPGGAT
IHALHVLESGGFRSLLINAVEASCIRTRELQSMADQEQVSPAAIKKTILDKVKLDSPAGTALSPSGHTKLLPRSLAPAGK
D
;
_entity_poly.pdbx_seq_one_letter_code_can   
;RAMSVGFIGAGQLAFALAKGFTAAGVLAAHKIMASSPDMDLATVSALRKMGVKLTPHNKETVQHSDVLFLAVKPHIIPFI
LDEIGADIEDRHIVVSCAAGVTISSIEKKLSAFRPAPRVIRCMTNTPVVVREGATVYATGTHAQVEDGRLMEQLLSSVGF
CTEVEEDLIDAVTGLSGSGPAYAFTALDALADGGVKMGLPRRLAVRLGAQALLGAAKMLLHSEQHPGQLKDNVSSPGGAT
IHALHVLESGGFRSLLINAVEASCIRTRELQSMADQEQVSPAAIKKTILDKVKLDSPAGTALSPSGHTKLLPRSLAPAGK
D
;
_entity_poly.pdbx_strand_id                 A,B,C,D,E 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ARG n 
1 2   ALA n 
1 3   MET n 
1 4   SER n 
1 5   VAL n 
1 6   GLY n 
1 7   PHE n 
1 8   ILE n 
1 9   GLY n 
1 10  ALA n 
1 11  GLY n 
1 12  GLN n 
1 13  LEU n 
1 14  ALA n 
1 15  PHE n 
1 16  ALA n 
1 17  LEU n 
1 18  ALA n 
1 19  LYS n 
1 20  GLY n 
1 21  PHE n 
1 22  THR n 
1 23  ALA n 
1 24  ALA n 
1 25  GLY n 
1 26  VAL n 
1 27  LEU n 
1 28  ALA n 
1 29  ALA n 
1 30  HIS n 
1 31  LYS n 
1 32  ILE n 
1 33  MET n 
1 34  ALA n 
1 35  SER n 
1 36  SER n 
1 37  PRO n 
1 38  ASP n 
1 39  MET n 
1 40  ASP n 
1 41  LEU n 
1 42  ALA n 
1 43  THR n 
1 44  VAL n 
1 45  SER n 
1 46  ALA n 
1 47  LEU n 
1 48  ARG n 
1 49  LYS n 
1 50  MET n 
1 51  GLY n 
1 52  VAL n 
1 53  LYS n 
1 54  LEU n 
1 55  THR n 
1 56  PRO n 
1 57  HIS n 
1 58  ASN n 
1 59  LYS n 
1 60  GLU n 
1 61  THR n 
1 62  VAL n 
1 63  GLN n 
1 64  HIS n 
1 65  SER n 
1 66  ASP n 
1 67  VAL n 
1 68  LEU n 
1 69  PHE n 
1 70  LEU n 
1 71  ALA n 
1 72  VAL n 
1 73  LYS n 
1 74  PRO n 
1 75  HIS n 
1 76  ILE n 
1 77  ILE n 
1 78  PRO n 
1 79  PHE n 
1 80  ILE n 
1 81  LEU n 
1 82  ASP n 
1 83  GLU n 
1 84  ILE n 
1 85  GLY n 
1 86  ALA n 
1 87  ASP n 
1 88  ILE n 
1 89  GLU n 
1 90  ASP n 
1 91  ARG n 
1 92  HIS n 
1 93  ILE n 
1 94  VAL n 
1 95  VAL n 
1 96  SER n 
1 97  CYS n 
1 98  ALA n 
1 99  ALA n 
1 100 GLY n 
1 101 VAL n 
1 102 THR n 
1 103 ILE n 
1 104 SER n 
1 105 SER n 
1 106 ILE n 
1 107 GLU n 
1 108 LYS n 
1 109 LYS n 
1 110 LEU n 
1 111 SER n 
1 112 ALA n 
1 113 PHE n 
1 114 ARG n 
1 115 PRO n 
1 116 ALA n 
1 117 PRO n 
1 118 ARG n 
1 119 VAL n 
1 120 ILE n 
1 121 ARG n 
1 122 CYS n 
1 123 MET n 
1 124 THR n 
1 125 ASN n 
1 126 THR n 
1 127 PRO n 
1 128 VAL n 
1 129 VAL n 
1 130 VAL n 
1 131 ARG n 
1 132 GLU n 
1 133 GLY n 
1 134 ALA n 
1 135 THR n 
1 136 VAL n 
1 137 TYR n 
1 138 ALA n 
1 139 THR n 
1 140 GLY n 
1 141 THR n 
1 142 HIS n 
1 143 ALA n 
1 144 GLN n 
1 145 VAL n 
1 146 GLU n 
1 147 ASP n 
1 148 GLY n 
1 149 ARG n 
1 150 LEU n 
1 151 MET n 
1 152 GLU n 
1 153 GLN n 
1 154 LEU n 
1 155 LEU n 
1 156 SER n 
1 157 SER n 
1 158 VAL n 
1 159 GLY n 
1 160 PHE n 
1 161 CYS n 
1 162 THR n 
1 163 GLU n 
1 164 VAL n 
1 165 GLU n 
1 166 GLU n 
1 167 ASP n 
1 168 LEU n 
1 169 ILE n 
1 170 ASP n 
1 171 ALA n 
1 172 VAL n 
1 173 THR n 
1 174 GLY n 
1 175 LEU n 
1 176 SER n 
1 177 GLY n 
1 178 SER n 
1 179 GLY n 
1 180 PRO n 
1 181 ALA n 
1 182 TYR n 
1 183 ALA n 
1 184 PHE n 
1 185 THR n 
1 186 ALA n 
1 187 LEU n 
1 188 ASP n 
1 189 ALA n 
1 190 LEU n 
1 191 ALA n 
1 192 ASP n 
1 193 GLY n 
1 194 GLY n 
1 195 VAL n 
1 196 LYS n 
1 197 MET n 
1 198 GLY n 
1 199 LEU n 
1 200 PRO n 
1 201 ARG n 
1 202 ARG n 
1 203 LEU n 
1 204 ALA n 
1 205 VAL n 
1 206 ARG n 
1 207 LEU n 
1 208 GLY n 
1 209 ALA n 
1 210 GLN n 
1 211 ALA n 
1 212 LEU n 
1 213 LEU n 
1 214 GLY n 
1 215 ALA n 
1 216 ALA n 
1 217 LYS n 
1 218 MET n 
1 219 LEU n 
1 220 LEU n 
1 221 HIS n 
1 222 SER n 
1 223 GLU n 
1 224 GLN n 
1 225 HIS n 
1 226 PRO n 
1 227 GLY n 
1 228 GLN n 
1 229 LEU n 
1 230 LYS n 
1 231 ASP n 
1 232 ASN n 
1 233 VAL n 
1 234 SER n 
1 235 SER n 
1 236 PRO n 
1 237 GLY n 
1 238 GLY n 
1 239 ALA n 
1 240 THR n 
1 241 ILE n 
1 242 HIS n 
1 243 ALA n 
1 244 LEU n 
1 245 HIS n 
1 246 VAL n 
1 247 LEU n 
1 248 GLU n 
1 249 SER n 
1 250 GLY n 
1 251 GLY n 
1 252 PHE n 
1 253 ARG n 
1 254 SER n 
1 255 LEU n 
1 256 LEU n 
1 257 ILE n 
1 258 ASN n 
1 259 ALA n 
1 260 VAL n 
1 261 GLU n 
1 262 ALA n 
1 263 SER n 
1 264 CYS n 
1 265 ILE n 
1 266 ARG n 
1 267 THR n 
1 268 ARG n 
1 269 GLU n 
1 270 LEU n 
1 271 GLN n 
1 272 SER n 
1 273 MET n 
1 274 ALA n 
1 275 ASP n 
1 276 GLN n 
1 277 GLU n 
1 278 GLN n 
1 279 VAL n 
1 280 SER n 
1 281 PRO n 
1 282 ALA n 
1 283 ALA n 
1 284 ILE n 
1 285 LYS n 
1 286 LYS n 
1 287 THR n 
1 288 ILE n 
1 289 LEU n 
1 290 ASP n 
1 291 LYS n 
1 292 VAL n 
1 293 LYS n 
1 294 LEU n 
1 295 ASP n 
1 296 SER n 
1 297 PRO n 
1 298 ALA n 
1 299 GLY n 
1 300 THR n 
1 301 ALA n 
1 302 LEU n 
1 303 SER n 
1 304 PRO n 
1 305 SER n 
1 306 GLY n 
1 307 HIS n 
1 308 THR n 
1 309 LYS n 
1 310 LEU n 
1 311 LEU n 
1 312 PRO n 
1 313 ARG n 
1 314 SER n 
1 315 LEU n 
1 316 ALA n 
1 317 PRO n 
1 318 ALA n 
1 319 GLY n 
1 320 LYS n 
1 321 ASP n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    P5CR1_HUMAN 
_struct_ref.pdbx_db_accession          P32322 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.pdbx_seq_one_letter_code   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2GER A 3 ? 321 ? P32322 1 ? 319 ? 1 319 
2 1 2GER B 3 ? 321 ? P32322 1 ? 319 ? 1 319 
3 1 2GER C 3 ? 321 ? P32322 1 ? 319 ? 1 319 
4 1 2GER D 3 ? 321 ? P32322 1 ? 319 ? 1 319 
5 1 2GER E 3 ? 321 ? P32322 1 ? 319 ? 1 319 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2GER ARG A 1 ? UNP P32322 ? ? 'CLONING ARTIFACT' -1 1  
1 2GER ALA A 2 ? UNP P32322 ? ? 'CLONING ARTIFACT' 0  2  
2 2GER ARG B 1 ? UNP P32322 ? ? 'CLONING ARTIFACT' -1 3  
2 2GER ALA B 2 ? UNP P32322 ? ? 'CLONING ARTIFACT' 0  4  
3 2GER ARG C 1 ? UNP P32322 ? ? 'CLONING ARTIFACT' -1 5  
3 2GER ALA C 2 ? UNP P32322 ? ? 'CLONING ARTIFACT' 0  6  
4 2GER ARG D 1 ? UNP P32322 ? ? 'CLONING ARTIFACT' -1 7  
4 2GER ALA D 2 ? UNP P32322 ? ? 'CLONING ARTIFACT' 0  8  
5 2GER ARG E 1 ? UNP P32322 ? ? 'CLONING ARTIFACT' -1 9  
5 2GER ALA E 2 ? UNP P32322 ? ? 'CLONING ARTIFACT' 0  10 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2GER 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.92 
_exptl_crystal.density_percent_sol   68.64 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            291 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pdbx_details    
'0.8-1M sodium acetate, 30-40mM imidazole, 50-60mM Tris-HCl, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 291K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   SBC-2 
_diffrn_detector.pdbx_collection_date   2005-08-10 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'SAGITALLY FOCUSED Si(111)' 
_diffrn_radiation.pdbx_diffrn_protocol             SAD 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9798 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 19-ID' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   19-ID 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.9798 
# 
_reflns.entry_id                     2GER 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             50 
_reflns.d_resolution_high            3.1 
_reflns.number_obs                   239396 
_reflns.number_all                   239961 
_reflns.percent_possible_obs         99.0 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             3.1 
_reflns_shell.d_res_low              3.2 
_reflns_shell.percent_possible_all   99.6 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 2GER 
_refine.ls_number_reflns_obs                     46587 
_refine.ls_number_reflns_all                     47236 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             50.0 
_refine.ls_d_res_high                            3.1 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          0.235 
_refine.ls_R_factor_all                          0.24 
_refine.ls_R_factor_R_work                       0.233 
_refine.ls_R_factor_R_free                       0.261 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  2326 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          SAD 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            random 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        10171 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             597 
_refine_hist.number_atoms_total               10768 
_refine_hist.d_res_high                       3.1 
_refine_hist.d_res_low                        50.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_angle_deg 0.007 ? ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d    1.466 ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  2GER 
_struct.title                     'Crystal Structure and Oxidative Mechanism of Human Pyrroline-5-carboxylate Reductase' 
_struct.pdbx_descriptor           'Pyrroline-5-carboxylate reductase 1 (E.C.1.5.1.2)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2GER 
_struct_keywords.pdbx_keywords   OXIDOREDUCTASE 
_struct_keywords.text            'Oxidative Mechanism of Human Pyrroline-5-carboxylate, OXIDOREDUCTASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 1 ? 
F N N 2 ? 
G N N 2 ? 
H N N 2 ? 
I N N 2 ? 
J N N 2 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ALA A 10  ? ALA A 24  ? ALA A 8   ALA A 22  1 ? 15 
HELX_P HELX_P2  2  ALA A 42  ? GLY A 51  ? ALA A 40  GLY A 49  1 ? 10 
HELX_P HELX_P3  3  LYS A 59  ? SER A 65  ? LYS A 57  SER A 63  1 ? 7  
HELX_P HELX_P4  4  ILE A 77  ? ASP A 82  ? ILE A 75  ASP A 80  1 ? 6  
HELX_P HELX_P5  5  THR A 102 ? LYS A 108 ? THR A 100 LYS A 106 1 ? 7  
HELX_P HELX_P6  6  ASN A 125 ? VAL A 130 ? ASN A 123 VAL A 128 5 ? 6  
HELX_P HELX_P7  7  GLU A 146 ? SER A 157 ? GLU A 144 SER A 155 1 ? 12 
HELX_P HELX_P8  8  GLU A 165 ? ASP A 167 ? GLU A 163 ASP A 165 5 ? 3  
HELX_P HELX_P9  9  LEU A 168 ? LYS A 196 ? LEU A 166 LYS A 194 1 ? 29 
HELX_P HELX_P10 10 PRO A 200 ? HIS A 221 ? PRO A 198 HIS A 219 1 ? 22 
HELX_P HELX_P11 11 HIS A 225 ? ASN A 232 ? HIS A 223 ASN A 230 1 ? 8  
HELX_P HELX_P12 12 THR A 240 ? SER A 249 ? THR A 238 SER A 247 1 ? 10 
HELX_P HELX_P13 13 ARG A 253 ? SER A 272 ? ARG A 251 SER A 270 1 ? 20 
HELX_P HELX_P14 14 GLY B 11  ? LYS B 19  ? GLY B 9   LYS B 17  1 ? 9  
HELX_P HELX_P15 15 THR B 43  ? LEU B 47  ? THR B 41  LEU B 45  5 ? 5  
HELX_P HELX_P16 16 LYS B 59  ? GLN B 63  ? LYS B 57  GLN B 61  5 ? 5  
HELX_P HELX_P17 17 ILE B 77  ? GLY B 85  ? ILE B 75  GLY B 83  1 ? 9  
HELX_P HELX_P18 18 THR B 102 ? GLU B 107 ? THR B 100 GLU B 105 1 ? 6  
HELX_P HELX_P19 19 ASN B 125 ? VAL B 130 ? ASN B 123 VAL B 128 5 ? 6  
HELX_P HELX_P20 20 GLY B 148 ? SER B 156 ? GLY B 146 SER B 154 1 ? 9  
HELX_P HELX_P21 21 GLU B 165 ? SER B 176 ? GLU B 163 SER B 174 1 ? 12 
HELX_P HELX_P22 22 SER B 178 ? MET B 197 ? SER B 176 MET B 195 1 ? 20 
HELX_P HELX_P23 23 PRO B 200 ? GLU B 223 ? PRO B 198 GLU B 221 1 ? 24 
HELX_P HELX_P24 24 HIS B 225 ? ASN B 232 ? HIS B 223 ASN B 230 1 ? 8  
HELX_P HELX_P25 25 ALA B 239 ? GLU B 248 ? ALA B 237 GLU B 246 1 ? 10 
HELX_P HELX_P26 26 GLY B 251 ? ASP B 275 ? GLY B 249 ASP B 273 1 ? 25 
HELX_P HELX_P27 27 GLN C 12  ? GLY C 25  ? GLN C 10  GLY C 23  1 ? 14 
HELX_P HELX_P28 28 ASP C 40  ? SER C 45  ? ASP C 38  SER C 43  1 ? 6  
HELX_P HELX_P29 29 SER C 45  ? VAL C 52  ? SER C 43  VAL C 50  1 ? 8  
HELX_P HELX_P30 30 LYS C 59  ? HIS C 64  ? LYS C 57  HIS C 62  1 ? 6  
HELX_P HELX_P31 31 ILE C 76  ? GLY C 85  ? ILE C 74  GLY C 83  1 ? 10 
HELX_P HELX_P32 32 ALA C 86  ? ILE C 88  ? ALA C 84  ILE C 86  5 ? 3  
HELX_P HELX_P33 33 THR C 102 ? SER C 111 ? THR C 100 SER C 109 1 ? 10 
HELX_P HELX_P34 34 ASN C 125 ? VAL C 130 ? ASN C 123 VAL C 128 5 ? 6  
HELX_P HELX_P35 35 LEU C 150 ? LEU C 155 ? LEU C 148 LEU C 153 1 ? 6  
HELX_P HELX_P36 36 LEU C 168 ? LEU C 175 ? LEU C 166 LEU C 173 1 ? 8  
HELX_P HELX_P37 37 SER C 178 ? MET C 197 ? SER C 176 MET C 195 1 ? 20 
HELX_P HELX_P38 38 PRO C 200 ? HIS C 221 ? PRO C 198 HIS C 219 1 ? 22 
HELX_P HELX_P39 39 HIS C 225 ? ASP C 231 ? HIS C 223 ASP C 229 1 ? 7  
HELX_P HELX_P40 40 ALA C 239 ? SER C 249 ? ALA C 237 SER C 247 1 ? 11 
HELX_P HELX_P41 41 PHE C 252 ? ILE C 257 ? PHE C 250 ILE C 255 1 ? 6  
HELX_P HELX_P42 42 GLU C 261 ? ASP C 275 ? GLU C 259 ASP C 273 1 ? 15 
HELX_P HELX_P43 43 GLY D 11  ? GLY D 25  ? GLY D 9   GLY D 23  1 ? 15 
HELX_P HELX_P44 44 ALA D 28  ? HIS D 30  ? ALA D 26  HIS D 28  5 ? 3  
HELX_P HELX_P45 45 ALA D 42  ? GLY D 51  ? ALA D 40  GLY D 49  1 ? 10 
HELX_P HELX_P46 46 HIS D 57  ? HIS D 64  ? HIS D 55  HIS D 62  1 ? 8  
HELX_P HELX_P47 47 ILE D 76  ? ALA D 86  ? ILE D 74  ALA D 84  1 ? 11 
HELX_P HELX_P48 48 THR D 102 ? SER D 111 ? THR D 100 SER D 109 1 ? 10 
HELX_P HELX_P49 49 ASN D 125 ? VAL D 130 ? ASN D 123 VAL D 128 5 ? 6  
HELX_P HELX_P50 50 GLN D 144 ? LEU D 155 ? GLN D 142 LEU D 153 1 ? 12 
HELX_P HELX_P51 51 ASP D 170 ? LEU D 175 ? ASP D 168 LEU D 173 1 ? 6  
HELX_P HELX_P52 52 SER D 178 ? MET D 197 ? SER D 176 MET D 195 1 ? 20 
HELX_P HELX_P53 53 PRO D 200 ? HIS D 221 ? PRO D 198 HIS D 219 1 ? 22 
HELX_P HELX_P54 54 HIS D 225 ? VAL D 233 ? HIS D 223 VAL D 231 1 ? 9  
HELX_P HELX_P55 55 ALA D 239 ? SER D 249 ? ALA D 237 SER D 247 1 ? 11 
HELX_P HELX_P56 56 GLY D 251 ? SER D 272 ? GLY D 249 SER D 270 1 ? 22 
HELX_P HELX_P57 57 GLY E 11  ? ALA E 24  ? GLY E 9   ALA E 22  1 ? 14 
HELX_P HELX_P58 58 ALA E 28  ? HIS E 30  ? ALA E 26  HIS E 28  5 ? 3  
HELX_P HELX_P59 59 SER E 45  ? MET E 50  ? SER E 43  MET E 48  1 ? 6  
HELX_P HELX_P60 60 HIS E 57  ? SER E 65  ? HIS E 55  SER E 63  1 ? 9  
HELX_P HELX_P61 61 ILE E 76  ? ASP E 82  ? ILE E 74  ASP E 80  1 ? 7  
HELX_P HELX_P62 62 THR E 102 ? ALA E 112 ? THR E 100 ALA E 110 1 ? 11 
HELX_P HELX_P63 63 ASN E 125 ? ARG E 131 ? ASN E 123 ARG E 129 5 ? 7  
HELX_P HELX_P64 64 ASP E 147 ? SER E 156 ? ASP E 145 SER E 154 1 ? 10 
HELX_P HELX_P65 65 SER E 157 ? GLY E 159 ? SER E 155 GLY E 157 5 ? 3  
HELX_P HELX_P66 66 ASP E 167 ? ALA E 171 ? ASP E 165 ALA E 169 5 ? 5  
HELX_P HELX_P67 67 SER E 178 ? MET E 197 ? SER E 176 MET E 195 1 ? 20 
HELX_P HELX_P68 68 PRO E 200 ? LEU E 220 ? PRO E 198 LEU E 218 1 ? 21 
HELX_P HELX_P69 69 HIS E 225 ? VAL E 233 ? HIS E 223 VAL E 231 1 ? 9  
HELX_P HELX_P70 70 ALA E 239 ? GLY E 250 ? ALA E 237 GLY E 248 1 ? 12 
HELX_P HELX_P71 71 GLY E 251 ? ASP E 275 ? GLY E 249 ASP E 273 1 ? 25 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 97 SG ? ? ? 1_555 A CYS 122 SG ? ? A CYS 95 A CYS 120 1_555 ? ? ? ? ? ? ? 2.069 ? 
disulf2 disulf ? ? B CYS 97 SG ? ? ? 1_555 B CYS 122 SG ? ? B CYS 95 B CYS 120 1_555 ? ? ? ? ? ? ? 2.049 ? 
disulf3 disulf ? ? C CYS 97 SG ? ? ? 1_555 C CYS 122 SG ? ? C CYS 95 C CYS 120 1_555 ? ? ? ? ? ? ? 2.047 ? 
disulf4 disulf ? ? D CYS 97 SG ? ? ? 1_555 D CYS 122 SG ? ? D CYS 95 D CYS 120 1_555 ? ? ? ? ? ? ? 2.072 ? 
disulf5 disulf ? ? E CYS 97 SG ? ? ? 1_555 E CYS 122 SG ? ? E CYS 95 E CYS 120 1_555 ? ? ? ? ? ? ? 2.058 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 7 ? 
B ? 2 ? 
C ? 3 ? 
D ? 3 ? 
E ? 2 ? 
F ? 3 ? 
G ? 8 ? 
H ? 8 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? parallel      
A 3 4 ? parallel      
A 4 5 ? parallel      
A 5 6 ? parallel      
A 6 7 ? anti-parallel 
B 1 2 ? parallel      
C 1 2 ? parallel      
C 2 3 ? parallel      
D 1 2 ? parallel      
D 2 3 ? anti-parallel 
E 1 2 ? parallel      
F 1 2 ? anti-parallel 
F 2 3 ? parallel      
G 1 2 ? parallel      
G 2 3 ? parallel      
G 3 4 ? parallel      
G 4 5 ? parallel      
G 5 6 ? parallel      
G 6 7 ? anti-parallel 
G 7 8 ? parallel      
H 1 2 ? parallel      
H 2 3 ? parallel      
H 3 4 ? parallel      
H 4 5 ? parallel      
H 5 6 ? parallel      
H 6 7 ? anti-parallel 
H 7 8 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LYS A 53  ? THR A 55  ? LYS A 51  THR A 53  
A 2 ILE A 32  ? SER A 35  ? ILE A 30  SER A 33  
A 3 VAL A 5   ? PHE A 7   ? VAL A 3   PHE A 5   
A 4 VAL A 67  ? LEU A 70  ? VAL A 65  LEU A 68  
A 5 ILE A 93  ? SER A 96  ? ILE A 91  SER A 94  
A 6 VAL A 119 ? MET A 123 ? VAL A 117 MET A 121 
A 7 VAL A 136 ? THR A 139 ? VAL A 134 THR A 137 
B 1 GLY A 133 ? ALA A 134 ? GLY A 131 ALA A 132 
B 2 GLY A 159 ? PHE A 160 ? GLY A 157 PHE A 158 
C 1 MET B 33  ? ALA B 34  ? MET B 31  ALA B 32  
C 2 GLY B 6   ? PHE B 7   ? GLY B 4   PHE B 5   
C 3 LEU B 68  ? PHE B 69  ? LEU B 66  PHE B 67  
D 1 VAL B 94  ? SER B 96  ? VAL B 92  SER B 94  
D 2 VAL B 119 ? MET B 123 ? VAL B 117 MET B 121 
D 3 VAL B 136 ? ALA B 138 ? VAL B 134 ALA B 136 
E 1 VAL C 5   ? GLY C 6   ? VAL C 3   GLY C 4   
E 2 ILE C 32  ? MET C 33  ? ILE C 30  MET C 31  
F 1 ILE C 120 ? MET C 123 ? ILE C 118 MET C 121 
F 2 ALA C 134 ? THR C 139 ? ALA C 132 THR C 137 
F 3 PHE C 160 ? GLU C 163 ? PHE C 158 GLU C 161 
G 1 LYS D 53  ? THR D 55  ? LYS D 51  THR D 53  
G 2 ILE D 32  ? SER D 35  ? ILE D 30  SER D 33  
G 3 VAL D 5   ? PHE D 7   ? VAL D 3   PHE D 5   
G 4 VAL D 67  ? LEU D 70  ? VAL D 65  LEU D 68  
G 5 ILE D 93  ? CYS D 97  ? ILE D 91  CYS D 95  
G 6 VAL D 119 ? MET D 123 ? VAL D 117 MET D 121 
G 7 GLY D 133 ? ALA D 138 ? GLY D 131 ALA D 136 
G 8 GLY D 159 ? GLU D 163 ? GLY D 157 GLU D 161 
H 1 LYS E 53  ? THR E 55  ? LYS E 51  THR E 53  
H 2 ILE E 32  ? SER E 35  ? ILE E 30  SER E 33  
H 3 VAL E 5   ? ILE E 8   ? VAL E 3   ILE E 6   
H 4 VAL E 67  ? LEU E 70  ? VAL E 65  LEU E 68  
H 5 ILE E 93  ? SER E 96  ? ILE E 91  SER E 94  
H 6 VAL E 119 ? MET E 123 ? VAL E 117 MET E 121 
H 7 ALA E 134 ? THR E 139 ? ALA E 132 THR E 137 
H 8 PHE E 160 ? GLU E 163 ? PHE E 158 GLU E 161 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O LYS A 53  ? O LYS A 51  N ALA A 34  ? N ALA A 32  
A 2 3 O MET A 33  ? O MET A 31  N PHE A 7   ? N PHE A 5   
A 3 4 N GLY A 6   ? N GLY A 4   O PHE A 69  ? O PHE A 67  
A 4 5 N LEU A 68  ? N LEU A 66  O ILE A 93  ? O ILE A 91  
A 5 6 N VAL A 94  ? N VAL A 92  O ILE A 120 ? O ILE A 118 
A 6 7 N MET A 123 ? N MET A 121 O VAL A 136 ? O VAL A 134 
B 1 2 N GLY A 133 ? N GLY A 131 O PHE A 160 ? O PHE A 158 
C 1 2 O MET B 33  ? O MET B 31  N PHE B 7   ? N PHE B 5   
C 2 3 N GLY B 6   ? N GLY B 4   O PHE B 69  ? O PHE B 67  
D 1 2 N VAL B 94  ? N VAL B 92  O ILE B 120 ? O ILE B 118 
D 2 3 N MET B 123 ? N MET B 121 O VAL B 136 ? O VAL B 134 
E 1 2 N VAL C 5   ? N VAL C 3   O MET C 33  ? O MET C 31  
F 1 2 N MET C 123 ? N MET C 121 O VAL C 136 ? O VAL C 134 
F 2 3 N THR C 135 ? N THR C 133 O PHE C 160 ? O PHE C 158 
G 1 2 O LYS D 53  ? O LYS D 51  N ILE D 32  ? N ILE D 30  
G 2 3 O MET D 33  ? O MET D 31  N PHE D 7   ? N PHE D 5   
G 3 4 N GLY D 6   ? N GLY D 4   O PHE D 69  ? O PHE D 67  
G 4 5 N LEU D 68  ? N LEU D 66  O ILE D 93  ? O ILE D 91  
G 5 6 N SER D 96  ? N SER D 94  O CYS D 122 ? O CYS D 120 
G 6 7 N ARG D 121 ? N ARG D 119 O ALA D 138 ? O ALA D 136 
G 7 8 N THR D 135 ? N THR D 133 O PHE D 160 ? O PHE D 158 
H 1 2 O LYS E 53  ? O LYS E 51  N ILE E 32  ? N ILE E 30  
H 2 3 O MET E 33  ? O MET E 31  N PHE E 7   ? N PHE E 5   
H 3 4 N GLY E 6   ? N GLY E 4   O PHE E 69  ? O PHE E 67  
H 4 5 N LEU E 68  ? N LEU E 66  O VAL E 95  ? O VAL E 93  
H 5 6 N VAL E 94  ? N VAL E 92  O ILE E 120 ? O ILE E 118 
H 6 7 N MET E 123 ? N MET E 121 O VAL E 136 ? O VAL E 134 
H 7 8 N THR E 135 ? N THR E 133 O PHE E 160 ? O PHE E 158 
# 
_database_PDB_matrix.entry_id          2GER 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2GER 
_atom_sites.fract_transf_matrix[1][1]   0.004817 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.002982 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008077 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.009737 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N N   . ARG A 1 1   ? 42.962  85.367  1.022   1.00 103.61 ? -1  ARG A N   1 
ATOM   2     C CA  . ARG A 1 1   ? 43.411  85.626  -0.327  1.00 106.68 ? -1  ARG A CA  1 
ATOM   3     C C   . ARG A 1 1   ? 44.738  84.943  -0.627  1.00 104.41 ? -1  ARG A C   1 
ATOM   4     O O   . ARG A 1 1   ? 45.070  84.599  -1.832  1.00 99.22  ? -1  ARG A O   1 
ATOM   5     C CB  . ARG A 1 1   ? 43.549  87.110  -0.601  1.00 111.62 ? -1  ARG A CB  1 
ATOM   6     C CG  . ARG A 1 1   ? 42.406  87.778  0.037   1.00 122.15 ? -1  ARG A CG  1 
ATOM   7     C CD  . ARG A 1 1   ? 42.410  89.193  -0.466  1.00 131.64 ? -1  ARG A CD  1 
ATOM   8     N NE  . ARG A 1 1   ? 41.057  89.698  -0.443  1.00 141.98 ? -1  ARG A NE  1 
ATOM   9     C CZ  . ARG A 1 1   ? 40.663  90.759  -1.120  1.00 147.04 ? -1  ARG A CZ  1 
ATOM   10    N NH1 . ARG A 1 1   ? 41.546  91.406  -1.860  1.00 150.49 ? -1  ARG A NH1 1 
ATOM   11    N NH2 . ARG A 1 1   ? 39.395  91.152  -1.065  1.00 150.67 ? -1  ARG A NH2 1 
ATOM   12    N N   . ALA A 1 2   ? 45.579  84.875  0.406   1.00 103.88 ? 0   ALA A N   1 
ATOM   13    C CA  . ALA A 1 2   ? 46.851  84.205  0.224   1.00 100.88 ? 0   ALA A CA  1 
ATOM   14    C C   . ALA A 1 2   ? 46.529  82.801  0.675   1.00 99.47  ? 0   ALA A C   1 
ATOM   15    O O   . ALA A 1 2   ? 47.380  81.923  0.761   1.00 98.53  ? 0   ALA A O   1 
ATOM   16    N N   . MET A 1 3   ? 45.238  82.586  0.910   1.00 98.90  ? 1   MET A N   1 
ATOM   17    C CA  . MET A 1 3   ? 44.720  81.291  1.360   1.00 98.11  ? 1   MET A CA  1 
ATOM   18    C C   . MET A 1 3   ? 44.846  80.194  0.307   1.00 98.46  ? 1   MET A C   1 
ATOM   19    O O   . MET A 1 3   ? 44.791  80.439  -0.915  1.00 99.24  ? 1   MET A O   1 
ATOM   20    C CB  . MET A 1 3   ? 43.259  81.387  1.731   1.00 96.14  ? 1   MET A CB  1 
ATOM   21    C CG  . MET A 1 3   ? 42.656  80.069  2.185   1.00 96.10  ? 1   MET A CG  1 
ATOM   22    S SD  . MET A 1 3   ? 40.873  80.085  2.089   1.00 96.20  ? 1   MET A SD  1 
ATOM   23    C CE  . MET A 1 3   ? 40.709  79.903  0.345   1.00 93.36  ? 1   MET A CE  1 
ATOM   24    N N   . SER A 1 4   ? 45.081  78.985  0.807   1.00 96.40  ? 2   SER A N   1 
ATOM   25    C CA  . SER A 1 4   ? 45.243  77.797  -0.018  1.00 93.83  ? 2   SER A CA  1 
ATOM   26    C C   . SER A 1 4   ? 44.741  76.624  0.815   1.00 90.27  ? 2   SER A C   1 
ATOM   27    O O   . SER A 1 4   ? 45.108  76.467  1.975   1.00 89.82  ? 2   SER A O   1 
ATOM   28    C CB  . SER A 1 4   ? 46.709  77.616  -0.409  1.00 97.02  ? 2   SER A CB  1 
ATOM   29    O OG  . SER A 1 4   ? 47.113  78.686  -1.263  1.00 101.50 ? 2   SER A OG  1 
ATOM   30    N N   . VAL A 1 5   ? 43.905  75.793  0.205   1.00 87.69  ? 3   VAL A N   1 
ATOM   31    C CA  . VAL A 1 5   ? 43.257  74.685  0.898   1.00 84.21  ? 3   VAL A CA  1 
ATOM   32    C C   . VAL A 1 5   ? 43.697  73.258  0.614   1.00 83.06  ? 3   VAL A C   1 
ATOM   33    O O   . VAL A 1 5   ? 44.470  72.980  -0.310  1.00 78.93  ? 3   VAL A O   1 
ATOM   34    C CB  . VAL A 1 5   ? 41.732  74.764  0.673   1.00 83.58  ? 3   VAL A CB  1 
ATOM   35    C CG1 . VAL A 1 5   ? 41.009  73.947  1.721   1.00 87.36  ? 3   VAL A CG1 1 
ATOM   36    C CG2 . VAL A 1 5   ? 41.261  76.225  0.714   1.00 79.05  ? 3   VAL A CG2 1 
ATOM   37    N N   . GLY A 1 6   ? 43.172  72.372  1.460   1.00 85.81  ? 4   GLY A N   1 
ATOM   38    C CA  . GLY A 1 6   ? 43.444  70.946  1.407   1.00 90.15  ? 4   GLY A CA  1 
ATOM   39    C C   . GLY A 1 6   ? 42.342  70.066  2.024   1.00 92.94  ? 4   GLY A C   1 
ATOM   40    O O   . GLY A 1 6   ? 41.622  70.476  2.966   1.00 91.83  ? 4   GLY A O   1 
ATOM   41    N N   . PHE A 1 7   ? 42.218  68.852  1.473   1.00 93.69  ? 5   PHE A N   1 
ATOM   42    C CA  . PHE A 1 7   ? 41.247  67.844  1.894   1.00 90.38  ? 5   PHE A CA  1 
ATOM   43    C C   . PHE A 1 7   ? 42.108  66.649  2.229   1.00 88.11  ? 5   PHE A C   1 
ATOM   44    O O   . PHE A 1 7   ? 42.858  66.170  1.394   1.00 82.08  ? 5   PHE A O   1 
ATOM   45    C CB  . PHE A 1 7   ? 40.324  67.449  0.735   1.00 93.76  ? 5   PHE A CB  1 
ATOM   46    C CG  . PHE A 1 7   ? 39.607  68.616  0.067   1.00 98.55  ? 5   PHE A CG  1 
ATOM   47    C CD1 . PHE A 1 7   ? 40.298  69.539  -0.719  1.00 99.86  ? 5   PHE A CD1 1 
ATOM   48    C CD2 . PHE A 1 7   ? 38.223  68.757  0.184   1.00 99.58  ? 5   PHE A CD2 1 
ATOM   49    C CE1 . PHE A 1 7   ? 39.612  70.577  -1.381  1.00 98.40  ? 5   PHE A CE1 1 
ATOM   50    C CE2 . PHE A 1 7   ? 37.532  69.789  -0.471  1.00 99.07  ? 5   PHE A CE2 1 
ATOM   51    C CZ  . PHE A 1 7   ? 38.227  70.695  -1.252  1.00 97.99  ? 5   PHE A CZ  1 
ATOM   52    N N   . ILE A 1 8   ? 42.011  66.183  3.460   1.00 90.63  ? 6   ILE A N   1 
ATOM   53    C CA  . ILE A 1 8   ? 42.786  65.030  3.901   1.00 93.61  ? 6   ILE A CA  1 
ATOM   54    C C   . ILE A 1 8   ? 42.165  63.800  3.296   1.00 95.86  ? 6   ILE A C   1 
ATOM   55    O O   . ILE A 1 8   ? 42.696  62.690  3.401   1.00 98.01  ? 6   ILE A O   1 
ATOM   56    C CB  . ILE A 1 8   ? 42.761  64.922  5.435   1.00 91.68  ? 6   ILE A CB  1 
ATOM   57    C CG1 . ILE A 1 8   ? 43.537  66.093  6.004   1.00 89.82  ? 6   ILE A CG1 1 
ATOM   58    C CG2 . ILE A 1 8   ? 43.347  63.604  5.920   1.00 89.78  ? 6   ILE A CG2 1 
ATOM   59    C CD1 . ILE A 1 8   ? 43.453  66.174  7.473   1.00 90.82  ? 6   ILE A CD1 1 
ATOM   60    N N   . GLY A 1 9   ? 41.026  64.010  2.657   1.00 96.46  ? 7   GLY A N   1 
ATOM   61    C CA  . GLY A 1 9   ? 40.347  62.905  2.033   1.00 100.89 ? 7   GLY A CA  1 
ATOM   62    C C   . GLY A 1 9   ? 40.583  62.885  0.541   1.00 105.34 ? 7   GLY A C   1 
ATOM   63    O O   . GLY A 1 9   ? 41.712  62.972  0.058   1.00 105.50 ? 7   GLY A O   1 
ATOM   64    N N   . ALA A 1 10  ? 39.471  62.751  -0.171  1.00 110.69 ? 8   ALA A N   1 
ATOM   65    C CA  . ALA A 1 10  ? 39.397  62.705  -1.627  1.00 113.38 ? 8   ALA A CA  1 
ATOM   66    C C   . ALA A 1 10  ? 38.014  62.106  -1.917  1.00 114.13 ? 8   ALA A C   1 
ATOM   67    O O   . ALA A 1 10  ? 36.986  62.571  -1.385  1.00 114.76 ? 8   ALA A O   1 
ATOM   68    C CB  . ALA A 1 10  ? 40.523  61.817  -2.217  1.00 111.07 ? 8   ALA A CB  1 
ATOM   69    N N   . GLY A 1 11  ? 37.996  61.056  -2.729  1.00 113.17 ? 9   GLY A N   1 
ATOM   70    C CA  . GLY A 1 11  ? 36.742  60.421  -3.062  1.00 107.65 ? 9   GLY A CA  1 
ATOM   71    C C   . GLY A 1 11  ? 35.866  61.439  -3.743  1.00 103.30 ? 9   GLY A C   1 
ATOM   72    O O   . GLY A 1 11  ? 36.334  62.411  -4.351  1.00 101.02 ? 9   GLY A O   1 
ATOM   73    N N   . GLN A 1 12  ? 34.572  61.225  -3.627  1.00 99.33  ? 10  GLN A N   1 
ATOM   74    C CA  . GLN A 1 12  ? 33.661  62.138  -4.258  1.00 95.15  ? 10  GLN A CA  1 
ATOM   75    C C   . GLN A 1 12  ? 33.850  63.510  -3.633  1.00 89.10  ? 10  GLN A C   1 
ATOM   76    O O   . GLN A 1 12  ? 34.689  64.298  -4.071  1.00 87.90  ? 10  GLN A O   1 
ATOM   77    C CB  . GLN A 1 12  ? 32.214  61.655  -4.078  1.00 99.38  ? 10  GLN A CB  1 
ATOM   78    C CG  . GLN A 1 12  ? 31.906  60.188  -4.500  1.00 101.94 ? 10  GLN A CG  1 
ATOM   79    C CD  . GLN A 1 12  ? 32.602  59.707  -5.781  1.00 102.10 ? 10  GLN A CD  1 
ATOM   80    O OE1 . GLN A 1 12  ? 32.653  60.407  -6.812  1.00 100.80 ? 10  GLN A OE1 1 
ATOM   81    N NE2 . GLN A 1 12  ? 33.127  58.482  -5.720  1.00 100.29 ? 10  GLN A NE2 1 
ATOM   82    N N   . LEU A 1 13  ? 33.069  63.759  -2.589  1.00 82.96  ? 11  LEU A N   1 
ATOM   83    C CA  . LEU A 1 13  ? 33.067  65.006  -1.854  1.00 75.18  ? 11  LEU A CA  1 
ATOM   84    C C   . LEU A 1 13  ? 34.217  65.934  -2.177  1.00 73.46  ? 11  LEU A C   1 
ATOM   85    O O   . LEU A 1 13  ? 34.001  67.084  -2.567  1.00 70.56  ? 11  LEU A O   1 
ATOM   86    C CB  . LEU A 1 13  ? 33.045  64.686  -0.378  1.00 73.34  ? 11  LEU A CB  1 
ATOM   87    C CG  . LEU A 1 13  ? 31.789  65.348  0.162   1.00 75.07  ? 11  LEU A CG  1 
ATOM   88    C CD1 . LEU A 1 13  ? 31.449  64.880  1.593   1.00 71.57  ? 11  LEU A CD1 1 
ATOM   89    C CD2 . LEU A 1 13  ? 32.042  66.851  0.058   1.00 74.03  ? 11  LEU A CD2 1 
ATOM   90    N N   . ALA A 1 14  ? 35.437  65.425  -2.013  1.00 72.03  ? 12  ALA A N   1 
ATOM   91    C CA  . ALA A 1 14  ? 36.634  66.209  -2.297  1.00 68.89  ? 12  ALA A CA  1 
ATOM   92    C C   . ALA A 1 14  ? 36.519  66.782  -3.698  1.00 68.38  ? 12  ALA A C   1 
ATOM   93    O O   . ALA A 1 14  ? 36.449  68.006  -3.881  1.00 63.35  ? 12  ALA A O   1 
ATOM   94    C CB  . ALA A 1 14  ? 37.859  65.339  -2.198  1.00 63.12  ? 12  ALA A CB  1 
ATOM   95    N N   . PHE A 1 15  ? 36.513  65.874  -4.676  1.00 72.20  ? 13  PHE A N   1 
ATOM   96    C CA  . PHE A 1 15  ? 36.394  66.213  -6.097  1.00 73.56  ? 13  PHE A CA  1 
ATOM   97    C C   . PHE A 1 15  ? 35.204  67.143  -6.298  1.00 72.94  ? 13  PHE A C   1 
ATOM   98    O O   . PHE A 1 15  ? 35.221  68.011  -7.171  1.00 73.41  ? 13  PHE A O   1 
ATOM   99    C CB  . PHE A 1 15  ? 36.234  64.923  -6.930  1.00 80.32  ? 13  PHE A CB  1 
ATOM   100   C CG  . PHE A 1 15  ? 36.027  65.153  -8.428  1.00 85.10  ? 13  PHE A CG  1 
ATOM   101   C CD1 . PHE A 1 15  ? 36.929  65.916  -9.172  1.00 86.59  ? 13  PHE A CD1 1 
ATOM   102   C CD2 . PHE A 1 15  ? 34.927  64.586  -9.089  1.00 85.71  ? 13  PHE A CD2 1 
ATOM   103   C CE1 . PHE A 1 15  ? 36.740  66.117  -10.548 1.00 88.60  ? 13  PHE A CE1 1 
ATOM   104   C CE2 . PHE A 1 15  ? 34.727  64.781  -10.466 1.00 87.50  ? 13  PHE A CE2 1 
ATOM   105   C CZ  . PHE A 1 15  ? 35.637  65.550  -11.196 1.00 88.43  ? 13  PHE A CZ  1 
ATOM   106   N N   . ALA A 1 16  ? 34.168  66.963  -5.484  1.00 71.02  ? 14  ALA A N   1 
ATOM   107   C CA  . ALA A 1 16  ? 32.985  67.811  -5.596  1.00 68.04  ? 14  ALA A CA  1 
ATOM   108   C C   . ALA A 1 16  ? 33.395  69.248  -5.287  1.00 64.53  ? 14  ALA A C   1 
ATOM   109   O O   . ALA A 1 16  ? 33.343  70.127  -6.158  1.00 62.01  ? 14  ALA A O   1 
ATOM   110   C CB  . ALA A 1 16  ? 31.882  67.336  -4.627  1.00 70.10  ? 14  ALA A CB  1 
ATOM   111   N N   . LEU A 1 17  ? 33.814  69.468  -4.045  1.00 60.36  ? 15  LEU A N   1 
ATOM   112   C CA  . LEU A 1 17  ? 34.254  70.770  -3.609  1.00 55.51  ? 15  LEU A CA  1 
ATOM   113   C C   . LEU A 1 17  ? 35.408  71.196  -4.490  1.00 60.09  ? 15  LEU A C   1 
ATOM   114   O O   . LEU A 1 17  ? 35.347  72.255  -5.124  1.00 63.16  ? 15  LEU A O   1 
ATOM   115   C CB  . LEU A 1 17  ? 34.717  70.686  -2.189  1.00 47.44  ? 15  LEU A CB  1 
ATOM   116   C CG  . LEU A 1 17  ? 33.592  70.259  -1.285  1.00 47.62  ? 15  LEU A CG  1 
ATOM   117   C CD1 . LEU A 1 17  ? 34.185  69.964  0.061   1.00 41.23  ? 15  LEU A CD1 1 
ATOM   118   C CD2 . LEU A 1 17  ? 32.512  71.328  -1.218  1.00 43.78  ? 15  LEU A CD2 1 
ATOM   119   N N   . ALA A 1 18  ? 36.443  70.362  -4.563  1.00 59.81  ? 16  ALA A N   1 
ATOM   120   C CA  . ALA A 1 18  ? 37.594  70.685  -5.389  1.00 63.73  ? 16  ALA A CA  1 
ATOM   121   C C   . ALA A 1 18  ? 37.154  71.309  -6.721  1.00 71.13  ? 16  ALA A C   1 
ATOM   122   O O   . ALA A 1 18  ? 37.552  72.421  -7.075  1.00 74.81  ? 16  ALA A O   1 
ATOM   123   C CB  . ALA A 1 18  ? 38.380  69.453  -5.661  1.00 63.85  ? 16  ALA A CB  1 
ATOM   124   N N   . LYS A 1 19  ? 36.310  70.582  -7.450  1.00 75.57  ? 17  LYS A N   1 
ATOM   125   C CA  . LYS A 1 19  ? 35.806  71.001  -8.759  1.00 73.93  ? 17  LYS A CA  1 
ATOM   126   C C   . LYS A 1 19  ? 34.977  72.291  -8.761  1.00 70.94  ? 17  LYS A C   1 
ATOM   127   O O   . LYS A 1 19  ? 35.162  73.147  -9.631  1.00 69.68  ? 17  LYS A O   1 
ATOM   128   C CB  . LYS A 1 19  ? 34.983  69.851  -9.374  1.00 74.72  ? 17  LYS A CB  1 
ATOM   129   C CG  . LYS A 1 19  ? 34.701  70.012  -10.853 1.00 78.06  ? 17  LYS A CG  1 
ATOM   130   C CD  . LYS A 1 19  ? 35.955  69.826  -11.680 1.00 81.78  ? 17  LYS A CD  1 
ATOM   131   C CE  . LYS A 1 19  ? 35.701  70.044  -13.173 1.00 86.46  ? 17  LYS A CE  1 
ATOM   132   N NZ  . LYS A 1 19  ? 36.874  69.638  -14.021 1.00 89.08  ? 17  LYS A NZ  1 
ATOM   133   N N   . GLY A 1 20  ? 34.059  72.415  -7.805  1.00 68.35  ? 18  GLY A N   1 
ATOM   134   C CA  . GLY A 1 20  ? 33.217  73.593  -7.753  1.00 70.47  ? 18  GLY A CA  1 
ATOM   135   C C   . GLY A 1 20  ? 34.012  74.846  -7.455  1.00 72.70  ? 18  GLY A C   1 
ATOM   136   O O   . GLY A 1 20  ? 33.739  75.922  -8.009  1.00 71.49  ? 18  GLY A O   1 
ATOM   137   N N   . PHE A 1 21  ? 34.994  74.693  -6.571  1.00 72.68  ? 19  PHE A N   1 
ATOM   138   C CA  . PHE A 1 21  ? 35.865  75.782  -6.157  1.00 72.61  ? 19  PHE A CA  1 
ATOM   139   C C   . PHE A 1 21  ? 36.704  76.291  -7.314  1.00 75.44  ? 19  PHE A C   1 
ATOM   140   O O   . PHE A 1 21  ? 36.818  77.507  -7.540  1.00 74.59  ? 19  PHE A O   1 
ATOM   141   C CB  . PHE A 1 21  ? 36.780  75.302  -5.048  1.00 68.41  ? 19  PHE A CB  1 
ATOM   142   C CG  . PHE A 1 21  ? 36.101  75.149  -3.715  1.00 66.99  ? 19  PHE A CG  1 
ATOM   143   C CD1 . PHE A 1 21  ? 36.594  74.232  -2.776  1.00 66.74  ? 19  PHE A CD1 1 
ATOM   144   C CD2 . PHE A 1 21  ? 35.000  75.943  -3.371  1.00 68.58  ? 19  PHE A CD2 1 
ATOM   145   C CE1 . PHE A 1 21  ? 36.002  74.100  -1.503  1.00 63.06  ? 19  PHE A CE1 1 
ATOM   146   C CE2 . PHE A 1 21  ? 34.378  75.833  -2.085  1.00 69.47  ? 19  PHE A CE2 1 
ATOM   147   C CZ  . PHE A 1 21  ? 34.881  74.907  -1.149  1.00 65.76  ? 19  PHE A CZ  1 
ATOM   148   N N   . THR A 1 22  ? 37.310  75.349  -8.034  1.00 77.45  ? 20  THR A N   1 
ATOM   149   C CA  . THR A 1 22  ? 38.125  75.688  -9.192  1.00 80.73  ? 20  THR A CA  1 
ATOM   150   C C   . THR A 1 22  ? 37.251  76.508  -10.137 1.00 84.85  ? 20  THR A C   1 
ATOM   151   O O   . THR A 1 22  ? 37.477  77.710  -10.337 1.00 85.09  ? 20  THR A O   1 
ATOM   152   C CB  . THR A 1 22  ? 38.625  74.405  -9.949  1.00 80.98  ? 20  THR A CB  1 
ATOM   153   O OG1 . THR A 1 22  ? 37.599  73.396  -9.973  1.00 82.90  ? 20  THR A OG1 1 
ATOM   154   C CG2 . THR A 1 22  ? 39.867  73.848  -9.294  1.00 78.91  ? 20  THR A CG2 1 
ATOM   155   N N   . ALA A 1 23  ? 36.236  75.840  -10.687 1.00 86.65  ? 21  ALA A N   1 
ATOM   156   C CA  . ALA A 1 23  ? 35.289  76.444  -11.604 1.00 85.94  ? 21  ALA A CA  1 
ATOM   157   C C   . ALA A 1 23  ? 34.674  77.738  -11.051 1.00 87.16  ? 21  ALA A C   1 
ATOM   158   O O   . ALA A 1 23  ? 34.243  78.595  -11.819 1.00 86.07  ? 21  ALA A O   1 
ATOM   159   C CB  . ALA A 1 23  ? 34.201  75.437  -11.926 1.00 85.62  ? 21  ALA A CB  1 
ATOM   160   N N   . ALA A 1 24  ? 34.634  77.880  -9.727  1.00 88.57  ? 22  ALA A N   1 
ATOM   161   C CA  . ALA A 1 24  ? 34.072  79.079  -9.109  1.00 90.97  ? 22  ALA A CA  1 
ATOM   162   C C   . ALA A 1 24  ? 35.010  80.271  -9.286  1.00 94.20  ? 22  ALA A C   1 
ATOM   163   O O   . ALA A 1 24  ? 34.650  81.417  -8.949  1.00 93.99  ? 22  ALA A O   1 
ATOM   164   C CB  . ALA A 1 24  ? 33.823  78.835  -7.630  1.00 90.16  ? 22  ALA A CB  1 
ATOM   165   N N   . GLY A 1 25  ? 36.207  79.985  -9.813  1.00 97.33  ? 23  GLY A N   1 
ATOM   166   C CA  . GLY A 1 25  ? 37.228  81.007  -10.048 1.00 100.82 ? 23  GLY A CA  1 
ATOM   167   C C   . GLY A 1 25  ? 37.792  81.568  -8.755  1.00 101.22 ? 23  GLY A C   1 
ATOM   168   O O   . GLY A 1 25  ? 38.416  82.642  -8.718  1.00 99.89  ? 23  GLY A O   1 
ATOM   169   N N   . VAL A 1 26  ? 37.561  80.804  -7.691  1.00 101.35 ? 24  VAL A N   1 
ATOM   170   C CA  . VAL A 1 26  ? 37.956  81.162  -6.340  1.00 99.90  ? 24  VAL A CA  1 
ATOM   171   C C   . VAL A 1 26  ? 39.400  80.832  -6.000  1.00 97.85  ? 24  VAL A C   1 
ATOM   172   O O   . VAL A 1 26  ? 40.265  81.703  -5.964  1.00 100.34 ? 24  VAL A O   1 
ATOM   173   C CB  . VAL A 1 26  ? 37.010  80.482  -5.324  1.00 99.66  ? 24  VAL A CB  1 
ATOM   174   C CG1 . VAL A 1 26  ? 37.417  80.851  -3.916  1.00 100.49 ? 24  VAL A CG1 1 
ATOM   175   C CG2 . VAL A 1 26  ? 35.567  80.924  -5.591  1.00 101.65 ? 24  VAL A CG2 1 
ATOM   176   N N   . LEU A 1 27  ? 39.666  79.574  -5.725  1.00 94.02  ? 25  LEU A N   1 
ATOM   177   C CA  . LEU A 1 27  ? 41.018  79.207  -5.402  1.00 91.46  ? 25  LEU A CA  1 
ATOM   178   C C   . LEU A 1 27  ? 41.740  79.012  -6.736  1.00 89.19  ? 25  LEU A C   1 
ATOM   179   O O   . LEU A 1 27  ? 41.611  79.841  -7.627  1.00 91.57  ? 25  LEU A O   1 
ATOM   180   C CB  . LEU A 1 27  ? 40.991  77.938  -4.558  1.00 92.31  ? 25  LEU A CB  1 
ATOM   181   C CG  . LEU A 1 27  ? 42.317  77.434  -3.979  1.00 95.05  ? 25  LEU A CG  1 
ATOM   182   C CD1 . LEU A 1 27  ? 43.244  78.614  -3.643  1.00 99.44  ? 25  LEU A CD1 1 
ATOM   183   C CD2 . LEU A 1 27  ? 42.017  76.592  -2.738  1.00 93.36  ? 25  LEU A CD2 1 
ATOM   184   N N   . ALA A 1 28  ? 42.491  77.931  -6.878  1.00 85.11  ? 26  ALA A N   1 
ATOM   185   C CA  . ALA A 1 28  ? 43.188  77.648  -8.118  1.00 83.42  ? 26  ALA A CA  1 
ATOM   186   C C   . ALA A 1 28  ? 43.724  76.254  -7.941  1.00 83.85  ? 26  ALA A C   1 
ATOM   187   O O   . ALA A 1 28  ? 44.533  76.002  -7.060  1.00 81.48  ? 26  ALA A O   1 
ATOM   188   C CB  . ALA A 1 28  ? 44.315  78.641  -8.347  1.00 84.24  ? 26  ALA A CB  1 
ATOM   189   N N   . ALA A 1 29  ? 43.250  75.351  -8.788  1.00 87.94  ? 27  ALA A N   1 
ATOM   190   C CA  . ALA A 1 29  ? 43.620  73.937  -8.736  1.00 94.17  ? 27  ALA A CA  1 
ATOM   191   C C   . ALA A 1 29  ? 44.917  73.659  -8.005  1.00 97.37  ? 27  ALA A C   1 
ATOM   192   O O   . ALA A 1 29  ? 44.922  73.002  -6.957  1.00 99.33  ? 27  ALA A O   1 
ATOM   193   C CB  . ALA A 1 29  ? 43.684  73.352  -10.151 1.00 94.97  ? 27  ALA A CB  1 
ATOM   194   N N   . HIS A 1 30  ? 46.012  74.178  -8.553  1.00 98.82  ? 28  HIS A N   1 
ATOM   195   C CA  . HIS A 1 30  ? 47.333  73.965  -7.983  1.00 97.61  ? 28  HIS A CA  1 
ATOM   196   C C   . HIS A 1 30  ? 47.438  74.422  -6.521  1.00 97.45  ? 28  HIS A C   1 
ATOM   197   O O   . HIS A 1 30  ? 48.095  73.781  -5.719  1.00 97.80  ? 28  HIS A O   1 
ATOM   198   C CB  . HIS A 1 30  ? 48.374  74.659  -8.859  1.00 95.95  ? 28  HIS A CB  1 
ATOM   199   C CG  . HIS A 1 30  ? 48.436  76.132  -8.657  1.00 93.31  ? 28  HIS A CG  1 
ATOM   200   N ND1 . HIS A 1 30  ? 47.338  76.948  -8.804  1.00 94.59  ? 28  HIS A ND1 1 
ATOM   201   C CD2 . HIS A 1 30  ? 49.463  76.939  -8.315  1.00 93.72  ? 28  HIS A CD2 1 
ATOM   202   C CE1 . HIS A 1 30  ? 47.688  78.197  -8.564  1.00 97.48  ? 28  HIS A CE1 1 
ATOM   203   N NE2 . HIS A 1 30  ? 48.974  78.220  -8.265  1.00 97.66  ? 28  HIS A NE2 1 
ATOM   204   N N   . LYS A 1 31  ? 46.774  75.511  -6.168  1.00 96.17  ? 29  LYS A N   1 
ATOM   205   C CA  . LYS A 1 31  ? 46.816  75.976  -4.798  1.00 93.38  ? 29  LYS A CA  1 
ATOM   206   C C   . LYS A 1 31  ? 45.860  75.135  -3.956  1.00 88.02  ? 29  LYS A C   1 
ATOM   207   O O   . LYS A 1 31  ? 45.103  75.665  -3.163  1.00 87.35  ? 29  LYS A O   1 
ATOM   208   C CB  . LYS A 1 31  ? 46.422  77.457  -4.732  1.00 98.80  ? 29  LYS A CB  1 
ATOM   209   C CG  . LYS A 1 31  ? 47.411  78.397  -5.421  1.00 107.37 ? 29  LYS A CG  1 
ATOM   210   C CD  . LYS A 1 31  ? 47.028  79.890  -5.258  1.00 115.95 ? 29  LYS A CD  1 
ATOM   211   C CE  . LYS A 1 31  ? 45.728  80.272  -6.000  1.00 118.15 ? 29  LYS A CE  1 
ATOM   212   N NZ  . LYS A 1 31  ? 45.456  81.748  -6.116  1.00 114.88 ? 29  LYS A NZ  1 
ATOM   213   N N   . ILE A 1 32  ? 45.891  73.822  -4.134  1.00 83.37  ? 30  ILE A N   1 
ATOM   214   C CA  . ILE A 1 32  ? 45.014  72.931  -3.382  1.00 82.14  ? 30  ILE A CA  1 
ATOM   215   C C   . ILE A 1 32  ? 45.680  71.603  -3.160  1.00 83.54  ? 30  ILE A C   1 
ATOM   216   O O   . ILE A 1 32  ? 46.487  71.182  -3.965  1.00 84.69  ? 30  ILE A O   1 
ATOM   217   C CB  . ILE A 1 32  ? 43.763  72.608  -4.143  1.00 81.06  ? 30  ILE A CB  1 
ATOM   218   C CG1 . ILE A 1 32  ? 43.099  73.884  -4.606  1.00 82.66  ? 30  ILE A CG1 1 
ATOM   219   C CG2 . ILE A 1 32  ? 42.832  71.807  -3.269  1.00 81.16  ? 30  ILE A CG2 1 
ATOM   220   C CD1 . ILE A 1 32  ? 41.916  73.598  -5.440  1.00 81.25  ? 30  ILE A CD1 1 
ATOM   221   N N   . MET A 1 33  ? 45.307  70.901  -2.100  1.00 85.86  ? 31  MET A N   1 
ATOM   222   C CA  . MET A 1 33  ? 45.936  69.610  -1.843  1.00 88.45  ? 31  MET A CA  1 
ATOM   223   C C   . MET A 1 33  ? 45.130  68.572  -1.049  1.00 87.76  ? 31  MET A C   1 
ATOM   224   O O   . MET A 1 33  ? 44.534  68.887  -0.026  1.00 87.32  ? 31  MET A O   1 
ATOM   225   C CB  . MET A 1 33  ? 47.277  69.849  -1.153  1.00 90.74  ? 31  MET A CB  1 
ATOM   226   C CG  . MET A 1 33  ? 48.077  68.593  -0.891  1.00 94.19  ? 31  MET A CG  1 
ATOM   227   S SD  . MET A 1 33  ? 49.726  68.955  -0.247  1.00 94.95  ? 31  MET A SD  1 
ATOM   228   C CE  . MET A 1 33  ? 50.791  68.617  -1.722  1.00 92.60  ? 31  MET A CE  1 
ATOM   229   N N   . ALA A 1 34  ? 45.124  67.330  -1.530  1.00 85.86  ? 32  ALA A N   1 
ATOM   230   C CA  . ALA A 1 34  ? 44.420  66.244  -0.856  1.00 85.98  ? 32  ALA A CA  1 
ATOM   231   C C   . ALA A 1 34  ? 45.269  64.976  -0.840  1.00 86.67  ? 32  ALA A C   1 
ATOM   232   O O   . ALA A 1 34  ? 46.083  64.750  -1.732  1.00 85.56  ? 32  ALA A O   1 
ATOM   233   C CB  . ALA A 1 34  ? 43.101  65.976  -1.532  1.00 84.50  ? 32  ALA A CB  1 
ATOM   234   N N   . SER A 1 35  ? 45.067  64.158  0.188   1.00 87.13  ? 33  SER A N   1 
ATOM   235   C CA  . SER A 1 35  ? 45.809  62.923  0.370   1.00 86.68  ? 33  SER A CA  1 
ATOM   236   C C   . SER A 1 35  ? 45.112  61.651  -0.145  1.00 90.54  ? 33  SER A C   1 
ATOM   237   O O   . SER A 1 35  ? 43.917  61.418  0.082   1.00 88.71  ? 33  SER A O   1 
ATOM   238   C CB  . SER A 1 35  ? 46.154  62.772  1.850   1.00 83.53  ? 33  SER A CB  1 
ATOM   239   O OG  . SER A 1 35  ? 45.007  62.909  2.670   1.00 75.33  ? 33  SER A OG  1 
ATOM   240   N N   . SER A 1 36  ? 45.889  60.828  -0.845  1.00 95.22  ? 34  SER A N   1 
ATOM   241   C CA  . SER A 1 36  ? 45.392  59.578  -1.412  1.00 97.86  ? 34  SER A CA  1 
ATOM   242   C C   . SER A 1 36  ? 45.752  58.343  -0.588  1.00 102.84 ? 34  SER A C   1 
ATOM   243   O O   . SER A 1 36  ? 46.730  57.642  -0.883  1.00 102.16 ? 34  SER A O   1 
ATOM   244   C CB  . SER A 1 36  ? 45.902  59.377  -2.862  1.00 94.77  ? 34  SER A CB  1 
ATOM   245   O OG  . SER A 1 36  ? 47.310  59.171  -2.936  1.00 85.67  ? 34  SER A OG  1 
ATOM   246   N N   . PRO A 1 37  ? 45.003  58.083  0.491   1.00 106.66 ? 35  PRO A N   1 
ATOM   247   C CA  . PRO A 1 37  ? 45.432  56.863  1.174   1.00 111.30 ? 35  PRO A CA  1 
ATOM   248   C C   . PRO A 1 37  ? 44.947  55.754  0.210   1.00 117.85 ? 35  PRO A C   1 
ATOM   249   O O   . PRO A 1 37  ? 43.745  55.499  0.141   1.00 122.09 ? 35  PRO A O   1 
ATOM   250   C CB  . PRO A 1 37  ? 44.652  56.923  2.490   1.00 109.22 ? 35  PRO A CB  1 
ATOM   251   C CG  . PRO A 1 37  ? 44.511  58.430  2.739   1.00 107.32 ? 35  PRO A CG  1 
ATOM   252   C CD  . PRO A 1 37  ? 44.136  58.912  1.350   1.00 106.81 ? 35  PRO A CD  1 
ATOM   253   N N   . ASP A 1 38  ? 45.877  55.154  -0.550  1.00 122.37 ? 36  ASP A N   1 
ATOM   254   C CA  . ASP A 1 38  ? 45.656  54.088  -1.579  1.00 126.44 ? 36  ASP A CA  1 
ATOM   255   C C   . ASP A 1 38  ? 45.694  54.664  -3.029  1.00 127.91 ? 36  ASP A C   1 
ATOM   256   O O   . ASP A 1 38  ? 46.739  54.578  -3.681  1.00 127.37 ? 36  ASP A O   1 
ATOM   257   C CB  . ASP A 1 38  ? 44.338  53.271  -1.364  1.00 127.00 ? 36  ASP A CB  1 
ATOM   258   C CG  . ASP A 1 38  ? 44.589  51.763  -1.002  1.00 126.32 ? 36  ASP A CG  1 
ATOM   259   O OD1 . ASP A 1 38  ? 45.513  51.126  -1.565  1.00 124.06 ? 36  ASP A OD1 1 
ATOM   260   O OD2 . ASP A 1 38  ? 43.836  51.205  -0.164  1.00 125.88 ? 36  ASP A OD2 1 
ATOM   261   N N   . MET A 1 39  ? 44.571  55.229  -3.503  1.00 129.91 ? 37  MET A N   1 
ATOM   262   C CA  . MET A 1 39  ? 44.379  55.848  -4.848  1.00 133.73 ? 37  MET A CA  1 
ATOM   263   C C   . MET A 1 39  ? 43.230  55.261  -5.701  1.00 133.53 ? 37  MET A C   1 
ATOM   264   O O   . MET A 1 39  ? 43.402  54.275  -6.422  1.00 131.33 ? 37  MET A O   1 
ATOM   265   C CB  . MET A 1 39  ? 45.663  55.832  -5.683  1.00 136.97 ? 37  MET A CB  1 
ATOM   266   C CG  . MET A 1 39  ? 46.728  56.804  -5.201  1.00 142.02 ? 37  MET A CG  1 
ATOM   267   S SD  . MET A 1 39  ? 48.249  56.609  -6.114  1.00 150.14 ? 37  MET A SD  1 
ATOM   268   C CE  . MET A 1 39  ? 48.795  54.948  -5.569  1.00 148.00 ? 37  MET A CE  1 
ATOM   269   N N   . ASP A 1 40  ? 42.067  55.909  -5.634  1.00 133.26 ? 38  ASP A N   1 
ATOM   270   C CA  . ASP A 1 40  ? 40.879  55.461  -6.349  1.00 131.48 ? 38  ASP A CA  1 
ATOM   271   C C   . ASP A 1 40  ? 40.736  56.058  -7.705  1.00 130.88 ? 38  ASP A C   1 
ATOM   272   O O   . ASP A 1 40  ? 39.933  56.966  -7.888  1.00 130.42 ? 38  ASP A O   1 
ATOM   273   C CB  . ASP A 1 40  ? 39.627  55.811  -5.577  1.00 133.41 ? 38  ASP A CB  1 
ATOM   274   C CG  . ASP A 1 40  ? 39.836  55.753  -4.099  1.00 137.38 ? 38  ASP A CG  1 
ATOM   275   O OD1 . ASP A 1 40  ? 40.470  54.783  -3.626  1.00 140.74 ? 38  ASP A OD1 1 
ATOM   276   O OD2 . ASP A 1 40  ? 39.364  56.674  -3.405  1.00 139.39 ? 38  ASP A OD2 1 
ATOM   277   N N   . LEU A 1 41  ? 41.507  55.545  -8.654  1.00 130.78 ? 39  LEU A N   1 
ATOM   278   C CA  . LEU A 1 41  ? 41.449  56.017  -10.032 1.00 130.96 ? 39  LEU A CA  1 
ATOM   279   C C   . LEU A 1 41  ? 40.508  57.204  -10.209 1.00 129.57 ? 39  LEU A C   1 
ATOM   280   O O   . LEU A 1 41  ? 40.946  58.353  -10.229 1.00 129.24 ? 39  LEU A O   1 
ATOM   281   C CB  . LEU A 1 41  ? 40.989  54.890  -10.960 1.00 132.26 ? 39  LEU A CB  1 
ATOM   282   C CG  . LEU A 1 41  ? 41.922  53.699  -11.169 1.00 133.27 ? 39  LEU A CG  1 
ATOM   283   C CD1 . LEU A 1 41  ? 41.284  52.769  -12.207 1.00 134.55 ? 39  LEU A CD1 1 
ATOM   284   C CD2 . LEU A 1 41  ? 43.294  54.179  -11.634 1.00 132.12 ? 39  LEU A CD2 1 
ATOM   285   N N   . ALA A 1 42  ? 39.213  56.908  -10.330 1.00 127.08 ? 40  ALA A N   1 
ATOM   286   C CA  . ALA A 1 42  ? 38.191  57.932  -10.514 1.00 124.59 ? 40  ALA A CA  1 
ATOM   287   C C   . ALA A 1 42  ? 38.627  59.214  -9.805  1.00 122.39 ? 40  ALA A C   1 
ATOM   288   O O   . ALA A 1 42  ? 39.223  60.099  -10.424 1.00 121.68 ? 40  ALA A O   1 
ATOM   289   C CB  . ALA A 1 42  ? 36.823  57.431  -9.968  1.00 124.21 ? 40  ALA A CB  1 
ATOM   290   N N   . THR A 1 43  ? 38.361  59.293  -8.504  1.00 118.13 ? 41  THR A N   1 
ATOM   291   C CA  . THR A 1 43  ? 38.722  60.456  -7.707  1.00 111.97 ? 41  THR A CA  1 
ATOM   292   C C   . THR A 1 43  ? 40.143  60.885  -7.996  1.00 109.28 ? 41  THR A C   1 
ATOM   293   O O   . THR A 1 43  ? 40.408  61.701  -8.889  1.00 108.83 ? 41  THR A O   1 
ATOM   294   C CB  . THR A 1 43  ? 38.646  60.130  -6.224  1.00 112.98 ? 41  THR A CB  1 
ATOM   295   O OG1 . THR A 1 43  ? 37.320  59.696  -5.906  1.00 113.52 ? 41  THR A OG1 1 
ATOM   296   C CG2 . THR A 1 43  ? 39.029  61.345  -5.393  1.00 114.12 ? 41  THR A CG2 1 
ATOM   297   N N   . VAL A 1 44  ? 41.046  60.313  -7.205  1.00 105.72 ? 42  VAL A N   1 
ATOM   298   C CA  . VAL A 1 44  ? 42.467  60.578  -7.295  1.00 101.30 ? 42  VAL A CA  1 
ATOM   299   C C   . VAL A 1 44  ? 42.867  60.873  -8.724  1.00 101.66 ? 42  VAL A C   1 
ATOM   300   O O   . VAL A 1 44  ? 43.027  62.030  -9.096  1.00 98.35  ? 42  VAL A O   1 
ATOM   301   C CB  . VAL A 1 44  ? 43.259  59.378  -6.744  1.00 98.54  ? 42  VAL A CB  1 
ATOM   302   C CG1 . VAL A 1 44  ? 44.752  59.609  -6.864  1.00 95.33  ? 42  VAL A CG1 1 
ATOM   303   C CG2 . VAL A 1 44  ? 42.875  59.168  -5.290  1.00 95.45  ? 42  VAL A CG2 1 
ATOM   304   N N   . SER A 1 45  ? 42.979  59.835  -9.540  1.00 105.15 ? 43  SER A N   1 
ATOM   305   C CA  . SER A 1 45  ? 43.377  60.024  -10.930 1.00 108.88 ? 43  SER A CA  1 
ATOM   306   C C   . SER A 1 45  ? 42.621  61.168  -11.640 1.00 109.55 ? 43  SER A C   1 
ATOM   307   O O   . SER A 1 45  ? 43.208  61.856  -12.478 1.00 109.51 ? 43  SER A O   1 
ATOM   308   C CB  . SER A 1 45  ? 43.234  58.708  -11.710 1.00 109.51 ? 43  SER A CB  1 
ATOM   309   O OG  . SER A 1 45  ? 44.022  58.719  -12.896 1.00 109.12 ? 43  SER A OG  1 
ATOM   310   N N   . ALA A 1 46  ? 41.343  61.384  -11.310 1.00 109.98 ? 44  ALA A N   1 
ATOM   311   C CA  . ALA A 1 46  ? 40.593  62.473  -11.942 1.00 110.58 ? 44  ALA A CA  1 
ATOM   312   C C   . ALA A 1 46  ? 41.380  63.712  -11.632 1.00 112.02 ? 44  ALA A C   1 
ATOM   313   O O   . ALA A 1 46  ? 42.025  64.293  -12.500 1.00 115.33 ? 44  ALA A O   1 
ATOM   314   C CB  . ALA A 1 46  ? 39.198  62.608  -11.356 1.00 106.29 ? 44  ALA A CB  1 
ATOM   315   N N   . LEU A 1 47  ? 41.317  64.103  -10.369 1.00 113.59 ? 45  LEU A N   1 
ATOM   316   C CA  . LEU A 1 47  ? 42.014  65.273  -9.864  1.00 115.67 ? 45  LEU A CA  1 
ATOM   317   C C   . LEU A 1 47  ? 43.343  65.526  -10.550 1.00 118.10 ? 45  LEU A C   1 
ATOM   318   O O   . LEU A 1 47  ? 43.617  66.656  -10.970 1.00 118.54 ? 45  LEU A O   1 
ATOM   319   C CB  . LEU A 1 47  ? 42.240  65.097  -8.377  1.00 114.95 ? 45  LEU A CB  1 
ATOM   320   C CG  . LEU A 1 47  ? 40.902  64.958  -7.655  1.00 116.52 ? 45  LEU A CG  1 
ATOM   321   C CD1 . LEU A 1 47  ? 41.072  64.324  -6.274  1.00 115.95 ? 45  LEU A CD1 1 
ATOM   322   C CD2 . LEU A 1 47  ? 40.278  66.344  -7.588  1.00 116.40 ? 45  LEU A CD2 1 
ATOM   323   N N   . ARG A 1 48  ? 44.158  64.472  -10.651 1.00 119.18 ? 46  ARG A N   1 
ATOM   324   C CA  . ARG A 1 48  ? 45.476  64.554  -11.286 1.00 120.55 ? 46  ARG A CA  1 
ATOM   325   C C   . ARG A 1 48  ? 45.403  65.501  -12.475 1.00 120.58 ? 46  ARG A C   1 
ATOM   326   O O   . ARG A 1 48  ? 46.214  66.418  -12.620 1.00 119.92 ? 46  ARG A O   1 
ATOM   327   C CB  . ARG A 1 48  ? 45.942  63.163  -11.757 1.00 122.48 ? 46  ARG A CB  1 
ATOM   328   C CG  . ARG A 1 48  ? 46.221  62.147  -10.630 1.00 125.72 ? 46  ARG A CG  1 
ATOM   329   C CD  . ARG A 1 48  ? 47.680  61.637  -10.640 1.00 125.96 ? 46  ARG A CD  1 
ATOM   330   N NE  . ARG A 1 48  ? 47.941  60.620  -9.614  1.00 123.84 ? 46  ARG A NE  1 
ATOM   331   C CZ  . ARG A 1 48  ? 49.094  59.973  -9.480  1.00 124.74 ? 46  ARG A CZ  1 
ATOM   332   N NH1 . ARG A 1 48  ? 50.108  60.226  -10.299 1.00 126.15 ? 46  ARG A NH1 1 
ATOM   333   N NH2 . ARG A 1 48  ? 49.232  59.066  -8.534  1.00 126.68 ? 46  ARG A NH2 1 
ATOM   334   N N   . LYS A 1 49  ? 44.408  65.266  -13.322 1.00 121.31 ? 47  LYS A N   1 
ATOM   335   C CA  . LYS A 1 49  ? 44.181  66.083  -14.502 1.00 121.06 ? 47  LYS A CA  1 
ATOM   336   C C   . LYS A 1 49  ? 43.657  67.463  -14.097 1.00 119.94 ? 47  LYS A C   1 
ATOM   337   O O   . LYS A 1 49  ? 44.159  68.481  -14.564 1.00 118.81 ? 47  LYS A O   1 
ATOM   338   C CB  . LYS A 1 49  ? 43.163  65.404  -15.433 1.00 122.61 ? 47  LYS A CB  1 
ATOM   339   C CG  . LYS A 1 49  ? 43.637  64.136  -16.134 1.00 121.96 ? 47  LYS A CG  1 
ATOM   340   C CD  . LYS A 1 49  ? 42.550  63.666  -17.086 1.00 122.82 ? 47  LYS A CD  1 
ATOM   341   C CE  . LYS A 1 49  ? 43.057  62.687  -18.120 1.00 121.28 ? 47  LYS A CE  1 
ATOM   342   N NZ  . LYS A 1 49  ? 42.080  62.634  -19.250 1.00 122.82 ? 47  LYS A NZ  1 
ATOM   343   N N   . MET A 1 50  ? 42.647  67.495  -13.232 1.00 118.94 ? 48  MET A N   1 
ATOM   344   C CA  . MET A 1 50  ? 42.067  68.760  -12.810 1.00 118.22 ? 48  MET A CA  1 
ATOM   345   C C   . MET A 1 50  ? 43.156  69.799  -12.576 1.00 118.26 ? 48  MET A C   1 
ATOM   346   O O   . MET A 1 50  ? 43.140  70.886  -13.171 1.00 119.28 ? 48  MET A O   1 
ATOM   347   C CB  . MET A 1 50  ? 41.234  68.587  -11.541 1.00 117.18 ? 48  MET A CB  1 
ATOM   348   C CG  . MET A 1 50  ? 40.328  69.784  -11.286 1.00 118.19 ? 48  MET A CG  1 
ATOM   349   S SD  . MET A 1 50  ? 39.105  69.508  -9.989  1.00 121.99 ? 48  MET A SD  1 
ATOM   350   C CE  . MET A 1 50  ? 39.400  70.873  -8.972  1.00 117.30 ? 48  MET A CE  1 
ATOM   351   N N   . GLY A 1 51  ? 44.104  69.451  -11.711 1.00 116.81 ? 49  GLY A N   1 
ATOM   352   C CA  . GLY A 1 51  ? 45.206  70.349  -11.405 1.00 114.88 ? 49  GLY A CA  1 
ATOM   353   C C   . GLY A 1 51  ? 45.427  70.527  -9.912  1.00 112.44 ? 49  GLY A C   1 
ATOM   354   O O   . GLY A 1 51  ? 45.938  71.557  -9.474  1.00 112.68 ? 49  GLY A O   1 
ATOM   355   N N   . VAL A 1 52  ? 45.050  69.523  -9.127  1.00 110.19 ? 50  VAL A N   1 
ATOM   356   C CA  . VAL A 1 52  ? 45.202  69.588  -7.678  1.00 109.27 ? 50  VAL A CA  1 
ATOM   357   C C   . VAL A 1 52  ? 46.395  68.795  -7.134  1.00 108.94 ? 50  VAL A C   1 
ATOM   358   O O   . VAL A 1 52  ? 46.758  67.755  -7.682  1.00 108.83 ? 50  VAL A O   1 
ATOM   359   C CB  . VAL A 1 52  ? 43.931  69.085  -6.981  1.00 108.44 ? 50  VAL A CB  1 
ATOM   360   C CG1 . VAL A 1 52  ? 44.071  69.224  -5.460  1.00 106.99 ? 50  VAL A CG1 1 
ATOM   361   C CG2 . VAL A 1 52  ? 42.729  69.860  -7.496  1.00 107.52 ? 50  VAL A CG2 1 
ATOM   362   N N   . LYS A 1 53  ? 46.997  69.285  -6.048  1.00 107.79 ? 51  LYS A N   1 
ATOM   363   C CA  . LYS A 1 53  ? 48.146  68.616  -5.441  1.00 106.67 ? 51  LYS A CA  1 
ATOM   364   C C   . LYS A 1 53  ? 47.743  67.416  -4.616  1.00 105.04 ? 51  LYS A C   1 
ATOM   365   O O   . LYS A 1 53  ? 47.015  67.538  -3.632  1.00 103.57 ? 51  LYS A O   1 
ATOM   366   C CB  . LYS A 1 53  ? 48.936  69.580  -4.553  1.00 110.72 ? 51  LYS A CB  1 
ATOM   367   C CG  . LYS A 1 53  ? 49.777  70.606  -5.310  1.00 115.82 ? 51  LYS A CG  1 
ATOM   368   C CD  . LYS A 1 53  ? 50.603  71.462  -4.344  1.00 119.36 ? 51  LYS A CD  1 
ATOM   369   C CE  . LYS A 1 53  ? 51.459  72.509  -5.061  1.00 120.39 ? 51  LYS A CE  1 
ATOM   370   N NZ  . LYS A 1 53  ? 51.937  73.592  -4.141  1.00 120.06 ? 51  LYS A NZ  1 
ATOM   371   N N   . LEU A 1 54  ? 48.224  66.247  -5.016  1.00 104.22 ? 52  LEU A N   1 
ATOM   372   C CA  . LEU A 1 54  ? 47.905  65.026  -4.286  1.00 103.79 ? 52  LEU A CA  1 
ATOM   373   C C   . LEU A 1 54  ? 49.128  64.389  -3.670  1.00 101.76 ? 52  LEU A C   1 
ATOM   374   O O   . LEU A 1 54  ? 50.132  64.154  -4.329  1.00 99.97  ? 52  LEU A O   1 
ATOM   375   C CB  . LEU A 1 54  ? 47.212  64.005  -5.190  1.00 104.50 ? 52  LEU A CB  1 
ATOM   376   C CG  . LEU A 1 54  ? 45.812  64.328  -5.720  1.00 104.67 ? 52  LEU A CG  1 
ATOM   377   C CD1 . LEU A 1 54  ? 45.298  63.153  -6.529  1.00 105.09 ? 52  LEU A CD1 1 
ATOM   378   C CD2 . LEU A 1 54  ? 44.882  64.620  -4.561  1.00 105.16 ? 52  LEU A CD2 1 
ATOM   379   N N   . THR A 1 55  ? 49.022  64.109  -2.385  1.00 101.58 ? 53  THR A N   1 
ATOM   380   C CA  . THR A 1 55  ? 50.104  63.504  -1.649  1.00 103.10 ? 53  THR A CA  1 
ATOM   381   C C   . THR A 1 55  ? 49.632  62.291  -0.875  1.00 104.08 ? 53  THR A C   1 
ATOM   382   O O   . THR A 1 55  ? 48.581  62.316  -0.234  1.00 103.77 ? 53  THR A O   1 
ATOM   383   C CB  . THR A 1 55  ? 50.668  64.459  -0.624  1.00 103.81 ? 53  THR A CB  1 
ATOM   384   O OG1 . THR A 1 55  ? 51.510  63.728  0.279   1.00 106.85 ? 53  THR A OG1 1 
ATOM   385   C CG2 . THR A 1 55  ? 49.527  65.117  0.163   1.00 104.05 ? 53  THR A CG2 1 
ATOM   386   N N   . PRO A 1 56  ? 50.419  61.219  -0.896  1.00 103.67 ? 54  PRO A N   1 
ATOM   387   C CA  . PRO A 1 56  ? 49.976  60.050  -0.153  1.00 104.04 ? 54  PRO A CA  1 
ATOM   388   C C   . PRO A 1 56  ? 49.819  60.418  1.309   1.00 104.47 ? 54  PRO A C   1 
ATOM   389   O O   . PRO A 1 56  ? 48.906  59.935  1.988   1.00 108.34 ? 54  PRO A O   1 
ATOM   390   C CB  . PRO A 1 56  ? 51.106  59.052  -0.391  1.00 105.01 ? 54  PRO A CB  1 
ATOM   391   C CG  . PRO A 1 56  ? 52.310  59.949  -0.488  1.00 104.45 ? 54  PRO A CG  1 
ATOM   392   C CD  . PRO A 1 56  ? 51.805  61.063  -1.366  1.00 104.81 ? 54  PRO A CD  1 
ATOM   393   N N   . HIS A 1 57  ? 50.699  61.305  1.773   1.00 101.66 ? 55  HIS A N   1 
ATOM   394   C CA  . HIS A 1 57  ? 50.740  61.731  3.173   1.00 98.79  ? 55  HIS A CA  1 
ATOM   395   C C   . HIS A 1 57  ? 49.772  62.832  3.542   1.00 96.53  ? 55  HIS A C   1 
ATOM   396   O O   . HIS A 1 57  ? 50.025  63.999  3.262   1.00 95.27  ? 55  HIS A O   1 
ATOM   397   C CB  . HIS A 1 57  ? 52.152  62.178  3.506   1.00 98.87  ? 55  HIS A CB  1 
ATOM   398   C CG  . HIS A 1 57  ? 53.191  61.153  3.182   1.00 98.58  ? 55  HIS A CG  1 
ATOM   399   N ND1 . HIS A 1 57  ? 53.297  59.960  3.863   1.00 97.53  ? 55  HIS A ND1 1 
ATOM   400   C CD2 . HIS A 1 57  ? 54.151  61.131  2.229   1.00 98.82  ? 55  HIS A CD2 1 
ATOM   401   C CE1 . HIS A 1 57  ? 54.281  59.245  3.345   1.00 100.35 ? 55  HIS A CE1 1 
ATOM   402   N NE2 . HIS A 1 57  ? 54.815  59.933  2.353   1.00 102.10 ? 55  HIS A NE2 1 
ATOM   403   N N   . ASN A 1 58  ? 48.675  62.467  4.198   1.00 95.99  ? 56  ASN A N   1 
ATOM   404   C CA  . ASN A 1 58  ? 47.682  63.450  4.597   1.00 95.13  ? 56  ASN A CA  1 
ATOM   405   C C   . ASN A 1 58  ? 48.233  64.310  5.716   1.00 94.87  ? 56  ASN A C   1 
ATOM   406   O O   . ASN A 1 58  ? 47.533  64.760  6.599   1.00 97.85  ? 56  ASN A O   1 
ATOM   407   C CB  . ASN A 1 58  ? 46.341  62.781  4.989   1.00 95.64  ? 56  ASN A CB  1 
ATOM   408   C CG  . ASN A 1 58  ? 46.502  61.500  5.812   1.00 95.53  ? 56  ASN A CG  1 
ATOM   409   O OD1 . ASN A 1 58  ? 47.234  60.587  5.439   1.00 97.43  ? 56  ASN A OD1 1 
ATOM   410   N ND2 . ASN A 1 58  ? 45.779  61.427  6.928   1.00 91.46  ? 56  ASN A ND2 1 
ATOM   411   N N   . LYS A 1 59  ? 49.526  64.560  5.642   1.00 94.86  ? 57  LYS A N   1 
ATOM   412   C CA  . LYS A 1 59  ? 50.204  65.369  6.637   1.00 94.28  ? 57  LYS A CA  1 
ATOM   413   C C   . LYS A 1 59  ? 50.827  66.549  5.906   1.00 90.96  ? 57  LYS A C   1 
ATOM   414   O O   . LYS A 1 59  ? 50.772  67.671  6.392   1.00 90.99  ? 57  LYS A O   1 
ATOM   415   C CB  . LYS A 1 59  ? 51.276  64.526  7.330   1.00 98.19  ? 57  LYS A CB  1 
ATOM   416   C CG  . LYS A 1 59  ? 50.811  63.076  7.615   1.00 102.79 ? 57  LYS A CG  1 
ATOM   417   C CD  . LYS A 1 59  ? 51.981  62.065  7.622   1.00 105.03 ? 57  LYS A CD  1 
ATOM   418   C CE  . LYS A 1 59  ? 51.503  60.586  7.737   1.00 109.44 ? 57  LYS A CE  1 
ATOM   419   N NZ  . LYS A 1 59  ? 52.572  59.514  7.812   1.00 108.85 ? 57  LYS A NZ  1 
ATOM   420   N N   . GLU A 1 60  ? 51.392  66.289  4.724   1.00 88.27  ? 58  GLU A N   1 
ATOM   421   C CA  . GLU A 1 60  ? 52.009  67.335  3.911   1.00 86.26  ? 58  GLU A CA  1 
ATOM   422   C C   . GLU A 1 60  ? 50.868  68.277  3.636   1.00 82.12  ? 58  GLU A C   1 
ATOM   423   O O   . GLU A 1 60  ? 51.030  69.485  3.476   1.00 79.49  ? 58  GLU A O   1 
ATOM   424   C CB  . GLU A 1 60  ? 52.519  66.794  2.567   1.00 90.76  ? 58  GLU A CB  1 
ATOM   425   C CG  . GLU A 1 60  ? 53.527  65.643  2.633   1.00 100.98 ? 58  GLU A CG  1 
ATOM   426   C CD  . GLU A 1 60  ? 54.242  65.368  1.293   1.00 105.55 ? 58  GLU A CD  1 
ATOM   427   O OE1 . GLU A 1 60  ? 53.574  65.287  0.235   1.00 104.66 ? 58  GLU A OE1 1 
ATOM   428   O OE2 . GLU A 1 60  ? 55.490  65.222  1.296   1.00 110.38 ? 58  GLU A OE2 1 
ATOM   429   N N   . THR A 1 61  ? 49.697  67.676  3.567   1.00 80.88  ? 59  THR A N   1 
ATOM   430   C CA  . THR A 1 61  ? 48.482  68.417  3.327   1.00 83.23  ? 59  THR A CA  1 
ATOM   431   C C   . THR A 1 61  ? 48.407  69.490  4.396   1.00 83.29  ? 59  THR A C   1 
ATOM   432   O O   . THR A 1 61  ? 48.577  70.694  4.140   1.00 83.64  ? 59  THR A O   1 
ATOM   433   C CB  . THR A 1 61  ? 47.241  67.497  3.471   1.00 82.75  ? 59  THR A CB  1 
ATOM   434   O OG1 . THR A 1 61  ? 47.312  66.446  2.504   1.00 82.91  ? 59  THR A OG1 1 
ATOM   435   C CG2 . THR A 1 61  ? 45.952  68.290  3.284   1.00 83.12  ? 59  THR A CG2 1 
ATOM   436   N N   . VAL A 1 62  ? 48.149  69.007  5.605   1.00 81.75  ? 60  VAL A N   1 
ATOM   437   C CA  . VAL A 1 62  ? 48.010  69.831  6.795   1.00 78.58  ? 60  VAL A CA  1 
ATOM   438   C C   . VAL A 1 62  ? 48.793  71.139  6.740   1.00 77.70  ? 60  VAL A C   1 
ATOM   439   O O   . VAL A 1 62  ? 48.327  72.202  7.177   1.00 74.35  ? 60  VAL A O   1 
ATOM   440   C CB  . VAL A 1 62  ? 48.477  69.053  8.015   1.00 77.37  ? 60  VAL A CB  1 
ATOM   441   C CG1 . VAL A 1 62  ? 47.844  69.646  9.262   1.00 72.08  ? 60  VAL A CG1 1 
ATOM   442   C CG2 . VAL A 1 62  ? 48.161  67.559  7.827   1.00 71.37  ? 60  VAL A CG2 1 
ATOM   443   N N   . GLN A 1 63  ? 49.996  71.040  6.206   1.00 77.28  ? 61  GLN A N   1 
ATOM   444   C CA  . GLN A 1 63  ? 50.861  72.184  6.102   1.00 82.20  ? 61  GLN A CA  1 
ATOM   445   C C   . GLN A 1 63  ? 50.398  73.040  4.944   1.00 84.88  ? 61  GLN A C   1 
ATOM   446   O O   . GLN A 1 63  ? 49.965  74.172  5.125   1.00 87.97  ? 61  GLN A O   1 
ATOM   447   C CB  . GLN A 1 63  ? 52.282  71.699  5.871   1.00 82.68  ? 61  GLN A CB  1 
ATOM   448   C CG  . GLN A 1 63  ? 52.618  70.480  6.734   1.00 82.83  ? 61  GLN A CG  1 
ATOM   449   C CD  . GLN A 1 63  ? 54.071  70.030  6.633   1.00 84.96  ? 61  GLN A CD  1 
ATOM   450   O OE1 . GLN A 1 63  ? 54.556  69.671  5.549   1.00 80.88  ? 61  GLN A OE1 1 
ATOM   451   N NE2 . GLN A 1 63  ? 54.772  70.037  7.775   1.00 84.54  ? 61  GLN A NE2 1 
ATOM   452   N N   . HIS A 1 64  ? 50.487  72.469  3.751   1.00 86.99  ? 62  HIS A N   1 
ATOM   453   C CA  . HIS A 1 64  ? 50.090  73.131  2.516   1.00 87.86  ? 62  HIS A CA  1 
ATOM   454   C C   . HIS A 1 64  ? 48.805  73.957  2.629   1.00 87.29  ? 62  HIS A C   1 
ATOM   455   O O   . HIS A 1 64  ? 48.567  74.878  1.836   1.00 89.05  ? 62  HIS A O   1 
ATOM   456   C CB  . HIS A 1 64  ? 49.905  72.081  1.416   1.00 88.20  ? 62  HIS A CB  1 
ATOM   457   C CG  . HIS A 1 64  ? 49.111  72.574  0.248   1.00 90.74  ? 62  HIS A CG  1 
ATOM   458   N ND1 . HIS A 1 64  ? 47.741  72.720  0.288   1.00 92.22  ? 62  HIS A ND1 1 
ATOM   459   C CD2 . HIS A 1 64  ? 49.501  73.018  -0.970  1.00 91.71  ? 62  HIS A CD2 1 
ATOM   460   C CE1 . HIS A 1 64  ? 47.321  73.231  -0.856  1.00 94.20  ? 62  HIS A CE1 1 
ATOM   461   N NE2 . HIS A 1 64  ? 48.370  73.421  -1.636  1.00 93.34  ? 62  HIS A NE2 1 
ATOM   462   N N   . SER A 1 65  ? 47.998  73.639  3.631   1.00 84.64  ? 63  SER A N   1 
ATOM   463   C CA  . SER A 1 65  ? 46.723  74.294  3.801   1.00 82.29  ? 63  SER A CA  1 
ATOM   464   C C   . SER A 1 65  ? 46.525  75.282  4.930   1.00 82.05  ? 63  SER A C   1 
ATOM   465   O O   . SER A 1 65  ? 47.042  75.123  6.034   1.00 81.92  ? 63  SER A O   1 
ATOM   466   C CB  . SER A 1 65  ? 45.663  73.220  3.916   1.00 82.63  ? 63  SER A CB  1 
ATOM   467   O OG  . SER A 1 65  ? 46.024  72.340  4.960   1.00 77.51  ? 63  SER A OG  1 
ATOM   468   N N   . ASP A 1 66  ? 45.727  76.300  4.634   1.00 83.03  ? 64  ASP A N   1 
ATOM   469   C CA  . ASP A 1 66  ? 45.380  77.325  5.606   1.00 85.54  ? 64  ASP A CA  1 
ATOM   470   C C   . ASP A 1 66  ? 43.954  77.013  6.124   1.00 86.46  ? 64  ASP A C   1 
ATOM   471   O O   . ASP A 1 66  ? 43.573  77.436  7.207   1.00 88.92  ? 64  ASP A O   1 
ATOM   472   C CB  . ASP A 1 66  ? 45.401  78.716  4.951   1.00 87.99  ? 64  ASP A CB  1 
ATOM   473   C CG  . ASP A 1 66  ? 46.713  79.023  4.286   1.00 90.53  ? 64  ASP A CG  1 
ATOM   474   O OD1 . ASP A 1 66  ? 47.744  79.004  4.999   1.00 95.15  ? 64  ASP A OD1 1 
ATOM   475   O OD2 . ASP A 1 66  ? 46.712  79.286  3.060   1.00 92.13  ? 64  ASP A OD2 1 
ATOM   476   N N   . VAL A 1 67  ? 43.158  76.308  5.321   1.00 83.88  ? 65  VAL A N   1 
ATOM   477   C CA  . VAL A 1 67  ? 41.781  75.918  5.671   1.00 79.71  ? 65  VAL A CA  1 
ATOM   478   C C   . VAL A 1 67  ? 41.731  74.413  5.464   1.00 82.88  ? 65  VAL A C   1 
ATOM   479   O O   . VAL A 1 67  ? 41.974  73.948  4.340   1.00 84.92  ? 65  VAL A O   1 
ATOM   480   C CB  . VAL A 1 67  ? 40.761  76.518  4.713   1.00 73.36  ? 65  VAL A CB  1 
ATOM   481   C CG1 . VAL A 1 67  ? 39.455  75.816  4.876   1.00 71.56  ? 65  VAL A CG1 1 
ATOM   482   C CG2 . VAL A 1 67  ? 40.604  77.984  4.977   1.00 74.72  ? 65  VAL A CG2 1 
ATOM   483   N N   . LEU A 1 68  ? 41.423  73.630  6.499   1.00 79.52  ? 66  LEU A N   1 
ATOM   484   C CA  . LEU A 1 68  ? 41.424  72.194  6.254   1.00 78.28  ? 66  LEU A CA  1 
ATOM   485   C C   . LEU A 1 68  ? 40.121  71.431  6.130   1.00 76.54  ? 66  LEU A C   1 
ATOM   486   O O   . LEU A 1 68  ? 39.169  71.615  6.902   1.00 74.66  ? 66  LEU A O   1 
ATOM   487   C CB  . LEU A 1 68  ? 42.299  71.469  7.268   1.00 79.77  ? 66  LEU A CB  1 
ATOM   488   C CG  . LEU A 1 68  ? 42.775  70.115  6.717   1.00 79.22  ? 66  LEU A CG  1 
ATOM   489   C CD1 . LEU A 1 68  ? 43.547  70.300  5.401   1.00 76.27  ? 66  LEU A CD1 1 
ATOM   490   C CD2 . LEU A 1 68  ? 43.659  69.452  7.732   1.00 77.56  ? 66  LEU A CD2 1 
ATOM   491   N N   . PHE A 1 69  ? 40.122  70.520  5.165   1.00 74.39  ? 67  PHE A N   1 
ATOM   492   C CA  . PHE A 1 69  ? 38.957  69.714  4.912   1.00 74.39  ? 67  PHE A CA  1 
ATOM   493   C C   . PHE A 1 69  ? 39.098  68.259  5.268   1.00 72.72  ? 67  PHE A C   1 
ATOM   494   O O   . PHE A 1 69  ? 40.013  67.573  4.814   1.00 67.56  ? 67  PHE A O   1 
ATOM   495   C CB  . PHE A 1 69  ? 38.557  69.866  3.457   1.00 76.16  ? 67  PHE A CB  1 
ATOM   496   C CG  . PHE A 1 69  ? 37.778  71.118  3.191   1.00 79.96  ? 67  PHE A CG  1 
ATOM   497   C CD1 . PHE A 1 69  ? 38.200  72.037  2.234   1.00 82.68  ? 67  PHE A CD1 1 
ATOM   498   C CD2 . PHE A 1 69  ? 36.620  71.395  3.922   1.00 80.22  ? 67  PHE A CD2 1 
ATOM   499   C CE1 . PHE A 1 69  ? 37.468  73.223  2.013   1.00 83.27  ? 67  PHE A CE1 1 
ATOM   500   C CE2 . PHE A 1 69  ? 35.890  72.568  3.709   1.00 81.97  ? 67  PHE A CE2 1 
ATOM   501   C CZ  . PHE A 1 69  ? 36.309  73.480  2.759   1.00 83.39  ? 67  PHE A CZ  1 
ATOM   502   N N   . LEU A 1 70  ? 38.167  67.820  6.111   1.00 74.83  ? 68  LEU A N   1 
ATOM   503   C CA  . LEU A 1 70  ? 38.068  66.441  6.564   1.00 79.65  ? 68  LEU A CA  1 
ATOM   504   C C   . LEU A 1 70  ? 36.933  65.835  5.747   1.00 84.40  ? 68  LEU A C   1 
ATOM   505   O O   . LEU A 1 70  ? 35.748  66.052  6.022   1.00 85.64  ? 68  LEU A O   1 
ATOM   506   C CB  . LEU A 1 70  ? 37.726  66.379  8.050   1.00 75.32  ? 68  LEU A CB  1 
ATOM   507   C CG  . LEU A 1 70  ? 38.693  67.177  8.910   1.00 74.80  ? 68  LEU A CG  1 
ATOM   508   C CD1 . LEU A 1 70  ? 38.423  66.911  10.371  1.00 73.33  ? 68  LEU A CD1 1 
ATOM   509   C CD2 . LEU A 1 70  ? 40.101  66.790  8.541   1.00 73.43  ? 68  LEU A CD2 1 
ATOM   510   N N   . ALA A 1 71  ? 37.328  65.110  4.708   1.00 88.69  ? 69  ALA A N   1 
ATOM   511   C CA  . ALA A 1 71  ? 36.424  64.441  3.786   1.00 91.74  ? 69  ALA A CA  1 
ATOM   512   C C   . ALA A 1 71  ? 36.680  62.949  3.896   1.00 94.98  ? 69  ALA A C   1 
ATOM   513   O O   . ALA A 1 71  ? 36.958  62.288  2.894   1.00 96.31  ? 69  ALA A O   1 
ATOM   514   C CB  . ALA A 1 71  ? 36.710  64.894  2.361   1.00 90.07  ? 69  ALA A CB  1 
ATOM   515   N N   . VAL A 1 72  ? 36.619  62.422  5.112   1.00 97.65  ? 70  VAL A N   1 
ATOM   516   C CA  . VAL A 1 72  ? 36.850  61.003  5.300   1.00 100.15 ? 70  VAL A CA  1 
ATOM   517   C C   . VAL A 1 72  ? 35.664  60.371  5.978   1.00 104.49 ? 70  VAL A C   1 
ATOM   518   O O   . VAL A 1 72  ? 34.788  61.068  6.517   1.00 104.16 ? 70  VAL A O   1 
ATOM   519   C CB  . VAL A 1 72  ? 38.097  60.711  6.165   1.00 97.69  ? 70  VAL A CB  1 
ATOM   520   C CG1 . VAL A 1 72  ? 39.315  61.353  5.542   1.00 98.34  ? 70  VAL A CG1 1 
ATOM   521   C CG2 . VAL A 1 72  ? 37.870  61.194  7.590   1.00 93.90  ? 70  VAL A CG2 1 
ATOM   522   N N   . LYS A 1 73  ? 35.660  59.038  5.928   1.00 107.93 ? 71  LYS A N   1 
ATOM   523   C CA  . LYS A 1 73  ? 34.620  58.210  6.531   1.00 110.10 ? 71  LYS A CA  1 
ATOM   524   C C   . LYS A 1 73  ? 34.429  58.713  7.964   1.00 110.73 ? 71  LYS A C   1 
ATOM   525   O O   . LYS A 1 73  ? 35.337  59.296  8.560   1.00 112.51 ? 71  LYS A O   1 
ATOM   526   C CB  . LYS A 1 73  ? 35.045  56.714  6.583   1.00 111.82 ? 71  LYS A CB  1 
ATOM   527   C CG  . LYS A 1 73  ? 35.559  56.023  5.274   1.00 112.99 ? 71  LYS A CG  1 
ATOM   528   C CD  . LYS A 1 73  ? 35.852  54.487  5.490   1.00 109.60 ? 71  LYS A CD  1 
ATOM   529   C CE  . LYS A 1 73  ? 36.635  53.843  4.324   1.00 109.20 ? 71  LYS A CE  1 
ATOM   530   N NZ  . LYS A 1 73  ? 36.990  52.407  4.567   1.00 107.62 ? 71  LYS A NZ  1 
ATOM   531   N N   . PRO A 1 74  ? 33.240  58.504  8.530   1.00 109.92 ? 72  PRO A N   1 
ATOM   532   C CA  . PRO A 1 74  ? 32.969  58.947  9.897   1.00 110.33 ? 72  PRO A CA  1 
ATOM   533   C C   . PRO A 1 74  ? 33.700  58.180  10.999  1.00 110.79 ? 72  PRO A C   1 
ATOM   534   O O   . PRO A 1 74  ? 33.836  58.676  12.125  1.00 110.20 ? 72  PRO A O   1 
ATOM   535   C CB  . PRO A 1 74  ? 31.456  58.809  9.998   1.00 110.31 ? 72  PRO A CB  1 
ATOM   536   C CG  . PRO A 1 74  ? 31.021  59.175  8.617   1.00 111.36 ? 72  PRO A CG  1 
ATOM   537   C CD  . PRO A 1 74  ? 31.982  58.362  7.779   1.00 110.58 ? 72  PRO A CD  1 
ATOM   538   N N   . HIS A 1 75  ? 34.167  56.976  10.684  1.00 111.72 ? 73  HIS A N   1 
ATOM   539   C CA  . HIS A 1 75  ? 34.874  56.187  11.678  1.00 114.26 ? 73  HIS A CA  1 
ATOM   540   C C   . HIS A 1 75  ? 36.385  56.340  11.526  1.00 111.84 ? 73  HIS A C   1 
ATOM   541   O O   . HIS A 1 75  ? 37.134  56.073  12.468  1.00 113.63 ? 73  HIS A O   1 
ATOM   542   C CB  . HIS A 1 75  ? 34.452  54.699  11.615  1.00 120.32 ? 73  HIS A CB  1 
ATOM   543   C CG  . HIS A 1 75  ? 34.933  53.944  10.410  1.00 127.00 ? 73  HIS A CG  1 
ATOM   544   N ND1 . HIS A 1 75  ? 35.255  52.607  10.449  1.00 130.00 ? 73  HIS A ND1 1 
ATOM   545   C CD2 . HIS A 1 75  ? 35.105  54.322  9.106   1.00 128.73 ? 73  HIS A CD2 1 
ATOM   546   C CE1 . HIS A 1 75  ? 35.604  52.186  9.244   1.00 131.10 ? 73  HIS A CE1 1 
ATOM   547   N NE2 . HIS A 1 75  ? 35.518  53.217  8.415   1.00 130.09 ? 73  HIS A NE2 1 
ATOM   548   N N   . ILE A 1 76  ? 36.811  56.807  10.352  1.00 107.28 ? 74  ILE A N   1 
ATOM   549   C CA  . ILE A 1 76  ? 38.223  57.027  10.037  1.00 102.93 ? 74  ILE A CA  1 
ATOM   550   C C   . ILE A 1 76  ? 38.694  58.356  10.608  1.00 99.43  ? 74  ILE A C   1 
ATOM   551   O O   . ILE A 1 76  ? 39.856  58.543  10.948  1.00 99.20  ? 74  ILE A O   1 
ATOM   552   C CB  . ILE A 1 76  ? 38.440  57.031  8.506   1.00 103.97 ? 74  ILE A CB  1 
ATOM   553   C CG1 . ILE A 1 76  ? 38.389  55.592  7.989   1.00 105.79 ? 74  ILE A CG1 1 
ATOM   554   C CG2 . ILE A 1 76  ? 39.752  57.720  8.145   1.00 105.06 ? 74  ILE A CG2 1 
ATOM   555   C CD1 . ILE A 1 76  ? 38.754  55.421  6.492   1.00 110.62 ? 74  ILE A CD1 1 
ATOM   556   N N   . ILE A 1 77  ? 37.764  59.281  10.728  1.00 96.48  ? 75  ILE A N   1 
ATOM   557   C CA  . ILE A 1 77  ? 38.060  60.598  11.251  1.00 93.04  ? 75  ILE A CA  1 
ATOM   558   C C   . ILE A 1 77  ? 38.801  60.538  12.602  1.00 92.44  ? 75  ILE A C   1 
ATOM   559   O O   . ILE A 1 77  ? 39.693  61.345  12.861  1.00 91.43  ? 75  ILE A O   1 
ATOM   560   C CB  . ILE A 1 77  ? 36.740  61.403  11.360  1.00 91.03  ? 75  ILE A CB  1 
ATOM   561   C CG1 . ILE A 1 77  ? 36.997  62.882  11.139  1.00 88.63  ? 75  ILE A CG1 1 
ATOM   562   C CG2 . ILE A 1 77  ? 36.102  61.185  12.700  1.00 92.16  ? 75  ILE A CG2 1 
ATOM   563   C CD1 . ILE A 1 77  ? 35.719  63.678  11.043  1.00 83.00  ? 75  ILE A CD1 1 
ATOM   564   N N   . PRO A 1 78  ? 38.449  59.578  13.481  1.00 93.52  ? 76  PRO A N   1 
ATOM   565   C CA  . PRO A 1 78  ? 39.178  59.550  14.754  1.00 93.12  ? 76  PRO A CA  1 
ATOM   566   C C   . PRO A 1 78  ? 40.668  59.252  14.557  1.00 92.86  ? 76  PRO A C   1 
ATOM   567   O O   . PRO A 1 78  ? 41.526  59.901  15.131  1.00 94.28  ? 76  PRO A O   1 
ATOM   568   C CB  . PRO A 1 78  ? 38.473  58.434  15.545  1.00 92.73  ? 76  PRO A CB  1 
ATOM   569   C CG  . PRO A 1 78  ? 37.082  58.441  15.001  1.00 93.84  ? 76  PRO A CG  1 
ATOM   570   C CD  . PRO A 1 78  ? 37.339  58.605  13.507  1.00 94.70  ? 76  PRO A CD  1 
ATOM   571   N N   . PHE A 1 79  ? 40.969  58.271  13.721  1.00 91.48  ? 77  PHE A N   1 
ATOM   572   C CA  . PHE A 1 79  ? 42.345  57.859  13.480  1.00 90.78  ? 77  PHE A CA  1 
ATOM   573   C C   . PHE A 1 79  ? 43.215  58.877  12.797  1.00 88.07  ? 77  PHE A C   1 
ATOM   574   O O   . PHE A 1 79  ? 44.382  58.610  12.530  1.00 86.35  ? 77  PHE A O   1 
ATOM   575   C CB  . PHE A 1 79  ? 42.351  56.557  12.677  1.00 96.88  ? 77  PHE A CB  1 
ATOM   576   C CG  . PHE A 1 79  ? 41.746  55.415  13.415  1.00 102.50 ? 77  PHE A CG  1 
ATOM   577   C CD1 . PHE A 1 79  ? 40.624  55.639  14.227  1.00 104.96 ? 77  PHE A CD1 1 
ATOM   578   C CD2 . PHE A 1 79  ? 42.315  54.138  13.368  1.00 104.53 ? 77  PHE A CD2 1 
ATOM   579   C CE1 . PHE A 1 79  ? 40.076  54.629  14.996  1.00 106.79 ? 77  PHE A CE1 1 
ATOM   580   C CE2 . PHE A 1 79  ? 41.776  53.098  14.137  1.00 105.87 ? 77  PHE A CE2 1 
ATOM   581   C CZ  . PHE A 1 79  ? 40.650  53.346  14.958  1.00 108.29 ? 77  PHE A CZ  1 
ATOM   582   N N   . ILE A 1 80  ? 42.649  60.036  12.500  1.00 87.61  ? 78  ILE A N   1 
ATOM   583   C CA  . ILE A 1 80  ? 43.422  61.085  11.851  1.00 91.04  ? 78  ILE A CA  1 
ATOM   584   C C   . ILE A 1 80  ? 43.580  62.236  12.855  1.00 92.47  ? 78  ILE A C   1 
ATOM   585   O O   . ILE A 1 80  ? 44.683  62.754  13.057  1.00 92.60  ? 78  ILE A O   1 
ATOM   586   C CB  . ILE A 1 80  ? 42.734  61.620  10.535  1.00 90.37  ? 78  ILE A CB  1 
ATOM   587   C CG1 . ILE A 1 80  ? 42.017  60.494  9.793   1.00 90.75  ? 78  ILE A CG1 1 
ATOM   588   C CG2 . ILE A 1 80  ? 43.789  62.158  9.546   1.00 88.69  ? 78  ILE A CG2 1 
ATOM   589   C CD1 . ILE A 1 80  ? 41.535  60.891  8.386   1.00 87.52  ? 78  ILE A CD1 1 
ATOM   590   N N   . LEU A 1 81  ? 42.485  62.637  13.492  1.00 94.80  ? 79  LEU A N   1 
ATOM   591   C CA  . LEU A 1 81  ? 42.563  63.712  14.474  1.00 99.55  ? 79  LEU A CA  1 
ATOM   592   C C   . LEU A 1 81  ? 43.710  63.470  15.483  1.00 103.76 ? 79  LEU A C   1 
ATOM   593   O O   . LEU A 1 81  ? 44.135  64.406  16.174  1.00 106.15 ? 79  LEU A O   1 
ATOM   594   C CB  . LEU A 1 81  ? 41.240  63.837  15.249  1.00 100.33 ? 79  LEU A CB  1 
ATOM   595   C CG  . LEU A 1 81  ? 39.992  64.488  14.639  1.00 101.52 ? 79  LEU A CG  1 
ATOM   596   C CD1 . LEU A 1 81  ? 38.828  64.406  15.611  1.00 103.95 ? 79  LEU A CD1 1 
ATOM   597   C CD2 . LEU A 1 81  ? 40.273  65.937  14.335  1.00 102.85 ? 79  LEU A CD2 1 
ATOM   598   N N   . ASP A 1 82  ? 44.199  62.219  15.561  1.00 105.06 ? 80  ASP A N   1 
ATOM   599   C CA  . ASP A 1 82  ? 45.267  61.797  16.497  1.00 102.04 ? 80  ASP A CA  1 
ATOM   600   C C   . ASP A 1 82  ? 46.549  61.389  15.767  1.00 100.55 ? 80  ASP A C   1 
ATOM   601   O O   . ASP A 1 82  ? 47.444  60.754  16.335  1.00 97.93  ? 80  ASP A O   1 
ATOM   602   C CB  . ASP A 1 82  ? 44.772  60.626  17.375  1.00 102.72 ? 80  ASP A CB  1 
ATOM   603   C CG  . ASP A 1 82  ? 43.432  60.928  18.099  1.00 103.76 ? 80  ASP A CG  1 
ATOM   604   O OD1 . ASP A 1 82  ? 43.375  61.880  18.922  1.00 101.89 ? 80  ASP A OD1 1 
ATOM   605   O OD2 . ASP A 1 82  ? 42.435  60.202  17.842  1.00 102.52 ? 80  ASP A OD2 1 
ATOM   606   N N   . GLU A 1 83  ? 46.605  61.772  14.495  1.00 101.75 ? 81  GLU A N   1 
ATOM   607   C CA  . GLU A 1 83  ? 47.734  61.525  13.601  1.00 104.72 ? 81  GLU A CA  1 
ATOM   608   C C   . GLU A 1 83  ? 48.251  62.902  13.196  1.00 104.12 ? 81  GLU A C   1 
ATOM   609   O O   . GLU A 1 83  ? 49.396  63.072  12.778  1.00 105.60 ? 81  GLU A O   1 
ATOM   610   C CB  . GLU A 1 83  ? 47.268  60.790  12.345  1.00 109.15 ? 81  GLU A CB  1 
ATOM   611   C CG  . GLU A 1 83  ? 48.380  60.519  11.334  1.00 119.62 ? 81  GLU A CG  1 
ATOM   612   C CD  . GLU A 1 83  ? 47.970  60.770  9.872   1.00 125.62 ? 81  GLU A CD  1 
ATOM   613   O OE1 . GLU A 1 83  ? 48.796  60.496  8.964   1.00 128.16 ? 81  GLU A OE1 1 
ATOM   614   O OE2 . GLU A 1 83  ? 46.836  61.244  9.620   1.00 129.73 ? 81  GLU A OE2 1 
ATOM   615   N N   . ILE A 1 84  ? 47.387  63.896  13.331  1.00 102.28 ? 82  ILE A N   1 
ATOM   616   C CA  . ILE A 1 84  ? 47.751  65.252  12.973  1.00 101.04 ? 82  ILE A CA  1 
ATOM   617   C C   . ILE A 1 84  ? 47.430  66.266  14.057  1.00 100.24 ? 82  ILE A C   1 
ATOM   618   O O   . ILE A 1 84  ? 47.853  67.414  13.965  1.00 102.30 ? 82  ILE A O   1 
ATOM   619   C CB  . ILE A 1 84  ? 47.034  65.684  11.716  1.00 101.80 ? 82  ILE A CB  1 
ATOM   620   C CG1 . ILE A 1 84  ? 47.346  64.706  10.602  1.00 104.69 ? 82  ILE A CG1 1 
ATOM   621   C CG2 . ILE A 1 84  ? 47.477  67.074  11.312  1.00 102.73 ? 82  ILE A CG2 1 
ATOM   622   C CD1 . ILE A 1 84  ? 46.602  65.024  9.339   1.00 108.37 ? 82  ILE A CD1 1 
ATOM   623   N N   . GLY A 1 85  ? 46.673  65.856  15.071  1.00 97.71  ? 83  GLY A N   1 
ATOM   624   C CA  . GLY A 1 85  ? 46.336  66.773  16.147  1.00 95.26  ? 83  GLY A CA  1 
ATOM   625   C C   . GLY A 1 85  ? 47.552  67.628  16.419  1.00 94.06  ? 83  GLY A C   1 
ATOM   626   O O   . GLY A 1 85  ? 47.484  68.860  16.509  1.00 92.67  ? 83  GLY A O   1 
ATOM   627   N N   . ALA A 1 86  ? 48.683  66.943  16.522  1.00 91.90  ? 84  ALA A N   1 
ATOM   628   C CA  . ALA A 1 86  ? 49.965  67.575  16.754  1.00 90.67  ? 84  ALA A CA  1 
ATOM   629   C C   . ALA A 1 86  ? 50.258  68.588  15.664  1.00 90.56  ? 84  ALA A C   1 
ATOM   630   O O   . ALA A 1 86  ? 50.360  69.783  15.929  1.00 94.73  ? 84  ALA A O   1 
ATOM   631   C CB  . ALA A 1 86  ? 51.046  66.523  16.763  1.00 91.63  ? 84  ALA A CB  1 
ATOM   632   N N   . ASP A 1 87  ? 50.402  68.087  14.439  1.00 89.01  ? 85  ASP A N   1 
ATOM   633   C CA  . ASP A 1 87  ? 50.689  68.904  13.257  1.00 86.14  ? 85  ASP A CA  1 
ATOM   634   C C   . ASP A 1 87  ? 49.647  69.995  12.985  1.00 84.38  ? 85  ASP A C   1 
ATOM   635   O O   . ASP A 1 87  ? 49.605  70.541  11.895  1.00 82.78  ? 85  ASP A O   1 
ATOM   636   C CB  . ASP A 1 87  ? 50.801  68.008  12.011  1.00 85.58  ? 85  ASP A CB  1 
ATOM   637   C CG  . ASP A 1 87  ? 52.133  67.256  11.925  1.00 87.35  ? 85  ASP A CG  1 
ATOM   638   O OD1 . ASP A 1 87  ? 52.232  66.359  11.064  1.00 89.68  ? 85  ASP A OD1 1 
ATOM   639   O OD2 . ASP A 1 87  ? 53.084  67.545  12.686  1.00 88.36  ? 85  ASP A OD2 1 
ATOM   640   N N   . ILE A 1 88  ? 48.819  70.326  13.965  1.00 83.41  ? 86  ILE A N   1 
ATOM   641   C CA  . ILE A 1 88  ? 47.813  71.345  13.749  1.00 85.07  ? 86  ILE A CA  1 
ATOM   642   C C   . ILE A 1 88  ? 48.138  72.696  14.316  1.00 89.33  ? 86  ILE A C   1 
ATOM   643   O O   . ILE A 1 88  ? 48.028  72.909  15.520  1.00 91.35  ? 86  ILE A O   1 
ATOM   644   C CB  . ILE A 1 88  ? 46.494  70.928  14.341  1.00 84.65  ? 86  ILE A CB  1 
ATOM   645   C CG1 . ILE A 1 88  ? 45.948  69.803  13.490  1.00 87.85  ? 86  ILE A CG1 1 
ATOM   646   C CG2 . ILE A 1 88  ? 45.544  72.139  14.475  1.00 79.66  ? 86  ILE A CG2 1 
ATOM   647   C CD1 . ILE A 1 88  ? 44.564  69.415  13.829  1.00 92.56  ? 86  ILE A CD1 1 
ATOM   648   N N   . GLU A 1 89  ? 48.520  73.626  13.452  1.00 93.32  ? 87  GLU A N   1 
ATOM   649   C CA  . GLU A 1 89  ? 48.834  74.969  13.910  1.00 96.66  ? 87  GLU A CA  1 
ATOM   650   C C   . GLU A 1 89  ? 47.572  75.711  14.259  1.00 96.23  ? 87  GLU A C   1 
ATOM   651   O O   . GLU A 1 89  ? 46.485  75.128  14.243  1.00 99.92  ? 87  GLU A O   1 
ATOM   652   C CB  . GLU A 1 89  ? 49.584  75.732  12.840  1.00 98.47  ? 87  GLU A CB  1 
ATOM   653   C CG  . GLU A 1 89  ? 51.066  75.814  13.110  1.00 110.53 ? 87  GLU A CG  1 
ATOM   654   C CD  . GLU A 1 89  ? 51.879  75.849  11.837  1.00 117.11 ? 87  GLU A CD  1 
ATOM   655   O OE1 . GLU A 1 89  ? 51.663  76.772  11.016  1.00 121.43 ? 87  GLU A OE1 1 
ATOM   656   O OE2 . GLU A 1 89  ? 52.735  74.951  11.652  1.00 119.83 ? 87  GLU A OE2 1 
ATOM   657   N N   . ASP A 1 90  ? 47.705  76.995  14.572  1.00 95.21  ? 88  ASP A N   1 
ATOM   658   C CA  . ASP A 1 90  ? 46.530  77.773  14.911  1.00 95.09  ? 88  ASP A CA  1 
ATOM   659   C C   . ASP A 1 90  ? 46.180  78.701  13.770  1.00 92.62  ? 88  ASP A C   1 
ATOM   660   O O   . ASP A 1 90  ? 45.157  79.356  13.805  1.00 92.68  ? 88  ASP A O   1 
ATOM   661   C CB  . ASP A 1 90  ? 46.754  78.557  16.204  1.00 99.98  ? 88  ASP A CB  1 
ATOM   662   C CG  . ASP A 1 90  ? 45.581  79.458  16.560  1.00 103.76 ? 88  ASP A CG  1 
ATOM   663   O OD1 . ASP A 1 90  ? 45.605  80.617  16.092  1.00 107.02 ? 88  ASP A OD1 1 
ATOM   664   O OD2 . ASP A 1 90  ? 44.645  79.019  17.287  1.00 105.53 ? 88  ASP A OD2 1 
ATOM   665   N N   . ARG A 1 91  ? 47.010  78.733  12.737  1.00 90.58  ? 89  ARG A N   1 
ATOM   666   C CA  . ARG A 1 91  ? 46.719  79.598  11.598  1.00 89.28  ? 89  ARG A CA  1 
ATOM   667   C C   . ARG A 1 91  ? 45.500  79.111  10.831  1.00 89.33  ? 89  ARG A C   1 
ATOM   668   O O   . ARG A 1 91  ? 44.755  79.922  10.269  1.00 92.19  ? 89  ARG A O   1 
ATOM   669   C CB  . ARG A 1 91  ? 47.880  79.630  10.618  1.00 86.63  ? 89  ARG A CB  1 
ATOM   670   C CG  . ARG A 1 91  ? 48.145  78.270  10.042  1.00 79.08  ? 89  ARG A CG  1 
ATOM   671   C CD  . ARG A 1 91  ? 48.716  78.315  8.665   1.00 74.71  ? 89  ARG A CD  1 
ATOM   672   N NE  . ARG A 1 91  ? 49.211  76.984  8.354   1.00 70.51  ? 89  ARG A NE  1 
ATOM   673   C CZ  . ARG A 1 91  ? 49.736  76.623  7.194   1.00 72.64  ? 89  ARG A CZ  1 
ATOM   674   N NH1 . ARG A 1 91  ? 49.836  77.501  6.191   1.00 69.95  ? 89  ARG A NH1 1 
ATOM   675   N NH2 . ARG A 1 91  ? 50.188  75.380  7.065   1.00 70.05  ? 89  ARG A NH2 1 
ATOM   676   N N   . HIS A 1 92  ? 45.302  77.793  10.791  1.00 86.63  ? 90  HIS A N   1 
ATOM   677   C CA  . HIS A 1 92  ? 44.174  77.232  10.044  1.00 82.32  ? 90  HIS A CA  1 
ATOM   678   C C   . HIS A 1 92  ? 42.924  76.770  10.788  1.00 78.46  ? 90  HIS A C   1 
ATOM   679   O O   . HIS A 1 92  ? 42.959  76.498  11.999  1.00 75.28  ? 90  HIS A O   1 
ATOM   680   C CB  . HIS A 1 92  ? 44.638  76.101  9.081   1.00 83.51  ? 90  HIS A CB  1 
ATOM   681   C CG  . HIS A 1 92  ? 45.644  75.139  9.645   1.00 85.42  ? 90  HIS A CG  1 
ATOM   682   N ND1 . HIS A 1 92  ? 45.725  74.826  10.987  1.00 83.52  ? 90  HIS A ND1 1 
ATOM   683   C CD2 . HIS A 1 92  ? 46.563  74.358  9.020   1.00 82.67  ? 90  HIS A CD2 1 
ATOM   684   C CE1 . HIS A 1 92  ? 46.649  73.896  11.163  1.00 83.48  ? 90  HIS A CE1 1 
ATOM   685   N NE2 . HIS A 1 92  ? 47.171  73.595  9.985   1.00 82.59  ? 90  HIS A NE2 1 
ATOM   686   N N   . ILE A 1 93  ? 41.818  76.714  10.035  1.00 76.91  ? 91  ILE A N   1 
ATOM   687   C CA  . ILE A 1 93  ? 40.517  76.273  10.541  1.00 73.73  ? 91  ILE A CA  1 
ATOM   688   C C   . ILE A 1 93  ? 40.257  74.905  9.960   1.00 75.35  ? 91  ILE A C   1 
ATOM   689   O O   . ILE A 1 93  ? 40.735  74.597  8.851   1.00 76.36  ? 91  ILE A O   1 
ATOM   690   C CB  . ILE A 1 93  ? 39.339  77.074  10.028  1.00 68.32  ? 91  ILE A CB  1 
ATOM   691   C CG1 . ILE A 1 93  ? 39.766  78.478  9.641   1.00 65.19  ? 91  ILE A CG1 1 
ATOM   692   C CG2 . ILE A 1 93  ? 38.238  77.015  11.044  1.00 68.31  ? 91  ILE A CG2 1 
ATOM   693   C CD1 . ILE A 1 93  ? 40.527  78.477  8.358   1.00 63.19  ? 91  ILE A CD1 1 
ATOM   694   N N   . VAL A 1 94  ? 39.477  74.104  10.691  1.00 75.95  ? 92  VAL A N   1 
ATOM   695   C CA  . VAL A 1 94  ? 39.114  72.749  10.261  1.00 76.76  ? 92  VAL A CA  1 
ATOM   696   C C   . VAL A 1 94  ? 37.624  72.576  9.992   1.00 75.70  ? 92  VAL A C   1 
ATOM   697   O O   . VAL A 1 94  ? 36.773  72.787  10.867  1.00 71.54  ? 92  VAL A O   1 
ATOM   698   C CB  . VAL A 1 94  ? 39.538  71.686  11.285  1.00 76.52  ? 92  VAL A CB  1 
ATOM   699   C CG1 . VAL A 1 94  ? 38.778  70.376  11.046  1.00 75.39  ? 92  VAL A CG1 1 
ATOM   700   C CG2 . VAL A 1 94  ? 41.011  71.441  11.145  1.00 77.09  ? 92  VAL A CG2 1 
ATOM   701   N N   . VAL A 1 95  ? 37.325  72.206  8.757   1.00 72.97  ? 93  VAL A N   1 
ATOM   702   C CA  . VAL A 1 95  ? 35.971  71.998  8.382   1.00 69.28  ? 93  VAL A CA  1 
ATOM   703   C C   . VAL A 1 95  ? 35.904  70.499  8.217   1.00 70.36  ? 93  VAL A C   1 
ATOM   704   O O   . VAL A 1 95  ? 36.589  69.929  7.374   1.00 68.91  ? 93  VAL A O   1 
ATOM   705   C CB  . VAL A 1 95  ? 35.675  72.707  7.088   1.00 66.14  ? 93  VAL A CB  1 
ATOM   706   C CG1 . VAL A 1 95  ? 34.185  72.701  6.848   1.00 68.43  ? 93  VAL A CG1 1 
ATOM   707   C CG2 . VAL A 1 95  ? 36.190  74.118  7.157   1.00 64.01  ? 93  VAL A CG2 1 
ATOM   708   N N   . SER A 1 96  ? 35.117  69.871  9.079   1.00 71.54  ? 94  SER A N   1 
ATOM   709   C CA  . SER A 1 96  ? 34.906  68.435  9.051   1.00 72.63  ? 94  SER A CA  1 
ATOM   710   C C   . SER A 1 96  ? 33.588  68.231  8.365   1.00 74.68  ? 94  SER A C   1 
ATOM   711   O O   . SER A 1 96  ? 32.610  68.870  8.742   1.00 75.46  ? 94  SER A O   1 
ATOM   712   C CB  . SER A 1 96  ? 34.791  67.873  10.465  1.00 74.15  ? 94  SER A CB  1 
ATOM   713   O OG  . SER A 1 96  ? 33.799  66.849  10.520  1.00 68.12  ? 94  SER A OG  1 
ATOM   714   N N   . CYS A 1 97  ? 33.530  67.353  7.374   1.00 76.46  ? 95  CYS A N   1 
ATOM   715   C CA  . CYS A 1 97  ? 32.256  67.141  6.718   1.00 81.23  ? 95  CYS A CA  1 
ATOM   716   C C   . CYS A 1 97  ? 31.730  65.750  6.921   1.00 83.68  ? 95  CYS A C   1 
ATOM   717   O O   . CYS A 1 97  ? 30.618  65.421  6.489   1.00 86.52  ? 95  CYS A O   1 
ATOM   718   C CB  . CYS A 1 97  ? 32.383  67.420  5.255   1.00 82.41  ? 95  CYS A CB  1 
ATOM   719   S SG  . CYS A 1 97  ? 32.790  69.156  4.891   1.00 88.84  ? 95  CYS A SG  1 
ATOM   720   N N   . ALA A 1 98  ? 32.545  64.927  7.567   1.00 85.01  ? 96  ALA A N   1 
ATOM   721   C CA  . ALA A 1 98  ? 32.150  63.570  7.869   1.00 86.13  ? 96  ALA A CA  1 
ATOM   722   C C   . ALA A 1 98  ? 30.717  63.626  8.407   1.00 86.37  ? 96  ALA A C   1 
ATOM   723   O O   . ALA A 1 98  ? 30.377  64.515  9.194   1.00 87.82  ? 96  ALA A O   1 
ATOM   724   C CB  . ALA A 1 98  ? 33.087  62.988  8.895   1.00 86.11  ? 96  ALA A CB  1 
ATOM   725   N N   . ALA A 1 99  ? 29.873  62.703  7.959   1.00 84.33  ? 97  ALA A N   1 
ATOM   726   C CA  . ALA A 1 99  ? 28.483  62.678  8.394   1.00 80.77  ? 97  ALA A CA  1 
ATOM   727   C C   . ALA A 1 99  ? 28.393  62.393  9.889   1.00 78.27  ? 97  ALA A C   1 
ATOM   728   O O   . ALA A 1 99  ? 29.244  61.697  10.440  1.00 74.93  ? 97  ALA A O   1 
ATOM   729   C CB  . ALA A 1 99  ? 27.715  61.618  7.603   1.00 81.29  ? 97  ALA A CB  1 
ATOM   730   N N   . GLY A 1 100 ? 27.376  62.954  10.540  1.00 78.65  ? 98  GLY A N   1 
ATOM   731   C CA  . GLY A 1 100 ? 27.159  62.716  11.958  1.00 80.13  ? 98  GLY A CA  1 
ATOM   732   C C   . GLY A 1 100 ? 28.248  62.974  12.996  1.00 81.73  ? 98  GLY A C   1 
ATOM   733   O O   . GLY A 1 100 ? 27.915  63.152  14.170  1.00 82.55  ? 98  GLY A O   1 
ATOM   734   N N   . VAL A 1 101 ? 29.528  62.990  12.601  1.00 81.49  ? 99  VAL A N   1 
ATOM   735   C CA  . VAL A 1 101 ? 30.637  63.237  13.542  1.00 77.77  ? 99  VAL A CA  1 
ATOM   736   C C   . VAL A 1 101 ? 30.566  64.649  14.172  1.00 79.02  ? 99  VAL A C   1 
ATOM   737   O O   . VAL A 1 101 ? 30.619  65.661  13.469  1.00 78.01  ? 99  VAL A O   1 
ATOM   738   C CB  . VAL A 1 101 ? 32.001  63.056  12.851  1.00 74.05  ? 99  VAL A CB  1 
ATOM   739   C CG1 . VAL A 1 101 ? 33.100  63.341  13.833  1.00 77.81  ? 99  VAL A CG1 1 
ATOM   740   C CG2 . VAL A 1 101 ? 32.152  61.643  12.352  1.00 73.21  ? 99  VAL A CG2 1 
ATOM   741   N N   . THR A 1 102 ? 30.466  64.688  15.501  1.00 79.69  ? 100 THR A N   1 
ATOM   742   C CA  . THR A 1 102 ? 30.342  65.916  16.291  1.00 79.44  ? 100 THR A CA  1 
ATOM   743   C C   . THR A 1 102 ? 31.569  66.783  16.468  1.00 79.18  ? 100 THR A C   1 
ATOM   744   O O   . THR A 1 102 ? 32.695  66.290  16.534  1.00 76.32  ? 100 THR A O   1 
ATOM   745   C CB  . THR A 1 102 ? 29.883  65.601  17.697  1.00 79.52  ? 100 THR A CB  1 
ATOM   746   O OG1 . THR A 1 102 ? 28.798  64.679  17.629  1.00 82.88  ? 100 THR A OG1 1 
ATOM   747   C CG2 . THR A 1 102 ? 29.451  66.874  18.422  1.00 78.78  ? 100 THR A CG2 1 
ATOM   748   N N   . ILE A 1 103 ? 31.334  68.086  16.578  1.00 79.20  ? 101 ILE A N   1 
ATOM   749   C CA  . ILE A 1 103 ? 32.423  69.016  16.789  1.00 79.65  ? 101 ILE A CA  1 
ATOM   750   C C   . ILE A 1 103 ? 33.109  68.457  18.021  1.00 77.72  ? 101 ILE A C   1 
ATOM   751   O O   . ILE A 1 103 ? 34.213  67.910  17.937  1.00 80.17  ? 101 ILE A O   1 
ATOM   752   C CB  . ILE A 1 103 ? 31.905  70.456  17.095  1.00 84.03  ? 101 ILE A CB  1 
ATOM   753   C CG1 . ILE A 1 103 ? 31.016  70.966  15.952  1.00 86.95  ? 101 ILE A CG1 1 
ATOM   754   C CG2 . ILE A 1 103 ? 33.076  71.409  17.249  1.00 84.11  ? 101 ILE A CG2 1 
ATOM   755   C CD1 . ILE A 1 103 ? 30.528  72.394  16.149  1.00 82.49  ? 101 ILE A CD1 1 
ATOM   756   N N   . SER A 1 104 ? 32.431  68.576  19.159  1.00 72.35  ? 102 SER A N   1 
ATOM   757   C CA  . SER A 1 104 ? 32.960  68.087  20.413  1.00 66.18  ? 102 SER A CA  1 
ATOM   758   C C   . SER A 1 104 ? 33.944  66.950  20.168  1.00 63.51  ? 102 SER A C   1 
ATOM   759   O O   . SER A 1 104 ? 35.144  67.152  20.177  1.00 62.22  ? 102 SER A O   1 
ATOM   760   C CB  . SER A 1 104 ? 31.825  67.596  21.286  1.00 67.66  ? 102 SER A CB  1 
ATOM   761   O OG  . SER A 1 104 ? 32.269  66.463  21.997  1.00 73.39  ? 102 SER A OG  1 
ATOM   762   N N   . SER A 1 105 ? 33.428  65.761  19.911  1.00 64.58  ? 103 SER A N   1 
ATOM   763   C CA  . SER A 1 105 ? 34.275  64.596  19.658  1.00 69.44  ? 103 SER A CA  1 
ATOM   764   C C   . SER A 1 105 ? 35.596  64.959  18.985  1.00 71.73  ? 103 SER A C   1 
ATOM   765   O O   . SER A 1 105 ? 36.651  64.431  19.357  1.00 72.21  ? 103 SER A O   1 
ATOM   766   C CB  . SER A 1 105 ? 33.553  63.582  18.762  1.00 73.26  ? 103 SER A CB  1 
ATOM   767   O OG  . SER A 1 105 ? 33.693  63.878  17.366  1.00 68.10  ? 103 SER A OG  1 
ATOM   768   N N   . ILE A 1 106 ? 35.510  65.833  17.975  1.00 72.59  ? 104 ILE A N   1 
ATOM   769   C CA  . ILE A 1 106 ? 36.672  66.302  17.225  1.00 71.66  ? 104 ILE A CA  1 
ATOM   770   C C   . ILE A 1 106 ? 37.471  67.102  18.179  1.00 73.42  ? 104 ILE A C   1 
ATOM   771   O O   . ILE A 1 106 ? 38.529  66.652  18.641  1.00 78.17  ? 104 ILE A O   1 
ATOM   772   C CB  . ILE A 1 106 ? 36.323  67.276  16.093  1.00 71.49  ? 104 ILE A CB  1 
ATOM   773   C CG1 . ILE A 1 106 ? 35.515  66.566  15.024  1.00 74.51  ? 104 ILE A CG1 1 
ATOM   774   C CG2 . ILE A 1 106 ? 37.586  67.848  15.503  1.00 63.28  ? 104 ILE A CG2 1 
ATOM   775   C CD1 . ILE A 1 106 ? 36.195  65.343  14.503  1.00 77.37  ? 104 ILE A CD1 1 
ATOM   776   N N   . GLU A 1 107 ? 36.966  68.306  18.453  1.00 71.71  ? 105 GLU A N   1 
ATOM   777   C CA  . GLU A 1 107 ? 37.616  69.212  19.385  1.00 71.45  ? 105 GLU A CA  1 
ATOM   778   C C   . GLU A 1 107 ? 38.227  68.374  20.506  1.00 72.69  ? 105 GLU A C   1 
ATOM   779   O O   . GLU A 1 107 ? 39.413  68.040  20.495  1.00 71.42  ? 105 GLU A O   1 
ATOM   780   C CB  . GLU A 1 107 ? 36.594  70.187  19.976  1.00 67.28  ? 105 GLU A CB  1 
ATOM   781   C CG  . GLU A 1 107 ? 35.969  71.123  18.965  1.00 68.25  ? 105 GLU A CG  1 
ATOM   782   C CD  . GLU A 1 107 ? 35.189  72.256  19.625  1.00 73.61  ? 105 GLU A CD  1 
ATOM   783   O OE1 . GLU A 1 107 ? 34.380  71.992  20.559  1.00 75.80  ? 105 GLU A OE1 1 
ATOM   784   O OE2 . GLU A 1 107 ? 35.384  73.419  19.200  1.00 72.17  ? 105 GLU A OE2 1 
ATOM   785   N N   . LYS A 1 108 ? 37.378  68.008  21.451  1.00 73.66  ? 106 LYS A N   1 
ATOM   786   C CA  . LYS A 1 108 ? 37.763  67.224  22.616  1.00 74.76  ? 106 LYS A CA  1 
ATOM   787   C C   . LYS A 1 108 ? 38.459  65.894  22.312  1.00 73.56  ? 106 LYS A C   1 
ATOM   788   O O   . LYS A 1 108 ? 37.931  64.826  22.608  1.00 75.79  ? 106 LYS A O   1 
ATOM   789   C CB  . LYS A 1 108 ? 36.502  67.013  23.454  1.00 78.03  ? 106 LYS A CB  1 
ATOM   790   C CG  . LYS A 1 108 ? 35.571  68.246  23.354  1.00 84.24  ? 106 LYS A CG  1 
ATOM   791   C CD  . LYS A 1 108 ? 34.293  68.146  24.179  1.00 85.41  ? 106 LYS A CD  1 
ATOM   792   C CE  . LYS A 1 108 ? 33.513  69.470  24.152  1.00 86.11  ? 106 LYS A CE  1 
ATOM   793   N NZ  . LYS A 1 108 ? 32.357  69.451  25.096  1.00 87.74  ? 106 LYS A NZ  1 
ATOM   794   N N   . LYS A 1 109 ? 39.647  65.968  21.728  1.00 70.74  ? 107 LYS A N   1 
ATOM   795   C CA  . LYS A 1 109 ? 40.417  64.787  21.405  1.00 74.30  ? 107 LYS A CA  1 
ATOM   796   C C   . LYS A 1 109 ? 41.545  65.301  20.557  1.00 76.83  ? 107 LYS A C   1 
ATOM   797   O O   . LYS A 1 109 ? 42.659  64.768  20.544  1.00 73.54  ? 107 LYS A O   1 
ATOM   798   C CB  . LYS A 1 109 ? 39.558  63.825  20.617  1.00 79.04  ? 107 LYS A CB  1 
ATOM   799   C CG  . LYS A 1 109 ? 39.586  62.405  21.156  1.00 88.73  ? 107 LYS A CG  1 
ATOM   800   C CD  . LYS A 1 109 ? 40.731  61.590  20.575  1.00 94.01  ? 107 LYS A CD  1 
ATOM   801   C CE  . LYS A 1 109 ? 40.609  60.135  21.033  1.00 95.98  ? 107 LYS A CE  1 
ATOM   802   N NZ  . LYS A 1 109 ? 41.398  59.164  20.209  1.00 101.79 ? 107 LYS A NZ  1 
ATOM   803   N N   . LEU A 1 110 ? 41.209  66.373  19.850  1.00 82.70  ? 108 LEU A N   1 
ATOM   804   C CA  . LEU A 1 110 ? 42.113  67.101  18.960  1.00 87.64  ? 108 LEU A CA  1 
ATOM   805   C C   . LEU A 1 110 ? 42.711  68.308  19.678  1.00 91.55  ? 108 LEU A C   1 
ATOM   806   O O   . LEU A 1 110 ? 43.687  68.895  19.200  1.00 90.87  ? 108 LEU A O   1 
ATOM   807   C CB  . LEU A 1 110 ? 41.354  67.611  17.734  1.00 86.84  ? 108 LEU A CB  1 
ATOM   808   C CG  . LEU A 1 110 ? 42.035  68.767  16.983  1.00 84.37  ? 108 LEU A CG  1 
ATOM   809   C CD1 . LEU A 1 110 ? 43.220  68.203  16.265  1.00 90.08  ? 108 LEU A CD1 1 
ATOM   810   C CD2 . LEU A 1 110 ? 41.099  69.447  15.989  1.00 81.88  ? 108 LEU A CD2 1 
ATOM   811   N N   . SER A 1 111 ? 42.091  68.696  20.798  1.00 97.67  ? 109 SER A N   1 
ATOM   812   C CA  . SER A 1 111 ? 42.560  69.827  21.608  1.00 104.08 ? 109 SER A CA  1 
ATOM   813   C C   . SER A 1 111 ? 43.699  69.302  22.484  1.00 107.45 ? 109 SER A C   1 
ATOM   814   O O   . SER A 1 111 ? 44.451  70.066  23.119  1.00 109.61 ? 109 SER A O   1 
ATOM   815   C CB  . SER A 1 111 ? 41.420  70.413  22.472  1.00 103.42 ? 109 SER A CB  1 
ATOM   816   O OG  . SER A 1 111 ? 40.868  69.443  23.351  1.00 106.93 ? 109 SER A OG  1 
ATOM   817   N N   . ALA A 1 112 ? 43.813  67.977  22.506  1.00 108.60 ? 110 ALA A N   1 
ATOM   818   C CA  . ALA A 1 112 ? 44.873  67.318  23.242  1.00 109.01 ? 110 ALA A CA  1 
ATOM   819   C C   . ALA A 1 112 ? 46.173  67.595  22.471  1.00 110.07 ? 110 ALA A C   1 
ATOM   820   O O   . ALA A 1 112 ? 47.044  66.737  22.418  1.00 113.00 ? 110 ALA A O   1 
ATOM   821   C CB  . ALA A 1 112 ? 44.600  65.806  23.321  1.00 109.09 ? 110 ALA A CB  1 
ATOM   822   N N   . PHE A 1 113 ? 46.271  68.770  21.837  1.00 109.95 ? 111 PHE A N   1 
ATOM   823   C CA  . PHE A 1 113 ? 47.463  69.195  21.079  1.00 111.15 ? 111 PHE A CA  1 
ATOM   824   C C   . PHE A 1 113 ? 47.432  70.704  20.835  1.00 111.54 ? 111 PHE A C   1 
ATOM   825   O O   . PHE A 1 113 ? 48.301  71.228  20.138  1.00 114.26 ? 111 PHE A O   1 
ATOM   826   C CB  . PHE A 1 113 ? 47.576  68.577  19.659  1.00 112.81 ? 111 PHE A CB  1 
ATOM   827   C CG  . PHE A 1 113 ? 47.200  67.129  19.552  1.00 113.30 ? 111 PHE A CG  1 
ATOM   828   C CD1 . PHE A 1 113 ? 45.869  66.743  19.652  1.00 117.13 ? 111 PHE A CD1 1 
ATOM   829   C CD2 . PHE A 1 113 ? 48.169  66.160  19.298  1.00 111.85 ? 111 PHE A CD2 1 
ATOM   830   C CE1 . PHE A 1 113 ? 45.498  65.416  19.503  1.00 120.09 ? 111 PHE A CE1 1 
ATOM   831   C CE2 . PHE A 1 113 ? 47.824  64.838  19.145  1.00 114.51 ? 111 PHE A CE2 1 
ATOM   832   C CZ  . PHE A 1 113 ? 46.479  64.453  19.247  1.00 119.76 ? 111 PHE A CZ  1 
ATOM   833   N N   . ARG A 1 114 ? 46.446  71.406  21.377  1.00 109.01 ? 112 ARG A N   1 
ATOM   834   C CA  . ARG A 1 114 ? 46.342  72.832  21.106  1.00 107.68 ? 112 ARG A CA  1 
ATOM   835   C C   . ARG A 1 114 ? 45.302  73.379  22.066  1.00 108.37 ? 112 ARG A C   1 
ATOM   836   O O   . ARG A 1 114 ? 44.198  72.863  22.137  1.00 110.34 ? 112 ARG A O   1 
ATOM   837   C CB  . ARG A 1 114 ? 45.884  73.016  19.641  1.00 108.50 ? 112 ARG A CB  1 
ATOM   838   C CG  . ARG A 1 114 ? 46.083  74.402  18.999  1.00 108.19 ? 112 ARG A CG  1 
ATOM   839   C CD  . ARG A 1 114 ? 47.502  74.621  18.470  1.00 105.31 ? 112 ARG A CD  1 
ATOM   840   N NE  . ARG A 1 114 ? 47.751  75.978  17.963  1.00 105.07 ? 112 ARG A NE  1 
ATOM   841   C CZ  . ARG A 1 114 ? 48.956  76.436  17.602  1.00 109.78 ? 112 ARG A CZ  1 
ATOM   842   N NH1 . ARG A 1 114 ? 50.033  75.656  17.687  1.00 111.27 ? 112 ARG A NH1 1 
ATOM   843   N NH2 . ARG A 1 114 ? 49.100  77.680  17.159  1.00 110.45 ? 112 ARG A NH2 1 
ATOM   844   N N   . PRO A 1 115 ? 45.642  74.438  22.812  1.00 109.26 ? 113 PRO A N   1 
ATOM   845   C CA  . PRO A 1 115 ? 44.774  75.102  23.792  1.00 110.62 ? 113 PRO A CA  1 
ATOM   846   C C   . PRO A 1 115 ? 43.358  75.352  23.281  1.00 112.24 ? 113 PRO A C   1 
ATOM   847   O O   . PRO A 1 115 ? 42.383  74.981  23.954  1.00 114.98 ? 113 PRO A O   1 
ATOM   848   C CB  . PRO A 1 115 ? 45.503  76.409  24.072  1.00 111.18 ? 113 PRO A CB  1 
ATOM   849   C CG  . PRO A 1 115 ? 46.936  76.021  23.924  1.00 113.39 ? 113 PRO A CG  1 
ATOM   850   C CD  . PRO A 1 115 ? 46.926  75.145  22.689  1.00 111.88 ? 113 PRO A CD  1 
ATOM   851   N N   . ALA A 1 116 ? 43.261  75.988  22.106  1.00 110.53 ? 114 ALA A N   1 
ATOM   852   C CA  . ALA A 1 116 ? 41.976  76.308  21.471  1.00 106.74 ? 114 ALA A CA  1 
ATOM   853   C C   . ALA A 1 116 ? 42.028  76.151  19.957  1.00 104.17 ? 114 ALA A C   1 
ATOM   854   O O   . ALA A 1 116 ? 42.417  77.071  19.240  1.00 102.08 ? 114 ALA A O   1 
ATOM   855   C CB  . ALA A 1 116 ? 41.543  77.734  21.821  1.00 105.84 ? 114 ALA A CB  1 
ATOM   856   N N   . PRO A 1 117 ? 41.661  74.962  19.455  1.00 102.40 ? 115 PRO A N   1 
ATOM   857   C CA  . PRO A 1 117 ? 41.663  74.699  18.014  1.00 99.74  ? 115 PRO A CA  1 
ATOM   858   C C   . PRO A 1 117 ? 40.398  75.312  17.397  1.00 97.48  ? 115 PRO A C   1 
ATOM   859   O O   . PRO A 1 117 ? 39.380  75.490  18.070  1.00 94.68  ? 115 PRO A O   1 
ATOM   860   C CB  . PRO A 1 117 ? 41.682  73.177  17.950  1.00 98.01  ? 115 PRO A CB  1 
ATOM   861   C CG  . PRO A 1 117 ? 40.835  72.825  19.118  1.00 100.40 ? 115 PRO A CG  1 
ATOM   862   C CD  . PRO A 1 117 ? 41.335  73.735  20.207  1.00 102.61 ? 115 PRO A CD  1 
ATOM   863   N N   . ARG A 1 118 ? 40.481  75.622  16.110  1.00 96.71  ? 116 ARG A N   1 
ATOM   864   C CA  . ARG A 1 118 ? 39.382  76.241  15.393  1.00 95.96  ? 116 ARG A CA  1 
ATOM   865   C C   . ARG A 1 118 ? 38.763  75.259  14.399  1.00 94.44  ? 116 ARG A C   1 
ATOM   866   O O   . ARG A 1 118 ? 39.393  74.896  13.406  1.00 93.12  ? 116 ARG A O   1 
ATOM   867   C CB  . ARG A 1 118 ? 39.918  77.471  14.684  1.00 96.83  ? 116 ARG A CB  1 
ATOM   868   C CG  . ARG A 1 118 ? 40.691  78.377  15.628  1.00 102.00 ? 116 ARG A CG  1 
ATOM   869   C CD  . ARG A 1 118 ? 41.698  79.208  14.876  1.00 107.37 ? 116 ARG A CD  1 
ATOM   870   N NE  . ARG A 1 118 ? 41.048  80.052  13.873  1.00 111.41 ? 116 ARG A NE  1 
ATOM   871   C CZ  . ARG A 1 118 ? 41.670  80.594  12.829  1.00 111.40 ? 116 ARG A CZ  1 
ATOM   872   N NH1 . ARG A 1 118 ? 42.968  80.382  12.640  1.00 112.50 ? 116 ARG A NH1 1 
ATOM   873   N NH2 . ARG A 1 118 ? 40.995  81.344  11.976  1.00 111.19 ? 116 ARG A NH2 1 
ATOM   874   N N   . VAL A 1 119 ? 37.516  74.853  14.679  1.00 92.24  ? 117 VAL A N   1 
ATOM   875   C CA  . VAL A 1 119 ? 36.783  73.869  13.864  1.00 87.14  ? 117 VAL A CA  1 
ATOM   876   C C   . VAL A 1 119 ? 35.291  74.141  13.590  1.00 84.74  ? 117 VAL A C   1 
ATOM   877   O O   . VAL A 1 119 ? 34.563  74.633  14.461  1.00 79.63  ? 117 VAL A O   1 
ATOM   878   C CB  . VAL A 1 119 ? 36.878  72.456  14.516  1.00 85.17  ? 117 VAL A CB  1 
ATOM   879   C CG1 . VAL A 1 119 ? 35.792  72.287  15.585  1.00 81.52  ? 117 VAL A CG1 1 
ATOM   880   C CG2 . VAL A 1 119 ? 36.761  71.378  13.463  1.00 85.69  ? 117 VAL A CG2 1 
ATOM   881   N N   . ILE A 1 120 ? 34.866  73.796  12.365  1.00 84.76  ? 118 ILE A N   1 
ATOM   882   C CA  . ILE A 1 120 ? 33.470  73.922  11.886  1.00 81.81  ? 118 ILE A CA  1 
ATOM   883   C C   . ILE A 1 120 ? 32.926  72.603  11.277  1.00 80.34  ? 118 ILE A C   1 
ATOM   884   O O   . ILE A 1 120 ? 33.614  71.927  10.483  1.00 76.82  ? 118 ILE A O   1 
ATOM   885   C CB  . ILE A 1 120 ? 33.308  75.048  10.822  1.00 77.64  ? 118 ILE A CB  1 
ATOM   886   C CG1 . ILE A 1 120 ? 34.564  75.149  9.970   1.00 75.58  ? 118 ILE A CG1 1 
ATOM   887   C CG2 . ILE A 1 120 ? 33.000  76.365  11.489  1.00 76.30  ? 118 ILE A CG2 1 
ATOM   888   C CD1 . ILE A 1 120 ? 34.508  76.286  9.008   1.00 78.20  ? 118 ILE A CD1 1 
ATOM   889   N N   . ARG A 1 121 ? 31.707  72.236  11.678  1.00 77.65  ? 119 ARG A N   1 
ATOM   890   C CA  . ARG A 1 121 ? 31.091  71.030  11.165  1.00 75.18  ? 119 ARG A CA  1 
ATOM   891   C C   . ARG A 1 121 ? 30.416  71.491  9.878   1.00 76.21  ? 119 ARG A C   1 
ATOM   892   O O   . ARG A 1 121 ? 29.833  72.585  9.815   1.00 73.97  ? 119 ARG A O   1 
ATOM   893   C CB  . ARG A 1 121 ? 30.085  70.457  12.169  1.00 73.11  ? 119 ARG A CB  1 
ATOM   894   C CG  . ARG A 1 121 ? 29.621  69.065  11.781  1.00 73.47  ? 119 ARG A CG  1 
ATOM   895   C CD  . ARG A 1 121 ? 28.665  68.457  12.802  1.00 76.49  ? 119 ARG A CD  1 
ATOM   896   N NE  . ARG A 1 121 ? 27.914  67.363  12.185  1.00 80.33  ? 119 ARG A NE  1 
ATOM   897   C CZ  . ARG A 1 121 ? 27.039  66.584  12.816  1.00 82.19  ? 119 ARG A CZ  1 
ATOM   898   N NH1 . ARG A 1 121 ? 26.793  66.764  14.104  1.00 84.34  ? 119 ARG A NH1 1 
ATOM   899   N NH2 . ARG A 1 121 ? 26.394  65.633  12.148  1.00 84.86  ? 119 ARG A NH2 1 
ATOM   900   N N   . CYS A 1 122 ? 30.507  70.664  8.849   1.00 76.10  ? 120 CYS A N   1 
ATOM   901   C CA  . CYS A 1 122 ? 29.961  71.016  7.562   1.00 75.63  ? 120 CYS A CA  1 
ATOM   902   C C   . CYS A 1 122 ? 29.088  69.898  7.026   1.00 75.35  ? 120 CYS A C   1 
ATOM   903   O O   . CYS A 1 122 ? 29.322  68.711  7.307   1.00 75.64  ? 120 CYS A O   1 
ATOM   904   C CB  . CYS A 1 122 ? 31.115  71.259  6.613   1.00 76.81  ? 120 CYS A CB  1 
ATOM   905   S SG  . CYS A 1 122 ? 31.056  70.267  5.088   1.00 93.69  ? 120 CYS A SG  1 
ATOM   906   N N   . MET A 1 123 ? 28.083  70.280  6.244   1.00 73.53  ? 121 MET A N   1 
ATOM   907   C CA  . MET A 1 123 ? 27.185  69.317  5.624   1.00 71.92  ? 121 MET A CA  1 
ATOM   908   C C   . MET A 1 123 ? 26.907  69.758  4.224   1.00 70.89  ? 121 MET A C   1 
ATOM   909   O O   . MET A 1 123 ? 26.219  70.750  4.023   1.00 69.20  ? 121 MET A O   1 
ATOM   910   C CB  . MET A 1 123 ? 25.848  69.223  6.339   1.00 71.69  ? 121 MET A CB  1 
ATOM   911   C CG  . MET A 1 123 ? 25.137  67.885  5.993   1.00 73.31  ? 121 MET A CG  1 
ATOM   912   S SD  . MET A 1 123 ? 25.847  66.924  4.542   1.00 66.91  ? 121 MET A SD  1 
ATOM   913   C CE  . MET A 1 123 ? 26.916  65.634  5.338   1.00 63.11  ? 121 MET A CE  1 
ATOM   914   N N   . THR A 1 124 ? 27.423  69.007  3.263   1.00 69.81  ? 122 THR A N   1 
ATOM   915   C CA  . THR A 1 124 ? 27.242  69.356  1.865   1.00 72.46  ? 122 THR A CA  1 
ATOM   916   C C   . THR A 1 124 ? 26.955  68.153  0.969   1.00 74.14  ? 122 THR A C   1 
ATOM   917   O O   . THR A 1 124 ? 27.021  67.007  1.419   1.00 78.98  ? 122 THR A O   1 
ATOM   918   C CB  . THR A 1 124 ? 28.495  70.122  1.376   1.00 71.52  ? 122 THR A CB  1 
ATOM   919   O OG1 . THR A 1 124 ? 28.449  71.438  1.926   1.00 70.64  ? 122 THR A OG1 1 
ATOM   920   C CG2 . THR A 1 124 ? 28.584  70.207  -0.146  1.00 70.93  ? 122 THR A CG2 1 
ATOM   921   N N   . ASN A 1 125 ? 26.626  68.414  -0.294  1.00 71.68  ? 123 ASN A N   1 
ATOM   922   C CA  . ASN A 1 125 ? 26.333  67.348  -1.247  1.00 67.13  ? 123 ASN A CA  1 
ATOM   923   C C   . ASN A 1 125 ? 27.076  67.534  -2.556  1.00 63.35  ? 123 ASN A C   1 
ATOM   924   O O   . ASN A 1 125 ? 27.524  68.628  -2.897  1.00 62.06  ? 123 ASN A O   1 
ATOM   925   C CB  . ASN A 1 125 ? 24.832  67.298  -1.512  1.00 64.77  ? 123 ASN A CB  1 
ATOM   926   C CG  . ASN A 1 125 ? 24.257  68.668  -1.777  1.00 57.70  ? 123 ASN A CG  1 
ATOM   927   O OD1 . ASN A 1 125 ? 23.053  68.824  -1.921  1.00 49.06  ? 123 ASN A OD1 1 
ATOM   928   N ND2 . ASN A 1 125 ? 25.124  69.673  -1.843  1.00 55.76  ? 123 ASN A ND2 1 
ATOM   929   N N   . THR A 1 126 ? 27.196  66.441  -3.285  1.00 59.41  ? 124 THR A N   1 
ATOM   930   C CA  . THR A 1 126 ? 27.870  66.434  -4.567  1.00 57.98  ? 124 THR A CA  1 
ATOM   931   C C   . THR A 1 126 ? 27.555  67.551  -5.573  1.00 59.75  ? 124 THR A C   1 
ATOM   932   O O   . THR A 1 126 ? 28.480  68.061  -6.194  1.00 56.89  ? 124 THR A O   1 
ATOM   933   C CB  . THR A 1 126 ? 27.617  65.102  -5.230  1.00 58.91  ? 124 THR A CB  1 
ATOM   934   O OG1 . THR A 1 126 ? 26.269  64.692  -4.929  1.00 55.30  ? 124 THR A OG1 1 
ATOM   935   C CG2 . THR A 1 126 ? 28.633  64.062  -4.728  1.00 57.34  ? 124 THR A CG2 1 
ATOM   936   N N   . PRO A 1 127 ? 26.253  67.936  -5.765  1.00 62.17  ? 125 PRO A N   1 
ATOM   937   C CA  . PRO A 1 127 ? 25.869  69.007  -6.721  1.00 61.49  ? 125 PRO A CA  1 
ATOM   938   C C   . PRO A 1 127 ? 26.684  70.298  -6.596  1.00 60.82  ? 125 PRO A C   1 
ATOM   939   O O   . PRO A 1 127 ? 26.544  71.245  -7.370  1.00 58.05  ? 125 PRO A O   1 
ATOM   940   C CB  . PRO A 1 127 ? 24.366  69.213  -6.458  1.00 58.63  ? 125 PRO A CB  1 
ATOM   941   C CG  . PRO A 1 127 ? 24.157  68.716  -5.094  1.00 62.64  ? 125 PRO A CG  1 
ATOM   942   C CD  . PRO A 1 127 ? 25.060  67.479  -5.027  1.00 64.83  ? 125 PRO A CD  1 
ATOM   943   N N   . VAL A 1 128 ? 27.549  70.300  -5.598  1.00 62.28  ? 126 VAL A N   1 
ATOM   944   C CA  . VAL A 1 128 ? 28.454  71.388  -5.340  1.00 62.74  ? 126 VAL A CA  1 
ATOM   945   C C   . VAL A 1 128 ? 29.307  71.495  -6.618  1.00 64.97  ? 126 VAL A C   1 
ATOM   946   O O   . VAL A 1 128 ? 29.627  72.584  -7.076  1.00 65.48  ? 126 VAL A O   1 
ATOM   947   C CB  . VAL A 1 128 ? 29.347  71.048  -4.084  1.00 62.83  ? 126 VAL A CB  1 
ATOM   948   C CG1 . VAL A 1 128 ? 30.844  71.110  -4.424  1.00 62.47  ? 126 VAL A CG1 1 
ATOM   949   C CG2 . VAL A 1 128 ? 29.013  71.984  -2.944  1.00 55.06  ? 126 VAL A CG2 1 
ATOM   950   N N   . VAL A 1 129 ? 29.635  70.350  -7.213  1.00 66.89  ? 127 VAL A N   1 
ATOM   951   C CA  . VAL A 1 129 ? 30.471  70.301  -8.423  1.00 68.41  ? 127 VAL A CA  1 
ATOM   952   C C   . VAL A 1 129 ? 30.063  71.289  -9.493  1.00 69.58  ? 127 VAL A C   1 
ATOM   953   O O   . VAL A 1 129 ? 30.732  71.448  -10.510 1.00 66.21  ? 127 VAL A O   1 
ATOM   954   C CB  . VAL A 1 129 ? 30.469  68.916  -9.102  1.00 69.33  ? 127 VAL A CB  1 
ATOM   955   C CG1 . VAL A 1 129 ? 31.670  68.818  -10.064 1.00 66.98  ? 127 VAL A CG1 1 
ATOM   956   C CG2 . VAL A 1 129 ? 30.480  67.797  -8.056  1.00 72.06  ? 127 VAL A CG2 1 
ATOM   957   N N   . VAL A 1 130 ? 28.934  71.931  -9.274  1.00 73.75  ? 128 VAL A N   1 
ATOM   958   C CA  . VAL A 1 130 ? 28.457  72.927  -10.202 1.00 75.98  ? 128 VAL A CA  1 
ATOM   959   C C   . VAL A 1 130 ? 28.425  74.234  -9.433  1.00 81.02  ? 128 VAL A C   1 
ATOM   960   O O   . VAL A 1 130 ? 29.384  75.013  -9.446  1.00 80.93  ? 128 VAL A O   1 
ATOM   961   C CB  . VAL A 1 130 ? 27.056  72.604  -10.698 1.00 72.35  ? 128 VAL A CB  1 
ATOM   962   C CG1 . VAL A 1 130 ? 26.466  73.831  -11.287 1.00 72.11  ? 128 VAL A CG1 1 
ATOM   963   C CG2 . VAL A 1 130 ? 27.110  71.514  -11.725 1.00 64.33  ? 128 VAL A CG2 1 
ATOM   964   N N   . ARG A 1 131 ? 27.319  74.459  -8.749  1.00 85.41  ? 129 ARG A N   1 
ATOM   965   C CA  . ARG A 1 131 ? 27.173  75.658  -7.974  1.00 94.31  ? 129 ARG A CA  1 
ATOM   966   C C   . ARG A 1 131 ? 25.855  75.536  -7.252  1.00 95.25  ? 129 ARG A C   1 
ATOM   967   O O   . ARG A 1 131 ? 25.333  76.516  -6.690  1.00 98.15  ? 129 ARG A O   1 
ATOM   968   C CB  . ARG A 1 131 ? 27.179  76.893  -8.885  1.00 102.81 ? 129 ARG A CB  1 
ATOM   969   C CG  . ARG A 1 131 ? 26.804  78.195  -8.180  1.00 111.78 ? 129 ARG A CG  1 
ATOM   970   C CD  . ARG A 1 131 ? 26.776  79.376  -9.128  1.00 120.60 ? 129 ARG A CD  1 
ATOM   971   N NE  . ARG A 1 131 ? 28.120  79.905  -9.384  1.00 129.18 ? 129 ARG A NE  1 
ATOM   972   C CZ  . ARG A 1 131 ? 28.368  81.184  -9.662  1.00 131.87 ? 129 ARG A CZ  1 
ATOM   973   N NH1 . ARG A 1 131 ? 27.358  82.043  -9.715  1.00 134.74 ? 129 ARG A NH1 1 
ATOM   974   N NH2 . ARG A 1 131 ? 29.609  81.615  -9.878  1.00 131.81 ? 129 ARG A NH2 1 
ATOM   975   N N   . GLU A 1 132 ? 25.307  74.328  -7.256  1.00 91.90  ? 130 GLU A N   1 
ATOM   976   C CA  . GLU A 1 132 ? 24.039  74.157  -6.588  1.00 88.92  ? 130 GLU A CA  1 
ATOM   977   C C   . GLU A 1 132 ? 24.041  73.136  -5.471  1.00 85.84  ? 130 GLU A C   1 
ATOM   978   O O   . GLU A 1 132 ? 23.025  72.515  -5.187  1.00 85.84  ? 130 GLU A O   1 
ATOM   979   C CB  . GLU A 1 132 ? 22.924  73.877  -7.612  1.00 91.14  ? 130 GLU A CB  1 
ATOM   980   C CG  . GLU A 1 132 ? 22.682  75.013  -8.648  1.00 90.57  ? 130 GLU A CG  1 
ATOM   981   C CD  . GLU A 1 132 ? 22.445  76.417  -8.032  1.00 90.23  ? 130 GLU A CD  1 
ATOM   982   O OE1 . GLU A 1 132 ? 21.660  76.543  -7.058  1.00 89.27  ? 130 GLU A OE1 1 
ATOM   983   O OE2 . GLU A 1 132 ? 23.038  77.402  -8.542  1.00 90.46  ? 130 GLU A OE2 1 
ATOM   984   N N   . GLY A 1 133 ? 25.186  72.960  -4.826  1.00 83.17  ? 131 GLY A N   1 
ATOM   985   C CA  . GLY A 1 133 ? 25.216  72.044  -3.705  1.00 80.25  ? 131 GLY A CA  1 
ATOM   986   C C   . GLY A 1 133 ? 24.429  72.729  -2.584  1.00 77.01  ? 131 GLY A C   1 
ATOM   987   O O   . GLY A 1 133 ? 24.159  73.928  -2.648  1.00 77.25  ? 131 GLY A O   1 
ATOM   988   N N   . ALA A 1 134 ? 24.034  71.986  -1.562  1.00 72.33  ? 132 ALA A N   1 
ATOM   989   C CA  . ALA A 1 134 ? 23.318  72.590  -0.456  1.00 70.18  ? 132 ALA A CA  1 
ATOM   990   C C   . ALA A 1 134 ? 24.210  72.399  0.743   1.00 70.56  ? 132 ALA A C   1 
ATOM   991   O O   . ALA A 1 134 ? 24.407  71.257  1.207   1.00 72.50  ? 132 ALA A O   1 
ATOM   992   C CB  . ALA A 1 134 ? 22.026  71.902  -0.244  1.00 70.49  ? 132 ALA A CB  1 
ATOM   993   N N   . THR A 1 135 ? 24.764  73.502  1.243   1.00 70.97  ? 133 THR A N   1 
ATOM   994   C CA  . THR A 1 135 ? 25.679  73.425  2.389   1.00 73.26  ? 133 THR A CA  1 
ATOM   995   C C   . THR A 1 135 ? 25.196  74.024  3.694   1.00 74.15  ? 133 THR A C   1 
ATOM   996   O O   . THR A 1 135 ? 24.504  75.042  3.733   1.00 76.13  ? 133 THR A O   1 
ATOM   997   C CB  . THR A 1 135 ? 27.012  74.092  2.107   1.00 70.67  ? 133 THR A CB  1 
ATOM   998   O OG1 . THR A 1 135 ? 27.621  73.491  0.964   1.00 73.88  ? 133 THR A OG1 1 
ATOM   999   C CG2 . THR A 1 135 ? 27.929  73.938  3.302   1.00 68.90  ? 133 THR A CG2 1 
ATOM   1000  N N   . VAL A 1 136 ? 25.587  73.378  4.776   1.00 73.28  ? 134 VAL A N   1 
ATOM   1001  C CA  . VAL A 1 136 ? 25.204  73.857  6.068   1.00 72.09  ? 134 VAL A CA  1 
ATOM   1002  C C   . VAL A 1 136 ? 26.430  73.720  6.915   1.00 76.47  ? 134 VAL A C   1 
ATOM   1003  O O   . VAL A 1 136 ? 27.346  72.948  6.590   1.00 76.42  ? 134 VAL A O   1 
ATOM   1004  C CB  . VAL A 1 136 ? 24.068  73.022  6.624   1.00 66.92  ? 134 VAL A CB  1 
ATOM   1005  C CG1 . VAL A 1 136 ? 24.277  72.729  8.070   1.00 70.38  ? 134 VAL A CG1 1 
ATOM   1006  C CG2 . VAL A 1 136 ? 22.792  73.775  6.449   1.00 61.65  ? 134 VAL A CG2 1 
ATOM   1007  N N   . TYR A 1 137 ? 26.469  74.479  7.996   1.00 80.87  ? 135 TYR A N   1 
ATOM   1008  C CA  . TYR A 1 137 ? 27.611  74.387  8.879   1.00 86.16  ? 135 TYR A CA  1 
ATOM   1009  C C   . TYR A 1 137 ? 27.296  74.952  10.256  1.00 87.19  ? 135 TYR A C   1 
ATOM   1010  O O   . TYR A 1 137 ? 26.350  75.744  10.430  1.00 85.09  ? 135 TYR A O   1 
ATOM   1011  C CB  . TYR A 1 137 ? 28.828  75.100  8.257   1.00 89.52  ? 135 TYR A CB  1 
ATOM   1012  C CG  . TYR A 1 137 ? 28.708  76.611  8.228   1.00 91.21  ? 135 TYR A CG  1 
ATOM   1013  C CD1 . TYR A 1 137 ? 28.650  77.331  9.414   1.00 92.45  ? 135 TYR A CD1 1 
ATOM   1014  C CD2 . TYR A 1 137 ? 28.638  77.319  7.024   1.00 92.49  ? 135 TYR A CD2 1 
ATOM   1015  C CE1 . TYR A 1 137 ? 28.524  78.701  9.420   1.00 89.85  ? 135 TYR A CE1 1 
ATOM   1016  C CE2 . TYR A 1 137 ? 28.512  78.704  7.021   1.00 91.14  ? 135 TYR A CE2 1 
ATOM   1017  C CZ  . TYR A 1 137 ? 28.455  79.384  8.234   1.00 89.85  ? 135 TYR A CZ  1 
ATOM   1018  O OH  . TYR A 1 137 ? 28.323  80.749  8.296   1.00 91.83  ? 135 TYR A OH  1 
ATOM   1019  N N   . ALA A 1 138 ? 28.101  74.518  11.220  1.00 90.35  ? 136 ALA A N   1 
ATOM   1020  C CA  . ALA A 1 138 ? 27.997  74.938  12.605  1.00 93.42  ? 136 ALA A CA  1 
ATOM   1021  C C   . ALA A 1 138 ? 29.406  75.281  13.127  1.00 94.62  ? 136 ALA A C   1 
ATOM   1022  O O   . ALA A 1 138 ? 30.395  74.569  12.874  1.00 93.53  ? 136 ALA A O   1 
ATOM   1023  C CB  . ALA A 1 138 ? 27.351  73.831  13.448  1.00 95.10  ? 136 ALA A CB  1 
ATOM   1024  N N   . THR A 1 139 ? 29.468  76.406  13.833  1.00 95.32  ? 137 THR A N   1 
ATOM   1025  C CA  . THR A 1 139 ? 30.689  76.933  14.423  1.00 92.77  ? 137 THR A CA  1 
ATOM   1026  C C   . THR A 1 139 ? 31.097  76.188  15.687  1.00 93.87  ? 137 THR A C   1 
ATOM   1027  O O   . THR A 1 139 ? 30.260  75.849  16.535  1.00 93.34  ? 137 THR A O   1 
ATOM   1028  C CB  . THR A 1 139 ? 30.516  78.417  14.800  1.00 90.71  ? 137 THR A CB  1 
ATOM   1029  O OG1 . THR A 1 139 ? 29.445  78.560  15.751  1.00 89.13  ? 137 THR A OG1 1 
ATOM   1030  C CG2 . THR A 1 139 ? 30.210  79.232  13.575  1.00 85.47  ? 137 THR A CG2 1 
ATOM   1031  N N   . GLY A 1 140 ? 32.394  75.940  15.798  1.00 93.56  ? 138 GLY A N   1 
ATOM   1032  C CA  . GLY A 1 140 ? 32.914  75.270  16.967  1.00 97.55  ? 138 GLY A CA  1 
ATOM   1033  C C   . GLY A 1 140 ? 32.818  76.204  18.159  1.00 98.58  ? 138 GLY A C   1 
ATOM   1034  O O   . GLY A 1 140 ? 32.122  77.223  18.100  1.00 99.78  ? 138 GLY A O   1 
ATOM   1035  N N   . THR A 1 141 ? 33.490  75.850  19.252  1.00 98.97  ? 139 THR A N   1 
ATOM   1036  C CA  . THR A 1 141 ? 33.484  76.689  20.441  1.00 98.09  ? 139 THR A CA  1 
ATOM   1037  C C   . THR A 1 141 ? 34.631  77.702  20.314  1.00 99.95  ? 139 THR A C   1 
ATOM   1038  O O   . THR A 1 141 ? 34.434  78.890  20.587  1.00 98.02  ? 139 THR A O   1 
ATOM   1039  C CB  . THR A 1 141 ? 33.583  75.824  21.730  1.00 95.87  ? 139 THR A CB  1 
ATOM   1040  O OG1 . THR A 1 141 ? 34.409  74.672  21.497  1.00 91.03  ? 139 THR A OG1 1 
ATOM   1041  C CG2 . THR A 1 141 ? 32.175  75.361  22.144  1.00 95.37  ? 139 THR A CG2 1 
ATOM   1042  N N   . HIS A 1 142 ? 35.801  77.234  19.851  1.00 102.68 ? 140 HIS A N   1 
ATOM   1043  C CA  . HIS A 1 142 ? 36.989  78.085  19.623  1.00 104.33 ? 140 HIS A CA  1 
ATOM   1044  C C   . HIS A 1 142 ? 36.917  78.554  18.170  1.00 105.77 ? 140 HIS A C   1 
ATOM   1045  O O   . HIS A 1 142 ? 37.812  78.270  17.361  1.00 106.13 ? 140 HIS A O   1 
ATOM   1046  C CB  . HIS A 1 142 ? 38.315  77.319  19.790  1.00 102.42 ? 140 HIS A CB  1 
ATOM   1047  C CG  . HIS A 1 142 ? 38.309  76.327  20.902  1.00 104.41 ? 140 HIS A CG  1 
ATOM   1048  N ND1 . HIS A 1 142 ? 37.929  76.649  22.187  1.00 105.42 ? 140 HIS A ND1 1 
ATOM   1049  C CD2 . HIS A 1 142 ? 38.625  75.012  20.921  1.00 105.27 ? 140 HIS A CD2 1 
ATOM   1050  C CE1 . HIS A 1 142 ? 38.009  75.573  22.949  1.00 105.67 ? 140 HIS A CE1 1 
ATOM   1051  N NE2 . HIS A 1 142 ? 38.429  74.565  22.205  1.00 105.61 ? 140 HIS A NE2 1 
ATOM   1052  N N   . ALA A 1 143 ? 35.848  79.263  17.835  1.00 106.72 ? 141 ALA A N   1 
ATOM   1053  C CA  . ALA A 1 143 ? 35.672  79.730  16.474  1.00 107.19 ? 141 ALA A CA  1 
ATOM   1054  C C   . ALA A 1 143 ? 35.249  81.189  16.423  1.00 109.26 ? 141 ALA A C   1 
ATOM   1055  O O   . ALA A 1 143 ? 34.132  81.542  16.794  1.00 109.01 ? 141 ALA A O   1 
ATOM   1056  C CB  . ALA A 1 143 ? 34.658  78.866  15.793  1.00 108.44 ? 141 ALA A CB  1 
ATOM   1057  N N   . GLN A 1 144 ? 36.167  82.027  15.954  1.00 111.79 ? 142 GLN A N   1 
ATOM   1058  C CA  . GLN A 1 144 ? 35.932  83.462  15.831  1.00 113.59 ? 142 GLN A CA  1 
ATOM   1059  C C   . GLN A 1 144 ? 34.960  83.722  14.686  1.00 112.76 ? 142 GLN A C   1 
ATOM   1060  O O   . GLN A 1 144 ? 34.774  82.870  13.822  1.00 113.48 ? 142 GLN A O   1 
ATOM   1061  C CB  . GLN A 1 144 ? 37.252  84.190  15.571  1.00 115.04 ? 142 GLN A CB  1 
ATOM   1062  C CG  . GLN A 1 144 ? 38.284  83.970  16.663  1.00 114.66 ? 142 GLN A CG  1 
ATOM   1063  C CD  . GLN A 1 144 ? 39.676  84.322  16.200  1.00 116.79 ? 142 GLN A CD  1 
ATOM   1064  O OE1 . GLN A 1 144 ? 40.201  83.695  15.280  1.00 114.45 ? 142 GLN A OE1 1 
ATOM   1065  N NE2 . GLN A 1 144 ? 40.281  85.337  16.824  1.00 120.59 ? 142 GLN A NE2 1 
ATOM   1066  N N   . VAL A 1 145 ? 34.369  84.909  14.655  1.00 110.46 ? 143 VAL A N   1 
ATOM   1067  C CA  . VAL A 1 145 ? 33.395  85.217  13.622  1.00 107.81 ? 143 VAL A CA  1 
ATOM   1068  C C   . VAL A 1 145 ? 33.971  85.669  12.265  1.00 108.15 ? 143 VAL A C   1 
ATOM   1069  O O   . VAL A 1 145 ? 33.243  86.219  11.433  1.00 108.91 ? 143 VAL A O   1 
ATOM   1070  C CB  . VAL A 1 145 ? 32.400  86.275  14.140  1.00 106.19 ? 143 VAL A CB  1 
ATOM   1071  C CG1 . VAL A 1 145 ? 31.057  86.097  13.444  1.00 106.57 ? 143 VAL A CG1 1 
ATOM   1072  C CG2 . VAL A 1 145 ? 32.256  86.169  15.654  1.00 103.64 ? 143 VAL A CG2 1 
ATOM   1073  N N   . GLU A 1 146 ? 35.267  85.444  12.044  1.00 108.17 ? 144 GLU A N   1 
ATOM   1074  C CA  . GLU A 1 146 ? 35.916  85.813  10.780  1.00 108.81 ? 144 GLU A CA  1 
ATOM   1075  C C   . GLU A 1 146 ? 36.164  84.519  10.013  1.00 106.58 ? 144 GLU A C   1 
ATOM   1076  O O   . GLU A 1 146 ? 36.566  84.521  8.840   1.00 103.85 ? 144 GLU A O   1 
ATOM   1077  C CB  . GLU A 1 146 ? 37.268  86.495  11.017  1.00 113.18 ? 144 GLU A CB  1 
ATOM   1078  C CG  . GLU A 1 146 ? 37.292  87.575  12.082  1.00 120.03 ? 144 GLU A CG  1 
ATOM   1079  C CD  . GLU A 1 146 ? 37.679  87.033  13.450  1.00 123.95 ? 144 GLU A CD  1 
ATOM   1080  O OE1 . GLU A 1 146 ? 38.763  86.410  13.561  1.00 124.85 ? 144 GLU A OE1 1 
ATOM   1081  O OE2 . GLU A 1 146 ? 36.901  87.233  14.414  1.00 125.84 ? 144 GLU A OE2 1 
ATOM   1082  N N   . ASP A 1 147 ? 35.934  83.419  10.720  1.00 104.16 ? 145 ASP A N   1 
ATOM   1083  C CA  . ASP A 1 147 ? 36.103  82.078  10.195  1.00 103.19 ? 145 ASP A CA  1 
ATOM   1084  C C   . ASP A 1 147 ? 34.751  81.640  9.643   1.00 104.47 ? 145 ASP A C   1 
ATOM   1085  O O   . ASP A 1 147 ? 34.679  81.050  8.565   1.00 106.87 ? 145 ASP A O   1 
ATOM   1086  C CB  . ASP A 1 147 ? 36.551  81.140  11.315  1.00 101.29 ? 145 ASP A CB  1 
ATOM   1087  C CG  . ASP A 1 147 ? 37.647  81.741  12.176  1.00 99.35  ? 145 ASP A CG  1 
ATOM   1088  O OD1 . ASP A 1 147 ? 38.670  82.178  11.616  1.00 98.46  ? 145 ASP A OD1 1 
ATOM   1089  O OD2 . ASP A 1 147 ? 37.480  81.775  13.413  1.00 96.26  ? 145 ASP A OD2 1 
ATOM   1090  N N   . GLY A 1 148 ? 33.684  81.945  10.383  1.00 105.14 ? 146 GLY A N   1 
ATOM   1091  C CA  . GLY A 1 148 ? 32.334  81.611  9.936   1.00 105.86 ? 146 GLY A CA  1 
ATOM   1092  C C   . GLY A 1 148 ? 31.919  82.510  8.773   1.00 104.76 ? 146 GLY A C   1 
ATOM   1093  O O   . GLY A 1 148 ? 30.845  82.382  8.152   1.00 107.01 ? 146 GLY A O   1 
ATOM   1094  N N   . ARG A 1 149 ? 32.796  83.458  8.490   1.00 101.90 ? 147 ARG A N   1 
ATOM   1095  C CA  . ARG A 1 149 ? 32.592  84.371  7.401   1.00 98.35  ? 147 ARG A CA  1 
ATOM   1096  C C   . ARG A 1 149 ? 33.306  83.757  6.200   1.00 94.83  ? 147 ARG A C   1 
ATOM   1097  O O   . ARG A 1 149 ? 32.700  83.631  5.148   1.00 95.65  ? 147 ARG A O   1 
ATOM   1098  C CB  . ARG A 1 149 ? 33.179  85.729  7.748   1.00 102.09 ? 147 ARG A CB  1 
ATOM   1099  C CG  . ARG A 1 149 ? 33.316  86.650  6.554   1.00 109.16 ? 147 ARG A CG  1 
ATOM   1100  C CD  . ARG A 1 149 ? 34.334  87.725  6.835   1.00 113.57 ? 147 ARG A CD  1 
ATOM   1101  N NE  . ARG A 1 149 ? 33.834  88.724  7.767   1.00 116.04 ? 147 ARG A NE  1 
ATOM   1102  C CZ  . ARG A 1 149 ? 34.561  89.738  8.217   1.00 117.15 ? 147 ARG A CZ  1 
ATOM   1103  N NH1 . ARG A 1 149 ? 35.832  89.885  7.831   1.00 115.60 ? 147 ARG A NH1 1 
ATOM   1104  N NH2 . ARG A 1 149 ? 33.999  90.624  9.025   1.00 117.51 ? 147 ARG A NH2 1 
ATOM   1105  N N   . LEU A 1 150 ? 34.574  83.357  6.350   1.00 89.94  ? 148 LEU A N   1 
ATOM   1106  C CA  . LEU A 1 150 ? 35.297  82.743  5.230   1.00 86.15  ? 148 LEU A CA  1 
ATOM   1107  C C   . LEU A 1 150 ? 34.505  81.505  4.805   1.00 85.44  ? 148 LEU A C   1 
ATOM   1108  O O   . LEU A 1 150 ? 34.302  81.276  3.602   1.00 85.80  ? 148 LEU A O   1 
ATOM   1109  C CB  . LEU A 1 150 ? 36.737  82.322  5.614   1.00 85.35  ? 148 LEU A CB  1 
ATOM   1110  C CG  . LEU A 1 150 ? 37.896  82.412  4.575   1.00 83.09  ? 148 LEU A CG  1 
ATOM   1111  C CD1 . LEU A 1 150 ? 39.082  81.563  5.042   1.00 74.58  ? 148 LEU A CD1 1 
ATOM   1112  C CD2 . LEU A 1 150 ? 37.462  81.943  3.196   1.00 82.14  ? 148 LEU A CD2 1 
ATOM   1113  N N   . MET A 1 151 ? 34.050  80.719  5.785   1.00 82.41  ? 149 MET A N   1 
ATOM   1114  C CA  . MET A 1 151 ? 33.279  79.516  5.494   1.00 79.21  ? 149 MET A CA  1 
ATOM   1115  C C   . MET A 1 151 ? 32.057  79.912  4.695   1.00 77.32  ? 149 MET A C   1 
ATOM   1116  O O   . MET A 1 151 ? 31.929  79.571  3.525   1.00 76.00  ? 149 MET A O   1 
ATOM   1117  C CB  . MET A 1 151 ? 32.816  78.851  6.775   1.00 81.68  ? 149 MET A CB  1 
ATOM   1118  C CG  . MET A 1 151 ? 31.968  77.602  6.548   1.00 85.35  ? 149 MET A CG  1 
ATOM   1119  S SD  . MET A 1 151 ? 32.937  76.094  6.293   1.00 93.35  ? 149 MET A SD  1 
ATOM   1120  C CE  . MET A 1 151 ? 33.931  76.531  4.819   1.00 86.16  ? 149 MET A CE  1 
ATOM   1121  N N   . GLU A 1 152 ? 31.168  80.652  5.346   1.00 74.20  ? 150 GLU A N   1 
ATOM   1122  C CA  . GLU A 1 152 ? 29.946  81.120  4.719   1.00 74.55  ? 150 GLU A CA  1 
ATOM   1123  C C   . GLU A 1 152 ? 30.212  81.720  3.347   1.00 76.17  ? 150 GLU A C   1 
ATOM   1124  O O   . GLU A 1 152 ? 29.362  81.669  2.480   1.00 78.54  ? 150 GLU A O   1 
ATOM   1125  C CB  . GLU A 1 152 ? 29.258  82.175  5.599   1.00 75.46  ? 150 GLU A CB  1 
ATOM   1126  C CG  . GLU A 1 152 ? 27.800  81.859  6.012   1.00 77.41  ? 150 GLU A CG  1 
ATOM   1127  C CD  . GLU A 1 152 ? 26.732  82.372  5.051   1.00 79.82  ? 150 GLU A CD  1 
ATOM   1128  O OE1 . GLU A 1 152 ? 27.037  82.536  3.849   1.00 82.63  ? 150 GLU A OE1 1 
ATOM   1129  O OE2 . GLU A 1 152 ? 25.576  82.593  5.502   1.00 79.27  ? 150 GLU A OE2 1 
ATOM   1130  N N   . GLN A 1 153 ? 31.387  82.288  3.124   1.00 79.45  ? 151 GLN A N   1 
ATOM   1131  C CA  . GLN A 1 153 ? 31.638  82.899  1.823   1.00 82.37  ? 151 GLN A CA  1 
ATOM   1132  C C   . GLN A 1 153 ? 32.309  81.937  0.888   1.00 79.32  ? 151 GLN A C   1 
ATOM   1133  O O   . GLN A 1 153 ? 32.054  81.952  -0.322  1.00 82.47  ? 151 GLN A O   1 
ATOM   1134  C CB  . GLN A 1 153 ? 32.492  84.174  1.952   1.00 89.37  ? 151 GLN A CB  1 
ATOM   1135  C CG  . GLN A 1 153 ? 32.544  85.036  0.666   1.00 100.74 ? 151 GLN A CG  1 
ATOM   1136  C CD  . GLN A 1 153 ? 33.442  86.286  0.786   1.00 106.53 ? 151 GLN A CD  1 
ATOM   1137  O OE1 . GLN A 1 153 ? 34.667  86.177  0.930   1.00 110.55 ? 151 GLN A OE1 1 
ATOM   1138  N NE2 . GLN A 1 153 ? 32.830  87.475  0.719   1.00 104.14 ? 151 GLN A NE2 1 
ATOM   1139  N N   . LEU A 1 154 ? 33.163  81.096  1.442   1.00 74.49  ? 152 LEU A N   1 
ATOM   1140  C CA  . LEU A 1 154 ? 33.865  80.130  0.631   1.00 74.61  ? 152 LEU A CA  1 
ATOM   1141  C C   . LEU A 1 154 ? 32.895  79.130  -0.026  1.00 76.75  ? 152 LEU A C   1 
ATOM   1142  O O   . LEU A 1 154 ? 33.130  78.634  -1.145  1.00 75.45  ? 152 LEU A O   1 
ATOM   1143  C CB  . LEU A 1 154 ? 34.860  79.412  1.516   1.00 74.07  ? 152 LEU A CB  1 
ATOM   1144  C CG  . LEU A 1 154 ? 35.662  78.290  0.883   1.00 75.32  ? 152 LEU A CG  1 
ATOM   1145  C CD1 . LEU A 1 154 ? 36.213  78.750  -0.459  1.00 77.40  ? 152 LEU A CD1 1 
ATOM   1146  C CD2 . LEU A 1 154 ? 36.779  77.867  1.846   1.00 76.15  ? 152 LEU A CD2 1 
ATOM   1147  N N   . LEU A 1 155 ? 31.789  78.855  0.656   1.00 78.19  ? 153 LEU A N   1 
ATOM   1148  C CA  . LEU A 1 155 ? 30.818  77.909  0.130   1.00 78.40  ? 153 LEU A CA  1 
ATOM   1149  C C   . LEU A 1 155 ? 29.737  78.502  -0.776  1.00 76.26  ? 153 LEU A C   1 
ATOM   1150  O O   . LEU A 1 155 ? 29.330  77.859  -1.746  1.00 74.40  ? 153 LEU A O   1 
ATOM   1151  C CB  . LEU A 1 155 ? 30.206  77.122  1.282   1.00 80.75  ? 153 LEU A CB  1 
ATOM   1152  C CG  . LEU A 1 155 ? 31.204  76.206  2.013   1.00 82.28  ? 153 LEU A CG  1 
ATOM   1153  C CD1 . LEU A 1 155 ? 30.660  75.784  3.377   1.00 86.23  ? 153 LEU A CD1 1 
ATOM   1154  C CD2 . LEU A 1 155 ? 31.496  74.986  1.139   1.00 83.32  ? 153 LEU A CD2 1 
ATOM   1155  N N   . SER A 1 156 ? 29.269  79.716  -0.481  1.00 74.01  ? 154 SER A N   1 
ATOM   1156  C CA  . SER A 1 156 ? 28.268  80.377  -1.341  1.00 74.82  ? 154 SER A CA  1 
ATOM   1157  C C   . SER A 1 156 ? 28.836  80.495  -2.746  1.00 74.13  ? 154 SER A C   1 
ATOM   1158  O O   . SER A 1 156 ? 28.141  80.798  -3.723  1.00 71.77  ? 154 SER A O   1 
ATOM   1159  C CB  . SER A 1 156 ? 27.979  81.765  -0.824  1.00 74.47  ? 154 SER A CB  1 
ATOM   1160  O OG  . SER A 1 156 ? 27.269  81.663  0.387   1.00 77.14  ? 154 SER A OG  1 
ATOM   1161  N N   . SER A 1 157 ? 30.136  80.270  -2.796  1.00 74.55  ? 155 SER A N   1 
ATOM   1162  C CA  . SER A 1 157 ? 30.901  80.285  -4.004  1.00 75.28  ? 155 SER A CA  1 
ATOM   1163  C C   . SER A 1 157 ? 30.368  79.144  -4.866  1.00 76.59  ? 155 SER A C   1 
ATOM   1164  O O   . SER A 1 157 ? 30.190  79.272  -6.097  1.00 75.48  ? 155 SER A O   1 
ATOM   1165  C CB  . SER A 1 157 ? 32.372  80.060  -3.624  1.00 72.81  ? 155 SER A CB  1 
ATOM   1166  O OG  . SER A 1 157 ? 33.137  79.494  -4.680  1.00 73.75  ? 155 SER A OG  1 
ATOM   1167  N N   . VAL A 1 158 ? 30.063  78.040  -4.193  1.00 77.54  ? 156 VAL A N   1 
ATOM   1168  C CA  . VAL A 1 158 ? 29.615  76.843  -4.880  1.00 77.07  ? 156 VAL A CA  1 
ATOM   1169  C C   . VAL A 1 158 ? 28.170  76.378  -4.594  1.00 75.25  ? 156 VAL A C   1 
ATOM   1170  O O   . VAL A 1 158 ? 27.781  75.259  -4.982  1.00 73.86  ? 156 VAL A O   1 
ATOM   1171  C CB  . VAL A 1 158 ? 30.657  75.713  -4.609  1.00 77.71  ? 156 VAL A CB  1 
ATOM   1172  C CG1 . VAL A 1 158 ? 30.250  74.432  -5.270  1.00 79.11  ? 156 VAL A CG1 1 
ATOM   1173  C CG2 . VAL A 1 158 ? 32.017  76.141  -5.152  1.00 77.97  ? 156 VAL A CG2 1 
ATOM   1174  N N   . GLY A 1 159 ? 27.366  77.221  -3.942  1.00 71.06  ? 157 GLY A N   1 
ATOM   1175  C CA  . GLY A 1 159 ? 26.003  76.805  -3.707  1.00 68.93  ? 157 GLY A CA  1 
ATOM   1176  C C   . GLY A 1 159 ? 25.112  77.652  -2.842  1.00 71.12  ? 157 GLY A C   1 
ATOM   1177  O O   . GLY A 1 159 ? 24.718  78.758  -3.161  1.00 74.97  ? 157 GLY A O   1 
ATOM   1178  N N   . PHE A 1 160 ? 24.769  77.077  -1.717  1.00 73.44  ? 158 PHE A N   1 
ATOM   1179  C CA  . PHE A 1 160 ? 23.917  77.718  -0.745  1.00 78.97  ? 158 PHE A CA  1 
ATOM   1180  C C   . PHE A 1 160 ? 24.504  77.409  0.643   1.00 81.23  ? 158 PHE A C   1 
ATOM   1181  O O   . PHE A 1 160 ? 24.908  76.262  0.893   1.00 83.44  ? 158 PHE A O   1 
ATOM   1182  C CB  . PHE A 1 160 ? 22.512  77.136  -0.872  1.00 77.04  ? 158 PHE A CB  1 
ATOM   1183  C CG  . PHE A 1 160 ? 21.652  77.360  0.344   1.00 78.13  ? 158 PHE A CG  1 
ATOM   1184  C CD1 . PHE A 1 160 ? 20.923  78.539  0.505   1.00 75.36  ? 158 PHE A CD1 1 
ATOM   1185  C CD2 . PHE A 1 160 ? 21.581  76.386  1.345   1.00 79.39  ? 158 PHE A CD2 1 
ATOM   1186  C CE1 . PHE A 1 160 ? 20.141  78.738  1.629   1.00 70.22  ? 158 PHE A CE1 1 
ATOM   1187  C CE2 . PHE A 1 160 ? 20.792  76.580  2.491   1.00 77.32  ? 158 PHE A CE2 1 
ATOM   1188  C CZ  . PHE A 1 160 ? 20.076  77.759  2.626   1.00 76.10  ? 158 PHE A CZ  1 
ATOM   1189  N N   . CYS A 1 161 ? 24.555  78.410  1.532   1.00 79.11  ? 159 CYS A N   1 
ATOM   1190  C CA  . CYS A 1 161 ? 25.101  78.221  2.892   1.00 77.89  ? 159 CYS A CA  1 
ATOM   1191  C C   . CYS A 1 161 ? 24.232  78.778  4.003   1.00 76.73  ? 159 CYS A C   1 
ATOM   1192  O O   . CYS A 1 161 ? 23.374  79.621  3.756   1.00 78.65  ? 159 CYS A O   1 
ATOM   1193  C CB  . CYS A 1 161 ? 26.444  78.927  3.044   1.00 79.67  ? 159 CYS A CB  1 
ATOM   1194  S SG  . CYS A 1 161 ? 27.935  78.000  2.752   1.00 82.91  ? 159 CYS A SG  1 
ATOM   1195  N N   . THR A 1 162 ? 24.489  78.308  5.225   1.00 75.83  ? 160 THR A N   1 
ATOM   1196  C CA  . THR A 1 162 ? 23.825  78.805  6.431   1.00 75.73  ? 160 THR A CA  1 
ATOM   1197  C C   . THR A 1 162 ? 24.329  78.159  7.711   1.00 77.47  ? 160 THR A C   1 
ATOM   1198  O O   . THR A 1 162 ? 24.805  77.019  7.739   1.00 75.42  ? 160 THR A O   1 
ATOM   1199  C CB  . THR A 1 162 ? 22.278  78.688  6.398   1.00 74.16  ? 160 THR A CB  1 
ATOM   1200  O OG1 . THR A 1 162 ? 21.760  79.551  5.386   1.00 74.33  ? 160 THR A OG1 1 
ATOM   1201  C CG2 . THR A 1 162 ? 21.658  79.146  7.747   1.00 74.09  ? 160 THR A CG2 1 
ATOM   1202  N N   . GLU A 1 163 ? 24.248  78.937  8.773   1.00 80.46  ? 161 GLU A N   1 
ATOM   1203  C CA  . GLU A 1 163 ? 24.662  78.478  10.067  1.00 84.85  ? 161 GLU A CA  1 
ATOM   1204  C C   . GLU A 1 163 ? 23.489  77.706  10.571  1.00 85.16  ? 161 GLU A C   1 
ATOM   1205  O O   . GLU A 1 163 ? 22.333  78.034  10.299  1.00 84.13  ? 161 GLU A O   1 
ATOM   1206  C CB  . GLU A 1 163 ? 24.924  79.645  11.005  1.00 89.18  ? 161 GLU A CB  1 
ATOM   1207  C CG  . GLU A 1 163 ? 26.148  80.434  10.683  1.00 97.46  ? 161 GLU A CG  1 
ATOM   1208  C CD  . GLU A 1 163 ? 26.352  81.532  11.683  1.00 105.13 ? 161 GLU A CD  1 
ATOM   1209  O OE1 . GLU A 1 163 ? 25.567  82.510  11.678  1.00 110.64 ? 161 GLU A OE1 1 
ATOM   1210  O OE2 . GLU A 1 163 ? 27.296  81.417  12.486  1.00 109.61 ? 161 GLU A OE2 1 
ATOM   1211  N N   . VAL A 1 164 ? 23.797  76.673  11.322  1.00 87.11  ? 162 VAL A N   1 
ATOM   1212  C CA  . VAL A 1 164 ? 22.771  75.843  11.877  1.00 88.39  ? 162 VAL A CA  1 
ATOM   1213  C C   . VAL A 1 164 ? 23.320  75.225  13.134  1.00 89.54  ? 162 VAL A C   1 
ATOM   1214  O O   . VAL A 1 164 ? 24.473  74.806  13.183  1.00 89.50  ? 162 VAL A O   1 
ATOM   1215  C CB  . VAL A 1 164 ? 22.409  74.720  10.924  1.00 89.53  ? 162 VAL A CB  1 
ATOM   1216  C CG1 . VAL A 1 164 ? 21.215  73.948  11.480  1.00 94.87  ? 162 VAL A CG1 1 
ATOM   1217  C CG2 . VAL A 1 164 ? 22.108  75.274  9.556   1.00 87.99  ? 162 VAL A CG2 1 
ATOM   1218  N N   . GLU A 1 165 ? 22.496  75.173  14.161  1.00 90.74  ? 163 GLU A N   1 
ATOM   1219  C CA  . GLU A 1 165 ? 22.945  74.566  15.383  1.00 94.77  ? 163 GLU A CA  1 
ATOM   1220  C C   . GLU A 1 165 ? 23.145  73.083  15.100  1.00 92.96  ? 163 GLU A C   1 
ATOM   1221  O O   . GLU A 1 165 ? 22.202  72.360  14.828  1.00 96.47  ? 163 GLU A O   1 
ATOM   1222  C CB  . GLU A 1 165 ? 21.915  74.789  16.467  1.00 100.05 ? 163 GLU A CB  1 
ATOM   1223  C CG  . GLU A 1 165 ? 22.384  75.789  17.486  1.00 112.23 ? 163 GLU A CG  1 
ATOM   1224  C CD  . GLU A 1 165 ? 21.243  76.317  18.298  1.00 121.85 ? 163 GLU A CD  1 
ATOM   1225  O OE1 . GLU A 1 165 ? 20.260  75.561  18.492  1.00 126.81 ? 163 GLU A OE1 1 
ATOM   1226  O OE2 . GLU A 1 165 ? 21.322  77.483  18.755  1.00 128.18 ? 163 GLU A OE2 1 
ATOM   1227  N N   . GLU A 1 166 ? 24.398  72.655  15.145  1.00 90.21  ? 164 GLU A N   1 
ATOM   1228  C CA  . GLU A 1 166 ? 24.808  71.272  14.895  1.00 87.65  ? 164 GLU A CA  1 
ATOM   1229  C C   . GLU A 1 166 ? 23.707  70.193  14.977  1.00 88.23  ? 164 GLU A C   1 
ATOM   1230  O O   . GLU A 1 166 ? 23.527  69.416  14.031  1.00 90.35  ? 164 GLU A O   1 
ATOM   1231  C CB  . GLU A 1 166 ? 25.964  70.905  15.838  1.00 86.11  ? 164 GLU A CB  1 
ATOM   1232  C CG  . GLU A 1 166 ? 26.866  69.806  15.356  1.00 83.30  ? 164 GLU A CG  1 
ATOM   1233  C CD  . GLU A 1 166 ? 27.883  69.379  16.399  1.00 86.43  ? 164 GLU A CD  1 
ATOM   1234  O OE1 . GLU A 1 166 ? 28.628  68.410  16.136  1.00 87.58  ? 164 GLU A OE1 1 
ATOM   1235  O OE2 . GLU A 1 166 ? 27.950  70.001  17.483  1.00 84.88  ? 164 GLU A OE2 1 
ATOM   1236  N N   . ASP A 1 167 ? 22.956  70.142  16.074  1.00 86.61  ? 165 ASP A N   1 
ATOM   1237  C CA  . ASP A 1 167 ? 21.899  69.123  16.220  1.00 85.85  ? 165 ASP A CA  1 
ATOM   1238  C C   . ASP A 1 167 ? 20.980  68.927  14.973  1.00 84.23  ? 165 ASP A C   1 
ATOM   1239  O O   . ASP A 1 167 ? 20.618  67.780  14.617  1.00 85.25  ? 165 ASP A O   1 
ATOM   1240  C CB  . ASP A 1 167 ? 21.037  69.443  17.451  1.00 83.02  ? 165 ASP A CB  1 
ATOM   1241  C CG  . ASP A 1 167 ? 20.215  70.704  17.280  1.00 79.99  ? 165 ASP A CG  1 
ATOM   1242  O OD1 . ASP A 1 167 ? 19.295  70.919  18.091  1.00 80.71  ? 165 ASP A OD1 1 
ATOM   1243  O OD2 . ASP A 1 167 ? 20.482  71.480  16.341  1.00 78.35  ? 165 ASP A OD2 1 
ATOM   1244  N N   . LEU A 1 168 ? 20.599  70.040  14.337  1.00 76.82  ? 166 LEU A N   1 
ATOM   1245  C CA  . LEU A 1 168 ? 19.753  70.015  13.157  1.00 67.97  ? 166 LEU A CA  1 
ATOM   1246  C C   . LEU A 1 168 ? 20.474  69.332  12.005  1.00 67.26  ? 166 LEU A C   1 
ATOM   1247  O O   . LEU A 1 168 ? 19.848  68.757  11.131  1.00 70.36  ? 166 LEU A O   1 
ATOM   1248  C CB  . LEU A 1 168 ? 19.405  71.433  12.734  1.00 61.15  ? 166 LEU A CB  1 
ATOM   1249  C CG  . LEU A 1 168 ? 18.427  72.289  13.541  1.00 57.28  ? 166 LEU A CG  1 
ATOM   1250  C CD1 . LEU A 1 168 ? 17.963  73.421  12.665  1.00 56.34  ? 166 LEU A CD1 1 
ATOM   1251  C CD2 . LEU A 1 168 ? 17.206  71.503  13.964  1.00 60.73  ? 166 LEU A CD2 1 
ATOM   1252  N N   . ILE A 1 169 ? 21.798  69.383  12.012  1.00 65.86  ? 167 ILE A N   1 
ATOM   1253  C CA  . ILE A 1 169 ? 22.579  68.788  10.937  1.00 65.14  ? 167 ILE A CA  1 
ATOM   1254  C C   . ILE A 1 169 ? 22.402  67.300  10.680  1.00 62.46  ? 167 ILE A C   1 
ATOM   1255  O O   . ILE A 1 169 ? 22.787  66.819  9.611   1.00 62.34  ? 167 ILE A O   1 
ATOM   1256  C CB  . ILE A 1 169 ? 24.089  69.067  11.113  1.00 66.05  ? 167 ILE A CB  1 
ATOM   1257  C CG1 . ILE A 1 169 ? 24.334  70.570  11.194  1.00 62.63  ? 167 ILE A CG1 1 
ATOM   1258  C CG2 . ILE A 1 169 ? 24.869  68.511  9.925   1.00 65.60  ? 167 ILE A CG2 1 
ATOM   1259  C CD1 . ILE A 1 169 ? 25.771  70.924  11.400  1.00 60.13  ? 167 ILE A CD1 1 
ATOM   1260  N N   . ASP A 1 170 ? 21.865  66.554  11.637  1.00 60.39  ? 168 ASP A N   1 
ATOM   1261  C CA  . ASP A 1 170 ? 21.645  65.138  11.359  1.00 63.72  ? 168 ASP A CA  1 
ATOM   1262  C C   . ASP A 1 170 ? 20.410  65.043  10.443  1.00 62.71  ? 168 ASP A C   1 
ATOM   1263  O O   . ASP A 1 170 ? 20.344  64.224  9.519   1.00 62.28  ? 168 ASP A O   1 
ATOM   1264  C CB  . ASP A 1 170 ? 21.400  64.327  12.644  1.00 70.34  ? 168 ASP A CB  1 
ATOM   1265  C CG  . ASP A 1 170 ? 22.686  64.054  13.429  1.00 74.72  ? 168 ASP A CG  1 
ATOM   1266  O OD1 . ASP A 1 170 ? 23.787  64.143  12.832  1.00 77.66  ? 168 ASP A OD1 1 
ATOM   1267  O OD2 . ASP A 1 170 ? 22.593  63.729  14.638  1.00 74.04  ? 168 ASP A OD2 1 
ATOM   1268  N N   . ALA A 1 171 ? 19.422  65.886  10.702  1.00 59.26  ? 169 ALA A N   1 
ATOM   1269  C CA  . ALA A 1 171 ? 18.226  65.883  9.875   1.00 53.76  ? 169 ALA A CA  1 
ATOM   1270  C C   . ALA A 1 171 ? 18.626  66.355  8.488   1.00 53.23  ? 169 ALA A C   1 
ATOM   1271  O O   . ALA A 1 171 ? 18.372  65.702  7.477   1.00 55.25  ? 169 ALA A O   1 
ATOM   1272  C CB  . ALA A 1 171 ? 17.210  66.824  10.447  1.00 52.16  ? 169 ALA A CB  1 
ATOM   1273  N N   . VAL A 1 172 ? 19.259  67.511  8.462   1.00 52.51  ? 170 VAL A N   1 
ATOM   1274  C CA  . VAL A 1 172 ? 19.688  68.133  7.234   1.00 54.29  ? 170 VAL A CA  1 
ATOM   1275  C C   . VAL A 1 172 ? 20.374  67.184  6.296   1.00 52.83  ? 170 VAL A C   1 
ATOM   1276  O O   . VAL A 1 172 ? 20.122  67.175  5.088   1.00 53.75  ? 170 VAL A O   1 
ATOM   1277  C CB  . VAL A 1 172 ? 20.648  69.257  7.533   1.00 57.30  ? 170 VAL A CB  1 
ATOM   1278  C CG1 . VAL A 1 172 ? 20.858  70.106  6.292   1.00 55.34  ? 170 VAL A CG1 1 
ATOM   1279  C CG2 . VAL A 1 172 ? 20.104  70.071  8.688   1.00 56.88  ? 170 VAL A CG2 1 
ATOM   1280  N N   . THR A 1 173 ? 21.274  66.390  6.843   1.00 51.44  ? 171 THR A N   1 
ATOM   1281  C CA  . THR A 1 173 ? 21.996  65.442  6.011   1.00 52.75  ? 171 THR A CA  1 
ATOM   1282  C C   . THR A 1 173 ? 20.995  64.505  5.311   1.00 49.49  ? 171 THR A C   1 
ATOM   1283  O O   . THR A 1 173 ? 21.209  64.031  4.200   1.00 46.90  ? 171 THR A O   1 
ATOM   1284  C CB  . THR A 1 173 ? 22.987  64.613  6.867   1.00 55.90  ? 171 THR A CB  1 
ATOM   1285  O OG1 . THR A 1 173 ? 22.477  64.479  8.204   1.00 63.11  ? 171 THR A OG1 1 
ATOM   1286  C CG2 . THR A 1 173 ? 24.354  65.265  6.906   1.00 52.57  ? 171 THR A CG2 1 
ATOM   1287  N N   . GLY A 1 174 ? 19.886  64.244  5.983   1.00 48.24  ? 172 GLY A N   1 
ATOM   1288  C CA  . GLY A 1 174 ? 18.880  63.388  5.405   1.00 45.55  ? 172 GLY A CA  1 
ATOM   1289  C C   . GLY A 1 174 ? 18.374  64.057  4.155   1.00 47.66  ? 172 GLY A C   1 
ATOM   1290  O O   . GLY A 1 174 ? 18.511  63.526  3.050   1.00 53.90  ? 172 GLY A O   1 
ATOM   1291  N N   . LEU A 1 175 ? 17.781  65.227  4.322   1.00 43.86  ? 173 LEU A N   1 
ATOM   1292  C CA  . LEU A 1 175 ? 17.275  65.970  3.192   1.00 38.80  ? 173 LEU A CA  1 
ATOM   1293  C C   . LEU A 1 175 ? 18.407  66.265  2.196   1.00 38.88  ? 173 LEU A C   1 
ATOM   1294  O O   . LEU A 1 175 ? 18.879  65.409  1.443   1.00 36.00  ? 173 LEU A O   1 
ATOM   1295  C CB  . LEU A 1 175 ? 16.717  67.281  3.707   1.00 42.93  ? 173 LEU A CB  1 
ATOM   1296  C CG  . LEU A 1 175 ? 15.460  67.862  3.071   1.00 47.47  ? 173 LEU A CG  1 
ATOM   1297  C CD1 . LEU A 1 175 ? 14.279  66.873  3.154   1.00 45.42  ? 173 LEU A CD1 1 
ATOM   1298  C CD2 . LEU A 1 175 ? 15.127  69.156  3.812   1.00 47.01  ? 173 LEU A CD2 1 
ATOM   1299  N N   . SER A 1 176 ? 18.860  67.507  2.231   1.00 42.31  ? 174 SER A N   1 
ATOM   1300  C CA  . SER A 1 176 ? 19.907  67.989  1.339   1.00 42.30  ? 174 SER A CA  1 
ATOM   1301  C C   . SER A 1 176 ? 21.151  67.127  1.123   1.00 43.03  ? 174 SER A C   1 
ATOM   1302  O O   . SER A 1 176 ? 21.786  67.225  0.074   1.00 44.63  ? 174 SER A O   1 
ATOM   1303  C CB  . SER A 1 176 ? 20.378  69.360  1.809   1.00 44.02  ? 174 SER A CB  1 
ATOM   1304  O OG  . SER A 1 176 ? 21.442  69.232  2.751   1.00 57.50  ? 174 SER A OG  1 
ATOM   1305  N N   . GLY A 1 177 ? 21.519  66.298  2.093   1.00 41.57  ? 175 GLY A N   1 
ATOM   1306  C CA  . GLY A 1 177 ? 22.737  65.529  1.928   1.00 43.14  ? 175 GLY A CA  1 
ATOM   1307  C C   . GLY A 1 177 ? 22.585  64.403  0.939   1.00 48.12  ? 175 GLY A C   1 
ATOM   1308  O O   . GLY A 1 177 ? 23.407  64.236  0.012   1.00 47.66  ? 175 GLY A O   1 
ATOM   1309  N N   . SER A 1 178 ? 21.514  63.634  1.137   1.00 48.89  ? 176 SER A N   1 
ATOM   1310  C CA  . SER A 1 178 ? 21.198  62.474  0.299   1.00 51.44  ? 176 SER A CA  1 
ATOM   1311  C C   . SER A 1 178 ? 20.347  62.832  -0.902  1.00 50.89  ? 176 SER A C   1 
ATOM   1312  O O   . SER A 1 178 ? 20.512  62.249  -1.975  1.00 49.84  ? 176 SER A O   1 
ATOM   1313  C CB  . SER A 1 178 ? 20.454  61.441  1.121   1.00 50.59  ? 176 SER A CB  1 
ATOM   1314  O OG  . SER A 1 178 ? 21.284  60.898  2.133   1.00 61.06  ? 176 SER A OG  1 
ATOM   1315  N N   . GLY A 1 179 ? 19.434  63.782  -0.684  1.00 47.69  ? 177 GLY A N   1 
ATOM   1316  C CA  . GLY A 1 179 ? 18.548  64.259  -1.726  1.00 47.14  ? 177 GLY A CA  1 
ATOM   1317  C C   . GLY A 1 179 ? 19.133  64.179  -3.123  1.00 49.19  ? 177 GLY A C   1 
ATOM   1318  O O   . GLY A 1 179 ? 18.477  63.709  -4.050  1.00 47.70  ? 177 GLY A O   1 
ATOM   1319  N N   . PRO A 1 180 ? 20.362  64.652  -3.321  1.00 52.65  ? 178 PRO A N   1 
ATOM   1320  C CA  . PRO A 1 180 ? 20.852  64.532  -4.685  1.00 54.96  ? 178 PRO A CA  1 
ATOM   1321  C C   . PRO A 1 180 ? 20.582  63.112  -5.200  1.00 56.74  ? 178 PRO A C   1 
ATOM   1322  O O   . PRO A 1 180 ? 20.152  62.928  -6.340  1.00 61.13  ? 178 PRO A O   1 
ATOM   1323  C CB  . PRO A 1 180 ? 22.341  64.870  -4.540  1.00 53.32  ? 178 PRO A CB  1 
ATOM   1324  C CG  . PRO A 1 180 ? 22.306  65.930  -3.495  1.00 56.60  ? 178 PRO A CG  1 
ATOM   1325  C CD  . PRO A 1 180 ? 21.312  65.393  -2.476  1.00 55.43  ? 178 PRO A CD  1 
ATOM   1326  N N   . ALA A 1 181 ? 20.800  62.107  -4.356  1.00 56.13  ? 179 ALA A N   1 
ATOM   1327  C CA  . ALA A 1 181 ? 20.588  60.714  -4.766  1.00 52.47  ? 179 ALA A CA  1 
ATOM   1328  C C   . ALA A 1 181 ? 19.097  60.281  -4.924  1.00 52.14  ? 179 ALA A C   1 
ATOM   1329  O O   . ALA A 1 181 ? 18.763  59.376  -5.690  1.00 51.66  ? 179 ALA A O   1 
ATOM   1330  C CB  . ALA A 1 181 ? 21.312  59.795  -3.801  1.00 45.29  ? 179 ALA A CB  1 
ATOM   1331  N N   . TYR A 1 182 ? 18.189  60.924  -4.203  1.00 53.24  ? 180 TYR A N   1 
ATOM   1332  C CA  . TYR A 1 182 ? 16.773  60.585  -4.307  1.00 49.02  ? 180 TYR A CA  1 
ATOM   1333  C C   . TYR A 1 182 ? 16.395  61.054  -5.679  1.00 47.54  ? 180 TYR A C   1 
ATOM   1334  O O   . TYR A 1 182 ? 15.600  60.447  -6.373  1.00 53.54  ? 180 TYR A O   1 
ATOM   1335  C CB  . TYR A 1 182 ? 15.959  61.347  -3.261  1.00 49.17  ? 180 TYR A CB  1 
ATOM   1336  C CG  . TYR A 1 182 ? 16.407  61.129  -1.808  1.00 53.33  ? 180 TYR A CG  1 
ATOM   1337  C CD1 . TYR A 1 182 ? 15.730  61.738  -0.741  1.00 53.61  ? 180 TYR A CD1 1 
ATOM   1338  C CD2 . TYR A 1 182 ? 17.483  60.294  -1.502  1.00 49.74  ? 180 TYR A CD2 1 
ATOM   1339  C CE1 . TYR A 1 182 ? 16.108  61.521  0.558   1.00 53.14  ? 180 TYR A CE1 1 
ATOM   1340  C CE2 . TYR A 1 182 ? 17.865  60.073  -0.208  1.00 54.37  ? 180 TYR A CE2 1 
ATOM   1341  C CZ  . TYR A 1 182 ? 17.177  60.688  0.823   1.00 56.85  ? 180 TYR A CZ  1 
ATOM   1342  O OH  . TYR A 1 182 ? 17.565  60.466  2.122   1.00 60.26  ? 180 TYR A OH  1 
ATOM   1343  N N   . ALA A 1 183 ? 17.004  62.154  -6.062  1.00 45.14  ? 181 ALA A N   1 
ATOM   1344  C CA  . ALA A 1 183 ? 16.771  62.766  -7.338  1.00 45.32  ? 181 ALA A CA  1 
ATOM   1345  C C   . ALA A 1 183 ? 17.177  61.848  -8.490  1.00 47.95  ? 181 ALA A C   1 
ATOM   1346  O O   . ALA A 1 183 ? 16.370  61.557  -9.381  1.00 46.32  ? 181 ALA A O   1 
ATOM   1347  C CB  . ALA A 1 183 ? 17.542  64.068  -7.389  1.00 45.14  ? 181 ALA A CB  1 
ATOM   1348  N N   . PHE A 1 184 ? 18.424  61.385  -8.459  1.00 50.59  ? 182 PHE A N   1 
ATOM   1349  C CA  . PHE A 1 184 ? 18.937  60.526  -9.505  1.00 54.06  ? 182 PHE A CA  1 
ATOM   1350  C C   . PHE A 1 184 ? 18.057  59.318  -9.685  1.00 59.45  ? 182 PHE A C   1 
ATOM   1351  O O   . PHE A 1 184 ? 17.897  58.819  -10.808 1.00 64.99  ? 182 PHE A O   1 
ATOM   1352  C CB  . PHE A 1 184 ? 20.354  60.064  -9.197  1.00 58.46  ? 182 PHE A CB  1 
ATOM   1353  C CG  . PHE A 1 184 ? 21.358  61.187  -9.072  1.00 68.87  ? 182 PHE A CG  1 
ATOM   1354  C CD1 . PHE A 1 184 ? 22.660  60.919  -8.679  1.00 74.88  ? 182 PHE A CD1 1 
ATOM   1355  C CD2 . PHE A 1 184 ? 21.002  62.513  -9.315  1.00 70.22  ? 182 PHE A CD2 1 
ATOM   1356  C CE1 . PHE A 1 184 ? 23.590  61.963  -8.525  1.00 73.50  ? 182 PHE A CE1 1 
ATOM   1357  C CE2 . PHE A 1 184 ? 21.928  63.561  -9.168  1.00 67.44  ? 182 PHE A CE2 1 
ATOM   1358  C CZ  . PHE A 1 184 ? 23.213  63.283  -8.775  1.00 70.17  ? 182 PHE A CZ  1 
ATOM   1359  N N   . THR A 1 185 ? 17.479  58.821  -8.597  1.00 60.81  ? 183 THR A N   1 
ATOM   1360  C CA  . THR A 1 185 ? 16.609  57.651  -8.746  1.00 59.46  ? 183 THR A CA  1 
ATOM   1361  C C   . THR A 1 185 ? 15.352  58.124  -9.441  1.00 55.62  ? 183 THR A C   1 
ATOM   1362  O O   . THR A 1 185 ? 14.887  57.497  -10.378 1.00 59.54  ? 183 THR A O   1 
ATOM   1363  C CB  . THR A 1 185 ? 16.223  56.995  -7.387  1.00 61.40  ? 183 THR A CB  1 
ATOM   1364  O OG1 . THR A 1 185 ? 17.387  56.406  -6.792  1.00 60.01  ? 183 THR A OG1 1 
ATOM   1365  C CG2 . THR A 1 185 ? 15.149  55.903  -7.595  1.00 63.30  ? 183 THR A CG2 1 
ATOM   1366  N N   . ALA A 1 186 ? 14.827  59.251  -8.981  1.00 50.12  ? 184 ALA A N   1 
ATOM   1367  C CA  . ALA A 1 186 ? 13.626  59.832  -9.545  1.00 45.71  ? 184 ALA A CA  1 
ATOM   1368  C C   . ALA A 1 186 ? 13.723  59.800  -11.044 1.00 45.02  ? 184 ALA A C   1 
ATOM   1369  O O   . ALA A 1 186 ? 12.935  59.129  -11.724 1.00 43.69  ? 184 ALA A O   1 
ATOM   1370  C CB  . ALA A 1 186 ? 13.483  61.239  -9.084  1.00 41.11  ? 184 ALA A CB  1 
ATOM   1371  N N   . LEU A 1 187 ? 14.726  60.507  -11.542 1.00 44.18  ? 185 LEU A N   1 
ATOM   1372  C CA  . LEU A 1 187 ? 14.968  60.627  -12.976 1.00 50.20  ? 185 LEU A CA  1 
ATOM   1373  C C   . LEU A 1 187 ? 15.202  59.338  -13.758 1.00 54.01  ? 185 LEU A C   1 
ATOM   1374  O O   . LEU A 1 187 ? 14.537  59.100  -14.770 1.00 59.60  ? 185 LEU A O   1 
ATOM   1375  C CB  . LEU A 1 187 ? 16.133  61.593  -13.235 1.00 42.17  ? 185 LEU A CB  1 
ATOM   1376  C CG  . LEU A 1 187 ? 15.974  62.926  -12.481 1.00 40.32  ? 185 LEU A CG  1 
ATOM   1377  C CD1 . LEU A 1 187 ? 16.694  64.044  -13.206 1.00 39.68  ? 185 LEU A CD1 1 
ATOM   1378  C CD2 . LEU A 1 187 ? 14.485  63.299  -12.349 1.00 39.69  ? 185 LEU A CD2 1 
ATOM   1379  N N   . ASP A 1 188 ? 16.159  58.521  -13.326 1.00 54.38  ? 186 ASP A N   1 
ATOM   1380  C CA  . ASP A 1 188 ? 16.406  57.282  -14.025 1.00 52.59  ? 186 ASP A CA  1 
ATOM   1381  C C   . ASP A 1 188 ? 15.030  56.647  -14.274 1.00 52.29  ? 186 ASP A C   1 
ATOM   1382  O O   . ASP A 1 188 ? 14.745  56.102  -15.344 1.00 50.01  ? 186 ASP A O   1 
ATOM   1383  C CB  . ASP A 1 188 ? 17.229  56.351  -13.165 1.00 55.28  ? 186 ASP A CB  1 
ATOM   1384  C CG  . ASP A 1 188 ? 17.444  55.020  -13.842 1.00 64.81  ? 186 ASP A CG  1 
ATOM   1385  O OD1 . ASP A 1 188 ? 18.239  54.979  -14.808 1.00 68.05  ? 186 ASP A OD1 1 
ATOM   1386  O OD2 . ASP A 1 188 ? 16.794  54.014  -13.459 1.00 70.38  ? 186 ASP A OD2 1 
ATOM   1387  N N   . ALA A 1 189 ? 14.181  56.717  -13.255 1.00 50.75  ? 187 ALA A N   1 
ATOM   1388  C CA  . ALA A 1 189 ? 12.830  56.187  -13.346 1.00 49.03  ? 187 ALA A CA  1 
ATOM   1389  C C   . ALA A 1 189 ? 12.121  56.913  -14.480 1.00 46.86  ? 187 ALA A C   1 
ATOM   1390  O O   . ALA A 1 189 ? 11.861  56.322  -15.525 1.00 48.72  ? 187 ALA A O   1 
ATOM   1391  C CB  . ALA A 1 189 ? 12.087  56.398  -12.003 1.00 49.66  ? 187 ALA A CB  1 
ATOM   1392  N N   . LEU A 1 190 ? 11.838  58.199  -14.280 1.00 44.32  ? 188 LEU A N   1 
ATOM   1393  C CA  . LEU A 1 190 ? 11.171  59.034  -15.295 1.00 45.14  ? 188 LEU A CA  1 
ATOM   1394  C C   . LEU A 1 190 ? 11.683  58.782  -16.691 1.00 47.73  ? 188 LEU A C   1 
ATOM   1395  O O   . LEU A 1 190 ? 10.892  58.673  -17.618 1.00 52.61  ? 188 LEU A O   1 
ATOM   1396  C CB  . LEU A 1 190 ? 11.347  60.509  -14.967 1.00 40.97  ? 188 LEU A CB  1 
ATOM   1397  C CG  . LEU A 1 190 ? 10.775  60.813  -13.591 1.00 42.30  ? 188 LEU A CG  1 
ATOM   1398  C CD1 . LEU A 1 190 ? 11.475  62.014  -13.030 1.00 40.12  ? 188 LEU A CD1 1 
ATOM   1399  C CD2 . LEU A 1 190 ? 9.255   60.978  -13.684 1.00 40.95  ? 188 LEU A CD2 1 
ATOM   1400  N N   . ALA A 1 191 ? 12.999  58.698  -16.839 1.00 45.00  ? 189 ALA A N   1 
ATOM   1401  C CA  . ALA A 1 191 ? 13.568  58.434  -18.133 1.00 46.30  ? 189 ALA A CA  1 
ATOM   1402  C C   . ALA A 1 191 ? 12.936  57.172  -18.678 1.00 47.61  ? 189 ALA A C   1 
ATOM   1403  O O   . ALA A 1 191 ? 12.498  57.124  -19.829 1.00 47.67  ? 189 ALA A O   1 
ATOM   1404  C CB  . ALA A 1 191 ? 15.075  58.254  -18.037 1.00 47.71  ? 189 ALA A CB  1 
ATOM   1405  N N   . ASP A 1 192 ? 12.874  56.146  -17.840 1.00 47.80  ? 190 ASP A N   1 
ATOM   1406  C CA  . ASP A 1 192 ? 12.325  54.855  -18.257 1.00 48.64  ? 190 ASP A CA  1 
ATOM   1407  C C   . ASP A 1 192 ? 10.866  55.000  -18.613 1.00 42.90  ? 190 ASP A C   1 
ATOM   1408  O O   . ASP A 1 192 ? 10.438  54.557  -19.654 1.00 36.73  ? 190 ASP A O   1 
ATOM   1409  C CB  . ASP A 1 192 ? 12.508  53.825  -17.137 1.00 52.65  ? 190 ASP A CB  1 
ATOM   1410  C CG  . ASP A 1 192 ? 13.960  53.334  -17.021 1.00 63.19  ? 190 ASP A CG  1 
ATOM   1411  O OD1 . ASP A 1 192 ? 14.822  53.737  -17.842 1.00 65.42  ? 190 ASP A OD1 1 
ATOM   1412  O OD2 . ASP A 1 192 ? 14.243  52.524  -16.103 1.00 68.54  ? 190 ASP A OD2 1 
ATOM   1413  N N   . GLY A 1 193 ? 10.113  55.614  -17.718 1.00 42.13  ? 191 GLY A N   1 
ATOM   1414  C CA  . GLY A 1 193 ? 8.702   55.833  -17.968 1.00 45.32  ? 191 GLY A CA  1 
ATOM   1415  C C   . GLY A 1 193 ? 8.520   56.755  -19.150 1.00 44.17  ? 191 GLY A C   1 
ATOM   1416  O O   . GLY A 1 193 ? 7.534   56.716  -19.866 1.00 38.48  ? 191 GLY A O   1 
ATOM   1417  N N   . GLY A 1 194 ? 9.508   57.612  -19.342 1.00 42.90  ? 192 GLY A N   1 
ATOM   1418  C CA  . GLY A 1 194 ? 9.449   58.517  -20.451 1.00 35.85  ? 192 GLY A CA  1 
ATOM   1419  C C   . GLY A 1 194 ? 9.525   57.575  -21.619 1.00 31.70  ? 192 GLY A C   1 
ATOM   1420  O O   . GLY A 1 194 ? 8.619   57.524  -22.397 1.00 41.41  ? 192 GLY A O   1 
ATOM   1421  N N   . VAL A 1 195 ? 10.609  56.824  -21.720 1.00 29.90  ? 193 VAL A N   1 
ATOM   1422  C CA  . VAL A 1 195 ? 10.829  55.866  -22.783 1.00 22.68  ? 193 VAL A CA  1 
ATOM   1423  C C   . VAL A 1 195 ? 9.694   54.883  -22.900 1.00 27.17  ? 193 VAL A C   1 
ATOM   1424  O O   . VAL A 1 195 ? 9.386   54.440  -23.981 1.00 30.26  ? 193 VAL A O   1 
ATOM   1425  C CB  . VAL A 1 195 ? 12.019  55.024  -22.506 1.00 24.57  ? 193 VAL A CB  1 
ATOM   1426  C CG1 . VAL A 1 195 ? 12.192  54.031  -23.593 1.00 23.63  ? 193 VAL A CG1 1 
ATOM   1427  C CG2 . VAL A 1 195 ? 13.250  55.880  -22.334 1.00 32.90  ? 193 VAL A CG2 1 
ATOM   1428  N N   . LYS A 1 196 ? 9.029   54.533  -21.808 1.00 34.25  ? 194 LYS A N   1 
ATOM   1429  C CA  . LYS A 1 196 ? 7.944   53.557  -21.953 1.00 40.04  ? 194 LYS A CA  1 
ATOM   1430  C C   . LYS A 1 196 ? 6.728   54.207  -22.594 1.00 43.85  ? 194 LYS A C   1 
ATOM   1431  O O   . LYS A 1 196 ? 5.621   53.688  -22.490 1.00 48.06  ? 194 LYS A O   1 
ATOM   1432  C CB  . LYS A 1 196 ? 7.535   52.920  -20.599 1.00 37.54  ? 194 LYS A CB  1 
ATOM   1433  C CG  . LYS A 1 196 ? 7.171   51.382  -20.713 1.00 32.60  ? 194 LYS A CG  1 
ATOM   1434  C CD  . LYS A 1 196 ? 5.660   51.026  -20.529 1.00 18.19  ? 194 LYS A CD  1 
ATOM   1435  C CE  . LYS A 1 196 ? 5.194   51.000  -19.102 1.00 7.25   ? 194 LYS A CE  1 
ATOM   1436  N NZ  . LYS A 1 196 ? 3.775   50.481  -18.805 1.00 9.55   ? 194 LYS A NZ  1 
ATOM   1437  N N   . MET A 1 197 ? 6.953   55.313  -23.295 1.00 45.21  ? 195 MET A N   1 
ATOM   1438  C CA  . MET A 1 197 ? 5.880   56.034  -23.955 1.00 45.19  ? 195 MET A CA  1 
ATOM   1439  C C   . MET A 1 197 ? 6.235   56.339  -25.394 1.00 49.14  ? 195 MET A C   1 
ATOM   1440  O O   . MET A 1 197 ? 5.380   56.769  -26.181 1.00 56.23  ? 195 MET A O   1 
ATOM   1441  C CB  . MET A 1 197 ? 5.556   57.325  -23.214 1.00 37.79  ? 195 MET A CB  1 
ATOM   1442  C CG  . MET A 1 197 ? 4.902   57.051  -21.895 1.00 35.23  ? 195 MET A CG  1 
ATOM   1443  S SD  . MET A 1 197 ? 3.897   55.534  -21.850 1.00 37.83  ? 195 MET A SD  1 
ATOM   1444  C CE  . MET A 1 197 ? 2.399   56.147  -21.333 1.00 31.88  ? 195 MET A CE  1 
ATOM   1445  N N   . GLY A 1 198 ? 7.491   56.100  -25.741 1.00 48.38  ? 196 GLY A N   1 
ATOM   1446  C CA  . GLY A 1 198 ? 7.905   56.331  -27.098 1.00 53.93  ? 196 GLY A CA  1 
ATOM   1447  C C   . GLY A 1 198 ? 9.197   57.074  -27.054 1.00 58.82  ? 196 GLY A C   1 
ATOM   1448  O O   . GLY A 1 198 ? 10.157  56.715  -27.718 1.00 64.77  ? 196 GLY A O   1 
ATOM   1449  N N   . LEU A 1 199 ? 9.232   58.109  -26.232 1.00 58.35  ? 197 LEU A N   1 
ATOM   1450  C CA  . LEU A 1 199 ? 10.431  58.933  -26.108 1.00 56.12  ? 197 LEU A CA  1 
ATOM   1451  C C   . LEU A 1 199 ? 11.713  58.133  -26.058 1.00 55.48  ? 197 LEU A C   1 
ATOM   1452  O O   . LEU A 1 199 ? 11.742  57.016  -25.535 1.00 56.03  ? 197 LEU A O   1 
ATOM   1453  C CB  . LEU A 1 199 ? 10.334  59.777  -24.850 1.00 59.62  ? 197 LEU A CB  1 
ATOM   1454  C CG  . LEU A 1 199 ? 9.181   60.770  -24.845 1.00 61.52  ? 197 LEU A CG  1 
ATOM   1455  C CD1 . LEU A 1 199 ? 8.968   61.281  -23.431 1.00 71.48  ? 197 LEU A CD1 1 
ATOM   1456  C CD2 . LEU A 1 199 ? 9.508   61.887  -25.800 1.00 61.59  ? 197 LEU A CD2 1 
ATOM   1457  N N   . PRO A 1 200 ? 12.785  58.678  -26.640 1.00 55.39  ? 198 PRO A N   1 
ATOM   1458  C CA  . PRO A 1 200 ? 14.072  57.984  -26.622 1.00 59.68  ? 198 PRO A CA  1 
ATOM   1459  C C   . PRO A 1 200 ? 14.765  58.187  -25.254 1.00 62.42  ? 198 PRO A C   1 
ATOM   1460  O O   . PRO A 1 200 ? 14.326  58.990  -24.422 1.00 58.98  ? 198 PRO A O   1 
ATOM   1461  C CB  . PRO A 1 200 ? 14.843  58.637  -27.781 1.00 58.76  ? 198 PRO A CB  1 
ATOM   1462  C CG  . PRO A 1 200 ? 14.289  60.002  -27.826 1.00 56.05  ? 198 PRO A CG  1 
ATOM   1463  C CD  . PRO A 1 200 ? 12.800  59.742  -27.655 1.00 57.09  ? 198 PRO A CD  1 
ATOM   1464  N N   . ARG A 1 201 ? 15.846  57.456  -25.028 1.00 64.76  ? 199 ARG A N   1 
ATOM   1465  C CA  . ARG A 1 201 ? 16.522  57.553  -23.769 1.00 65.16  ? 199 ARG A CA  1 
ATOM   1466  C C   . ARG A 1 201 ? 17.055  58.963  -23.549 1.00 67.09  ? 199 ARG A C   1 
ATOM   1467  O O   . ARG A 1 201 ? 16.517  59.690  -22.709 1.00 64.41  ? 199 ARG A O   1 
ATOM   1468  C CB  . ARG A 1 201 ? 17.627  56.511  -23.728 1.00 69.42  ? 199 ARG A CB  1 
ATOM   1469  C CG  . ARG A 1 201 ? 18.107  56.155  -22.330 1.00 70.80  ? 199 ARG A CG  1 
ATOM   1470  C CD  . ARG A 1 201 ? 16.960  55.858  -21.393 1.00 72.57  ? 199 ARG A CD  1 
ATOM   1471  N NE  . ARG A 1 201 ? 17.442  55.644  -20.023 1.00 76.92  ? 199 ARG A NE  1 
ATOM   1472  C CZ  . ARG A 1 201 ? 16.640  55.467  -18.980 1.00 78.71  ? 199 ARG A CZ  1 
ATOM   1473  N NH1 . ARG A 1 201 ? 15.326  55.491  -19.172 1.00 77.99  ? 199 ARG A NH1 1 
ATOM   1474  N NH2 . ARG A 1 201 ? 17.140  55.241  -17.767 1.00 76.88  ? 199 ARG A NH2 1 
ATOM   1475  N N   . ARG A 1 202 ? 18.087  59.359  -24.297 1.00 68.71  ? 200 ARG A N   1 
ATOM   1476  C CA  . ARG A 1 202 ? 18.679  60.689  -24.138 1.00 73.12  ? 200 ARG A CA  1 
ATOM   1477  C C   . ARG A 1 202 ? 17.621  61.746  -23.886 1.00 71.79  ? 200 ARG A C   1 
ATOM   1478  O O   . ARG A 1 202 ? 17.684  62.504  -22.900 1.00 69.66  ? 200 ARG A O   1 
ATOM   1479  C CB  . ARG A 1 202 ? 19.466  61.070  -25.385 1.00 82.71  ? 200 ARG A CB  1 
ATOM   1480  C CG  . ARG A 1 202 ? 20.445  59.994  -25.806 1.00 101.86 ? 200 ARG A CG  1 
ATOM   1481  C CD  . ARG A 1 202 ? 21.280  60.372  -27.044 1.00 116.71 ? 200 ARG A CD  1 
ATOM   1482  N NE  . ARG A 1 202 ? 22.191  59.274  -27.417 1.00 130.30 ? 200 ARG A NE  1 
ATOM   1483  C CZ  . ARG A 1 202 ? 23.127  59.322  -28.373 1.00 135.69 ? 200 ARG A CZ  1 
ATOM   1484  N NH1 . ARG A 1 202 ? 23.313  60.423  -29.101 1.00 138.94 ? 200 ARG A NH1 1 
ATOM   1485  N NH2 . ARG A 1 202 ? 23.892  58.256  -28.590 1.00 138.20 ? 200 ARG A NH2 1 
ATOM   1486  N N   . LEU A 1 203 ? 16.640  61.769  -24.784 1.00 70.63  ? 201 LEU A N   1 
ATOM   1487  C CA  . LEU A 1 203 ? 15.555  62.724  -24.723 1.00 68.02  ? 201 LEU A CA  1 
ATOM   1488  C C   . LEU A 1 203 ? 14.803  62.716  -23.393 1.00 66.62  ? 201 LEU A C   1 
ATOM   1489  O O   . LEU A 1 203 ? 14.830  63.725  -22.684 1.00 66.38  ? 201 LEU A O   1 
ATOM   1490  C CB  . LEU A 1 203 ? 14.579  62.489  -25.877 1.00 70.58  ? 201 LEU A CB  1 
ATOM   1491  C CG  . LEU A 1 203 ? 13.488  63.571  -26.042 1.00 74.72  ? 201 LEU A CG  1 
ATOM   1492  C CD1 . LEU A 1 203 ? 14.139  64.834  -26.598 1.00 74.12  ? 201 LEU A CD1 1 
ATOM   1493  C CD2 . LEU A 1 203 ? 12.352  63.104  -26.967 1.00 71.42  ? 201 LEU A CD2 1 
ATOM   1494  N N   . ALA A 1 204 ? 14.155  61.592  -23.050 1.00 64.85  ? 202 ALA A N   1 
ATOM   1495  C CA  . ALA A 1 204 ? 13.368  61.447  -21.801 1.00 61.99  ? 202 ALA A CA  1 
ATOM   1496  C C   . ALA A 1 204 ? 14.122  61.951  -20.580 1.00 61.84  ? 202 ALA A C   1 
ATOM   1497  O O   . ALA A 1 204 ? 13.618  62.742  -19.764 1.00 52.53  ? 202 ALA A O   1 
ATOM   1498  C CB  . ALA A 1 204 ? 12.994  59.996  -21.594 1.00 57.79  ? 202 ALA A CB  1 
ATOM   1499  N N   . VAL A 1 205 ? 15.347  61.450  -20.472 1.00 67.89  ? 203 VAL A N   1 
ATOM   1500  C CA  . VAL A 1 205 ? 16.281  61.801  -19.410 1.00 72.10  ? 203 VAL A CA  1 
ATOM   1501  C C   . VAL A 1 205 ? 16.418  63.316  -19.252 1.00 69.34  ? 203 VAL A C   1 
ATOM   1502  O O   . VAL A 1 205 ? 16.093  63.864  -18.191 1.00 66.99  ? 203 VAL A O   1 
ATOM   1503  C CB  . VAL A 1 205 ? 17.694  61.207  -19.707 1.00 75.51  ? 203 VAL A CB  1 
ATOM   1504  C CG1 . VAL A 1 205 ? 18.637  61.516  -18.555 1.00 74.50  ? 203 VAL A CG1 1 
ATOM   1505  C CG2 . VAL A 1 205 ? 17.602  59.699  -19.925 1.00 76.53  ? 203 VAL A CG2 1 
ATOM   1506  N N   . ARG A 1 206 ? 16.906  63.974  -20.302 1.00 68.60  ? 204 ARG A N   1 
ATOM   1507  C CA  . ARG A 1 206 ? 17.076  65.421  -20.274 1.00 71.25  ? 204 ARG A CA  1 
ATOM   1508  C C   . ARG A 1 206 ? 15.797  66.222  -19.990 1.00 65.63  ? 204 ARG A C   1 
ATOM   1509  O O   . ARG A 1 206 ? 15.838  67.173  -19.224 1.00 63.11  ? 204 ARG A O   1 
ATOM   1510  C CB  . ARG A 1 206 ? 17.735  65.891  -21.567 1.00 78.91  ? 204 ARG A CB  1 
ATOM   1511  C CG  . ARG A 1 206 ? 19.099  65.242  -21.763 1.00 90.72  ? 204 ARG A CG  1 
ATOM   1512  C CD  . ARG A 1 206 ? 20.005  66.087  -22.647 1.00 100.99 ? 204 ARG A CD  1 
ATOM   1513  N NE  . ARG A 1 206 ? 21.219  65.347  -23.004 1.00 110.43 ? 204 ARG A NE  1 
ATOM   1514  C CZ  . ARG A 1 206 ? 22.135  65.776  -23.870 1.00 114.43 ? 204 ARG A CZ  1 
ATOM   1515  N NH1 . ARG A 1 206 ? 21.968  66.954  -24.463 1.00 116.41 ? 204 ARG A NH1 1 
ATOM   1516  N NH2 . ARG A 1 206 ? 23.204  65.028  -24.155 1.00 115.33 ? 204 ARG A NH2 1 
ATOM   1517  N N   . LEU A 1 207 ? 14.662  65.853  -20.572 1.00 59.77  ? 205 LEU A N   1 
ATOM   1518  C CA  . LEU A 1 207 ? 13.439  66.598  -20.282 1.00 56.58  ? 205 LEU A CA  1 
ATOM   1519  C C   . LEU A 1 207 ? 13.003  66.337  -18.826 1.00 55.91  ? 205 LEU A C   1 
ATOM   1520  O O   . LEU A 1 207 ? 12.486  67.240  -18.148 1.00 55.26  ? 205 LEU A O   1 
ATOM   1521  C CB  . LEU A 1 207 ? 12.314  66.157  -21.208 1.00 58.70  ? 205 LEU A CB  1 
ATOM   1522  C CG  . LEU A 1 207 ? 12.711  65.570  -22.560 1.00 59.64  ? 205 LEU A CG  1 
ATOM   1523  C CD1 . LEU A 1 207 ? 11.538  64.802  -23.173 1.00 52.23  ? 205 LEU A CD1 1 
ATOM   1524  C CD2 . LEU A 1 207 ? 13.165  66.697  -23.461 1.00 59.08  ? 205 LEU A CD2 1 
ATOM   1525  N N   . GLY A 1 208 ? 13.179  65.094  -18.368 1.00 53.42  ? 206 GLY A N   1 
ATOM   1526  C CA  . GLY A 1 208 ? 12.812  64.735  -17.006 1.00 51.85  ? 206 GLY A CA  1 
ATOM   1527  C C   . GLY A 1 208 ? 13.655  65.554  -16.041 1.00 52.05  ? 206 GLY A C   1 
ATOM   1528  O O   . GLY A 1 208 ? 13.211  66.021  -14.970 1.00 48.47  ? 206 GLY A O   1 
ATOM   1529  N N   . ALA A 1 209 ? 14.912  65.709  -16.440 1.00 51.87  ? 207 ALA A N   1 
ATOM   1530  C CA  . ALA A 1 209 ? 15.870  66.493  -15.676 1.00 49.92  ? 207 ALA A CA  1 
ATOM   1531  C C   . ALA A 1 209 ? 15.335  67.933  -15.704 1.00 46.35  ? 207 ALA A C   1 
ATOM   1532  O O   . ALA A 1 209 ? 14.918  68.468  -14.691 1.00 40.08  ? 207 ALA A O   1 
ATOM   1533  C CB  . ALA A 1 209 ? 17.275  66.390  -16.336 1.00 45.22  ? 207 ALA A CB  1 
ATOM   1534  N N   . GLN A 1 210 ? 15.297  68.533  -16.891 1.00 46.74  ? 208 GLN A N   1 
ATOM   1535  C CA  . GLN A 1 210 ? 14.794  69.902  -17.058 1.00 49.23  ? 208 GLN A CA  1 
ATOM   1536  C C   . GLN A 1 210 ? 13.479  70.089  -16.354 1.00 51.44  ? 208 GLN A C   1 
ATOM   1537  O O   . GLN A 1 210 ? 13.215  71.175  -15.817 1.00 52.22  ? 208 GLN A O   1 
ATOM   1538  C CB  . GLN A 1 210 ? 14.598  70.260  -18.532 1.00 52.26  ? 208 GLN A CB  1 
ATOM   1539  C CG  . GLN A 1 210 ? 15.672  71.185  -19.119 1.00 57.16  ? 208 GLN A CG  1 
ATOM   1540  C CD  . GLN A 1 210 ? 15.726  72.552  -18.444 1.00 61.60  ? 208 GLN A CD  1 
ATOM   1541  O OE1 . GLN A 1 210 ? 14.738  73.006  -17.862 1.00 63.52  ? 208 GLN A OE1 1 
ATOM   1542  N NE2 . GLN A 1 210 ? 16.880  73.227  -18.540 1.00 60.72  ? 208 GLN A NE2 1 
ATOM   1543  N N   . ALA A 1 211 ? 12.646  69.049  -16.375 1.00 52.71  ? 209 ALA A N   1 
ATOM   1544  C CA  . ALA A 1 211 ? 11.373  69.142  -15.701 1.00 56.06  ? 209 ALA A CA  1 
ATOM   1545  C C   . ALA A 1 211 ? 11.681  69.557  -14.241 1.00 58.67  ? 209 ALA A C   1 
ATOM   1546  O O   . ALA A 1 211 ? 11.277  70.659  -13.768 1.00 56.59  ? 209 ALA A O   1 
ATOM   1547  C CB  . ALA A 1 211 ? 10.648  67.811  -15.767 1.00 52.11  ? 209 ALA A CB  1 
ATOM   1548  N N   . LEU A 1 212 ? 12.440  68.701  -13.549 1.00 57.80  ? 210 LEU A N   1 
ATOM   1549  C CA  . LEU A 1 212 ? 12.853  68.942  -12.147 1.00 55.28  ? 210 LEU A CA  1 
ATOM   1550  C C   . LEU A 1 212 ? 13.435  70.340  -11.885 1.00 53.65  ? 210 LEU A C   1 
ATOM   1551  O O   . LEU A 1 212 ? 12.952  71.119  -11.062 1.00 51.97  ? 210 LEU A O   1 
ATOM   1552  C CB  . LEU A 1 212 ? 13.903  67.907  -11.774 1.00 55.61  ? 210 LEU A CB  1 
ATOM   1553  C CG  . LEU A 1 212 ? 13.311  66.614  -11.240 1.00 58.56  ? 210 LEU A CG  1 
ATOM   1554  C CD1 . LEU A 1 212 ? 14.298  66.041  -10.230 1.00 57.62  ? 210 LEU A CD1 1 
ATOM   1555  C CD2 . LEU A 1 212 ? 11.960  66.888  -10.572 1.00 56.87  ? 210 LEU A CD2 1 
ATOM   1556  N N   . LEU A 1 213 ? 14.513  70.613  -12.592 1.00 53.07  ? 211 LEU A N   1 
ATOM   1557  C CA  . LEU A 1 213 ? 15.195  71.878  -12.534 1.00 52.70  ? 211 LEU A CA  1 
ATOM   1558  C C   . LEU A 1 213 ? 14.183  72.984  -12.417 1.00 52.77  ? 211 LEU A C   1 
ATOM   1559  O O   . LEU A 1 213 ? 14.166  73.755  -11.444 1.00 53.02  ? 211 LEU A O   1 
ATOM   1560  C CB  . LEU A 1 213 ? 15.945  72.069  -13.830 1.00 52.68  ? 211 LEU A CB  1 
ATOM   1561  C CG  . LEU A 1 213 ? 17.100  73.060  -13.800 1.00 56.90  ? 211 LEU A CG  1 
ATOM   1562  C CD1 . LEU A 1 213 ? 16.856  74.108  -12.693 1.00 53.46  ? 211 LEU A CD1 1 
ATOM   1563  C CD2 . LEU A 1 213 ? 18.405  72.289  -13.572 1.00 49.31  ? 211 LEU A CD2 1 
ATOM   1564  N N   . GLY A 1 214 ? 13.365  73.065  -13.462 1.00 51.74  ? 212 GLY A N   1 
ATOM   1565  C CA  . GLY A 1 214 ? 12.320  74.064  -13.523 1.00 52.86  ? 212 GLY A CA  1 
ATOM   1566  C C   . GLY A 1 214 ? 11.546  74.193  -12.225 1.00 53.72  ? 212 GLY A C   1 
ATOM   1567  O O   . GLY A 1 214 ? 11.416  75.286  -11.649 1.00 56.57  ? 212 GLY A O   1 
ATOM   1568  N N   . ALA A 1 215 ? 11.035  73.066  -11.754 1.00 55.28  ? 213 ALA A N   1 
ATOM   1569  C CA  . ALA A 1 215 ? 10.254  73.051  -10.529 1.00 58.10  ? 213 ALA A CA  1 
ATOM   1570  C C   . ALA A 1 215 ? 11.000  73.732  -9.364  1.00 60.37  ? 213 ALA A C   1 
ATOM   1571  O O   . ALA A 1 215 ? 10.456  74.633  -8.684  1.00 57.54  ? 213 ALA A O   1 
ATOM   1572  C CB  . ALA A 1 215 ? 9.896   71.623  -10.176 1.00 55.69  ? 213 ALA A CB  1 
ATOM   1573  N N   . ALA A 1 216 ? 12.244  73.299  -9.140  1.00 60.76  ? 214 ALA A N   1 
ATOM   1574  C CA  . ALA A 1 216 ? 13.068  73.849  -8.074  1.00 59.65  ? 214 ALA A CA  1 
ATOM   1575  C C   . ALA A 1 216 ? 12.984  75.369  -8.072  1.00 59.18  ? 214 ALA A C   1 
ATOM   1576  O O   . ALA A 1 216 ? 12.372  75.953  -7.162  1.00 55.78  ? 214 ALA A O   1 
ATOM   1577  C CB  . ALA A 1 216 ? 14.498  73.394  -8.252  1.00 59.17  ? 214 ALA A CB  1 
ATOM   1578  N N   . LYS A 1 217 ? 13.593  75.991  -9.089  1.00 59.70  ? 215 LYS A N   1 
ATOM   1579  C CA  . LYS A 1 217 ? 13.582  77.450  -9.243  1.00 63.07  ? 215 LYS A CA  1 
ATOM   1580  C C   . LYS A 1 217 ? 12.256  78.089  -8.841  1.00 62.35  ? 215 LYS A C   1 
ATOM   1581  O O   . LYS A 1 217 ? 12.197  78.972  -7.982  1.00 64.03  ? 215 LYS A O   1 
ATOM   1582  C CB  . LYS A 1 217 ? 13.876  77.826  -10.691 1.00 66.93  ? 215 LYS A CB  1 
ATOM   1583  C CG  . LYS A 1 217 ? 15.347  77.754  -11.075 1.00 73.26  ? 215 LYS A CG  1 
ATOM   1584  C CD  . LYS A 1 217 ? 16.103  79.074  -10.772 1.00 75.46  ? 215 LYS A CD  1 
ATOM   1585  C CE  . LYS A 1 217 ? 15.949  80.168  -11.876 1.00 73.62  ? 215 LYS A CE  1 
ATOM   1586  N NZ  . LYS A 1 217 ? 16.793  79.961  -13.133 1.00 66.95  ? 215 LYS A NZ  1 
ATOM   1587  N N   . MET A 1 218 ? 11.182  77.655  -9.468  1.00 58.32  ? 216 MET A N   1 
ATOM   1588  C CA  . MET A 1 218 ? 9.918   78.229  -9.119  1.00 58.96  ? 216 MET A CA  1 
ATOM   1589  C C   . MET A 1 218 ? 9.676   78.204  -7.628  1.00 60.73  ? 216 MET A C   1 
ATOM   1590  O O   . MET A 1 218 ? 9.191   79.195  -7.051  1.00 63.11  ? 216 MET A O   1 
ATOM   1591  C CB  . MET A 1 218 ? 8.800   77.503  -9.838  1.00 61.99  ? 216 MET A CB  1 
ATOM   1592  C CG  . MET A 1 218 ? 8.637   77.924  -11.272 1.00 66.53  ? 216 MET A CG  1 
ATOM   1593  S SD  . MET A 1 218 ? 7.240   77.098  -12.014 1.00 73.20  ? 216 MET A SD  1 
ATOM   1594  C CE  . MET A 1 218 ? 5.809   78.064  -11.374 1.00 67.48  ? 216 MET A CE  1 
ATOM   1595  N N   . LEU A 1 219 ? 10.023  77.092  -6.991  1.00 61.89  ? 217 LEU A N   1 
ATOM   1596  C CA  . LEU A 1 219 ? 9.785   76.991  -5.567  1.00 64.27  ? 217 LEU A CA  1 
ATOM   1597  C C   . LEU A 1 219 ? 10.722  77.861  -4.722  1.00 64.33  ? 217 LEU A C   1 
ATOM   1598  O O   . LEU A 1 219 ? 10.329  78.388  -3.678  1.00 63.12  ? 217 LEU A O   1 
ATOM   1599  C CB  . LEU A 1 219 ? 9.886   75.538  -5.121  1.00 66.41  ? 217 LEU A CB  1 
ATOM   1600  C CG  . LEU A 1 219 ? 9.399   75.407  -3.673  1.00 70.16  ? 217 LEU A CG  1 
ATOM   1601  C CD1 . LEU A 1 219 ? 7.890   75.589  -3.651  1.00 74.07  ? 217 LEU A CD1 1 
ATOM   1602  C CD2 . LEU A 1 219 ? 9.780   74.072  -3.073  1.00 72.27  ? 217 LEU A CD2 1 
ATOM   1603  N N   . LEU A 1 220 ? 11.962  78.004  -5.169  1.00 65.85  ? 218 LEU A N   1 
ATOM   1604  C CA  . LEU A 1 220 ? 12.946  78.812  -4.454  1.00 69.83  ? 218 LEU A CA  1 
ATOM   1605  C C   . LEU A 1 220 ? 12.625  80.307  -4.546  1.00 74.06  ? 218 LEU A C   1 
ATOM   1606  O O   . LEU A 1 220 ? 12.581  81.022  -3.523  1.00 70.48  ? 218 LEU A O   1 
ATOM   1607  C CB  . LEU A 1 220 ? 14.339  78.573  -5.034  1.00 69.91  ? 218 LEU A CB  1 
ATOM   1608  C CG  . LEU A 1 220 ? 14.877  77.151  -4.964  1.00 68.93  ? 218 LEU A CG  1 
ATOM   1609  C CD1 . LEU A 1 220 ? 16.304  77.080  -5.499  1.00 66.42  ? 218 LEU A CD1 1 
ATOM   1610  C CD2 . LEU A 1 220 ? 14.813  76.697  -3.522  1.00 67.05  ? 218 LEU A CD2 1 
ATOM   1611  N N   . HIS A 1 221 ? 12.396  80.766  -5.780  1.00 77.80  ? 219 HIS A N   1 
ATOM   1612  C CA  . HIS A 1 221 ? 12.096  82.174  -6.048  1.00 84.83  ? 219 HIS A CA  1 
ATOM   1613  C C   . HIS A 1 221 ? 10.652  82.532  -5.729  1.00 85.65  ? 219 HIS A C   1 
ATOM   1614  O O   . HIS A 1 221 ? 9.988   83.177  -6.532  1.00 85.92  ? 219 HIS A O   1 
ATOM   1615  C CB  . HIS A 1 221 ? 12.374  82.519  -7.523  1.00 88.78  ? 219 HIS A CB  1 
ATOM   1616  C CG  . HIS A 1 221 ? 13.767  82.192  -7.976  1.00 95.39  ? 219 HIS A CG  1 
ATOM   1617  N ND1 . HIS A 1 221 ? 14.371  80.982  -7.708  1.00 97.76  ? 219 HIS A ND1 1 
ATOM   1618  C CD2 . HIS A 1 221 ? 14.660  82.903  -8.706  1.00 96.09  ? 219 HIS A CD2 1 
ATOM   1619  C CE1 . HIS A 1 221 ? 15.575  80.961  -8.252  1.00 96.93  ? 219 HIS A CE1 1 
ATOM   1620  N NE2 . HIS A 1 221 ? 15.775  82.112  -8.865  1.00 96.44  ? 219 HIS A NE2 1 
ATOM   1621  N N   . SER A 1 222 ? 10.166  82.124  -4.564  1.00 85.56  ? 220 SER A N   1 
ATOM   1622  C CA  . SER A 1 222 ? 8.802   82.426  -4.187  1.00 84.57  ? 220 SER A CA  1 
ATOM   1623  C C   . SER A 1 222 ? 8.537   81.609  -2.982  1.00 87.57  ? 220 SER A C   1 
ATOM   1624  O O   . SER A 1 222 ? 9.389   80.841  -2.549  1.00 89.52  ? 220 SER A O   1 
ATOM   1625  C CB  . SER A 1 222 ? 7.826   81.962  -5.250  1.00 83.66  ? 220 SER A CB  1 
ATOM   1626  O OG  . SER A 1 222 ? 7.787   80.546  -5.267  1.00 79.07  ? 220 SER A OG  1 
ATOM   1627  N N   . GLU A 1 223 ? 7.354   81.781  -2.424  1.00 91.61  ? 221 GLU A N   1 
ATOM   1628  C CA  . GLU A 1 223 ? 6.968   80.970  -1.288  1.00 99.13  ? 221 GLU A CA  1 
ATOM   1629  C C   . GLU A 1 223 ? 6.019   80.029  -1.956  1.00 98.16  ? 221 GLU A C   1 
ATOM   1630  O O   . GLU A 1 223 ? 6.340   78.864  -2.239  1.00 97.71  ? 221 GLU A O   1 
ATOM   1631  C CB  . GLU A 1 223 ? 6.233   81.770  -0.209  1.00 102.72 ? 221 GLU A CB  1 
ATOM   1632  C CG  . GLU A 1 223 ? 7.058   81.896  1.061   1.00 112.79 ? 221 GLU A CG  1 
ATOM   1633  C CD  . GLU A 1 223 ? 8.329   82.717  0.844   1.00 120.03 ? 221 GLU A CD  1 
ATOM   1634  O OE1 . GLU A 1 223 ? 9.147   82.364  -0.048  1.00 121.86 ? 221 GLU A OE1 1 
ATOM   1635  O OE2 . GLU A 1 223 ? 8.514   83.727  1.568   1.00 125.61 ? 221 GLU A OE2 1 
ATOM   1636  N N   . GLN A 1 224 ? 4.849   80.568  -2.251  1.00 97.27  ? 222 GLN A N   1 
ATOM   1637  C CA  . GLN A 1 224 ? 3.853   79.784  -2.923  1.00 94.44  ? 222 GLN A CA  1 
ATOM   1638  C C   . GLN A 1 224 ? 3.449   78.535  -2.094  1.00 91.25  ? 222 GLN A C   1 
ATOM   1639  O O   . GLN A 1 224 ? 2.294   78.429  -1.657  1.00 91.33  ? 222 GLN A O   1 
ATOM   1640  C CB  . GLN A 1 224 ? 4.414   79.405  -4.311  1.00 96.25  ? 222 GLN A CB  1 
ATOM   1641  C CG  . GLN A 1 224 ? 4.640   80.586  -5.270  1.00 95.83  ? 222 GLN A CG  1 
ATOM   1642  C CD  . GLN A 1 224 ? 3.327   81.138  -5.845  1.00 99.52  ? 222 GLN A CD  1 
ATOM   1643  O OE1 . GLN A 1 224 ? 2.385   81.417  -5.094  1.00 97.79  ? 222 GLN A OE1 1 
ATOM   1644  N NE2 . GLN A 1 224 ? 3.261   81.295  -7.179  1.00 100.08 ? 222 GLN A NE2 1 
ATOM   1645  N N   . HIS A 1 225 ? 4.401   77.623  -1.874  1.00 84.27  ? 223 HIS A N   1 
ATOM   1646  C CA  . HIS A 1 225 ? 4.191   76.367  -1.146  1.00 79.58  ? 223 HIS A CA  1 
ATOM   1647  C C   . HIS A 1 225 ? 4.153   75.337  -2.249  1.00 79.32  ? 223 HIS A C   1 
ATOM   1648  O O   . HIS A 1 225 ? 3.458   75.521  -3.229  1.00 80.95  ? 223 HIS A O   1 
ATOM   1649  C CB  . HIS A 1 225 ? 2.853   76.342  -0.417  1.00 76.23  ? 223 HIS A CB  1 
ATOM   1650  C CG  . HIS A 1 225 ? 2.670   75.160  0.481   1.00 75.75  ? 223 HIS A CG  1 
ATOM   1651  N ND1 . HIS A 1 225 ? 3.189   73.919  0.193   1.00 76.33  ? 223 HIS A ND1 1 
ATOM   1652  C CD2 . HIS A 1 225 ? 2.010   75.026  1.655   1.00 75.64  ? 223 HIS A CD2 1 
ATOM   1653  C CE1 . HIS A 1 225 ? 2.861   73.073  1.152   1.00 78.42  ? 223 HIS A CE1 1 
ATOM   1654  N NE2 . HIS A 1 225 ? 2.144   73.720  2.051   1.00 75.02  ? 223 HIS A NE2 1 
ATOM   1655  N N   . PRO A 1 226 ? 4.893   74.233  -2.110  1.00 77.99  ? 224 PRO A N   1 
ATOM   1656  C CA  . PRO A 1 226 ? 4.874   73.221  -3.169  1.00 77.27  ? 224 PRO A CA  1 
ATOM   1657  C C   . PRO A 1 226 ? 3.440   72.829  -3.502  1.00 75.53  ? 224 PRO A C   1 
ATOM   1658  O O   . PRO A 1 226 ? 3.127   72.494  -4.661  1.00 75.47  ? 224 PRO A O   1 
ATOM   1659  C CB  . PRO A 1 226 ? 5.649   72.057  -2.548  1.00 77.33  ? 224 PRO A CB  1 
ATOM   1660  C CG  . PRO A 1 226 ? 6.610   72.765  -1.638  1.00 79.49  ? 224 PRO A CG  1 
ATOM   1661  C CD  . PRO A 1 226 ? 5.743   73.804  -0.991  1.00 77.66  ? 224 PRO A CD  1 
ATOM   1662  N N   . GLY A 1 227 ? 2.582   72.905  -2.480  1.00 72.28  ? 225 GLY A N   1 
ATOM   1663  C CA  . GLY A 1 227 ? 1.197   72.516  -2.629  1.00 70.53  ? 225 GLY A CA  1 
ATOM   1664  C C   . GLY A 1 227 ? 0.445   73.276  -3.685  1.00 68.53  ? 225 GLY A C   1 
ATOM   1665  O O   . GLY A 1 227 ? -0.150  72.687  -4.577  1.00 65.11  ? 225 GLY A O   1 
ATOM   1666  N N   . GLN A 1 228 ? 0.489   74.596  -3.575  1.00 69.27  ? 226 GLN A N   1 
ATOM   1667  C CA  . GLN A 1 228 ? -0.200  75.507  -4.482  1.00 68.60  ? 226 GLN A CA  1 
ATOM   1668  C C   . GLN A 1 228 ? 0.317   75.533  -5.913  1.00 64.78  ? 226 GLN A C   1 
ATOM   1669  O O   . GLN A 1 228 ? -0.460  75.653  -6.833  1.00 68.29  ? 226 GLN A O   1 
ATOM   1670  C CB  . GLN A 1 228 ? -0.121  76.885  -3.894  1.00 73.91  ? 226 GLN A CB  1 
ATOM   1671  C CG  . GLN A 1 228 ? -1.045  77.895  -4.471  1.00 85.85  ? 226 GLN A CG  1 
ATOM   1672  C CD  . GLN A 1 228 ? -0.895  79.189  -3.699  1.00 98.39  ? 226 GLN A CD  1 
ATOM   1673  O OE1 . GLN A 1 228 ? -1.283  79.266  -2.526  1.00 104.55 ? 226 GLN A OE1 1 
ATOM   1674  N NE2 . GLN A 1 228 ? -0.294  80.206  -4.331  1.00 102.87 ? 226 GLN A NE2 1 
ATOM   1675  N N   . LEU A 1 229 ? 1.625   75.435  -6.101  1.00 61.41  ? 227 LEU A N   1 
ATOM   1676  C CA  . LEU A 1 229 ? 2.193   75.435  -7.439  1.00 58.57  ? 227 LEU A CA  1 
ATOM   1677  C C   . LEU A 1 229 ? 1.720   74.174  -8.097  1.00 61.92  ? 227 LEU A C   1 
ATOM   1678  O O   . LEU A 1 229 ? 1.723   74.083  -9.322  1.00 67.52  ? 227 LEU A O   1 
ATOM   1679  C CB  . LEU A 1 229 ? 3.724   75.403  -7.426  1.00 56.46  ? 227 LEU A CB  1 
ATOM   1680  C CG  . LEU A 1 229 ? 4.564   76.620  -7.067  1.00 54.79  ? 227 LEU A CG  1 
ATOM   1681  C CD1 . LEU A 1 229 ? 6.048   76.263  -7.171  1.00 52.34  ? 227 LEU A CD1 1 
ATOM   1682  C CD2 . LEU A 1 229 ? 4.209   77.758  -8.006  1.00 56.11  ? 227 LEU A CD2 1 
ATOM   1683  N N   . LYS A 1 230 ? 1.349   73.191  -7.279  1.00 61.51  ? 228 LYS A N   1 
ATOM   1684  C CA  . LYS A 1 230 ? 0.859   71.920  -7.786  1.00 62.72  ? 228 LYS A CA  1 
ATOM   1685  C C   . LYS A 1 230 ? -0.470  72.190  -8.453  1.00 64.03  ? 228 LYS A C   1 
ATOM   1686  O O   . LYS A 1 230 ? -0.779  71.653  -9.519  1.00 63.07  ? 228 LYS A O   1 
ATOM   1687  C CB  . LYS A 1 230 ? 0.665   70.938  -6.625  1.00 66.81  ? 228 LYS A CB  1 
ATOM   1688  C CG  . LYS A 1 230 ? -0.493  69.924  -6.795  1.00 66.72  ? 228 LYS A CG  1 
ATOM   1689  C CD  . LYS A 1 230 ? -0.646  69.013  -5.573  1.00 66.00  ? 228 LYS A CD  1 
ATOM   1690  C CE  . LYS A 1 230 ? -2.128  68.768  -5.217  1.00 68.80  ? 228 LYS A CE  1 
ATOM   1691  N NZ  . LYS A 1 230 ? -2.859  69.971  -4.686  1.00 67.42  ? 228 LYS A NZ  1 
ATOM   1692  N N   . ASP A 1 231 ? -1.250  73.028  -7.780  1.00 64.46  ? 229 ASP A N   1 
ATOM   1693  C CA  . ASP A 1 231 ? -2.561  73.460  -8.231  1.00 66.15  ? 229 ASP A CA  1 
ATOM   1694  C C   . ASP A 1 231 ? -2.440  74.262  -9.546  1.00 66.97  ? 229 ASP A C   1 
ATOM   1695  O O   . ASP A 1 231 ? -3.227  74.072  -10.473 1.00 68.16  ? 229 ASP A O   1 
ATOM   1696  C CB  . ASP A 1 231 ? -3.198  74.298  -7.118  1.00 67.37  ? 229 ASP A CB  1 
ATOM   1697  C CG  . ASP A 1 231 ? -3.293  73.529  -5.803  1.00 69.67  ? 229 ASP A CG  1 
ATOM   1698  O OD1 . ASP A 1 231 ? -2.473  72.606  -5.622  1.00 73.08  ? 229 ASP A OD1 1 
ATOM   1699  O OD2 . ASP A 1 231 ? -4.163  73.834  -4.950  1.00 70.00  ? 229 ASP A OD2 1 
ATOM   1700  N N   . ASN A 1 232 ? -1.433  75.126  -9.632  1.00 68.16  ? 230 ASN A N   1 
ATOM   1701  C CA  . ASN A 1 232 ? -1.194  75.943  -10.820 1.00 68.72  ? 230 ASN A CA  1 
ATOM   1702  C C   . ASN A 1 232 ? -0.842  75.094  -12.032 1.00 70.41  ? 230 ASN A C   1 
ATOM   1703  O O   . ASN A 1 232 ? -0.852  75.583  -13.158 1.00 72.90  ? 230 ASN A O   1 
ATOM   1704  C CB  . ASN A 1 232 ? -0.015  76.901  -10.611 1.00 67.94  ? 230 ASN A CB  1 
ATOM   1705  C CG  . ASN A 1 232 ? -0.197  77.804  -9.431  1.00 68.10  ? 230 ASN A CG  1 
ATOM   1706  O OD1 . ASN A 1 232 ? -1.279  77.839  -8.831  1.00 62.73  ? 230 ASN A OD1 1 
ATOM   1707  N ND2 . ASN A 1 232 ? 0.863   78.554  -9.079  1.00 66.94  ? 230 ASN A ND2 1 
ATOM   1708  N N   . VAL A 1 233 ? -0.522  73.828  -11.818 1.00 68.99  ? 231 VAL A N   1 
ATOM   1709  C CA  . VAL A 1 233 ? -0.103  73.006  -12.940 1.00 72.73  ? 231 VAL A CA  1 
ATOM   1710  C C   . VAL A 1 233 ? -1.091  71.950  -13.427 1.00 72.35  ? 231 VAL A C   1 
ATOM   1711  O O   . VAL A 1 233 ? -0.922  71.383  -14.536 1.00 70.90  ? 231 VAL A O   1 
ATOM   1712  C CB  . VAL A 1 233 ? 1.277   72.356  -12.607 1.00 76.48  ? 231 VAL A CB  1 
ATOM   1713  C CG1 . VAL A 1 233 ? 1.798   71.485  -13.785 1.00 79.90  ? 231 VAL A CG1 1 
ATOM   1714  C CG2 . VAL A 1 233 ? 2.264   73.465  -12.267 1.00 78.50  ? 231 VAL A CG2 1 
ATOM   1715  N N   . SER A 1 234 ? -2.124  71.700  -12.618 1.00 72.15  ? 232 SER A N   1 
ATOM   1716  C CA  . SER A 1 234 ? -3.131  70.704  -12.965 1.00 69.24  ? 232 SER A CA  1 
ATOM   1717  C C   . SER A 1 234 ? -4.492  71.277  -13.429 1.00 67.77  ? 232 SER A C   1 
ATOM   1718  O O   . SER A 1 234 ? -5.298  71.731  -12.596 1.00 67.05  ? 232 SER A O   1 
ATOM   1719  C CB  . SER A 1 234 ? -3.301  69.701  -11.786 1.00 67.30  ? 232 SER A CB  1 
ATOM   1720  O OG  . SER A 1 234 ? -3.186  70.312  -10.502 1.00 62.77  ? 232 SER A OG  1 
ATOM   1721  N N   . SER A 1 235 ? -4.720  71.277  -14.756 1.00 63.35  ? 233 SER A N   1 
ATOM   1722  C CA  . SER A 1 235 ? -5.992  71.754  -15.315 1.00 61.33  ? 233 SER A CA  1 
ATOM   1723  C C   . SER A 1 235 ? -7.067  70.734  -14.947 1.00 59.07  ? 233 SER A C   1 
ATOM   1724  O O   . SER A 1 235 ? -6.928  69.555  -15.244 1.00 61.65  ? 233 SER A O   1 
ATOM   1725  C CB  . SER A 1 235 ? -5.904  71.943  -16.837 1.00 65.19  ? 233 SER A CB  1 
ATOM   1726  O OG  . SER A 1 235 ? -5.506  70.771  -17.530 1.00 74.04  ? 233 SER A OG  1 
ATOM   1727  N N   . PRO A 1 236 ? -8.171  71.186  -14.317 1.00 56.39  ? 234 PRO A N   1 
ATOM   1728  C CA  . PRO A 1 236 ? -9.317  70.408  -13.845 1.00 56.02  ? 234 PRO A CA  1 
ATOM   1729  C C   . PRO A 1 236 ? -9.642  69.211  -14.656 1.00 57.43  ? 234 PRO A C   1 
ATOM   1730  O O   . PRO A 1 236 ? -10.382 68.323  -14.223 1.00 60.91  ? 234 PRO A O   1 
ATOM   1731  C CB  . PRO A 1 236 ? -10.423 71.420  -13.835 1.00 55.93  ? 234 PRO A CB  1 
ATOM   1732  C CG  . PRO A 1 236 ? -9.743  72.579  -13.324 1.00 58.88  ? 234 PRO A CG  1 
ATOM   1733  C CD  . PRO A 1 236 ? -8.522  72.607  -14.246 1.00 60.33  ? 234 PRO A CD  1 
ATOM   1734  N N   . GLY A 1 237 ? -9.077  69.196  -15.852 1.00 59.85  ? 235 GLY A N   1 
ATOM   1735  C CA  . GLY A 1 237 ? -9.268  68.089  -16.765 1.00 54.83  ? 235 GLY A CA  1 
ATOM   1736  C C   . GLY A 1 237 ? -8.480  66.891  -16.310 1.00 46.24  ? 235 GLY A C   1 
ATOM   1737  O O   . GLY A 1 237 ? -8.993  66.065  -15.565 1.00 44.22  ? 235 GLY A O   1 
ATOM   1738  N N   . GLY A 1 238 ? -7.231  66.811  -16.749 1.00 37.43  ? 236 GLY A N   1 
ATOM   1739  C CA  . GLY A 1 238 ? -6.426  65.684  -16.399 1.00 36.46  ? 236 GLY A CA  1 
ATOM   1740  C C   . GLY A 1 238 ? -5.031  65.812  -16.934 1.00 45.55  ? 236 GLY A C   1 
ATOM   1741  O O   . GLY A 1 238 ? -4.460  66.910  -17.070 1.00 43.38  ? 236 GLY A O   1 
ATOM   1742  N N   . ALA A 1 239 ? -4.472  64.640  -17.212 1.00 52.56  ? 237 ALA A N   1 
ATOM   1743  C CA  . ALA A 1 239 ? -3.118  64.505  -17.719 1.00 56.23  ? 237 ALA A CA  1 
ATOM   1744  C C   . ALA A 1 239 ? -2.097  64.707  -16.576 1.00 59.79  ? 237 ALA A C   1 
ATOM   1745  O O   . ALA A 1 239 ? -1.113  63.952  -16.483 1.00 63.32  ? 237 ALA A O   1 
ATOM   1746  C CB  . ALA A 1 239 ? -2.870  65.505  -18.869 1.00 52.86  ? 237 ALA A CB  1 
ATOM   1747  N N   . THR A 1 240 ? -2.309  65.711  -15.718 1.00 53.99  ? 238 THR A N   1 
ATOM   1748  C CA  . THR A 1 240 ? -1.376  65.935  -14.627 1.00 49.58  ? 238 THR A CA  1 
ATOM   1749  C C   . THR A 1 240 ? -1.955  65.416  -13.344 1.00 48.09  ? 238 THR A C   1 
ATOM   1750  O O   . THR A 1 240 ? -1.442  64.477  -12.746 1.00 45.21  ? 238 THR A O   1 
ATOM   1751  C CB  . THR A 1 240 ? -1.048  67.394  -14.471 1.00 48.48  ? 238 THR A CB  1 
ATOM   1752  O OG1 . THR A 1 240 ? -0.377  67.841  -15.658 1.00 45.31  ? 238 THR A OG1 1 
ATOM   1753  C CG2 . THR A 1 240 ? -0.152  67.596  -13.260 1.00 39.01  ? 238 THR A CG2 1 
ATOM   1754  N N   . ILE A 1 241 ? -3.049  66.019  -12.928 1.00 47.27  ? 239 ILE A N   1 
ATOM   1755  C CA  . ILE A 1 241 ? -3.707  65.582  -11.703 1.00 50.31  ? 239 ILE A CA  1 
ATOM   1756  C C   . ILE A 1 241 ? -3.923  64.078  -11.727 1.00 46.13  ? 239 ILE A C   1 
ATOM   1757  O O   . ILE A 1 241 ? -4.029  63.414  -10.699 1.00 48.35  ? 239 ILE A O   1 
ATOM   1758  C CB  . ILE A 1 241 ? -5.066  66.272  -11.517 1.00 48.52  ? 239 ILE A CB  1 
ATOM   1759  C CG1 . ILE A 1 241 ? -5.740  65.752  -10.243 1.00 49.07  ? 239 ILE A CG1 1 
ATOM   1760  C CG2 . ILE A 1 241 ? -5.935  66.006  -12.698 1.00 44.37  ? 239 ILE A CG2 1 
ATOM   1761  C CD1 . ILE A 1 241 ? -6.995  66.478  -9.873  1.00 48.10  ? 239 ILE A CD1 1 
ATOM   1762  N N   . HIS A 1 242 ? -4.008  63.554  -12.926 1.00 46.60  ? 240 HIS A N   1 
ATOM   1763  C CA  . HIS A 1 242 ? -4.175  62.140  -13.123 1.00 50.12  ? 240 HIS A CA  1 
ATOM   1764  C C   . HIS A 1 242 ? -2.867  61.453  -12.755 1.00 49.13  ? 240 HIS A C   1 
ATOM   1765  O O   . HIS A 1 242 ? -2.869  60.513  -11.981 1.00 51.43  ? 240 HIS A O   1 
ATOM   1766  C CB  . HIS A 1 242 ? -4.565  61.847  -14.577 1.00 53.86  ? 240 HIS A CB  1 
ATOM   1767  C CG  . HIS A 1 242 ? -6.041  61.888  -14.821 1.00 51.67  ? 240 HIS A CG  1 
ATOM   1768  N ND1 . HIS A 1 242 ? -6.688  61.007  -15.655 1.00 55.71  ? 240 HIS A ND1 1 
ATOM   1769  C CD2 . HIS A 1 242 ? -7.012  62.657  -14.272 1.00 54.62  ? 240 HIS A CD2 1 
ATOM   1770  C CE1 . HIS A 1 242 ? -7.994  61.219  -15.610 1.00 50.58  ? 240 HIS A CE1 1 
ATOM   1771  N NE2 . HIS A 1 242 ? -8.214  62.217  -14.777 1.00 55.19  ? 240 HIS A NE2 1 
ATOM   1772  N N   . ALA A 1 243 ? -1.745  61.922  -13.289 1.00 47.73  ? 241 ALA A N   1 
ATOM   1773  C CA  . ALA A 1 243 ? -0.468  61.303  -12.939 1.00 45.24  ? 241 ALA A CA  1 
ATOM   1774  C C   . ALA A 1 243 ? -0.370  61.359  -11.427 1.00 45.68  ? 241 ALA A C   1 
ATOM   1775  O O   . ALA A 1 243 ? 0.036   60.406  -10.788 1.00 44.80  ? 241 ALA A O   1 
ATOM   1776  C CB  . ALA A 1 243 ? 0.693   62.055  -13.555 1.00 47.59  ? 241 ALA A CB  1 
ATOM   1777  N N   . LEU A 1 244 ? -0.762  62.485  -10.854 1.00 44.76  ? 242 LEU A N   1 
ATOM   1778  C CA  . LEU A 1 244 ? -0.724  62.650  -9.410  1.00 46.79  ? 242 LEU A CA  1 
ATOM   1779  C C   . LEU A 1 244 ? -1.458  61.514  -8.717  1.00 46.19  ? 242 LEU A C   1 
ATOM   1780  O O   . LEU A 1 244 ? -0.867  60.733  -7.966  1.00 47.06  ? 242 LEU A O   1 
ATOM   1781  C CB  . LEU A 1 244 ? -1.348  63.992  -9.022  1.00 47.86  ? 242 LEU A CB  1 
ATOM   1782  C CG  . LEU A 1 244 ? -0.552  65.226  -9.510  1.00 51.84  ? 242 LEU A CG  1 
ATOM   1783  C CD1 . LEU A 1 244 ? -1.066  66.401  -8.700  1.00 51.33  ? 242 LEU A CD1 1 
ATOM   1784  C CD2 . LEU A 1 244 ? 1.007   65.080  -9.351  1.00 46.78  ? 242 LEU A CD2 1 
ATOM   1785  N N   . HIS A 1 245 ? -2.753  61.426  -8.956  1.00 43.82  ? 243 HIS A N   1 
ATOM   1786  C CA  . HIS A 1 245 ? -3.507  60.348  -8.350  1.00 43.58  ? 243 HIS A CA  1 
ATOM   1787  C C   . HIS A 1 245 ? -2.644  59.076  -8.167  1.00 40.05  ? 243 HIS A C   1 
ATOM   1788  O O   . HIS A 1 245 ? -2.516  58.561  -7.079  1.00 41.71  ? 243 HIS A O   1 
ATOM   1789  C CB  . HIS A 1 245 ? -4.740  60.009  -9.204  1.00 47.75  ? 243 HIS A CB  1 
ATOM   1790  C CG  . HIS A 1 245 ? -5.780  59.218  -8.460  1.00 49.21  ? 243 HIS A CG  1 
ATOM   1791  N ND1 . HIS A 1 245 ? -5.446  58.241  -7.546  1.00 52.25  ? 243 HIS A ND1 1 
ATOM   1792  C CD2 . HIS A 1 245 ? -7.132  59.315  -8.423  1.00 45.53  ? 243 HIS A CD2 1 
ATOM   1793  C CE1 . HIS A 1 245 ? -6.543  57.782  -6.971  1.00 49.84  ? 243 HIS A CE1 1 
ATOM   1794  N NE2 . HIS A 1 245 ? -7.580  58.419  -7.484  1.00 46.81  ? 243 HIS A NE2 1 
ATOM   1795  N N   . VAL A 1 246 ? -2.004  58.603  -9.228  1.00 39.22  ? 244 VAL A N   1 
ATOM   1796  C CA  . VAL A 1 246 ? -1.210  57.383  -9.131  1.00 40.52  ? 244 VAL A CA  1 
ATOM   1797  C C   . VAL A 1 246 ? -0.143  57.505  -8.082  1.00 39.59  ? 244 VAL A C   1 
ATOM   1798  O O   . VAL A 1 246 ? -0.036  56.661  -7.202  1.00 45.38  ? 244 VAL A O   1 
ATOM   1799  C CB  . VAL A 1 246 ? -0.600  56.949  -10.532 1.00 34.65  ? 244 VAL A CB  1 
ATOM   1800  C CG1 . VAL A 1 246 ? -1.458  57.495  -11.635 1.00 31.27  ? 244 VAL A CG1 1 
ATOM   1801  C CG2 . VAL A 1 246 ? 0.839   57.381  -10.717 1.00 33.69  ? 244 VAL A CG2 1 
ATOM   1802  N N   . LEU A 1 247 ? 0.621   58.582  -8.153  1.00 37.76  ? 245 LEU A N   1 
ATOM   1803  C CA  . LEU A 1 247 ? 1.660   58.815  -7.178  1.00 40.94  ? 245 LEU A CA  1 
ATOM   1804  C C   . LEU A 1 247 ? 0.977   58.764  -5.805  1.00 46.61  ? 245 LEU A C   1 
ATOM   1805  O O   . LEU A 1 247 ? 1.349   57.984  -4.937  1.00 51.05  ? 245 LEU A O   1 
ATOM   1806  C CB  . LEU A 1 247 ? 2.276   60.201  -7.376  1.00 35.47  ? 245 LEU A CB  1 
ATOM   1807  C CG  . LEU A 1 247 ? 3.092   60.516  -8.625  1.00 37.03  ? 245 LEU A CG  1 
ATOM   1808  C CD1 . LEU A 1 247 ? 3.551   61.974  -8.501  1.00 29.45  ? 245 LEU A CD1 1 
ATOM   1809  C CD2 . LEU A 1 247 ? 4.301   59.544  -8.785  1.00 31.21  ? 245 LEU A CD2 1 
ATOM   1810  N N   . GLU A 1 248 ? -0.047  59.588  -5.635  1.00 46.84  ? 246 GLU A N   1 
ATOM   1811  C CA  . GLU A 1 248 ? -0.738  59.665  -4.372  1.00 51.51  ? 246 GLU A CA  1 
ATOM   1812  C C   . GLU A 1 248 ? -1.318  58.337  -3.916  1.00 54.05  ? 246 GLU A C   1 
ATOM   1813  O O   . GLU A 1 248 ? -1.709  58.188  -2.732  1.00 53.36  ? 246 GLU A O   1 
ATOM   1814  C CB  . GLU A 1 248 ? -1.870  60.666  -4.475  1.00 51.53  ? 246 GLU A CB  1 
ATOM   1815  C CG  . GLU A 1 248 ? -2.117  61.479  -3.201  1.00 57.21  ? 246 GLU A CG  1 
ATOM   1816  C CD  . GLU A 1 248 ? -1.075  62.585  -2.979  1.00 57.18  ? 246 GLU A CD  1 
ATOM   1817  O OE1 . GLU A 1 248 ? -1.380  63.568  -2.236  1.00 65.07  ? 246 GLU A OE1 1 
ATOM   1818  O OE2 . GLU A 1 248 ? 0.038   62.458  -3.549  1.00 47.52  ? 246 GLU A OE2 1 
ATOM   1819  N N   . SER A 1 249 ? -1.395  57.391  -4.853  1.00 52.17  ? 247 SER A N   1 
ATOM   1820  C CA  . SER A 1 249 ? -1.975  56.100  -4.558  1.00 50.45  ? 247 SER A CA  1 
ATOM   1821  C C   . SER A 1 249 ? -0.938  55.022  -4.334  1.00 48.90  ? 247 SER A C   1 
ATOM   1822  O O   . SER A 1 249 ? -1.256  53.850  -4.185  1.00 47.79  ? 247 SER A O   1 
ATOM   1823  C CB  . SER A 1 249 ? -2.921  55.712  -5.669  1.00 47.70  ? 247 SER A CB  1 
ATOM   1824  O OG  . SER A 1 249 ? -4.055  55.096  -5.094  1.00 52.07  ? 247 SER A OG  1 
ATOM   1825  N N   . GLY A 1 250 ? 0.316   55.436  -4.314  1.00 47.25  ? 248 GLY A N   1 
ATOM   1826  C CA  . GLY A 1 250 ? 1.408   54.515  -4.073  1.00 48.46  ? 248 GLY A CA  1 
ATOM   1827  C C   . GLY A 1 250 ? 2.254   55.067  -2.942  1.00 50.34  ? 248 GLY A C   1 
ATOM   1828  O O   . GLY A 1 250 ? 3.390   54.661  -2.758  1.00 50.92  ? 248 GLY A O   1 
ATOM   1829  N N   . GLY A 1 251 ? 1.676   56.003  -2.189  1.00 51.39  ? 249 GLY A N   1 
ATOM   1830  C CA  . GLY A 1 251 ? 2.367   56.651  -1.077  1.00 48.76  ? 249 GLY A CA  1 
ATOM   1831  C C   . GLY A 1 251 ? 3.642   57.409  -1.436  1.00 47.34  ? 249 GLY A C   1 
ATOM   1832  O O   . GLY A 1 251 ? 4.576   57.460  -0.626  1.00 50.22  ? 249 GLY A O   1 
ATOM   1833  N N   . PHE A 1 252 ? 3.685   57.999  -2.628  1.00 44.11  ? 250 PHE A N   1 
ATOM   1834  C CA  . PHE A 1 252 ? 4.878   58.707  -3.121  1.00 45.24  ? 250 PHE A CA  1 
ATOM   1835  C C   . PHE A 1 252 ? 5.513   59.670  -2.105  1.00 45.18  ? 250 PHE A C   1 
ATOM   1836  O O   . PHE A 1 252 ? 6.733   59.676  -1.891  1.00 38.57  ? 250 PHE A O   1 
ATOM   1837  C CB  . PHE A 1 252 ? 4.521   59.439  -4.424  1.00 41.64  ? 250 PHE A CB  1 
ATOM   1838  C CG  . PHE A 1 252 ? 5.626   60.287  -4.986  1.00 30.25  ? 250 PHE A CG  1 
ATOM   1839  C CD1 . PHE A 1 252 ? 6.702   59.715  -5.624  1.00 31.17  ? 250 PHE A CD1 1 
ATOM   1840  C CD2 . PHE A 1 252 ? 5.529   61.677  -4.946  1.00 34.55  ? 250 PHE A CD2 1 
ATOM   1841  C CE1 . PHE A 1 252 ? 7.666   60.511  -6.232  1.00 28.71  ? 250 PHE A CE1 1 
ATOM   1842  C CE2 . PHE A 1 252 ? 6.467   62.482  -5.540  1.00 30.61  ? 250 PHE A CE2 1 
ATOM   1843  C CZ  . PHE A 1 252 ? 7.543   61.909  -6.190  1.00 32.21  ? 250 PHE A CZ  1 
ATOM   1844  N N   . ARG A 1 253 ? 4.671   60.498  -1.509  1.00 45.90  ? 251 ARG A N   1 
ATOM   1845  C CA  . ARG A 1 253 ? 5.113   61.429  -0.503  1.00 43.37  ? 251 ARG A CA  1 
ATOM   1846  C C   . ARG A 1 253 ? 5.745   60.566  0.601   1.00 44.49  ? 251 ARG A C   1 
ATOM   1847  O O   . ARG A 1 253 ? 6.923   60.694  0.943   1.00 48.27  ? 251 ARG A O   1 
ATOM   1848  C CB  . ARG A 1 253 ? 3.887   62.153  -0.011  1.00 38.89  ? 251 ARG A CB  1 
ATOM   1849  C CG  . ARG A 1 253 ? 2.744   61.968  -0.928  1.00 38.07  ? 251 ARG A CG  1 
ATOM   1850  C CD  . ARG A 1 253 ? 1.766   62.998  -0.617  1.00 38.87  ? 251 ARG A CD  1 
ATOM   1851  N NE  . ARG A 1 253 ? 2.392   64.282  -0.880  1.00 48.42  ? 251 ARG A NE  1 
ATOM   1852  C CZ  . ARG A 1 253 ? 1.720   65.407  -1.105  1.00 52.66  ? 251 ARG A CZ  1 
ATOM   1853  N NH1 . ARG A 1 253 ? 0.397   65.413  -1.101  1.00 55.36  ? 251 ARG A NH1 1 
ATOM   1854  N NH2 . ARG A 1 253 ? 2.367   66.532  -1.343  1.00 57.31  ? 251 ARG A NH2 1 
ATOM   1855  N N   . SER A 1 254 ? 4.960   59.640  1.113   1.00 42.14  ? 252 SER A N   1 
ATOM   1856  C CA  . SER A 1 254 ? 5.440   58.761  2.134   1.00 42.90  ? 252 SER A CA  1 
ATOM   1857  C C   . SER A 1 254 ? 6.838   58.284  1.830   1.00 39.86  ? 252 SER A C   1 
ATOM   1858  O O   . SER A 1 254 ? 7.771   58.729  2.434   1.00 45.68  ? 252 SER A O   1 
ATOM   1859  C CB  . SER A 1 254 ? 4.516   57.574  2.257   1.00 47.17  ? 252 SER A CB  1 
ATOM   1860  O OG  . SER A 1 254 ? 4.773   56.864  3.453   1.00 62.58  ? 252 SER A OG  1 
ATOM   1861  N N   . LEU A 1 255 ? 7.008   57.397  0.872   1.00 41.40  ? 253 LEU A N   1 
ATOM   1862  C CA  . LEU A 1 255 ? 8.342   56.882  0.568   1.00 38.88  ? 253 LEU A CA  1 
ATOM   1863  C C   . LEU A 1 255 ? 9.471   57.888  0.441   1.00 39.85  ? 253 LEU A C   1 
ATOM   1864  O O   . LEU A 1 255 ? 10.611  57.504  0.123   1.00 38.26  ? 253 LEU A O   1 
ATOM   1865  C CB  . LEU A 1 255 ? 8.312   56.085  -0.715  1.00 40.14  ? 253 LEU A CB  1 
ATOM   1866  C CG  . LEU A 1 255 ? 7.088   55.206  -0.849  1.00 44.09  ? 253 LEU A CG  1 
ATOM   1867  C CD1 . LEU A 1 255 ? 7.417   54.143  -1.900  1.00 48.18  ? 253 LEU A CD1 1 
ATOM   1868  C CD2 . LEU A 1 255 ? 6.709   54.581  0.526   1.00 45.92  ? 253 LEU A CD2 1 
ATOM   1869  N N   . LEU A 1 256 ? 9.202   59.159  0.696   1.00 40.04  ? 254 LEU A N   1 
ATOM   1870  C CA  . LEU A 1 256 ? 10.272  60.160  0.575   1.00 41.97  ? 254 LEU A CA  1 
ATOM   1871  C C   . LEU A 1 256 ? 10.675  60.600  1.977   1.00 40.44  ? 254 LEU A C   1 
ATOM   1872  O O   . LEU A 1 256 ? 11.815  60.960  2.261   1.00 39.96  ? 254 LEU A O   1 
ATOM   1873  C CB  . LEU A 1 256 ? 9.799   61.362  -0.248  1.00 32.80  ? 254 LEU A CB  1 
ATOM   1874  C CG  . LEU A 1 256 ? 9.880   61.189  -1.777  1.00 30.35  ? 254 LEU A CG  1 
ATOM   1875  C CD1 . LEU A 1 256 ? 9.148   62.402  -2.431  1.00 24.48  ? 254 LEU A CD1 1 
ATOM   1876  C CD2 . LEU A 1 256 ? 11.359  61.054  -2.255  1.00 14.94  ? 254 LEU A CD2 1 
ATOM   1877  N N   . ILE A 1 257 ? 9.682   60.589  2.834   1.00 38.46  ? 255 ILE A N   1 
ATOM   1878  C CA  . ILE A 1 257 ? 9.827   60.914  4.215   1.00 40.33  ? 255 ILE A CA  1 
ATOM   1879  C C   . ILE A 1 257 ? 10.667  59.765  4.759   1.00 46.33  ? 255 ILE A C   1 
ATOM   1880  O O   . ILE A 1 257 ? 11.771  59.980  5.202   1.00 51.82  ? 255 ILE A O   1 
ATOM   1881  C CB  . ILE A 1 257 ? 8.441   60.960  4.831   1.00 36.75  ? 255 ILE A CB  1 
ATOM   1882  C CG1 . ILE A 1 257 ? 7.645   62.058  4.149   1.00 42.30  ? 255 ILE A CG1 1 
ATOM   1883  C CG2 . ILE A 1 257 ? 8.513   61.293  6.256   1.00 41.98  ? 255 ILE A CG2 1 
ATOM   1884  C CD1 . ILE A 1 257 ? 6.153   61.868  4.254   1.00 36.31  ? 255 ILE A CD1 1 
ATOM   1885  N N   . ASN A 1 258 ? 10.165  58.541  4.673   1.00 47.36  ? 256 ASN A N   1 
ATOM   1886  C CA  . ASN A 1 258 ? 10.913  57.368  5.130   1.00 44.32  ? 256 ASN A CA  1 
ATOM   1887  C C   . ASN A 1 258 ? 12.361  57.432  4.648   1.00 45.66  ? 256 ASN A C   1 
ATOM   1888  O O   . ASN A 1 258 ? 13.237  56.856  5.288   1.00 52.31  ? 256 ASN A O   1 
ATOM   1889  C CB  . ASN A 1 258 ? 10.316  56.066  4.580   1.00 41.24  ? 256 ASN A CB  1 
ATOM   1890  C CG  . ASN A 1 258 ? 8.831   55.979  4.763   1.00 44.45  ? 256 ASN A CG  1 
ATOM   1891  O OD1 . ASN A 1 258 ? 8.192   56.940  5.187   1.00 44.10  ? 256 ASN A OD1 1 
ATOM   1892  N ND2 . ASN A 1 258 ? 8.259   54.826  4.424   1.00 42.41  ? 256 ASN A ND2 1 
ATOM   1893  N N   . ALA A 1 259 ? 12.628  58.126  3.539   1.00 42.21  ? 257 ALA A N   1 
ATOM   1894  C CA  . ALA A 1 259 ? 13.988  58.182  3.043   1.00 42.23  ? 257 ALA A CA  1 
ATOM   1895  C C   . ALA A 1 259 ? 14.767  59.245  3.792   1.00 40.46  ? 257 ALA A C   1 
ATOM   1896  O O   . ALA A 1 259 ? 15.956  59.106  4.038   1.00 44.09  ? 257 ALA A O   1 
ATOM   1897  C CB  . ALA A 1 259 ? 14.008  58.447  1.534   1.00 41.33  ? 257 ALA A CB  1 
ATOM   1898  N N   . VAL A 1 260 ? 14.085  60.316  4.155   1.00 37.63  ? 258 VAL A N   1 
ATOM   1899  C CA  . VAL A 1 260 ? 14.695  61.404  4.893   1.00 36.33  ? 258 VAL A CA  1 
ATOM   1900  C C   . VAL A 1 260 ? 14.985  60.821  6.272   1.00 37.74  ? 258 VAL A C   1 
ATOM   1901  O O   . VAL A 1 260 ? 16.134  60.770  6.693   1.00 41.81  ? 258 VAL A O   1 
ATOM   1902  C CB  . VAL A 1 260 ? 13.711  62.656  4.951   1.00 35.70  ? 258 VAL A CB  1 
ATOM   1903  C CG1 . VAL A 1 260 ? 13.637  63.199  6.343   1.00 37.85  ? 258 VAL A CG1 1 
ATOM   1904  C CG2 . VAL A 1 260 ? 14.160  63.750  3.972   1.00 28.87  ? 258 VAL A CG2 1 
ATOM   1905  N N   . GLU A 1 261 ? 13.929  60.350  6.939   1.00 39.53  ? 259 GLU A N   1 
ATOM   1906  C CA  . GLU A 1 261 ? 13.959  59.750  8.292   1.00 37.07  ? 259 GLU A CA  1 
ATOM   1907  C C   . GLU A 1 261 ? 15.040  58.711  8.456   1.00 39.18  ? 259 GLU A C   1 
ATOM   1908  O O   . GLU A 1 261 ? 15.794  58.698  9.418   1.00 42.86  ? 259 GLU A O   1 
ATOM   1909  C CB  . GLU A 1 261 ? 12.631  59.086  8.586   1.00 26.37  ? 259 GLU A CB  1 
ATOM   1910  C CG  . GLU A 1 261 ? 12.627  58.414  9.863   1.00 26.74  ? 259 GLU A CG  1 
ATOM   1911  C CD  . GLU A 1 261 ? 11.217  58.066  10.350  1.00 34.55  ? 259 GLU A CD  1 
ATOM   1912  O OE1 . GLU A 1 261 ? 10.591  57.158  9.773   1.00 35.71  ? 259 GLU A OE1 1 
ATOM   1913  O OE2 . GLU A 1 261 ? 10.733  58.691  11.320  1.00 36.79  ? 259 GLU A OE2 1 
ATOM   1914  N N   . ALA A 1 262 ? 15.063  57.817  7.498   1.00 40.58  ? 260 ALA A N   1 
ATOM   1915  C CA  . ALA A 1 262 ? 16.037  56.775  7.469   1.00 42.61  ? 260 ALA A CA  1 
ATOM   1916  C C   . ALA A 1 262 ? 17.410  57.363  7.344   1.00 41.36  ? 260 ALA A C   1 
ATOM   1917  O O   . ALA A 1 262 ? 18.301  57.016  8.101   1.00 46.80  ? 260 ALA A O   1 
ATOM   1918  C CB  . ALA A 1 262 ? 15.779  55.877  6.294   1.00 48.16  ? 260 ALA A CB  1 
ATOM   1919  N N   . SER A 1 263 ? 17.596  58.228  6.356   1.00 44.73  ? 261 SER A N   1 
ATOM   1920  C CA  . SER A 1 263 ? 18.909  58.848  6.118   1.00 46.30  ? 261 SER A CA  1 
ATOM   1921  C C   . SER A 1 263 ? 19.374  59.451  7.411   1.00 49.11  ? 261 SER A C   1 
ATOM   1922  O O   . SER A 1 263 ? 20.484  59.186  7.847   1.00 52.14  ? 261 SER A O   1 
ATOM   1923  C CB  . SER A 1 263 ? 18.836  59.973  5.069   1.00 40.80  ? 261 SER A CB  1 
ATOM   1924  O OG  . SER A 1 263 ? 20.138  60.470  4.731   1.00 31.48  ? 261 SER A OG  1 
ATOM   1925  N N   . CYS A 1 264 ? 18.512  60.289  7.985   1.00 50.60  ? 262 CYS A N   1 
ATOM   1926  C CA  . CYS A 1 264 ? 18.751  60.965  9.246   1.00 48.74  ? 262 CYS A CA  1 
ATOM   1927  C C   . CYS A 1 264 ? 19.148  59.940  10.310  1.00 45.15  ? 262 CYS A C   1 
ATOM   1928  O O   . CYS A 1 264 ? 20.278  59.894  10.786  1.00 44.14  ? 262 CYS A O   1 
ATOM   1929  C CB  . CYS A 1 264 ? 17.471  61.648  9.668   1.00 50.62  ? 262 CYS A CB  1 
ATOM   1930  S SG  . CYS A 1 264 ? 17.693  62.534  11.154  1.00 60.84  ? 262 CYS A SG  1 
ATOM   1931  N N   . ILE A 1 265 ? 18.186  59.110  10.658  1.00 44.68  ? 263 ILE A N   1 
ATOM   1932  C CA  . ILE A 1 265 ? 18.356  58.060  11.637  1.00 44.99  ? 263 ILE A CA  1 
ATOM   1933  C C   . ILE A 1 265 ? 19.650  57.248  11.497  1.00 46.68  ? 263 ILE A C   1 
ATOM   1934  O O   . ILE A 1 265 ? 20.243  56.843  12.505  1.00 46.66  ? 263 ILE A O   1 
ATOM   1935  C CB  . ILE A 1 265 ? 17.179  57.133  11.568  1.00 44.03  ? 263 ILE A CB  1 
ATOM   1936  C CG1 . ILE A 1 265 ? 15.960  57.840  12.114  1.00 47.54  ? 263 ILE A CG1 1 
ATOM   1937  C CG2 . ILE A 1 265 ? 17.472  55.875  12.320  1.00 44.75  ? 263 ILE A CG2 1 
ATOM   1938  C CD1 . ILE A 1 265 ? 14.738  56.978  12.090  1.00 53.82  ? 263 ILE A CD1 1 
ATOM   1939  N N   . ARG A 1 266 ? 20.087  56.990  10.269  1.00 46.34  ? 264 ARG A N   1 
ATOM   1940  C CA  . ARG A 1 266 ? 21.329  56.256  10.103  1.00 47.62  ? 264 ARG A CA  1 
ATOM   1941  C C   . ARG A 1 266 ? 22.448  57.133  10.613  1.00 50.44  ? 264 ARG A C   1 
ATOM   1942  O O   . ARG A 1 266 ? 23.317  56.676  11.339  1.00 55.09  ? 264 ARG A O   1 
ATOM   1943  C CB  . ARG A 1 266 ? 21.599  55.893  8.637   1.00 46.92  ? 264 ARG A CB  1 
ATOM   1944  C CG  . ARG A 1 266 ? 22.882  55.068  8.395   1.00 46.28  ? 264 ARG A CG  1 
ATOM   1945  C CD  . ARG A 1 266 ? 22.952  53.927  9.410   1.00 53.29  ? 264 ARG A CD  1 
ATOM   1946  N NE  . ARG A 1 266 ? 24.109  53.043  9.230   1.00 59.95  ? 264 ARG A NE  1 
ATOM   1947  C CZ  . ARG A 1 266 ? 24.307  51.900  9.888   1.00 69.41  ? 264 ARG A CZ  1 
ATOM   1948  N NH1 . ARG A 1 266 ? 23.423  51.470  10.798  1.00 72.74  ? 264 ARG A NH1 1 
ATOM   1949  N NH2 . ARG A 1 266 ? 25.388  51.174  9.628   1.00 70.44  ? 264 ARG A NH2 1 
ATOM   1950  N N   . THR A 1 267 ? 22.426  58.404  10.239  1.00 54.35  ? 265 THR A N   1 
ATOM   1951  C CA  . THR A 1 267 ? 23.463  59.338  10.676  1.00 60.05  ? 265 THR A CA  1 
ATOM   1952  C C   . THR A 1 267 ? 23.494  59.405  12.214  1.00 60.97  ? 265 THR A C   1 
ATOM   1953  O O   . THR A 1 267 ? 24.558  59.388  12.816  1.00 59.35  ? 265 THR A O   1 
ATOM   1954  C CB  . THR A 1 267 ? 23.255  60.763  10.059  1.00 59.62  ? 265 THR A CB  1 
ATOM   1955  O OG1 . THR A 1 267 ? 23.809  60.788  8.733   1.00 63.65  ? 265 THR A OG1 1 
ATOM   1956  C CG2 . THR A 1 267 ? 23.958  61.842  10.899  1.00 62.10  ? 265 THR A CG2 1 
ATOM   1957  N N   . ARG A 1 268 ? 22.330  59.468  12.841  1.00 61.43  ? 266 ARG A N   1 
ATOM   1958  C CA  . ARG A 1 268 ? 22.287  59.498  14.282  1.00 64.55  ? 266 ARG A CA  1 
ATOM   1959  C C   . ARG A 1 268 ? 23.131  58.305  14.781  1.00 67.28  ? 266 ARG A C   1 
ATOM   1960  O O   . ARG A 1 268 ? 24.115  58.475  15.489  1.00 68.68  ? 266 ARG A O   1 
ATOM   1961  C CB  . ARG A 1 268 ? 20.831  59.386  14.792  1.00 62.53  ? 266 ARG A CB  1 
ATOM   1962  C CG  . ARG A 1 268 ? 19.879  60.457  14.274  1.00 63.26  ? 266 ARG A CG  1 
ATOM   1963  C CD  . ARG A 1 268 ? 18.598  60.476  15.115  1.00 68.26  ? 266 ARG A CD  1 
ATOM   1964  N NE  . ARG A 1 268 ? 17.659  61.559  14.784  1.00 67.30  ? 266 ARG A NE  1 
ATOM   1965  C CZ  . ARG A 1 268 ? 17.982  62.852  14.611  1.00 70.35  ? 266 ARG A CZ  1 
ATOM   1966  N NH1 . ARG A 1 268 ? 19.239  63.292  14.719  1.00 63.44  ? 266 ARG A NH1 1 
ATOM   1967  N NH2 . ARG A 1 268 ? 17.024  63.737  14.338  1.00 71.79  ? 266 ARG A NH2 1 
ATOM   1968  N N   . GLU A 1 269 ? 22.749  57.097  14.384  1.00 70.43  ? 267 GLU A N   1 
ATOM   1969  C CA  . GLU A 1 269 ? 23.431  55.876  14.805  1.00 71.09  ? 267 GLU A CA  1 
ATOM   1970  C C   . GLU A 1 269 ? 24.909  55.932  14.607  1.00 70.49  ? 267 GLU A C   1 
ATOM   1971  O O   . GLU A 1 269 ? 25.666  55.911  15.555  1.00 72.81  ? 267 GLU A O   1 
ATOM   1972  C CB  . GLU A 1 269 ? 22.892  54.680  14.031  1.00 74.93  ? 267 GLU A CB  1 
ATOM   1973  C CG  . GLU A 1 269 ? 21.712  54.012  14.681  1.00 81.46  ? 267 GLU A CG  1 
ATOM   1974  C CD  . GLU A 1 269 ? 21.117  52.945  13.801  1.00 87.69  ? 267 GLU A CD  1 
ATOM   1975  O OE1 . GLU A 1 269 ? 21.885  52.330  12.998  1.00 87.30  ? 267 GLU A OE1 1 
ATOM   1976  O OE2 . GLU A 1 269 ? 19.880  52.714  13.923  1.00 90.40  ? 267 GLU A OE2 1 
ATOM   1977  N N   . LEU A 1 270 ? 25.303  55.948  13.350  1.00 72.02  ? 268 LEU A N   1 
ATOM   1978  C CA  . LEU A 1 270 ? 26.697  56.002  12.998  1.00 76.36  ? 268 LEU A CA  1 
ATOM   1979  C C   . LEU A 1 270 ? 27.566  56.799  13.991  1.00 78.88  ? 268 LEU A C   1 
ATOM   1980  O O   . LEU A 1 270 ? 28.658  56.359  14.358  1.00 82.47  ? 268 LEU A O   1 
ATOM   1981  C CB  . LEU A 1 270 ? 26.853  56.584  11.585  1.00 74.58  ? 268 LEU A CB  1 
ATOM   1982  C CG  . LEU A 1 270 ? 26.462  55.834  10.313  1.00 71.97  ? 268 LEU A CG  1 
ATOM   1983  C CD1 . LEU A 1 270 ? 27.195  56.531  9.172   1.00 75.43  ? 268 LEU A CD1 1 
ATOM   1984  C CD2 . LEU A 1 270 ? 26.863  54.353  10.347  1.00 70.65  ? 268 LEU A CD2 1 
ATOM   1985  N N   . GLN A 1 271 ? 27.093  57.966  14.425  1.00 81.24  ? 269 GLN A N   1 
ATOM   1986  C CA  . GLN A 1 271 ? 27.850  58.806  15.356  1.00 81.26  ? 269 GLN A CA  1 
ATOM   1987  C C   . GLN A 1 271 ? 27.640  58.344  16.792  1.00 79.43  ? 269 GLN A C   1 
ATOM   1988  O O   . GLN A 1 271 ? 28.606  58.097  17.496  1.00 76.36  ? 269 GLN A O   1 
ATOM   1989  C CB  . GLN A 1 271 ? 27.457  60.279  15.145  1.00 86.49  ? 269 GLN A CB  1 
ATOM   1990  C CG  . GLN A 1 271 ? 26.653  60.953  16.248  1.00 95.17  ? 269 GLN A CG  1 
ATOM   1991  C CD  . GLN A 1 271 ? 25.553  61.901  15.715  1.00 99.73  ? 269 GLN A CD  1 
ATOM   1992  O OE1 . GLN A 1 271 ? 25.730  62.601  14.697  1.00 95.17  ? 269 GLN A OE1 1 
ATOM   1993  N NE2 . GLN A 1 271 ? 24.414  61.934  16.425  1.00 102.07 ? 269 GLN A NE2 1 
ATOM   1994  N N   . SER A 1 272 ? 26.380  58.185  17.202  1.00 82.44  ? 270 SER A N   1 
ATOM   1995  C CA  . SER A 1 272 ? 26.018  57.714  18.548  1.00 86.28  ? 270 SER A CA  1 
ATOM   1996  C C   . SER A 1 272 ? 26.335  56.210  18.682  1.00 89.88  ? 270 SER A C   1 
ATOM   1997  O O   . SER A 1 272 ? 25.656  55.449  19.376  1.00 88.62  ? 270 SER A O   1 
ATOM   1998  C CB  . SER A 1 272 ? 24.530  57.970  18.805  1.00 84.01  ? 270 SER A CB  1 
ATOM   1999  O OG  . SER A 1 272 ? 24.233  59.353  18.709  1.00 83.76  ? 270 SER A OG  1 
ATOM   2000  N N   . MET A 1 273 ? 27.400  55.817  17.999  1.00 94.64  ? 271 MET A N   1 
ATOM   2001  C CA  . MET A 1 273 ? 27.896  54.453  17.966  1.00 101.08 ? 271 MET A CA  1 
ATOM   2002  C C   . MET A 1 273 ? 29.415  54.575  17.982  1.00 105.15 ? 271 MET A C   1 
ATOM   2003  O O   . MET A 1 273 ? 30.126  53.692  18.470  1.00 107.21 ? 271 MET A O   1 
ATOM   2004  C CB  . MET A 1 273 ? 27.428  53.780  16.681  1.00 103.83 ? 271 MET A CB  1 
ATOM   2005  C CG  . MET A 1 273 ? 28.355  52.707  16.151  1.00 110.89 ? 271 MET A CG  1 
ATOM   2006  S SD  . MET A 1 273 ? 28.345  52.630  14.326  1.00 118.06 ? 271 MET A SD  1 
ATOM   2007  C CE  . MET A 1 273 ? 29.998  53.442  13.913  1.00 116.93 ? 271 MET A CE  1 
ATOM   2008  N N   . ALA A 1 274 ? 29.908  55.682  17.433  1.00 107.08 ? 272 ALA A N   1 
ATOM   2009  C CA  . ALA A 1 274 ? 31.331  55.941  17.418  1.00 110.40 ? 272 ALA A CA  1 
ATOM   2010  C C   . ALA A 1 274 ? 31.648  56.675  18.721  1.00 116.85 ? 272 ALA A C   1 
ATOM   2011  O O   . ALA A 1 274 ? 32.808  56.957  18.996  1.00 122.06 ? 272 ALA A O   1 
ATOM   2012  C CB  . ALA A 1 274 ? 31.704  56.795  16.217  1.00 103.30 ? 272 ALA A CB  1 
ATOM   2013  N N   . ASP A 1 275 ? 30.615  56.959  19.525  1.00 122.14 ? 273 ASP A N   1 
ATOM   2014  C CA  . ASP A 1 275 ? 30.774  57.666  20.804  1.00 126.47 ? 273 ASP A CA  1 
ATOM   2015  C C   . ASP A 1 275 ? 31.406  56.812  21.875  1.00 129.88 ? 273 ASP A C   1 
ATOM   2016  O O   . ASP A 1 275 ? 32.204  57.294  22.687  1.00 130.86 ? 273 ASP A O   1 
ATOM   2017  C CB  . ASP A 1 275 ? 29.435  58.154  21.342  1.00 126.87 ? 273 ASP A CB  1 
ATOM   2018  C CG  . ASP A 1 275 ? 28.793  59.199  20.459  1.00 129.69 ? 273 ASP A CG  1 
ATOM   2019  O OD1 . ASP A 1 275 ? 29.535  59.936  19.775  1.00 130.50 ? 273 ASP A OD1 1 
ATOM   2020  O OD2 . ASP A 1 275 ? 27.544  59.313  20.461  1.00 129.93 ? 273 ASP A OD2 1 
ATOM   2021  N N   . GLN A 1 276 ? 31.023  55.543  21.885  1.00 134.74 ? 274 GLN A N   1 
ATOM   2022  C CA  . GLN A 1 276 ? 31.549  54.590  22.847  1.00 141.35 ? 274 GLN A CA  1 
ATOM   2023  C C   . GLN A 1 276 ? 32.652  53.781  22.196  1.00 144.53 ? 274 GLN A C   1 
ATOM   2024  O O   . GLN A 1 276 ? 33.854  54.037  22.370  1.00 146.13 ? 274 GLN A O   1 
ATOM   2025  C CB  . GLN A 1 276 ? 30.468  53.613  23.268  1.00 142.31 ? 274 GLN A CB  1 
ATOM   2026  C CG  . GLN A 1 276 ? 29.199  54.218  23.766  1.00 144.93 ? 274 GLN A CG  1 
ATOM   2027  C CD  . GLN A 1 276 ? 28.243  53.154  24.255  1.00 146.17 ? 274 GLN A CD  1 
ATOM   2028  O OE1 . GLN A 1 276 ? 27.808  52.289  23.489  1.00 146.40 ? 274 GLN A OE1 1 
ATOM   2029  N NE2 . GLN A 1 276 ? 27.913  53.205  25.540  1.00 147.95 ? 274 GLN A NE2 1 
ATOM   2030  N N   . GLU A 1 277 ? 32.198  52.783  21.450  1.00 146.96 ? 275 GLU A N   1 
ATOM   2031  C CA  . GLU A 1 277 ? 33.057  51.865  20.736  1.00 149.77 ? 275 GLU A CA  1 
ATOM   2032  C C   . GLU A 1 277 ? 33.466  52.509  19.412  1.00 149.92 ? 275 GLU A C   1 
ATOM   2033  O O   . GLU A 1 277 ? 34.630  52.941  19.318  1.00 149.55 ? 275 GLU A O   1 
ATOM   2034  C CB  . GLU A 1 277 ? 32.271  50.586  20.477  1.00 151.96 ? 275 GLU A CB  1 
ATOM   2035  C CG  . GLU A 1 277 ? 33.071  49.321  20.430  1.00 155.62 ? 275 GLU A CG  1 
ATOM   2036  C CD  . GLU A 1 277 ? 32.165  48.125  20.278  1.00 158.12 ? 275 GLU A CD  1 
ATOM   2037  O OE1 . GLU A 1 277 ? 31.297  47.940  21.161  1.00 159.61 ? 275 GLU A OE1 1 
ATOM   2038  O OE2 . GLU A 1 277 ? 32.312  47.379  19.281  1.00 160.02 ? 275 GLU A OE2 1 
ATOM   2039  N N   . ARG B 1 1   ? 11.223  -10.665 21.128  1.00 164.44 ? -1  ARG B N   1 
ATOM   2040  C CA  . ARG B 1 1   ? 10.189  -10.461 20.067  1.00 165.06 ? -1  ARG B CA  1 
ATOM   2041  C C   . ARG B 1 1   ? 8.760   -10.608 20.600  1.00 166.26 ? -1  ARG B C   1 
ATOM   2042  O O   . ARG B 1 1   ? 7.874   -11.047 19.863  1.00 166.20 ? -1  ARG B O   1 
ATOM   2043  C CB  . ARG B 1 1   ? 10.424  -11.443 18.924  1.00 162.00 ? -1  ARG B CB  1 
ATOM   2044  N N   . ALA B 1 2   ? 8.544   -10.237 21.869  1.00 167.90 ? 0   ALA B N   1 
ATOM   2045  C CA  . ALA B 1 2   ? 7.221   -10.320 22.525  1.00 168.70 ? 0   ALA B CA  1 
ATOM   2046  C C   . ALA B 1 2   ? 7.152   -9.390  23.754  1.00 169.31 ? 0   ALA B C   1 
ATOM   2047  O O   . ALA B 1 2   ? 8.071   -9.405  24.581  1.00 170.36 ? 0   ALA B O   1 
ATOM   2048  C CB  . ALA B 1 2   ? 6.940   -11.769 22.954  1.00 168.17 ? 0   ALA B CB  1 
ATOM   2049  N N   . MET B 1 3   ? 6.074   -8.599  23.884  1.00 169.57 ? 1   MET B N   1 
ATOM   2050  C CA  . MET B 1 3   ? 5.924   -7.663  25.023  1.00 168.41 ? 1   MET B CA  1 
ATOM   2051  C C   . MET B 1 3   ? 4.538   -7.058  25.323  1.00 166.98 ? 1   MET B C   1 
ATOM   2052  O O   . MET B 1 3   ? 3.495   -7.688  25.131  1.00 167.04 ? 1   MET B O   1 
ATOM   2053  C CB  . MET B 1 3   ? 6.898   -6.481  24.885  1.00 168.37 ? 1   MET B CB  1 
ATOM   2054  C CG  . MET B 1 3   ? 6.469   -5.454  23.839  1.00 168.91 ? 1   MET B CG  1 
ATOM   2055  S SD  . MET B 1 3   ? 7.109   -3.794  24.135  1.00 170.89 ? 1   MET B SD  1 
ATOM   2056  C CE  . MET B 1 3   ? 8.681   -3.835  23.235  1.00 170.21 ? 1   MET B CE  1 
ATOM   2057  N N   . SER B 1 4   ? 4.581   -5.821  25.829  1.00 164.99 ? 2   SER B N   1 
ATOM   2058  C CA  . SER B 1 4   ? 3.420   -5.007  26.202  1.00 162.86 ? 2   SER B CA  1 
ATOM   2059  C C   . SER B 1 4   ? 3.905   -3.545  26.150  1.00 161.88 ? 2   SER B C   1 
ATOM   2060  O O   . SER B 1 4   ? 5.041   -3.294  25.743  1.00 161.86 ? 2   SER B O   1 
ATOM   2061  C CB  . SER B 1 4   ? 2.956   -5.366  27.625  1.00 161.98 ? 2   SER B CB  1 
ATOM   2062  O OG  . SER B 1 4   ? 1.818   -4.617  28.028  1.00 160.15 ? 2   SER B OG  1 
ATOM   2063  N N   . VAL B 1 5   ? 3.069   -2.585  26.550  1.00 159.69 ? 3   VAL B N   1 
ATOM   2064  C CA  . VAL B 1 5   ? 3.477   -1.173  26.530  1.00 156.52 ? 3   VAL B CA  1 
ATOM   2065  C C   . VAL B 1 5   ? 2.677   -0.252  27.443  1.00 154.36 ? 3   VAL B C   1 
ATOM   2066  O O   . VAL B 1 5   ? 1.463   -0.398  27.612  1.00 153.06 ? 3   VAL B O   1 
ATOM   2067  C CB  . VAL B 1 5   ? 3.416   -0.573  25.103  1.00 157.39 ? 3   VAL B CB  1 
ATOM   2068  C CG1 . VAL B 1 5   ? 3.390   0.952   25.179  1.00 159.21 ? 3   VAL B CG1 1 
ATOM   2069  C CG2 . VAL B 1 5   ? 4.627   -1.013  24.293  1.00 156.47 ? 3   VAL B CG2 1 
ATOM   2070  N N   . GLY B 1 6   ? 3.379   0.717   28.016  1.00 152.48 ? 4   GLY B N   1 
ATOM   2071  C CA  . GLY B 1 6   ? 2.731   1.661   28.898  1.00 151.25 ? 4   GLY B CA  1 
ATOM   2072  C C   . GLY B 1 6   ? 2.215   2.860   28.135  1.00 149.73 ? 4   GLY B C   1 
ATOM   2073  O O   . GLY B 1 6   ? 2.907   3.871   28.007  1.00 149.07 ? 4   GLY B O   1 
ATOM   2074  N N   . PHE B 1 7   ? 1.004   2.742   27.604  1.00 148.92 ? 5   PHE B N   1 
ATOM   2075  C CA  . PHE B 1 7   ? 0.401   3.846   26.872  1.00 149.90 ? 5   PHE B CA  1 
ATOM   2076  C C   . PHE B 1 7   ? -0.349  4.728   27.866  1.00 151.29 ? 5   PHE B C   1 
ATOM   2077  O O   . PHE B 1 7   ? -1.580  4.832   27.840  1.00 150.25 ? 5   PHE B O   1 
ATOM   2078  C CB  . PHE B 1 7   ? -0.552  3.323   25.801  1.00 149.25 ? 5   PHE B CB  1 
ATOM   2079  C CG  . PHE B 1 7   ? -0.099  3.588   24.383  1.00 147.28 ? 5   PHE B CG  1 
ATOM   2080  C CD1 . PHE B 1 7   ? -0.206  4.857   23.831  1.00 145.46 ? 5   PHE B CD1 1 
ATOM   2081  C CD2 . PHE B 1 7   ? 0.393   2.551   23.590  1.00 146.91 ? 5   PHE B CD2 1 
ATOM   2082  C CE1 . PHE B 1 7   ? 0.159   5.084   22.527  1.00 144.79 ? 5   PHE B CE1 1 
ATOM   2083  C CE2 . PHE B 1 7   ? 0.763   2.769   22.275  1.00 145.06 ? 5   PHE B CE2 1 
ATOM   2084  C CZ  . PHE B 1 7   ? 0.645   4.036   21.745  1.00 145.60 ? 5   PHE B CZ  1 
ATOM   2085  N N   . ILE B 1 8   ? 0.429   5.349   28.750  1.00 153.42 ? 6   ILE B N   1 
ATOM   2086  C CA  . ILE B 1 8   ? -0.062  6.249   29.796  1.00 154.96 ? 6   ILE B CA  1 
ATOM   2087  C C   . ILE B 1 8   ? -0.771  7.456   29.177  1.00 153.91 ? 6   ILE B C   1 
ATOM   2088  O O   . ILE B 1 8   ? -1.377  8.270   29.871  1.00 152.36 ? 6   ILE B O   1 
ATOM   2089  C CB  . ILE B 1 8   ? 1.128   6.739   30.695  1.00 157.15 ? 6   ILE B CB  1 
ATOM   2090  C CG1 . ILE B 1 8   ? 1.845   5.531   31.330  1.00 157.38 ? 6   ILE B CG1 1 
ATOM   2091  C CG2 . ILE B 1 8   ? 0.620   7.701   31.765  1.00 157.71 ? 6   ILE B CG2 1 
ATOM   2092  C CD1 . ILE B 1 8   ? 3.205   5.852   31.946  1.00 156.40 ? 6   ILE B CD1 1 
ATOM   2093  N N   . GLY B 1 9   ? -0.680  7.548   27.856  1.00 153.94 ? 7   GLY B N   1 
ATOM   2094  C CA  . GLY B 1 9   ? -1.300  8.635   27.132  1.00 154.34 ? 7   GLY B CA  1 
ATOM   2095  C C   . GLY B 1 9   ? -2.301  8.113   26.127  1.00 154.81 ? 7   GLY B C   1 
ATOM   2096  O O   . GLY B 1 9   ? -1.958  7.816   24.977  1.00 154.32 ? 7   GLY B O   1 
ATOM   2097  N N   . ALA B 1 10  ? -3.546  7.988   26.579  1.00 155.44 ? 8   ALA B N   1 
ATOM   2098  C CA  . ALA B 1 10  ? -4.635  7.512   25.736  1.00 155.95 ? 8   ALA B CA  1 
ATOM   2099  C C   . ALA B 1 10  ? -5.370  8.691   25.094  1.00 155.85 ? 8   ALA B C   1 
ATOM   2100  O O   . ALA B 1 10  ? -6.011  9.484   25.792  1.00 157.04 ? 8   ALA B O   1 
ATOM   2101  C CB  . ALA B 1 10  ? -5.603  6.670   26.567  1.00 155.30 ? 8   ALA B CB  1 
ATOM   2102  N N   . GLY B 1 11  ? -5.271  8.807   23.769  1.00 153.85 ? 9   GLY B N   1 
ATOM   2103  C CA  . GLY B 1 11  ? -5.935  9.895   23.078  1.00 152.29 ? 9   GLY B CA  1 
ATOM   2104  C C   . GLY B 1 11  ? -5.380  10.127  21.693  1.00 151.42 ? 9   GLY B C   1 
ATOM   2105  O O   . GLY B 1 11  ? -5.826  9.511   20.726  1.00 152.12 ? 9   GLY B O   1 
ATOM   2106  N N   . GLN B 1 12  ? -4.415  11.038  21.597  1.00 149.89 ? 10  GLN B N   1 
ATOM   2107  C CA  . GLN B 1 12  ? -3.779  11.354  20.323  1.00 147.82 ? 10  GLN B CA  1 
ATOM   2108  C C   . GLN B 1 12  ? -2.972  10.145  19.913  1.00 144.96 ? 10  GLN B C   1 
ATOM   2109  O O   . GLN B 1 12  ? -3.530  9.122   19.528  1.00 147.11 ? 10  GLN B O   1 
ATOM   2110  C CB  . GLN B 1 12  ? -2.879  12.593  20.454  1.00 148.30 ? 10  GLN B CB  1 
ATOM   2111  C CG  . GLN B 1 12  ? -3.532  13.862  19.932  1.00 152.60 ? 10  GLN B CG  1 
ATOM   2112  C CD  . GLN B 1 12  ? -4.954  14.056  20.462  1.00 156.40 ? 10  GLN B CD  1 
ATOM   2113  O OE1 . GLN B 1 12  ? -5.829  13.209  20.257  1.00 157.12 ? 10  GLN B OE1 1 
ATOM   2114  N NE2 . GLN B 1 12  ? -5.188  15.179  21.138  1.00 158.16 ? 10  GLN B NE2 1 
ATOM   2115  N N   . LEU B 1 13  ? -1.659  10.239  20.016  1.00 140.50 ? 11  LEU B N   1 
ATOM   2116  C CA  . LEU B 1 13  ? -0.820  9.115   19.641  1.00 135.65 ? 11  LEU B CA  1 
ATOM   2117  C C   . LEU B 1 13  ? -1.328  7.777   20.216  1.00 131.65 ? 11  LEU B C   1 
ATOM   2118  O O   . LEU B 1 13  ? -1.031  6.719   19.667  1.00 129.99 ? 11  LEU B O   1 
ATOM   2119  C CB  . LEU B 1 13  ? 0.616   9.390   20.082  1.00 136.56 ? 11  LEU B CB  1 
ATOM   2120  C CG  . LEU B 1 13  ? 1.044   10.847  19.832  1.00 138.17 ? 11  LEU B CG  1 
ATOM   2121  C CD1 . LEU B 1 13  ? 2.511   11.014  20.216  1.00 140.32 ? 11  LEU B CD1 1 
ATOM   2122  C CD2 . LEU B 1 13  ? 0.818   11.242  18.370  1.00 137.70 ? 11  LEU B CD2 1 
ATOM   2123  N N   . ALA B 1 14  ? -2.095  7.811   21.306  1.00 127.02 ? 12  ALA B N   1 
ATOM   2124  C CA  . ALA B 1 14  ? -2.611  6.565   21.875  1.00 123.06 ? 12  ALA B CA  1 
ATOM   2125  C C   . ALA B 1 14  ? -3.412  5.890   20.791  1.00 122.18 ? 12  ALA B C   1 
ATOM   2126  O O   . ALA B 1 14  ? -3.022  4.848   20.270  1.00 120.33 ? 12  ALA B O   1 
ATOM   2127  C CB  . ALA B 1 14  ? -3.498  6.842   23.043  1.00 118.85 ? 12  ALA B CB  1 
ATOM   2128  N N   . PHE B 1 15  ? -4.544  6.515   20.473  1.00 122.91 ? 13  PHE B N   1 
ATOM   2129  C CA  . PHE B 1 15  ? -5.471  6.068   19.434  1.00 123.41 ? 13  PHE B CA  1 
ATOM   2130  C C   . PHE B 1 15  ? -4.654  5.719   18.190  1.00 124.98 ? 13  PHE B C   1 
ATOM   2131  O O   . PHE B 1 15  ? -4.879  4.677   17.560  1.00 124.50 ? 13  PHE B O   1 
ATOM   2132  C CB  . PHE B 1 15  ? -6.452  7.217   19.110  1.00 122.00 ? 13  PHE B CB  1 
ATOM   2133  C CG  . PHE B 1 15  ? -7.663  6.811   18.300  1.00 122.83 ? 13  PHE B CG  1 
ATOM   2134  C CD1 . PHE B 1 15  ? -8.613  7.777   17.937  1.00 122.07 ? 13  PHE B CD1 1 
ATOM   2135  C CD2 . PHE B 1 15  ? -7.879  5.478   17.929  1.00 123.10 ? 13  PHE B CD2 1 
ATOM   2136  C CE1 . PHE B 1 15  ? -9.763  7.428   17.221  1.00 123.38 ? 13  PHE B CE1 1 
ATOM   2137  C CE2 . PHE B 1 15  ? -9.024  5.111   17.213  1.00 123.56 ? 13  PHE B CE2 1 
ATOM   2138  C CZ  . PHE B 1 15  ? -9.973  6.092   16.857  1.00 124.97 ? 13  PHE B CZ  1 
ATOM   2139  N N   . ALA B 1 16  ? -3.700  6.601   17.867  1.00 126.19 ? 14  ALA B N   1 
ATOM   2140  C CA  . ALA B 1 16  ? -2.830  6.475   16.693  1.00 125.78 ? 14  ALA B CA  1 
ATOM   2141  C C   . ALA B 1 16  ? -1.923  5.246   16.688  1.00 125.14 ? 14  ALA B C   1 
ATOM   2142  O O   . ALA B 1 16  ? -1.834  4.551   15.672  1.00 127.41 ? 14  ALA B O   1 
ATOM   2143  C CB  . ALA B 1 16  ? -1.982  7.753   16.517  1.00 125.17 ? 14  ALA B CB  1 
ATOM   2144  N N   . LEU B 1 17  ? -1.239  4.984   17.800  1.00 121.82 ? 15  LEU B N   1 
ATOM   2145  C CA  . LEU B 1 17  ? -0.354  3.820   17.884  1.00 117.82 ? 15  LEU B CA  1 
ATOM   2146  C C   . LEU B 1 17  ? -1.175  2.667   18.441  1.00 116.87 ? 15  LEU B C   1 
ATOM   2147  O O   . LEU B 1 17  ? -0.745  1.513   18.499  1.00 113.77 ? 15  LEU B O   1 
ATOM   2148  C CB  . LEU B 1 17  ? 0.842   4.151   18.764  1.00 115.54 ? 15  LEU B CB  1 
ATOM   2149  C CG  . LEU B 1 17  ? 1.621   5.367   18.251  1.00 111.98 ? 15  LEU B CG  1 
ATOM   2150  C CD1 . LEU B 1 17  ? 1.819   6.377   19.369  1.00 107.15 ? 15  LEU B CD1 1 
ATOM   2151  C CD2 . LEU B 1 17  ? 2.939   4.905   17.661  1.00 109.94 ? 15  LEU B CD2 1 
ATOM   2152  N N   . ALA B 1 18  ? -2.386  3.012   18.848  1.00 117.20 ? 16  ALA B N   1 
ATOM   2153  C CA  . ALA B 1 18  ? -3.322  2.021   19.316  1.00 118.79 ? 16  ALA B CA  1 
ATOM   2154  C C   . ALA B 1 18  ? -3.578  1.234   18.035  1.00 120.75 ? 16  ALA B C   1 
ATOM   2155  O O   . ALA B 1 18  ? -2.904  0.235   17.766  1.00 120.09 ? 16  ALA B O   1 
ATOM   2156  C CB  . ALA B 1 18  ? -4.598  2.690   19.784  1.00 117.77 ? 16  ALA B CB  1 
ATOM   2157  N N   . LYS B 1 19  ? -4.521  1.729   17.229  1.00 122.60 ? 17  LYS B N   1 
ATOM   2158  C CA  . LYS B 1 19  ? -4.869  1.113   15.945  1.00 123.85 ? 17  LYS B CA  1 
ATOM   2159  C C   . LYS B 1 19  ? -3.616  0.871   15.092  1.00 122.85 ? 17  LYS B C   1 
ATOM   2160  O O   . LYS B 1 19  ? -3.669  0.179   14.066  1.00 122.53 ? 17  LYS B O   1 
ATOM   2161  C CB  . LYS B 1 19  ? -5.840  2.011   15.176  1.00 126.20 ? 17  LYS B CB  1 
ATOM   2162  C CG  . LYS B 1 19  ? -6.345  1.408   13.867  1.00 128.41 ? 17  LYS B CG  1 
ATOM   2163  C CD  . LYS B 1 19  ? -7.161  2.423   13.066  1.00 132.59 ? 17  LYS B CD  1 
ATOM   2164  C CE  . LYS B 1 19  ? -8.214  3.122   13.933  1.00 135.29 ? 17  LYS B CE  1 
ATOM   2165  N NZ  . LYS B 1 19  ? -8.987  2.148   14.759  1.00 137.41 ? 17  LYS B NZ  1 
ATOM   2166  N N   . GLY B 1 20  ? -2.503  1.460   15.522  1.00 121.52 ? 18  GLY B N   1 
ATOM   2167  C CA  . GLY B 1 20  ? -1.247  1.294   14.828  1.00 119.52 ? 18  GLY B CA  1 
ATOM   2168  C C   . GLY B 1 20  ? -0.669  -0.013  15.313  1.00 120.78 ? 18  GLY B C   1 
ATOM   2169  O O   . GLY B 1 20  ? -1.038  -0.513  16.375  1.00 117.41 ? 18  GLY B O   1 
ATOM   2170  N N   . PHE B 1 21  ? 0.250   -0.559  14.528  1.00 124.12 ? 19  PHE B N   1 
ATOM   2171  C CA  . PHE B 1 21  ? 0.890   -1.823  14.839  1.00 126.72 ? 19  PHE B CA  1 
ATOM   2172  C C   . PHE B 1 21  ? -0.009  -2.701  15.679  1.00 130.40 ? 19  PHE B C   1 
ATOM   2173  O O   . PHE B 1 21  ? 0.429   -3.276  16.678  1.00 130.91 ? 19  PHE B O   1 
ATOM   2174  C CB  . PHE B 1 21  ? 2.257   -1.622  15.532  1.00 123.19 ? 19  PHE B CB  1 
ATOM   2175  C CG  . PHE B 1 21  ? 2.259   -0.605  16.647  1.00 120.44 ? 19  PHE B CG  1 
ATOM   2176  C CD1 . PHE B 1 21  ? 1.359   -0.689  17.704  1.00 118.96 ? 19  PHE B CD1 1 
ATOM   2177  C CD2 . PHE B 1 21  ? 3.202   0.423   16.658  1.00 117.60 ? 19  PHE B CD2 1 
ATOM   2178  C CE1 . PHE B 1 21  ? 1.403   0.231   18.747  1.00 116.50 ? 19  PHE B CE1 1 
ATOM   2179  C CE2 . PHE B 1 21  ? 3.248   1.344   17.698  1.00 114.57 ? 19  PHE B CE2 1 
ATOM   2180  C CZ  . PHE B 1 21  ? 2.348   1.246   18.741  1.00 115.09 ? 19  PHE B CZ  1 
ATOM   2181  N N   . THR B 1 22  ? -1.280  -2.775  15.278  1.00 135.17 ? 20  THR B N   1 
ATOM   2182  C CA  . THR B 1 22  ? -2.246  -3.626  15.969  1.00 141.74 ? 20  THR B CA  1 
ATOM   2183  C C   . THR B 1 22  ? -1.990  -5.012  15.400  1.00 148.08 ? 20  THR B C   1 
ATOM   2184  O O   . THR B 1 22  ? -1.045  -5.694  15.811  1.00 151.76 ? 20  THR B O   1 
ATOM   2185  C CB  . THR B 1 22  ? -3.715  -3.229  15.679  1.00 139.39 ? 20  THR B CB  1 
ATOM   2186  O OG1 . THR B 1 22  ? -3.934  -3.137  14.268  1.00 137.53 ? 20  THR B OG1 1 
ATOM   2187  C CG2 . THR B 1 22  ? -4.039  -1.915  16.326  1.00 138.83 ? 20  THR B CG2 1 
ATOM   2188  N N   . ALA B 1 23  ? -2.827  -5.438  14.459  1.00 152.48 ? 21  ALA B N   1 
ATOM   2189  C CA  . ALA B 1 23  ? -2.601  -6.726  13.817  1.00 154.41 ? 21  ALA B CA  1 
ATOM   2190  C C   . ALA B 1 23  ? -1.579  -6.372  12.736  1.00 154.60 ? 21  ALA B C   1 
ATOM   2191  O O   . ALA B 1 23  ? -0.972  -7.258  12.123  1.00 155.48 ? 21  ALA B O   1 
ATOM   2192  C CB  . ALA B 1 23  ? -3.900  -7.273  13.196  1.00 154.72 ? 21  ALA B CB  1 
ATOM   2193  N N   . ALA B 1 24  ? -1.395  -5.060  12.538  1.00 153.24 ? 22  ALA B N   1 
ATOM   2194  C CA  . ALA B 1 24  ? -0.450  -4.542  11.562  1.00 152.62 ? 22  ALA B CA  1 
ATOM   2195  C C   . ALA B 1 24  ? 0.829   -5.320  11.763  1.00 154.04 ? 22  ALA B C   1 
ATOM   2196  O O   . ALA B 1 24  ? 1.537   -5.620  10.804  1.00 154.14 ? 22  ALA B O   1 
ATOM   2197  C CB  . ALA B 1 24  ? -0.207  -3.059  11.783  1.00 149.44 ? 22  ALA B CB  1 
ATOM   2198  N N   . GLY B 1 25  ? 1.105   -5.666  13.021  1.00 156.18 ? 23  GLY B N   1 
ATOM   2199  C CA  . GLY B 1 25  ? 2.299   -6.433  13.337  1.00 160.30 ? 23  GLY B CA  1 
ATOM   2200  C C   . GLY B 1 25  ? 2.676   -6.589  14.810  1.00 163.22 ? 23  GLY B C   1 
ATOM   2201  O O   . GLY B 1 25  ? 2.327   -5.748  15.652  1.00 163.17 ? 23  GLY B O   1 
ATOM   2202  N N   . VAL B 1 26  ? 3.415   -7.674  15.086  1.00 166.07 ? 24  VAL B N   1 
ATOM   2203  C CA  . VAL B 1 26  ? 3.931   -8.087  16.413  1.00 167.09 ? 24  VAL B CA  1 
ATOM   2204  C C   . VAL B 1 26  ? 2.981   -8.062  17.629  1.00 168.15 ? 24  VAL B C   1 
ATOM   2205  O O   . VAL B 1 26  ? 2.616   -9.124  18.158  1.00 168.19 ? 24  VAL B O   1 
ATOM   2206  C CB  . VAL B 1 26  ? 5.234   -7.304  16.802  1.00 166.60 ? 24  VAL B CB  1 
ATOM   2207  C CG1 . VAL B 1 26  ? 5.685   -7.698  18.209  1.00 164.64 ? 24  VAL B CG1 1 
ATOM   2208  C CG2 . VAL B 1 26  ? 6.356   -7.616  15.812  1.00 165.31 ? 24  VAL B CG2 1 
ATOM   2209  N N   . LEU B 1 27  ? 2.604   -6.863  18.074  1.00 167.83 ? 25  LEU B N   1 
ATOM   2210  C CA  . LEU B 1 27  ? 1.726   -6.696  19.232  1.00 166.88 ? 25  LEU B CA  1 
ATOM   2211  C C   . LEU B 1 27  ? 0.282   -7.181  19.048  1.00 166.41 ? 25  LEU B C   1 
ATOM   2212  O O   . LEU B 1 27  ? -0.128  -7.571  17.953  1.00 166.92 ? 25  LEU B O   1 
ATOM   2213  C CB  . LEU B 1 27  ? 1.727   -5.226  19.652  1.00 166.26 ? 25  LEU B CB  1 
ATOM   2214  C CG  . LEU B 1 27  ? 3.127   -4.703  19.991  1.00 166.23 ? 25  LEU B CG  1 
ATOM   2215  C CD1 . LEU B 1 27  ? 3.054   -3.236  20.377  1.00 168.19 ? 25  LEU B CD1 1 
ATOM   2216  C CD2 . LEU B 1 27  ? 3.717   -5.528  21.130  1.00 165.24 ? 25  LEU B CD2 1 
ATOM   2217  N N   . ALA B 1 28  ? -0.479  -7.164  20.139  1.00 165.15 ? 26  ALA B N   1 
ATOM   2218  C CA  . ALA B 1 28  ? -1.874  -7.585  20.123  1.00 164.25 ? 26  ALA B CA  1 
ATOM   2219  C C   . ALA B 1 28  ? -2.648  -6.645  21.026  1.00 163.99 ? 26  ALA B C   1 
ATOM   2220  O O   . ALA B 1 28  ? -2.221  -6.338  22.138  1.00 163.72 ? 26  ALA B O   1 
ATOM   2221  C CB  . ALA B 1 28  ? -2.004  -9.018  20.614  1.00 163.35 ? 26  ALA B CB  1 
ATOM   2222  N N   . ALA B 1 29  ? -3.792  -6.196  20.529  1.00 164.30 ? 27  ALA B N   1 
ATOM   2223  C CA  . ALA B 1 29  ? -4.653  -5.258  21.238  1.00 165.36 ? 27  ALA B CA  1 
ATOM   2224  C C   . ALA B 1 29  ? -4.745  -5.454  22.749  1.00 166.03 ? 27  ALA B C   1 
ATOM   2225  O O   . ALA B 1 29  ? -4.905  -4.495  23.508  1.00 164.81 ? 27  ALA B O   1 
ATOM   2226  C CB  . ALA B 1 29  ? -6.064  -5.291  20.613  1.00 164.22 ? 27  ALA B CB  1 
ATOM   2227  N N   . HIS B 1 30  ? -4.628  -6.696  23.191  1.00 167.93 ? 28  HIS B N   1 
ATOM   2228  C CA  . HIS B 1 30  ? -4.755  -6.977  24.608  1.00 170.12 ? 28  HIS B CA  1 
ATOM   2229  C C   . HIS B 1 30  ? -3.469  -7.112  25.401  1.00 169.35 ? 28  HIS B C   1 
ATOM   2230  O O   . HIS B 1 30  ? -3.439  -6.764  26.591  1.00 170.31 ? 28  HIS B O   1 
ATOM   2231  C CB  . HIS B 1 30  ? -5.631  -8.213  24.784  1.00 174.30 ? 28  HIS B CB  1 
ATOM   2232  C CG  . HIS B 1 30  ? -7.084  -7.942  24.524  1.00 178.92 ? 28  HIS B CG  1 
ATOM   2233  N ND1 . HIS B 1 30  ? -7.925  -8.859  23.928  1.00 180.86 ? 28  HIS B ND1 1 
ATOM   2234  C CD2 . HIS B 1 30  ? -7.842  -6.852  24.785  1.00 181.18 ? 28  HIS B CD2 1 
ATOM   2235  C CE1 . HIS B 1 30  ? -9.139  -8.343  23.834  1.00 181.87 ? 28  HIS B CE1 1 
ATOM   2236  N NE2 . HIS B 1 30  ? -9.117  -7.126  24.345  1.00 183.29 ? 28  HIS B NE2 1 
ATOM   2237  N N   . LYS B 1 31  ? -2.411  -7.602  24.755  1.00 167.36 ? 29  LYS B N   1 
ATOM   2238  C CA  . LYS B 1 31  ? -1.116  -7.791  25.418  1.00 164.42 ? 29  LYS B CA  1 
ATOM   2239  C C   . LYS B 1 31  ? -0.467  -6.489  25.908  1.00 165.96 ? 29  LYS B C   1 
ATOM   2240  O O   . LYS B 1 31  ? 0.747   -6.439  26.099  1.00 164.99 ? 29  LYS B O   1 
ATOM   2241  C CB  . LYS B 1 31  ? -0.150  -8.521  24.475  1.00 157.54 ? 29  LYS B CB  1 
ATOM   2242  C CG  . LYS B 1 31  ? -0.363  -10.030 24.372  1.00 147.63 ? 29  LYS B CG  1 
ATOM   2243  C CD  . LYS B 1 31  ? 0.763   -10.682 23.590  1.00 138.20 ? 29  LYS B CD  1 
ATOM   2244  C CE  . LYS B 1 31  ? 2.133   -10.209 24.078  1.00 132.58 ? 29  LYS B CE  1 
ATOM   2245  N NZ  . LYS B 1 31  ? 3.254   -10.738 23.254  1.00 126.47 ? 29  LYS B NZ  1 
ATOM   2246  N N   . ILE B 1 32  ? -1.279  -5.452  26.125  1.00 168.38 ? 30  ILE B N   1 
ATOM   2247  C CA  . ILE B 1 32  ? -0.783  -4.150  26.574  1.00 170.47 ? 30  ILE B CA  1 
ATOM   2248  C C   . ILE B 1 32  ? -1.902  -3.327  27.215  1.00 173.02 ? 30  ILE B C   1 
ATOM   2249  O O   . ILE B 1 32  ? -3.062  -3.419  26.798  1.00 173.84 ? 30  ILE B O   1 
ATOM   2250  C CB  . ILE B 1 32  ? -0.237  -3.350  25.389  1.00 169.62 ? 30  ILE B CB  1 
ATOM   2251  C CG1 . ILE B 1 32  ? 0.820   -4.172  24.654  1.00 169.76 ? 30  ILE B CG1 1 
ATOM   2252  C CG2 . ILE B 1 32  ? 0.326   -2.034  25.875  1.00 167.53 ? 30  ILE B CG2 1 
ATOM   2253  C CD1 . ILE B 1 32  ? 0.787   -4.037  23.150  1.00 172.23 ? 30  ILE B CD1 1 
ATOM   2254  N N   . MET B 1 33  ? -1.561  -2.521  28.224  1.00 174.90 ? 31  MET B N   1 
ATOM   2255  C CA  . MET B 1 33  ? -2.575  -1.693  28.881  1.00 175.48 ? 31  MET B CA  1 
ATOM   2256  C C   . MET B 1 33  ? -2.420  -0.205  28.585  1.00 176.01 ? 31  MET B C   1 
ATOM   2257  O O   . MET B 1 33  ? -1.308  0.288   28.359  1.00 174.69 ? 31  MET B O   1 
ATOM   2258  C CB  . MET B 1 33  ? -2.580  -1.907  30.400  1.00 174.63 ? 31  MET B CB  1 
ATOM   2259  C CG  . MET B 1 33  ? -3.804  -1.280  31.084  1.00 173.25 ? 31  MET B CG  1 
ATOM   2260  S SD  . MET B 1 33  ? -3.895  -1.503  32.877  1.00 171.73 ? 31  MET B SD  1 
ATOM   2261  C CE  . MET B 1 33  ? -4.879  -3.005  32.976  1.00 169.53 ? 31  MET B CE  1 
ATOM   2262  N N   . ALA B 1 34  ? -3.554  0.495   28.591  1.00 177.54 ? 32  ALA B N   1 
ATOM   2263  C CA  . ALA B 1 34  ? -3.605  1.929   28.320  1.00 179.16 ? 32  ALA B CA  1 
ATOM   2264  C C   . ALA B 1 34  ? -3.909  2.711   29.594  1.00 180.49 ? 32  ALA B C   1 
ATOM   2265  O O   . ALA B 1 34  ? -4.411  2.151   30.568  1.00 181.30 ? 32  ALA B O   1 
ATOM   2266  C CB  . ALA B 1 34  ? -4.678  2.221   27.262  1.00 178.36 ? 32  ALA B CB  1 
ATOM   2267  N N   . SER B 1 35  ? -3.591  4.003   29.586  1.00 181.47 ? 33  SER B N   1 
ATOM   2268  C CA  . SER B 1 35  ? -3.853  4.865   30.736  1.00 182.02 ? 33  SER B CA  1 
ATOM   2269  C C   . SER B 1 35  ? -4.473  6.166   30.242  1.00 183.09 ? 33  SER B C   1 
ATOM   2270  O O   . SER B 1 35  ? -3.840  6.921   29.500  1.00 183.50 ? 33  SER B O   1 
ATOM   2271  C CB  . SER B 1 35  ? -2.563  5.164   31.508  1.00 180.59 ? 33  SER B CB  1 
ATOM   2272  O OG  . SER B 1 35  ? -2.812  6.050   32.588  1.00 177.47 ? 33  SER B OG  1 
ATOM   2273  N N   . SER B 1 36  ? -5.718  6.412   30.646  1.00 183.50 ? 34  SER B N   1 
ATOM   2274  C CA  . SER B 1 36  ? -6.435  7.618   30.251  1.00 183.41 ? 34  SER B CA  1 
ATOM   2275  C C   . SER B 1 36  ? -6.409  8.629   31.387  1.00 185.00 ? 34  SER B C   1 
ATOM   2276  O O   . SER B 1 36  ? -7.097  8.447   32.391  1.00 185.38 ? 34  SER B O   1 
ATOM   2277  C CB  . SER B 1 36  ? -7.893  7.289   29.893  1.00 181.46 ? 34  SER B CB  1 
ATOM   2278  O OG  . SER B 1 36  ? -8.617  6.771   30.999  1.00 177.57 ? 34  SER B OG  1 
ATOM   2279  N N   . PRO B 1 37  ? -5.602  9.702   31.253  1.00 186.32 ? 35  PRO B N   1 
ATOM   2280  C CA  . PRO B 1 37  ? -5.537  10.714  32.312  1.00 186.79 ? 35  PRO B CA  1 
ATOM   2281  C C   . PRO B 1 37  ? -6.841  11.521  32.403  1.00 187.07 ? 35  PRO B C   1 
ATOM   2282  O O   . PRO B 1 37  ? -6.808  12.759  32.472  1.00 187.26 ? 35  PRO B O   1 
ATOM   2283  C CB  . PRO B 1 37  ? -4.332  11.564  31.900  1.00 186.40 ? 35  PRO B CB  1 
ATOM   2284  C CG  . PRO B 1 37  ? -4.408  11.515  30.411  1.00 186.93 ? 35  PRO B CG  1 
ATOM   2285  C CD  . PRO B 1 37  ? -4.685  10.046  30.150  1.00 186.99 ? 35  PRO B CD  1 
ATOM   2286  N N   . ASP B 1 38  ? -7.972  10.796  32.389  1.00 187.28 ? 36  ASP B N   1 
ATOM   2287  C CA  . ASP B 1 38  ? -9.336  11.354  32.489  1.00 186.47 ? 36  ASP B CA  1 
ATOM   2288  C C   . ASP B 1 38  ? -10.424 10.269  32.238  1.00 185.42 ? 36  ASP B C   1 
ATOM   2289  O O   . ASP B 1 38  ? -10.610 9.337   33.036  1.00 184.54 ? 36  ASP B O   1 
ATOM   2290  C CB  . ASP B 1 38  ? -9.512  12.530  31.496  1.00 186.14 ? 36  ASP B CB  1 
ATOM   2291  C CG  . ASP B 1 38  ? -10.657 13.481  31.885  1.00 185.46 ? 36  ASP B CG  1 
ATOM   2292  O OD1 . ASP B 1 38  ? -11.790 12.998  32.111  1.00 185.62 ? 36  ASP B OD1 1 
ATOM   2293  O OD2 . ASP B 1 38  ? -10.422 14.713  31.959  1.00 184.47 ? 36  ASP B OD2 1 
ATOM   2294  N N   . MET B 1 39  ? -11.134 10.410  31.120  1.00 184.65 ? 37  MET B N   1 
ATOM   2295  C CA  . MET B 1 39  ? -12.202 9.494   30.714  1.00 183.67 ? 37  MET B CA  1 
ATOM   2296  C C   . MET B 1 39  ? -12.848 10.051  29.432  1.00 185.24 ? 37  MET B C   1 
ATOM   2297  O O   . MET B 1 39  ? -14.068 10.248  29.386  1.00 186.16 ? 37  MET B O   1 
ATOM   2298  C CB  . MET B 1 39  ? -13.256 9.394   31.825  1.00 179.06 ? 37  MET B CB  1 
ATOM   2299  C CG  . MET B 1 39  ? -14.222 8.259   31.654  1.00 174.08 ? 37  MET B CG  1 
ATOM   2300  S SD  . MET B 1 39  ? -13.288 6.781   31.318  1.00 171.61 ? 37  MET B SD  1 
ATOM   2301  C CE  . MET B 1 39  ? -12.294 6.651   32.809  1.00 170.59 ? 37  MET B CE  1 
ATOM   2302  N N   . ASP B 1 40  ? -12.023 10.300  28.406  1.00 185.78 ? 38  ASP B N   1 
ATOM   2303  C CA  . ASP B 1 40  ? -12.475 10.872  27.120  1.00 185.25 ? 38  ASP B CA  1 
ATOM   2304  C C   . ASP B 1 40  ? -13.528 10.030  26.395  1.00 183.19 ? 38  ASP B C   1 
ATOM   2305  O O   . ASP B 1 40  ? -13.345 8.831   26.181  1.00 182.36 ? 38  ASP B O   1 
ATOM   2306  C CB  . ASP B 1 40  ? -11.276 11.120  26.178  1.00 187.79 ? 38  ASP B CB  1 
ATOM   2307  C CG  . ASP B 1 40  ? -11.643 11.987  24.960  1.00 190.17 ? 38  ASP B CG  1 
ATOM   2308  O OD1 . ASP B 1 40  ? -10.790 12.164  24.060  1.00 191.82 ? 38  ASP B OD1 1 
ATOM   2309  O OD2 . ASP B 1 40  ? -12.783 12.501  24.901  1.00 191.45 ? 38  ASP B OD2 1 
ATOM   2310  N N   . LEU B 1 41  ? -14.617 10.690  26.002  1.00 180.44 ? 39  LEU B N   1 
ATOM   2311  C CA  . LEU B 1 41  ? -15.749 10.054  25.327  1.00 176.96 ? 39  LEU B CA  1 
ATOM   2312  C C   . LEU B 1 41  ? -15.615 9.959   23.794  1.00 176.49 ? 39  LEU B C   1 
ATOM   2313  O O   . LEU B 1 41  ? -16.471 9.348   23.146  1.00 176.60 ? 39  LEU B O   1 
ATOM   2314  C CB  . LEU B 1 41  ? -17.042 10.809  25.712  1.00 172.15 ? 39  LEU B CB  1 
ATOM   2315  C CG  . LEU B 1 41  ? -18.448 10.296  25.387  1.00 166.27 ? 39  LEU B CG  1 
ATOM   2316  C CD1 . LEU B 1 41  ? -18.694 8.946   26.032  1.00 163.23 ? 39  LEU B CD1 1 
ATOM   2317  C CD2 . LEU B 1 41  ? -19.449 11.312  25.899  1.00 164.08 ? 39  LEU B CD2 1 
ATOM   2318  N N   . ALA B 1 42  ? -14.546 10.535  23.225  1.00 175.49 ? 40  ALA B N   1 
ATOM   2319  C CA  . ALA B 1 42  ? -14.313 10.527  21.764  1.00 173.56 ? 40  ALA B CA  1 
ATOM   2320  C C   . ALA B 1 42  ? -13.286 9.496   21.268  1.00 172.76 ? 40  ALA B C   1 
ATOM   2321  O O   . ALA B 1 42  ? -13.411 8.958   20.160  1.00 172.18 ? 40  ALA B O   1 
ATOM   2322  C CB  . ALA B 1 42  ? -13.901 11.934  21.287  1.00 171.68 ? 40  ALA B CB  1 
ATOM   2323  N N   . THR B 1 43  ? -12.268 9.239   22.086  1.00 172.46 ? 41  THR B N   1 
ATOM   2324  C CA  . THR B 1 43  ? -11.212 8.277   21.752  1.00 171.26 ? 41  THR B CA  1 
ATOM   2325  C C   . THR B 1 43  ? -10.950 7.272   22.904  1.00 169.87 ? 41  THR B C   1 
ATOM   2326  O O   . THR B 1 43  ? -10.906 6.069   22.658  1.00 169.10 ? 41  THR B O   1 
ATOM   2327  C CB  . THR B 1 43  ? -9.886  9.015   21.356  1.00 171.50 ? 41  THR B CB  1 
ATOM   2328  O OG1 . THR B 1 43  ? -10.089 9.770   20.152  1.00 170.87 ? 41  THR B OG1 1 
ATOM   2329  C CG2 . THR B 1 43  ? -8.763  8.022   21.125  1.00 170.25 ? 41  THR B CG2 1 
ATOM   2330  N N   . VAL B 1 44  ? -10.795 7.759   24.143  1.00 168.63 ? 42  VAL B N   1 
ATOM   2331  C CA  . VAL B 1 44  ? -10.556 6.902   25.329  1.00 166.64 ? 42  VAL B CA  1 
ATOM   2332  C C   . VAL B 1 44  ? -11.725 5.944   25.563  1.00 164.93 ? 42  VAL B C   1 
ATOM   2333  O O   . VAL B 1 44  ? -11.546 4.717   25.626  1.00 163.90 ? 42  VAL B O   1 
ATOM   2334  C CB  . VAL B 1 44  ? -10.345 7.751   26.635  1.00 166.71 ? 42  VAL B CB  1 
ATOM   2335  C CG1 . VAL B 1 44  ? -10.578 6.894   27.885  1.00 166.55 ? 42  VAL B CG1 1 
ATOM   2336  C CG2 . VAL B 1 44  ? -8.932  8.316   26.670  1.00 166.40 ? 42  VAL B CG2 1 
ATOM   2337  N N   . SER B 1 45  ? -12.917 6.512   25.717  1.00 162.50 ? 43  SER B N   1 
ATOM   2338  C CA  . SER B 1 45  ? -14.114 5.711   25.900  1.00 159.63 ? 43  SER B CA  1 
ATOM   2339  C C   . SER B 1 45  ? -14.582 5.306   24.485  1.00 158.86 ? 43  SER B C   1 
ATOM   2340  O O   . SER B 1 45  ? -15.770 5.064   24.220  1.00 158.36 ? 43  SER B O   1 
ATOM   2341  C CB  . SER B 1 45  ? -15.175 6.508   26.676  1.00 157.63 ? 43  SER B CB  1 
ATOM   2342  O OG  . SER B 1 45  ? -14.775 6.691   28.034  1.00 149.89 ? 43  SER B OG  1 
ATOM   2343  N N   . ALA B 1 46  ? -13.594 5.247   23.591  1.00 156.82 ? 44  ALA B N   1 
ATOM   2344  C CA  . ALA B 1 46  ? -13.749 4.827   22.206  1.00 154.24 ? 44  ALA B CA  1 
ATOM   2345  C C   . ALA B 1 46  ? -12.597 3.835   22.044  1.00 153.27 ? 44  ALA B C   1 
ATOM   2346  O O   . ALA B 1 46  ? -12.454 3.184   21.008  1.00 153.24 ? 44  ALA B O   1 
ATOM   2347  C CB  . ALA B 1 46  ? -13.579 6.006   21.251  1.00 152.22 ? 44  ALA B CB  1 
ATOM   2348  N N   . LEU B 1 47  ? -11.775 3.743   23.095  1.00 152.10 ? 45  LEU B N   1 
ATOM   2349  C CA  . LEU B 1 47  ? -10.618 2.842   23.142  1.00 150.91 ? 45  LEU B CA  1 
ATOM   2350  C C   . LEU B 1 47  ? -10.977 1.552   23.868  1.00 149.65 ? 45  LEU B C   1 
ATOM   2351  O O   . LEU B 1 47  ? -10.551 0.468   23.456  1.00 147.35 ? 45  LEU B O   1 
ATOM   2352  C CB  . LEU B 1 47  ? -9.422  3.475   23.876  1.00 151.50 ? 45  LEU B CB  1 
ATOM   2353  C CG  . LEU B 1 47  ? -8.559  4.659   23.409  1.00 151.04 ? 45  LEU B CG  1 
ATOM   2354  C CD1 . LEU B 1 47  ? -7.270  4.611   24.214  1.00 149.52 ? 45  LEU B CD1 1 
ATOM   2355  C CD2 . LEU B 1 47  ? -8.228  4.600   21.930  1.00 151.68 ? 45  LEU B CD2 1 
ATOM   2356  N N   . ARG B 1 48  ? -11.729 1.675   24.965  1.00 149.72 ? 46  ARG B N   1 
ATOM   2357  C CA  . ARG B 1 48  ? -12.149 0.493   25.724  1.00 149.59 ? 46  ARG B CA  1 
ATOM   2358  C C   . ARG B 1 48  ? -12.576 -0.483  24.635  1.00 150.34 ? 46  ARG B C   1 
ATOM   2359  O O   . ARG B 1 48  ? -12.187 -1.659  24.622  1.00 148.34 ? 46  ARG B O   1 
ATOM   2360  C CB  . ARG B 1 48  ? -13.342 0.810   26.654  1.00 146.14 ? 46  ARG B CB  1 
ATOM   2361  C CG  . ARG B 1 48  ? -13.135 1.982   27.634  1.00 142.03 ? 46  ARG B CG  1 
ATOM   2362  C CD  . ARG B 1 48  ? -14.455 2.322   28.338  1.00 140.26 ? 46  ARG B CD  1 
ATOM   2363  N NE  . ARG B 1 48  ? -14.381 3.465   29.259  1.00 136.64 ? 46  ARG B NE  1 
ATOM   2364  C CZ  . ARG B 1 48  ? -15.431 3.971   29.914  1.00 134.09 ? 46  ARG B CZ  1 
ATOM   2365  N NH1 . ARG B 1 48  ? -16.644 3.450   29.760  1.00 131.65 ? 46  ARG B NH1 1 
ATOM   2366  N NH2 . ARG B 1 48  ? -15.274 5.000   30.731  1.00 133.19 ? 46  ARG B NH2 1 
ATOM   2367  N N   . LYS B 1 49  ? -13.349 0.064   23.698  1.00 152.86 ? 47  LYS B N   1 
ATOM   2368  C CA  . LYS B 1 49  ? -13.860 -0.663  22.547  1.00 154.78 ? 47  LYS B CA  1 
ATOM   2369  C C   . LYS B 1 49  ? -12.798 -0.696  21.430  1.00 156.27 ? 47  LYS B C   1 
ATOM   2370  O O   . LYS B 1 49  ? -13.001 -0.137  20.349  1.00 157.05 ? 47  LYS B O   1 
ATOM   2371  C CB  . LYS B 1 49  ? -15.173 -0.008  22.038  1.00 153.90 ? 47  LYS B CB  1 
ATOM   2372  C CG  . LYS B 1 49  ? -15.066 1.466   21.593  1.00 151.57 ? 47  LYS B CG  1 
ATOM   2373  C CD  . LYS B 1 49  ? -16.404 2.043   21.086  1.00 148.92 ? 47  LYS B CD  1 
ATOM   2374  C CE  . LYS B 1 49  ? -17.457 2.188   22.184  1.00 148.10 ? 47  LYS B CE  1 
ATOM   2375  N NZ  . LYS B 1 49  ? -17.913 0.871   22.718  1.00 146.78 ? 47  LYS B NZ  1 
ATOM   2376  N N   . MET B 1 50  ? -11.664 -1.342  21.713  1.00 157.08 ? 48  MET B N   1 
ATOM   2377  C CA  . MET B 1 50  ? -10.565 -1.483  20.751  1.00 157.17 ? 48  MET B CA  1 
ATOM   2378  C C   . MET B 1 50  ? -9.840  -2.802  21.013  1.00 155.88 ? 48  MET B C   1 
ATOM   2379  O O   . MET B 1 50  ? -8.789  -3.095  20.419  1.00 154.80 ? 48  MET B O   1 
ATOM   2380  C CB  . MET B 1 50  ? -9.557  -0.326  20.888  1.00 158.48 ? 48  MET B CB  1 
ATOM   2381  C CG  . MET B 1 50  ? -9.919  0.962   20.144  1.00 159.64 ? 48  MET B CG  1 
ATOM   2382  S SD  . MET B 1 50  ? -8.534  2.159   20.013  1.00 160.34 ? 48  MET B SD  1 
ATOM   2383  C CE  . MET B 1 50  ? -7.595  1.512   18.623  1.00 158.03 ? 48  MET B CE  1 
ATOM   2384  N N   . GLY B 1 51  ? -10.422 -3.608  21.892  1.00 154.91 ? 49  GLY B N   1 
ATOM   2385  C CA  . GLY B 1 51  ? -9.768  -4.844  22.245  1.00 153.59 ? 49  GLY B CA  1 
ATOM   2386  C C   . GLY B 1 51  ? -8.527  -4.315  22.929  1.00 152.03 ? 49  GLY B C   1 
ATOM   2387  O O   . GLY B 1 51  ? -7.434  -4.869  22.787  1.00 153.08 ? 49  GLY B O   1 
ATOM   2388  N N   . VAL B 1 52  ? -8.698  -3.213  23.655  1.00 148.34 ? 50  VAL B N   1 
ATOM   2389  C CA  . VAL B 1 52  ? -7.586  -2.587  24.355  1.00 144.55 ? 50  VAL B CA  1 
ATOM   2390  C C   . VAL B 1 52  ? -8.045  -2.119  25.731  1.00 142.83 ? 50  VAL B C   1 
ATOM   2391  O O   . VAL B 1 52  ? -9.229  -1.843  25.927  1.00 143.03 ? 50  VAL B O   1 
ATOM   2392  C CB  . VAL B 1 52  ? -7.066  -1.377  23.568  1.00 144.02 ? 50  VAL B CB  1 
ATOM   2393  C CG1 . VAL B 1 52  ? -5.824  -0.807  24.246  1.00 142.91 ? 50  VAL B CG1 1 
ATOM   2394  C CG2 . VAL B 1 52  ? -6.768  -1.779  22.134  1.00 142.90 ? 50  VAL B CG2 1 
ATOM   2395  N N   . LYS B 1 53  ? -7.106  -2.046  26.675  1.00 139.77 ? 51  LYS B N   1 
ATOM   2396  C CA  . LYS B 1 53  ? -7.396  -1.603  28.036  1.00 136.24 ? 51  LYS B CA  1 
ATOM   2397  C C   . LYS B 1 53  ? -7.404  -0.082  28.090  1.00 135.73 ? 51  LYS B C   1 
ATOM   2398  O O   . LYS B 1 53  ? -7.233  0.589   27.064  1.00 135.07 ? 51  LYS B O   1 
ATOM   2399  C CB  . LYS B 1 53  ? -6.349  -2.127  29.028  1.00 132.45 ? 51  LYS B CB  1 
ATOM   2400  C CG  . LYS B 1 53  ? -6.030  -3.608  28.916  1.00 129.17 ? 51  LYS B CG  1 
ATOM   2401  C CD  . LYS B 1 53  ? -7.278  -4.455  28.895  1.00 128.50 ? 51  LYS B CD  1 
ATOM   2402  C CE  . LYS B 1 53  ? -8.101  -4.250  30.148  1.00 127.46 ? 51  LYS B CE  1 
ATOM   2403  N NZ  . LYS B 1 53  ? -9.340  -5.063  30.074  1.00 125.94 ? 51  LYS B NZ  1 
ATOM   2404  N N   . THR B 1 55  ? -7.747  2.870   31.868  1.00 167.88 ? 53  THR B N   1 
ATOM   2405  C CA  . THR B 1 55  ? -7.126  2.923   33.203  1.00 168.76 ? 53  THR B CA  1 
ATOM   2406  C C   . THR B 1 55  ? -6.890  4.380   33.657  1.00 170.00 ? 53  THR B C   1 
ATOM   2407  O O   . THR B 1 55  ? -5.837  4.960   33.369  1.00 170.58 ? 53  THR B O   1 
ATOM   2408  C CB  . THR B 1 55  ? -5.747  2.166   33.204  1.00 167.93 ? 53  THR B CB  1 
ATOM   2409  O OG1 . THR B 1 55  ? -5.943  0.797   32.819  1.00 165.64 ? 53  THR B OG1 1 
ATOM   2410  C CG2 . THR B 1 55  ? -5.090  2.207   34.585  1.00 167.45 ? 53  THR B CG2 1 
ATOM   2411  N N   . PRO B 1 56  ? -7.864  4.983   34.384  1.00 169.85 ? 54  PRO B N   1 
ATOM   2412  C CA  . PRO B 1 56  ? -7.727  6.368   34.856  1.00 168.70 ? 54  PRO B CA  1 
ATOM   2413  C C   . PRO B 1 56  ? -6.580  6.529   35.862  1.00 168.22 ? 54  PRO B C   1 
ATOM   2414  O O   . PRO B 1 56  ? -6.339  7.616   36.390  1.00 167.34 ? 54  PRO B O   1 
ATOM   2415  C CB  . PRO B 1 56  ? -9.099  6.654   35.471  1.00 167.37 ? 54  PRO B CB  1 
ATOM   2416  C CG  . PRO B 1 56  ? -9.464  5.338   36.054  1.00 167.54 ? 54  PRO B CG  1 
ATOM   2417  C CD  . PRO B 1 56  ? -9.094  4.378   34.934  1.00 169.58 ? 54  PRO B CD  1 
ATOM   2418  N N   . HIS B 1 57  ? -5.875  5.431   36.119  1.00 167.75 ? 55  HIS B N   1 
ATOM   2419  C CA  . HIS B 1 57  ? -4.750  5.438   37.042  1.00 166.20 ? 55  HIS B CA  1 
ATOM   2420  C C   . HIS B 1 57  ? -3.487  5.346   36.210  1.00 165.74 ? 55  HIS B C   1 
ATOM   2421  O O   . HIS B 1 57  ? -3.202  4.311   35.594  1.00 164.73 ? 55  HIS B O   1 
ATOM   2422  C CB  . HIS B 1 57  ? -4.845  4.250   37.994  1.00 165.87 ? 55  HIS B CB  1 
ATOM   2423  C CG  . HIS B 1 57  ? -6.147  4.177   38.733  1.00 164.92 ? 55  HIS B CG  1 
ATOM   2424  N ND1 . HIS B 1 57  ? -6.422  4.946   39.845  1.00 164.18 ? 55  HIS B ND1 1 
ATOM   2425  C CD2 . HIS B 1 57  ? -7.265  3.452   38.493  1.00 163.72 ? 55  HIS B CD2 1 
ATOM   2426  C CE1 . HIS B 1 57  ? -7.651  4.695   40.258  1.00 164.02 ? 55  HIS B CE1 1 
ATOM   2427  N NE2 . HIS B 1 57  ? -8.185  3.793   39.455  1.00 163.87 ? 55  HIS B NE2 1 
ATOM   2428  N N   . ASN B 1 58  ? -2.739  6.445   36.189  1.00 165.59 ? 56  ASN B N   1 
ATOM   2429  C CA  . ASN B 1 58  ? -1.499  6.537   35.423  1.00 165.41 ? 56  ASN B CA  1 
ATOM   2430  C C   . ASN B 1 58  ? -0.519  5.367   35.660  1.00 166.07 ? 56  ASN B C   1 
ATOM   2431  O O   . ASN B 1 58  ? -0.168  4.638   34.719  1.00 167.63 ? 56  ASN B O   1 
ATOM   2432  C CB  . ASN B 1 58  ? -0.799  7.878   35.720  1.00 162.18 ? 56  ASN B CB  1 
ATOM   2433  C CG  . ASN B 1 58  ? -1.614  9.088   35.275  1.00 159.04 ? 56  ASN B CG  1 
ATOM   2434  O OD1 . ASN B 1 58  ? -1.923  9.257   34.089  1.00 157.40 ? 56  ASN B OD1 1 
ATOM   2435  N ND2 . ASN B 1 58  ? -1.956  9.940   36.227  1.00 154.54 ? 56  ASN B ND2 1 
ATOM   2436  N N   . LYS B 1 59  ? -0.093  5.189   36.909  1.00 165.02 ? 57  LYS B N   1 
ATOM   2437  C CA  . LYS B 1 59  ? 0.863   4.139   37.276  1.00 163.24 ? 57  LYS B CA  1 
ATOM   2438  C C   . LYS B 1 59  ? 0.478   2.719   36.863  1.00 161.26 ? 57  LYS B C   1 
ATOM   2439  O O   . LYS B 1 59  ? 1.267   2.008   36.236  1.00 160.08 ? 57  LYS B O   1 
ATOM   2440  C CB  . LYS B 1 59  ? 1.106   4.160   38.787  1.00 163.76 ? 57  LYS B CB  1 
ATOM   2441  C CG  . LYS B 1 59  ? -0.082  3.685   39.618  1.00 164.33 ? 57  LYS B CG  1 
ATOM   2442  C CD  . LYS B 1 59  ? 0.217   3.706   41.109  1.00 163.59 ? 57  LYS B CD  1 
ATOM   2443  C CE  . LYS B 1 59  ? -0.895  3.025   41.892  1.00 162.66 ? 57  LYS B CE  1 
ATOM   2444  N NZ  . LYS B 1 59  ? -2.228  3.599   41.563  1.00 160.60 ? 57  LYS B NZ  1 
ATOM   2445  N N   . GLU B 1 60  ? -0.730  2.315   37.239  1.00 159.42 ? 58  GLU B N   1 
ATOM   2446  C CA  . GLU B 1 60  ? -1.237  0.992   36.942  1.00 158.44 ? 58  GLU B CA  1 
ATOM   2447  C C   . GLU B 1 60  ? -0.738  0.470   35.614  1.00 156.32 ? 58  GLU B C   1 
ATOM   2448  O O   . GLU B 1 60  ? -0.039  -0.541  35.571  1.00 156.14 ? 58  GLU B O   1 
ATOM   2449  C CB  . GLU B 1 60  ? -2.762  1.005   36.980  1.00 161.61 ? 58  GLU B CB  1 
ATOM   2450  C CG  . GLU B 1 60  ? -3.295  1.160   38.400  1.00 168.88 ? 58  GLU B CG  1 
ATOM   2451  C CD  . GLU B 1 60  ? -4.783  0.884   38.518  1.00 172.47 ? 58  GLU B CD  1 
ATOM   2452  O OE1 . GLU B 1 60  ? -5.260  0.652   39.655  1.00 173.40 ? 58  GLU B OE1 1 
ATOM   2453  O OE2 . GLU B 1 60  ? -5.475  0.904   37.478  1.00 174.80 ? 58  GLU B OE2 1 
ATOM   2454  N N   . THR B 1 61  ? -1.077  1.169   34.535  1.00 154.32 ? 59  THR B N   1 
ATOM   2455  C CA  . THR B 1 61  ? -0.652  0.771   33.187  1.00 151.60 ? 59  THR B CA  1 
ATOM   2456  C C   . THR B 1 61  ? 0.794   0.238   33.121  1.00 149.58 ? 59  THR B C   1 
ATOM   2457  O O   . THR B 1 61  ? 1.112   -0.624  32.290  1.00 148.33 ? 59  THR B O   1 
ATOM   2458  C CB  . THR B 1 61  ? -0.794  1.952   32.198  1.00 150.57 ? 59  THR B CB  1 
ATOM   2459  O OG1 . THR B 1 61  ? -2.134  2.459   32.255  1.00 147.32 ? 59  THR B OG1 1 
ATOM   2460  C CG2 . THR B 1 61  ? -0.481  1.498   30.774  1.00 148.94 ? 59  THR B CG2 1 
ATOM   2461  N N   . VAL B 1 62  ? 1.659   0.757   33.993  1.00 146.37 ? 60  VAL B N   1 
ATOM   2462  C CA  . VAL B 1 62  ? 3.054   0.333   34.036  1.00 142.28 ? 60  VAL B CA  1 
ATOM   2463  C C   . VAL B 1 62  ? 3.170   -1.147  34.427  1.00 143.44 ? 60  VAL B C   1 
ATOM   2464  O O   . VAL B 1 62  ? 4.122   -1.813  34.042  1.00 145.12 ? 60  VAL B O   1 
ATOM   2465  C CB  . VAL B 1 62  ? 3.878   1.195   35.029  1.00 137.57 ? 60  VAL B CB  1 
ATOM   2466  C CG1 . VAL B 1 62  ? 5.336   0.812   34.963  1.00 133.57 ? 60  VAL B CG1 1 
ATOM   2467  C CG2 . VAL B 1 62  ? 3.729   2.655   34.695  1.00 133.11 ? 60  VAL B CG2 1 
ATOM   2468  N N   . GLN B 1 63  ? 2.190   -1.657  35.170  1.00 142.96 ? 61  GLN B N   1 
ATOM   2469  C CA  . GLN B 1 63  ? 2.176   -3.054  35.615  1.00 143.37 ? 61  GLN B CA  1 
ATOM   2470  C C   . GLN B 1 63  ? 2.698   -4.066  34.581  1.00 145.43 ? 61  GLN B C   1 
ATOM   2471  O O   . GLN B 1 63  ? 3.889   -4.405  34.557  1.00 144.64 ? 61  GLN B O   1 
ATOM   2472  C CB  . GLN B 1 63  ? 0.750   -3.461  36.033  1.00 141.71 ? 61  GLN B CB  1 
ATOM   2473  C CG  . GLN B 1 63  ? 0.156   -2.649  37.177  1.00 139.29 ? 61  GLN B CG  1 
ATOM   2474  C CD  . GLN B 1 63  ? -1.107  -3.276  37.760  1.00 138.54 ? 61  GLN B CD  1 
ATOM   2475  O OE1 . GLN B 1 63  ? -2.048  -3.611  37.039  1.00 137.63 ? 61  GLN B OE1 1 
ATOM   2476  N NE2 . GLN B 1 63  ? -1.127  -3.434  39.076  1.00 139.11 ? 61  GLN B NE2 1 
ATOM   2477  N N   . HIS B 1 64  ? 1.782   -4.556  33.745  1.00 148.13 ? 62  HIS B N   1 
ATOM   2478  C CA  . HIS B 1 64  ? 2.098   -5.536  32.699  1.00 150.08 ? 62  HIS B CA  1 
ATOM   2479  C C   . HIS B 1 64  ? 2.873   -4.904  31.543  1.00 148.05 ? 62  HIS B C   1 
ATOM   2480  O O   . HIS B 1 64  ? 2.920   -5.451  30.441  1.00 146.90 ? 62  HIS B O   1 
ATOM   2481  C CB  . HIS B 1 64  ? 0.804   -6.173  32.157  1.00 155.07 ? 62  HIS B CB  1 
ATOM   2482  C CG  . HIS B 1 64  ? 0.321   -7.353  32.952  1.00 159.63 ? 62  HIS B CG  1 
ATOM   2483  N ND1 . HIS B 1 64  ? 0.910   -8.598  32.875  1.00 161.19 ? 62  HIS B ND1 1 
ATOM   2484  C CD2 . HIS B 1 64  ? -0.686  -7.472  33.854  1.00 160.50 ? 62  HIS B CD2 1 
ATOM   2485  C CE1 . HIS B 1 64  ? 0.290   -9.432  33.693  1.00 161.03 ? 62  HIS B CE1 1 
ATOM   2486  N NE2 . HIS B 1 64  ? -0.681  -8.772  34.299  1.00 160.92 ? 62  HIS B NE2 1 
ATOM   2487  N N   . SER B 1 65  ? 3.483   -3.754  31.802  1.00 146.76 ? 63  SER B N   1 
ATOM   2488  C CA  . SER B 1 65  ? 4.247   -3.047  30.784  1.00 145.64 ? 63  SER B CA  1 
ATOM   2489  C C   . SER B 1 65  ? 5.582   -3.719  30.487  1.00 147.81 ? 63  SER B C   1 
ATOM   2490  O O   . SER B 1 65  ? 5.952   -4.717  31.103  1.00 148.14 ? 63  SER B O   1 
ATOM   2491  C CB  . SER B 1 65  ? 4.499   -1.593  31.206  1.00 142.24 ? 63  SER B CB  1 
ATOM   2492  O OG  . SER B 1 65  ? 3.294   -0.848  31.294  1.00 135.98 ? 63  SER B OG  1 
ATOM   2493  N N   . ASP B 1 66  ? 6.294   -3.141  29.525  1.00 150.59 ? 64  ASP B N   1 
ATOM   2494  C CA  . ASP B 1 66  ? 7.603   -3.616  29.074  1.00 152.71 ? 64  ASP B CA  1 
ATOM   2495  C C   . ASP B 1 66  ? 8.322   -2.503  28.263  1.00 154.57 ? 64  ASP B C   1 
ATOM   2496  O O   . ASP B 1 66  ? 9.537   -2.561  28.056  1.00 155.99 ? 64  ASP B O   1 
ATOM   2497  C CB  . ASP B 1 66  ? 7.446   -4.898  28.231  1.00 150.99 ? 64  ASP B CB  1 
ATOM   2498  C CG  . ASP B 1 66  ? 7.901   -6.160  28.974  1.00 150.13 ? 64  ASP B CG  1 
ATOM   2499  O OD1 . ASP B 1 66  ? 9.119   -6.295  29.243  1.00 149.42 ? 64  ASP B OD1 1 
ATOM   2500  O OD2 . ASP B 1 66  ? 7.043   -7.023  29.284  1.00 149.42 ? 64  ASP B OD2 1 
ATOM   2501  N N   . VAL B 1 67  ? 7.561   -1.504  27.802  1.00 155.39 ? 65  VAL B N   1 
ATOM   2502  C CA  . VAL B 1 67  ? 8.096   -0.341  27.066  1.00 153.95 ? 65  VAL B CA  1 
ATOM   2503  C C   . VAL B 1 67  ? 7.111   0.818   27.215  1.00 152.58 ? 65  VAL B C   1 
ATOM   2504  O O   . VAL B 1 67  ? 6.034   0.824   26.608  1.00 151.04 ? 65  VAL B O   1 
ATOM   2505  C CB  . VAL B 1 67  ? 8.316   -0.602  25.548  1.00 154.13 ? 65  VAL B CB  1 
ATOM   2506  C CG1 . VAL B 1 67  ? 8.562   0.730   24.832  1.00 153.42 ? 65  VAL B CG1 1 
ATOM   2507  C CG2 . VAL B 1 67  ? 9.525   -1.521  25.333  1.00 152.65 ? 65  VAL B CG2 1 
ATOM   2508  N N   . LEU B 1 68  ? 7.495   1.791   28.036  1.00 151.19 ? 66  LEU B N   1 
ATOM   2509  C CA  . LEU B 1 68  ? 6.655   2.943   28.304  1.00 149.63 ? 66  LEU B CA  1 
ATOM   2510  C C   . LEU B 1 68  ? 6.722   4.034   27.259  1.00 147.85 ? 66  LEU B C   1 
ATOM   2511  O O   . LEU B 1 68  ? 7.717   4.202   26.543  1.00 146.54 ? 66  LEU B O   1 
ATOM   2512  C CB  . LEU B 1 68  ? 6.987   3.549   29.678  1.00 150.73 ? 66  LEU B CB  1 
ATOM   2513  C CG  . LEU B 1 68  ? 6.700   2.766   30.972  1.00 152.28 ? 66  LEU B CG  1 
ATOM   2514  C CD1 . LEU B 1 68  ? 7.014   3.646   32.192  1.00 151.75 ? 66  LEU B CD1 1 
ATOM   2515  C CD2 . LEU B 1 68  ? 5.244   2.330   31.007  1.00 152.61 ? 66  LEU B CD2 1 
ATOM   2516  N N   . PHE B 1 69  ? 5.619   4.765   27.195  1.00 146.54 ? 67  PHE B N   1 
ATOM   2517  C CA  . PHE B 1 69  ? 5.446   5.883   26.299  1.00 146.15 ? 67  PHE B CA  1 
ATOM   2518  C C   . PHE B 1 69  ? 4.706   6.926   27.110  1.00 143.66 ? 67  PHE B C   1 
ATOM   2519  O O   . PHE B 1 69  ? 3.696   6.630   27.729  1.00 141.01 ? 67  PHE B O   1 
ATOM   2520  C CB  . PHE B 1 69  ? 4.612   5.472   25.084  1.00 149.94 ? 67  PHE B CB  1 
ATOM   2521  C CG  . PHE B 1 69  ? 5.378   4.679   24.064  1.00 155.20 ? 67  PHE B CG  1 
ATOM   2522  C CD1 . PHE B 1 69  ? 5.155   3.314   23.902  1.00 156.89 ? 67  PHE B CD1 1 
ATOM   2523  C CD2 . PHE B 1 69  ? 6.361   5.294   23.291  1.00 157.30 ? 67  PHE B CD2 1 
ATOM   2524  C CE1 . PHE B 1 69  ? 5.909   2.566   22.986  1.00 158.74 ? 67  PHE B CE1 1 
ATOM   2525  C CE2 . PHE B 1 69  ? 7.122   4.563   22.372  1.00 158.71 ? 67  PHE B CE2 1 
ATOM   2526  C CZ  . PHE B 1 69  ? 6.894   3.197   22.223  1.00 159.42 ? 67  PHE B CZ  1 
ATOM   2527  N N   . LEU B 1 70  ? 5.223   8.143   27.126  1.00 142.48 ? 68  LEU B N   1 
ATOM   2528  C CA  . LEU B 1 70  ? 4.574   9.204   27.868  1.00 142.71 ? 68  LEU B CA  1 
ATOM   2529  C C   . LEU B 1 70  ? 3.770   10.082  26.932  1.00 145.72 ? 68  LEU B C   1 
ATOM   2530  O O   . LEU B 1 70  ? 4.030   11.272  26.826  1.00 145.85 ? 68  LEU B O   1 
ATOM   2531  C CB  . LEU B 1 70  ? 5.600   10.052  28.595  1.00 140.07 ? 68  LEU B CB  1 
ATOM   2532  C CG  . LEU B 1 70  ? 6.622   9.208   29.342  1.00 138.02 ? 68  LEU B CG  1 
ATOM   2533  C CD1 . LEU B 1 70  ? 7.392   10.114  30.278  1.00 138.21 ? 68  LEU B CD1 1 
ATOM   2534  C CD2 . LEU B 1 70  ? 5.940   8.092   30.126  1.00 137.15 ? 68  LEU B CD2 1 
ATOM   2535  N N   . ALA B 1 71  ? 2.792   9.481   26.253  1.00 149.71 ? 69  ALA B N   1 
ATOM   2536  C CA  . ALA B 1 71  ? 1.917   10.193  25.311  1.00 152.52 ? 69  ALA B CA  1 
ATOM   2537  C C   . ALA B 1 71  ? 0.972   11.133  26.051  1.00 154.70 ? 69  ALA B C   1 
ATOM   2538  O O   . ALA B 1 71  ? -0.216  11.213  25.739  1.00 155.58 ? 69  ALA B O   1 
ATOM   2539  C CB  . ALA B 1 71  ? 1.110   9.196   24.483  1.00 152.09 ? 69  ALA B CB  1 
ATOM   2540  N N   . VAL B 1 72  ? 1.512   11.844  27.034  1.00 156.91 ? 70  VAL B N   1 
ATOM   2541  C CA  . VAL B 1 72  ? 0.725   12.778  27.826  1.00 157.91 ? 70  VAL B CA  1 
ATOM   2542  C C   . VAL B 1 72  ? 0.924   14.200  27.296  1.00 158.75 ? 70  VAL B C   1 
ATOM   2543  O O   . VAL B 1 72  ? 1.677   14.430  26.342  1.00 157.32 ? 70  VAL B O   1 
ATOM   2544  C CB  . VAL B 1 72  ? 1.136   12.711  29.328  1.00 157.81 ? 70  VAL B CB  1 
ATOM   2545  C CG1 . VAL B 1 72  ? 0.141   13.477  30.180  1.00 156.97 ? 70  VAL B CG1 1 
ATOM   2546  C CG2 . VAL B 1 72  ? 1.224   11.256  29.790  1.00 156.47 ? 70  VAL B CG2 1 
ATOM   2547  N N   . LYS B 1 73  ? 0.223   15.150  27.904  1.00 160.50 ? 71  LYS B N   1 
ATOM   2548  C CA  . LYS B 1 73  ? 0.336   16.540  27.504  1.00 162.31 ? 71  LYS B CA  1 
ATOM   2549  C C   . LYS B 1 73  ? 1.785   16.971  27.628  1.00 161.77 ? 71  LYS B C   1 
ATOM   2550  O O   . LYS B 1 73  ? 2.634   16.222  28.114  1.00 162.16 ? 71  LYS B O   1 
ATOM   2551  C CB  . LYS B 1 73  ? -0.505  17.444  28.402  1.00 164.84 ? 71  LYS B CB  1 
ATOM   2552  C CG  . LYS B 1 73  ? -2.001  17.282  28.288  1.00 168.21 ? 71  LYS B CG  1 
ATOM   2553  C CD  . LYS B 1 73  ? -2.485  15.983  28.915  1.00 170.05 ? 71  LYS B CD  1 
ATOM   2554  C CE  . LYS B 1 73  ? -4.003  15.892  28.824  1.00 171.00 ? 71  LYS B CE  1 
ATOM   2555  N NZ  . LYS B 1 73  ? -4.558  14.628  29.381  1.00 171.74 ? 71  LYS B NZ  1 
ATOM   2556  N N   . PRO B 1 74  ? 2.081   18.202  27.205  1.00 160.89 ? 72  PRO B N   1 
ATOM   2557  C CA  . PRO B 1 74  ? 3.446   18.726  27.277  1.00 160.35 ? 72  PRO B CA  1 
ATOM   2558  C C   . PRO B 1 74  ? 4.041   18.743  28.688  1.00 160.33 ? 72  PRO B C   1 
ATOM   2559  O O   . PRO B 1 74  ? 5.263   18.652  28.855  1.00 159.92 ? 72  PRO B O   1 
ATOM   2560  C CB  . PRO B 1 74  ? 3.301   20.122  26.685  1.00 159.88 ? 72  PRO B CB  1 
ATOM   2561  C CG  . PRO B 1 74  ? 1.846   20.466  26.944  1.00 159.24 ? 72  PRO B CG  1 
ATOM   2562  C CD  . PRO B 1 74  ? 1.167   19.189  26.606  1.00 159.29 ? 72  PRO B CD  1 
ATOM   2563  N N   . HIS B 1 75  ? 3.170   18.839  29.692  1.00 160.11 ? 73  HIS B N   1 
ATOM   2564  C CA  . HIS B 1 75  ? 3.580   18.881  31.091  1.00 159.56 ? 73  HIS B CA  1 
ATOM   2565  C C   . HIS B 1 75  ? 3.847   17.499  31.685  1.00 159.13 ? 73  HIS B C   1 
ATOM   2566  O O   . HIS B 1 75  ? 3.458   17.211  32.819  1.00 156.05 ? 73  HIS B O   1 
ATOM   2567  C CB  . HIS B 1 75  ? 2.512   19.576  31.922  1.00 161.40 ? 73  HIS B CB  1 
ATOM   2568  C CG  . HIS B 1 75  ? 1.205   18.848  31.947  1.00 164.15 ? 73  HIS B CG  1 
ATOM   2569  N ND1 . HIS B 1 75  ? 0.298   18.898  30.910  1.00 163.97 ? 73  HIS B ND1 1 
ATOM   2570  C CD2 . HIS B 1 75  ? 0.658   18.039  32.887  1.00 165.98 ? 73  HIS B CD2 1 
ATOM   2571  C CE1 . HIS B 1 75  ? -0.752  18.153  31.211  1.00 165.05 ? 73  HIS B CE1 1 
ATOM   2572  N NE2 . HIS B 1 75  ? -0.556  17.620  32.404  1.00 167.02 ? 73  HIS B NE2 1 
ATOM   2573  N N   . ILE B 1 76  ? 4.502   16.635  30.916  1.00 160.46 ? 74  ILE B N   1 
ATOM   2574  C CA  . ILE B 1 76  ? 4.836   15.304  31.409  1.00 161.13 ? 74  ILE B CA  1 
ATOM   2575  C C   . ILE B 1 76  ? 5.830   15.543  32.526  1.00 165.70 ? 74  ILE B C   1 
ATOM   2576  O O   . ILE B 1 76  ? 6.224   14.611  33.223  1.00 166.14 ? 74  ILE B O   1 
ATOM   2577  C CB  . ILE B 1 76  ? 5.561   14.439  30.358  1.00 156.31 ? 74  ILE B CB  1 
ATOM   2578  C CG1 . ILE B 1 76  ? 4.807   14.455  29.044  1.00 154.06 ? 74  ILE B CG1 1 
ATOM   2579  C CG2 . ILE B 1 76  ? 5.670   13.005  30.843  1.00 153.60 ? 74  ILE B CG2 1 
ATOM   2580  C CD1 . ILE B 1 76  ? 5.559   13.758  27.957  1.00 155.01 ? 74  ILE B CD1 1 
ATOM   2581  N N   . ILE B 1 77  ? 6.225   16.805  32.683  1.00 171.15 ? 75  ILE B N   1 
ATOM   2582  C CA  . ILE B 1 77  ? 7.214   17.191  33.681  1.00 177.14 ? 75  ILE B CA  1 
ATOM   2583  C C   . ILE B 1 77  ? 6.912   16.774  35.145  1.00 180.70 ? 75  ILE B C   1 
ATOM   2584  O O   . ILE B 1 77  ? 7.324   15.682  35.562  1.00 182.16 ? 75  ILE B O   1 
ATOM   2585  C CB  . ILE B 1 77  ? 7.540   18.741  33.591  1.00 177.54 ? 75  ILE B CB  1 
ATOM   2586  C CG1 . ILE B 1 77  ? 7.648   19.189  32.133  1.00 177.00 ? 75  ILE B CG1 1 
ATOM   2587  C CG2 . ILE B 1 77  ? 8.886   19.052  34.265  1.00 177.61 ? 75  ILE B CG2 1 
ATOM   2588  C CD1 . ILE B 1 77  ? 7.895   20.674  32.001  1.00 175.43 ? 75  ILE B CD1 1 
ATOM   2589  N N   . PRO B 1 78  ? 6.167   17.597  35.931  1.00 182.77 ? 76  PRO B N   1 
ATOM   2590  C CA  . PRO B 1 78  ? 5.886   17.229  37.336  1.00 182.16 ? 76  PRO B CA  1 
ATOM   2591  C C   . PRO B 1 78  ? 4.930   16.067  37.601  1.00 180.01 ? 76  PRO B C   1 
ATOM   2592  O O   . PRO B 1 78  ? 5.334   14.967  37.994  1.00 179.15 ? 76  PRO B O   1 
ATOM   2593  C CB  . PRO B 1 78  ? 5.330   18.531  37.943  1.00 182.98 ? 76  PRO B CB  1 
ATOM   2594  C CG  . PRO B 1 78  ? 5.678   19.609  36.932  1.00 183.77 ? 76  PRO B CG  1 
ATOM   2595  C CD  . PRO B 1 78  ? 5.525   18.887  35.622  1.00 183.97 ? 76  PRO B CD  1 
ATOM   2596  N N   . PHE B 1 79  ? 3.651   16.359  37.412  1.00 177.68 ? 77  PHE B N   1 
ATOM   2597  C CA  . PHE B 1 79  ? 2.582   15.409  37.631  1.00 175.01 ? 77  PHE B CA  1 
ATOM   2598  C C   . PHE B 1 79  ? 2.744   14.076  36.852  1.00 172.32 ? 77  PHE B C   1 
ATOM   2599  O O   . PHE B 1 79  ? 1.774   13.330  36.723  1.00 174.40 ? 77  PHE B O   1 
ATOM   2600  C CB  . PHE B 1 79  ? 1.219   16.076  37.286  1.00 176.19 ? 77  PHE B CB  1 
ATOM   2601  C CG  . PHE B 1 79  ? 0.940   17.394  38.024  1.00 176.36 ? 77  PHE B CG  1 
ATOM   2602  C CD1 . PHE B 1 79  ? 1.519   18.593  37.604  1.00 176.53 ? 77  PHE B CD1 1 
ATOM   2603  C CD2 . PHE B 1 79  ? 0.087   17.427  39.133  1.00 175.91 ? 77  PHE B CD2 1 
ATOM   2604  C CE1 . PHE B 1 79  ? 1.254   19.801  38.278  1.00 176.48 ? 77  PHE B CE1 1 
ATOM   2605  C CE2 . PHE B 1 79  ? -0.183  18.628  39.810  1.00 174.70 ? 77  PHE B CE2 1 
ATOM   2606  C CZ  . PHE B 1 79  ? 0.402   19.814  39.381  1.00 175.39 ? 77  PHE B CZ  1 
ATOM   2607  N N   . ILE B 1 80  ? 3.942   13.762  36.340  1.00 167.36 ? 78  ILE B N   1 
ATOM   2608  C CA  . ILE B 1 80  ? 4.147   12.500  35.595  1.00 162.52 ? 78  ILE B CA  1 
ATOM   2609  C C   . ILE B 1 80  ? 5.440   11.725  35.947  1.00 157.76 ? 78  ILE B C   1 
ATOM   2610  O O   . ILE B 1 80  ? 5.375   10.632  36.501  1.00 156.50 ? 78  ILE B O   1 
ATOM   2611  C CB  . ILE B 1 80  ? 4.101   12.730  34.036  1.00 164.53 ? 78  ILE B CB  1 
ATOM   2612  C CG1 . ILE B 1 80  ? 2.821   13.486  33.658  1.00 165.67 ? 78  ILE B CG1 1 
ATOM   2613  C CG2 . ILE B 1 80  ? 4.157   11.381  33.291  1.00 163.61 ? 78  ILE B CG2 1 
ATOM   2614  C CD1 . ILE B 1 80  ? 2.545   13.614  32.161  1.00 165.74 ? 78  ILE B CD1 1 
ATOM   2615  N N   . LEU B 1 81  ? 6.605   12.286  35.632  1.00 152.58 ? 79  LEU B N   1 
ATOM   2616  C CA  . LEU B 1 81  ? 7.887   11.633  35.922  1.00 146.29 ? 79  LEU B CA  1 
ATOM   2617  C C   . LEU B 1 81  ? 8.142   11.484  37.414  1.00 144.89 ? 79  LEU B C   1 
ATOM   2618  O O   . LEU B 1 81  ? 9.091   10.818  37.837  1.00 141.67 ? 79  LEU B O   1 
ATOM   2619  C CB  . LEU B 1 81  ? 9.033   12.428  35.306  1.00 141.20 ? 79  LEU B CB  1 
ATOM   2620  C CG  . LEU B 1 81  ? 8.769   12.800  33.859  1.00 136.91 ? 79  LEU B CG  1 
ATOM   2621  C CD1 . LEU B 1 81  ? 9.890   13.680  33.380  1.00 135.78 ? 79  LEU B CD1 1 
ATOM   2622  C CD2 . LEU B 1 81  ? 8.624   11.547  33.017  1.00 133.95 ? 79  LEU B CD2 1 
ATOM   2623  N N   . ASP B 1 82  ? 7.300   12.123  38.213  1.00 145.31 ? 80  ASP B N   1 
ATOM   2624  C CA  . ASP B 1 82  ? 7.445   12.041  39.655  1.00 147.10 ? 80  ASP B CA  1 
ATOM   2625  C C   . ASP B 1 82  ? 6.608   10.916  40.224  1.00 149.00 ? 80  ASP B C   1 
ATOM   2626  O O   . ASP B 1 82  ? 6.754   10.565  41.390  1.00 150.77 ? 80  ASP B O   1 
ATOM   2627  C CB  . ASP B 1 82  ? 7.038   13.348  40.329  1.00 146.61 ? 80  ASP B CB  1 
ATOM   2628  C CG  . ASP B 1 82  ? 8.044   14.440  40.117  1.00 145.69 ? 80  ASP B CG  1 
ATOM   2629  O OD1 . ASP B 1 82  ? 9.253   14.127  40.126  1.00 145.95 ? 80  ASP B OD1 1 
ATOM   2630  O OD2 . ASP B 1 82  ? 7.635   15.608  39.959  1.00 143.94 ? 80  ASP B OD2 1 
ATOM   2631  N N   . GLU B 1 83  ? 5.730   10.352  39.402  1.00 149.95 ? 81  GLU B N   1 
ATOM   2632  C CA  . GLU B 1 83  ? 4.877   9.260   39.842  1.00 150.49 ? 81  GLU B CA  1 
ATOM   2633  C C   . GLU B 1 83  ? 5.264   7.983   39.118  1.00 150.02 ? 81  GLU B C   1 
ATOM   2634  O O   . GLU B 1 83  ? 4.692   6.923   39.350  1.00 149.07 ? 81  GLU B O   1 
ATOM   2635  C CB  . GLU B 1 83  ? 3.415   9.612   39.587  1.00 151.53 ? 81  GLU B CB  1 
ATOM   2636  C CG  . GLU B 1 83  ? 2.921   10.736  40.477  1.00 154.98 ? 81  GLU B CG  1 
ATOM   2637  C CD  . GLU B 1 83  ? 1.978   11.672  39.758  1.00 158.04 ? 81  GLU B CD  1 
ATOM   2638  O OE1 . GLU B 1 83  ? 0.953   11.195  39.222  1.00 160.79 ? 81  GLU B OE1 1 
ATOM   2639  O OE2 . GLU B 1 83  ? 2.264   12.889  39.728  1.00 159.02 ? 81  GLU B OE2 1 
ATOM   2640  N N   . ILE B 1 84  ? 6.246   8.099   38.234  1.00 151.02 ? 82  ILE B N   1 
ATOM   2641  C CA  . ILE B 1 84  ? 6.740   6.950   37.488  1.00 152.21 ? 82  ILE B CA  1 
ATOM   2642  C C   . ILE B 1 84  ? 8.089   6.575   38.114  1.00 156.18 ? 82  ILE B C   1 
ATOM   2643  O O   . ILE B 1 84  ? 8.492   5.411   38.100  1.00 157.91 ? 82  ILE B O   1 
ATOM   2644  C CB  . ILE B 1 84  ? 6.948   7.291   35.984  1.00 147.65 ? 82  ILE B CB  1 
ATOM   2645  C CG1 . ILE B 1 84  ? 5.782   8.130   35.471  1.00 144.74 ? 82  ILE B CG1 1 
ATOM   2646  C CG2 . ILE B 1 84  ? 7.001   6.013   35.158  1.00 143.10 ? 82  ILE B CG2 1 
ATOM   2647  C CD1 . ILE B 1 84  ? 5.999   8.698   34.090  1.00 143.63 ? 82  ILE B CD1 1 
ATOM   2648  N N   . GLY B 1 85  ? 8.764   7.574   38.684  1.00 158.22 ? 83  GLY B N   1 
ATOM   2649  C CA  . GLY B 1 85  ? 10.067  7.367   39.300  1.00 159.45 ? 83  GLY B CA  1 
ATOM   2650  C C   . GLY B 1 85  ? 10.252  6.127   40.161  1.00 160.45 ? 83  GLY B C   1 
ATOM   2651  O O   . GLY B 1 85  ? 10.770  5.108   39.694  1.00 160.34 ? 83  GLY B O   1 
ATOM   2652  N N   . ALA B 1 86  ? 9.841   6.214   41.425  1.00 160.42 ? 84  ALA B N   1 
ATOM   2653  C CA  . ALA B 1 86  ? 9.971   5.100   42.361  1.00 160.03 ? 84  ALA B CA  1 
ATOM   2654  C C   . ALA B 1 86  ? 9.387   3.806   41.790  1.00 160.57 ? 84  ALA B C   1 
ATOM   2655  O O   . ALA B 1 86  ? 9.680   2.711   42.285  1.00 159.63 ? 84  ALA B O   1 
ATOM   2656  C CB  . ALA B 1 86  ? 9.286   5.451   43.678  1.00 158.80 ? 84  ALA B CB  1 
ATOM   2657  N N   . ASP B 1 87  ? 8.580   3.950   40.736  1.00 161.66 ? 85  ASP B N   1 
ATOM   2658  C CA  . ASP B 1 87  ? 7.911   2.827   40.057  1.00 160.80 ? 85  ASP B CA  1 
ATOM   2659  C C   . ASP B 1 87  ? 8.528   2.470   38.699  1.00 158.06 ? 85  ASP B C   1 
ATOM   2660  O O   . ASP B 1 87  ? 7.815   2.308   37.701  1.00 157.60 ? 85  ASP B O   1 
ATOM   2661  C CB  . ASP B 1 87  ? 6.433   3.162   39.845  1.00 162.12 ? 85  ASP B CB  1 
ATOM   2662  C CG  . ASP B 1 87  ? 5.772   3.691   41.096  1.00 162.41 ? 85  ASP B CG  1 
ATOM   2663  O OD1 . ASP B 1 87  ? 5.682   2.928   42.083  1.00 163.84 ? 85  ASP B OD1 1 
ATOM   2664  O OD2 . ASP B 1 87  ? 5.350   4.869   41.092  1.00 161.41 ? 85  ASP B OD2 1 
ATOM   2665  N N   . ILE B 1 88  ? 9.849   2.346   38.671  1.00 154.73 ? 86  ILE B N   1 
ATOM   2666  C CA  . ILE B 1 88  ? 10.551  2.023   37.444  1.00 151.57 ? 86  ILE B CA  1 
ATOM   2667  C C   . ILE B 1 88  ? 11.780  1.157   37.689  1.00 149.85 ? 86  ILE B C   1 
ATOM   2668  O O   . ILE B 1 88  ? 12.562  1.394   38.612  1.00 149.77 ? 86  ILE B O   1 
ATOM   2669  C CB  . ILE B 1 88  ? 11.008  3.307   36.710  1.00 151.72 ? 86  ILE B CB  1 
ATOM   2670  C CG1 . ILE B 1 88  ? 9.799   4.043   36.111  1.00 151.79 ? 86  ILE B CG1 1 
ATOM   2671  C CG2 . ILE B 1 88  ? 12.025  2.947   35.641  1.00 152.67 ? 86  ILE B CG2 1 
ATOM   2672  C CD1 . ILE B 1 88  ? 10.126  5.390   35.464  1.00 150.76 ? 86  ILE B CD1 1 
ATOM   2673  N N   . GLU B 1 89  ? 11.940  0.146   36.846  1.00 147.65 ? 87  GLU B N   1 
ATOM   2674  C CA  . GLU B 1 89  ? 13.092  -0.745  36.923  1.00 146.00 ? 87  GLU B CA  1 
ATOM   2675  C C   . GLU B 1 89  ? 13.727  -0.758  35.547  1.00 143.94 ? 87  GLU B C   1 
ATOM   2676  O O   . GLU B 1 89  ? 13.282  -0.049  34.645  1.00 142.72 ? 87  GLU B O   1 
ATOM   2677  C CB  . GLU B 1 89  ? 12.676  -2.175  37.248  1.00 147.51 ? 87  GLU B CB  1 
ATOM   2678  C CG  . GLU B 1 89  ? 12.088  -2.414  38.611  1.00 148.03 ? 87  GLU B CG  1 
ATOM   2679  C CD  . GLU B 1 89  ? 11.888  -3.895  38.860  1.00 148.48 ? 87  GLU B CD  1 
ATOM   2680  O OE1 . GLU B 1 89  ? 12.905  -4.623  38.954  1.00 149.82 ? 87  GLU B OE1 1 
ATOM   2681  O OE2 . GLU B 1 89  ? 10.719  -4.335  38.948  1.00 147.13 ? 87  GLU B OE2 1 
ATOM   2682  N N   . ASP B 1 90  ? 14.755  -1.581  35.385  1.00 142.21 ? 88  ASP B N   1 
ATOM   2683  C CA  . ASP B 1 90  ? 15.419  -1.705  34.101  1.00 141.23 ? 88  ASP B CA  1 
ATOM   2684  C C   . ASP B 1 90  ? 14.533  -2.623  33.261  1.00 140.59 ? 88  ASP B C   1 
ATOM   2685  O O   . ASP B 1 90  ? 15.012  -3.267  32.325  1.00 139.93 ? 88  ASP B O   1 
ATOM   2686  C CB  . ASP B 1 90  ? 16.803  -2.341  34.278  1.00 141.78 ? 88  ASP B CB  1 
ATOM   2687  C CG  . ASP B 1 90  ? 17.682  -1.576  35.249  1.00 141.59 ? 88  ASP B CG  1 
ATOM   2688  O OD1 . ASP B 1 90  ? 18.852  -1.974  35.450  1.00 141.22 ? 88  ASP B OD1 1 
ATOM   2689  O OD2 . ASP B 1 90  ? 17.204  -0.573  35.814  1.00 142.19 ? 88  ASP B OD2 1 
ATOM   2690  N N   . ARG B 1 91  ? 13.240  -2.679  33.599  1.00 140.11 ? 89  ARG B N   1 
ATOM   2691  C CA  . ARG B 1 91  ? 12.276  -3.547  32.897  1.00 139.33 ? 89  ARG B CA  1 
ATOM   2692  C C   . ARG B 1 91  ? 11.291  -2.874  31.935  1.00 139.16 ? 89  ARG B C   1 
ATOM   2693  O O   . ARG B 1 91  ? 10.311  -3.508  31.507  1.00 138.90 ? 89  ARG B O   1 
ATOM   2694  C CB  . ARG B 1 91  ? 11.463  -4.380  33.904  1.00 138.37 ? 89  ARG B CB  1 
ATOM   2695  C CG  . ARG B 1 91  ? 10.372  -3.626  34.673  1.00 135.06 ? 89  ARG B CG  1 
ATOM   2696  C CD  . ARG B 1 91  ? 9.083   -3.438  33.872  1.00 130.06 ? 89  ARG B CD  1 
ATOM   2697  N NE  . ARG B 1 91  ? 8.043   -2.853  34.706  1.00 128.10 ? 89  ARG B NE  1 
ATOM   2698  C CZ  . ARG B 1 91  ? 6.835   -2.517  34.282  1.00 125.83 ? 89  ARG B CZ  1 
ATOM   2699  N NH1 . ARG B 1 91  ? 6.497   -2.702  33.013  1.00 124.43 ? 89  ARG B NH1 1 
ATOM   2700  N NH2 . ARG B 1 91  ? 5.969   -2.006  35.145  1.00 123.85 ? 89  ARG B NH2 1 
ATOM   2701  N N   . HIS B 1 92  ? 11.537  -1.604  31.606  1.00 136.90 ? 90  HIS B N   1 
ATOM   2702  C CA  . HIS B 1 92  ? 10.673  -0.870  30.677  1.00 132.90 ? 90  HIS B CA  1 
ATOM   2703  C C   . HIS B 1 92  ? 11.342  0.395   30.125  1.00 130.02 ? 90  HIS B C   1 
ATOM   2704  O O   . HIS B 1 92  ? 11.961  1.138   30.886  1.00 130.96 ? 90  HIS B O   1 
ATOM   2705  C CB  . HIS B 1 92  ? 9.319   -0.541  31.351  1.00 132.24 ? 90  HIS B CB  1 
ATOM   2706  C CG  . HIS B 1 92  ? 9.419   -0.127  32.789  1.00 129.30 ? 90  HIS B CG  1 
ATOM   2707  N ND1 . HIS B 1 92  ? 8.319   -0.035  33.611  1.00 128.16 ? 90  HIS B ND1 1 
ATOM   2708  C CD2 . HIS B 1 92  ? 10.488  0.224   33.550  1.00 126.98 ? 90  HIS B CD2 1 
ATOM   2709  C CE1 . HIS B 1 92  ? 8.700   0.351   34.816  1.00 127.87 ? 90  HIS B CE1 1 
ATOM   2710  N NE2 . HIS B 1 92  ? 10.011  0.514   34.803  1.00 126.85 ? 90  HIS B NE2 1 
ATOM   2711  N N   . ILE B 1 93  ? 11.242  0.614   28.806  1.00 125.82 ? 91  ILE B N   1 
ATOM   2712  C CA  . ILE B 1 93  ? 11.828  1.791   28.156  1.00 121.94 ? 91  ILE B CA  1 
ATOM   2713  C C   . ILE B 1 93  ? 10.791  2.880   27.887  1.00 123.75 ? 91  ILE B C   1 
ATOM   2714  O O   . ILE B 1 93  ? 9.743   2.620   27.292  1.00 122.85 ? 91  ILE B O   1 
ATOM   2715  C CB  . ILE B 1 93  ? 12.460  1.458   26.790  1.00 116.66 ? 91  ILE B CB  1 
ATOM   2716  C CG1 . ILE B 1 93  ? 13.563  0.434   26.945  1.00 113.20 ? 91  ILE B CG1 1 
ATOM   2717  C CG2 . ILE B 1 93  ? 13.073  2.705   26.177  1.00 117.31 ? 91  ILE B CG2 1 
ATOM   2718  C CD1 . ILE B 1 93  ? 14.355  0.261   25.682  1.00 109.04 ? 91  ILE B CD1 1 
ATOM   2719  N N   . VAL B 1 94  ? 11.104  4.108   28.295  1.00 125.72 ? 92  VAL B N   1 
ATOM   2720  C CA  . VAL B 1 94  ? 10.200  5.239   28.082  1.00 129.02 ? 92  VAL B CA  1 
ATOM   2721  C C   . VAL B 1 94  ? 10.570  6.018   26.810  1.00 129.85 ? 92  VAL B C   1 
ATOM   2722  O O   . VAL B 1 94  ? 11.745  6.124   26.434  1.00 131.48 ? 92  VAL B O   1 
ATOM   2723  C CB  . VAL B 1 94  ? 10.202  6.224   29.290  1.00 129.23 ? 92  VAL B CB  1 
ATOM   2724  C CG1 . VAL B 1 94  ? 9.292   7.417   29.002  1.00 130.86 ? 92  VAL B CG1 1 
ATOM   2725  C CG2 . VAL B 1 94  ? 9.705   5.526   30.528  1.00 130.59 ? 92  VAL B CG2 1 
ATOM   2726  N N   . VAL B 1 95  ? 9.550   6.561   26.155  1.00 127.85 ? 93  VAL B N   1 
ATOM   2727  C CA  . VAL B 1 95  ? 9.734   7.320   24.934  1.00 123.05 ? 93  VAL B CA  1 
ATOM   2728  C C   . VAL B 1 95  ? 8.877   8.608   25.085  1.00 122.57 ? 93  VAL B C   1 
ATOM   2729  O O   . VAL B 1 95  ? 7.650   8.547   25.171  1.00 120.97 ? 93  VAL B O   1 
ATOM   2730  C CB  . VAL B 1 95  ? 9.318   6.413   23.747  1.00 120.60 ? 93  VAL B CB  1 
ATOM   2731  C CG1 . VAL B 1 95  ? 9.842   6.948   22.455  1.00 119.67 ? 93  VAL B CG1 1 
ATOM   2732  C CG2 . VAL B 1 95  ? 9.856   4.997   23.976  1.00 114.16 ? 93  VAL B CG2 1 
ATOM   2733  N N   . SER B 1 96  ? 9.543   9.766   25.157  1.00 122.25 ? 94  SER B N   1 
ATOM   2734  C CA  . SER B 1 96  ? 8.880   11.067  25.348  1.00 122.09 ? 94  SER B CA  1 
ATOM   2735  C C   . SER B 1 96  ? 8.253   11.668  24.121  1.00 121.58 ? 94  SER B C   1 
ATOM   2736  O O   . SER B 1 96  ? 8.575   12.788  23.735  1.00 118.72 ? 94  SER B O   1 
ATOM   2737  C CB  . SER B 1 96  ? 9.855   12.101  25.856  1.00 124.02 ? 94  SER B CB  1 
ATOM   2738  O OG  . SER B 1 96  ? 10.544  12.648  24.742  1.00 126.54 ? 94  SER B OG  1 
ATOM   2739  N N   . CYS B 1 97  ? 7.321   10.954  23.527  1.00 123.93 ? 95  CYS B N   1 
ATOM   2740  C CA  . CYS B 1 97  ? 6.707   11.468  22.327  1.00 127.29 ? 95  CYS B CA  1 
ATOM   2741  C C   . CYS B 1 97  ? 5.511   12.351  22.665  1.00 127.20 ? 95  CYS B C   1 
ATOM   2742  O O   . CYS B 1 97  ? 4.365   11.900  22.731  1.00 126.47 ? 95  CYS B O   1 
ATOM   2743  C CB  . CYS B 1 97  ? 6.306   10.316  21.403  1.00 128.92 ? 95  CYS B CB  1 
ATOM   2744  S SG  . CYS B 1 97  ? 7.469   8.889   21.275  1.00 134.22 ? 95  CYS B SG  1 
ATOM   2745  N N   . ALA B 1 98  ? 5.820   13.623  22.896  1.00 127.77 ? 96  ALA B N   1 
ATOM   2746  C CA  . ALA B 1 98  ? 4.835   14.646  23.216  1.00 128.82 ? 96  ALA B CA  1 
ATOM   2747  C C   . ALA B 1 98  ? 5.537   15.994  23.325  1.00 129.84 ? 96  ALA B C   1 
ATOM   2748  O O   . ALA B 1 98  ? 6.677   16.081  23.807  1.00 129.98 ? 96  ALA B O   1 
ATOM   2749  C CB  . ALA B 1 98  ? 4.133   14.319  24.518  1.00 128.34 ? 96  ALA B CB  1 
ATOM   2750  N N   . ALA B 1 99  ? 4.847   17.029  22.849  1.00 130.52 ? 97  ALA B N   1 
ATOM   2751  C CA  . ALA B 1 99  ? 5.335   18.404  22.870  1.00 130.84 ? 97  ALA B CA  1 
ATOM   2752  C C   . ALA B 1 99  ? 6.845   18.598  22.725  1.00 131.07 ? 97  ALA B C   1 
ATOM   2753  O O   . ALA B 1 99  ? 7.535   17.847  22.024  1.00 129.85 ? 97  ALA B O   1 
ATOM   2754  C CB  . ALA B 1 99  ? 4.857   19.091  24.140  1.00 130.19 ? 97  ALA B CB  1 
ATOM   2755  N N   . GLY B 1 100 ? 7.343   19.634  23.395  1.00 131.70 ? 98  GLY B N   1 
ATOM   2756  C CA  . GLY B 1 100 ? 8.760   19.943  23.355  1.00 133.76 ? 98  GLY B CA  1 
ATOM   2757  C C   . GLY B 1 100 ? 9.488   19.555  24.633  1.00 134.93 ? 98  GLY B C   1 
ATOM   2758  O O   . GLY B 1 100 ? 10.209  20.371  25.223  1.00 136.61 ? 98  GLY B O   1 
ATOM   2759  N N   . VAL B 1 101 ? 9.297   18.307  25.063  1.00 133.84 ? 99  VAL B N   1 
ATOM   2760  C CA  . VAL B 1 101 ? 9.939   17.788  26.268  1.00 130.62 ? 99  VAL B CA  1 
ATOM   2761  C C   . VAL B 1 101 ? 11.293  17.221  25.857  1.00 131.60 ? 99  VAL B C   1 
ATOM   2762  O O   . VAL B 1 101 ? 11.360  16.295  25.048  1.00 131.67 ? 99  VAL B O   1 
ATOM   2763  C CB  . VAL B 1 101 ? 9.085   16.677  26.916  1.00 127.45 ? 99  VAL B CB  1 
ATOM   2764  C CG1 . VAL B 1 101 ? 9.823   16.069  28.096  1.00 126.08 ? 99  VAL B CG1 1 
ATOM   2765  C CG2 . VAL B 1 101 ? 7.754   17.247  27.374  1.00 122.88 ? 99  VAL B CG2 1 
ATOM   2766  N N   . THR B 1 102 ? 12.365  17.780  26.414  1.00 131.88 ? 100 THR B N   1 
ATOM   2767  C CA  . THR B 1 102 ? 13.730  17.352  26.090  1.00 133.38 ? 100 THR B CA  1 
ATOM   2768  C C   . THR B 1 102 ? 14.091  16.001  26.772  1.00 133.44 ? 100 THR B C   1 
ATOM   2769  O O   . THR B 1 102 ? 13.421  15.584  27.726  1.00 132.01 ? 100 THR B O   1 
ATOM   2770  C CB  . THR B 1 102 ? 14.735  18.481  26.492  1.00 134.44 ? 100 THR B CB  1 
ATOM   2771  O OG1 . THR B 1 102 ? 14.237  19.745  26.027  1.00 133.90 ? 100 THR B OG1 1 
ATOM   2772  C CG2 . THR B 1 102 ? 16.118  18.253  25.857  1.00 135.17 ? 100 THR B CG2 1 
ATOM   2773  N N   . ILE B 1 103 ? 15.123  15.311  26.263  1.00 133.82 ? 101 ILE B N   1 
ATOM   2774  C CA  . ILE B 1 103 ? 15.561  14.020  26.820  1.00 133.07 ? 101 ILE B CA  1 
ATOM   2775  C C   . ILE B 1 103 ? 16.067  14.227  28.234  1.00 135.24 ? 101 ILE B C   1 
ATOM   2776  O O   . ILE B 1 103 ? 15.854  13.390  29.111  1.00 137.10 ? 101 ILE B O   1 
ATOM   2777  C CB  . ILE B 1 103 ? 16.727  13.341  26.012  1.00 130.89 ? 101 ILE B CB  1 
ATOM   2778  C CG1 . ILE B 1 103 ? 17.972  14.240  25.997  1.00 130.95 ? 101 ILE B CG1 1 
ATOM   2779  C CG2 . ILE B 1 103 ? 16.255  12.962  24.625  1.00 128.89 ? 101 ILE B CG2 1 
ATOM   2780  C CD1 . ILE B 1 103 ? 19.177  13.670  25.217  1.00 130.85 ? 101 ILE B CD1 1 
ATOM   2781  N N   . SER B 1 104 ? 16.755  15.343  28.453  1.00 137.39 ? 102 SER B N   1 
ATOM   2782  C CA  . SER B 1 104 ? 17.296  15.663  29.772  1.00 139.35 ? 102 SER B CA  1 
ATOM   2783  C C   . SER B 1 104 ? 16.226  16.262  30.689  1.00 139.97 ? 102 SER B C   1 
ATOM   2784  O O   . SER B 1 104 ? 16.400  16.306  31.908  1.00 140.36 ? 102 SER B O   1 
ATOM   2785  C CB  . SER B 1 104 ? 18.483  16.623  29.637  1.00 140.10 ? 102 SER B CB  1 
ATOM   2786  O OG  . SER B 1 104 ? 19.496  16.064  28.811  1.00 141.78 ? 102 SER B OG  1 
ATOM   2787  N N   . SER B 1 105 ? 15.124  16.724  30.098  1.00 141.69 ? 103 SER B N   1 
ATOM   2788  C CA  . SER B 1 105 ? 14.013  17.292  30.870  1.00 142.69 ? 103 SER B CA  1 
ATOM   2789  C C   . SER B 1 105 ? 13.514  16.182  31.806  1.00 142.74 ? 103 SER B C   1 
ATOM   2790  O O   . SER B 1 105 ? 12.994  16.434  32.901  1.00 144.37 ? 103 SER B O   1 
ATOM   2791  C CB  . SER B 1 105 ? 12.854  17.732  29.939  1.00 142.35 ? 103 SER B CB  1 
ATOM   2792  O OG  . SER B 1 105 ? 13.183  18.856  29.133  1.00 139.52 ? 103 SER B OG  1 
ATOM   2793  N N   . ILE B 1 106 ? 13.697  14.947  31.358  1.00 140.55 ? 104 ILE B N   1 
ATOM   2794  C CA  . ILE B 1 106 ? 13.251  13.790  32.106  1.00 136.74 ? 104 ILE B CA  1 
ATOM   2795  C C   . ILE B 1 106 ? 14.413  13.039  32.706  1.00 133.84 ? 104 ILE B C   1 
ATOM   2796  O O   . ILE B 1 106 ? 14.316  12.471  33.792  1.00 132.64 ? 104 ILE B O   1 
ATOM   2797  C CB  . ILE B 1 106 ? 12.484  12.870  31.183  1.00 137.77 ? 104 ILE B CB  1 
ATOM   2798  C CG1 . ILE B 1 106 ? 11.387  13.685  30.480  1.00 138.10 ? 104 ILE B CG1 1 
ATOM   2799  C CG2 . ILE B 1 106 ? 11.968  11.684  31.971  1.00 138.37 ? 104 ILE B CG2 1 
ATOM   2800  C CD1 . ILE B 1 106 ? 10.627  12.947  29.421  1.00 137.57 ? 104 ILE B CD1 1 
ATOM   2801  N N   . GLU B 1 107 ? 15.514  13.051  31.971  1.00 132.03 ? 105 GLU B N   1 
ATOM   2802  C CA  . GLU B 1 107 ? 16.739  12.389  32.368  1.00 132.14 ? 105 GLU B CA  1 
ATOM   2803  C C   . GLU B 1 107 ? 17.242  12.933  33.713  1.00 133.92 ? 105 GLU B C   1 
ATOM   2804  O O   . GLU B 1 107 ? 18.287  12.498  34.214  1.00 134.99 ? 105 GLU B O   1 
ATOM   2805  C CB  . GLU B 1 107 ? 17.799  12.611  31.286  1.00 129.76 ? 105 GLU B CB  1 
ATOM   2806  C CG  . GLU B 1 107 ? 18.789  11.491  31.129  1.00 127.65 ? 105 GLU B CG  1 
ATOM   2807  C CD  . GLU B 1 107 ? 18.130  10.217  30.684  1.00 127.34 ? 105 GLU B CD  1 
ATOM   2808  O OE1 . GLU B 1 107 ? 17.410  9.618   31.510  1.00 130.19 ? 105 GLU B OE1 1 
ATOM   2809  O OE2 . GLU B 1 107 ? 18.330  9.816   29.520  1.00 126.41 ? 105 GLU B OE2 1 
ATOM   2810  N N   . LYS B 1 108 ? 16.507  13.887  34.290  1.00 133.99 ? 106 LYS B N   1 
ATOM   2811  C CA  . LYS B 1 108 ? 16.884  14.488  35.575  1.00 132.46 ? 106 LYS B CA  1 
ATOM   2812  C C   . LYS B 1 108 ? 15.661  14.696  36.449  1.00 132.82 ? 106 LYS B C   1 
ATOM   2813  O O   . LYS B 1 108 ? 15.513  15.713  37.139  1.00 132.05 ? 106 LYS B O   1 
ATOM   2814  C CB  . LYS B 1 108 ? 17.618  15.806  35.335  1.00 129.66 ? 106 LYS B CB  1 
ATOM   2815  C CG  . LYS B 1 108 ? 18.898  15.573  34.571  1.00 127.86 ? 106 LYS B CG  1 
ATOM   2816  C CD  . LYS B 1 108 ? 19.451  16.814  33.938  1.00 125.67 ? 106 LYS B CD  1 
ATOM   2817  C CE  . LYS B 1 108 ? 20.539  16.404  32.960  1.00 125.50 ? 106 LYS B CE  1 
ATOM   2818  N NZ  . LYS B 1 108 ? 21.174  17.560  32.283  1.00 125.82 ? 106 LYS B NZ  1 
ATOM   2819  N N   . LYS B 1 109 ? 14.798  13.688  36.405  1.00 133.51 ? 107 LYS B N   1 
ATOM   2820  C CA  . LYS B 1 109 ? 13.553  13.653  37.152  1.00 134.95 ? 107 LYS B CA  1 
ATOM   2821  C C   . LYS B 1 109 ? 13.250  12.205  37.497  1.00 136.27 ? 107 LYS B C   1 
ATOM   2822  O O   . LYS B 1 109 ? 12.701  11.902  38.555  1.00 137.12 ? 107 LYS B O   1 
ATOM   2823  C CB  . LYS B 1 109 ? 12.423  14.226  36.305  1.00 133.48 ? 107 LYS B CB  1 
ATOM   2824  C CG  . LYS B 1 109 ? 12.537  15.713  36.079  1.00 131.38 ? 107 LYS B CG  1 
ATOM   2825  C CD  . LYS B 1 109 ? 11.202  16.357  36.344  1.00 128.68 ? 107 LYS B CD  1 
ATOM   2826  C CE  . LYS B 1 109 ? 10.703  15.925  37.711  1.00 127.56 ? 107 LYS B CE  1 
ATOM   2827  N NZ  . LYS B 1 109 ? 9.328   16.380  37.996  1.00 126.34 ? 107 LYS B NZ  1 
ATOM   2828  N N   . LEU B 1 110 ? 13.590  11.315  36.573  1.00 136.96 ? 108 LEU B N   1 
ATOM   2829  C CA  . LEU B 1 110 ? 13.395  9.884   36.769  1.00 136.05 ? 108 LEU B CA  1 
ATOM   2830  C C   . LEU B 1 110 ? 14.753  9.298   37.079  1.00 136.17 ? 108 LEU B C   1 
ATOM   2831  O O   . LEU B 1 110 ? 14.865  8.175   37.556  1.00 137.36 ? 108 LEU B O   1 
ATOM   2832  C CB  . LEU B 1 110 ? 12.836  9.232   35.510  1.00 133.84 ? 108 LEU B CB  1 
ATOM   2833  C CG  . LEU B 1 110 ? 11.377  9.550   35.210  1.00 133.23 ? 108 LEU B CG  1 
ATOM   2834  C CD1 . LEU B 1 110 ? 10.942  8.818   33.958  1.00 133.07 ? 108 LEU B CD1 1 
ATOM   2835  C CD2 . LEU B 1 110 ? 10.519  9.128   36.388  1.00 131.85 ? 108 LEU B CD2 1 
ATOM   2836  N N   . SER B 1 111 ? 15.789  10.069  36.779  1.00 135.55 ? 109 SER B N   1 
ATOM   2837  C CA  . SER B 1 111 ? 17.149  9.643   37.051  1.00 135.40 ? 109 SER B CA  1 
ATOM   2838  C C   . SER B 1 111 ? 17.544  10.290  38.356  1.00 135.79 ? 109 SER B C   1 
ATOM   2839  O O   . SER B 1 111 ? 18.597  10.914  38.473  1.00 136.30 ? 109 SER B O   1 
ATOM   2840  C CB  . SER B 1 111 ? 18.091  10.080  35.939  1.00 134.85 ? 109 SER B CB  1 
ATOM   2841  O OG  . SER B 1 111 ? 17.760  9.420   34.733  1.00 131.97 ? 109 SER B OG  1 
ATOM   2842  N N   . ALA B 1 112 ? 16.657  10.133  39.328  1.00 135.75 ? 110 ALA B N   1 
ATOM   2843  C CA  . ALA B 1 112 ? 16.839  10.658  40.666  1.00 136.46 ? 110 ALA B CA  1 
ATOM   2844  C C   . ALA B 1 112 ? 16.154  9.624   41.539  1.00 136.99 ? 110 ALA B C   1 
ATOM   2845  O O   . ALA B 1 112 ? 16.509  9.418   42.699  1.00 135.67 ? 110 ALA B O   1 
ATOM   2846  C CB  . ALA B 1 112 ? 16.153  12.011  40.787  1.00 135.65 ? 110 ALA B CB  1 
ATOM   2847  N N   . PHE B 1 113 ? 15.171  8.968   40.932  1.00 139.50 ? 111 PHE B N   1 
ATOM   2848  C CA  . PHE B 1 113 ? 14.378  7.924   41.566  1.00 142.85 ? 111 PHE B CA  1 
ATOM   2849  C C   . PHE B 1 113 ? 15.006  6.581   41.232  1.00 143.44 ? 111 PHE B C   1 
ATOM   2850  O O   . PHE B 1 113 ? 14.595  5.535   41.737  1.00 144.50 ? 111 PHE B O   1 
ATOM   2851  C CB  . PHE B 1 113 ? 12.954  7.935   41.009  1.00 145.76 ? 111 PHE B CB  1 
ATOM   2852  C CG  . PHE B 1 113 ? 12.162  9.150   41.378  1.00 149.86 ? 111 PHE B CG  1 
ATOM   2853  C CD1 . PHE B 1 113 ? 12.664  10.424  41.137  1.00 151.92 ? 111 PHE B CD1 1 
ATOM   2854  C CD2 . PHE B 1 113 ? 10.904  9.023   41.962  1.00 150.95 ? 111 PHE B CD2 1 
ATOM   2855  C CE1 . PHE B 1 113 ? 11.925  11.556  41.474  1.00 153.25 ? 111 PHE B CE1 1 
ATOM   2856  C CE2 . PHE B 1 113 ? 10.158  10.146  42.299  1.00 152.05 ? 111 PHE B CE2 1 
ATOM   2857  C CZ  . PHE B 1 113 ? 10.671  11.417  42.055  1.00 153.18 ? 111 PHE B CZ  1 
ATOM   2858  N N   . ARG B 1 114 ? 15.999  6.618   40.358  1.00 143.58 ? 112 ARG B N   1 
ATOM   2859  C CA  . ARG B 1 114 ? 16.676  5.412   39.921  1.00 143.20 ? 112 ARG B CA  1 
ATOM   2860  C C   . ARG B 1 114 ? 17.954  5.876   39.270  1.00 143.09 ? 112 ARG B C   1 
ATOM   2861  O O   . ARG B 1 114 ? 17.983  6.924   38.627  1.00 142.52 ? 112 ARG B O   1 
ATOM   2862  C CB  . ARG B 1 114 ? 15.823  4.667   38.881  1.00 142.54 ? 112 ARG B CB  1 
ATOM   2863  C CG  . ARG B 1 114 ? 16.431  3.373   38.332  1.00 140.09 ? 112 ARG B CG  1 
ATOM   2864  C CD  . ARG B 1 114 ? 16.095  2.155   39.187  1.00 136.12 ? 112 ARG B CD  1 
ATOM   2865  N NE  . ARG B 1 114 ? 16.718  0.956   38.636  1.00 133.88 ? 112 ARG B NE  1 
ATOM   2866  C CZ  . ARG B 1 114 ? 16.471  -0.283  39.043  1.00 131.70 ? 112 ARG B CZ  1 
ATOM   2867  N NH1 . ARG B 1 114 ? 15.603  -0.512  40.018  1.00 130.16 ? 112 ARG B NH1 1 
ATOM   2868  N NH2 . ARG B 1 114 ? 17.097  -1.293  38.463  1.00 131.65 ? 112 ARG B NH2 1 
ATOM   2869  N N   . PRO B 1 115 ? 19.029  5.104   39.436  1.00 143.27 ? 113 PRO B N   1 
ATOM   2870  C CA  . PRO B 1 115 ? 20.307  5.470   38.837  1.00 143.12 ? 113 PRO B CA  1 
ATOM   2871  C C   . PRO B 1 115 ? 20.126  6.099   37.449  1.00 142.63 ? 113 PRO B C   1 
ATOM   2872  O O   . PRO B 1 115 ? 19.892  7.309   37.331  1.00 142.69 ? 113 PRO B O   1 
ATOM   2873  C CB  . PRO B 1 115 ? 21.038  4.133   38.799  1.00 143.98 ? 113 PRO B CB  1 
ATOM   2874  C CG  . PRO B 1 115 ? 20.603  3.506   40.094  1.00 143.95 ? 113 PRO B CG  1 
ATOM   2875  C CD  . PRO B 1 115 ? 19.115  3.795   40.113  1.00 143.96 ? 113 PRO B CD  1 
ATOM   2876  N N   . ALA B 1 116 ? 20.210  5.270   36.410  1.00 141.01 ? 114 ALA B N   1 
ATOM   2877  C CA  . ALA B 1 116 ? 20.081  5.746   35.038  1.00 137.67 ? 114 ALA B CA  1 
ATOM   2878  C C   . ALA B 1 116 ? 19.060  4.967   34.240  1.00 134.72 ? 114 ALA B C   1 
ATOM   2879  O O   . ALA B 1 116 ? 19.308  3.825   33.850  1.00 133.53 ? 114 ALA B O   1 
ATOM   2880  C CB  . ALA B 1 116 ? 21.420  5.675   34.345  1.00 139.01 ? 114 ALA B CB  1 
ATOM   2881  N N   . PRO B 1 117 ? 17.885  5.570   34.001  1.00 132.88 ? 115 PRO B N   1 
ATOM   2882  C CA  . PRO B 1 117 ? 16.825  4.919   33.233  1.00 133.02 ? 115 PRO B CA  1 
ATOM   2883  C C   . PRO B 1 117 ? 17.148  4.895   31.732  1.00 135.20 ? 115 PRO B C   1 
ATOM   2884  O O   . PRO B 1 117 ? 18.224  5.318   31.310  1.00 134.78 ? 115 PRO B O   1 
ATOM   2885  C CB  . PRO B 1 117 ? 15.597  5.764   33.574  1.00 128.75 ? 115 PRO B CB  1 
ATOM   2886  C CG  . PRO B 1 117 ? 16.180  7.115   33.808  1.00 127.72 ? 115 PRO B CG  1 
ATOM   2887  C CD  . PRO B 1 117 ? 17.381  6.796   34.642  1.00 129.62 ? 115 PRO B CD  1 
ATOM   2888  N N   . ARG B 1 118 ? 16.225  4.358   30.938  1.00 137.86 ? 116 ARG B N   1 
ATOM   2889  C CA  . ARG B 1 118 ? 16.377  4.289   29.479  1.00 140.47 ? 116 ARG B CA  1 
ATOM   2890  C C   . ARG B 1 118 ? 15.450  5.356   28.891  1.00 140.22 ? 116 ARG B C   1 
ATOM   2891  O O   . ARG B 1 118 ? 14.246  5.142   28.759  1.00 139.55 ? 116 ARG B O   1 
ATOM   2892  C CB  . ARG B 1 118 ? 15.970  2.905   28.942  1.00 141.82 ? 116 ARG B CB  1 
ATOM   2893  C CG  . ARG B 1 118 ? 17.035  1.814   29.018  1.00 147.32 ? 116 ARG B CG  1 
ATOM   2894  C CD  . ARG B 1 118 ? 16.519  0.499   28.380  1.00 154.34 ? 116 ARG B CD  1 
ATOM   2895  N NE  . ARG B 1 118 ? 17.486  -0.613  28.372  1.00 159.05 ? 116 ARG B NE  1 
ATOM   2896  C CZ  . ARG B 1 118 ? 17.224  -1.848  27.928  1.00 159.85 ? 116 ARG B CZ  1 
ATOM   2897  N NH1 . ARG B 1 118 ? 16.019  -2.148  27.450  1.00 160.21 ? 116 ARG B NH1 1 
ATOM   2898  N NH2 . ARG B 1 118 ? 18.164  -2.791  27.954  1.00 160.11 ? 116 ARG B NH2 1 
ATOM   2899  N N   . VAL B 1 119 ? 16.020  6.505   28.547  1.00 139.34 ? 117 VAL B N   1 
ATOM   2900  C CA  . VAL B 1 119 ? 15.240  7.610   28.012  1.00 137.05 ? 117 VAL B CA  1 
ATOM   2901  C C   . VAL B 1 119 ? 15.421  7.837   26.519  1.00 135.47 ? 117 VAL B C   1 
ATOM   2902  O O   . VAL B 1 119 ? 16.547  8.010   26.048  1.00 135.50 ? 117 VAL B O   1 
ATOM   2903  C CB  . VAL B 1 119 ? 15.588  8.913   28.752  1.00 138.21 ? 117 VAL B CB  1 
ATOM   2904  C CG1 . VAL B 1 119 ? 14.851  10.080  28.134  1.00 139.67 ? 117 VAL B CG1 1 
ATOM   2905  C CG2 . VAL B 1 119 ? 15.229  8.776   30.216  1.00 137.72 ? 117 VAL B CG2 1 
ATOM   2906  N N   . ILE B 1 120 ? 14.301  7.859   25.791  1.00 133.62 ? 118 ILE B N   1 
ATOM   2907  C CA  . ILE B 1 120 ? 14.299  8.069   24.332  1.00 131.97 ? 118 ILE B CA  1 
ATOM   2908  C C   . ILE B 1 120 ? 13.147  8.977   23.827  1.00 127.53 ? 118 ILE B C   1 
ATOM   2909  O O   . ILE B 1 120 ? 11.977  8.597   23.912  1.00 125.64 ? 118 ILE B O   1 
ATOM   2910  C CB  . ILE B 1 120 ? 14.252  6.696   23.578  1.00 134.31 ? 118 ILE B CB  1 
ATOM   2911  C CG1 . ILE B 1 120 ? 15.640  6.018   23.633  1.00 136.66 ? 118 ILE B CG1 1 
ATOM   2912  C CG2 . ILE B 1 120 ? 13.802  6.910   22.147  1.00 135.90 ? 118 ILE B CG2 1 
ATOM   2913  C CD1 . ILE B 1 120 ? 15.755  4.664   22.924  1.00 134.51 ? 118 ILE B CD1 1 
ATOM   2914  N N   . ARG B 1 121 ? 13.495  10.162  23.299  1.00 123.18 ? 119 ARG B N   1 
ATOM   2915  C CA  . ARG B 1 121 ? 12.509  11.127  22.791  1.00 116.65 ? 119 ARG B CA  1 
ATOM   2916  C C   . ARG B 1 121 ? 12.108  10.810  21.367  1.00 114.91 ? 119 ARG B C   1 
ATOM   2917  O O   . ARG B 1 121 ? 12.837  10.144  20.623  1.00 110.70 ? 119 ARG B O   1 
ATOM   2918  C CB  . ARG B 1 121 ? 13.045  12.559  22.842  1.00 114.15 ? 119 ARG B CB  1 
ATOM   2919  C CG  . ARG B 1 121 ? 12.038  13.609  22.380  1.00 111.61 ? 119 ARG B CG  1 
ATOM   2920  C CD  . ARG B 1 121 ? 12.685  14.981  22.336  1.00 110.29 ? 119 ARG B CD  1 
ATOM   2921  N NE  . ARG B 1 121 ? 11.729  16.029  22.015  1.00 108.49 ? 119 ARG B NE  1 
ATOM   2922  C CZ  . ARG B 1 121 ? 12.062  17.296  21.801  1.00 105.98 ? 119 ARG B CZ  1 
ATOM   2923  N NH1 . ARG B 1 121 ? 13.334  17.661  21.872  1.00 102.56 ? 119 ARG B NH1 1 
ATOM   2924  N NH2 . ARG B 1 121 ? 11.125  18.193  21.523  1.00 104.79 ? 119 ARG B NH2 1 
ATOM   2925  N N   . CYS B 1 122 ? 10.957  11.319  20.961  1.00 114.41 ? 120 CYS B N   1 
ATOM   2926  C CA  . CYS B 1 122 ? 10.502  10.988  19.639  1.00 115.33 ? 120 CYS B CA  1 
ATOM   2927  C C   . CYS B 1 122 ? 9.349   11.818  19.145  1.00 111.93 ? 120 CYS B C   1 
ATOM   2928  O O   . CYS B 1 122 ? 8.353   11.987  19.829  1.00 110.26 ? 120 CYS B O   1 
ATOM   2929  C CB  . CYS B 1 122 ? 10.133  9.510   19.643  1.00 122.28 ? 120 CYS B CB  1 
ATOM   2930  S SG  . CYS B 1 122 ? 8.388   8.986   19.446  1.00 133.80 ? 120 CYS B SG  1 
ATOM   2931  N N   . MET B 1 123 ? 9.482   12.358  17.948  1.00 110.57 ? 121 MET B N   1 
ATOM   2932  C CA  . MET B 1 123 ? 8.385   13.139  17.402  1.00 111.02 ? 121 MET B CA  1 
ATOM   2933  C C   . MET B 1 123 ? 7.677   12.298  16.358  1.00 109.12 ? 121 MET B C   1 
ATOM   2934  O O   . MET B 1 123 ? 8.270   11.393  15.768  1.00 107.48 ? 121 MET B O   1 
ATOM   2935  C CB  . MET B 1 123 ? 8.865   14.447  16.771  1.00 114.58 ? 121 MET B CB  1 
ATOM   2936  C CG  . MET B 1 123 ? 7.717   15.324  16.250  1.00 118.11 ? 121 MET B CG  1 
ATOM   2937  S SD  . MET B 1 123 ? 6.141   15.208  17.225  1.00 125.90 ? 121 MET B SD  1 
ATOM   2938  C CE  . MET B 1 123 ? 6.695   15.642  18.891  1.00 123.15 ? 121 MET B CE  1 
ATOM   2939  N N   . THR B 1 124 ? 6.402   12.609  16.147  1.00 106.37 ? 122 THR B N   1 
ATOM   2940  C CA  . THR B 1 124 ? 5.566   11.887  15.199  1.00 101.79 ? 122 THR B CA  1 
ATOM   2941  C C   . THR B 1 124 ? 4.483   12.773  14.590  1.00 99.92  ? 122 THR B C   1 
ATOM   2942  O O   . THR B 1 124 ? 4.637   14.000  14.419  1.00 102.44 ? 122 THR B O   1 
ATOM   2943  C CB  . THR B 1 124 ? 4.823   10.782  15.902  1.00 100.69 ? 122 THR B CB  1 
ATOM   2944  O OG1 . THR B 1 124 ? 3.824   11.372  16.744  1.00 101.08 ? 122 THR B OG1 1 
ATOM   2945  C CG2 . THR B 1 124 ? 5.760   9.990   16.760  1.00 101.73 ? 122 THR B CG2 1 
ATOM   2946  N N   . ASN B 1 125 ? 3.373   12.111  14.273  1.00 92.81  ? 123 ASN B N   1 
ATOM   2947  C CA  . ASN B 1 125 ? 2.207   12.757  13.708  1.00 83.91  ? 123 ASN B CA  1 
ATOM   2948  C C   . ASN B 1 125 ? 1.048   11.805  13.819  1.00 78.02  ? 123 ASN B C   1 
ATOM   2949  O O   . ASN B 1 125 ? 1.203   10.634  14.129  1.00 74.70  ? 123 ASN B O   1 
ATOM   2950  C CB  . ASN B 1 125 ? 2.422   13.148  12.243  1.00 82.73  ? 123 ASN B CB  1 
ATOM   2951  C CG  . ASN B 1 125 ? 3.115   12.077  11.446  1.00 79.63  ? 123 ASN B CG  1 
ATOM   2952  O OD1 . ASN B 1 125 ? 3.122   10.896  11.816  1.00 79.28  ? 123 ASN B OD1 1 
ATOM   2953  N ND2 . ASN B 1 125 ? 3.705   12.483  10.334  1.00 75.25  ? 123 ASN B ND2 1 
ATOM   2954  N N   . THR B 1 126 ? -0.125  12.331  13.547  1.00 74.32  ? 124 THR B N   1 
ATOM   2955  C CA  . THR B 1 126 ? -1.347  11.573  13.634  1.00 75.30  ? 124 THR B CA  1 
ATOM   2956  C C   . THR B 1 126 ? -1.519  10.481  12.592  1.00 74.60  ? 124 THR B C   1 
ATOM   2957  O O   . THR B 1 126 ? -2.002  9.401   12.908  1.00 72.15  ? 124 THR B O   1 
ATOM   2958  C CB  . THR B 1 126 ? -2.525  12.517  13.495  1.00 78.76  ? 124 THR B CB  1 
ATOM   2959  O OG1 . THR B 1 126 ? -2.067  13.850  13.758  1.00 82.06  ? 124 THR B OG1 1 
ATOM   2960  C CG2 . THR B 1 126 ? -3.662  12.130  14.452  1.00 77.67  ? 124 THR B CG2 1 
ATOM   2961  N N   . PRO B 1 127 ? -1.125  10.744  11.335  1.00 75.79  ? 125 PRO B N   1 
ATOM   2962  C CA  . PRO B 1 127 ? -1.281  9.739   10.291  1.00 76.61  ? 125 PRO B CA  1 
ATOM   2963  C C   . PRO B 1 127 ? -0.609  8.426   10.635  1.00 78.71  ? 125 PRO B C   1 
ATOM   2964  O O   . PRO B 1 127 ? -0.715  7.463   9.893   1.00 81.79  ? 125 PRO B O   1 
ATOM   2965  C CB  . PRO B 1 127 ? -0.674  10.417  9.075   1.00 72.89  ? 125 PRO B CB  1 
ATOM   2966  C CG  . PRO B 1 127 ? 0.437   11.146  9.656   1.00 73.35  ? 125 PRO B CG  1 
ATOM   2967  C CD  . PRO B 1 127 ? -0.195  11.788  10.876  1.00 78.15  ? 125 PRO B CD  1 
ATOM   2968  N N   . VAL B 1 128 ? 0.091   8.384   11.759  1.00 81.53  ? 126 VAL B N   1 
ATOM   2969  C CA  . VAL B 1 128 ? 0.718   7.144   12.182  1.00 83.65  ? 126 VAL B CA  1 
ATOM   2970  C C   . VAL B 1 128 ? -0.417  6.144   12.243  1.00 85.36  ? 126 VAL B C   1 
ATOM   2971  O O   . VAL B 1 128 ? -0.242  4.935   12.072  1.00 83.24  ? 126 VAL B O   1 
ATOM   2972  C CB  . VAL B 1 128 ? 1.313   7.269   13.565  1.00 83.48  ? 126 VAL B CB  1 
ATOM   2973  C CG1 . VAL B 1 128 ? 1.734   5.917   14.060  1.00 83.77  ? 126 VAL B CG1 1 
ATOM   2974  C CG2 . VAL B 1 128 ? 2.490   8.206   13.510  1.00 86.94  ? 126 VAL B CG2 1 
ATOM   2975  N N   . VAL B 1 129 ? -1.594  6.701   12.485  1.00 89.10  ? 127 VAL B N   1 
ATOM   2976  C CA  . VAL B 1 129 ? -2.840  5.956   12.568  1.00 93.22  ? 127 VAL B CA  1 
ATOM   2977  C C   . VAL B 1 129 ? -3.036  4.999   11.396  1.00 89.69  ? 127 VAL B C   1 
ATOM   2978  O O   . VAL B 1 129 ? -3.639  3.948   11.556  1.00 90.67  ? 127 VAL B O   1 
ATOM   2979  C CB  . VAL B 1 129 ? -4.067  6.928   12.606  1.00 98.29  ? 127 VAL B CB  1 
ATOM   2980  C CG1 . VAL B 1 129 ? -5.379  6.132   12.506  1.00 98.97  ? 127 VAL B CG1 1 
ATOM   2981  C CG2 . VAL B 1 129 ? -4.028  7.788   13.882  1.00 100.92 ? 127 VAL B CG2 1 
ATOM   2982  N N   . VAL B 1 130 ? -2.561  5.364   10.212  1.00 86.57  ? 128 VAL B N   1 
ATOM   2983  C CA  . VAL B 1 130 ? -2.735  4.476   9.080   1.00 83.25  ? 128 VAL B CA  1 
ATOM   2984  C C   . VAL B 1 130 ? -1.500  3.614   8.925   1.00 82.14  ? 128 VAL B C   1 
ATOM   2985  O O   . VAL B 1 130 ? -1.503  2.447   9.271   1.00 84.20  ? 128 VAL B O   1 
ATOM   2986  C CB  . VAL B 1 130 ? -2.988  5.252   7.785   1.00 85.05  ? 128 VAL B CB  1 
ATOM   2987  C CG1 . VAL B 1 130 ? -3.421  4.291   6.699   1.00 85.09  ? 128 VAL B CG1 1 
ATOM   2988  C CG2 . VAL B 1 130 ? -4.060  6.304   8.002   1.00 84.58  ? 128 VAL B CG2 1 
ATOM   2989  N N   . ARG B 1 131 ? -0.435  4.188   8.410   1.00 79.78  ? 129 ARG B N   1 
ATOM   2990  C CA  . ARG B 1 131 ? 0.785   3.438   8.239   1.00 82.77  ? 129 ARG B CA  1 
ATOM   2991  C C   . ARG B 1 131 ? 1.819   4.318   7.596   1.00 83.55  ? 129 ARG B C   1 
ATOM   2992  O O   . ARG B 1 131 ? 2.988   3.961   7.511   1.00 84.41  ? 129 ARG B O   1 
ATOM   2993  C CB  . ARG B 1 131 ? 0.538   2.220   7.365   1.00 87.49  ? 129 ARG B CB  1 
ATOM   2994  C CG  . ARG B 1 131 ? 1.773   1.360   7.075   1.00 96.05  ? 129 ARG B CG  1 
ATOM   2995  C CD  . ARG B 1 131 ? 2.522   1.812   5.808   1.00 104.92 ? 129 ARG B CD  1 
ATOM   2996  N NE  . ARG B 1 131 ? 3.770   1.065   5.613   1.00 111.82 ? 129 ARG B NE  1 
ATOM   2997  C CZ  . ARG B 1 131 ? 4.611   1.220   4.588   1.00 114.63 ? 129 ARG B CZ  1 
ATOM   2998  N NH1 . ARG B 1 131 ? 4.360   2.105   3.631   1.00 116.76 ? 129 ARG B NH1 1 
ATOM   2999  N NH2 . ARG B 1 131 ? 5.714   0.481   4.517   1.00 116.57 ? 129 ARG B NH2 1 
ATOM   3000  N N   . GLU B 1 132 ? 1.392   5.495   7.164   1.00 84.22  ? 130 GLU B N   1 
ATOM   3001  C CA  . GLU B 1 132 ? 2.301   6.420   6.513   1.00 83.98  ? 130 GLU B CA  1 
ATOM   3002  C C   . GLU B 1 132 ? 2.607   7.649   7.368   1.00 82.60  ? 130 GLU B C   1 
ATOM   3003  O O   . GLU B 1 132 ? 2.944   8.705   6.851   1.00 83.54  ? 130 GLU B O   1 
ATOM   3004  C CB  . GLU B 1 132 ? 1.733   6.816   5.140   1.00 85.38  ? 130 GLU B CB  1 
ATOM   3005  C CG  . GLU B 1 132 ? 1.489   5.628   4.167   1.00 85.00  ? 130 GLU B CG  1 
ATOM   3006  C CD  . GLU B 1 132 ? 2.781   4.954   3.647   1.00 88.06  ? 130 GLU B CD  1 
ATOM   3007  O OE1 . GLU B 1 132 ? 2.665   4.006   2.828   1.00 88.39  ? 130 GLU B OE1 1 
ATOM   3008  O OE2 . GLU B 1 132 ? 3.906   5.363   4.046   1.00 85.94  ? 130 GLU B OE2 1 
ATOM   3009  N N   . GLY B 1 133 ? 2.478   7.500   8.682   1.00 82.60  ? 131 GLY B N   1 
ATOM   3010  C CA  . GLY B 1 133 ? 2.816   8.585   9.582   1.00 80.32  ? 131 GLY B CA  1 
ATOM   3011  C C   . GLY B 1 133 ? 4.325   8.590   9.525   1.00 79.65  ? 131 GLY B C   1 
ATOM   3012  O O   . GLY B 1 133 ? 4.901   7.677   8.964   1.00 81.25  ? 131 GLY B O   1 
ATOM   3013  N N   . ALA B 1 134 ? 4.984   9.609   10.049  1.00 79.63  ? 132 ALA B N   1 
ATOM   3014  C CA  . ALA B 1 134 ? 6.449   9.633   10.023  1.00 81.30  ? 132 ALA B CA  1 
ATOM   3015  C C   . ALA B 1 134 ? 6.882   10.145  11.360  1.00 84.49  ? 132 ALA B C   1 
ATOM   3016  O O   . ALA B 1 134 ? 6.211   10.989  11.950  1.00 87.25  ? 132 ALA B O   1 
ATOM   3017  C CB  . ALA B 1 134 ? 6.976   10.539  8.938   1.00 75.28  ? 132 ALA B CB  1 
ATOM   3018  N N   . THR B 1 135 ? 7.981   9.608   11.868  1.00 89.15  ? 133 THR B N   1 
ATOM   3019  C CA  . THR B 1 135 ? 8.478   10.039  13.177  1.00 93.48  ? 133 THR B CA  1 
ATOM   3020  C C   . THR B 1 135 ? 9.971   9.729   13.334  1.00 95.56  ? 133 THR B C   1 
ATOM   3021  O O   . THR B 1 135 ? 10.582  9.097   12.458  1.00 92.54  ? 133 THR B O   1 
ATOM   3022  C CB  . THR B 1 135 ? 7.715   9.367   14.338  1.00 92.55  ? 133 THR B CB  1 
ATOM   3023  O OG1 . THR B 1 135 ? 8.519   8.311   14.865  1.00 95.05  ? 133 THR B OG1 1 
ATOM   3024  C CG2 . THR B 1 135 ? 6.387   8.794   13.869  1.00 90.66  ? 133 THR B CG2 1 
ATOM   3025  N N   . VAL B 1 136 ? 10.554  10.187  14.442  1.00 99.21  ? 134 VAL B N   1 
ATOM   3026  C CA  . VAL B 1 136 ? 11.967  9.956   14.671  1.00 105.06 ? 134 VAL B CA  1 
ATOM   3027  C C   . VAL B 1 136 ? 12.311  9.679   16.147  1.00 111.98 ? 134 VAL B C   1 
ATOM   3028  O O   . VAL B 1 136 ? 11.515  9.949   17.063  1.00 109.90 ? 134 VAL B O   1 
ATOM   3029  C CB  . VAL B 1 136 ? 12.806  11.140  14.105  1.00 102.26 ? 134 VAL B CB  1 
ATOM   3030  C CG1 . VAL B 1 136 ? 14.287  10.853  14.259  1.00 104.28 ? 134 VAL B CG1 1 
ATOM   3031  C CG2 . VAL B 1 136 ? 12.506  11.329  12.637  1.00 97.67  ? 134 VAL B CG2 1 
ATOM   3032  N N   . TYR B 1 137 ? 13.509  9.128   16.348  1.00 121.06 ? 135 TYR B N   1 
ATOM   3033  C CA  . TYR B 1 137 ? 14.026  8.742   17.662  1.00 127.73 ? 135 TYR B CA  1 
ATOM   3034  C C   . TYR B 1 137 ? 15.472  9.239   17.895  1.00 132.43 ? 135 TYR B C   1 
ATOM   3035  O O   . TYR B 1 137 ? 16.231  9.452   16.933  1.00 133.69 ? 135 TYR B O   1 
ATOM   3036  C CB  . TYR B 1 137 ? 13.982  7.214   17.740  1.00 127.45 ? 135 TYR B CB  1 
ATOM   3037  C CG  . TYR B 1 137 ? 14.720  6.526   16.586  1.00 129.01 ? 135 TYR B CG  1 
ATOM   3038  C CD1 . TYR B 1 137 ? 16.118  6.497   16.540  1.00 130.41 ? 135 TYR B CD1 1 
ATOM   3039  C CD2 . TYR B 1 137 ? 14.023  5.905   15.549  1.00 128.91 ? 135 TYR B CD2 1 
ATOM   3040  C CE1 . TYR B 1 137 ? 16.804  5.865   15.497  1.00 131.11 ? 135 TYR B CE1 1 
ATOM   3041  C CE2 . TYR B 1 137 ? 14.703  5.273   14.497  1.00 131.31 ? 135 TYR B CE2 1 
ATOM   3042  C CZ  . TYR B 1 137 ? 16.100  5.253   14.476  1.00 131.99 ? 135 TYR B CZ  1 
ATOM   3043  O OH  . TYR B 1 137 ? 16.812  4.623   13.461  1.00 130.99 ? 135 TYR B OH  1 
ATOM   3044  N N   . ALA B 1 138 ? 15.849  9.428   19.165  1.00 136.02 ? 136 ALA B N   1 
ATOM   3045  C CA  . ALA B 1 138 ? 17.212  9.872   19.521  1.00 139.42 ? 136 ALA B CA  1 
ATOM   3046  C C   . ALA B 1 138 ? 17.720  9.253   20.856  1.00 141.21 ? 136 ALA B C   1 
ATOM   3047  O O   . ALA B 1 138 ? 16.913  8.947   21.743  1.00 140.90 ? 136 ALA B O   1 
ATOM   3048  C CB  . ALA B 1 138 ? 17.267  11.410  19.576  1.00 138.11 ? 136 ALA B CB  1 
ATOM   3049  N N   . THR B 1 139 ? 19.045  9.071   20.981  1.00 142.46 ? 137 THR B N   1 
ATOM   3050  C CA  . THR B 1 139 ? 19.678  8.470   22.173  1.00 141.95 ? 137 THR B CA  1 
ATOM   3051  C C   . THR B 1 139 ? 19.306  9.138   23.500  1.00 143.99 ? 137 THR B C   1 
ATOM   3052  O O   . THR B 1 139 ? 18.223  8.920   24.040  1.00 144.13 ? 137 THR B O   1 
ATOM   3053  C CB  . THR B 1 139 ? 21.236  8.484   22.090  1.00 140.20 ? 137 THR B CB  1 
ATOM   3054  O OG1 . THR B 1 139 ? 21.673  7.957   20.833  1.00 138.46 ? 137 THR B OG1 1 
ATOM   3055  C CG2 . THR B 1 139 ? 21.831  7.635   23.208  1.00 137.47 ? 137 THR B CG2 1 
ATOM   3056  N N   . GLY B 1 140 ? 20.217  9.942   24.038  1.00 145.88 ? 138 GLY B N   1 
ATOM   3057  C CA  . GLY B 1 140 ? 19.936  10.596  25.300  1.00 147.06 ? 138 GLY B CA  1 
ATOM   3058  C C   . GLY B 1 140 ? 20.210  9.685   26.482  1.00 147.99 ? 138 GLY B C   1 
ATOM   3059  O O   . GLY B 1 140 ? 19.378  8.843   26.856  1.00 147.86 ? 138 GLY B O   1 
ATOM   3060  N N   . THR B 1 141 ? 21.395  9.865   27.064  1.00 148.45 ? 139 THR B N   1 
ATOM   3061  C CA  . THR B 1 141 ? 21.849  9.098   28.221  1.00 147.44 ? 139 THR B CA  1 
ATOM   3062  C C   . THR B 1 141 ? 21.823  7.606   27.914  1.00 147.67 ? 139 THR B C   1 
ATOM   3063  O O   . THR B 1 141 ? 21.387  6.773   28.716  1.00 146.53 ? 139 THR B O   1 
ATOM   3064  C CB  . THR B 1 141 ? 20.981  9.401   29.452  1.00 147.23 ? 139 THR B CB  1 
ATOM   3065  O OG1 . THR B 1 141 ? 20.971  10.812  29.692  1.00 145.55 ? 139 THR B OG1 1 
ATOM   3066  C CG2 . THR B 1 141 ? 21.537  8.737   30.662  1.00 145.69 ? 139 THR B CG2 1 
ATOM   3067  N N   . HIS B 1 142 ? 22.302  7.299   26.718  1.00 148.35 ? 140 HIS B N   1 
ATOM   3068  C CA  . HIS B 1 142 ? 22.393  5.941   26.217  1.00 149.10 ? 140 HIS B CA  1 
ATOM   3069  C C   . HIS B 1 142 ? 21.232  4.968   26.470  1.00 148.94 ? 140 HIS B C   1 
ATOM   3070  O O   . HIS B 1 142 ? 20.262  5.257   27.187  1.00 146.85 ? 140 HIS B O   1 
ATOM   3071  C CB  . HIS B 1 142 ? 23.719  5.313   26.686  1.00 148.11 ? 140 HIS B CB  1 
ATOM   3072  C CG  . HIS B 1 142 ? 24.746  5.183   25.600  1.00 144.56 ? 140 HIS B CG  1 
ATOM   3073  N ND1 . HIS B 1 142 ? 25.086  6.225   24.763  1.00 143.62 ? 140 HIS B ND1 1 
ATOM   3074  C CD2 . HIS B 1 142 ? 25.502  4.130   25.212  1.00 142.46 ? 140 HIS B CD2 1 
ATOM   3075  C CE1 . HIS B 1 142 ? 26.003  5.818   23.905  1.00 141.61 ? 140 HIS B CE1 1 
ATOM   3076  N NE2 . HIS B 1 142 ? 26.273  4.550   24.156  1.00 142.06 ? 140 HIS B NE2 1 
ATOM   3077  N N   . ALA B 1 143 ? 21.388  3.811   25.831  1.00 148.77 ? 141 ALA B N   1 
ATOM   3078  C CA  . ALA B 1 143 ? 20.464  2.686   25.827  1.00 147.54 ? 141 ALA B CA  1 
ATOM   3079  C C   . ALA B 1 143 ? 20.855  2.074   24.478  1.00 147.43 ? 141 ALA B C   1 
ATOM   3080  O O   . ALA B 1 143 ? 20.096  1.350   23.848  1.00 147.38 ? 141 ALA B O   1 
ATOM   3081  C CB  . ALA B 1 143 ? 19.014  3.191   25.799  1.00 147.44 ? 141 ALA B CB  1 
ATOM   3082  N N   . GLN B 1 144 ? 22.076  2.396   24.066  1.00 147.37 ? 142 GLN B N   1 
ATOM   3083  C CA  . GLN B 1 144 ? 22.652  1.983   22.796  1.00 146.93 ? 142 GLN B CA  1 
ATOM   3084  C C   . GLN B 1 144 ? 22.525  0.524   22.368  1.00 146.18 ? 142 GLN B C   1 
ATOM   3085  O O   . GLN B 1 144 ? 21.912  -0.303  23.043  1.00 144.21 ? 142 GLN B O   1 
ATOM   3086  C CB  . GLN B 1 144 ? 24.125  2.381   22.779  1.00 148.52 ? 142 GLN B CB  1 
ATOM   3087  C CG  . GLN B 1 144 ? 24.736  2.474   21.395  1.00 149.70 ? 142 GLN B CG  1 
ATOM   3088  C CD  . GLN B 1 144 ? 26.248  2.459   21.437  1.00 151.05 ? 142 GLN B CD  1 
ATOM   3089  O OE1 . GLN B 1 144 ? 26.857  1.493   21.908  1.00 151.28 ? 142 GLN B OE1 1 
ATOM   3090  N NE2 . GLN B 1 144 ? 26.866  3.531   20.950  1.00 151.25 ? 142 GLN B NE2 1 
ATOM   3091  N N   . VAL B 1 145 ? 23.131  0.236   21.221  1.00 147.60 ? 143 VAL B N   1 
ATOM   3092  C CA  . VAL B 1 145 ? 23.143  -1.091  20.616  1.00 150.39 ? 143 VAL B CA  1 
ATOM   3093  C C   . VAL B 1 145 ? 21.739  -1.570  20.268  1.00 151.10 ? 143 VAL B C   1 
ATOM   3094  O O   . VAL B 1 145 ? 20.858  -0.761  20.017  1.00 151.68 ? 143 VAL B O   1 
ATOM   3095  C CB  . VAL B 1 145 ? 23.817  -2.119  21.538  1.00 151.38 ? 143 VAL B CB  1 
ATOM   3096  C CG1 . VAL B 1 145 ? 24.245  -3.338  20.726  1.00 151.97 ? 143 VAL B CG1 1 
ATOM   3097  C CG2 . VAL B 1 145 ? 25.011  -1.487  22.223  1.00 150.60 ? 143 VAL B CG2 1 
ATOM   3098  N N   . GLU B 1 146 ? 21.534  -2.884  20.258  1.00 152.26 ? 144 GLU B N   1 
ATOM   3099  C CA  . GLU B 1 146 ? 20.237  -3.457  19.916  1.00 152.60 ? 144 GLU B CA  1 
ATOM   3100  C C   . GLU B 1 146 ? 19.132  -3.105  20.905  1.00 154.69 ? 144 GLU B C   1 
ATOM   3101  O O   . GLU B 1 146 ? 18.234  -3.910  21.189  1.00 153.79 ? 144 GLU B O   1 
ATOM   3102  C CB  . GLU B 1 146 ? 20.350  -4.977  19.764  1.00 150.16 ? 144 GLU B CB  1 
ATOM   3103  C CG  . GLU B 1 146 ? 21.366  -5.403  18.712  1.00 144.21 ? 144 GLU B CG  1 
ATOM   3104  C CD  . GLU B 1 146 ? 21.234  -4.588  17.446  1.00 140.18 ? 144 GLU B CD  1 
ATOM   3105  O OE1 . GLU B 1 146 ? 20.235  -4.770  16.718  1.00 136.70 ? 144 GLU B OE1 1 
ATOM   3106  O OE2 . GLU B 1 146 ? 22.126  -3.755  17.187  1.00 138.59 ? 144 GLU B OE2 1 
ATOM   3107  N N   . ASP B 1 147 ? 19.225  -1.879  21.415  1.00 157.61 ? 145 ASP B N   1 
ATOM   3108  C CA  . ASP B 1 147 ? 18.272  -1.295  22.354  1.00 160.64 ? 145 ASP B CA  1 
ATOM   3109  C C   . ASP B 1 147 ? 17.736  -0.003  21.705  1.00 162.61 ? 145 ASP B C   1 
ATOM   3110  O O   . ASP B 1 147 ? 16.826  0.659   22.228  1.00 164.54 ? 145 ASP B O   1 
ATOM   3111  C CB  . ASP B 1 147 ? 18.967  -1.009  23.692  1.00 159.54 ? 145 ASP B CB  1 
ATOM   3112  C CG  . ASP B 1 147 ? 18.061  -0.309  24.685  1.00 159.13 ? 145 ASP B CG  1 
ATOM   3113  O OD1 . ASP B 1 147 ? 16.831  -0.518  24.640  1.00 158.53 ? 145 ASP B OD1 1 
ATOM   3114  O OD2 . ASP B 1 147 ? 18.575  0.445   25.532  1.00 159.01 ? 145 ASP B OD2 1 
ATOM   3115  N N   . GLY B 1 148 ? 18.315  0.319   20.544  1.00 162.94 ? 146 GLY B N   1 
ATOM   3116  C CA  . GLY B 1 148 ? 17.926  1.482   19.758  1.00 160.47 ? 146 GLY B CA  1 
ATOM   3117  C C   . GLY B 1 148 ? 17.335  1.018   18.428  1.00 159.11 ? 146 GLY B C   1 
ATOM   3118  O O   . GLY B 1 148 ? 16.271  1.499   18.028  1.00 159.91 ? 146 GLY B O   1 
ATOM   3119  N N   . ARG B 1 149 ? 18.014  0.077   17.753  1.00 156.92 ? 147 ARG B N   1 
ATOM   3120  C CA  . ARG B 1 149 ? 17.563  -0.501  16.470  1.00 153.69 ? 147 ARG B CA  1 
ATOM   3121  C C   . ARG B 1 149 ? 16.273  -1.294  16.680  1.00 152.23 ? 147 ARG B C   1 
ATOM   3122  O O   . ARG B 1 149 ? 15.635  -1.768  15.727  1.00 150.43 ? 147 ARG B O   1 
ATOM   3123  C CB  . ARG B 1 149 ? 18.612  -1.459  15.900  1.00 151.83 ? 147 ARG B CB  1 
ATOM   3124  C CG  . ARG B 1 149 ? 18.117  -2.216  14.679  1.00 150.93 ? 147 ARG B CG  1 
ATOM   3125  C CD  . ARG B 1 149 ? 17.858  -1.253  13.531  1.00 151.23 ? 147 ARG B CD  1 
ATOM   3126  N NE  . ARG B 1 149 ? 16.965  -1.804  12.517  1.00 152.15 ? 147 ARG B NE  1 
ATOM   3127  C CZ  . ARG B 1 149 ? 16.919  -1.377  11.259  1.00 152.21 ? 147 ARG B CZ  1 
ATOM   3128  N NH1 . ARG B 1 149 ? 17.722  -0.395  10.859  1.00 150.83 ? 147 ARG B NH1 1 
ATOM   3129  N NH2 . ARG B 1 149 ? 16.065  -1.927  10.405  1.00 152.30 ? 147 ARG B NH2 1 
ATOM   3130  N N   . LEU B 1 150 ? 15.925  -1.442  17.952  1.00 151.51 ? 148 LEU B N   1 
ATOM   3131  C CA  . LEU B 1 150 ? 14.738  -2.157  18.370  1.00 150.61 ? 148 LEU B CA  1 
ATOM   3132  C C   . LEU B 1 150 ? 13.525  -1.243  18.217  1.00 148.45 ? 148 LEU B C   1 
ATOM   3133  O O   . LEU B 1 150 ? 12.409  -1.701  17.976  1.00 148.55 ? 148 LEU B O   1 
ATOM   3134  C CB  . LEU B 1 150 ? 14.905  -2.600  19.825  1.00 152.18 ? 148 LEU B CB  1 
ATOM   3135  C CG  . LEU B 1 150 ? 14.056  -3.766  20.334  1.00 152.58 ? 148 LEU B CG  1 
ATOM   3136  C CD1 . LEU B 1 150 ? 14.339  -5.045  19.537  1.00 152.46 ? 148 LEU B CD1 1 
ATOM   3137  C CD2 . LEU B 1 150 ? 14.372  -3.969  21.795  1.00 152.70 ? 148 LEU B CD2 1 
ATOM   3138  N N   . MET B 1 151 ? 13.737  0.058   18.355  1.00 145.63 ? 149 MET B N   1 
ATOM   3139  C CA  . MET B 1 151 ? 12.628  0.986   18.199  1.00 141.84 ? 149 MET B CA  1 
ATOM   3140  C C   . MET B 1 151 ? 12.357  1.185   16.717  1.00 138.25 ? 149 MET B C   1 
ATOM   3141  O O   . MET B 1 151 ? 11.204  1.222   16.304  1.00 137.36 ? 149 MET B O   1 
ATOM   3142  C CB  . MET B 1 151 ? 12.947  2.313   18.871  1.00 143.23 ? 149 MET B CB  1 
ATOM   3143  C CG  . MET B 1 151 ? 13.258  2.155   20.328  1.00 145.81 ? 149 MET B CG  1 
ATOM   3144  S SD  . MET B 1 151 ? 13.389  3.728   21.136  1.00 153.45 ? 149 MET B SD  1 
ATOM   3145  C CE  . MET B 1 151 ? 11.799  3.811   21.969  1.00 151.53 ? 149 MET B CE  1 
ATOM   3146  N N   . GLU B 1 152 ? 13.418  1.285   15.918  1.00 133.58 ? 150 GLU B N   1 
ATOM   3147  C CA  . GLU B 1 152 ? 13.248  1.468   14.485  1.00 130.33 ? 150 GLU B CA  1 
ATOM   3148  C C   . GLU B 1 152 ? 12.417  0.344   13.894  1.00 130.36 ? 150 GLU B C   1 
ATOM   3149  O O   . GLU B 1 152 ? 11.754  0.511   12.874  1.00 131.23 ? 150 GLU B O   1 
ATOM   3150  C CB  . GLU B 1 152 ? 14.588  1.519   13.761  1.00 126.34 ? 150 GLU B CB  1 
ATOM   3151  C CG  . GLU B 1 152 ? 14.409  1.771   12.279  1.00 123.90 ? 150 GLU B CG  1 
ATOM   3152  C CD  . GLU B 1 152 ? 15.707  1.882   11.533  1.00 123.73 ? 150 GLU B CD  1 
ATOM   3153  O OE1 . GLU B 1 152 ? 16.535  2.754   11.881  1.00 119.59 ? 150 GLU B OE1 1 
ATOM   3154  O OE2 . GLU B 1 152 ? 15.894  1.101   10.578  1.00 127.25 ? 150 GLU B OE2 1 
ATOM   3155  N N   . GLN B 1 153 ? 12.460  -0.811  14.536  1.00 129.87 ? 151 GLN B N   1 
ATOM   3156  C CA  . GLN B 1 153 ? 11.694  -1.943  14.060  1.00 129.66 ? 151 GLN B CA  1 
ATOM   3157  C C   . GLN B 1 153 ? 10.198  -1.693  14.306  1.00 128.78 ? 151 GLN B C   1 
ATOM   3158  O O   . GLN B 1 153 ? 9.416   -1.656  13.351  1.00 128.10 ? 151 GLN B O   1 
ATOM   3159  C CB  . GLN B 1 153 ? 12.154  -3.222  14.772  1.00 132.08 ? 151 GLN B CB  1 
ATOM   3160  C CG  . GLN B 1 153 ? 13.547  -3.726  14.367  1.00 132.20 ? 151 GLN B CG  1 
ATOM   3161  C CD  . GLN B 1 153 ? 14.121  -4.766  15.339  1.00 132.10 ? 151 GLN B CD  1 
ATOM   3162  O OE1 . GLN B 1 153 ? 13.436  -5.715  15.748  1.00 130.21 ? 151 GLN B OE1 1 
ATOM   3163  N NE2 . GLN B 1 153 ? 15.393  -4.595  15.697  1.00 130.39 ? 151 GLN B NE2 1 
ATOM   3164  N N   . LEU B 1 154 ? 9.817   -1.492  15.573  1.00 127.11 ? 152 LEU B N   1 
ATOM   3165  C CA  . LEU B 1 154 ? 8.413   -1.265  15.956  1.00 126.92 ? 152 LEU B CA  1 
ATOM   3166  C C   . LEU B 1 154 ? 7.731   -0.086  15.286  1.00 126.23 ? 152 LEU B C   1 
ATOM   3167  O O   . LEU B 1 154 ? 6.497   -0.049  15.156  1.00 126.40 ? 152 LEU B O   1 
ATOM   3168  C CB  . LEU B 1 154 ? 8.280   -1.077  17.479  1.00 126.95 ? 152 LEU B CB  1 
ATOM   3169  C CG  . LEU B 1 154 ? 6.978   -0.420  18.002  1.00 127.50 ? 152 LEU B CG  1 
ATOM   3170  C CD1 . LEU B 1 154 ? 5.757   -1.219  17.561  1.00 126.31 ? 152 LEU B CD1 1 
ATOM   3171  C CD2 . LEU B 1 154 ? 7.015   -0.311  19.528  1.00 128.48 ? 152 LEU B CD2 1 
ATOM   3172  N N   . LEU B 1 155 ? 8.529   0.880   14.864  1.00 123.76 ? 153 LEU B N   1 
ATOM   3173  C CA  . LEU B 1 155 ? 7.966   2.065   14.262  1.00 120.06 ? 153 LEU B CA  1 
ATOM   3174  C C   . LEU B 1 155 ? 8.086   2.100   12.741  1.00 118.54 ? 153 LEU B C   1 
ATOM   3175  O O   . LEU B 1 155 ? 7.109   2.402   12.063  1.00 118.14 ? 153 LEU B O   1 
ATOM   3176  C CB  . LEU B 1 155 ? 8.617   3.285   14.923  1.00 119.68 ? 153 LEU B CB  1 
ATOM   3177  C CG  . LEU B 1 155 ? 8.529   3.213   16.470  1.00 118.72 ? 153 LEU B CG  1 
ATOM   3178  C CD1 . LEU B 1 155 ? 9.405   4.274   17.148  1.00 118.49 ? 153 LEU B CD1 1 
ATOM   3179  C CD2 . LEU B 1 155 ? 7.070   3.372   16.890  1.00 115.13 ? 153 LEU B CD2 1 
ATOM   3180  N N   . SER B 1 156 ? 9.259   1.758   12.205  1.00 117.79 ? 154 SER B N   1 
ATOM   3181  C CA  . SER B 1 156 ? 9.488   1.784   10.751  1.00 118.20 ? 154 SER B CA  1 
ATOM   3182  C C   . SER B 1 156 ? 8.633   0.771   10.001  1.00 116.62 ? 154 SER B C   1 
ATOM   3183  O O   . SER B 1 156 ? 8.900   0.415   8.845   1.00 116.73 ? 154 SER B O   1 
ATOM   3184  C CB  . SER B 1 156 ? 10.971  1.550   10.425  1.00 120.14 ? 154 SER B CB  1 
ATOM   3185  O OG  . SER B 1 156 ? 11.249  1.844   9.059   1.00 123.19 ? 154 SER B OG  1 
ATOM   3186  N N   . SER B 1 157 ? 7.583   0.332   10.674  1.00 115.45 ? 155 SER B N   1 
ATOM   3187  C CA  . SER B 1 157 ? 6.650   -0.633  10.130  1.00 114.99 ? 155 SER B CA  1 
ATOM   3188  C C   . SER B 1 157 ? 5.302   0.053   9.922   1.00 114.40 ? 155 SER B C   1 
ATOM   3189  O O   . SER B 1 157 ? 4.567   -0.273  8.993   1.00 112.33 ? 155 SER B O   1 
ATOM   3190  C CB  . SER B 1 157 ? 6.496   -1.773  11.121  1.00 115.28 ? 155 SER B CB  1 
ATOM   3191  O OG  . SER B 1 157 ? 5.933   -1.291  12.329  1.00 111.95 ? 155 SER B OG  1 
ATOM   3192  N N   . VAL B 1 158 ? 5.006   1.018   10.794  1.00 115.28 ? 156 VAL B N   1 
ATOM   3193  C CA  . VAL B 1 158 ? 3.758   1.789   10.764  1.00 117.12 ? 156 VAL B CA  1 
ATOM   3194  C C   . VAL B 1 158 ? 3.983   3.245   10.297  1.00 117.86 ? 156 VAL B C   1 
ATOM   3195  O O   . VAL B 1 158 ? 3.222   4.146   10.667  1.00 121.01 ? 156 VAL B O   1 
ATOM   3196  C CB  . VAL B 1 158 ? 3.089   1.797   12.177  1.00 115.27 ? 156 VAL B CB  1 
ATOM   3197  C CG1 . VAL B 1 158 ? 1.649   2.304   12.110  1.00 115.02 ? 156 VAL B CG1 1 
ATOM   3198  C CG2 . VAL B 1 158 ? 3.130   0.396   12.752  1.00 116.41 ? 156 VAL B CG2 1 
ATOM   3199  N N   . GLY B 1 159 ? 5.023   3.470   9.487   1.00 115.86 ? 157 GLY B N   1 
ATOM   3200  C CA  . GLY B 1 159 ? 5.314   4.811   8.991   1.00 111.59 ? 157 GLY B CA  1 
ATOM   3201  C C   . GLY B 1 159 ? 6.664   4.983   8.306   1.00 110.00 ? 157 GLY B C   1 
ATOM   3202  O O   . GLY B 1 159 ? 6.828   4.626   7.133   1.00 109.01 ? 157 GLY B O   1 
ATOM   3203  N N   . PHE B 1 160 ? 7.627   5.543   9.040   1.00 107.33 ? 158 PHE B N   1 
ATOM   3204  C CA  . PHE B 1 160 ? 8.969   5.770   8.524   1.00 106.14 ? 158 PHE B CA  1 
ATOM   3205  C C   . PHE B 1 160 ? 9.973   6.244   9.578   1.00 103.92 ? 158 PHE B C   1 
ATOM   3206  O O   . PHE B 1 160 ? 9.636   7.105   10.383  1.00 102.37 ? 158 PHE B O   1 
ATOM   3207  C CB  . PHE B 1 160 ? 8.924   6.803   7.421   1.00 109.74 ? 158 PHE B CB  1 
ATOM   3208  C CG  . PHE B 1 160 ? 10.269  7.229   6.988   1.00 114.69 ? 158 PHE B CG  1 
ATOM   3209  C CD1 . PHE B 1 160 ? 11.028  6.401   6.156   1.00 116.34 ? 158 PHE B CD1 1 
ATOM   3210  C CD2 . PHE B 1 160 ? 10.835  8.400   7.501   1.00 113.66 ? 158 PHE B CD2 1 
ATOM   3211  C CE1 . PHE B 1 160 ? 12.340  6.725   5.846   1.00 118.43 ? 158 PHE B CE1 1 
ATOM   3212  C CE2 . PHE B 1 160 ? 12.142  8.741   7.203   1.00 114.52 ? 158 PHE B CE2 1 
ATOM   3213  C CZ  . PHE B 1 160 ? 12.907  7.902   6.373   1.00 118.97 ? 158 PHE B CZ  1 
ATOM   3214  N N   . CYS B 1 161 ? 11.209  5.717   9.536   1.00 103.02 ? 159 CYS B N   1 
ATOM   3215  C CA  . CYS B 1 161 ? 12.271  6.072   10.513  1.00 103.18 ? 159 CYS B CA  1 
ATOM   3216  C C   . CYS B 1 161 ? 13.769  6.151   10.091  1.00 103.57 ? 159 CYS B C   1 
ATOM   3217  O O   . CYS B 1 161 ? 14.164  5.679   9.019   1.00 103.40 ? 159 CYS B O   1 
ATOM   3218  C CB  . CYS B 1 161 ? 12.219  5.119   11.720  1.00 103.01 ? 159 CYS B CB  1 
ATOM   3219  S SG  . CYS B 1 161 ? 10.847  5.308   12.894  1.00 102.62 ? 159 CYS B SG  1 
ATOM   3220  N N   . THR B 1 162 ? 14.569  6.743   10.995  1.00 103.84 ? 160 THR B N   1 
ATOM   3221  C CA  . THR B 1 162 ? 16.043  6.945   10.934  1.00 105.01 ? 160 THR B CA  1 
ATOM   3222  C C   . THR B 1 162 ? 16.365  7.849   12.136  1.00 104.63 ? 160 THR B C   1 
ATOM   3223  O O   . THR B 1 162 ? 15.542  7.978   13.047  1.00 103.12 ? 160 THR B O   1 
ATOM   3224  C CB  . THR B 1 162 ? 16.555  7.625   9.592   1.00 107.47 ? 160 THR B CB  1 
ATOM   3225  O OG1 . THR B 1 162 ? 16.448  6.686   8.509   1.00 109.87 ? 160 THR B OG1 1 
ATOM   3226  C CG2 . THR B 1 162 ? 18.061  8.053   9.693   1.00 104.37 ? 160 THR B CG2 1 
ATOM   3227  N N   . GLU B 1 163 ? 17.533  8.478   12.164  1.00 104.34 ? 161 GLU B N   1 
ATOM   3228  C CA  . GLU B 1 163 ? 17.828  9.322   13.298  1.00 104.90 ? 161 GLU B CA  1 
ATOM   3229  C C   . GLU B 1 163 ? 18.995  10.238  13.077  1.00 104.31 ? 161 GLU B C   1 
ATOM   3230  O O   . GLU B 1 163 ? 19.815  10.046  12.191  1.00 103.82 ? 161 GLU B O   1 
ATOM   3231  C CB  . GLU B 1 163 ? 18.146  8.478   14.514  1.00 109.49 ? 161 GLU B CB  1 
ATOM   3232  C CG  . GLU B 1 163 ? 19.635  8.189   14.605  1.00 119.59 ? 161 GLU B CG  1 
ATOM   3233  C CD  . GLU B 1 163 ? 19.953  6.786   15.046  1.00 125.34 ? 161 GLU B CD  1 
ATOM   3234  O OE1 . GLU B 1 163 ? 19.509  6.397   16.151  1.00 128.90 ? 161 GLU B OE1 1 
ATOM   3235  O OE2 . GLU B 1 163 ? 20.653  6.076   14.281  1.00 128.79 ? 161 GLU B OE2 1 
ATOM   3236  N N   . VAL B 1 164 ? 19.045  11.224  13.956  1.00 104.82 ? 162 VAL B N   1 
ATOM   3237  C CA  . VAL B 1 164 ? 20.053  12.265  14.055  1.00 106.81 ? 162 VAL B CA  1 
ATOM   3238  C C   . VAL B 1 164 ? 19.623  12.986  15.363  1.00 108.65 ? 162 VAL B C   1 
ATOM   3239  O O   . VAL B 1 164 ? 18.438  13.084  15.664  1.00 108.84 ? 162 VAL B O   1 
ATOM   3240  C CB  . VAL B 1 164 ? 20.030  13.274  12.843  1.00 106.74 ? 162 VAL B CB  1 
ATOM   3241  C CG1 . VAL B 1 164 ? 21.335  14.059  12.808  1.00 101.82 ? 162 VAL B CG1 1 
ATOM   3242  C CG2 . VAL B 1 164 ? 19.807  12.546  11.502  1.00 105.05 ? 162 VAL B CG2 1 
ATOM   3243  N N   . GLU B 1 165 ? 20.594  13.464  16.136  1.00 109.90 ? 163 GLU B N   1 
ATOM   3244  C CA  . GLU B 1 165 ? 20.381  14.143  17.424  1.00 109.87 ? 163 GLU B CA  1 
ATOM   3245  C C   . GLU B 1 165 ? 19.046  14.819  17.738  1.00 108.13 ? 163 GLU B C   1 
ATOM   3246  O O   . GLU B 1 165 ? 18.288  15.185  16.853  1.00 105.46 ? 163 GLU B O   1 
ATOM   3247  C CB  . GLU B 1 165 ? 21.513  15.140  17.644  1.00 113.13 ? 163 GLU B CB  1 
ATOM   3248  C CG  . GLU B 1 165 ? 21.828  15.968  16.420  1.00 118.18 ? 163 GLU B CG  1 
ATOM   3249  C CD  . GLU B 1 165 ? 23.321  16.120  16.184  1.00 122.86 ? 163 GLU B CD  1 
ATOM   3250  O OE1 . GLU B 1 165 ? 24.034  16.638  17.079  1.00 126.00 ? 163 GLU B OE1 1 
ATOM   3251  O OE2 . GLU B 1 165 ? 23.785  15.719  15.092  1.00 125.12 ? 163 GLU B OE2 1 
ATOM   3252  N N   . GLU B 1 166 ? 18.794  14.995  19.030  1.00 109.93 ? 164 GLU B N   1 
ATOM   3253  C CA  . GLU B 1 166 ? 17.560  15.593  19.537  1.00 112.48 ? 164 GLU B CA  1 
ATOM   3254  C C   . GLU B 1 166 ? 17.286  17.062  19.231  1.00 112.71 ? 164 GLU B C   1 
ATOM   3255  O O   . GLU B 1 166 ? 16.148  17.537  19.344  1.00 111.99 ? 164 GLU B O   1 
ATOM   3256  C CB  . GLU B 1 166 ? 17.488  15.416  21.045  1.00 114.73 ? 164 GLU B CB  1 
ATOM   3257  C CG  . GLU B 1 166 ? 16.373  16.226  21.655  1.00 118.06 ? 164 GLU B CG  1 
ATOM   3258  C CD  . GLU B 1 166 ? 16.251  15.988  23.109  1.00 120.70 ? 164 GLU B CD  1 
ATOM   3259  O OE1 . GLU B 1 166 ? 17.305  16.060  23.783  1.00 120.78 ? 164 GLU B OE1 1 
ATOM   3260  O OE2 . GLU B 1 166 ? 15.111  15.734  23.567  1.00 121.53 ? 164 GLU B OE2 1 
ATOM   3261  N N   . ASP B 1 167 ? 18.327  17.796  18.879  1.00 114.27 ? 165 ASP B N   1 
ATOM   3262  C CA  . ASP B 1 167 ? 18.152  19.205  18.561  1.00 116.31 ? 165 ASP B CA  1 
ATOM   3263  C C   . ASP B 1 167 ? 17.231  19.337  17.336  1.00 112.93 ? 165 ASP B C   1 
ATOM   3264  O O   . ASP B 1 167 ? 16.369  20.224  17.280  1.00 113.06 ? 165 ASP B O   1 
ATOM   3265  C CB  . ASP B 1 167 ? 19.514  19.846  18.267  1.00 123.96 ? 165 ASP B CB  1 
ATOM   3266  C CG  . ASP B 1 167 ? 20.304  19.100  17.171  1.00 130.02 ? 165 ASP B CG  1 
ATOM   3267  O OD1 . ASP B 1 167 ? 19.718  18.704  16.132  1.00 131.74 ? 165 ASP B OD1 1 
ATOM   3268  O OD2 . ASP B 1 167 ? 21.531  18.920  17.339  1.00 133.49 ? 165 ASP B OD2 1 
ATOM   3269  N N   . LEU B 1 168 ? 17.422  18.442  16.363  1.00 106.28 ? 166 LEU B N   1 
ATOM   3270  C CA  . LEU B 1 168 ? 16.632  18.419  15.136  1.00 97.41  ? 166 LEU B CA  1 
ATOM   3271  C C   . LEU B 1 168 ? 15.152  18.158  15.445  1.00 95.99  ? 166 LEU B C   1 
ATOM   3272  O O   . LEU B 1 168 ? 14.256  18.672  14.774  1.00 93.82  ? 166 LEU B O   1 
ATOM   3273  C CB  . LEU B 1 168 ? 17.161  17.332  14.185  1.00 91.76  ? 166 LEU B CB  1 
ATOM   3274  C CG  . LEU B 1 168 ? 18.615  17.371  13.684  1.00 88.43  ? 166 LEU B CG  1 
ATOM   3275  C CD1 . LEU B 1 168 ? 18.797  16.312  12.614  1.00 85.95  ? 166 LEU B CD1 1 
ATOM   3276  C CD2 . LEU B 1 168 ? 18.959  18.723  13.109  1.00 87.32  ? 166 LEU B CD2 1 
ATOM   3277  N N   . ILE B 1 169 ? 14.907  17.355  16.473  1.00 95.69  ? 167 ILE B N   1 
ATOM   3278  C CA  . ILE B 1 169 ? 13.551  17.013  16.876  1.00 94.26  ? 167 ILE B CA  1 
ATOM   3279  C C   . ILE B 1 169 ? 12.615  18.207  16.829  1.00 94.46  ? 167 ILE B C   1 
ATOM   3280  O O   . ILE B 1 169 ? 11.469  18.088  16.374  1.00 93.50  ? 167 ILE B O   1 
ATOM   3281  C CB  . ILE B 1 169 ? 13.540  16.405  18.291  1.00 93.28  ? 167 ILE B CB  1 
ATOM   3282  C CG1 . ILE B 1 169 ? 14.197  15.026  18.240  1.00 93.68  ? 167 ILE B CG1 1 
ATOM   3283  C CG2 . ILE B 1 169 ? 12.118  16.281  18.821  1.00 90.55  ? 167 ILE B CG2 1 
ATOM   3284  C CD1 . ILE B 1 169 ? 14.198  14.311  19.564  1.00 97.61  ? 167 ILE B CD1 1 
ATOM   3285  N N   . ASP B 1 170 ? 13.118  19.355  17.273  1.00 94.31  ? 168 ASP B N   1 
ATOM   3286  C CA  . ASP B 1 170 ? 12.332  20.579  17.306  1.00 93.80  ? 168 ASP B CA  1 
ATOM   3287  C C   . ASP B 1 170 ? 11.957  20.990  15.895  1.00 91.53  ? 168 ASP B C   1 
ATOM   3288  O O   . ASP B 1 170 ? 10.891  21.574  15.654  1.00 90.01  ? 168 ASP B O   1 
ATOM   3289  C CB  . ASP B 1 170 ? 13.146  21.669  17.997  1.00 99.17  ? 168 ASP B CB  1 
ATOM   3290  C CG  . ASP B 1 170 ? 13.537  21.285  19.430  1.00 104.92 ? 168 ASP B CG  1 
ATOM   3291  O OD1 . ASP B 1 170 ? 12.608  21.064  20.248  1.00 103.78 ? 168 ASP B OD1 1 
ATOM   3292  O OD2 . ASP B 1 170 ? 14.759  21.204  19.744  1.00 107.84 ? 168 ASP B OD2 1 
ATOM   3293  N N   . ALA B 1 171 ? 12.838  20.649  14.957  1.00 88.43  ? 169 ALA B N   1 
ATOM   3294  C CA  . ALA B 1 171 ? 12.650  20.961  13.537  1.00 84.32  ? 169 ALA B CA  1 
ATOM   3295  C C   . ALA B 1 171 ? 11.727  19.935  12.870  1.00 81.55  ? 169 ALA B C   1 
ATOM   3296  O O   . ALA B 1 171 ? 10.711  20.296  12.267  1.00 79.95  ? 169 ALA B O   1 
ATOM   3297  C CB  . ALA B 1 171 ? 14.000  20.979  12.836  1.00 81.24  ? 169 ALA B CB  1 
ATOM   3298  N N   . VAL B 1 172 ? 12.094  18.659  12.980  1.00 76.93  ? 170 VAL B N   1 
ATOM   3299  C CA  . VAL B 1 172 ? 11.295  17.575  12.420  1.00 73.97  ? 170 VAL B CA  1 
ATOM   3300  C C   . VAL B 1 172 ? 9.824   17.777  12.736  1.00 75.19  ? 170 VAL B C   1 
ATOM   3301  O O   . VAL B 1 172 ? 8.938   17.315  12.028  1.00 78.28  ? 170 VAL B O   1 
ATOM   3302  C CB  . VAL B 1 172 ? 11.735  16.225  12.991  1.00 70.86  ? 170 VAL B CB  1 
ATOM   3303  C CG1 . VAL B 1 172 ? 10.557  15.240  13.026  1.00 69.56  ? 170 VAL B CG1 1 
ATOM   3304  C CG2 . VAL B 1 172 ? 12.853  15.670  12.136  1.00 66.13  ? 170 VAL B CG2 1 
ATOM   3305  N N   . THR B 1 173 ? 9.571   18.472  13.824  1.00 75.57  ? 171 THR B N   1 
ATOM   3306  C CA  . THR B 1 173 ? 8.214   18.743  14.232  1.00 76.45  ? 171 THR B CA  1 
ATOM   3307  C C   . THR B 1 173 ? 7.648   19.926  13.467  1.00 76.74  ? 171 THR B C   1 
ATOM   3308  O O   . THR B 1 173 ? 6.516   19.867  12.991  1.00 76.97  ? 171 THR B O   1 
ATOM   3309  C CB  . THR B 1 173 ? 8.154   19.068  15.694  1.00 78.95  ? 171 THR B CB  1 
ATOM   3310  O OG1 . THR B 1 173 ? 9.021   18.174  16.400  1.00 77.96  ? 171 THR B OG1 1 
ATOM   3311  C CG2 . THR B 1 173 ? 6.695   18.931  16.202  1.00 81.90  ? 171 THR B CG2 1 
ATOM   3312  N N   . GLY B 1 174 ? 8.424   21.008  13.373  1.00 75.73  ? 172 GLY B N   1 
ATOM   3313  C CA  . GLY B 1 174 ? 7.971   22.178  12.633  1.00 72.39  ? 172 GLY B CA  1 
ATOM   3314  C C   . GLY B 1 174 ? 7.633   21.767  11.207  1.00 68.85  ? 172 GLY B C   1 
ATOM   3315  O O   . GLY B 1 174 ? 6.887   22.437  10.477  1.00 67.26  ? 172 GLY B O   1 
ATOM   3316  N N   . LEU B 1 175 ? 8.195   20.643  10.796  1.00 65.69  ? 173 LEU B N   1 
ATOM   3317  C CA  . LEU B 1 175 ? 7.915   20.149  9.471   1.00 63.64  ? 173 LEU B CA  1 
ATOM   3318  C C   . LEU B 1 175 ? 6.836   19.077  9.596   1.00 63.49  ? 173 LEU B C   1 
ATOM   3319  O O   . LEU B 1 175 ? 5.644   19.379  9.495   1.00 62.49  ? 173 LEU B O   1 
ATOM   3320  C CB  . LEU B 1 175 ? 9.191   19.586  8.851   1.00 64.75  ? 173 LEU B CB  1 
ATOM   3321  C CG  . LEU B 1 175 ? 9.183   18.998  7.440   1.00 66.02  ? 173 LEU B CG  1 
ATOM   3322  C CD1 . LEU B 1 175 ? 8.644   19.995  6.455   1.00 73.03  ? 173 LEU B CD1 1 
ATOM   3323  C CD2 . LEU B 1 175 ? 10.595  18.637  7.041   1.00 65.91  ? 173 LEU B CD2 1 
ATOM   3324  N N   . SER B 1 176 ? 7.246   17.835  9.844   1.00 65.04  ? 174 SER B N   1 
ATOM   3325  C CA  . SER B 1 176 ? 6.310   16.703  9.955   1.00 64.94  ? 174 SER B CA  1 
ATOM   3326  C C   . SER B 1 176 ? 5.330   16.823  11.110  1.00 62.60  ? 174 SER B C   1 
ATOM   3327  O O   . SER B 1 176 ? 4.177   16.362  11.019  1.00 59.75  ? 174 SER B O   1 
ATOM   3328  C CB  . SER B 1 176 ? 7.081   15.391  10.115  1.00 65.82  ? 174 SER B CB  1 
ATOM   3329  O OG  . SER B 1 176 ? 6.754   14.781  11.359  1.00 77.97  ? 174 SER B OG  1 
ATOM   3330  N N   . GLY B 1 177 ? 5.811   17.415  12.200  1.00 60.46  ? 175 GLY B N   1 
ATOM   3331  C CA  . GLY B 1 177 ? 4.976   17.576  13.364  1.00 64.57  ? 175 GLY B CA  1 
ATOM   3332  C C   . GLY B 1 177 ? 3.627   18.087  12.914  1.00 63.95  ? 175 GLY B C   1 
ATOM   3333  O O   . GLY B 1 177 ? 2.645   17.332  12.937  1.00 65.58  ? 175 GLY B O   1 
ATOM   3334  N N   . SER B 1 178 ? 3.585   19.349  12.476  1.00 61.50  ? 176 SER B N   1 
ATOM   3335  C CA  . SER B 1 178 ? 2.339   19.976  12.033  1.00 57.69  ? 176 SER B CA  1 
ATOM   3336  C C   . SER B 1 178 ? 1.960   19.694  10.577  1.00 56.10  ? 176 SER B C   1 
ATOM   3337  O O   . SER B 1 178 ? 0.766   19.671  10.248  1.00 52.86  ? 176 SER B O   1 
ATOM   3338  C CB  . SER B 1 178 ? 2.398   21.487  12.284  1.00 55.01  ? 176 SER B CB  1 
ATOM   3339  O OG  . SER B 1 178 ? 2.651   21.784  13.649  1.00 51.06  ? 176 SER B OG  1 
ATOM   3340  N N   . GLY B 1 179 ? 2.976   19.479  9.735   1.00 52.69  ? 177 GLY B N   1 
ATOM   3341  C CA  . GLY B 1 179 ? 2.774   19.182  8.330   1.00 49.25  ? 177 GLY B CA  1 
ATOM   3342  C C   . GLY B 1 179 ? 1.358   18.763  8.028   1.00 54.61  ? 177 GLY B C   1 
ATOM   3343  O O   . GLY B 1 179 ? 0.666   19.374  7.229   1.00 58.06  ? 177 GLY B O   1 
ATOM   3344  N N   . PRO B 1 180 ? 0.878   17.717  8.683   1.00 60.17  ? 178 PRO B N   1 
ATOM   3345  C CA  . PRO B 1 180 ? -0.486  17.207  8.483   1.00 59.07  ? 178 PRO B CA  1 
ATOM   3346  C C   . PRO B 1 180 ? -1.607  18.260  8.557   1.00 56.96  ? 178 PRO B C   1 
ATOM   3347  O O   . PRO B 1 180 ? -2.637  18.128  7.908   1.00 56.26  ? 178 PRO B O   1 
ATOM   3348  C CB  . PRO B 1 180 ? -0.608  16.148  9.582   1.00 58.71  ? 178 PRO B CB  1 
ATOM   3349  C CG  . PRO B 1 180 ? 0.812   15.603  9.667   1.00 62.46  ? 178 PRO B CG  1 
ATOM   3350  C CD  . PRO B 1 180 ? 1.665   16.840  9.576   1.00 63.03  ? 178 PRO B CD  1 
ATOM   3351  N N   . ALA B 1 181 ? -1.404  19.309  9.342   1.00 54.75  ? 179 ALA B N   1 
ATOM   3352  C CA  . ALA B 1 181 ? -2.419  20.331  9.498   1.00 49.74  ? 179 ALA B CA  1 
ATOM   3353  C C   . ALA B 1 181 ? -2.447  21.228  8.286   1.00 49.97  ? 179 ALA B C   1 
ATOM   3354  O O   . ALA B 1 181 ? -3.521  21.652  7.812   1.00 47.23  ? 179 ALA B O   1 
ATOM   3355  C CB  . ALA B 1 181 ? -2.144  21.142  10.757  1.00 56.73  ? 179 ALA B CB  1 
ATOM   3356  N N   . TYR B 1 182 ? -1.251  21.525  7.799   1.00 48.32  ? 180 TYR B N   1 
ATOM   3357  C CA  . TYR B 1 182 ? -1.098  22.355  6.618   1.00 48.02  ? 180 TYR B CA  1 
ATOM   3358  C C   . TYR B 1 182 ? -1.861  21.664  5.515   1.00 50.78  ? 180 TYR B C   1 
ATOM   3359  O O   . TYR B 1 182 ? -2.628  22.287  4.786   1.00 51.96  ? 180 TYR B O   1 
ATOM   3360  C CB  . TYR B 1 182 ? 0.349   22.397  6.199   1.00 43.19  ? 180 TYR B CB  1 
ATOM   3361  C CG  . TYR B 1 182 ? 1.312   22.625  7.337   1.00 48.15  ? 180 TYR B CG  1 
ATOM   3362  C CD1 . TYR B 1 182 ? 2.678   22.432  7.143   1.00 49.97  ? 180 TYR B CD1 1 
ATOM   3363  C CD2 . TYR B 1 182 ? 0.874   23.077  8.596   1.00 51.80  ? 180 TYR B CD2 1 
ATOM   3364  C CE1 . TYR B 1 182 ? 3.590   22.680  8.140   1.00 49.97  ? 180 TYR B CE1 1 
ATOM   3365  C CE2 . TYR B 1 182 ? 1.773   23.329  9.606   1.00 51.89  ? 180 TYR B CE2 1 
ATOM   3366  C CZ  . TYR B 1 182 ? 3.143   23.127  9.363   1.00 55.86  ? 180 TYR B CZ  1 
ATOM   3367  O OH  . TYR B 1 182 ? 4.093   23.373  10.328  1.00 59.71  ? 180 TYR B OH  1 
ATOM   3368  N N   . ALA B 1 183 ? -1.608  20.360  5.390   1.00 51.07  ? 181 ALA B N   1 
ATOM   3369  C CA  . ALA B 1 183 ? -2.250  19.512  4.385   1.00 47.01  ? 181 ALA B CA  1 
ATOM   3370  C C   . ALA B 1 183 ? -3.788  19.559  4.515   1.00 46.89  ? 181 ALA B C   1 
ATOM   3371  O O   . ALA B 1 183 ? -4.510  19.880  3.566   1.00 47.41  ? 181 ALA B O   1 
ATOM   3372  C CB  . ALA B 1 183 ? -1.755  18.098  4.541   1.00 44.82  ? 181 ALA B CB  1 
ATOM   3373  N N   . PHE B 1 184 ? -4.296  19.253  5.697   1.00 42.99  ? 182 PHE B N   1 
ATOM   3374  C CA  . PHE B 1 184 ? -5.725  19.286  5.892   1.00 43.77  ? 182 PHE B CA  1 
ATOM   3375  C C   . PHE B 1 184 ? -6.300  20.608  5.437   1.00 44.80  ? 182 PHE B C   1 
ATOM   3376  O O   . PHE B 1 184 ? -7.431  20.688  4.970   1.00 44.90  ? 182 PHE B O   1 
ATOM   3377  C CB  . PHE B 1 184 ? -6.037  19.037  7.353   1.00 47.36  ? 182 PHE B CB  1 
ATOM   3378  C CG  . PHE B 1 184 ? -5.730  17.655  7.785   1.00 55.35  ? 182 PHE B CG  1 
ATOM   3379  C CD1 . PHE B 1 184 ? -6.039  17.235  9.059   1.00 64.31  ? 182 PHE B CD1 1 
ATOM   3380  C CD2 . PHE B 1 184 ? -5.177  16.740  6.887   1.00 59.06  ? 182 PHE B CD2 1 
ATOM   3381  C CE1 . PHE B 1 184 ? -5.806  15.914  9.424   1.00 67.30  ? 182 PHE B CE1 1 
ATOM   3382  C CE2 . PHE B 1 184 ? -4.941  15.432  7.234   1.00 57.63  ? 182 PHE B CE2 1 
ATOM   3383  C CZ  . PHE B 1 184 ? -5.256  15.010  8.498   1.00 64.42  ? 182 PHE B CZ  1 
ATOM   3384  N N   . THR B 1 185 ? -5.510  21.655  5.582   1.00 46.26  ? 183 THR B N   1 
ATOM   3385  C CA  . THR B 1 185 ? -5.960  22.959  5.155   1.00 48.71  ? 183 THR B CA  1 
ATOM   3386  C C   . THR B 1 185 ? -5.819  23.048  3.644   1.00 46.07  ? 183 THR B C   1 
ATOM   3387  O O   . THR B 1 185 ? -6.737  23.425  2.933   1.00 38.66  ? 183 THR B O   1 
ATOM   3388  C CB  . THR B 1 185 ? -5.138  24.045  5.803   1.00 48.78  ? 183 THR B CB  1 
ATOM   3389  O OG1 . THR B 1 185 ? -5.518  24.152  7.188   1.00 53.45  ? 183 THR B OG1 1 
ATOM   3390  C CG2 . THR B 1 185 ? -5.350  25.345  5.060   1.00 46.06  ? 183 THR B CG2 1 
ATOM   3391  N N   . ALA B 1 186 ? -4.638  22.683  3.173   1.00 46.44  ? 184 ALA B N   1 
ATOM   3392  C CA  . ALA B 1 186 ? -4.346  22.683  1.759   1.00 48.07  ? 184 ALA B CA  1 
ATOM   3393  C C   . ALA B 1 186 ? -5.516  22.048  1.052   1.00 48.41  ? 184 ALA B C   1 
ATOM   3394  O O   . ALA B 1 186 ? -5.946  22.548  0.022   1.00 52.02  ? 184 ALA B O   1 
ATOM   3395  C CB  . ALA B 1 186 ? -3.081  21.887  1.500   1.00 44.25  ? 184 ALA B CB  1 
ATOM   3396  N N   . LEU B 1 187 ? -6.035  20.971  1.647   1.00 47.03  ? 185 LEU B N   1 
ATOM   3397  C CA  . LEU B 1 187 ? -7.164  20.211  1.125   1.00 45.99  ? 185 LEU B CA  1 
ATOM   3398  C C   . LEU B 1 187 ? -8.480  20.940  1.166   1.00 43.24  ? 185 LEU B C   1 
ATOM   3399  O O   . LEU B 1 187 ? -8.965  21.371  0.137   1.00 47.09  ? 185 LEU B O   1 
ATOM   3400  C CB  . LEU B 1 187 ? -7.274  18.885  1.859   1.00 49.11  ? 185 LEU B CB  1 
ATOM   3401  C CG  . LEU B 1 187 ? -6.182  17.940  1.320   1.00 53.17  ? 185 LEU B CG  1 
ATOM   3402  C CD1 . LEU B 1 187 ? -6.153  16.644  2.096   1.00 48.06  ? 185 LEU B CD1 1 
ATOM   3403  C CD2 . LEU B 1 187 ? -6.433  17.656  -0.156  1.00 51.91  ? 185 LEU B CD2 1 
ATOM   3404  N N   . ASP B 1 188 ? -9.079  21.085  2.330   1.00 42.20  ? 186 ASP B N   1 
ATOM   3405  C CA  . ASP B 1 188 ? -10.311 21.849  2.399   1.00 43.86  ? 186 ASP B CA  1 
ATOM   3406  C C   . ASP B 1 188 ? -10.177 23.044  1.420   1.00 45.34  ? 186 ASP B C   1 
ATOM   3407  O O   . ASP B 1 188 ? -11.119 23.426  0.762   1.00 44.08  ? 186 ASP B O   1 
ATOM   3408  C CB  . ASP B 1 188 ? -10.481 22.348  3.831   1.00 48.87  ? 186 ASP B CB  1 
ATOM   3409  C CG  . ASP B 1 188 ? -11.704 23.220  4.028   1.00 55.69  ? 186 ASP B CG  1 
ATOM   3410  O OD1 . ASP B 1 188 ? -11.823 24.250  3.336   1.00 64.26  ? 186 ASP B OD1 1 
ATOM   3411  O OD2 . ASP B 1 188 ? -12.558 22.911  4.898   1.00 57.01  ? 186 ASP B OD2 1 
ATOM   3412  N N   . ALA B 1 189 ? -8.991  23.626  1.309   1.00 45.59  ? 187 ALA B N   1 
ATOM   3413  C CA  . ALA B 1 189 ? -8.785  24.760  0.410   1.00 42.54  ? 187 ALA B CA  1 
ATOM   3414  C C   . ALA B 1 189 ? -9.137  24.392  -1.024  1.00 43.20  ? 187 ALA B C   1 
ATOM   3415  O O   . ALA B 1 189 ? -10.051 24.984  -1.617  1.00 37.09  ? 187 ALA B O   1 
ATOM   3416  C CB  . ALA B 1 189 ? -7.314  25.239  0.500   1.00 40.95  ? 187 ALA B CB  1 
ATOM   3417  N N   . LEU B 1 190 ? -8.364  23.452  -1.568  1.00 42.02  ? 188 LEU B N   1 
ATOM   3418  C CA  . LEU B 1 190 ? -8.527  22.929  -2.917  1.00 43.22  ? 188 LEU B CA  1 
ATOM   3419  C C   . LEU B 1 190 ? -9.930  22.407  -3.229  1.00 47.60  ? 188 LEU B C   1 
ATOM   3420  O O   . LEU B 1 190 ? -10.476 22.612  -4.307  1.00 48.14  ? 188 LEU B O   1 
ATOM   3421  C CB  . LEU B 1 190 ? -7.567  21.784  -3.122  1.00 41.73  ? 188 LEU B CB  1 
ATOM   3422  C CG  . LEU B 1 190 ? -6.097  22.165  -3.000  1.00 46.37  ? 188 LEU B CG  1 
ATOM   3423  C CD1 . LEU B 1 190 ? -5.168  21.008  -3.411  1.00 42.84  ? 188 LEU B CD1 1 
ATOM   3424  C CD2 . LEU B 1 190 ? -5.848  23.365  -3.902  1.00 44.40  ? 188 LEU B CD2 1 
ATOM   3425  N N   . ALA B 1 191 ? -10.493 21.703  -2.261  1.00 51.29  ? 189 ALA B N   1 
ATOM   3426  C CA  . ALA B 1 191 ? -11.818 21.110  -2.362  1.00 53.36  ? 189 ALA B CA  1 
ATOM   3427  C C   . ALA B 1 191 ? -12.873 22.158  -2.148  1.00 53.37  ? 189 ALA B C   1 
ATOM   3428  O O   . ALA B 1 191 ? -13.964 21.876  -1.624  1.00 55.47  ? 189 ALA B O   1 
ATOM   3429  C CB  . ALA B 1 191 ? -11.977 19.987  -1.315  1.00 61.15  ? 189 ALA B CB  1 
ATOM   3430  N N   . ASP B 1 192 ? -12.527 23.374  -2.538  1.00 51.40  ? 190 ASP B N   1 
ATOM   3431  C CA  . ASP B 1 192 ? -13.424 24.493  -2.448  1.00 52.97  ? 190 ASP B CA  1 
ATOM   3432  C C   . ASP B 1 192 ? -13.101 25.171  -3.745  1.00 53.49  ? 190 ASP B C   1 
ATOM   3433  O O   . ASP B 1 192 ? -13.999 25.476  -4.516  1.00 54.68  ? 190 ASP B O   1 
ATOM   3434  C CB  . ASP B 1 192 ? -13.097 25.389  -1.251  1.00 55.53  ? 190 ASP B CB  1 
ATOM   3435  C CG  . ASP B 1 192 ? -13.964 25.084  -0.028  1.00 62.78  ? 190 ASP B CG  1 
ATOM   3436  O OD1 . ASP B 1 192 ? -15.212 25.037  -0.137  1.00 69.90  ? 190 ASP B OD1 1 
ATOM   3437  O OD2 . ASP B 1 192 ? -13.413 24.892  1.073   1.00 70.63  ? 190 ASP B OD2 1 
ATOM   3438  N N   . GLY B 1 193 ? -11.811 25.366  -3.999  1.00 51.75  ? 191 GLY B N   1 
ATOM   3439  C CA  . GLY B 1 193 ? -11.415 25.989  -5.242  1.00 54.65  ? 191 GLY B CA  1 
ATOM   3440  C C   . GLY B 1 193 ? -12.190 25.334  -6.377  1.00 57.81  ? 191 GLY B C   1 
ATOM   3441  O O   . GLY B 1 193 ? -12.873 26.013  -7.169  1.00 61.00  ? 191 GLY B O   1 
ATOM   3442  N N   . GLY B 1 194 ? -12.082 24.005  -6.437  1.00 55.37  ? 192 GLY B N   1 
ATOM   3443  C CA  . GLY B 1 194 ? -12.759 23.209  -7.449  1.00 49.30  ? 192 GLY B CA  1 
ATOM   3444  C C   . GLY B 1 194 ? -14.272 23.107  -7.306  1.00 46.23  ? 192 GLY B C   1 
ATOM   3445  O O   . GLY B 1 194 ? -14.952 22.830  -8.278  1.00 43.07  ? 192 GLY B O   1 
ATOM   3446  N N   . VAL B 1 195 ? -14.816 23.305  -6.110  1.00 46.55  ? 193 VAL B N   1 
ATOM   3447  C CA  . VAL B 1 195 ? -16.256 23.246  -5.957  1.00 44.45  ? 193 VAL B CA  1 
ATOM   3448  C C   . VAL B 1 195 ? -16.652 24.509  -6.681  1.00 50.98  ? 193 VAL B C   1 
ATOM   3449  O O   . VAL B 1 195 ? -17.613 24.522  -7.453  1.00 57.18  ? 193 VAL B O   1 
ATOM   3450  C CB  . VAL B 1 195 ? -16.692 23.342  -4.484  1.00 37.22  ? 193 VAL B CB  1 
ATOM   3451  C CG1 . VAL B 1 195 ? -18.171 23.585  -4.394  1.00 30.31  ? 193 VAL B CG1 1 
ATOM   3452  C CG2 . VAL B 1 195 ? -16.347 22.066  -3.754  1.00 33.83  ? 193 VAL B CG2 1 
ATOM   3453  N N   . LYS B 1 196 ? -15.874 25.568  -6.458  1.00 53.43  ? 194 LYS B N   1 
ATOM   3454  C CA  . LYS B 1 196 ? -16.114 26.856  -7.105  1.00 52.42  ? 194 LYS B CA  1 
ATOM   3455  C C   . LYS B 1 196 ? -16.178 26.665  -8.610  1.00 55.39  ? 194 LYS B C   1 
ATOM   3456  O O   . LYS B 1 196 ? -16.964 27.307  -9.312  1.00 58.16  ? 194 LYS B O   1 
ATOM   3457  C CB  . LYS B 1 196 ? -14.977 27.817  -6.766  1.00 49.93  ? 194 LYS B CB  1 
ATOM   3458  C CG  . LYS B 1 196 ? -14.997 29.158  -7.520  1.00 43.65  ? 194 LYS B CG  1 
ATOM   3459  C CD  . LYS B 1 196 ? -13.893 30.049  -7.017  1.00 34.88  ? 194 LYS B CD  1 
ATOM   3460  C CE  . LYS B 1 196 ? -13.532 31.146  -8.029  1.00 33.00  ? 194 LYS B CE  1 
ATOM   3461  N NZ  . LYS B 1 196 ? -14.556 32.200  -8.158  1.00 34.96  ? 194 LYS B NZ  1 
ATOM   3462  N N   . MET B 1 197 ? -15.323 25.775  -9.092  1.00 57.42  ? 195 MET B N   1 
ATOM   3463  C CA  . MET B 1 197 ? -15.275 25.472  -10.505 1.00 60.24  ? 195 MET B CA  1 
ATOM   3464  C C   . MET B 1 197 ? -16.336 24.422  -10.946 1.00 63.78  ? 195 MET B C   1 
ATOM   3465  O O   . MET B 1 197 ? -16.248 23.917  -12.068 1.00 70.38  ? 195 MET B O   1 
ATOM   3466  C CB  . MET B 1 197 ? -13.843 25.051  -10.927 1.00 51.25  ? 195 MET B CB  1 
ATOM   3467  C CG  . MET B 1 197 ? -12.804 26.163  -10.790 1.00 52.59  ? 195 MET B CG  1 
ATOM   3468  S SD  . MET B 1 197 ? -13.048 27.613  -11.861 1.00 53.83  ? 195 MET B SD  1 
ATOM   3469  C CE  . MET B 1 197 ? -14.531 28.351  -11.135 1.00 51.67  ? 195 MET B CE  1 
ATOM   3470  N N   . GLY B 1 198 ? -17.318 24.086  -10.089 1.00 60.66  ? 196 GLY B N   1 
ATOM   3471  C CA  . GLY B 1 198 ? -18.367 23.153  -10.500 1.00 56.60  ? 196 GLY B CA  1 
ATOM   3472  C C   . GLY B 1 198 ? -18.485 21.774  -9.894  1.00 55.04  ? 196 GLY B C   1 
ATOM   3473  O O   . GLY B 1 198 ? -19.590 21.254  -9.742  1.00 54.01  ? 196 GLY B O   1 
ATOM   3474  N N   . LEU B 1 199 ? -17.351 21.159  -9.586  1.00 57.59  ? 197 LEU B N   1 
ATOM   3475  C CA  . LEU B 1 199 ? -17.371 19.830  -8.979  1.00 58.56  ? 197 LEU B CA  1 
ATOM   3476  C C   . LEU B 1 199 ? -18.121 19.855  -7.690  1.00 63.77  ? 197 LEU B C   1 
ATOM   3477  O O   . LEU B 1 199 ? -18.256 20.885  -7.026  1.00 66.02  ? 197 LEU B O   1 
ATOM   3478  C CB  . LEU B 1 199 ? -16.004 19.324  -8.573  1.00 49.15  ? 197 LEU B CB  1 
ATOM   3479  C CG  . LEU B 1 199 ? -14.867 19.391  -9.531  1.00 46.32  ? 197 LEU B CG  1 
ATOM   3480  C CD1 . LEU B 1 199 ? -13.761 18.568  -8.932  1.00 43.69  ? 197 LEU B CD1 1 
ATOM   3481  C CD2 . LEU B 1 199 ? -15.293 18.861  -10.861 1.00 53.64  ? 197 LEU B CD2 1 
ATOM   3482  N N   . PRO B 1 200 ? -18.624 18.695  -7.309  1.00 68.00  ? 198 PRO B N   1 
ATOM   3483  C CA  . PRO B 1 200 ? -19.353 18.624  -6.044  1.00 71.48  ? 198 PRO B CA  1 
ATOM   3484  C C   . PRO B 1 200 ? -18.320 18.638  -4.861  1.00 73.76  ? 198 PRO B C   1 
ATOM   3485  O O   . PRO B 1 200 ? -17.093 18.550  -5.080  1.00 71.37  ? 198 PRO B O   1 
ATOM   3486  C CB  . PRO B 1 200 ? -20.141 17.313  -6.176  1.00 72.80  ? 198 PRO B CB  1 
ATOM   3487  C CG  . PRO B 1 200 ? -19.350 16.505  -7.201  1.00 72.92  ? 198 PRO B CG  1 
ATOM   3488  C CD  . PRO B 1 200 ? -18.946 17.562  -8.195  1.00 69.05  ? 198 PRO B CD  1 
ATOM   3489  N N   . ARG B 1 201 ? -18.810 18.759  -3.623  1.00 74.81  ? 199 ARG B N   1 
ATOM   3490  C CA  . ARG B 1 201 ? -17.939 18.841  -2.461  1.00 74.22  ? 199 ARG B CA  1 
ATOM   3491  C C   . ARG B 1 201 ? -17.070 17.618  -2.234  1.00 74.59  ? 199 ARG B C   1 
ATOM   3492  O O   . ARG B 1 201 ? -15.861 17.697  -2.455  1.00 70.98  ? 199 ARG B O   1 
ATOM   3493  C CB  . ARG B 1 201 ? -18.770 19.170  -1.207  1.00 78.23  ? 199 ARG B CB  1 
ATOM   3494  C CG  . ARG B 1 201 ? -17.971 19.380  0.072   1.00 77.63  ? 199 ARG B CG  1 
ATOM   3495  C CD  . ARG B 1 201 ? -16.919 20.485  -0.038  1.00 75.66  ? 199 ARG B CD  1 
ATOM   3496  N NE  . ARG B 1 201 ? -16.069 20.500  1.155   1.00 76.82  ? 199 ARG B NE  1 
ATOM   3497  C CZ  . ARG B 1 201 ? -15.227 21.477  1.471   1.00 77.22  ? 199 ARG B CZ  1 
ATOM   3498  N NH1 . ARG B 1 201 ? -15.120 22.524  0.672   1.00 72.32  ? 199 ARG B NH1 1 
ATOM   3499  N NH2 . ARG B 1 201 ? -14.519 21.423  2.596   1.00 76.73  ? 199 ARG B NH2 1 
ATOM   3500  N N   . ARG B 1 202 ? -17.667 16.502  -1.801  1.00 78.18  ? 200 ARG B N   1 
ATOM   3501  C CA  . ARG B 1 202 ? -16.894 15.279  -1.519  1.00 81.23  ? 200 ARG B CA  1 
ATOM   3502  C C   . ARG B 1 202 ? -16.014 14.854  -2.676  1.00 80.18  ? 200 ARG B C   1 
ATOM   3503  O O   . ARG B 1 202 ? -14.863 14.440  -2.490  1.00 82.70  ? 200 ARG B O   1 
ATOM   3504  C CB  . ARG B 1 202 ? -17.797 14.097  -1.170  1.00 86.44  ? 200 ARG B CB  1 
ATOM   3505  C CG  . ARG B 1 202 ? -17.021 12.765  -1.146  1.00 95.85  ? 200 ARG B CG  1 
ATOM   3506  C CD  . ARG B 1 202 ? -17.917 11.498  -1.161  1.00 106.38 ? 200 ARG B CD  1 
ATOM   3507  N NE  . ARG B 1 202 ? -18.674 11.326  0.078   1.00 112.34 ? 200 ARG B NE  1 
ATOM   3508  C CZ  . ARG B 1 202 ? -18.366 10.478  1.056   1.00 114.89 ? 200 ARG B CZ  1 
ATOM   3509  N NH1 . ARG B 1 202 ? -17.306 9.689   0.954   1.00 117.19 ? 200 ARG B NH1 1 
ATOM   3510  N NH2 . ARG B 1 202 ? -19.113 10.443  2.157   1.00 115.29 ? 200 ARG B NH2 1 
ATOM   3511  N N   . LEU B 1 203 ? -16.569 14.942  -3.874  1.00 75.27  ? 201 LEU B N   1 
ATOM   3512  C CA  . LEU B 1 203 ? -15.842 14.564  -5.059  1.00 71.71  ? 201 LEU B CA  1 
ATOM   3513  C C   . LEU B 1 203 ? -14.502 15.285  -5.138  1.00 69.47  ? 201 LEU B C   1 
ATOM   3514  O O   . LEU B 1 203 ? -13.438 14.665  -5.331  1.00 65.23  ? 201 LEU B O   1 
ATOM   3515  C CB  . LEU B 1 203 ? -16.689 14.902  -6.273  1.00 73.08  ? 201 LEU B CB  1 
ATOM   3516  C CG  . LEU B 1 203 ? -15.958 14.739  -7.599  1.00 73.21  ? 201 LEU B CG  1 
ATOM   3517  C CD1 . LEU B 1 203 ? -15.176 13.404  -7.584  1.00 68.07  ? 201 LEU B CD1 1 
ATOM   3518  C CD2 . LEU B 1 203 ? -16.955 14.831  -8.753  1.00 72.25  ? 201 LEU B CD2 1 
ATOM   3519  N N   . ALA B 1 204 ? -14.588 16.606  -4.974  1.00 69.46  ? 202 ALA B N   1 
ATOM   3520  C CA  . ALA B 1 204 ? -13.450 17.524  -5.013  1.00 69.30  ? 202 ALA B CA  1 
ATOM   3521  C C   . ALA B 1 204 ? -12.389 17.202  -3.938  1.00 67.37  ? 202 ALA B C   1 
ATOM   3522  O O   . ALA B 1 204 ? -11.190 17.146  -4.222  1.00 65.94  ? 202 ALA B O   1 
ATOM   3523  C CB  . ALA B 1 204 ? -13.965 18.968  -4.847  1.00 71.52  ? 202 ALA B CB  1 
ATOM   3524  N N   . VAL B 1 205 ? -12.836 17.004  -2.703  1.00 61.82  ? 203 VAL B N   1 
ATOM   3525  C CA  . VAL B 1 205 ? -11.922 16.671  -1.629  1.00 62.72  ? 203 VAL B CA  1 
ATOM   3526  C C   . VAL B 1 205 ? -11.033 15.489  -2.019  1.00 63.39  ? 203 VAL B C   1 
ATOM   3527  O O   . VAL B 1 205 ? -9.796  15.582  -1.958  1.00 61.33  ? 203 VAL B O   1 
ATOM   3528  C CB  . VAL B 1 205 ? -12.692 16.294  -0.356  1.00 65.89  ? 203 VAL B CB  1 
ATOM   3529  C CG1 . VAL B 1 205 ? -11.710 16.056  0.783   1.00 68.39  ? 203 VAL B CG1 1 
ATOM   3530  C CG2 . VAL B 1 205 ? -13.686 17.392  0.007   1.00 69.43  ? 203 VAL B CG2 1 
ATOM   3531  N N   . ARG B 1 206 ? -11.692 14.391  -2.422  1.00 64.54  ? 204 ARG B N   1 
ATOM   3532  C CA  . ARG B 1 206 ? -11.071 13.114  -2.842  1.00 64.26  ? 204 ARG B CA  1 
ATOM   3533  C C   . ARG B 1 206 ? -9.914  13.263  -3.817  1.00 61.22  ? 204 ARG B C   1 
ATOM   3534  O O   . ARG B 1 206 ? -8.782  12.796  -3.597  1.00 57.35  ? 204 ARG B O   1 
ATOM   3535  C CB  . ARG B 1 206 ? -12.102 12.226  -3.538  1.00 67.04  ? 204 ARG B CB  1 
ATOM   3536  C CG  . ARG B 1 206 ? -13.393 12.015  -2.796  1.00 77.38  ? 204 ARG B CG  1 
ATOM   3537  C CD  . ARG B 1 206 ? -13.182 11.350  -1.441  1.00 87.11  ? 204 ARG B CD  1 
ATOM   3538  N NE  . ARG B 1 206 ? -14.367 10.578  -1.034  1.00 96.73  ? 204 ARG B NE  1 
ATOM   3539  C CZ  . ARG B 1 206 ? -14.752 9.433   -1.605  1.00 100.36 ? 204 ARG B CZ  1 
ATOM   3540  N NH1 . ARG B 1 206 ? -14.045 8.914   -2.599  1.00 103.30 ? 204 ARG B NH1 1 
ATOM   3541  N NH2 . ARG B 1 206 ? -15.858 8.817   -1.208  1.00 101.16 ? 204 ARG B NH2 1 
ATOM   3542  N N   . LEU B 1 207 ? -10.248 13.889  -4.932  1.00 58.18  ? 205 LEU B N   1 
ATOM   3543  C CA  . LEU B 1 207 ? -9.298  14.136  -5.997  1.00 57.78  ? 205 LEU B CA  1 
ATOM   3544  C C   . LEU B 1 207 ? -8.141  14.937  -5.434  1.00 53.81  ? 205 LEU B C   1 
ATOM   3545  O O   . LEU B 1 207 ? -6.977  14.685  -5.746  1.00 49.07  ? 205 LEU B O   1 
ATOM   3546  C CB  . LEU B 1 207 ? -10.008 14.912  -7.103  1.00 64.08  ? 205 LEU B CB  1 
ATOM   3547  C CG  . LEU B 1 207 ? -11.349 14.292  -7.537  1.00 65.37  ? 205 LEU B CG  1 
ATOM   3548  C CD1 . LEU B 1 207 ? -12.166 15.281  -8.356  1.00 64.40  ? 205 LEU B CD1 1 
ATOM   3549  C CD2 . LEU B 1 207 ? -11.068 13.035  -8.351  1.00 66.97  ? 205 LEU B CD2 1 
ATOM   3550  N N   . GLY B 1 208 ? -8.485  15.918  -4.606  1.00 50.74  ? 206 GLY B N   1 
ATOM   3551  C CA  . GLY B 1 208 ? -7.462  16.726  -3.972  1.00 49.67  ? 206 GLY B CA  1 
ATOM   3552  C C   . GLY B 1 208 ? -6.565  15.803  -3.169  1.00 47.08  ? 206 GLY B C   1 
ATOM   3553  O O   . GLY B 1 208 ? -5.325  15.767  -3.289  1.00 44.23  ? 206 GLY B O   1 
ATOM   3554  N N   . ALA B 1 209 ? -7.225  15.038  -2.321  1.00 45.26  ? 207 ALA B N   1 
ATOM   3555  C CA  . ALA B 1 209 ? -6.531  14.073  -1.514  1.00 45.53  ? 207 ALA B CA  1 
ATOM   3556  C C   . ALA B 1 209 ? -5.666  13.239  -2.447  1.00 46.50  ? 207 ALA B C   1 
ATOM   3557  O O   . ALA B 1 209 ? -4.442  13.311  -2.412  1.00 46.29  ? 207 ALA B O   1 
ATOM   3558  C CB  . ALA B 1 209 ? -7.542  13.180  -0.794  1.00 44.08  ? 207 ALA B CB  1 
ATOM   3559  N N   . GLN B 1 210 ? -6.321  12.471  -3.306  1.00 46.41  ? 208 GLN B N   1 
ATOM   3560  C CA  . GLN B 1 210 ? -5.628  11.590  -4.208  1.00 48.53  ? 208 GLN B CA  1 
ATOM   3561  C C   . GLN B 1 210 ? -4.440  12.209  -4.896  1.00 48.61  ? 208 GLN B C   1 
ATOM   3562  O O   . GLN B 1 210 ? -3.396  11.585  -5.040  1.00 43.72  ? 208 GLN B O   1 
ATOM   3563  C CB  . GLN B 1 210 ? -6.596  11.073  -5.234  1.00 51.47  ? 208 GLN B CB  1 
ATOM   3564  C CG  . GLN B 1 210 ? -6.106  9.790   -5.863  1.00 62.23  ? 208 GLN B CG  1 
ATOM   3565  C CD  . GLN B 1 210 ? -5.765  8.709   -4.842  1.00 66.34  ? 208 GLN B CD  1 
ATOM   3566  O OE1 . GLN B 1 210 ? -6.621  8.257   -4.068  1.00 74.63  ? 208 GLN B OE1 1 
ATOM   3567  N NE2 . GLN B 1 210 ? -4.509  8.283   -4.843  1.00 66.29  ? 208 GLN B NE2 1 
ATOM   3568  N N   . ALA B 1 211 ? -4.594  13.447  -5.333  1.00 53.57  ? 209 ALA B N   1 
ATOM   3569  C CA  . ALA B 1 211 ? -3.488  14.116  -6.007  1.00 54.83  ? 209 ALA B CA  1 
ATOM   3570  C C   . ALA B 1 211 ? -2.291  14.324  -5.050  1.00 54.81  ? 209 ALA B C   1 
ATOM   3571  O O   . ALA B 1 211 ? -1.133  14.092  -5.402  1.00 53.03  ? 209 ALA B O   1 
ATOM   3572  C CB  . ALA B 1 211 ? -3.960  15.454  -6.579  1.00 52.55  ? 209 ALA B CB  1 
ATOM   3573  N N   . LEU B 1 212 ? -2.562  14.765  -3.832  1.00 53.78  ? 210 LEU B N   1 
ATOM   3574  C CA  . LEU B 1 212 ? -1.467  14.983  -2.894  1.00 57.35  ? 210 LEU B CA  1 
ATOM   3575  C C   . LEU B 1 212 ? -0.869  13.634  -2.586  1.00 59.31  ? 210 LEU B C   1 
ATOM   3576  O O   . LEU B 1 212 ? 0.360   13.470  -2.550  1.00 61.74  ? 210 LEU B O   1 
ATOM   3577  C CB  . LEU B 1 212 ? -1.988  15.673  -1.631  1.00 58.81  ? 210 LEU B CB  1 
ATOM   3578  C CG  . LEU B 1 212 ? -2.837  16.846  -2.149  1.00 62.26  ? 210 LEU B CG  1 
ATOM   3579  C CD1 . LEU B 1 212 ? -3.596  17.497  -1.030  1.00 60.12  ? 210 LEU B CD1 1 
ATOM   3580  C CD2 . LEU B 1 212 ? -1.934  17.829  -2.888  1.00 60.36  ? 210 LEU B CD2 1 
ATOM   3581  N N   . LEU B 1 213 ? -1.752  12.661  -2.396  1.00 59.36  ? 211 LEU B N   1 
ATOM   3582  C CA  . LEU B 1 213 ? -1.340  11.299  -2.122  1.00 58.61  ? 211 LEU B CA  1 
ATOM   3583  C C   . LEU B 1 213 ? -0.319  10.823  -3.172  1.00 57.33  ? 211 LEU B C   1 
ATOM   3584  O O   . LEU B 1 213 ? 0.786   10.370  -2.838  1.00 55.19  ? 211 LEU B O   1 
ATOM   3585  C CB  . LEU B 1 213 ? -2.572  10.405  -2.149  1.00 63.34  ? 211 LEU B CB  1 
ATOM   3586  C CG  . LEU B 1 213 ? -2.368  8.903   -1.932  1.00 68.46  ? 211 LEU B CG  1 
ATOM   3587  C CD1 . LEU B 1 213 ? -0.980  8.591   -1.359  1.00 64.46  ? 211 LEU B CD1 1 
ATOM   3588  C CD2 . LEU B 1 213 ? -3.481  8.429   -0.990  1.00 66.53  ? 211 LEU B CD2 1 
ATOM   3589  N N   . GLY B 1 214 ? -0.699  10.928  -4.441  1.00 54.97  ? 212 GLY B N   1 
ATOM   3590  C CA  . GLY B 1 214 ? 0.197   10.494  -5.492  1.00 51.97  ? 212 GLY B CA  1 
ATOM   3591  C C   . GLY B 1 214 ? 1.527   11.217  -5.511  1.00 51.24  ? 212 GLY B C   1 
ATOM   3592  O O   . GLY B 1 214 ? 2.596   10.624  -5.370  1.00 53.58  ? 212 GLY B O   1 
ATOM   3593  N N   . ALA B 1 215 ? 1.462   12.529  -5.679  1.00 52.38  ? 213 ALA B N   1 
ATOM   3594  C CA  . ALA B 1 215 ? 2.658   13.372  -5.755  1.00 51.04  ? 213 ALA B CA  1 
ATOM   3595  C C   . ALA B 1 215 ? 3.722   12.951  -4.758  1.00 47.99  ? 213 ALA B C   1 
ATOM   3596  O O   . ALA B 1 215 ? 4.870   12.683  -5.121  1.00 43.60  ? 213 ALA B O   1 
ATOM   3597  C CB  . ALA B 1 215 ? 2.251   14.845  -5.517  1.00 52.50  ? 213 ALA B CB  1 
ATOM   3598  N N   . ALA B 1 216 ? 3.299   12.904  -3.501  1.00 46.89  ? 214 ALA B N   1 
ATOM   3599  C CA  . ALA B 1 216 ? 4.164   12.517  -2.408  1.00 49.63  ? 214 ALA B CA  1 
ATOM   3600  C C   . ALA B 1 216 ? 4.861   11.221  -2.777  1.00 51.82  ? 214 ALA B C   1 
ATOM   3601  O O   . ALA B 1 216 ? 6.056   11.191  -3.065  1.00 52.39  ? 214 ALA B O   1 
ATOM   3602  C CB  . ALA B 1 216 ? 3.334   12.329  -1.143  1.00 51.38  ? 214 ALA B CB  1 
ATOM   3603  N N   . LYS B 1 217 ? 4.074   10.153  -2.776  1.00 53.88  ? 215 LYS B N   1 
ATOM   3604  C CA  . LYS B 1 217 ? 4.548   8.833   -3.099  1.00 52.99  ? 215 LYS B CA  1 
ATOM   3605  C C   . LYS B 1 217 ? 5.493   8.989   -4.263  1.00 49.50  ? 215 LYS B C   1 
ATOM   3606  O O   . LYS B 1 217 ? 6.648   8.572   -4.211  1.00 51.45  ? 215 LYS B O   1 
ATOM   3607  C CB  . LYS B 1 217 ? 3.366   7.953   -3.492  1.00 60.76  ? 215 LYS B CB  1 
ATOM   3608  C CG  . LYS B 1 217 ? 3.672   6.452   -3.620  1.00 72.36  ? 215 LYS B CG  1 
ATOM   3609  C CD  . LYS B 1 217 ? 2.351   5.684   -3.787  1.00 78.58  ? 215 LYS B CD  1 
ATOM   3610  C CE  . LYS B 1 217 ? 2.491   4.181   -3.608  1.00 82.29  ? 215 LYS B CE  1 
ATOM   3611  N NZ  . LYS B 1 217 ? 1.127   3.554   -3.733  1.00 83.24  ? 215 LYS B NZ  1 
ATOM   3612  N N   . MET B 1 218 ? 5.005   9.628   -5.308  1.00 44.39  ? 216 MET B N   1 
ATOM   3613  C CA  . MET B 1 218 ? 5.819   9.811   -6.468  1.00 47.20  ? 216 MET B CA  1 
ATOM   3614  C C   . MET B 1 218 ? 7.154   10.387  -6.073  1.00 49.83  ? 216 MET B C   1 
ATOM   3615  O O   . MET B 1 218 ? 8.203   9.829   -6.344  1.00 51.08  ? 216 MET B O   1 
ATOM   3616  C CB  . MET B 1 218 ? 5.123   10.717  -7.450  1.00 49.69  ? 216 MET B CB  1 
ATOM   3617  C CG  . MET B 1 218 ? 5.659   10.517  -8.836  1.00 56.36  ? 216 MET B CG  1 
ATOM   3618  S SD  . MET B 1 218 ? 4.419   10.891  -10.089 1.00 69.09  ? 216 MET B SD  1 
ATOM   3619  C CE  . MET B 1 218 ? 5.310   12.148  -11.111 1.00 65.57  ? 216 MET B CE  1 
ATOM   3620  N N   . LEU B 1 219 ? 7.121   11.505  -5.382  1.00 55.06  ? 217 LEU B N   1 
ATOM   3621  C CA  . LEU B 1 219 ? 8.352   12.133  -4.962  1.00 58.55  ? 217 LEU B CA  1 
ATOM   3622  C C   . LEU B 1 219 ? 9.215   11.238  -4.084  1.00 65.06  ? 217 LEU B C   1 
ATOM   3623  O O   . LEU B 1 219 ? 10.413  11.171  -4.286  1.00 67.12  ? 217 LEU B O   1 
ATOM   3624  C CB  . LEU B 1 219 ? 8.064   13.412  -4.199  1.00 58.13  ? 217 LEU B CB  1 
ATOM   3625  C CG  . LEU B 1 219 ? 9.353   14.055  -3.676  1.00 59.76  ? 217 LEU B CG  1 
ATOM   3626  C CD1 . LEU B 1 219 ? 10.153  14.596  -4.849  1.00 62.30  ? 217 LEU B CD1 1 
ATOM   3627  C CD2 . LEU B 1 219 ? 9.038   15.173  -2.677  1.00 66.14  ? 217 LEU B CD2 1 
ATOM   3628  N N   . LEU B 1 220 ? 8.620   10.565  -3.097  1.00 71.79  ? 218 LEU B N   1 
ATOM   3629  C CA  . LEU B 1 220 ? 9.386   9.685   -2.195  1.00 75.51  ? 218 LEU B CA  1 
ATOM   3630  C C   . LEU B 1 220 ? 10.214  8.665   -2.967  1.00 80.12  ? 218 LEU B C   1 
ATOM   3631  O O   . LEU B 1 220 ? 11.437  8.572   -2.781  1.00 82.91  ? 218 LEU B O   1 
ATOM   3632  C CB  . LEU B 1 220 ? 8.448   8.945   -1.223  1.00 71.55  ? 218 LEU B CB  1 
ATOM   3633  C CG  . LEU B 1 220 ? 7.910   9.688   0.007   1.00 67.48  ? 218 LEU B CG  1 
ATOM   3634  C CD1 . LEU B 1 220 ? 6.553   9.140   0.372   1.00 64.62  ? 218 LEU B CD1 1 
ATOM   3635  C CD2 . LEU B 1 220 ? 8.873   9.549   1.181   1.00 61.94  ? 218 LEU B CD2 1 
ATOM   3636  N N   . HIS B 1 221 ? 9.534   7.918   -3.832  1.00 84.69  ? 219 HIS B N   1 
ATOM   3637  C CA  . HIS B 1 221 ? 10.158  6.891   -4.644  1.00 89.89  ? 219 HIS B CA  1 
ATOM   3638  C C   . HIS B 1 221 ? 11.117  7.428   -5.710  1.00 90.01  ? 219 HIS B C   1 
ATOM   3639  O O   . HIS B 1 221 ? 12.289  7.058   -5.760  1.00 90.39  ? 219 HIS B O   1 
ATOM   3640  C CB  . HIS B 1 221 ? 9.064   6.049   -5.293  1.00 94.79  ? 219 HIS B CB  1 
ATOM   3641  C CG  . HIS B 1 221 ? 8.071   5.499   -4.318  1.00 103.01 ? 219 HIS B CG  1 
ATOM   3642  N ND1 . HIS B 1 221 ? 8.443   4.976   -3.097  1.00 106.11 ? 219 HIS B ND1 1 
ATOM   3643  C CD2 . HIS B 1 221 ? 6.731   5.326   -4.408  1.00 106.97 ? 219 HIS B CD2 1 
ATOM   3644  C CE1 . HIS B 1 221 ? 7.375   4.499   -2.482  1.00 109.44 ? 219 HIS B CE1 1 
ATOM   3645  N NE2 . HIS B 1 221 ? 6.322   4.698   -3.256  1.00 108.10 ? 219 HIS B NE2 1 
ATOM   3646  N N   . SER B 1 222 ? 10.617  8.311   -6.557  1.00 91.57  ? 220 SER B N   1 
ATOM   3647  C CA  . SER B 1 222 ? 11.426  8.882   -7.630  1.00 95.95  ? 220 SER B CA  1 
ATOM   3648  C C   . SER B 1 222 ? 12.735  9.500   -7.154  1.00 97.55  ? 220 SER B C   1 
ATOM   3649  O O   . SER B 1 222 ? 13.814  9.025   -7.470  1.00 98.66  ? 220 SER B O   1 
ATOM   3650  C CB  . SER B 1 222 ? 10.629  9.969   -8.369  1.00 98.39  ? 220 SER B CB  1 
ATOM   3651  O OG  . SER B 1 222 ? 9.263   9.602   -8.531  1.00 101.55 ? 220 SER B OG  1 
ATOM   3652  N N   . GLU B 1 223 ? 12.588  10.583  -6.401  1.00 100.06 ? 221 GLU B N   1 
ATOM   3653  C CA  . GLU B 1 223 ? 13.654  11.411  -5.850  1.00 100.46 ? 221 GLU B CA  1 
ATOM   3654  C C   . GLU B 1 223 ? 13.723  12.613  -6.773  1.00 98.81  ? 221 GLU B C   1 
ATOM   3655  O O   . GLU B 1 223 ? 13.307  13.712  -6.407  1.00 97.73  ? 221 GLU B O   1 
ATOM   3656  C CB  . GLU B 1 223 ? 14.987  10.688  -5.817  1.00 101.92 ? 221 GLU B CB  1 
ATOM   3657  C CG  . GLU B 1 223 ? 14.956  9.487   -4.915  1.00 106.01 ? 221 GLU B CG  1 
ATOM   3658  C CD  . GLU B 1 223 ? 16.277  9.269   -4.249  1.00 109.10 ? 221 GLU B CD  1 
ATOM   3659  O OE1 . GLU B 1 223 ? 17.305  9.705   -4.832  1.00 107.07 ? 221 GLU B OE1 1 
ATOM   3660  O OE2 . GLU B 1 223 ? 16.274  8.660   -3.156  1.00 109.46 ? 221 GLU B OE2 1 
ATOM   3661  N N   . GLN B 1 224 ? 14.246  12.398  -7.972  1.00 95.83  ? 222 GLN B N   1 
ATOM   3662  C CA  . GLN B 1 224 ? 14.312  13.462  -8.972  1.00 93.63  ? 222 GLN B CA  1 
ATOM   3663  C C   . GLN B 1 224 ? 14.645  14.848  -8.420  1.00 88.70  ? 222 GLN B C   1 
ATOM   3664  O O   . GLN B 1 224 ? 15.759  15.362  -8.554  1.00 88.81  ? 222 GLN B O   1 
ATOM   3665  C CB  . GLN B 1 224 ? 12.955  13.546  -9.686  1.00 97.53  ? 222 GLN B CB  1 
ATOM   3666  C CG  . GLN B 1 224 ? 12.694  12.459  -10.695 1.00 99.83  ? 222 GLN B CG  1 
ATOM   3667  C CD  . GLN B 1 224 ? 13.698  12.499  -11.837 1.00 103.81 ? 222 GLN B CD  1 
ATOM   3668  O OE1 . GLN B 1 224 ? 13.852  13.520  -12.521 1.00 100.75 ? 222 GLN B OE1 1 
ATOM   3669  N NE2 . GLN B 1 224 ? 14.393  11.383  -12.049 1.00 109.84 ? 222 GLN B NE2 1 
ATOM   3670  N N   . HIS B 1 225 ? 13.618  15.449  -7.837  1.00 82.76  ? 223 HIS B N   1 
ATOM   3671  C CA  . HIS B 1 225 ? 13.657  16.767  -7.235  1.00 76.40  ? 223 HIS B CA  1 
ATOM   3672  C C   . HIS B 1 225 ? 12.284  17.338  -7.558  1.00 74.59  ? 223 HIS B C   1 
ATOM   3673  O O   . HIS B 1 225 ? 11.873  17.366  -8.724  1.00 76.90  ? 223 HIS B O   1 
ATOM   3674  C CB  . HIS B 1 225 ? 14.741  17.630  -7.856  1.00 71.89  ? 223 HIS B CB  1 
ATOM   3675  C CG  . HIS B 1 225 ? 14.931  18.933  -7.152  1.00 74.30  ? 223 HIS B CG  1 
ATOM   3676  N ND1 . HIS B 1 225 ? 13.878  19.662  -6.653  1.00 76.49  ? 223 HIS B ND1 1 
ATOM   3677  C CD2 . HIS B 1 225 ? 16.048  19.642  -6.860  1.00 74.44  ? 223 HIS B CD2 1 
ATOM   3678  C CE1 . HIS B 1 225 ? 14.335  20.763  -6.080  1.00 76.65  ? 223 HIS B CE1 1 
ATOM   3679  N NE2 . HIS B 1 225 ? 15.649  20.774  -6.192  1.00 75.34  ? 223 HIS B NE2 1 
ATOM   3680  N N   . PRO B 1 226 ? 11.542  17.780  -6.528  1.00 71.26  ? 224 PRO B N   1 
ATOM   3681  C CA  . PRO B 1 226 ? 10.201  18.343  -6.722  1.00 69.36  ? 224 PRO B CA  1 
ATOM   3682  C C   . PRO B 1 226 ? 10.194  19.288  -7.913  1.00 67.52  ? 224 PRO B C   1 
ATOM   3683  O O   . PRO B 1 226 ? 9.210   19.405  -8.641  1.00 66.86  ? 224 PRO B O   1 
ATOM   3684  C CB  . PRO B 1 226 ? 9.941   19.066  -5.406  1.00 67.54  ? 224 PRO B CB  1 
ATOM   3685  C CG  . PRO B 1 226 ? 10.636  18.203  -4.417  1.00 70.30  ? 224 PRO B CG  1 
ATOM   3686  C CD  . PRO B 1 226 ? 11.955  17.895  -5.117  1.00 70.30  ? 224 PRO B CD  1 
ATOM   3687  N N   . GLY B 1 227 ? 11.325  19.953  -8.099  1.00 67.09  ? 225 GLY B N   1 
ATOM   3688  C CA  . GLY B 1 227 ? 11.470  20.885  -9.196  1.00 66.81  ? 225 GLY B CA  1 
ATOM   3689  C C   . GLY B 1 227 ? 11.283  20.155  -10.501 1.00 64.80  ? 225 GLY B C   1 
ATOM   3690  O O   . GLY B 1 227 ? 10.339  20.420  -11.235 1.00 66.57  ? 225 GLY B O   1 
ATOM   3691  N N   . GLN B 1 228 ? 12.181  19.219  -10.775 1.00 62.92  ? 226 GLN B N   1 
ATOM   3692  C CA  . GLN B 1 228 ? 12.124  18.449  -12.003 1.00 65.13  ? 226 GLN B CA  1 
ATOM   3693  C C   . GLN B 1 228 ? 10.753  17.841  -12.193 1.00 64.74  ? 226 GLN B C   1 
ATOM   3694  O O   . GLN B 1 228 ? 10.098  18.055  -13.211 1.00 68.78  ? 226 GLN B O   1 
ATOM   3695  C CB  . GLN B 1 228 ? 13.139  17.317  -11.987 1.00 68.94  ? 226 GLN B CB  1 
ATOM   3696  C CG  . GLN B 1 228 ? 13.158  16.583  -13.305 1.00 74.81  ? 226 GLN B CG  1 
ATOM   3697  C CD  . GLN B 1 228 ? 13.707  17.463  -14.425 1.00 80.83  ? 226 GLN B CD  1 
ATOM   3698  O OE1 . GLN B 1 228 ? 14.891  17.809  -14.417 1.00 81.42  ? 226 GLN B OE1 1 
ATOM   3699  N NE2 . GLN B 1 228 ? 12.850  17.840  -15.384 1.00 81.86  ? 226 GLN B NE2 1 
ATOM   3700  N N   . LEU B 1 229 ? 10.323  17.072  -11.204 1.00 59.96  ? 227 LEU B N   1 
ATOM   3701  C CA  . LEU B 1 229 ? 9.024   16.441  -11.270 1.00 59.03  ? 227 LEU B CA  1 
ATOM   3702  C C   . LEU B 1 229 ? 7.924   17.466  -11.623 1.00 58.90  ? 227 LEU B C   1 
ATOM   3703  O O   . LEU B 1 229 ? 6.950   17.152  -12.333 1.00 56.95  ? 227 LEU B O   1 
ATOM   3704  C CB  . LEU B 1 229 ? 8.748   15.744  -9.937  1.00 58.43  ? 227 LEU B CB  1 
ATOM   3705  C CG  . LEU B 1 229 ? 9.469   14.405  -9.749  1.00 61.26  ? 227 LEU B CG  1 
ATOM   3706  C CD1 . LEU B 1 229 ? 9.333   13.930  -8.319  1.00 65.04  ? 227 LEU B CD1 1 
ATOM   3707  C CD2 . LEU B 1 229 ? 8.881   13.375  -10.710 1.00 63.01  ? 227 LEU B CD2 1 
ATOM   3708  N N   . LYS B 1 230 ? 8.098   18.692  -11.128 1.00 58.42  ? 228 LYS B N   1 
ATOM   3709  C CA  . LYS B 1 230 ? 7.171   19.795  -11.378 1.00 55.23  ? 228 LYS B CA  1 
ATOM   3710  C C   . LYS B 1 230 ? 7.160   20.044  -12.883 1.00 55.65  ? 228 LYS B C   1 
ATOM   3711  O O   . LYS B 1 230 ? 6.124   20.007  -13.529 1.00 56.84  ? 228 LYS B O   1 
ATOM   3712  C CB  . LYS B 1 230 ? 7.651   21.070  -10.655 1.00 57.44  ? 228 LYS B CB  1 
ATOM   3713  C CG  . LYS B 1 230 ? 6.749   22.301  -10.834 1.00 59.03  ? 228 LYS B CG  1 
ATOM   3714  C CD  . LYS B 1 230 ? 7.487   23.641  -10.633 1.00 68.40  ? 228 LYS B CD  1 
ATOM   3715  C CE  . LYS B 1 230 ? 8.485   23.967  -11.768 1.00 69.38  ? 228 LYS B CE  1 
ATOM   3716  N NZ  . LYS B 1 230 ? 9.364   25.142  -11.424 1.00 73.30  ? 228 LYS B NZ  1 
ATOM   3717  N N   . ASP B 1 231 ? 8.339   20.323  -13.421 1.00 54.43  ? 229 ASP B N   1 
ATOM   3718  C CA  . ASP B 1 231 ? 8.515   20.563  -14.837 1.00 56.94  ? 229 ASP B CA  1 
ATOM   3719  C C   . ASP B 1 231 ? 7.855   19.424  -15.600 1.00 60.99  ? 229 ASP B C   1 
ATOM   3720  O O   . ASP B 1 231 ? 7.140   19.645  -16.573 1.00 63.97  ? 229 ASP B O   1 
ATOM   3721  C CB  . ASP B 1 231 ? 9.999   20.575  -15.171 1.00 55.73  ? 229 ASP B CB  1 
ATOM   3722  C CG  . ASP B 1 231 ? 10.791  21.526  -14.294 1.00 59.41  ? 229 ASP B CG  1 
ATOM   3723  O OD1 . ASP B 1 231 ? 10.179  22.113  -13.373 1.00 62.43  ? 229 ASP B OD1 1 
ATOM   3724  O OD2 . ASP B 1 231 ? 12.021  21.692  -14.518 1.00 58.01  ? 229 ASP B OD2 1 
ATOM   3725  N N   . ASN B 1 232 ? 8.106   18.206  -15.124 1.00 65.34  ? 230 ASN B N   1 
ATOM   3726  C CA  . ASN B 1 232 ? 7.596   16.957  -15.702 1.00 67.65  ? 230 ASN B CA  1 
ATOM   3727  C C   . ASN B 1 232 ? 6.066   16.805  -15.696 1.00 68.92  ? 230 ASN B C   1 
ATOM   3728  O O   . ASN B 1 232 ? 5.530   15.747  -16.028 1.00 72.32  ? 230 ASN B O   1 
ATOM   3729  C CB  . ASN B 1 232 ? 8.230   15.767  -14.974 1.00 70.17  ? 230 ASN B CB  1 
ATOM   3730  C CG  . ASN B 1 232 ? 9.736   15.693  -15.183 1.00 77.94  ? 230 ASN B CG  1 
ATOM   3731  O OD1 . ASN B 1 232 ? 10.438  16.711  -15.143 1.00 83.47  ? 230 ASN B OD1 1 
ATOM   3732  N ND2 . ASN B 1 232 ? 10.242  14.485  -15.393 1.00 80.90  ? 230 ASN B ND2 1 
ATOM   3733  N N   . VAL B 1 233 ? 5.347   17.845  -15.314 1.00 65.03  ? 231 VAL B N   1 
ATOM   3734  C CA  . VAL B 1 233 ? 3.905   17.736  -15.317 1.00 62.59  ? 231 VAL B CA  1 
ATOM   3735  C C   . VAL B 1 233 ? 3.392   19.030  -15.923 1.00 64.80  ? 231 VAL B C   1 
ATOM   3736  O O   . VAL B 1 233 ? 2.177   19.281  -16.005 1.00 64.56  ? 231 VAL B O   1 
ATOM   3737  C CB  . VAL B 1 233 ? 3.409   17.543  -13.894 1.00 61.47  ? 231 VAL B CB  1 
ATOM   3738  C CG1 . VAL B 1 233 ? 1.942   17.187  -13.891 1.00 60.58  ? 231 VAL B CG1 1 
ATOM   3739  C CG2 . VAL B 1 233 ? 4.225   16.451  -13.235 1.00 59.98  ? 231 VAL B CG2 1 
ATOM   3740  N N   . SER B 1 234 ? 4.370   19.829  -16.354 1.00 65.47  ? 232 SER B N   1 
ATOM   3741  C CA  . SER B 1 234 ? 4.185   21.145  -16.975 1.00 65.88  ? 232 SER B CA  1 
ATOM   3742  C C   . SER B 1 234 ? 4.193   21.092  -18.505 1.00 66.61  ? 232 SER B C   1 
ATOM   3743  O O   . SER B 1 234 ? 5.258   20.878  -19.113 1.00 69.48  ? 232 SER B O   1 
ATOM   3744  C CB  . SER B 1 234 ? 5.316   22.104  -16.550 1.00 63.66  ? 232 SER B CB  1 
ATOM   3745  O OG  . SER B 1 234 ? 5.131   22.583  -15.230 1.00 59.43  ? 232 SER B OG  1 
ATOM   3746  N N   . SER B 1 235 ? 3.029   21.319  -19.122 1.00 66.73  ? 233 SER B N   1 
ATOM   3747  C CA  . SER B 1 235 ? 2.895   21.331  -20.596 1.00 68.39  ? 233 SER B CA  1 
ATOM   3748  C C   . SER B 1 235 ? 3.120   22.782  -21.019 1.00 67.35  ? 233 SER B C   1 
ATOM   3749  O O   . SER B 1 235 ? 2.369   23.657  -20.588 1.00 66.13  ? 233 SER B O   1 
ATOM   3750  C CB  . SER B 1 235 ? 1.488   20.834  -21.038 1.00 71.44  ? 233 SER B CB  1 
ATOM   3751  O OG  . SER B 1 235 ? 0.456   21.053  -20.071 1.00 70.95  ? 233 SER B OG  1 
ATOM   3752  N N   . PRO B 1 236 ? 4.148   23.060  -21.864 1.00 66.12  ? 234 PRO B N   1 
ATOM   3753  C CA  . PRO B 1 236 ? 4.445   24.435  -22.306 1.00 63.39  ? 234 PRO B CA  1 
ATOM   3754  C C   . PRO B 1 236 ? 3.205   25.274  -22.526 1.00 62.69  ? 234 PRO B C   1 
ATOM   3755  O O   . PRO B 1 236 ? 3.260   26.500  -22.571 1.00 61.64  ? 234 PRO B O   1 
ATOM   3756  C CB  . PRO B 1 236 ? 5.268   24.224  -23.575 1.00 66.01  ? 234 PRO B CB  1 
ATOM   3757  C CG  . PRO B 1 236 ? 6.049   22.953  -23.256 1.00 64.21  ? 234 PRO B CG  1 
ATOM   3758  C CD  . PRO B 1 236 ? 4.959   22.083  -22.625 1.00 66.19  ? 234 PRO B CD  1 
ATOM   3759  N N   . GLY B 1 237 ? 2.081   24.587  -22.659 1.00 63.86  ? 235 GLY B N   1 
ATOM   3760  C CA  . GLY B 1 237 ? 0.812   25.257  -22.836 1.00 64.08  ? 235 GLY B CA  1 
ATOM   3761  C C   . GLY B 1 237 ? 0.375   26.010  -21.585 1.00 60.80  ? 235 GLY B C   1 
ATOM   3762  O O   . GLY B 1 237 ? 0.679   27.197  -21.440 1.00 59.36  ? 235 GLY B O   1 
ATOM   3763  N N   . GLY B 1 238 ? -0.325  25.321  -20.681 1.00 56.15  ? 236 GLY B N   1 
ATOM   3764  C CA  . GLY B 1 238 ? -0.792  25.966  -19.474 1.00 52.65  ? 236 GLY B CA  1 
ATOM   3765  C C   . GLY B 1 238 ? -1.637  25.072  -18.591 1.00 49.04  ? 236 GLY B C   1 
ATOM   3766  O O   . GLY B 1 238 ? -1.280  23.951  -18.284 1.00 45.32  ? 236 GLY B O   1 
ATOM   3767  N N   . ALA B 1 239 ? -2.791  25.578  -18.202 1.00 49.19  ? 237 ALA B N   1 
ATOM   3768  C CA  . ALA B 1 239 ? -3.663  24.858  -17.312 1.00 50.80  ? 237 ALA B CA  1 
ATOM   3769  C C   . ALA B 1 239 ? -2.774  24.791  -16.073 1.00 53.39  ? 237 ALA B C   1 
ATOM   3770  O O   . ALA B 1 239 ? -2.876  25.609  -15.158 1.00 55.38  ? 237 ALA B O   1 
ATOM   3771  C CB  . ALA B 1 239 ? -3.956  23.450  -17.870 1.00 50.81  ? 237 ALA B CB  1 
ATOM   3772  N N   . THR B 1 240 ? -1.863  23.831  -16.073 1.00 52.08  ? 238 THR B N   1 
ATOM   3773  C CA  . THR B 1 240 ? -0.979  23.653  -14.951 1.00 46.34  ? 238 THR B CA  1 
ATOM   3774  C C   . THR B 1 240 ? -0.078  24.839  -14.754 1.00 42.80  ? 238 THR B C   1 
ATOM   3775  O O   . THR B 1 240 ? -0.220  25.570  -13.786 1.00 42.55  ? 238 THR B O   1 
ATOM   3776  C CB  . THR B 1 240 ? -0.125  22.395  -15.116 1.00 47.21  ? 238 THR B CB  1 
ATOM   3777  O OG1 . THR B 1 240 ? -0.988  21.270  -15.306 1.00 52.31  ? 238 THR B OG1 1 
ATOM   3778  C CG2 . THR B 1 240 ? 0.734   22.170  -13.875 1.00 42.00  ? 238 THR B CG2 1 
ATOM   3779  N N   . ILE B 1 241 ? 0.835   25.064  -15.679 1.00 41.19  ? 239 ILE B N   1 
ATOM   3780  C CA  . ILE B 1 241 ? 1.758   26.170  -15.474 1.00 44.80  ? 239 ILE B CA  1 
ATOM   3781  C C   . ILE B 1 241 ? 1.051   27.473  -15.164 1.00 45.07  ? 239 ILE B C   1 
ATOM   3782  O O   . ILE B 1 241 ? 1.598   28.376  -14.533 1.00 44.01  ? 239 ILE B O   1 
ATOM   3783  C CB  . ILE B 1 241 ? 2.650   26.414  -16.667 1.00 42.42  ? 239 ILE B CB  1 
ATOM   3784  C CG1 . ILE B 1 241 ? 3.959   27.025  -16.164 1.00 34.67  ? 239 ILE B CG1 1 
ATOM   3785  C CG2 . ILE B 1 241 ? 1.990   27.383  -17.646 1.00 38.13  ? 239 ILE B CG2 1 
ATOM   3786  C CD1 . ILE B 1 241 ? 4.887   27.371  -17.253 1.00 46.75  ? 239 ILE B CD1 1 
ATOM   3787  N N   . HIS B 1 242 ? -0.182  27.590  -15.596 1.00 43.74  ? 240 HIS B N   1 
ATOM   3788  C CA  . HIS B 1 242 ? -0.860  28.825  -15.315 1.00 44.56  ? 240 HIS B CA  1 
ATOM   3789  C C   . HIS B 1 242 ? -1.175  28.901  -13.840 1.00 45.04  ? 240 HIS B C   1 
ATOM   3790  O O   . HIS B 1 242 ? -1.210  29.972  -13.237 1.00 47.22  ? 240 HIS B O   1 
ATOM   3791  C CB  . HIS B 1 242 ? -2.096  28.935  -16.219 1.00 45.62  ? 240 HIS B CB  1 
ATOM   3792  C CG  . HIS B 1 242 ? -1.757  29.411  -17.603 1.00 48.68  ? 240 HIS B CG  1 
ATOM   3793  N ND1 . HIS B 1 242 ? -2.566  30.262  -18.330 1.00 47.48  ? 240 HIS B ND1 1 
ATOM   3794  C CD2 . HIS B 1 242 ? -0.625  29.252  -18.332 1.00 45.71  ? 240 HIS B CD2 1 
ATOM   3795  C CE1 . HIS B 1 242 ? -1.940  30.617  -19.439 1.00 47.23  ? 240 HIS B CE1 1 
ATOM   3796  N NE2 . HIS B 1 242 ? -0.761  30.019  -19.461 1.00 49.37  ? 240 HIS B NE2 1 
ATOM   3797  N N   . ALA B 1 243 ? -1.368  27.737  -13.254 1.00 44.43  ? 241 ALA B N   1 
ATOM   3798  C CA  . ALA B 1 243 ? -1.652  27.690  -11.841 1.00 42.15  ? 241 ALA B CA  1 
ATOM   3799  C C   . ALA B 1 243 ? -0.317  27.909  -11.086 1.00 43.43  ? 241 ALA B C   1 
ATOM   3800  O O   . ALA B 1 243 ? -0.229  28.694  -10.146 1.00 38.38  ? 241 ALA B O   1 
ATOM   3801  C CB  . ALA B 1 243 ? -2.288  26.348  -11.462 1.00 38.19  ? 241 ALA B CB  1 
ATOM   3802  N N   . LEU B 1 244 ? 0.738   27.226  -11.487 1.00 40.27  ? 242 LEU B N   1 
ATOM   3803  C CA  . LEU B 1 244 ? 1.959   27.457  -10.778 1.00 43.12  ? 242 LEU B CA  1 
ATOM   3804  C C   . LEU B 1 244 ? 2.140   28.943  -10.693 1.00 43.03  ? 242 LEU B C   1 
ATOM   3805  O O   . LEU B 1 244 ? 2.201   29.492  -9.608  1.00 47.66  ? 242 LEU B O   1 
ATOM   3806  C CB  . LEU B 1 244 ? 3.127   26.826  -11.504 1.00 43.42  ? 242 LEU B CB  1 
ATOM   3807  C CG  . LEU B 1 244 ? 3.036   25.299  -11.479 1.00 49.70  ? 242 LEU B CG  1 
ATOM   3808  C CD1 . LEU B 1 244 ? 4.480   24.781  -11.434 1.00 53.63  ? 242 LEU B CD1 1 
ATOM   3809  C CD2 . LEU B 1 244 ? 2.250   24.778  -10.223 1.00 51.57  ? 242 LEU B CD2 1 
ATOM   3810  N N   . HIS B 1 245 ? 2.173   29.597  -11.849 1.00 44.55  ? 243 HIS B N   1 
ATOM   3811  C CA  . HIS B 1 245 ? 2.378   31.037  -11.920 1.00 44.43  ? 243 HIS B CA  1 
ATOM   3812  C C   . HIS B 1 245 ? 1.585   31.786  -10.891 1.00 41.21  ? 243 HIS B C   1 
ATOM   3813  O O   . HIS B 1 245 ? 2.096   32.665  -10.218 1.00 43.27  ? 243 HIS B O   1 
ATOM   3814  C CB  . HIS B 1 245 ? 2.020   31.601  -13.302 1.00 50.03  ? 243 HIS B CB  1 
ATOM   3815  C CG  . HIS B 1 245 ? 2.207   33.093  -13.414 1.00 55.36  ? 243 HIS B CG  1 
ATOM   3816  N ND1 . HIS B 1 245 ? 3.448   33.696  -13.405 1.00 53.91  ? 243 HIS B ND1 1 
ATOM   3817  C CD2 . HIS B 1 245 ? 1.307   34.103  -13.496 1.00 59.80  ? 243 HIS B CD2 1 
ATOM   3818  C CE1 . HIS B 1 245 ? 3.308   35.004  -13.478 1.00 54.76  ? 243 HIS B CE1 1 
ATOM   3819  N NE2 . HIS B 1 245 ? 2.017   35.280  -13.536 1.00 63.31  ? 243 HIS B NE2 1 
ATOM   3820  N N   . VAL B 1 246 ? 0.318   31.465  -10.804 1.00 35.78  ? 244 VAL B N   1 
ATOM   3821  C CA  . VAL B 1 246 ? -0.541  32.106  -9.849  1.00 40.63  ? 244 VAL B CA  1 
ATOM   3822  C C   . VAL B 1 246 ? -0.014  31.989  -8.406  1.00 45.29  ? 244 VAL B C   1 
ATOM   3823  O O   . VAL B 1 246 ? 0.260   32.993  -7.745  1.00 51.62  ? 244 VAL B O   1 
ATOM   3824  C CB  . VAL B 1 246 ? -1.931  31.486  -9.940  1.00 39.43  ? 244 VAL B CB  1 
ATOM   3825  C CG1 . VAL B 1 246 ? -2.662  31.599  -8.600  1.00 39.48  ? 244 VAL B CG1 1 
ATOM   3826  C CG2 . VAL B 1 246 ? -2.700  32.160  -11.056 1.00 43.23  ? 244 VAL B CG2 1 
ATOM   3827  N N   . LEU B 1 247 ? 0.109   30.756  -7.925  1.00 42.03  ? 245 LEU B N   1 
ATOM   3828  C CA  . LEU B 1 247 ? 0.597   30.460  -6.589  1.00 31.29  ? 245 LEU B CA  1 
ATOM   3829  C C   . LEU B 1 247 ? 1.893   31.198  -6.428  1.00 33.26  ? 245 LEU B C   1 
ATOM   3830  O O   . LEU B 1 247 ? 2.081   31.896  -5.455  1.00 40.06  ? 245 LEU B O   1 
ATOM   3831  C CB  . LEU B 1 247 ? 0.910   28.979  -6.461  1.00 26.29  ? 245 LEU B CB  1 
ATOM   3832  C CG  . LEU B 1 247 ? -0.158  27.866  -6.535  1.00 30.01  ? 245 LEU B CG  1 
ATOM   3833  C CD1 . LEU B 1 247 ? 0.536   26.507  -6.216  1.00 22.78  ? 245 LEU B CD1 1 
ATOM   3834  C CD2 . LEU B 1 247 ? -1.367  28.144  -5.581  1.00 13.50  ? 245 LEU B CD2 1 
ATOM   3835  N N   . GLU B 1 248 ? 2.792   31.030  -7.384  1.00 27.96  ? 246 GLU B N   1 
ATOM   3836  C CA  . GLU B 1 248 ? 4.083   31.683  -7.334  1.00 39.43  ? 246 GLU B CA  1 
ATOM   3837  C C   . GLU B 1 248 ? 4.009   33.222  -7.218  1.00 46.46  ? 246 GLU B C   1 
ATOM   3838  O O   . GLU B 1 248 ? 5.036   33.914  -7.159  1.00 44.20  ? 246 GLU B O   1 
ATOM   3839  C CB  . GLU B 1 248 ? 4.879   31.309  -8.573  1.00 34.55  ? 246 GLU B CB  1 
ATOM   3840  C CG  . GLU B 1 248 ? 5.439   29.912  -8.536  1.00 43.78  ? 246 GLU B CG  1 
ATOM   3841  C CD  . GLU B 1 248 ? 6.829   29.856  -7.960  1.00 49.17  ? 246 GLU B CD  1 
ATOM   3842  O OE1 . GLU B 1 248 ? 7.027   30.388  -6.847  1.00 49.97  ? 246 GLU B OE1 1 
ATOM   3843  O OE2 . GLU B 1 248 ? 7.726   29.273  -8.626  1.00 59.32  ? 246 GLU B OE2 1 
ATOM   3844  N N   . SER B 1 249 ? 2.792   33.755  -7.233  1.00 52.35  ? 247 SER B N   1 
ATOM   3845  C CA  . SER B 1 249 ? 2.578   35.198  -7.155  1.00 56.57  ? 247 SER B CA  1 
ATOM   3846  C C   . SER B 1 249 ? 2.076   35.573  -5.786  1.00 57.05  ? 247 SER B C   1 
ATOM   3847  O O   . SER B 1 249 ? 2.286   36.698  -5.341  1.00 59.63  ? 247 SER B O   1 
ATOM   3848  C CB  . SER B 1 249 ? 1.582   35.648  -8.228  1.00 57.26  ? 247 SER B CB  1 
ATOM   3849  O OG  . SER B 1 249 ? 2.184   35.618  -9.499  1.00 59.24  ? 247 SER B OG  1 
ATOM   3850  N N   . GLY B 1 250 ? 1.384   34.629  -5.153  1.00 54.72  ? 248 GLY B N   1 
ATOM   3851  C CA  . GLY B 1 250 ? 0.890   34.823  -3.809  1.00 50.57  ? 248 GLY B CA  1 
ATOM   3852  C C   . GLY B 1 250 ? 1.917   34.262  -2.828  1.00 53.25  ? 248 GLY B C   1 
ATOM   3853  O O   . GLY B 1 250 ? 1.567   33.827  -1.716  1.00 57.39  ? 248 GLY B O   1 
ATOM   3854  N N   . GLY B 1 251 ? 3.187   34.269  -3.249  1.00 52.99  ? 249 GLY B N   1 
ATOM   3855  C CA  . GLY B 1 251 ? 4.291   33.798  -2.421  1.00 49.86  ? 249 GLY B CA  1 
ATOM   3856  C C   . GLY B 1 251 ? 4.020   32.509  -1.684  1.00 46.90  ? 249 GLY B C   1 
ATOM   3857  O O   . GLY B 1 251 ? 4.292   32.404  -0.479  1.00 46.35  ? 249 GLY B O   1 
ATOM   3858  N N   . PHE B 1 252 ? 3.480   31.547  -2.428  1.00 42.62  ? 250 PHE B N   1 
ATOM   3859  C CA  . PHE B 1 252 ? 3.081   30.213  -1.927  1.00 46.05  ? 250 PHE B CA  1 
ATOM   3860  C C   . PHE B 1 252 ? 4.151   29.413  -1.089  1.00 45.78  ? 250 PHE B C   1 
ATOM   3861  O O   . PHE B 1 252 ? 3.816   28.722  -0.122  1.00 38.23  ? 250 PHE B O   1 
ATOM   3862  C CB  . PHE B 1 252 ? 2.565   29.376  -3.137  1.00 38.69  ? 250 PHE B CB  1 
ATOM   3863  C CG  . PHE B 1 252 ? 1.946   28.094  -2.763  1.00 24.08  ? 250 PHE B CG  1 
ATOM   3864  C CD1 . PHE B 1 252 ? 0.742   28.070  -2.075  1.00 27.74  ? 250 PHE B CD1 1 
ATOM   3865  C CD2 . PHE B 1 252 ? 2.618   26.895  -3.001  1.00 29.12  ? 250 PHE B CD2 1 
ATOM   3866  C CE1 . PHE B 1 252 ? 0.228   26.845  -1.622  1.00 27.84  ? 250 PHE B CE1 1 
ATOM   3867  C CE2 . PHE B 1 252 ? 2.130   25.692  -2.559  1.00 23.75  ? 250 PHE B CE2 1 
ATOM   3868  C CZ  . PHE B 1 252 ? 0.928   25.655  -1.861  1.00 23.14  ? 250 PHE B CZ  1 
ATOM   3869  N N   . ARG B 1 253 ? 5.417   29.492  -1.483  1.00 45.30  ? 251 ARG B N   1 
ATOM   3870  C CA  . ARG B 1 253 ? 6.475   28.826  -0.756  1.00 45.53  ? 251 ARG B CA  1 
ATOM   3871  C C   . ARG B 1 253 ? 6.580   29.670  0.552   1.00 45.32  ? 251 ARG B C   1 
ATOM   3872  O O   . ARG B 1 253 ? 6.203   29.234  1.633   1.00 41.95  ? 251 ARG B O   1 
ATOM   3873  C CB  . ARG B 1 253 ? 7.760   28.879  -1.608  1.00 44.88  ? 251 ARG B CB  1 
ATOM   3874  C CG  . ARG B 1 253 ? 7.509   28.821  -3.138  1.00 43.15  ? 251 ARG B CG  1 
ATOM   3875  C CD  . ARG B 1 253 ? 8.698   28.261  -3.881  1.00 45.08  ? 251 ARG B CD  1 
ATOM   3876  N NE  . ARG B 1 253 ? 8.409   27.761  -5.224  1.00 47.49  ? 251 ARG B NE  1 
ATOM   3877  C CZ  . ARG B 1 253 ? 9.301   27.096  -5.953  1.00 52.87  ? 251 ARG B CZ  1 
ATOM   3878  N NH1 . ARG B 1 253 ? 10.513  26.865  -5.444  1.00 58.34  ? 251 ARG B NH1 1 
ATOM   3879  N NH2 . ARG B 1 253 ? 8.996   26.674  -7.181  1.00 56.51  ? 251 ARG B NH2 1 
ATOM   3880  N N   . SER B 1 254 ? 7.048   30.901  0.433   1.00 47.49  ? 252 SER B N   1 
ATOM   3881  C CA  . SER B 1 254 ? 7.179   31.806  1.575   1.00 48.63  ? 252 SER B CA  1 
ATOM   3882  C C   . SER B 1 254 ? 6.214   31.499  2.700   1.00 46.39  ? 252 SER B C   1 
ATOM   3883  O O   . SER B 1 254 ? 6.547   31.598  3.869   1.00 47.58  ? 252 SER B O   1 
ATOM   3884  C CB  . SER B 1 254 ? 6.905   33.233  1.133   1.00 55.36  ? 252 SER B CB  1 
ATOM   3885  O OG  . SER B 1 254 ? 7.483   33.513  -0.134  1.00 65.07  ? 252 SER B OG  1 
ATOM   3886  N N   . LEU B 1 255 ? 5.000   31.136  2.345   1.00 43.05  ? 253 LEU B N   1 
ATOM   3887  C CA  . LEU B 1 255 ? 4.014   30.855  3.366   1.00 43.55  ? 253 LEU B CA  1 
ATOM   3888  C C   . LEU B 1 255 ? 4.244   29.516  4.025   1.00 41.86  ? 253 LEU B C   1 
ATOM   3889  O O   . LEU B 1 255 ? 3.913   29.303  5.197   1.00 37.17  ? 253 LEU B O   1 
ATOM   3890  C CB  . LEU B 1 255 ? 2.614   30.889  2.760   1.00 41.95  ? 253 LEU B CB  1 
ATOM   3891  C CG  . LEU B 1 255 ? 2.198   32.209  2.081   1.00 45.81  ? 253 LEU B CG  1 
ATOM   3892  C CD1 . LEU B 1 255 ? 0.697   32.411  2.277   1.00 40.36  ? 253 LEU B CD1 1 
ATOM   3893  C CD2 . LEU B 1 255 ? 2.994   33.398  2.674   1.00 48.90  ? 253 LEU B CD2 1 
ATOM   3894  N N   . LEU B 1 256 ? 4.804   28.598  3.259   1.00 40.43  ? 254 LEU B N   1 
ATOM   3895  C CA  . LEU B 1 256 ? 5.035   27.281  3.801   1.00 36.06  ? 254 LEU B CA  1 
ATOM   3896  C C   . LEU B 1 256 ? 6.250   27.415  4.692   1.00 31.76  ? 254 LEU B C   1 
ATOM   3897  O O   . LEU B 1 256 ? 6.254   26.954  5.814   1.00 31.48  ? 254 LEU B O   1 
ATOM   3898  C CB  . LEU B 1 256 ? 5.205   26.271  2.651   1.00 37.44  ? 254 LEU B CB  1 
ATOM   3899  C CG  . LEU B 1 256 ? 3.875   25.868  1.950   1.00 32.18  ? 254 LEU B CG  1 
ATOM   3900  C CD1 . LEU B 1 256 ? 4.074   24.918  0.744   1.00 33.08  ? 254 LEU B CD1 1 
ATOM   3901  C CD2 . LEU B 1 256 ? 2.954   25.234  2.985   1.00 27.06  ? 254 LEU B CD2 1 
ATOM   3902  N N   . ILE B 1 257 ? 7.260   28.124  4.212   1.00 27.84  ? 255 ILE B N   1 
ATOM   3903  C CA  . ILE B 1 257 ? 8.464   28.366  4.991   1.00 25.57  ? 255 ILE B CA  1 
ATOM   3904  C C   . ILE B 1 257 ? 8.173   29.164  6.262   1.00 31.51  ? 255 ILE B C   1 
ATOM   3905  O O   . ILE B 1 257 ? 9.016   29.187  7.132   1.00 37.05  ? 255 ILE B O   1 
ATOM   3906  C CB  . ILE B 1 257 ? 9.470   29.170  4.233   1.00 19.94  ? 255 ILE B CB  1 
ATOM   3907  C CG1 . ILE B 1 257 ? 9.619   28.602  2.825   1.00 14.07  ? 255 ILE B CG1 1 
ATOM   3908  C CG2 . ILE B 1 257 ? 10.800  29.199  5.027   1.00 30.00  ? 255 ILE B CG2 1 
ATOM   3909  C CD1 . ILE B 1 257 ? 10.801  29.125  2.053   1.00 18.62  ? 255 ILE B CD1 1 
ATOM   3910  N N   . ASN B 1 258 ? 7.017   29.839  6.350   1.00 34.28  ? 256 ASN B N   1 
ATOM   3911  C CA  . ASN B 1 258 ? 6.616   30.582  7.561   1.00 33.97  ? 256 ASN B CA  1 
ATOM   3912  C C   . ASN B 1 258 ? 5.789   29.588  8.410   1.00 38.13  ? 256 ASN B C   1 
ATOM   3913  O O   . ASN B 1 258 ? 5.407   29.880  9.540   1.00 39.81  ? 256 ASN B O   1 
ATOM   3914  C CB  . ASN B 1 258 ? 5.679   31.772  7.278   1.00 32.73  ? 256 ASN B CB  1 
ATOM   3915  C CG  . ASN B 1 258 ? 6.324   32.914  6.545   1.00 34.04  ? 256 ASN B CG  1 
ATOM   3916  O OD1 . ASN B 1 258 ? 7.539   32.960  6.316   1.00 30.80  ? 256 ASN B OD1 1 
ATOM   3917  N ND2 . ASN B 1 258 ? 5.482   33.868  6.154   1.00 32.59  ? 256 ASN B ND2 1 
ATOM   3918  N N   . ALA B 1 259 ? 5.490   28.419  7.843   1.00 39.45  ? 257 ALA B N   1 
ATOM   3919  C CA  . ALA B 1 259 ? 4.748   27.393  8.559   1.00 36.45  ? 257 ALA B CA  1 
ATOM   3920  C C   . ALA B 1 259 ? 5.762   26.552  9.327   1.00 37.23  ? 257 ALA B C   1 
ATOM   3921  O O   . ALA B 1 259 ? 5.640   26.481  10.552  1.00 36.29  ? 257 ALA B O   1 
ATOM   3922  C CB  . ALA B 1 259 ? 3.898   26.512  7.591   1.00 33.14  ? 257 ALA B CB  1 
ATOM   3923  N N   . VAL B 1 260 ? 6.744   25.947  8.644   1.00 33.12  ? 258 VAL B N   1 
ATOM   3924  C CA  . VAL B 1 260 ? 7.728   25.139  9.329   1.00 39.96  ? 258 VAL B CA  1 
ATOM   3925  C C   . VAL B 1 260 ? 8.405   25.966  10.466  1.00 46.25  ? 258 VAL B C   1 
ATOM   3926  O O   . VAL B 1 260 ? 8.288   25.634  11.677  1.00 49.43  ? 258 VAL B O   1 
ATOM   3927  C CB  . VAL B 1 260 ? 8.773   24.574  8.315   1.00 40.29  ? 258 VAL B CB  1 
ATOM   3928  C CG1 . VAL B 1 260 ? 9.742   25.631  7.903   1.00 44.11  ? 258 VAL B CG1 1 
ATOM   3929  C CG2 . VAL B 1 260 ? 9.515   23.414  8.917   1.00 37.96  ? 258 VAL B CG2 1 
ATOM   3930  N N   . GLU B 1 261 ? 9.102   27.042  10.085  1.00 47.80  ? 259 GLU B N   1 
ATOM   3931  C CA  . GLU B 1 261 ? 9.794   27.974  11.006  1.00 44.22  ? 259 GLU B CA  1 
ATOM   3932  C C   . GLU B 1 261 ? 8.983   28.408  12.252  1.00 42.29  ? 259 GLU B C   1 
ATOM   3933  O O   . GLU B 1 261 ? 9.500   28.392  13.343  1.00 40.74  ? 259 GLU B O   1 
ATOM   3934  C CB  . GLU B 1 261 ? 10.210  29.234  10.210  1.00 39.00  ? 259 GLU B CB  1 
ATOM   3935  C CG  . GLU B 1 261 ? 10.522  30.471  11.048  1.00 39.68  ? 259 GLU B CG  1 
ATOM   3936  C CD  . GLU B 1 261 ? 11.013  31.680  10.244  1.00 43.73  ? 259 GLU B CD  1 
ATOM   3937  O OE1 . GLU B 1 261 ? 10.160  32.486  9.779   1.00 38.29  ? 259 GLU B OE1 1 
ATOM   3938  O OE2 . GLU B 1 261 ? 12.259  31.839  10.071  1.00 41.21  ? 259 GLU B OE2 1 
ATOM   3939  N N   . ALA B 1 262 ? 7.731   28.806  12.068  1.00 40.67  ? 260 ALA B N   1 
ATOM   3940  C CA  . ALA B 1 262 ? 6.919   29.288  13.170  1.00 43.93  ? 260 ALA B CA  1 
ATOM   3941  C C   . ALA B 1 262 ? 6.508   28.198  14.124  1.00 49.71  ? 260 ALA B C   1 
ATOM   3942  O O   . ALA B 1 262 ? 6.421   28.398  15.335  1.00 56.16  ? 260 ALA B O   1 
ATOM   3943  C CB  . ALA B 1 262 ? 5.685   29.984  12.646  1.00 40.84  ? 260 ALA B CB  1 
ATOM   3944  N N   . SER B 1 263 ? 6.213   27.031  13.583  1.00 54.64  ? 261 SER B N   1 
ATOM   3945  C CA  . SER B 1 263 ? 5.792   25.901  14.418  1.00 55.60  ? 261 SER B CA  1 
ATOM   3946  C C   . SER B 1 263 ? 7.020   25.445  15.150  1.00 55.12  ? 261 SER B C   1 
ATOM   3947  O O   . SER B 1 263 ? 6.960   25.083  16.331  1.00 52.79  ? 261 SER B O   1 
ATOM   3948  C CB  . SER B 1 263 ? 5.289   24.739  13.556  1.00 56.21  ? 261 SER B CB  1 
ATOM   3949  O OG  . SER B 1 263 ? 5.146   23.574  14.345  1.00 53.20  ? 261 SER B OG  1 
ATOM   3950  N N   . CYS B 1 264 ? 8.127   25.445  14.413  1.00 51.95  ? 262 CYS B N   1 
ATOM   3951  C CA  . CYS B 1 264 ? 9.369   25.041  14.995  1.00 54.68  ? 262 CYS B CA  1 
ATOM   3952  C C   . CYS B 1 264 ? 9.667   25.950  16.155  1.00 53.38  ? 262 CYS B C   1 
ATOM   3953  O O   . CYS B 1 264 ? 9.666   25.523  17.305  1.00 58.40  ? 262 CYS B O   1 
ATOM   3954  C CB  . CYS B 1 264 ? 10.520  25.125  14.022  1.00 56.11  ? 262 CYS B CB  1 
ATOM   3955  S SG  . CYS B 1 264 ? 12.027  24.850  14.978  1.00 72.50  ? 262 CYS B SG  1 
ATOM   3956  N N   . ILE B 1 265 ? 9.945   27.204  15.855  1.00 49.77  ? 263 ILE B N   1 
ATOM   3957  C CA  . ILE B 1 265 ? 10.231  28.168  16.888  1.00 47.00  ? 263 ILE B CA  1 
ATOM   3958  C C   . ILE B 1 265 ? 9.259   28.061  18.072  1.00 48.07  ? 263 ILE B C   1 
ATOM   3959  O O   . ILE B 1 265 ? 9.682   27.997  19.226  1.00 51.23  ? 263 ILE B O   1 
ATOM   3960  C CB  . ILE B 1 265 ? 10.183  29.576  16.311  1.00 44.78  ? 263 ILE B CB  1 
ATOM   3961  C CG1 . ILE B 1 265 ? 11.441  29.839  15.500  1.00 46.18  ? 263 ILE B CG1 1 
ATOM   3962  C CG2 . ILE B 1 265 ? 10.043  30.578  17.417  1.00 48.50  ? 263 ILE B CG2 1 
ATOM   3963  C CD1 . ILE B 1 265 ? 11.359  31.059  14.644  1.00 53.39  ? 263 ILE B CD1 1 
ATOM   3964  N N   . ARG B 1 266 ? 7.962   28.038  17.807  1.00 47.68  ? 264 ARG B N   1 
ATOM   3965  C CA  . ARG B 1 266 ? 7.006   27.936  18.905  1.00 49.50  ? 264 ARG B CA  1 
ATOM   3966  C C   . ARG B 1 266 ? 7.191   26.644  19.704  1.00 54.08  ? 264 ARG B C   1 
ATOM   3967  O O   . ARG B 1 266 ? 6.778   26.541  20.861  1.00 52.54  ? 264 ARG B O   1 
ATOM   3968  C CB  . ARG B 1 266 ? 5.587   27.955  18.385  1.00 46.71  ? 264 ARG B CB  1 
ATOM   3969  C CG  . ARG B 1 266 ? 4.619   27.491  19.449  1.00 42.45  ? 264 ARG B CG  1 
ATOM   3970  C CD  . ARG B 1 266 ? 4.780   28.357  20.640  1.00 41.27  ? 264 ARG B CD  1 
ATOM   3971  N NE  . ARG B 1 266 ? 3.650   28.246  21.545  1.00 45.64  ? 264 ARG B NE  1 
ATOM   3972  C CZ  . ARG B 1 266 ? 3.377   29.157  22.479  1.00 43.99  ? 264 ARG B CZ  1 
ATOM   3973  N NH1 . ARG B 1 266 ? 4.161   30.225  22.610  1.00 46.68  ? 264 ARG B NH1 1 
ATOM   3974  N NH2 . ARG B 1 266 ? 2.313   29.019  23.263  1.00 39.26  ? 264 ARG B NH2 1 
ATOM   3975  N N   . THR B 1 267 ? 7.779   25.640  19.068  1.00 57.76  ? 265 THR B N   1 
ATOM   3976  C CA  . THR B 1 267 ? 8.025   24.390  19.739  1.00 60.98  ? 265 THR B CA  1 
ATOM   3977  C C   . THR B 1 267 ? 9.303   24.568  20.587  1.00 67.02  ? 265 THR B C   1 
ATOM   3978  O O   . THR B 1 267 ? 9.533   23.859  21.564  1.00 66.89  ? 265 THR B O   1 
ATOM   3979  C CB  . THR B 1 267 ? 8.138   23.276  18.718  1.00 56.64  ? 265 THR B CB  1 
ATOM   3980  O OG1 . THR B 1 267 ? 6.965   22.464  18.808  1.00 62.93  ? 265 THR B OG1 1 
ATOM   3981  C CG2 . THR B 1 267 ? 9.355   22.440  18.946  1.00 59.18  ? 265 THR B CG2 1 
ATOM   3982  N N   . ARG B 1 268 ? 10.124  25.545  20.217  1.00 71.87  ? 266 ARG B N   1 
ATOM   3983  C CA  . ARG B 1 268 ? 11.318  25.844  20.978  1.00 72.97  ? 266 ARG B CA  1 
ATOM   3984  C C   . ARG B 1 268 ? 10.799  26.599  22.211  1.00 76.65  ? 266 ARG B C   1 
ATOM   3985  O O   . ARG B 1 268 ? 11.174  26.273  23.333  1.00 80.51  ? 266 ARG B O   1 
ATOM   3986  C CB  . ARG B 1 268 ? 12.284  26.710  20.149  1.00 73.85  ? 266 ARG B CB  1 
ATOM   3987  C CG  . ARG B 1 268 ? 13.026  25.960  19.041  1.00 76.59  ? 266 ARG B CG  1 
ATOM   3988  C CD  . ARG B 1 268 ? 13.763  26.917  18.107  1.00 81.58  ? 266 ARG B CD  1 
ATOM   3989  N NE  . ARG B 1 268 ? 14.521  26.193  17.087  1.00 87.61  ? 266 ARG B NE  1 
ATOM   3990  C CZ  . ARG B 1 268 ? 15.122  26.762  16.041  1.00 90.64  ? 266 ARG B CZ  1 
ATOM   3991  N NH1 . ARG B 1 268 ? 15.054  28.079  15.863  1.00 92.86  ? 266 ARG B NH1 1 
ATOM   3992  N NH2 . ARG B 1 268 ? 15.807  26.014  15.175  1.00 92.18  ? 266 ARG B NH2 1 
ATOM   3993  N N   . GLU B 1 269 ? 9.907   27.575  22.014  1.00 77.62  ? 267 GLU B N   1 
ATOM   3994  C CA  . GLU B 1 269 ? 9.356   28.360  23.126  1.00 78.10  ? 267 GLU B CA  1 
ATOM   3995  C C   . GLU B 1 269 ? 8.643   27.505  24.174  1.00 76.35  ? 267 GLU B C   1 
ATOM   3996  O O   . GLU B 1 269 ? 8.339   27.961  25.285  1.00 74.56  ? 267 GLU B O   1 
ATOM   3997  C CB  . GLU B 1 269 ? 8.383   29.413  22.593  1.00 83.40  ? 267 GLU B CB  1 
ATOM   3998  C CG  . GLU B 1 269 ? 8.986   30.413  21.606  1.00 92.89  ? 267 GLU B CG  1 
ATOM   3999  C CD  . GLU B 1 269 ? 8.205   31.714  21.541  1.00 98.54  ? 267 GLU B CD  1 
ATOM   4000  O OE1 . GLU B 1 269 ? 6.958   31.645  21.378  1.00 97.02  ? 267 GLU B OE1 1 
ATOM   4001  O OE2 . GLU B 1 269 ? 8.848   32.796  21.646  1.00 102.15 ? 267 GLU B OE2 1 
ATOM   4002  N N   . LEU B 1 270 ? 8.373   26.261  23.807  1.00 75.36  ? 268 LEU B N   1 
ATOM   4003  C CA  . LEU B 1 270 ? 7.707   25.338  24.709  1.00 78.04  ? 268 LEU B CA  1 
ATOM   4004  C C   . LEU B 1 270 ? 8.688   24.621  25.606  1.00 82.58  ? 268 LEU B C   1 
ATOM   4005  O O   . LEU B 1 270 ? 8.370   24.325  26.745  1.00 85.46  ? 268 LEU B O   1 
ATOM   4006  C CB  . LEU B 1 270 ? 6.904   24.316  23.925  1.00 74.95  ? 268 LEU B CB  1 
ATOM   4007  C CG  . LEU B 1 270 ? 5.880   25.017  23.046  1.00 73.36  ? 268 LEU B CG  1 
ATOM   4008  C CD1 . LEU B 1 270 ? 5.051   23.989  22.285  1.00 74.87  ? 268 LEU B CD1 1 
ATOM   4009  C CD2 . LEU B 1 270 ? 5.024   25.917  23.913  1.00 66.77  ? 268 LEU B CD2 1 
ATOM   4010  N N   . GLN B 1 271 ? 9.877   24.318  25.099  1.00 87.00  ? 269 GLN B N   1 
ATOM   4011  C CA  . GLN B 1 271 ? 10.858  23.676  25.952  1.00 91.83  ? 269 GLN B CA  1 
ATOM   4012  C C   . GLN B 1 271 ? 11.247  24.756  26.983  1.00 93.84  ? 269 GLN B C   1 
ATOM   4013  O O   . GLN B 1 271 ? 11.340  24.464  28.160  1.00 97.25  ? 269 GLN B O   1 
ATOM   4014  C CB  . GLN B 1 271 ? 12.083  23.181  25.154  1.00 92.95  ? 269 GLN B CB  1 
ATOM   4015  C CG  . GLN B 1 271 ? 12.988  24.266  24.596  1.00 103.38 ? 269 GLN B CG  1 
ATOM   4016  C CD  . GLN B 1 271 ? 14.306  23.731  24.024  1.00 110.66 ? 269 GLN B CD  1 
ATOM   4017  O OE1 . GLN B 1 271 ? 14.314  22.855  23.153  1.00 114.15 ? 269 GLN B OE1 1 
ATOM   4018  N NE2 . GLN B 1 271 ? 15.429  24.268  24.511  1.00 114.71 ? 269 GLN B NE2 1 
ATOM   4019  N N   . SER B 1 272 ? 11.418  26.006  26.544  1.00 95.04  ? 270 SER B N   1 
ATOM   4020  C CA  . SER B 1 272 ? 11.773  27.128  27.427  1.00 96.76  ? 270 SER B CA  1 
ATOM   4021  C C   . SER B 1 272 ? 10.703  27.417  28.445  1.00 99.63  ? 270 SER B C   1 
ATOM   4022  O O   . SER B 1 272 ? 10.576  28.530  28.933  1.00 98.45  ? 270 SER B O   1 
ATOM   4023  C CB  . SER B 1 272 ? 11.982  28.404  26.635  1.00 95.63  ? 270 SER B CB  1 
ATOM   4024  O OG  . SER B 1 272 ? 13.161  28.323  25.888  1.00 100.06 ? 270 SER B OG  1 
ATOM   4025  N N   . MET B 1 273 ? 9.908   26.406  28.727  1.00 104.50 ? 271 MET B N   1 
ATOM   4026  C CA  . MET B 1 273 ? 8.829   26.489  29.686  1.00 111.08 ? 271 MET B CA  1 
ATOM   4027  C C   . MET B 1 273 ? 8.902   25.193  30.448  1.00 115.07 ? 271 MET B C   1 
ATOM   4028  O O   . MET B 1 273 ? 8.629   25.148  31.639  1.00 114.83 ? 271 MET B O   1 
ATOM   4029  C CB  . MET B 1 273 ? 7.483   26.558  28.982  1.00 114.53 ? 271 MET B CB  1 
ATOM   4030  C CG  . MET B 1 273 ? 7.118   27.911  28.403  1.00 118.90 ? 271 MET B CG  1 
ATOM   4031  S SD  . MET B 1 273 ? 5.371   27.868  27.937  1.00 118.41 ? 271 MET B SD  1 
ATOM   4032  C CE  . MET B 1 273 ? 4.572   27.429  29.581  1.00 120.30 ? 271 MET B CE  1 
ATOM   4033  N N   . ALA B 1 274 ? 9.271   24.135  29.728  1.00 121.86 ? 272 ALA B N   1 
ATOM   4034  C CA  . ALA B 1 274 ? 9.429   22.789  30.285  1.00 128.34 ? 272 ALA B CA  1 
ATOM   4035  C C   . ALA B 1 274 ? 10.825  22.680  30.874  1.00 132.65 ? 272 ALA B C   1 
ATOM   4036  O O   . ALA B 1 274 ? 11.097  21.799  31.694  1.00 133.90 ? 272 ALA B O   1 
ATOM   4037  C CB  . ALA B 1 274 ? 9.257   21.727  29.185  1.00 126.39 ? 272 ALA B CB  1 
ATOM   4038  N N   . ASP B 1 275 ? 11.684  23.606  30.439  1.00 137.09 ? 273 ASP B N   1 
ATOM   4039  C CA  . ASP B 1 275 ? 13.091  23.708  30.841  1.00 139.41 ? 273 ASP B CA  1 
ATOM   4040  C C   . ASP B 1 275 ? 13.311  24.998  31.641  1.00 142.94 ? 273 ASP B C   1 
ATOM   4041  O O   . ASP B 1 275 ? 14.309  25.698  31.438  1.00 142.26 ? 273 ASP B O   1 
ATOM   4042  C CB  . ASP B 1 275 ? 13.993  23.752  29.591  1.00 136.23 ? 273 ASP B CB  1 
ATOM   4043  C CG  . ASP B 1 275 ? 13.914  22.485  28.753  1.00 132.64 ? 273 ASP B CG  1 
ATOM   4044  O OD1 . ASP B 1 275 ? 12.817  21.880  28.664  1.00 132.68 ? 273 ASP B OD1 1 
ATOM   4045  O OD2 . ASP B 1 275 ? 14.951  22.110  28.167  1.00 126.59 ? 273 ASP B OD2 1 
ATOM   4046  N N   . GLN B 1 276 ? 12.392  25.312  32.548  1.00 148.66 ? 274 GLN B N   1 
ATOM   4047  C CA  . GLN B 1 276 ? 12.515  26.538  33.318  1.00 154.89 ? 274 GLN B CA  1 
ATOM   4048  C C   . GLN B 1 276 ? 11.791  26.443  34.654  1.00 158.57 ? 274 GLN B C   1 
ATOM   4049  O O   . GLN B 1 276 ? 12.389  26.580  35.724  1.00 157.68 ? 274 GLN B O   1 
ATOM   4050  C CB  . GLN B 1 276 ? 11.955  27.706  32.479  1.00 155.65 ? 274 GLN B CB  1 
ATOM   4051  C CG  . GLN B 1 276 ? 11.994  29.084  33.141  1.00 157.09 ? 274 GLN B CG  1 
ATOM   4052  C CD  . GLN B 1 276 ? 11.475  30.212  32.230  1.00 157.33 ? 274 GLN B CD  1 
ATOM   4053  O OE1 . GLN B 1 276 ? 12.063  30.514  31.188  1.00 156.70 ? 274 GLN B OE1 1 
ATOM   4054  N NE2 . GLN B 1 276 ? 10.374  30.836  32.632  1.00 157.69 ? 274 GLN B NE2 1 
ATOM   4055  N N   . GLU B 1 277 ? 10.497  26.181  34.587  1.00 164.48 ? 275 GLU B N   1 
ATOM   4056  C CA  . GLU B 1 277 ? 9.696   26.122  35.793  1.00 170.86 ? 275 GLU B CA  1 
ATOM   4057  C C   . GLU B 1 277 ? 9.152   24.714  36.063  1.00 169.93 ? 275 GLU B C   1 
ATOM   4058  O O   . GLU B 1 277 ? 9.322   23.843  35.175  1.00 168.46 ? 275 GLU B O   1 
ATOM   4059  C CB  . GLU B 1 277 ? 8.566   27.162  35.655  1.00 180.16 ? 275 GLU B CB  1 
ATOM   4060  C CG  . GLU B 1 277 ? 9.021   28.460  34.900  1.00 191.47 ? 275 GLU B CG  1 
ATOM   4061  C CD  . GLU B 1 277 ? 8.001   29.627  34.915  1.00 197.39 ? 275 GLU B CD  1 
ATOM   4062  O OE1 . GLU B 1 277 ? 6.838   29.431  34.484  1.00 199.52 ? 275 GLU B OE1 1 
ATOM   4063  O OE2 . GLU B 1 277 ? 8.376   30.750  35.347  1.00 199.55 ? 275 GLU B OE2 1 
ATOM   4064  N N   . ARG C 1 1   ? -14.514 88.377  37.102  1.00 144.47 ? -1  ARG C N   1 
ATOM   4065  C CA  . ARG C 1 1   ? -14.868 89.680  36.483  1.00 145.18 ? -1  ARG C CA  1 
ATOM   4066  C C   . ARG C 1 1   ? -13.611 90.366  35.930  1.00 146.71 ? -1  ARG C C   1 
ATOM   4067  O O   . ARG C 1 1   ? -13.113 89.986  34.870  1.00 145.51 ? -1  ARG C O   1 
ATOM   4068  C CB  . ARG C 1 1   ? -15.574 90.572  37.514  1.00 143.01 ? -1  ARG C CB  1 
ATOM   4069  N N   . ALA C 1 2   ? -13.105 91.368  36.652  1.00 149.97 ? 0   ALA C N   1 
ATOM   4070  C CA  . ALA C 1 2   ? -11.906 92.085  36.228  1.00 152.40 ? 0   ALA C CA  1 
ATOM   4071  C C   . ALA C 1 2   ? -10.735 91.140  36.039  1.00 153.85 ? 0   ALA C C   1 
ATOM   4072  O O   . ALA C 1 2   ? -10.560 90.207  36.837  1.00 154.85 ? 0   ALA C O   1 
ATOM   4073  N N   . MET C 1 3   ? -9.910  91.385  35.016  1.00 155.04 ? 1   MET C N   1 
ATOM   4074  C CA  . MET C 1 3   ? -8.803  90.468  34.746  1.00 154.36 ? 1   MET C CA  1 
ATOM   4075  C C   . MET C 1 3   ? -7.781  90.861  33.658  1.00 151.21 ? 1   MET C C   1 
ATOM   4076  O O   . MET C 1 3   ? -8.104  91.543  32.674  1.00 149.25 ? 1   MET C O   1 
ATOM   4077  C CB  . MET C 1 3   ? -9.434  89.121  34.408  1.00 158.73 ? 1   MET C CB  1 
ATOM   4078  C CG  . MET C 1 3   ? -8.534  87.940  34.240  1.00 162.26 ? 1   MET C CG  1 
ATOM   4079  S SD  . MET C 1 3   ? -9.667  86.575  33.865  1.00 167.41 ? 1   MET C SD  1 
ATOM   4080  C CE  . MET C 1 3   ? -9.801  86.772  32.066  1.00 165.68 ? 1   MET C CE  1 
ATOM   4081  N N   . SER C 1 4   ? -6.548  90.395  33.847  1.00 147.51 ? 2   SER C N   1 
ATOM   4082  C CA  . SER C 1 4   ? -5.455  90.658  32.919  1.00 144.15 ? 2   SER C CA  1 
ATOM   4083  C C   . SER C 1 4   ? -4.860  89.318  32.507  1.00 142.52 ? 2   SER C C   1 
ATOM   4084  O O   . SER C 1 4   ? -5.234  88.273  33.034  1.00 141.44 ? 2   SER C O   1 
ATOM   4085  C CB  . SER C 1 4   ? -4.363  91.501  33.587  1.00 142.53 ? 2   SER C CB  1 
ATOM   4086  O OG  . SER C 1 4   ? -4.870  92.725  34.081  1.00 140.47 ? 2   SER C OG  1 
ATOM   4087  N N   . VAL C 1 5   ? -3.929  89.360  31.562  1.00 141.09 ? 3   VAL C N   1 
ATOM   4088  C CA  . VAL C 1 5   ? -3.253  88.166  31.057  1.00 138.39 ? 3   VAL C CA  1 
ATOM   4089  C C   . VAL C 1 5   ? -1.953  88.604  30.370  1.00 138.45 ? 3   VAL C C   1 
ATOM   4090  O O   . VAL C 1 5   ? -1.724  89.793  30.158  1.00 139.05 ? 3   VAL C O   1 
ATOM   4091  C CB  . VAL C 1 5   ? -4.131  87.419  30.033  1.00 137.23 ? 3   VAL C CB  1 
ATOM   4092  C CG1 . VAL C 1 5   ? -3.452  86.131  29.612  1.00 137.38 ? 3   VAL C CG1 1 
ATOM   4093  C CG2 . VAL C 1 5   ? -5.510  87.137  30.616  1.00 134.39 ? 3   VAL C CG2 1 
ATOM   4094  N N   . GLY C 1 6   ? -1.098  87.647  30.035  1.00 137.72 ? 4   GLY C N   1 
ATOM   4095  C CA  . GLY C 1 6   ? 0.149   87.984  29.379  1.00 139.25 ? 4   GLY C CA  1 
ATOM   4096  C C   . GLY C 1 6   ? 0.635   86.794  28.588  1.00 140.87 ? 4   GLY C C   1 
ATOM   4097  O O   . GLY C 1 6   ? 0.182   85.680  28.833  1.00 140.99 ? 4   GLY C O   1 
ATOM   4098  N N   . PHE C 1 7   ? 1.555   87.003  27.652  1.00 143.39 ? 5   PHE C N   1 
ATOM   4099  C CA  . PHE C 1 7   ? 2.049   85.884  26.857  1.00 147.16 ? 5   PHE C CA  1 
ATOM   4100  C C   . PHE C 1 7   ? 3.543   85.734  26.680  1.00 149.23 ? 5   PHE C C   1 
ATOM   4101  O O   . PHE C 1 7   ? 4.086   86.061  25.618  1.00 150.38 ? 5   PHE C O   1 
ATOM   4102  C CB  . PHE C 1 7   ? 1.415   85.888  25.475  1.00 148.54 ? 5   PHE C CB  1 
ATOM   4103  C CG  . PHE C 1 7   ? 0.063   85.263  25.441  1.00 151.85 ? 5   PHE C CG  1 
ATOM   4104  C CD1 . PHE C 1 7   ? -1.015  85.884  26.065  1.00 153.54 ? 5   PHE C CD1 1 
ATOM   4105  C CD2 . PHE C 1 7   ? -0.136  84.044  24.805  1.00 152.95 ? 5   PHE C CD2 1 
ATOM   4106  C CE1 . PHE C 1 7   ? -2.274  85.305  26.057  1.00 153.71 ? 5   PHE C CE1 1 
ATOM   4107  C CE2 . PHE C 1 7   ? -1.389  83.457  24.791  1.00 155.04 ? 5   PHE C CE2 1 
ATOM   4108  C CZ  . PHE C 1 7   ? -2.465  84.091  25.420  1.00 154.67 ? 5   PHE C CZ  1 
ATOM   4109  N N   . ILE C 1 8   ? 4.201   85.215  27.710  1.00 151.06 ? 6   ILE C N   1 
ATOM   4110  C CA  . ILE C 1 8   ? 5.636   84.972  27.663  1.00 152.96 ? 6   ILE C CA  1 
ATOM   4111  C C   . ILE C 1 8   ? 5.807   83.938  26.568  1.00 151.37 ? 6   ILE C C   1 
ATOM   4112  O O   . ILE C 1 8   ? 6.742   83.986  25.767  1.00 150.97 ? 6   ILE C O   1 
ATOM   4113  C CB  . ILE C 1 8   ? 6.144   84.405  29.007  1.00 155.63 ? 6   ILE C CB  1 
ATOM   4114  C CG1 . ILE C 1 8   ? 5.983   85.470  30.105  1.00 157.56 ? 6   ILE C CG1 1 
ATOM   4115  C CG2 . ILE C 1 8   ? 7.589   83.938  28.857  1.00 157.08 ? 6   ILE C CG2 1 
ATOM   4116  C CD1 . ILE C 1 8   ? 6.261   84.980  31.532  1.00 159.33 ? 6   ILE C CD1 1 
ATOM   4117  N N   . GLY C 1 9   ? 4.882   82.995  26.544  1.00 149.69 ? 7   GLY C N   1 
ATOM   4118  C CA  . GLY C 1 9   ? 4.931   81.999  25.510  1.00 150.48 ? 7   GLY C CA  1 
ATOM   4119  C C   . GLY C 1 9   ? 4.297   82.660  24.305  1.00 151.50 ? 7   GLY C C   1 
ATOM   4120  O O   . GLY C 1 9   ? 3.220   82.243  23.881  1.00 151.44 ? 7   GLY C O   1 
ATOM   4121  N N   . ALA C 1 10  ? 4.950   83.698  23.770  1.00 152.57 ? 8   ALA C N   1 
ATOM   4122  C CA  . ALA C 1 10  ? 4.439   84.436  22.602  1.00 153.76 ? 8   ALA C CA  1 
ATOM   4123  C C   . ALA C 1 10  ? 4.907   83.801  21.292  1.00 154.39 ? 8   ALA C C   1 
ATOM   4124  O O   . ALA C 1 10  ? 6.020   83.280  21.209  1.00 154.61 ? 8   ALA C O   1 
ATOM   4125  C CB  . ALA C 1 10  ? 4.884   85.904  22.657  1.00 151.60 ? 8   ALA C CB  1 
ATOM   4126  N N   . GLY C 1 11  ? 4.050   83.853  20.273  1.00 154.60 ? 9   GLY C N   1 
ATOM   4127  C CA  . GLY C 1 11  ? 4.386   83.261  18.989  1.00 154.18 ? 9   GLY C CA  1 
ATOM   4128  C C   . GLY C 1 11  ? 3.289   82.314  18.532  1.00 154.16 ? 9   GLY C C   1 
ATOM   4129  O O   . GLY C 1 11  ? 2.297   82.170  19.239  1.00 154.22 ? 9   GLY C O   1 
ATOM   4130  N N   . GLN C 1 12  ? 3.461   81.671  17.372  1.00 153.78 ? 10  GLN C N   1 
ATOM   4131  C CA  . GLN C 1 12  ? 2.465   80.734  16.817  1.00 152.27 ? 10  GLN C CA  1 
ATOM   4132  C C   . GLN C 1 12  ? 1.079   80.818  17.477  1.00 149.48 ? 10  GLN C C   1 
ATOM   4133  O O   . GLN C 1 12  ? 0.445   81.879  17.466  1.00 150.46 ? 10  GLN C O   1 
ATOM   4134  C CB  . GLN C 1 12  ? 2.988   79.287  16.883  1.00 154.11 ? 10  GLN C CB  1 
ATOM   4135  C CG  . GLN C 1 12  ? 4.052   78.970  15.837  1.00 156.94 ? 10  GLN C CG  1 
ATOM   4136  C CD  . GLN C 1 12  ? 3.483   78.323  14.579  1.00 158.42 ? 10  GLN C CD  1 
ATOM   4137  O OE1 . GLN C 1 12  ? 2.392   78.670  14.122  1.00 158.32 ? 10  GLN C OE1 1 
ATOM   4138  N NE2 . GLN C 1 12  ? 4.235   77.387  14.005  1.00 158.70 ? 10  GLN C NE2 1 
ATOM   4139  N N   . LEU C 1 13  ? 0.616   79.710  18.055  1.00 144.05 ? 11  LEU C N   1 
ATOM   4140  C CA  . LEU C 1 13  ? -0.698  79.657  18.702  1.00 137.64 ? 11  LEU C CA  1 
ATOM   4141  C C   . LEU C 1 13  ? -0.988  80.762  19.764  1.00 135.19 ? 11  LEU C C   1 
ATOM   4142  O O   . LEU C 1 13  ? -1.997  80.697  20.463  1.00 134.73 ? 11  LEU C O   1 
ATOM   4143  C CB  . LEU C 1 13  ? -0.891  78.253  19.304  1.00 133.36 ? 11  LEU C CB  1 
ATOM   4144  C CG  . LEU C 1 13  ? -2.297  77.754  19.651  1.00 128.72 ? 11  LEU C CG  1 
ATOM   4145  C CD1 . LEU C 1 13  ? -3.195  77.898  18.434  1.00 127.60 ? 11  LEU C CD1 1 
ATOM   4146  C CD2 . LEU C 1 13  ? -2.231  76.299  20.108  1.00 126.80 ? 11  LEU C CD2 1 
ATOM   4147  N N   . ALA C 1 14  ? -0.117  81.768  19.877  1.00 131.56 ? 12  ALA C N   1 
ATOM   4148  C CA  . ALA C 1 14  ? -0.291  82.874  20.831  1.00 128.60 ? 12  ALA C CA  1 
ATOM   4149  C C   . ALA C 1 14  ? -1.292  83.837  20.241  1.00 127.43 ? 12  ALA C C   1 
ATOM   4150  O O   . ALA C 1 14  ? -2.297  84.190  20.849  1.00 123.82 ? 12  ALA C O   1 
ATOM   4151  C CB  . ALA C 1 14  ? 1.029   83.604  21.047  1.00 128.71 ? 12  ALA C CB  1 
ATOM   4152  N N   . PHE C 1 15  ? -0.961  84.280  19.040  1.00 129.70 ? 13  PHE C N   1 
ATOM   4153  C CA  . PHE C 1 15  ? -1.792  85.181  18.266  1.00 132.60 ? 13  PHE C CA  1 
ATOM   4154  C C   . PHE C 1 15  ? -3.191  84.543  18.220  1.00 132.23 ? 13  PHE C C   1 
ATOM   4155  O O   . PHE C 1 15  ? -4.189  85.219  18.493  1.00 131.11 ? 13  PHE C O   1 
ATOM   4156  C CB  . PHE C 1 15  ? -1.180  85.288  16.859  1.00 138.35 ? 13  PHE C CB  1 
ATOM   4157  C CG  . PHE C 1 15  ? -1.792  86.343  15.975  1.00 143.25 ? 13  PHE C CG  1 
ATOM   4158  C CD1 . PHE C 1 15  ? -0.968  87.268  15.326  1.00 145.26 ? 13  PHE C CD1 1 
ATOM   4159  C CD2 . PHE C 1 15  ? -3.162  86.368  15.720  1.00 144.92 ? 13  PHE C CD2 1 
ATOM   4160  C CE1 . PHE C 1 15  ? -1.490  88.196  14.435  1.00 147.09 ? 13  PHE C CE1 1 
ATOM   4161  C CE2 . PHE C 1 15  ? -3.702  87.296  14.827  1.00 147.09 ? 13  PHE C CE2 1 
ATOM   4162  C CZ  . PHE C 1 15  ? -2.862  88.217  14.176  1.00 148.03 ? 13  PHE C CZ  1 
ATOM   4163  N N   . ALA C 1 16  ? -3.242  83.239  17.901  1.00 130.72 ? 14  ALA C N   1 
ATOM   4164  C CA  . ALA C 1 16  ? -4.499  82.475  17.795  1.00 126.98 ? 14  ALA C CA  1 
ATOM   4165  C C   . ALA C 1 16  ? -5.365  82.623  19.049  1.00 125.34 ? 14  ALA C C   1 
ATOM   4166  O O   . ALA C 1 16  ? -6.593  82.719  18.954  1.00 125.40 ? 14  ALA C O   1 
ATOM   4167  C CB  . ALA C 1 16  ? -4.207  80.968  17.508  1.00 123.67 ? 14  ALA C CB  1 
ATOM   4168  N N   . LEU C 1 17  ? -4.716  82.648  20.214  1.00 124.06 ? 15  LEU C N   1 
ATOM   4169  C CA  . LEU C 1 17  ? -5.393  82.805  21.502  1.00 120.27 ? 15  LEU C CA  1 
ATOM   4170  C C   . LEU C 1 17  ? -5.819  84.252  21.596  1.00 118.07 ? 15  LEU C C   1 
ATOM   4171  O O   . LEU C 1 17  ? -6.955  84.561  21.941  1.00 115.70 ? 15  LEU C O   1 
ATOM   4172  C CB  . LEU C 1 17  ? -4.436  82.476  22.651  1.00 119.76 ? 15  LEU C CB  1 
ATOM   4173  C CG  . LEU C 1 17  ? -3.985  81.016  22.763  1.00 118.95 ? 15  LEU C CG  1 
ATOM   4174  C CD1 . LEU C 1 17  ? -2.979  80.824  23.881  1.00 117.10 ? 15  LEU C CD1 1 
ATOM   4175  C CD2 . LEU C 1 17  ? -5.213  80.175  23.023  1.00 119.96 ? 15  LEU C CD2 1 
ATOM   4176  N N   . ALA C 1 18  ? -4.882  85.131  21.267  1.00 117.41 ? 16  ALA C N   1 
ATOM   4177  C CA  . ALA C 1 18  ? -5.118  86.562  21.277  1.00 116.92 ? 16  ALA C CA  1 
ATOM   4178  C C   . ALA C 1 18  ? -6.437  86.885  20.573  1.00 117.36 ? 16  ALA C C   1 
ATOM   4179  O O   . ALA C 1 18  ? -7.495  86.958  21.219  1.00 116.85 ? 16  ALA C O   1 
ATOM   4180  C CB  . ALA C 1 18  ? -3.970  87.265  20.582  1.00 115.83 ? 16  ALA C CB  1 
ATOM   4181  N N   . LYS C 1 19  ? -6.367  87.061  19.250  1.00 117.48 ? 17  LYS C N   1 
ATOM   4182  C CA  . LYS C 1 19  ? -7.537  87.396  18.424  1.00 118.57 ? 17  LYS C CA  1 
ATOM   4183  C C   . LYS C 1 19  ? -8.818  86.654  18.787  1.00 119.56 ? 17  LYS C C   1 
ATOM   4184  O O   . LYS C 1 19  ? -9.928  87.152  18.573  1.00 119.88 ? 17  LYS C O   1 
ATOM   4185  C CB  . LYS C 1 19  ? -7.243  87.140  16.947  1.00 116.32 ? 17  LYS C CB  1 
ATOM   4186  C CG  . LYS C 1 19  ? -8.432  87.405  16.012  1.00 113.71 ? 17  LYS C CG  1 
ATOM   4187  C CD  . LYS C 1 19  ? -8.061  87.098  14.575  1.00 114.25 ? 17  LYS C CD  1 
ATOM   4188  C CE  . LYS C 1 19  ? -6.802  87.862  14.178  1.00 116.81 ? 17  LYS C CE  1 
ATOM   4189  N NZ  . LYS C 1 19  ? -6.226  87.457  12.855  1.00 118.41 ? 17  LYS C NZ  1 
ATOM   4190  N N   . GLY C 1 20  ? -8.655  85.448  19.312  1.00 120.24 ? 18  GLY C N   1 
ATOM   4191  C CA  . GLY C 1 20  ? -9.802  84.655  19.697  1.00 121.87 ? 18  GLY C CA  1 
ATOM   4192  C C   . GLY C 1 20  ? -10.522 85.333  20.838  1.00 122.57 ? 18  GLY C C   1 
ATOM   4193  O O   . GLY C 1 20  ? -11.746 85.473  20.843  1.00 122.99 ? 18  GLY C O   1 
ATOM   4194  N N   . PHE C 1 21  ? -9.750  85.762  21.820  1.00 122.00 ? 19  PHE C N   1 
ATOM   4195  C CA  . PHE C 1 21  ? -10.336 86.430  22.956  1.00 121.83 ? 19  PHE C CA  1 
ATOM   4196  C C   . PHE C 1 21  ? -10.866 87.767  22.494  1.00 121.20 ? 19  PHE C C   1 
ATOM   4197  O O   . PHE C 1 21  ? -11.869 88.263  23.013  1.00 119.34 ? 19  PHE C O   1 
ATOM   4198  C CB  . PHE C 1 21  ? -9.276  86.604  24.019  1.00 123.47 ? 19  PHE C CB  1 
ATOM   4199  C CG  . PHE C 1 21  ? -8.713  85.309  24.511  1.00 126.14 ? 19  PHE C CG  1 
ATOM   4200  C CD1 . PHE C 1 21  ? -7.341  85.074  24.470  1.00 126.44 ? 19  PHE C CD1 1 
ATOM   4201  C CD2 . PHE C 1 21  ? -9.553  84.330  25.045  1.00 126.43 ? 19  PHE C CD2 1 
ATOM   4202  C CE1 . PHE C 1 21  ? -6.809  83.885  24.951  1.00 126.46 ? 19  PHE C CE1 1 
ATOM   4203  C CE2 . PHE C 1 21  ? -9.034  83.143  25.529  1.00 126.39 ? 19  PHE C CE2 1 
ATOM   4204  C CZ  . PHE C 1 21  ? -7.656  82.917  25.484  1.00 125.42 ? 19  PHE C CZ  1 
ATOM   4205  N N   . THR C 1 22  ? -10.182 88.336  21.503  1.00 122.36 ? 20  THR C N   1 
ATOM   4206  C CA  . THR C 1 22  ? -10.575 89.618  20.926  1.00 125.64 ? 20  THR C CA  1 
ATOM   4207  C C   . THR C 1 22  ? -12.028 89.479  20.522  1.00 130.40 ? 20  THR C C   1 
ATOM   4208  O O   . THR C 1 22  ? -12.917 90.034  21.161  1.00 131.46 ? 20  THR C O   1 
ATOM   4209  C CB  . THR C 1 22  ? -9.770  89.953  19.650  1.00 123.54 ? 20  THR C CB  1 
ATOM   4210  O OG1 . THR C 1 22  ? -8.370  89.921  19.942  1.00 121.31 ? 20  THR C OG1 1 
ATOM   4211  C CG2 . THR C 1 22  ? -10.152 91.335  19.121  1.00 122.69 ? 20  THR C CG2 1 
ATOM   4212  N N   . ALA C 1 23  ? -12.248 88.705  19.465  1.00 135.50 ? 21  ALA C N   1 
ATOM   4213  C CA  . ALA C 1 23  ? -13.578 88.452  18.918  1.00 140.21 ? 21  ALA C CA  1 
ATOM   4214  C C   . ALA C 1 23  ? -14.629 87.990  19.939  1.00 143.01 ? 21  ALA C C   1 
ATOM   4215  O O   . ALA C 1 23  ? -15.827 88.254  19.771  1.00 144.76 ? 21  ALA C O   1 
ATOM   4216  C CB  . ALA C 1 23  ? -13.473 87.438  17.776  1.00 141.08 ? 21  ALA C CB  1 
ATOM   4217  N N   . ALA C 1 24  ? -14.183 87.305  20.990  1.00 145.68 ? 22  ALA C N   1 
ATOM   4218  C CA  . ALA C 1 24  ? -15.075 86.804  22.042  1.00 148.30 ? 22  ALA C CA  1 
ATOM   4219  C C   . ALA C 1 24  ? -16.027 87.889  22.563  1.00 149.25 ? 22  ALA C C   1 
ATOM   4220  O O   . ALA C 1 24  ? -17.177 87.621  22.938  1.00 148.21 ? 22  ALA C O   1 
ATOM   4221  C CB  . ALA C 1 24  ? -14.234 86.254  23.201  1.00 148.92 ? 22  ALA C CB  1 
ATOM   4222  N N   . GLY C 1 25  ? -15.537 89.121  22.568  1.00 150.41 ? 23  GLY C N   1 
ATOM   4223  C CA  . GLY C 1 25  ? -16.336 90.217  23.066  1.00 152.06 ? 23  GLY C CA  1 
ATOM   4224  C C   . GLY C 1 25  ? -16.033 90.334  24.542  1.00 154.47 ? 23  GLY C C   1 
ATOM   4225  O O   . GLY C 1 25  ? -16.627 91.150  25.247  1.00 154.69 ? 23  GLY C O   1 
ATOM   4226  N N   . VAL C 1 26  ? -15.099 89.507  25.012  1.00 156.96 ? 24  VAL C N   1 
ATOM   4227  C CA  . VAL C 1 26  ? -14.721 89.522  26.417  1.00 160.05 ? 24  VAL C CA  1 
ATOM   4228  C C   . VAL C 1 26  ? -13.233 89.869  26.598  1.00 161.95 ? 24  VAL C C   1 
ATOM   4229  O O   . VAL C 1 26  ? -12.512 89.134  27.260  1.00 162.37 ? 24  VAL C O   1 
ATOM   4230  C CB  . VAL C 1 26  ? -15.044 88.139  27.122  1.00 160.35 ? 24  VAL C CB  1 
ATOM   4231  C CG1 . VAL C 1 26  ? -14.919 88.276  28.652  1.00 159.29 ? 24  VAL C CG1 1 
ATOM   4232  C CG2 . VAL C 1 26  ? -16.467 87.665  26.773  1.00 159.59 ? 24  VAL C CG2 1 
ATOM   4233  N N   . LEU C 1 27  ? -12.783 90.984  26.005  1.00 164.70 ? 25  LEU C N   1 
ATOM   4234  C CA  . LEU C 1 27  ? -11.386 91.439  26.148  1.00 167.50 ? 25  LEU C CA  1 
ATOM   4235  C C   . LEU C 1 27  ? -10.870 92.541  25.180  1.00 168.87 ? 25  LEU C C   1 
ATOM   4236  O O   . LEU C 1 27  ? -11.245 92.573  24.001  1.00 168.52 ? 25  LEU C O   1 
ATOM   4237  C CB  . LEU C 1 27  ? -10.455 90.233  26.077  1.00 168.42 ? 25  LEU C CB  1 
ATOM   4238  C CG  . LEU C 1 27  ? -9.085  90.345  26.746  1.00 169.52 ? 25  LEU C CG  1 
ATOM   4239  C CD1 . LEU C 1 27  ? -9.185  90.841  28.196  1.00 168.18 ? 25  LEU C CD1 1 
ATOM   4240  C CD2 . LEU C 1 27  ? -8.446  88.965  26.686  1.00 171.05 ? 25  LEU C CD2 1 
ATOM   4241  N N   . ALA C 1 28  ? -10.005 93.430  25.694  1.00 169.94 ? 26  ALA C N   1 
ATOM   4242  C CA  . ALA C 1 28  ? -9.404  94.528  24.914  1.00 170.47 ? 26  ALA C CA  1 
ATOM   4243  C C   . ALA C 1 28  ? -7.869  94.413  24.966  1.00 171.42 ? 26  ALA C C   1 
ATOM   4244  O O   . ALA C 1 28  ? -7.271  94.541  26.041  1.00 170.89 ? 26  ALA C O   1 
ATOM   4245  C CB  . ALA C 1 28  ? -9.861  95.883  25.472  1.00 168.93 ? 26  ALA C CB  1 
ATOM   4246  N N   . ALA C 1 29  ? -7.260  94.185  23.794  1.00 173.00 ? 27  ALA C N   1 
ATOM   4247  C CA  . ALA C 1 29  ? -5.808  93.981  23.622  1.00 173.91 ? 27  ALA C CA  1 
ATOM   4248  C C   . ALA C 1 29  ? -4.880  95.009  24.232  1.00 174.25 ? 27  ALA C C   1 
ATOM   4249  O O   . ALA C 1 29  ? -4.100  95.654  23.527  1.00 175.15 ? 27  ALA C O   1 
ATOM   4250  C CB  . ALA C 1 29  ? -5.472  93.820  22.131  1.00 173.82 ? 27  ALA C CB  1 
ATOM   4251  N N   . HIS C 1 30  ? -4.933  95.127  25.548  1.00 174.48 ? 28  HIS C N   1 
ATOM   4252  C CA  . HIS C 1 30  ? -4.101  96.074  26.252  1.00 174.22 ? 28  HIS C CA  1 
ATOM   4253  C C   . HIS C 1 30  ? -4.004  95.592  27.689  1.00 172.80 ? 28  HIS C C   1 
ATOM   4254  O O   . HIS C 1 30  ? -3.074  95.959  28.414  1.00 173.40 ? 28  HIS C O   1 
ATOM   4255  C CB  . HIS C 1 30  ? -4.731  97.469  26.141  1.00 175.92 ? 28  HIS C CB  1 
ATOM   4256  C CG  . HIS C 1 30  ? -4.871  97.945  24.723  1.00 178.06 ? 28  HIS C CG  1 
ATOM   4257  N ND1 . HIS C 1 30  ? -3.795  98.379  23.976  1.00 179.83 ? 28  HIS C ND1 1 
ATOM   4258  C CD2 . HIS C 1 30  ? -5.933  97.943  23.883  1.00 178.81 ? 28  HIS C CD2 1 
ATOM   4259  C CE1 . HIS C 1 30  ? -4.189  98.619  22.736  1.00 180.34 ? 28  HIS C CE1 1 
ATOM   4260  N NE2 . HIS C 1 30  ? -5.481  98.361  22.651  1.00 179.98 ? 28  HIS C NE2 1 
ATOM   4261  N N   . LYS C 1 31  ? -4.961  94.746  28.079  1.00 169.42 ? 29  LYS C N   1 
ATOM   4262  C CA  . LYS C 1 31  ? -4.999  94.171  29.424  1.00 165.50 ? 29  LYS C CA  1 
ATOM   4263  C C   . LYS C 1 31  ? -4.073  92.967  29.410  1.00 165.81 ? 29  LYS C C   1 
ATOM   4264  O O   . LYS C 1 31  ? -4.107  92.137  30.314  1.00 164.88 ? 29  LYS C O   1 
ATOM   4265  C CB  . LYS C 1 31  ? -6.422  93.720  29.776  1.00 160.00 ? 29  LYS C CB  1 
ATOM   4266  C CG  . LYS C 1 31  ? -7.489  94.705  29.345  1.00 153.63 ? 29  LYS C CG  1 
ATOM   4267  C CD  . LYS C 1 31  ? -7.116  96.128  29.729  1.00 148.03 ? 29  LYS C CD  1 
ATOM   4268  C CE  . LYS C 1 31  ? -8.055  97.131  29.109  1.00 144.44 ? 29  LYS C CE  1 
ATOM   4269  N NZ  . LYS C 1 31  ? -9.454  96.865  29.528  1.00 141.81 ? 29  LYS C NZ  1 
ATOM   4270  N N   . ILE C 1 32  ? -3.240  92.899  28.374  1.00 167.24 ? 30  ILE C N   1 
ATOM   4271  C CA  . ILE C 1 32  ? -2.309  91.794  28.188  1.00 169.58 ? 30  ILE C CA  1 
ATOM   4272  C C   . ILE C 1 32  ? -1.054  92.148  27.396  1.00 169.08 ? 30  ILE C C   1 
ATOM   4273  O O   . ILE C 1 32  ? -1.140  92.662  26.281  1.00 169.04 ? 30  ILE C O   1 
ATOM   4274  C CB  . ILE C 1 32  ? -3.009  90.655  27.471  1.00 172.22 ? 30  ILE C CB  1 
ATOM   4275  C CG1 . ILE C 1 32  ? -4.238  90.253  28.279  1.00 175.02 ? 30  ILE C CG1 1 
ATOM   4276  C CG2 . ILE C 1 32  ? -2.045  89.489  27.261  1.00 172.21 ? 30  ILE C CG2 1 
ATOM   4277  C CD1 . ILE C 1 32  ? -5.233  89.464  27.512  1.00 179.29 ? 30  ILE C CD1 1 
ATOM   4278  N N   . MET C 1 33  ? 0.110   91.836  27.965  1.00 168.06 ? 31  MET C N   1 
ATOM   4279  C CA  . MET C 1 33  ? 1.390   92.133  27.322  1.00 166.37 ? 31  MET C CA  1 
ATOM   4280  C C   . MET C 1 33  ? 1.820   90.988  26.416  1.00 166.42 ? 31  MET C C   1 
ATOM   4281  O O   . MET C 1 33  ? 1.414   89.842  26.615  1.00 165.26 ? 31  MET C O   1 
ATOM   4282  C CB  . MET C 1 33  ? 2.470   92.376  28.381  1.00 165.00 ? 31  MET C CB  1 
ATOM   4283  C CG  . MET C 1 33  ? 3.680   93.143  27.885  1.00 162.64 ? 31  MET C CG  1 
ATOM   4284  S SD  . MET C 1 33  ? 3.388   94.921  27.682  1.00 162.58 ? 31  MET C SD  1 
ATOM   4285  C CE  . MET C 1 33  ? 3.719   95.551  29.360  1.00 161.61 ? 31  MET C CE  1 
ATOM   4286  N N   . ALA C 1 34  ? 2.645   91.305  25.426  1.00 168.24 ? 32  ALA C N   1 
ATOM   4287  C CA  . ALA C 1 34  ? 3.129   90.306  24.479  1.00 171.25 ? 32  ALA C CA  1 
ATOM   4288  C C   . ALA C 1 34  ? 4.648   90.136  24.485  1.00 172.78 ? 32  ALA C C   1 
ATOM   4289  O O   . ALA C 1 34  ? 5.337   90.535  23.540  1.00 174.83 ? 32  ALA C O   1 
ATOM   4290  C CB  . ALA C 1 34  ? 2.661   90.661  23.063  1.00 172.19 ? 32  ALA C CB  1 
ATOM   4291  N N   . SER C 1 35  ? 5.178   89.539  25.543  1.00 172.95 ? 33  SER C N   1 
ATOM   4292  C CA  . SER C 1 35  ? 6.614   89.319  25.626  1.00 171.87 ? 33  SER C CA  1 
ATOM   4293  C C   . SER C 1 35  ? 6.958   88.092  24.782  1.00 171.58 ? 33  SER C C   1 
ATOM   4294  O O   . SER C 1 35  ? 6.431   86.998  24.992  1.00 171.40 ? 33  SER C O   1 
ATOM   4295  C CB  . SER C 1 35  ? 7.033   89.106  27.079  1.00 171.54 ? 33  SER C CB  1 
ATOM   4296  O OG  . SER C 1 35  ? 8.438   89.006  27.169  1.00 172.76 ? 33  SER C OG  1 
ATOM   4297  N N   . SER C 1 36  ? 7.829   88.279  23.804  1.00 171.20 ? 34  SER C N   1 
ATOM   4298  C CA  . SER C 1 36  ? 8.192   87.170  22.950  1.00 171.56 ? 34  SER C CA  1 
ATOM   4299  C C   . SER C 1 36  ? 9.697   87.024  22.886  1.00 172.34 ? 34  SER C C   1 
ATOM   4300  O O   . SER C 1 36  ? 10.409  88.003  22.646  1.00 171.04 ? 34  SER C O   1 
ATOM   4301  C CB  . SER C 1 36  ? 7.625   87.390  21.550  1.00 171.85 ? 34  SER C CB  1 
ATOM   4302  O OG  . SER C 1 36  ? 7.741   86.213  20.770  1.00 171.76 ? 34  SER C OG  1 
ATOM   4303  N N   . PRO C 1 37  ? 10.204  85.795  23.108  1.00 174.15 ? 35  PRO C N   1 
ATOM   4304  C CA  . PRO C 1 37  ? 11.655  85.582  23.058  1.00 175.95 ? 35  PRO C CA  1 
ATOM   4305  C C   . PRO C 1 37  ? 12.157  85.878  21.646  1.00 177.88 ? 35  PRO C C   1 
ATOM   4306  O O   . PRO C 1 37  ? 12.405  84.956  20.848  1.00 178.05 ? 35  PRO C O   1 
ATOM   4307  C CB  . PRO C 1 37  ? 11.814  84.109  23.467  1.00 174.57 ? 35  PRO C CB  1 
ATOM   4308  C CG  . PRO C 1 37  ? 10.540  83.483  23.007  1.00 174.02 ? 35  PRO C CG  1 
ATOM   4309  C CD  . PRO C 1 37  ? 9.487   84.527  23.346  1.00 173.73 ? 35  PRO C CD  1 
ATOM   4310  N N   . ASP C 1 38  ? 12.277  87.181  21.364  1.00 179.60 ? 36  ASP C N   1 
ATOM   4311  C CA  . ASP C 1 38  ? 12.718  87.716  20.078  1.00 180.41 ? 36  ASP C CA  1 
ATOM   4312  C C   . ASP C 1 38  ? 11.533  88.115  19.226  1.00 179.47 ? 36  ASP C C   1 
ATOM   4313  O O   . ASP C 1 38  ? 10.555  88.684  19.737  1.00 178.63 ? 36  ASP C O   1 
ATOM   4314  C CB  . ASP C 1 38  ? 13.565  86.696  19.326  1.00 183.54 ? 36  ASP C CB  1 
ATOM   4315  C CG  . ASP C 1 38  ? 14.888  86.453  19.999  1.00 186.96 ? 36  ASP C CG  1 
ATOM   4316  O OD1 . ASP C 1 38  ? 15.592  85.502  19.597  1.00 190.19 ? 36  ASP C OD1 1 
ATOM   4317  O OD2 . ASP C 1 38  ? 15.219  87.226  20.932  1.00 187.72 ? 36  ASP C OD2 1 
ATOM   4318  N N   . MET C 1 39  ? 11.628  87.815  17.931  1.00 178.34 ? 37  MET C N   1 
ATOM   4319  C CA  . MET C 1 39  ? 10.564  88.144  16.995  1.00 177.15 ? 37  MET C CA  1 
ATOM   4320  C C   . MET C 1 39  ? 10.533  87.327  15.707  1.00 176.69 ? 37  MET C C   1 
ATOM   4321  O O   . MET C 1 39  ? 11.486  86.611  15.375  1.00 175.98 ? 37  MET C O   1 
ATOM   4322  C CB  . MET C 1 39  ? 10.626  89.629  16.653  1.00 175.41 ? 37  MET C CB  1 
ATOM   4323  C CG  . MET C 1 39  ? 10.312  90.522  17.821  1.00 173.81 ? 37  MET C CG  1 
ATOM   4324  S SD  . MET C 1 39  ? 10.140  92.188  17.278  1.00 172.48 ? 37  MET C SD  1 
ATOM   4325  C CE  . MET C 1 39  ? 8.480   92.096  16.520  1.00 172.14 ? 37  MET C CE  1 
ATOM   4326  N N   . ASP C 1 40  ? 9.411   87.458  14.997  1.00 176.17 ? 38  ASP C N   1 
ATOM   4327  C CA  . ASP C 1 40  ? 9.159   86.769  13.733  1.00 175.64 ? 38  ASP C CA  1 
ATOM   4328  C C   . ASP C 1 40  ? 7.885   87.310  13.083  1.00 175.07 ? 38  ASP C C   1 
ATOM   4329  O O   . ASP C 1 40  ? 6.853   87.433  13.744  1.00 174.62 ? 38  ASP C O   1 
ATOM   4330  C CB  . ASP C 1 40  ? 8.983   85.272  13.964  1.00 176.09 ? 38  ASP C CB  1 
ATOM   4331  C CG  . ASP C 1 40  ? 8.768   84.512  12.673  1.00 177.02 ? 38  ASP C CG  1 
ATOM   4332  O OD1 . ASP C 1 40  ? 8.284   83.360  12.734  1.00 177.71 ? 38  ASP C OD1 1 
ATOM   4333  O OD2 . ASP C 1 40  ? 9.092   85.064  11.594  1.00 177.25 ? 38  ASP C OD2 1 
ATOM   4334  N N   . LEU C 1 41  ? 7.953   87.612  11.786  1.00 174.61 ? 39  LEU C N   1 
ATOM   4335  C CA  . LEU C 1 41  ? 6.799   88.142  11.049  1.00 173.36 ? 39  LEU C CA  1 
ATOM   4336  C C   . LEU C 1 41  ? 5.559   87.267  11.225  1.00 172.38 ? 39  LEU C C   1 
ATOM   4337  O O   . LEU C 1 41  ? 4.471   87.765  11.526  1.00 172.41 ? 39  LEU C O   1 
ATOM   4338  C CB  . LEU C 1 41  ? 7.120   88.267  9.547   1.00 173.39 ? 39  LEU C CB  1 
ATOM   4339  C CG  . LEU C 1 41  ? 8.139   89.316  9.076   1.00 173.13 ? 39  LEU C CG  1 
ATOM   4340  C CD1 . LEU C 1 41  ? 8.281   89.235  7.560   1.00 172.68 ? 39  LEU C CD1 1 
ATOM   4341  C CD2 . LEU C 1 41  ? 7.689   90.715  9.488   1.00 173.69 ? 39  LEU C CD2 1 
ATOM   4342  N N   . ALA C 1 42  ? 5.747   85.965  11.032  1.00 170.74 ? 40  ALA C N   1 
ATOM   4343  C CA  . ALA C 1 42  ? 4.691   84.959  11.144  1.00 169.01 ? 40  ALA C CA  1 
ATOM   4344  C C   . ALA C 1 42  ? 3.455   85.378  11.942  1.00 168.21 ? 40  ALA C C   1 
ATOM   4345  O O   . ALA C 1 42  ? 2.349   85.490  11.396  1.00 167.97 ? 40  ALA C O   1 
ATOM   4346  C CB  . ALA C 1 42  ? 5.272   83.683  11.738  1.00 167.74 ? 40  ALA C CB  1 
ATOM   4347  N N   . THR C 1 43  ? 3.649   85.604  13.238  1.00 167.39 ? 41  THR C N   1 
ATOM   4348  C CA  . THR C 1 43  ? 2.555   85.988  14.125  1.00 165.30 ? 41  THR C CA  1 
ATOM   4349  C C   . THR C 1 43  ? 2.998   86.906  15.279  1.00 161.43 ? 41  THR C C   1 
ATOM   4350  O O   . THR C 1 43  ? 2.177   87.386  16.058  1.00 159.46 ? 41  THR C O   1 
ATOM   4351  C CB  . THR C 1 43  ? 1.862   84.712  14.691  1.00 167.87 ? 41  THR C CB  1 
ATOM   4352  O OG1 . THR C 1 43  ? 2.860   83.769  15.113  1.00 168.92 ? 41  THR C OG1 1 
ATOM   4353  C CG2 . THR C 1 43  ? 0.965   84.062  13.620  1.00 166.51 ? 41  THR C CG2 1 
ATOM   4354  N N   . VAL C 1 44  ? 4.301   87.143  15.379  1.00 158.20 ? 42  VAL C N   1 
ATOM   4355  C CA  . VAL C 1 44  ? 4.854   88.012  16.413  1.00 156.03 ? 42  VAL C CA  1 
ATOM   4356  C C   . VAL C 1 44  ? 4.740   89.430  15.868  1.00 154.38 ? 42  VAL C C   1 
ATOM   4357  O O   . VAL C 1 44  ? 4.865   90.416  16.601  1.00 153.37 ? 42  VAL C O   1 
ATOM   4358  C CB  . VAL C 1 44  ? 6.349   87.703  16.666  1.00 156.53 ? 42  VAL C CB  1 
ATOM   4359  C CG1 . VAL C 1 44  ? 6.883   88.574  17.807  1.00 156.56 ? 42  VAL C CG1 1 
ATOM   4360  C CG2 . VAL C 1 44  ? 6.532   86.224  16.971  1.00 156.08 ? 42  VAL C CG2 1 
ATOM   4361  N N   . SER C 1 45  ? 4.502   89.512  14.560  1.00 152.38 ? 43  SER C N   1 
ATOM   4362  C CA  . SER C 1 45  ? 4.370   90.786  13.865  1.00 149.85 ? 43  SER C CA  1 
ATOM   4363  C C   . SER C 1 45  ? 2.910   91.201  13.711  1.00 148.92 ? 43  SER C C   1 
ATOM   4364  O O   . SER C 1 45  ? 2.501   92.224  14.256  1.00 147.84 ? 43  SER C O   1 
ATOM   4365  C CB  . SER C 1 45  ? 5.028   90.706  12.486  1.00 149.00 ? 43  SER C CB  1 
ATOM   4366  O OG  . SER C 1 45  ? 5.190   91.995  11.921  1.00 145.48 ? 43  SER C OG  1 
ATOM   4367  N N   . ALA C 1 46  ? 2.126   90.419  12.967  1.00 148.03 ? 44  ALA C N   1 
ATOM   4368  C CA  . ALA C 1 46  ? 0.713   90.738  12.776  1.00 148.00 ? 44  ALA C CA  1 
ATOM   4369  C C   . ALA C 1 46  ? 0.086   90.956  14.160  1.00 148.34 ? 44  ALA C C   1 
ATOM   4370  O O   . ALA C 1 46  ? -0.919  91.660  14.302  1.00 148.20 ? 44  ALA C O   1 
ATOM   4371  C CB  . ALA C 1 46  ? 0.008   89.601  12.031  1.00 147.26 ? 44  ALA C CB  1 
ATOM   4372  N N   . LEU C 1 47  ? 0.698   90.342  15.175  1.00 148.21 ? 45  LEU C N   1 
ATOM   4373  C CA  . LEU C 1 47  ? 0.261   90.455  16.572  1.00 146.09 ? 45  LEU C CA  1 
ATOM   4374  C C   . LEU C 1 47  ? 0.403   91.929  16.938  1.00 145.00 ? 45  LEU C C   1 
ATOM   4375  O O   . LEU C 1 47  ? -0.450  92.510  17.622  1.00 141.93 ? 45  LEU C O   1 
ATOM   4376  C CB  . LEU C 1 47  ? 1.167   89.580  17.456  1.00 145.93 ? 45  LEU C CB  1 
ATOM   4377  C CG  . LEU C 1 47  ? 0.954   89.419  18.961  1.00 144.03 ? 45  LEU C CG  1 
ATOM   4378  C CD1 . LEU C 1 47  ? 2.015   88.463  19.512  1.00 143.30 ? 45  LEU C CD1 1 
ATOM   4379  C CD2 . LEU C 1 47  ? 1.054   90.767  19.656  1.00 144.21 ? 45  LEU C CD2 1 
ATOM   4380  N N   . ARG C 1 48  ? 1.512   92.512  16.492  1.00 144.73 ? 46  ARG C N   1 
ATOM   4381  C CA  . ARG C 1 48  ? 1.779   93.921  16.700  1.00 145.22 ? 46  ARG C CA  1 
ATOM   4382  C C   . ARG C 1 48  ? 0.543   94.670  16.203  1.00 144.92 ? 46  ARG C C   1 
ATOM   4383  O O   . ARG C 1 48  ? -0.287  95.100  16.997  1.00 144.30 ? 46  ARG C O   1 
ATOM   4384  C CB  . ARG C 1 48  ? 2.985   94.347  15.872  1.00 147.77 ? 46  ARG C CB  1 
ATOM   4385  C CG  . ARG C 1 48  ? 4.325   93.921  16.415  1.00 153.40 ? 46  ARG C CG  1 
ATOM   4386  C CD  . ARG C 1 48  ? 4.811   94.951  17.414  1.00 160.22 ? 46  ARG C CD  1 
ATOM   4387  N NE  . ARG C 1 48  ? 6.248   94.861  17.660  1.00 165.01 ? 46  ARG C NE  1 
ATOM   4388  C CZ  . ARG C 1 48  ? 6.903   95.601  18.552  1.00 166.34 ? 46  ARG C CZ  1 
ATOM   4389  N NH1 . ARG C 1 48  ? 6.256   96.496  19.292  1.00 166.50 ? 46  ARG C NH1 1 
ATOM   4390  N NH2 . ARG C 1 48  ? 8.209   95.434  18.708  1.00 168.09 ? 46  ARG C NH2 1 
ATOM   4391  N N   . LYS C 1 49  ? 0.431   94.791  14.877  1.00 144.98 ? 47  LYS C N   1 
ATOM   4392  C CA  . LYS C 1 49  ? -0.680  95.480  14.209  1.00 144.63 ? 47  LYS C CA  1 
ATOM   4393  C C   . LYS C 1 49  ? -2.002  95.167  14.900  1.00 144.74 ? 47  LYS C C   1 
ATOM   4394  O O   . LYS C 1 49  ? -2.974  95.921  14.781  1.00 144.00 ? 47  LYS C O   1 
ATOM   4395  C CB  . LYS C 1 49  ? -0.740  95.083  12.713  1.00 143.20 ? 47  LYS C CB  1 
ATOM   4396  C CG  . LYS C 1 49  ? -1.728  95.894  11.857  1.00 139.81 ? 47  LYS C CG  1 
ATOM   4397  C CD  . LYS C 1 49  ? -1.514  95.730  10.339  1.00 135.76 ? 47  LYS C CD  1 
ATOM   4398  C CE  . LYS C 1 49  ? -0.346  96.575  9.826   1.00 134.74 ? 47  LYS C CE  1 
ATOM   4399  N NZ  . LYS C 1 49  ? -0.318  96.728  8.336   1.00 133.86 ? 47  LYS C NZ  1 
ATOM   4400  N N   . MET C 1 50  ? -2.035  94.052  15.622  1.00 144.95 ? 48  MET C N   1 
ATOM   4401  C CA  . MET C 1 50  ? -3.237  93.690  16.338  1.00 145.67 ? 48  MET C CA  1 
ATOM   4402  C C   . MET C 1 50  ? -3.532  94.836  17.284  1.00 145.37 ? 48  MET C C   1 
ATOM   4403  O O   . MET C 1 50  ? -4.643  95.363  17.326  1.00 144.90 ? 48  MET C O   1 
ATOM   4404  C CB  . MET C 1 50  ? -3.024  92.403  17.128  1.00 145.68 ? 48  MET C CB  1 
ATOM   4405  C CG  . MET C 1 50  ? -4.227  92.001  17.948  1.00 147.92 ? 48  MET C CG  1 
ATOM   4406  S SD  . MET C 1 50  ? -5.785  92.062  17.024  1.00 151.82 ? 48  MET C SD  1 
ATOM   4407  C CE  . MET C 1 50  ? -6.616  93.430  17.800  1.00 146.69 ? 48  MET C CE  1 
ATOM   4408  N N   . GLY C 1 51  ? -2.508  95.244  18.017  1.00 145.69 ? 49  GLY C N   1 
ATOM   4409  C CA  . GLY C 1 51  ? -2.671  96.322  18.964  1.00 146.33 ? 49  GLY C CA  1 
ATOM   4410  C C   . GLY C 1 51  ? -2.351  95.710  20.298  1.00 146.46 ? 49  GLY C C   1 
ATOM   4411  O O   . GLY C 1 51  ? -2.965  96.034  21.310  1.00 147.18 ? 49  GLY C O   1 
ATOM   4412  N N   . VAL C 1 52  ? -1.392  94.791  20.278  1.00 145.97 ? 50  VAL C N   1 
ATOM   4413  C CA  . VAL C 1 52  ? -0.964  94.098  21.481  1.00 145.12 ? 50  VAL C CA  1 
ATOM   4414  C C   . VAL C 1 52  ? 0.505   94.410  21.787  1.00 146.22 ? 50  VAL C C   1 
ATOM   4415  O O   . VAL C 1 52  ? 1.418   93.798  21.214  1.00 146.00 ? 50  VAL C O   1 
ATOM   4416  C CB  . VAL C 1 52  ? -1.134  92.597  21.305  1.00 142.80 ? 50  VAL C CB  1 
ATOM   4417  C CG1 . VAL C 1 52  ? -1.071  91.916  22.653  1.00 141.47 ? 50  VAL C CG1 1 
ATOM   4418  C CG2 . VAL C 1 52  ? -2.437  92.312  20.600  1.00 139.57 ? 50  VAL C CG2 1 
ATOM   4419  N N   . LYS C 1 53  ? 0.718   95.365  22.695  1.00 146.82 ? 51  LYS C N   1 
ATOM   4420  C CA  . LYS C 1 53  ? 2.060   95.802  23.090  1.00 146.67 ? 51  LYS C CA  1 
ATOM   4421  C C   . LYS C 1 53  ? 3.044   94.639  23.256  1.00 147.06 ? 51  LYS C C   1 
ATOM   4422  O O   . LYS C 1 53  ? 2.667   93.550  23.692  1.00 146.45 ? 51  LYS C O   1 
ATOM   4423  C CB  . LYS C 1 53  ? 1.989   96.637  24.392  1.00 143.84 ? 51  LYS C CB  1 
ATOM   4424  C CG  . LYS C 1 53  ? 1.376   98.034  24.230  1.00 138.24 ? 51  LYS C CG  1 
ATOM   4425  C CD  . LYS C 1 53  ? -0.102  98.003  23.881  1.00 132.10 ? 51  LYS C CD  1 
ATOM   4426  C CE  . LYS C 1 53  ? -0.964  97.812  25.111  1.00 130.62 ? 51  LYS C CE  1 
ATOM   4427  N NZ  . LYS C 1 53  ? -0.650  96.605  25.907  1.00 127.01 ? 51  LYS C NZ  1 
ATOM   4428  N N   . LEU C 1 54  ? 4.304   94.876  22.893  1.00 147.26 ? 52  LEU C N   1 
ATOM   4429  C CA  . LEU C 1 54  ? 5.337   93.856  23.012  1.00 147.49 ? 52  LEU C CA  1 
ATOM   4430  C C   . LEU C 1 54  ? 6.412   94.269  24.003  1.00 147.92 ? 52  LEU C C   1 
ATOM   4431  O O   . LEU C 1 54  ? 7.087   95.279  23.827  1.00 147.01 ? 52  LEU C O   1 
ATOM   4432  C CB  . LEU C 1 54  ? 5.976   93.559  21.637  1.00 147.12 ? 52  LEU C CB  1 
ATOM   4433  C CG  . LEU C 1 54  ? 7.150   92.558  21.509  1.00 146.18 ? 52  LEU C CG  1 
ATOM   4434  C CD1 . LEU C 1 54  ? 7.159   91.940  20.114  1.00 144.62 ? 52  LEU C CD1 1 
ATOM   4435  C CD2 . LEU C 1 54  ? 8.478   93.252  21.786  1.00 145.67 ? 52  LEU C CD2 1 
ATOM   4436  N N   . THR C 1 55  ? 6.546   93.486  25.063  1.00 149.55 ? 53  THR C N   1 
ATOM   4437  C CA  . THR C 1 55  ? 7.570   93.740  26.052  1.00 151.85 ? 53  THR C CA  1 
ATOM   4438  C C   . THR C 1 55  ? 8.696   92.817  25.625  1.00 153.39 ? 53  THR C C   1 
ATOM   4439  O O   . THR C 1 55  ? 8.516   91.601  25.538  1.00 152.42 ? 53  THR C O   1 
ATOM   4440  C CB  . THR C 1 55  ? 7.109   93.364  27.475  1.00 152.37 ? 53  THR C CB  1 
ATOM   4441  O OG1 . THR C 1 55  ? 6.089   94.274  27.906  1.00 152.70 ? 53  THR C OG1 1 
ATOM   4442  C CG2 . THR C 1 55  ? 8.279   93.425  28.444  1.00 150.87 ? 53  THR C CG2 1 
ATOM   4443  N N   . PRO C 1 56  ? 9.868   93.389  25.324  1.00 155.21 ? 54  PRO C N   1 
ATOM   4444  C CA  . PRO C 1 56  ? 11.038  92.619  24.896  1.00 157.69 ? 54  PRO C CA  1 
ATOM   4445  C C   . PRO C 1 56  ? 11.542  91.732  26.036  1.00 161.36 ? 54  PRO C C   1 
ATOM   4446  O O   . PRO C 1 56  ? 12.518  90.984  25.884  1.00 162.08 ? 54  PRO C O   1 
ATOM   4447  C CB  . PRO C 1 56  ? 12.027  93.709  24.507  1.00 155.84 ? 54  PRO C CB  1 
ATOM   4448  C CG  . PRO C 1 56  ? 11.683  94.816  25.477  1.00 154.72 ? 54  PRO C CG  1 
ATOM   4449  C CD  . PRO C 1 56  ? 10.185  94.824  25.438  1.00 153.80 ? 54  PRO C CD  1 
ATOM   4450  N N   . HIS C 1 57  ? 10.842  91.818  27.168  1.00 164.94 ? 55  HIS C N   1 
ATOM   4451  C CA  . HIS C 1 57  ? 11.175  91.058  28.367  1.00 167.04 ? 55  HIS C CA  1 
ATOM   4452  C C   . HIS C 1 57  ? 9.994   90.290  28.951  1.00 167.30 ? 55  HIS C C   1 
ATOM   4453  O O   . HIS C 1 57  ? 8.906   90.843  29.174  1.00 168.03 ? 55  HIS C O   1 
ATOM   4454  C CB  . HIS C 1 57  ? 11.744  91.996  29.430  1.00 169.12 ? 55  HIS C CB  1 
ATOM   4455  C CG  . HIS C 1 57  ? 13.042  92.625  29.036  1.00 171.43 ? 55  HIS C CG  1 
ATOM   4456  N ND1 . HIS C 1 57  ? 14.126  91.886  28.603  1.00 172.55 ? 55  HIS C ND1 1 
ATOM   4457  C CD2 . HIS C 1 57  ? 13.437  93.919  29.017  1.00 171.85 ? 55  HIS C CD2 1 
ATOM   4458  C CE1 . HIS C 1 57  ? 15.131  92.700  28.338  1.00 173.22 ? 55  HIS C CE1 1 
ATOM   4459  N NE2 . HIS C 1 57  ? 14.740  93.939  28.582  1.00 173.21 ? 55  HIS C NE2 1 
ATOM   4460  N N   . ASN C 1 58  ? 10.240  89.006  29.204  1.00 166.26 ? 56  ASN C N   1 
ATOM   4461  C CA  . ASN C 1 58  ? 9.245   88.097  29.770  1.00 164.59 ? 56  ASN C CA  1 
ATOM   4462  C C   . ASN C 1 58  ? 8.864   88.533  31.209  1.00 163.14 ? 56  ASN C C   1 
ATOM   4463  O O   . ASN C 1 58  ? 8.129   87.842  31.919  1.00 163.07 ? 56  ASN C O   1 
ATOM   4464  C CB  . ASN C 1 58  ? 9.804   86.655  29.775  1.00 164.62 ? 56  ASN C CB  1 
ATOM   4465  C CG  . ASN C 1 58  ? 10.463  86.248  28.438  1.00 163.95 ? 56  ASN C CG  1 
ATOM   4466  O OD1 . ASN C 1 58  ? 9.938   86.519  27.355  1.00 163.58 ? 56  ASN C OD1 1 
ATOM   4467  N ND2 . ASN C 1 58  ? 11.606  85.571  28.525  1.00 163.65 ? 56  ASN C ND2 1 
ATOM   4468  N N   . LYS C 1 59  ? 9.360   89.696  31.620  1.00 160.53 ? 57  LYS C N   1 
ATOM   4469  C CA  . LYS C 1 59  ? 9.101   90.224  32.951  1.00 156.55 ? 57  LYS C CA  1 
ATOM   4470  C C   . LYS C 1 59  ? 7.864   91.098  32.957  1.00 153.89 ? 57  LYS C C   1 
ATOM   4471  O O   . LYS C 1 59  ? 6.791   90.645  33.337  1.00 153.10 ? 57  LYS C O   1 
ATOM   4472  C CB  . LYS C 1 59  ? 10.318  91.025  33.437  1.00 157.34 ? 57  LYS C CB  1 
ATOM   4473  C CG  . LYS C 1 59  ? 11.597  90.189  33.454  1.00 160.83 ? 57  LYS C CG  1 
ATOM   4474  C CD  . LYS C 1 59  ? 12.868  90.958  33.838  1.00 162.38 ? 57  LYS C CD  1 
ATOM   4475  C CE  . LYS C 1 59  ? 14.105  90.052  33.689  1.00 163.85 ? 57  LYS C CE  1 
ATOM   4476  N NZ  . LYS C 1 59  ? 15.408  90.708  34.027  1.00 163.78 ? 57  LYS C NZ  1 
ATOM   4477  N N   . GLU C 1 60  ? 8.024   92.344  32.528  1.00 151.63 ? 58  GLU C N   1 
ATOM   4478  C CA  . GLU C 1 60  ? 6.926   93.303  32.496  1.00 151.25 ? 58  GLU C CA  1 
ATOM   4479  C C   . GLU C 1 60  ? 5.561   92.682  32.170  1.00 150.76 ? 58  GLU C C   1 
ATOM   4480  O O   . GLU C 1 60  ? 4.539   93.068  32.751  1.00 151.10 ? 58  GLU C O   1 
ATOM   4481  C CB  . GLU C 1 60  ? 7.235   94.396  31.479  1.00 151.18 ? 58  GLU C CB  1 
ATOM   4482  C CG  . GLU C 1 60  ? 8.643   94.933  31.558  1.00 152.51 ? 58  GLU C CG  1 
ATOM   4483  C CD  . GLU C 1 60  ? 8.951   95.899  30.434  1.00 154.53 ? 58  GLU C CD  1 
ATOM   4484  O OE1 . GLU C 1 60  ? 8.302   96.969  30.374  1.00 156.21 ? 58  GLU C OE1 1 
ATOM   4485  O OE2 . GLU C 1 60  ? 9.839   95.589  29.605  1.00 154.42 ? 58  GLU C OE2 1 
ATOM   4486  N N   . THR C 1 61  ? 5.551   91.733  31.236  1.00 148.65 ? 59  THR C N   1 
ATOM   4487  C CA  . THR C 1 61  ? 4.320   91.061  30.816  1.00 145.58 ? 59  THR C CA  1 
ATOM   4488  C C   . THR C 1 61  ? 3.642   90.323  31.966  1.00 144.80 ? 59  THR C C   1 
ATOM   4489  O O   . THR C 1 61  ? 2.436   90.091  31.946  1.00 142.99 ? 59  THR C O   1 
ATOM   4490  C CB  . THR C 1 61  ? 4.608   90.046  29.682  1.00 144.93 ? 59  THR C CB  1 
ATOM   4491  O OG1 . THR C 1 61  ? 5.165   90.738  28.559  1.00 142.85 ? 59  THR C OG1 1 
ATOM   4492  C CG2 . THR C 1 61  ? 3.331   89.329  29.251  1.00 143.98 ? 59  THR C CG2 1 
ATOM   4493  N N   . VAL C 1 62  ? 4.432   89.958  32.966  1.00 145.10 ? 60  VAL C N   1 
ATOM   4494  C CA  . VAL C 1 62  ? 3.939   89.221  34.126  1.00 145.20 ? 60  VAL C CA  1 
ATOM   4495  C C   . VAL C 1 62  ? 3.282   90.114  35.175  1.00 145.40 ? 60  VAL C C   1 
ATOM   4496  O O   . VAL C 1 62  ? 2.569   89.634  36.062  1.00 145.33 ? 60  VAL C O   1 
ATOM   4497  C CB  . VAL C 1 62  ? 5.093   88.470  34.818  1.00 144.51 ? 60  VAL C CB  1 
ATOM   4498  C CG1 . VAL C 1 62  ? 4.535   87.391  35.728  1.00 144.17 ? 60  VAL C CG1 1 
ATOM   4499  C CG2 . VAL C 1 62  ? 6.041   87.895  33.783  1.00 142.43 ? 60  VAL C CG2 1 
ATOM   4500  N N   . GLN C 1 63  ? 3.516   91.413  35.046  1.00 145.67 ? 61  GLN C N   1 
ATOM   4501  C CA  . GLN C 1 63  ? 3.017   92.403  35.988  1.00 146.81 ? 61  GLN C CA  1 
ATOM   4502  C C   . GLN C 1 63  ? 1.529   92.686  36.013  1.00 148.62 ? 61  GLN C C   1 
ATOM   4503  O O   . GLN C 1 63  ? 0.805   92.151  36.848  1.00 148.30 ? 61  GLN C O   1 
ATOM   4504  C CB  . GLN C 1 63  ? 3.785   93.698  35.775  1.00 146.44 ? 61  GLN C CB  1 
ATOM   4505  C CG  . GLN C 1 63  ? 5.147   93.665  36.439  1.00 145.87 ? 61  GLN C CG  1 
ATOM   4506  C CD  . GLN C 1 63  ? 5.648   92.249  36.639  1.00 144.60 ? 61  GLN C CD  1 
ATOM   4507  O OE1 . GLN C 1 63  ? 5.854   91.513  35.675  1.00 143.87 ? 61  GLN C OE1 1 
ATOM   4508  N NE2 . GLN C 1 63  ? 5.834   91.857  37.898  1.00 144.16 ? 61  GLN C NE2 1 
ATOM   4509  N N   . HIS C 1 64  ? 1.084   93.563  35.121  1.00 151.26 ? 62  HIS C N   1 
ATOM   4510  C CA  . HIS C 1 64  ? -0.331  93.935  35.005  1.00 154.04 ? 62  HIS C CA  1 
ATOM   4511  C C   . HIS C 1 64  ? -1.222  92.685  35.063  1.00 154.87 ? 62  HIS C C   1 
ATOM   4512  O O   . HIS C 1 64  ? -2.439  92.775  35.253  1.00 155.57 ? 62  HIS C O   1 
ATOM   4513  C CB  . HIS C 1 64  ? -0.549  94.610  33.660  1.00 155.22 ? 62  HIS C CB  1 
ATOM   4514  C CG  . HIS C 1 64  ? -0.133  93.749  32.509  1.00 157.88 ? 62  HIS C CG  1 
ATOM   4515  N ND1 . HIS C 1 64  ? 1.161   93.298  32.358  1.00 158.31 ? 62  HIS C ND1 1 
ATOM   4516  C CD2 . HIS C 1 64  ? -0.853  93.175  31.515  1.00 158.18 ? 62  HIS C CD2 1 
ATOM   4517  C CE1 . HIS C 1 64  ? 1.220   92.479  31.322  1.00 158.57 ? 62  HIS C CE1 1 
ATOM   4518  N NE2 . HIS C 1 64  ? 0.013   92.387  30.795  1.00 159.19 ? 62  HIS C NE2 1 
ATOM   4519  N N   . SER C 1 65  ? -0.581  91.533  34.873  1.00 154.30 ? 63  SER C N   1 
ATOM   4520  C CA  . SER C 1 65  ? -1.197  90.207  34.856  1.00 152.23 ? 63  SER C CA  1 
ATOM   4521  C C   . SER C 1 65  ? -2.257  89.870  35.920  1.00 151.29 ? 63  SER C C   1 
ATOM   4522  O O   . SER C 1 65  ? -2.625  90.690  36.761  1.00 151.20 ? 63  SER C O   1 
ATOM   4523  C CB  . SER C 1 65  ? -0.083  89.150  34.916  1.00 151.24 ? 63  SER C CB  1 
ATOM   4524  O OG  . SER C 1 65  ? 0.873   89.353  33.886  1.00 149.25 ? 63  SER C OG  1 
ATOM   4525  N N   . ASP C 1 66  ? -2.747  88.635  35.834  1.00 149.14 ? 64  ASP C N   1 
ATOM   4526  C CA  . ASP C 1 66  ? -3.737  88.049  36.745  1.00 146.39 ? 64  ASP C CA  1 
ATOM   4527  C C   . ASP C 1 66  ? -3.861  86.603  36.234  1.00 144.98 ? 64  ASP C C   1 
ATOM   4528  O O   . ASP C 1 66  ? -4.670  85.819  36.732  1.00 146.15 ? 64  ASP C O   1 
ATOM   4529  C CB  . ASP C 1 66  ? -5.097  88.791  36.673  1.00 144.61 ? 64  ASP C CB  1 
ATOM   4530  C CG  . ASP C 1 66  ? -6.039  88.471  37.866  1.00 142.43 ? 64  ASP C CG  1 
ATOM   4531  O OD1 . ASP C 1 66  ? -7.175  89.000  37.886  1.00 139.85 ? 64  ASP C OD1 1 
ATOM   4532  O OD2 . ASP C 1 66  ? -5.663  87.707  38.783  1.00 139.51 ? 64  ASP C OD2 1 
ATOM   4533  N N   . VAL C 1 67  ? -3.031  86.269  35.237  1.00 141.80 ? 65  VAL C N   1 
ATOM   4534  C CA  . VAL C 1 67  ? -2.980  84.935  34.624  1.00 138.56 ? 65  VAL C CA  1 
ATOM   4535  C C   . VAL C 1 67  ? -2.324  85.001  33.243  1.00 136.92 ? 65  VAL C C   1 
ATOM   4536  O O   . VAL C 1 67  ? -2.839  85.634  32.331  1.00 135.76 ? 65  VAL C O   1 
ATOM   4537  C CB  . VAL C 1 67  ? -4.372  84.328  34.462  1.00 137.88 ? 65  VAL C CB  1 
ATOM   4538  C CG1 . VAL C 1 67  ? -5.246  85.277  33.671  1.00 137.27 ? 65  VAL C CG1 1 
ATOM   4539  C CG2 . VAL C 1 67  ? -4.267  82.967  33.770  1.00 136.56 ? 65  VAL C CG2 1 
ATOM   4540  N N   . LEU C 1 68  ? -1.192  84.320  33.100  1.00 136.33 ? 66  LEU C N   1 
ATOM   4541  C CA  . LEU C 1 68  ? -0.424  84.318  31.863  1.00 134.96 ? 66  LEU C CA  1 
ATOM   4542  C C   . LEU C 1 68  ? -0.203  82.935  31.232  1.00 132.11 ? 66  LEU C C   1 
ATOM   4543  O O   . LEU C 1 68  ? 0.416   82.051  31.823  1.00 130.80 ? 66  LEU C O   1 
ATOM   4544  C CB  . LEU C 1 68  ? 0.927   84.985  32.140  1.00 137.85 ? 66  LEU C CB  1 
ATOM   4545  C CG  . LEU C 1 68  ? 1.843   85.381  30.987  1.00 140.28 ? 66  LEU C CG  1 
ATOM   4546  C CD1 . LEU C 1 68  ? 2.984   86.204  31.546  1.00 140.62 ? 66  LEU C CD1 1 
ATOM   4547  C CD2 . LEU C 1 68  ? 2.353   84.147  30.250  1.00 143.46 ? 66  LEU C CD2 1 
ATOM   4548  N N   . PHE C 1 69  ? -0.694  82.753  30.017  1.00 129.11 ? 67  PHE C N   1 
ATOM   4549  C CA  . PHE C 1 69  ? -0.515  81.482  29.345  1.00 128.43 ? 67  PHE C CA  1 
ATOM   4550  C C   . PHE C 1 69  ? 0.938   81.309  28.976  1.00 128.75 ? 67  PHE C C   1 
ATOM   4551  O O   . PHE C 1 69  ? 1.386   81.754  27.923  1.00 127.98 ? 67  PHE C O   1 
ATOM   4552  C CB  . PHE C 1 69  ? -1.386  81.408  28.093  1.00 128.42 ? 67  PHE C CB  1 
ATOM   4553  C CG  . PHE C 1 69  ? -2.863  81.352  28.387  1.00 126.85 ? 67  PHE C CG  1 
ATOM   4554  C CD1 . PHE C 1 69  ? -3.546  82.482  28.834  1.00 124.79 ? 67  PHE C CD1 1 
ATOM   4555  C CD2 . PHE C 1 69  ? -3.560  80.155  28.270  1.00 125.50 ? 67  PHE C CD2 1 
ATOM   4556  C CE1 . PHE C 1 69  ? -4.903  82.420  29.167  1.00 122.77 ? 67  PHE C CE1 1 
ATOM   4557  C CE2 . PHE C 1 69  ? -4.918  80.085  28.604  1.00 123.90 ? 67  PHE C CE2 1 
ATOM   4558  C CZ  . PHE C 1 69  ? -5.585  81.224  29.054  1.00 123.02 ? 67  PHE C CZ  1 
ATOM   4559  N N   . LEU C 1 70  ? 1.681   80.670  29.864  1.00 130.37 ? 68  LEU C N   1 
ATOM   4560  C CA  . LEU C 1 70  ? 3.084   80.444  29.612  1.00 134.56 ? 68  LEU C CA  1 
ATOM   4561  C C   . LEU C 1 70  ? 3.205   79.389  28.533  1.00 139.23 ? 68  LEU C C   1 
ATOM   4562  O O   . LEU C 1 70  ? 3.604   78.254  28.788  1.00 140.12 ? 68  LEU C O   1 
ATOM   4563  C CB  . LEU C 1 70  ? 3.768   79.978  30.882  1.00 132.61 ? 68  LEU C CB  1 
ATOM   4564  C CG  . LEU C 1 70  ? 5.276   79.818  30.734  1.00 133.82 ? 68  LEU C CG  1 
ATOM   4565  C CD1 . LEU C 1 70  ? 5.901   81.058  30.086  1.00 131.78 ? 68  LEU C CD1 1 
ATOM   4566  C CD2 . LEU C 1 70  ? 5.847   79.570  32.110  1.00 134.13 ? 68  LEU C CD2 1 
ATOM   4567  N N   . ALA C 1 71  ? 2.861   79.783  27.315  1.00 145.09 ? 69  ALA C N   1 
ATOM   4568  C CA  . ALA C 1 71  ? 2.887   78.878  26.177  1.00 150.66 ? 69  ALA C CA  1 
ATOM   4569  C C   . ALA C 1 71  ? 4.167   78.910  25.357  1.00 154.11 ? 69  ALA C C   1 
ATOM   4570  O O   . ALA C 1 71  ? 4.240   79.622  24.350  1.00 155.80 ? 69  ALA C O   1 
ATOM   4571  C CB  . ALA C 1 71  ? 1.710   79.177  25.274  1.00 150.16 ? 69  ALA C CB  1 
ATOM   4572  N N   . VAL C 1 72  ? 5.178   78.154  25.773  1.00 156.42 ? 70  VAL C N   1 
ATOM   4573  C CA  . VAL C 1 72  ? 6.414   78.117  25.003  1.00 157.61 ? 70  VAL C CA  1 
ATOM   4574  C C   . VAL C 1 72  ? 6.654   76.673  24.591  1.00 159.62 ? 70  VAL C C   1 
ATOM   4575  O O   . VAL C 1 72  ? 6.122   75.746  25.225  1.00 159.72 ? 70  VAL C O   1 
ATOM   4576  C CB  . VAL C 1 72  ? 7.621   78.622  25.822  1.00 155.73 ? 70  VAL C CB  1 
ATOM   4577  C CG1 . VAL C 1 72  ? 8.770   78.970  24.881  1.00 152.48 ? 70  VAL C CG1 1 
ATOM   4578  C CG2 . VAL C 1 72  ? 7.225   79.827  26.657  1.00 155.65 ? 70  VAL C CG2 1 
ATOM   4579  N N   . LYS C 1 73  ? 7.418   76.486  23.516  1.00 161.35 ? 71  LYS C N   1 
ATOM   4580  C CA  . LYS C 1 73  ? 7.729   75.146  23.050  1.00 163.83 ? 71  LYS C CA  1 
ATOM   4581  C C   . LYS C 1 73  ? 8.476   74.497  24.225  1.00 166.91 ? 71  LYS C C   1 
ATOM   4582  O O   . LYS C 1 73  ? 9.528   74.996  24.632  1.00 169.17 ? 71  LYS C O   1 
ATOM   4583  C CB  . LYS C 1 73  ? 8.619   75.216  21.801  1.00 162.03 ? 71  LYS C CB  1 
ATOM   4584  C CG  . LYS C 1 73  ? 8.103   76.139  20.693  1.00 162.05 ? 71  LYS C CG  1 
ATOM   4585  C CD  . LYS C 1 73  ? 8.454   77.602  20.956  1.00 164.21 ? 71  LYS C CD  1 
ATOM   4586  C CE  . LYS C 1 73  ? 9.969   77.832  20.905  1.00 166.27 ? 71  LYS C CE  1 
ATOM   4587  N NZ  . LYS C 1 73  ? 10.385  79.220  21.280  1.00 167.42 ? 71  LYS C NZ  1 
ATOM   4588  N N   . PRO C 1 74  ? 7.933   73.393  24.794  1.00 168.76 ? 72  PRO C N   1 
ATOM   4589  C CA  . PRO C 1 74  ? 8.487   72.632  25.933  1.00 169.54 ? 72  PRO C CA  1 
ATOM   4590  C C   . PRO C 1 74  ? 10.016  72.635  26.167  1.00 169.86 ? 72  PRO C C   1 
ATOM   4591  O O   . PRO C 1 74  ? 10.477  72.491  27.314  1.00 168.96 ? 72  PRO C O   1 
ATOM   4592  C CB  . PRO C 1 74  ? 7.923   71.233  25.702  1.00 169.23 ? 72  PRO C CB  1 
ATOM   4593  C CG  . PRO C 1 74  ? 6.551   71.544  25.213  1.00 167.91 ? 72  PRO C CG  1 
ATOM   4594  C CD  . PRO C 1 74  ? 6.772   72.681  24.221  1.00 167.98 ? 72  PRO C CD  1 
ATOM   4595  N N   . HIS C 1 75  ? 10.786  72.791  25.086  1.00 170.22 ? 73  HIS C N   1 
ATOM   4596  C CA  . HIS C 1 75  ? 12.243  72.838  25.174  1.00 169.03 ? 73  HIS C CA  1 
ATOM   4597  C C   . HIS C 1 75  ? 12.648  74.176  25.798  1.00 168.76 ? 73  HIS C C   1 
ATOM   4598  O O   . HIS C 1 75  ? 13.825  74.418  26.058  1.00 170.83 ? 73  HIS C O   1 
ATOM   4599  C CB  . HIS C 1 75  ? 12.908  72.606  23.774  1.00 167.61 ? 73  HIS C CB  1 
ATOM   4600  C CG  . HIS C 1 75  ? 12.865  73.780  22.828  1.00 166.10 ? 73  HIS C CG  1 
ATOM   4601  N ND1 . HIS C 1 75  ? 11.698  74.420  22.466  1.00 166.46 ? 73  HIS C ND1 1 
ATOM   4602  C CD2 . HIS C 1 75  ? 13.851  74.385  22.122  1.00 165.67 ? 73  HIS C CD2 1 
ATOM   4603  C CE1 . HIS C 1 75  ? 11.967  75.366  21.584  1.00 164.68 ? 73  HIS C CE1 1 
ATOM   4604  N NE2 . HIS C 1 75  ? 13.267  75.366  21.356  1.00 163.62 ? 73  HIS C NE2 1 
ATOM   4605  N N   . ILE C 1 76  ? 11.661  75.031  26.062  1.00 167.17 ? 74  ILE C N   1 
ATOM   4606  C CA  . ILE C 1 76  ? 11.929  76.329  26.668  1.00 166.18 ? 74  ILE C CA  1 
ATOM   4607  C C   . ILE C 1 76  ? 11.079  76.562  27.932  1.00 165.03 ? 74  ILE C C   1 
ATOM   4608  O O   . ILE C 1 76  ? 11.357  77.485  28.693  1.00 165.59 ? 74  ILE C O   1 
ATOM   4609  C CB  . ILE C 1 76  ? 11.692  77.514  25.644  1.00 166.91 ? 74  ILE C CB  1 
ATOM   4610  C CG1 . ILE C 1 76  ? 12.547  77.328  24.379  1.00 165.80 ? 74  ILE C CG1 1 
ATOM   4611  C CG2 . ILE C 1 76  ? 12.082  78.854  26.276  1.00 167.79 ? 74  ILE C CG2 1 
ATOM   4612  C CD1 . ILE C 1 76  ? 12.506  78.525  23.406  1.00 165.86 ? 74  ILE C CD1 1 
ATOM   4613  N N   . ILE C 1 77  ? 10.053  75.745  28.173  1.00 162.92 ? 75  ILE C N   1 
ATOM   4614  C CA  . ILE C 1 77  ? 9.234   75.962  29.366  1.00 161.23 ? 75  ILE C CA  1 
ATOM   4615  C C   . ILE C 1 77  ? 10.123  76.072  30.592  1.00 163.91 ? 75  ILE C C   1 
ATOM   4616  O O   . ILE C 1 77  ? 9.788   76.778  31.541  1.00 163.76 ? 75  ILE C O   1 
ATOM   4617  C CB  . ILE C 1 77  ? 8.180   74.849  29.565  1.00 157.11 ? 75  ILE C CB  1 
ATOM   4618  C CG1 . ILE C 1 77  ? 7.038   75.064  28.570  1.00 155.01 ? 75  ILE C CG1 1 
ATOM   4619  C CG2 . ILE C 1 77  ? 7.638   74.875  30.989  1.00 154.04 ? 75  ILE C CG2 1 
ATOM   4620  C CD1 . ILE C 1 77  ? 5.898   74.084  28.694  1.00 151.53 ? 75  ILE C CD1 1 
ATOM   4621  N N   . PRO C 1 78  ? 11.264  75.358  30.596  1.00 166.65 ? 76  PRO C N   1 
ATOM   4622  C CA  . PRO C 1 78  ? 12.215  75.394  31.721  1.00 168.94 ? 76  PRO C CA  1 
ATOM   4623  C C   . PRO C 1 78  ? 13.020  76.717  31.861  1.00 170.14 ? 76  PRO C C   1 
ATOM   4624  O O   . PRO C 1 78  ? 12.972  77.366  32.910  1.00 171.36 ? 76  PRO C O   1 
ATOM   4625  C CB  . PRO C 1 78  ? 13.109  74.186  31.445  1.00 168.92 ? 76  PRO C CB  1 
ATOM   4626  C CG  . PRO C 1 78  ? 12.150  73.217  30.819  1.00 168.41 ? 76  PRO C CG  1 
ATOM   4627  C CD  . PRO C 1 78  ? 11.426  74.103  29.833  1.00 166.90 ? 76  PRO C CD  1 
ATOM   4628  N N   . PHE C 1 79  ? 13.749  77.110  30.812  1.00 169.89 ? 77  PHE C N   1 
ATOM   4629  C CA  . PHE C 1 79  ? 14.540  78.355  30.817  1.00 169.03 ? 77  PHE C CA  1 
ATOM   4630  C C   . PHE C 1 79  ? 13.718  79.535  31.385  1.00 167.43 ? 77  PHE C C   1 
ATOM   4631  O O   . PHE C 1 79  ? 14.216  80.345  32.180  1.00 165.87 ? 77  PHE C O   1 
ATOM   4632  C CB  . PHE C 1 79  ? 14.975  78.728  29.379  1.00 170.85 ? 77  PHE C CB  1 
ATOM   4633  C CG  . PHE C 1 79  ? 16.181  77.962  28.844  1.00 171.59 ? 77  PHE C CG  1 
ATOM   4634  C CD1 . PHE C 1 79  ? 16.344  76.590  29.077  1.00 172.13 ? 77  PHE C CD1 1 
ATOM   4635  C CD2 . PHE C 1 79  ? 17.111  78.615  28.015  1.00 170.35 ? 77  PHE C CD2 1 
ATOM   4636  C CE1 . PHE C 1 79  ? 17.421  75.882  28.485  1.00 171.33 ? 77  PHE C CE1 1 
ATOM   4637  C CE2 . PHE C 1 79  ? 18.181  77.918  27.426  1.00 169.21 ? 77  PHE C CE2 1 
ATOM   4638  C CZ  . PHE C 1 79  ? 18.329  76.554  27.659  1.00 169.73 ? 77  PHE C CZ  1 
ATOM   4639  N N   . ILE C 1 80  ? 12.457  79.613  30.956  1.00 165.86 ? 78  ILE C N   1 
ATOM   4640  C CA  . ILE C 1 80  ? 11.523  80.672  31.346  1.00 163.42 ? 78  ILE C CA  1 
ATOM   4641  C C   . ILE C 1 80  ? 10.880  80.518  32.738  1.00 163.03 ? 78  ILE C C   1 
ATOM   4642  O O   . ILE C 1 80  ? 10.452  81.508  33.332  1.00 163.50 ? 78  ILE C O   1 
ATOM   4643  C CB  . ILE C 1 80  ? 10.431  80.839  30.237  1.00 160.81 ? 78  ILE C CB  1 
ATOM   4644  C CG1 . ILE C 1 80  ? 11.058  81.483  28.995  1.00 158.37 ? 78  ILE C CG1 1 
ATOM   4645  C CG2 . ILE C 1 80  ? 9.276   81.686  30.733  1.00 160.83 ? 78  ILE C CG2 1 
ATOM   4646  C CD1 . ILE C 1 80  ? 10.122  81.577  27.820  1.00 158.36 ? 78  ILE C CD1 1 
ATOM   4647  N N   . LEU C 1 81  ? 10.805  79.295  33.262  1.00 161.17 ? 79  LEU C N   1 
ATOM   4648  C CA  . LEU C 1 81  ? 10.249  79.090  34.602  1.00 158.34 ? 79  LEU C CA  1 
ATOM   4649  C C   . LEU C 1 81  ? 11.360  79.336  35.626  1.00 158.45 ? 79  LEU C C   1 
ATOM   4650  O O   . LEU C 1 81  ? 11.098  79.531  36.820  1.00 157.16 ? 79  LEU C O   1 
ATOM   4651  C CB  . LEU C 1 81  ? 9.679   77.676  34.760  1.00 154.68 ? 79  LEU C CB  1 
ATOM   4652  C CG  . LEU C 1 81  ? 8.335   77.418  34.088  1.00 150.79 ? 79  LEU C CG  1 
ATOM   4653  C CD1 . LEU C 1 81  ? 7.865   76.013  34.410  1.00 150.06 ? 79  LEU C CD1 1 
ATOM   4654  C CD2 . LEU C 1 81  ? 7.335   78.442  34.577  1.00 148.63 ? 79  LEU C CD2 1 
ATOM   4655  N N   . ASP C 1 82  ? 12.603  79.308  35.148  1.00 159.32 ? 80  ASP C N   1 
ATOM   4656  C CA  . ASP C 1 82  ? 13.749  79.581  36.004  1.00 160.84 ? 80  ASP C CA  1 
ATOM   4657  C C   . ASP C 1 82  ? 13.760  81.096  36.157  1.00 161.26 ? 80  ASP C C   1 
ATOM   4658  O O   . ASP C 1 82  ? 14.381  81.640  37.073  1.00 161.99 ? 80  ASP C O   1 
ATOM   4659  C CB  . ASP C 1 82  ? 15.063  79.112  35.351  1.00 161.75 ? 80  ASP C CB  1 
ATOM   4660  C CG  . ASP C 1 82  ? 15.313  77.611  35.522  1.00 162.87 ? 80  ASP C CG  1 
ATOM   4661  O OD1 . ASP C 1 82  ? 16.436  77.142  35.230  1.00 162.62 ? 80  ASP C OD1 1 
ATOM   4662  O OD2 . ASP C 1 82  ? 14.389  76.894  35.949  1.00 164.21 ? 80  ASP C OD2 1 
ATOM   4663  N N   . GLU C 1 83  ? 13.052  81.765  35.247  1.00 160.80 ? 81  GLU C N   1 
ATOM   4664  C CA  . GLU C 1 83  ? 12.947  83.220  35.234  1.00 160.47 ? 81  GLU C CA  1 
ATOM   4665  C C   . GLU C 1 83  ? 11.731  83.749  36.027  1.00 160.69 ? 81  GLU C C   1 
ATOM   4666  O O   . GLU C 1 83  ? 11.804  84.808  36.661  1.00 160.34 ? 81  GLU C O   1 
ATOM   4667  C CB  . GLU C 1 83  ? 12.885  83.696  33.779  1.00 158.70 ? 81  GLU C CB  1 
ATOM   4668  C CG  . GLU C 1 83  ? 13.012  85.194  33.596  1.00 159.61 ? 81  GLU C CG  1 
ATOM   4669  C CD  . GLU C 1 83  ? 12.953  85.608  32.136  1.00 159.76 ? 81  GLU C CD  1 
ATOM   4670  O OE1 . GLU C 1 83  ? 13.035  86.822  31.854  1.00 159.84 ? 81  GLU C OE1 1 
ATOM   4671  O OE2 . GLU C 1 83  ? 12.826  84.719  31.267  1.00 160.49 ? 81  GLU C OE2 1 
ATOM   4672  N N   . ILE C 1 84  ? 10.626  83.000  35.999  1.00 161.16 ? 82  ILE C N   1 
ATOM   4673  C CA  . ILE C 1 84  ? 9.392   83.391  36.693  1.00 160.99 ? 82  ILE C CA  1 
ATOM   4674  C C   . ILE C 1 84  ? 9.309   82.928  38.144  1.00 162.32 ? 82  ILE C C   1 
ATOM   4675  O O   . ILE C 1 84  ? 8.606   83.540  38.945  1.00 162.19 ? 82  ILE C O   1 
ATOM   4676  C CB  . ILE C 1 84  ? 8.134   82.828  36.008  1.00 159.72 ? 82  ILE C CB  1 
ATOM   4677  C CG1 . ILE C 1 84  ? 8.181   83.079  34.504  1.00 158.82 ? 82  ILE C CG1 1 
ATOM   4678  C CG2 . ILE C 1 84  ? 6.899   83.478  36.609  1.00 157.75 ? 82  ILE C CG2 1 
ATOM   4679  C CD1 . ILE C 1 84  ? 7.073   82.388  33.761  1.00 158.35 ? 82  ILE C CD1 1 
ATOM   4680  N N   . GLY C 1 85  ? 10.002  81.837  38.463  1.00 163.95 ? 83  GLY C N   1 
ATOM   4681  C CA  . GLY C 1 85  ? 9.991   81.286  39.813  1.00 165.53 ? 83  GLY C CA  1 
ATOM   4682  C C   . GLY C 1 85  ? 10.034  82.274  40.969  1.00 166.53 ? 83  GLY C C   1 
ATOM   4683  O O   . GLY C 1 85  ? 9.069   82.362  41.740  1.00 165.25 ? 83  GLY C O   1 
ATOM   4684  N N   . ALA C 1 86  ? 11.152  82.997  41.100  1.00 168.01 ? 84  ALA C N   1 
ATOM   4685  C CA  . ALA C 1 86  ? 11.334  84.001  42.159  1.00 168.07 ? 84  ALA C CA  1 
ATOM   4686  C C   . ALA C 1 86  ? 10.454  85.233  41.874  1.00 168.18 ? 84  ALA C C   1 
ATOM   4687  O O   . ALA C 1 86  ? 10.373  86.152  42.701  1.00 168.97 ? 84  ALA C O   1 
ATOM   4688  C CB  . ALA C 1 86  ? 12.834  84.416  42.262  1.00 164.94 ? 84  ALA C CB  1 
ATOM   4689  N N   . ASP C 1 87  ? 9.788   85.218  40.710  1.00 167.26 ? 85  ASP C N   1 
ATOM   4690  C CA  . ASP C 1 87  ? 8.907   86.303  40.251  1.00 164.22 ? 85  ASP C CA  1 
ATOM   4691  C C   . ASP C 1 87  ? 7.408   85.904  40.336  1.00 160.74 ? 85  ASP C C   1 
ATOM   4692  O O   . ASP C 1 87  ? 6.502   86.682  40.026  1.00 158.69 ? 85  ASP C O   1 
ATOM   4693  C CB  . ASP C 1 87  ? 9.292   86.704  38.810  1.00 166.17 ? 85  ASP C CB  1 
ATOM   4694  C CG  . ASP C 1 87  ? 10.787  87.090  38.663  1.00 167.81 ? 85  ASP C CG  1 
ATOM   4695  O OD1 . ASP C 1 87  ? 11.202  87.528  37.567  1.00 168.78 ? 85  ASP C OD1 1 
ATOM   4696  O OD2 . ASP C 1 87  ? 11.560  86.954  39.636  1.00 170.04 ? 85  ASP C OD2 1 
ATOM   4697  N N   . ILE C 1 88  ? 7.170   84.676  40.772  1.00 157.60 ? 86  ILE C N   1 
ATOM   4698  C CA  . ILE C 1 88  ? 5.828   84.143  40.948  1.00 154.28 ? 86  ILE C CA  1 
ATOM   4699  C C   . ILE C 1 88  ? 5.231   84.862  42.154  1.00 152.47 ? 86  ILE C C   1 
ATOM   4700  O O   . ILE C 1 88  ? 5.923   85.090  43.143  1.00 152.74 ? 86  ILE C O   1 
ATOM   4701  C CB  . ILE C 1 88  ? 5.895   82.616  41.244  1.00 154.00 ? 86  ILE C CB  1 
ATOM   4702  C CG1 . ILE C 1 88  ? 6.620   81.892  40.109  1.00 153.17 ? 86  ILE C CG1 1 
ATOM   4703  C CG2 . ILE C 1 88  ? 4.500   82.039  41.406  1.00 153.99 ? 86  ILE C CG2 1 
ATOM   4704  C CD1 . ILE C 1 88  ? 6.889   80.441  40.397  1.00 152.70 ? 86  ILE C CD1 1 
ATOM   4705  N N   . GLU C 1 89  ? 3.962   85.238  42.087  1.00 149.45 ? 87  GLU C N   1 
ATOM   4706  C CA  . GLU C 1 89  ? 3.371   85.910  43.233  1.00 147.30 ? 87  GLU C CA  1 
ATOM   4707  C C   . GLU C 1 89  ? 2.176   85.186  43.835  1.00 145.71 ? 87  GLU C C   1 
ATOM   4708  O O   . GLU C 1 89  ? 2.234   83.981  44.050  1.00 145.07 ? 87  GLU C O   1 
ATOM   4709  C CB  . GLU C 1 89  ? 3.018   87.342  42.867  1.00 147.10 ? 87  GLU C CB  1 
ATOM   4710  C CG  . GLU C 1 89  ? 4.246   88.214  42.788  1.00 147.92 ? 87  GLU C CG  1 
ATOM   4711  C CD  . GLU C 1 89  ? 3.911   89.663  42.978  1.00 149.92 ? 87  GLU C CD  1 
ATOM   4712  O OE1 . GLU C 1 89  ? 4.846   90.475  43.151  1.00 150.84 ? 87  GLU C OE1 1 
ATOM   4713  O OE2 . GLU C 1 89  ? 2.702   89.984  42.955  1.00 151.05 ? 87  GLU C OE2 1 
ATOM   4714  N N   . ASP C 1 90  ? 1.098   85.913  44.117  1.00 144.91 ? 88  ASP C N   1 
ATOM   4715  C CA  . ASP C 1 90  ? -0.089  85.302  44.714  1.00 144.69 ? 88  ASP C CA  1 
ATOM   4716  C C   . ASP C 1 90  ? -1.387  85.453  43.940  1.00 145.42 ? 88  ASP C C   1 
ATOM   4717  O O   . ASP C 1 90  ? -2.289  84.616  44.059  1.00 145.87 ? 88  ASP C O   1 
ATOM   4718  C CB  . ASP C 1 90  ? -0.320  85.862  46.114  1.00 143.08 ? 88  ASP C CB  1 
ATOM   4719  C CG  . ASP C 1 90  ? 0.750   85.443  47.089  1.00 141.77 ? 88  ASP C CG  1 
ATOM   4720  O OD1 . ASP C 1 90  ? 0.634   85.815  48.272  1.00 140.41 ? 88  ASP C OD1 1 
ATOM   4721  O OD2 . ASP C 1 90  ? 1.704   84.744  46.681  1.00 140.68 ? 88  ASP C OD2 1 
ATOM   4722  N N   . ARG C 1 91  ? -1.482  86.523  43.157  1.00 146.47 ? 89  ARG C N   1 
ATOM   4723  C CA  . ARG C 1 91  ? -2.689  86.828  42.385  1.00 147.09 ? 89  ARG C CA  1 
ATOM   4724  C C   . ARG C 1 91  ? -2.945  86.021  41.111  1.00 148.35 ? 89  ARG C C   1 
ATOM   4725  O O   . ARG C 1 91  ? -4.107  85.702  40.806  1.00 146.94 ? 89  ARG C O   1 
ATOM   4726  C CB  . ARG C 1 91  ? -2.724  88.337  42.063  1.00 145.20 ? 89  ARG C CB  1 
ATOM   4727  C CG  . ARG C 1 91  ? -1.438  88.927  41.471  1.00 141.22 ? 89  ARG C CG  1 
ATOM   4728  C CD  . ARG C 1 91  ? -1.296  88.578  40.007  1.00 139.41 ? 89  ARG C CD  1 
ATOM   4729  N NE  . ARG C 1 91  ? 0.007   88.946  39.466  1.00 137.84 ? 89  ARG C NE  1 
ATOM   4730  C CZ  . ARG C 1 91  ? 0.244   90.039  38.757  1.00 137.70 ? 89  ARG C CZ  1 
ATOM   4731  N NH1 . ARG C 1 91  ? -0.737  90.889  38.495  1.00 137.03 ? 89  ARG C NH1 1 
ATOM   4732  N NH2 . ARG C 1 91  ? 1.464   90.271  38.296  1.00 138.17 ? 89  ARG C NH2 1 
ATOM   4733  N N   . HIS C 1 92  ? -1.876  85.693  40.377  1.00 150.29 ? 90  HIS C N   1 
ATOM   4734  C CA  . HIS C 1 92  ? -2.017  84.938  39.125  1.00 150.22 ? 90  HIS C CA  1 
ATOM   4735  C C   . HIS C 1 92  ? -1.967  83.393  39.206  1.00 150.06 ? 90  HIS C C   1 
ATOM   4736  O O   . HIS C 1 92  ? -1.399  82.819  40.148  1.00 150.49 ? 90  HIS C O   1 
ATOM   4737  C CB  . HIS C 1 92  ? -1.035  85.449  38.009  1.00 147.87 ? 90  HIS C CB  1 
ATOM   4738  C CG  . HIS C 1 92  ? 0.325   85.909  38.477  1.00 144.78 ? 90  HIS C CG  1 
ATOM   4739  N ND1 . HIS C 1 92  ? 1.101   85.207  39.380  1.00 143.57 ? 90  HIS C ND1 1 
ATOM   4740  C CD2 . HIS C 1 92  ? 1.091   86.953  38.068  1.00 141.76 ? 90  HIS C CD2 1 
ATOM   4741  C CE1 . HIS C 1 92  ? 2.278   85.798  39.506  1.00 141.11 ? 90  HIS C CE1 1 
ATOM   4742  N NE2 . HIS C 1 92  ? 2.298   86.860  38.721  1.00 139.69 ? 90  HIS C NE2 1 
ATOM   4743  N N   . ILE C 1 93  ? -2.615  82.753  38.219  1.00 148.41 ? 91  ILE C N   1 
ATOM   4744  C CA  . ILE C 1 93  ? -2.699  81.290  38.059  1.00 144.80 ? 91  ILE C CA  1 
ATOM   4745  C C   . ILE C 1 93  ? -2.089  80.967  36.670  1.00 143.43 ? 91  ILE C C   1 
ATOM   4746  O O   . ILE C 1 93  ? -2.604  81.443  35.656  1.00 142.07 ? 91  ILE C O   1 
ATOM   4747  C CB  . ILE C 1 93  ? -4.209  80.780  38.111  1.00 142.39 ? 91  ILE C CB  1 
ATOM   4748  C CG1 . ILE C 1 93  ? -4.906  81.219  39.404  1.00 139.29 ? 91  ILE C CG1 1 
ATOM   4749  C CG2 . ILE C 1 93  ? -4.259  79.258  38.073  1.00 142.27 ? 91  ILE C CG2 1 
ATOM   4750  C CD1 . ILE C 1 93  ? -6.380  80.827  39.485  1.00 132.89 ? 91  ILE C CD1 1 
ATOM   4751  N N   . VAL C 1 94  ? -0.999  80.181  36.635  1.00 143.12 ? 92  VAL C N   1 
ATOM   4752  C CA  . VAL C 1 94  ? -0.298  79.804  35.379  1.00 143.74 ? 92  VAL C CA  1 
ATOM   4753  C C   . VAL C 1 94  ? -0.987  78.742  34.492  1.00 143.26 ? 92  VAL C C   1 
ATOM   4754  O O   . VAL C 1 94  ? -0.856  77.535  34.727  1.00 144.66 ? 92  VAL C O   1 
ATOM   4755  C CB  . VAL C 1 94  ? 1.166   79.276  35.634  1.00 143.43 ? 92  VAL C CB  1 
ATOM   4756  C CG1 . VAL C 1 94  ? 1.877   79.022  34.290  1.00 141.78 ? 92  VAL C CG1 1 
ATOM   4757  C CG2 . VAL C 1 94  ? 1.956   80.262  36.457  1.00 143.97 ? 92  VAL C CG2 1 
ATOM   4758  N N   . VAL C 1 95  ? -1.701  79.194  33.463  1.00 139.01 ? 93  VAL C N   1 
ATOM   4759  C CA  . VAL C 1 95  ? -2.369  78.288  32.554  1.00 131.96 ? 93  VAL C CA  1 
ATOM   4760  C C   . VAL C 1 95  ? -1.335  77.958  31.495  1.00 131.97 ? 93  VAL C C   1 
ATOM   4761  O O   . VAL C 1 95  ? -1.428  78.410  30.362  1.00 131.04 ? 93  VAL C O   1 
ATOM   4762  C CB  . VAL C 1 95  ? -3.581  78.972  31.916  1.00 128.76 ? 93  VAL C CB  1 
ATOM   4763  C CG1 . VAL C 1 95  ? -4.673  79.144  32.934  1.00 125.42 ? 93  VAL C CG1 1 
ATOM   4764  C CG2 . VAL C 1 95  ? -3.181  80.341  31.419  1.00 128.16 ? 93  VAL C CG2 1 
ATOM   4765  N N   . SER C 1 96  ? -0.315  77.203  31.884  1.00 132.96 ? 94  SER C N   1 
ATOM   4766  C CA  . SER C 1 96  ? 0.711   76.816  30.934  1.00 134.95 ? 94  SER C CA  1 
ATOM   4767  C C   . SER C 1 96  ? 0.132   75.755  30.042  1.00 134.59 ? 94  SER C C   1 
ATOM   4768  O O   . SER C 1 96  ? -0.234  74.661  30.484  1.00 131.43 ? 94  SER C O   1 
ATOM   4769  C CB  . SER C 1 96  ? 1.956   76.248  31.612  1.00 136.88 ? 94  SER C CB  1 
ATOM   4770  O OG  . SER C 1 96  ? 2.869   75.782  30.623  1.00 138.41 ? 94  SER C OG  1 
ATOM   4771  N N   . CYS C 1 97  ? 0.061   76.089  28.771  1.00 135.45 ? 95  CYS C N   1 
ATOM   4772  C CA  . CYS C 1 97  ? -0.477  75.177  27.818  1.00 136.87 ? 95  CYS C CA  1 
ATOM   4773  C C   . CYS C 1 97  ? 0.612   74.944  26.783  1.00 138.04 ? 95  CYS C C   1 
ATOM   4774  O O   . CYS C 1 97  ? 1.136   75.871  26.177  1.00 137.75 ? 95  CYS C O   1 
ATOM   4775  C CB  . CYS C 1 97  ? -1.755  75.789  27.251  1.00 137.96 ? 95  CYS C CB  1 
ATOM   4776  S SG  . CYS C 1 97  ? -2.817  76.521  28.562  1.00 139.81 ? 95  CYS C SG  1 
ATOM   4777  N N   . ALA C 1 98  ? 0.982   73.683  26.635  1.00 139.56 ? 96  ALA C N   1 
ATOM   4778  C CA  . ALA C 1 98  ? 2.017   73.280  25.702  1.00 140.85 ? 96  ALA C CA  1 
ATOM   4779  C C   . ALA C 1 98  ? 1.985   71.753  25.674  1.00 142.48 ? 96  ALA C C   1 
ATOM   4780  O O   . ALA C 1 98  ? 1.558   71.120  26.648  1.00 143.49 ? 96  ALA C O   1 
ATOM   4781  C CB  . ALA C 1 98  ? 3.386   73.797  26.185  1.00 138.34 ? 96  ALA C CB  1 
ATOM   4782  N N   . ALA C 1 99  ? 2.420   71.167  24.559  1.00 143.06 ? 97  ALA C N   1 
ATOM   4783  C CA  . ALA C 1 99  ? 2.431   69.711  24.407  1.00 141.48 ? 97  ALA C CA  1 
ATOM   4784  C C   . ALA C 1 99  ? 3.739   69.084  24.929  1.00 140.27 ? 97  ALA C C   1 
ATOM   4785  O O   . ALA C 1 99  ? 4.833   69.476  24.513  1.00 140.36 ? 97  ALA C O   1 
ATOM   4786  C CB  . ALA C 1 99  ? 2.209   69.337  22.921  1.00 142.31 ? 97  ALA C CB  1 
ATOM   4787  N N   . GLY C 1 100 ? 3.620   68.122  25.847  1.00 137.82 ? 98  GLY C N   1 
ATOM   4788  C CA  . GLY C 1 100 ? 4.795   67.457  26.399  1.00 133.88 ? 98  GLY C CA  1 
ATOM   4789  C C   . GLY C 1 100 ? 5.396   68.089  27.646  1.00 131.08 ? 98  GLY C C   1 
ATOM   4790  O O   . GLY C 1 100 ? 6.614   68.209  27.761  1.00 132.92 ? 98  GLY C O   1 
ATOM   4791  N N   . VAL C 1 101 ? 4.549   68.500  28.585  1.00 126.01 ? 99  VAL C N   1 
ATOM   4792  C CA  . VAL C 1 101 ? 5.025   69.112  29.816  1.00 119.72 ? 99  VAL C CA  1 
ATOM   4793  C C   . VAL C 1 101 ? 4.039   68.830  30.919  1.00 116.79 ? 99  VAL C C   1 
ATOM   4794  O O   . VAL C 1 101 ? 2.946   69.368  30.927  1.00 114.46 ? 99  VAL C O   1 
ATOM   4795  C CB  . VAL C 1 101 ? 5.152   70.626  29.694  1.00 119.84 ? 99  VAL C CB  1 
ATOM   4796  C CG1 . VAL C 1 101 ? 5.929   71.147  30.867  1.00 119.69 ? 99  VAL C CG1 1 
ATOM   4797  C CG2 . VAL C 1 101 ? 5.833   71.006  28.391  1.00 118.94 ? 99  VAL C CG2 1 
ATOM   4798  N N   . THR C 1 102 ? 4.432   67.988  31.859  1.00 117.62 ? 100 THR C N   1 
ATOM   4799  C CA  . THR C 1 102 ? 3.559   67.618  32.967  1.00 119.04 ? 100 THR C CA  1 
ATOM   4800  C C   . THR C 1 102 ? 3.170   68.796  33.849  1.00 118.31 ? 100 THR C C   1 
ATOM   4801  O O   . THR C 1 102 ? 3.791   69.856  33.782  1.00 120.05 ? 100 THR C O   1 
ATOM   4802  C CB  . THR C 1 102 ? 4.225   66.568  33.851  1.00 120.52 ? 100 THR C CB  1 
ATOM   4803  O OG1 . THR C 1 102 ? 4.753   65.518  33.029  1.00 120.96 ? 100 THR C OG1 1 
ATOM   4804  C CG2 . THR C 1 102 ? 3.206   65.979  34.821  1.00 120.21 ? 100 THR C CG2 1 
ATOM   4805  N N   . ILE C 1 103 ? 2.138   68.597  34.671  1.00 116.25 ? 101 ILE C N   1 
ATOM   4806  C CA  . ILE C 1 103 ? 1.651   69.632  35.576  1.00 114.54 ? 101 ILE C CA  1 
ATOM   4807  C C   . ILE C 1 103 ? 2.611   69.791  36.739  1.00 119.33 ? 101 ILE C C   1 
ATOM   4808  O O   . ILE C 1 103 ? 2.793   70.887  37.266  1.00 118.78 ? 101 ILE C O   1 
ATOM   4809  C CB  . ILE C 1 103 ? 0.254   69.285  36.142  1.00 108.76 ? 101 ILE C CB  1 
ATOM   4810  C CG1 . ILE C 1 103 ? -0.193  70.375  37.109  1.00 102.76 ? 101 ILE C CG1 1 
ATOM   4811  C CG2 . ILE C 1 103 ? 0.281   67.935  36.859  1.00 105.69 ? 101 ILE C CG2 1 
ATOM   4812  C CD1 . ILE C 1 103 ? -1.608  70.235  37.539  1.00 97.78  ? 101 ILE C CD1 1 
ATOM   4813  N N   . SER C 1 104 ? 3.216   68.677  37.140  1.00 125.52 ? 102 SER C N   1 
ATOM   4814  C CA  . SER C 1 104 ? 4.188   68.654  38.243  1.00 129.53 ? 102 SER C CA  1 
ATOM   4815  C C   . SER C 1 104 ? 5.601   68.888  37.685  1.00 131.90 ? 102 SER C C   1 
ATOM   4816  O O   . SER C 1 104 ? 6.550   69.124  38.442  1.00 130.89 ? 102 SER C O   1 
ATOM   4817  C CB  . SER C 1 104 ? 4.107   67.314  39.000  1.00 130.14 ? 102 SER C CB  1 
ATOM   4818  O OG  . SER C 1 104 ? 2.772   67.047  39.429  1.00 128.75 ? 102 SER C OG  1 
ATOM   4819  N N   . SER C 1 105 ? 5.723   68.824  36.356  1.00 135.02 ? 103 SER C N   1 
ATOM   4820  C CA  . SER C 1 105 ? 6.988   69.084  35.674  1.00 138.05 ? 103 SER C CA  1 
ATOM   4821  C C   . SER C 1 105 ? 7.233   70.571  36.007  1.00 140.50 ? 103 SER C C   1 
ATOM   4822  O O   . SER C 1 105 ? 8.383   71.023  36.106  1.00 142.80 ? 103 SER C O   1 
ATOM   4823  C CB  . SER C 1 105 ? 6.819   68.865  34.154  1.00 137.22 ? 103 SER C CB  1 
ATOM   4824  O OG  . SER C 1 105 ? 8.050   68.806  33.444  1.00 136.35 ? 103 SER C OG  1 
ATOM   4825  N N   . ILE C 1 106 ? 6.119   71.295  36.207  1.00 141.11 ? 104 ILE C N   1 
ATOM   4826  C CA  . ILE C 1 106 ? 6.084   72.730  36.557  1.00 138.80 ? 104 ILE C CA  1 
ATOM   4827  C C   . ILE C 1 106 ? 5.965   72.989  38.072  1.00 137.96 ? 104 ILE C C   1 
ATOM   4828  O O   . ILE C 1 106 ? 6.751   73.754  38.627  1.00 139.30 ? 104 ILE C O   1 
ATOM   4829  C CB  . ILE C 1 106 ? 4.893   73.473  35.844  1.00 136.73 ? 104 ILE C CB  1 
ATOM   4830  C CG1 . ILE C 1 106 ? 5.247   73.777  34.388  1.00 134.99 ? 104 ILE C CG1 1 
ATOM   4831  C CG2 . ILE C 1 106 ? 4.582   74.789  36.552  1.00 133.89 ? 104 ILE C CG2 1 
ATOM   4832  C CD1 . ILE C 1 106 ? 5.677   72.579  33.593  1.00 134.74 ? 104 ILE C CD1 1 
ATOM   4833  N N   . GLU C 1 107 ? 4.991   72.360  38.732  1.00 135.40 ? 105 GLU C N   1 
ATOM   4834  C CA  . GLU C 1 107 ? 4.783   72.543  40.173  1.00 133.12 ? 105 GLU C CA  1 
ATOM   4835  C C   . GLU C 1 107 ? 5.998   72.132  40.979  1.00 135.59 ? 105 GLU C C   1 
ATOM   4836  O O   . GLU C 1 107 ? 6.310   72.726  42.014  1.00 135.77 ? 105 GLU C O   1 
ATOM   4837  C CB  . GLU C 1 107 ? 3.611   71.710  40.655  1.00 127.54 ? 105 GLU C CB  1 
ATOM   4838  C CG  . GLU C 1 107 ? 2.363   71.866  39.868  1.00 120.81 ? 105 GLU C CG  1 
ATOM   4839  C CD  . GLU C 1 107 ? 1.184   71.211  40.530  1.00 118.07 ? 105 GLU C CD  1 
ATOM   4840  O OE1 . GLU C 1 107 ? 0.088   71.250  39.935  1.00 117.35 ? 105 GLU C OE1 1 
ATOM   4841  O OE2 . GLU C 1 107 ? 1.352   70.672  41.642  1.00 114.40 ? 105 GLU C OE2 1 
ATOM   4842  N N   . LYS C 1 108 ? 6.667   71.092  40.507  1.00 138.34 ? 106 LYS C N   1 
ATOM   4843  C CA  . LYS C 1 108 ? 7.852   70.607  41.174  1.00 140.76 ? 106 LYS C CA  1 
ATOM   4844  C C   . LYS C 1 108 ? 9.045   71.347  40.574  1.00 140.96 ? 106 LYS C C   1 
ATOM   4845  O O   . LYS C 1 108 ? 10.034  70.744  40.165  1.00 140.58 ? 106 LYS C O   1 
ATOM   4846  C CB  . LYS C 1 108 ? 7.962   69.099  40.972  1.00 143.75 ? 106 LYS C CB  1 
ATOM   4847  C CG  . LYS C 1 108 ? 6.665   68.356  41.336  1.00 145.99 ? 106 LYS C CG  1 
ATOM   4848  C CD  . LYS C 1 108 ? 6.891   66.868  41.562  1.00 149.72 ? 106 LYS C CD  1 
ATOM   4849  C CE  . LYS C 1 108 ? 7.803   66.620  42.766  1.00 153.33 ? 106 LYS C CE  1 
ATOM   4850  N NZ  . LYS C 1 108 ? 8.084   65.168  43.009  1.00 153.99 ? 106 LYS C NZ  1 
ATOM   4851  N N   . LYS C 1 109 ? 8.933   72.673  40.533  1.00 141.81 ? 107 LYS C N   1 
ATOM   4852  C CA  . LYS C 1 109 ? 9.979   73.524  39.976  1.00 143.07 ? 107 LYS C CA  1 
ATOM   4853  C C   . LYS C 1 109 ? 9.730   75.012  40.267  1.00 143.06 ? 107 LYS C C   1 
ATOM   4854  O O   . LYS C 1 109 ? 10.677  75.771  40.483  1.00 143.20 ? 107 LYS C O   1 
ATOM   4855  C CB  . LYS C 1 109 ? 10.064  73.286  38.474  1.00 144.06 ? 107 LYS C CB  1 
ATOM   4856  C CG  . LYS C 1 109 ? 11.264  73.887  37.807  1.00 147.35 ? 107 LYS C CG  1 
ATOM   4857  C CD  . LYS C 1 109 ? 11.163  73.676  36.306  1.00 152.22 ? 107 LYS C CD  1 
ATOM   4858  C CE  . LYS C 1 109 ? 12.406  74.160  35.569  1.00 156.29 ? 107 LYS C CE  1 
ATOM   4859  N NZ  . LYS C 1 109 ? 13.603  73.335  35.913  1.00 161.40 ? 107 LYS C NZ  1 
ATOM   4860  N N   . LEU C 1 110 ? 8.460   75.425  40.254  1.00 143.53 ? 108 LEU C N   1 
ATOM   4861  C CA  . LEU C 1 110 ? 8.072   76.815  40.553  1.00 142.88 ? 108 LEU C CA  1 
ATOM   4862  C C   . LEU C 1 110 ? 7.558   76.900  41.988  1.00 144.29 ? 108 LEU C C   1 
ATOM   4863  O O   . LEU C 1 110 ? 7.505   77.985  42.574  1.00 143.76 ? 108 LEU C O   1 
ATOM   4864  C CB  . LEU C 1 110 ? 6.957   77.312  39.620  1.00 139.37 ? 108 LEU C CB  1 
ATOM   4865  C CG  . LEU C 1 110 ? 7.245   77.774  38.196  1.00 134.92 ? 108 LEU C CG  1 
ATOM   4866  C CD1 . LEU C 1 110 ? 6.003   78.445  37.655  1.00 131.93 ? 108 LEU C CD1 1 
ATOM   4867  C CD2 . LEU C 1 110 ? 8.406   78.742  38.190  1.00 133.51 ? 108 LEU C CD2 1 
ATOM   4868  N N   . SER C 1 111 ? 7.145   75.757  42.536  1.00 146.39 ? 109 SER C N   1 
ATOM   4869  C CA  . SER C 1 111 ? 6.661   75.704  43.911  1.00 147.79 ? 109 SER C CA  1 
ATOM   4870  C C   . SER C 1 111 ? 7.888   75.835  44.809  1.00 150.63 ? 109 SER C C   1 
ATOM   4871  O O   . SER C 1 111 ? 7.781   76.201  45.984  1.00 150.49 ? 109 SER C O   1 
ATOM   4872  C CB  . SER C 1 111 ? 5.946   74.376  44.190  1.00 144.84 ? 109 SER C CB  1 
ATOM   4873  O OG  . SER C 1 111 ? 4.693   74.294  43.528  1.00 139.62 ? 109 SER C OG  1 
ATOM   4874  N N   . ALA C 1 112 ? 9.052   75.534  44.227  1.00 153.17 ? 110 ALA C N   1 
ATOM   4875  C CA  . ALA C 1 112 ? 10.332  75.609  44.930  1.00 155.71 ? 110 ALA C CA  1 
ATOM   4876  C C   . ALA C 1 112 ? 10.635  77.056  45.335  1.00 157.04 ? 110 ALA C C   1 
ATOM   4877  O O   . ALA C 1 112 ? 11.321  77.307  46.335  1.00 157.46 ? 110 ALA C O   1 
ATOM   4878  C CB  . ALA C 1 112 ? 11.450  75.062  44.037  1.00 155.09 ? 110 ALA C CB  1 
ATOM   4879  N N   . PHE C 1 113 ? 10.112  77.994  44.546  1.00 157.75 ? 111 PHE C N   1 
ATOM   4880  C CA  . PHE C 1 113 ? 10.289  79.432  44.773  1.00 156.63 ? 111 PHE C CA  1 
ATOM   4881  C C   . PHE C 1 113 ? 9.171   80.018  45.659  1.00 155.07 ? 111 PHE C C   1 
ATOM   4882  O O   . PHE C 1 113 ? 9.329   80.139  46.880  1.00 155.32 ? 111 PHE C O   1 
ATOM   4883  C CB  . PHE C 1 113 ? 10.329  80.175  43.421  1.00 156.91 ? 111 PHE C CB  1 
ATOM   4884  C CG  . PHE C 1 113 ? 11.439  79.719  42.496  1.00 157.22 ? 111 PHE C CG  1 
ATOM   4885  C CD1 . PHE C 1 113 ? 11.430  78.441  41.940  1.00 158.26 ? 111 PHE C CD1 1 
ATOM   4886  C CD2 . PHE C 1 113 ? 12.490  80.578  42.176  1.00 156.76 ? 111 PHE C CD2 1 
ATOM   4887  C CE1 . PHE C 1 113 ? 12.450  78.031  41.081  1.00 158.19 ? 111 PHE C CE1 1 
ATOM   4888  C CE2 . PHE C 1 113 ? 13.515  80.178  41.318  1.00 156.68 ? 111 PHE C CE2 1 
ATOM   4889  C CZ  . PHE C 1 113 ? 13.495  78.903  40.769  1.00 157.79 ? 111 PHE C CZ  1 
ATOM   4890  N N   . ARG C 1 114 ? 8.050   80.373  45.031  1.00 152.83 ? 112 ARG C N   1 
ATOM   4891  C CA  . ARG C 1 114 ? 6.885   80.954  45.709  1.00 149.49 ? 112 ARG C CA  1 
ATOM   4892  C C   . ARG C 1 114 ? 6.135   79.879  46.513  1.00 148.12 ? 112 ARG C C   1 
ATOM   4893  O O   . ARG C 1 114 ? 6.336   78.681  46.293  1.00 146.97 ? 112 ARG C O   1 
ATOM   4894  C CB  . ARG C 1 114 ? 5.959   81.578  44.649  1.00 148.37 ? 112 ARG C CB  1 
ATOM   4895  C CG  . ARG C 1 114 ? 5.194   82.811  45.098  1.00 144.17 ? 112 ARG C CG  1 
ATOM   4896  C CD  . ARG C 1 114 ? 6.145   83.846  45.668  1.00 141.37 ? 112 ARG C CD  1 
ATOM   4897  N NE  . ARG C 1 114 ? 5.470   85.092  46.001  1.00 140.90 ? 112 ARG C NE  1 
ATOM   4898  C CZ  . ARG C 1 114 ? 4.462   85.199  46.858  1.00 140.25 ? 112 ARG C CZ  1 
ATOM   4899  N NH1 . ARG C 1 114 ? 3.996   84.130  47.484  1.00 139.75 ? 112 ARG C NH1 1 
ATOM   4900  N NH2 . ARG C 1 114 ? 3.919   86.386  47.088  1.00 139.63 ? 112 ARG C NH2 1 
ATOM   4901  N N   . PRO C 1 115 ? 5.268   80.293  47.462  1.00 147.06 ? 113 PRO C N   1 
ATOM   4902  C CA  . PRO C 1 115 ? 4.502   79.349  48.283  1.00 146.06 ? 113 PRO C CA  1 
ATOM   4903  C C   . PRO C 1 115 ? 3.885   78.197  47.487  1.00 145.62 ? 113 PRO C C   1 
ATOM   4904  O O   . PRO C 1 115 ? 4.544   77.195  47.202  1.00 146.10 ? 113 PRO C O   1 
ATOM   4905  C CB  . PRO C 1 115 ? 3.442   80.244  48.925  1.00 145.36 ? 113 PRO C CB  1 
ATOM   4906  C CG  . PRO C 1 115 ? 4.199   81.489  49.175  1.00 145.37 ? 113 PRO C CG  1 
ATOM   4907  C CD  . PRO C 1 115 ? 5.003   81.677  47.896  1.00 146.32 ? 113 PRO C CD  1 
ATOM   4908  N N   . ALA C 1 116 ? 2.613   78.344  47.135  1.00 144.55 ? 114 ALA C N   1 
ATOM   4909  C CA  . ALA C 1 116 ? 1.917   77.320  46.370  1.00 142.81 ? 114 ALA C CA  1 
ATOM   4910  C C   . ALA C 1 116 ? 1.535   77.875  45.005  1.00 141.46 ? 114 ALA C C   1 
ATOM   4911  O O   . ALA C 1 116 ? 0.441   78.412  44.836  1.00 141.54 ? 114 ALA C O   1 
ATOM   4912  C CB  . ALA C 1 116 ? 0.668   76.862  47.128  1.00 142.46 ? 114 ALA C CB  1 
ATOM   4913  N N   . PRO C 1 117 ? 2.439   77.759  44.015  1.00 139.80 ? 115 PRO C N   1 
ATOM   4914  C CA  . PRO C 1 117 ? 2.138   78.271  42.679  1.00 140.93 ? 115 PRO C CA  1 
ATOM   4915  C C   . PRO C 1 117 ? 0.986   77.471  42.075  1.00 144.73 ? 115 PRO C C   1 
ATOM   4916  O O   . PRO C 1 117 ? 1.085   76.252  41.955  1.00 145.72 ? 115 PRO C O   1 
ATOM   4917  C CB  . PRO C 1 117 ? 3.453   78.075  41.936  1.00 137.57 ? 115 PRO C CB  1 
ATOM   4918  C CG  . PRO C 1 117 ? 3.994   76.859  42.572  1.00 136.25 ? 115 PRO C CG  1 
ATOM   4919  C CD  . PRO C 1 117 ? 3.745   77.086  44.031  1.00 137.77 ? 115 PRO C CD  1 
ATOM   4920  N N   . ARG C 1 118 ? -0.099  78.169  41.710  1.00 148.47 ? 116 ARG C N   1 
ATOM   4921  C CA  . ARG C 1 118 ? -1.330  77.578  41.119  1.00 150.59 ? 116 ARG C CA  1 
ATOM   4922  C C   . ARG C 1 118 ? -1.211  77.292  39.596  1.00 151.42 ? 116 ARG C C   1 
ATOM   4923  O O   . ARG C 1 118 ? -1.548  78.154  38.781  1.00 152.57 ? 116 ARG C O   1 
ATOM   4924  C CB  . ARG C 1 118 ? -2.533  78.524  41.369  1.00 149.27 ? 116 ARG C CB  1 
ATOM   4925  C CG  . ARG C 1 118 ? -2.660  79.018  42.809  1.00 148.42 ? 116 ARG C CG  1 
ATOM   4926  C CD  . ARG C 1 118 ? -3.339  80.389  42.891  1.00 147.80 ? 116 ARG C CD  1 
ATOM   4927  N NE  . ARG C 1 118 ? -4.791  80.321  43.043  1.00 147.39 ? 116 ARG C NE  1 
ATOM   4928  C CZ  . ARG C 1 118 ? -5.581  81.390  43.142  1.00 146.39 ? 116 ARG C CZ  1 
ATOM   4929  N NH1 . ARG C 1 118 ? -5.064  82.611  43.103  1.00 146.21 ? 116 ARG C NH1 1 
ATOM   4930  N NH2 . ARG C 1 118 ? -6.890  81.240  43.288  1.00 144.89 ? 116 ARG C NH2 1 
ATOM   4931  N N   . VAL C 1 119 ? -0.763  76.088  39.215  1.00 150.03 ? 117 VAL C N   1 
ATOM   4932  C CA  . VAL C 1 119 ? -0.585  75.743  37.797  1.00 147.44 ? 117 VAL C CA  1 
ATOM   4933  C C   . VAL C 1 119 ? -1.658  74.820  37.189  1.00 148.05 ? 117 VAL C C   1 
ATOM   4934  O O   . VAL C 1 119 ? -1.917  73.723  37.708  1.00 148.53 ? 117 VAL C O   1 
ATOM   4935  C CB  . VAL C 1 119 ? 0.811   75.083  37.560  1.00 146.05 ? 117 VAL C CB  1 
ATOM   4936  C CG1 . VAL C 1 119 ? 1.113   74.989  36.071  1.00 145.02 ? 117 VAL C CG1 1 
ATOM   4937  C CG2 . VAL C 1 119 ? 1.894   75.883  38.255  1.00 146.24 ? 117 VAL C CG2 1 
ATOM   4938  N N   . ILE C 1 120 ? -2.276  75.284  36.092  1.00 147.90 ? 118 ILE C N   1 
ATOM   4939  C CA  . ILE C 1 120 ? -3.295  74.523  35.341  1.00 145.07 ? 118 ILE C CA  1 
ATOM   4940  C C   . ILE C 1 120 ? -2.850  74.327  33.875  1.00 142.80 ? 118 ILE C C   1 
ATOM   4941  O O   . ILE C 1 120 ? -2.869  75.276  33.070  1.00 141.91 ? 118 ILE C O   1 
ATOM   4942  C CB  . ILE C 1 120 ? -4.716  75.214  35.380  1.00 143.90 ? 118 ILE C CB  1 
ATOM   4943  C CG1 . ILE C 1 120 ? -4.589  76.727  35.159  1.00 141.86 ? 118 ILE C CG1 1 
ATOM   4944  C CG2 . ILE C 1 120 ? -5.429  74.886  36.702  1.00 143.16 ? 118 ILE C CG2 1 
ATOM   4945  C CD1 . ILE C 1 120 ? -5.874  77.503  35.393  1.00 139.98 ? 118 ILE C CD1 1 
ATOM   4946  N N   . ARG C 1 121 ? -2.421  73.095  33.568  1.00 139.35 ? 119 ARG C N   1 
ATOM   4947  C CA  . ARG C 1 121 ? -1.956  72.696  32.233  1.00 135.13 ? 119 ARG C CA  1 
ATOM   4948  C C   . ARG C 1 121 ? -3.164  72.616  31.329  1.00 135.62 ? 119 ARG C C   1 
ATOM   4949  O O   . ARG C 1 121 ? -4.244  72.225  31.778  1.00 136.93 ? 119 ARG C O   1 
ATOM   4950  C CB  . ARG C 1 121 ? -1.289  71.318  32.275  1.00 129.89 ? 119 ARG C CB  1 
ATOM   4951  C CG  . ARG C 1 121 ? -1.116  70.666  30.912  1.00 122.16 ? 119 ARG C CG  1 
ATOM   4952  C CD  . ARG C 1 121 ? -0.574  69.266  31.045  1.00 113.27 ? 119 ARG C CD  1 
ATOM   4953  N NE  . ARG C 1 121 ? -0.310  68.676  29.745  1.00 105.38 ? 119 ARG C NE  1 
ATOM   4954  C CZ  . ARG C 1 121 ? 0.290   67.507  29.572  1.00 100.92 ? 119 ARG C CZ  1 
ATOM   4955  N NH1 . ARG C 1 121 ? 0.692   66.801  30.622  1.00 94.76  ? 119 ARG C NH1 1 
ATOM   4956  N NH2 . ARG C 1 121 ? 0.470   67.044  28.345  1.00 99.60  ? 119 ARG C NH2 1 
ATOM   4957  N N   . CYS C 1 122 ? -2.991  72.955  30.056  1.00 133.53 ? 120 CYS C N   1 
ATOM   4958  C CA  . CYS C 1 122 ? -4.128  72.921  29.153  1.00 130.47 ? 120 CYS C CA  1 
ATOM   4959  C C   . CYS C 1 122 ? -3.705  72.620  27.719  1.00 125.72 ? 120 CYS C C   1 
ATOM   4960  O O   . CYS C 1 122 ? -2.517  72.734  27.383  1.00 127.04 ? 120 CYS C O   1 
ATOM   4961  C CB  . CYS C 1 122 ? -4.933  74.248  29.309  1.00 132.90 ? 120 CYS C CB  1 
ATOM   4962  S SG  . CYS C 1 122 ? -4.688  75.748  28.262  1.00 138.42 ? 120 CYS C SG  1 
ATOM   4963  N N   . MET C 1 123 ? -4.654  72.168  26.897  1.00 118.37 ? 121 MET C N   1 
ATOM   4964  C CA  . MET C 1 123 ? -4.350  71.875  25.504  1.00 110.22 ? 121 MET C CA  1 
ATOM   4965  C C   . MET C 1 123 ? -5.431  72.384  24.577  1.00 107.54 ? 121 MET C C   1 
ATOM   4966  O O   . MET C 1 123 ? -6.627  72.246  24.864  1.00 103.81 ? 121 MET C O   1 
ATOM   4967  C CB  . MET C 1 123 ? -4.175  70.374  25.292  1.00 108.65 ? 121 MET C CB  1 
ATOM   4968  C CG  . MET C 1 123 ? -2.914  70.002  24.459  1.00 108.06 ? 121 MET C CG  1 
ATOM   4969  S SD  . MET C 1 123 ? -2.956  70.125  22.634  1.00 101.12 ? 121 MET C SD  1 
ATOM   4970  C CE  . MET C 1 123 ? -2.143  71.662  22.343  1.00 101.05 ? 121 MET C CE  1 
ATOM   4971  N N   . THR C 1 124 ? -5.005  73.015  23.483  1.00 105.07 ? 122 THR C N   1 
ATOM   4972  C CA  . THR C 1 124 ? -5.946  73.487  22.472  1.00 104.02 ? 122 THR C CA  1 
ATOM   4973  C C   . THR C 1 124 ? -5.310  73.398  21.095  1.00 102.62 ? 122 THR C C   1 
ATOM   4974  O O   . THR C 1 124 ? -4.130  73.033  20.940  1.00 103.90 ? 122 THR C O   1 
ATOM   4975  C CB  . THR C 1 124 ? -6.379  74.924  22.660  1.00 101.95 ? 122 THR C CB  1 
ATOM   4976  O OG1 . THR C 1 124 ? -5.431  75.784  22.030  1.00 106.08 ? 122 THR C OG1 1 
ATOM   4977  C CG2 . THR C 1 124 ? -6.482  75.248  24.111  1.00 100.49 ? 122 THR C CG2 1 
ATOM   4978  N N   . ASN C 1 125 ? -6.093  73.767  20.096  1.00 98.47  ? 123 ASN C N   1 
ATOM   4979  C CA  . ASN C 1 125 ? -5.628  73.700  18.734  1.00 94.24  ? 123 ASN C CA  1 
ATOM   4980  C C   . ASN C 1 125 ? -5.585  75.078  18.103  1.00 90.97  ? 123 ASN C C   1 
ATOM   4981  O O   . ASN C 1 125 ? -5.985  76.074  18.710  1.00 89.61  ? 123 ASN C O   1 
ATOM   4982  C CB  . ASN C 1 125 ? -6.577  72.806  17.980  1.00 95.02  ? 123 ASN C CB  1 
ATOM   4983  C CG  . ASN C 1 125 ? -7.912  72.703  18.682  1.00 97.22  ? 123 ASN C CG  1 
ATOM   4984  O OD1 . ASN C 1 125 ? -8.489  73.717  19.096  1.00 98.20  ? 123 ASN C OD1 1 
ATOM   4985  N ND2 . ASN C 1 125 ? -8.406  71.480  18.839  1.00 100.55 ? 123 ASN C ND2 1 
ATOM   4986  N N   . THR C 1 126 ? -5.113  75.113  16.866  1.00 85.93  ? 124 THR C N   1 
ATOM   4987  C CA  . THR C 1 126 ? -4.998  76.347  16.112  1.00 84.34  ? 124 THR C CA  1 
ATOM   4988  C C   . THR C 1 126 ? -6.307  77.050  15.775  1.00 81.48  ? 124 THR C C   1 
ATOM   4989  O O   . THR C 1 126 ? -6.395  78.270  15.916  1.00 79.18  ? 124 THR C O   1 
ATOM   4990  C CB  . THR C 1 126 ? -4.263  76.096  14.813  1.00 87.92  ? 124 THR C CB  1 
ATOM   4991  O OG1 . THR C 1 126 ? -3.308  75.052  15.023  1.00 92.32  ? 124 THR C OG1 1 
ATOM   4992  C CG2 . THR C 1 126 ? -3.549  77.371  14.347  1.00 92.97  ? 124 THR C CG2 1 
ATOM   4993  N N   . PRO C 1 127 ? -7.348  76.295  15.351  1.00 79.30  ? 125 PRO C N   1 
ATOM   4994  C CA  . PRO C 1 127 ? -8.650  76.864  14.988  1.00 75.94  ? 125 PRO C CA  1 
ATOM   4995  C C   . PRO C 1 127 ? -9.233  77.701  16.088  1.00 76.87  ? 125 PRO C C   1 
ATOM   4996  O O   . PRO C 1 127 ? -10.344 78.236  15.959  1.00 79.34  ? 125 PRO C O   1 
ATOM   4997  C CB  . PRO C 1 127 ? -9.499  75.641  14.719  1.00 73.23  ? 125 PRO C CB  1 
ATOM   4998  C CG  . PRO C 1 127 ? -9.010  74.707  15.734  1.00 75.57  ? 125 PRO C CG  1 
ATOM   4999  C CD  . PRO C 1 127 ? -7.499  74.844  15.550  1.00 79.16  ? 125 PRO C CD  1 
ATOM   5000  N N   . VAL C 1 128 ? -8.496  77.785  17.192  1.00 76.78  ? 126 VAL C N   1 
ATOM   5001  C CA  . VAL C 1 128 ? -8.937  78.606  18.305  1.00 73.62  ? 126 VAL C CA  1 
ATOM   5002  C C   . VAL C 1 128 ? -9.109  80.002  17.708  1.00 72.86  ? 126 VAL C C   1 
ATOM   5003  O O   . VAL C 1 128 ? -9.911  80.787  18.200  1.00 72.50  ? 126 VAL C O   1 
ATOM   5004  C CB  . VAL C 1 128 ? -7.902  78.632  19.466  1.00 69.75  ? 126 VAL C CB  1 
ATOM   5005  C CG1 . VAL C 1 128 ? -7.964  77.319  20.247  1.00 65.72  ? 126 VAL C CG1 1 
ATOM   5006  C CG2 . VAL C 1 128 ? -6.498  78.870  18.909  1.00 65.82  ? 126 VAL C CG2 1 
ATOM   5007  N N   . VAL C 1 129 ? -8.370  80.271  16.623  1.00 71.45  ? 127 VAL C N   1 
ATOM   5008  C CA  . VAL C 1 129 ? -8.414  81.545  15.908  1.00 68.89  ? 127 VAL C CA  1 
ATOM   5009  C C   . VAL C 1 129 ? -9.841  81.947  15.603  1.00 70.76  ? 127 VAL C C   1 
ATOM   5010  O O   . VAL C 1 129 ? -10.108 83.051  15.178  1.00 71.25  ? 127 VAL C O   1 
ATOM   5011  C CB  . VAL C 1 129 ? -7.666  81.481  14.575  1.00 66.41  ? 127 VAL C CB  1 
ATOM   5012  C CG1 . VAL C 1 129 ? -7.751  82.831  13.894  1.00 64.75  ? 127 VAL C CG1 1 
ATOM   5013  C CG2 . VAL C 1 129 ? -6.204  81.058  14.801  1.00 70.02  ? 127 VAL C CG2 1 
ATOM   5014  N N   . VAL C 1 130 ? -10.761 81.019  15.794  1.00 74.10  ? 128 VAL C N   1 
ATOM   5015  C CA  . VAL C 1 130 ? -12.170 81.269  15.584  1.00 76.63  ? 128 VAL C CA  1 
ATOM   5016  C C   . VAL C 1 130 ? -12.802 80.632  16.810  1.00 82.60  ? 128 VAL C C   1 
ATOM   5017  O O   . VAL C 1 130 ? -12.104 80.032  17.623  1.00 81.31  ? 128 VAL C O   1 
ATOM   5018  C CB  . VAL C 1 130 ? -12.669 80.549  14.352  1.00 73.82  ? 128 VAL C CB  1 
ATOM   5019  C CG1 . VAL C 1 130 ? -14.162 80.688  14.271  1.00 72.93  ? 128 VAL C CG1 1 
ATOM   5020  C CG2 . VAL C 1 130 ? -11.984 81.106  13.112  1.00 71.37  ? 128 VAL C CG2 1 
ATOM   5021  N N   . ARG C 1 131 ? -14.111 80.752  16.964  1.00 91.06  ? 129 ARG C N   1 
ATOM   5022  C CA  . ARG C 1 131 ? -14.768 80.146  18.119  1.00 100.47 ? 129 ARG C CA  1 
ATOM   5023  C C   . ARG C 1 131 ? -14.733 78.622  18.010  1.00 101.30 ? 129 ARG C C   1 
ATOM   5024  O O   . ARG C 1 131 ? -15.453 77.921  18.736  1.00 103.93 ? 129 ARG C O   1 
ATOM   5025  C CB  . ARG C 1 131 ? -16.245 80.584  18.221  1.00 109.59 ? 129 ARG C CB  1 
ATOM   5026  C CG  . ARG C 1 131 ? -16.956 80.136  19.523  1.00 120.20 ? 129 ARG C CG  1 
ATOM   5027  C CD  . ARG C 1 131 ? -18.482 79.942  19.376  1.00 127.99 ? 129 ARG C CD  1 
ATOM   5028  N NE  . ARG C 1 131 ? -18.843 78.690  18.694  1.00 136.19 ? 129 ARG C NE  1 
ATOM   5029  C CZ  . ARG C 1 131 ? -20.078 78.184  18.638  1.00 139.29 ? 129 ARG C CZ  1 
ATOM   5030  N NH1 . ARG C 1 131 ? -21.083 78.816  19.225  1.00 141.87 ? 129 ARG C NH1 1 
ATOM   5031  N NH2 . ARG C 1 131 ? -20.317 77.048  17.991  1.00 141.18 ? 129 ARG C NH2 1 
ATOM   5032  N N   . GLU C 1 132 ? -13.901 78.094  17.118  1.00 100.21 ? 130 GLU C N   1 
ATOM   5033  C CA  . GLU C 1 132 ? -13.876 76.651  16.938  1.00 96.46  ? 130 GLU C CA  1 
ATOM   5034  C C   . GLU C 1 132 ? -12.593 75.892  17.276  1.00 93.49  ? 130 GLU C C   1 
ATOM   5035  O O   . GLU C 1 132 ? -11.918 75.352  16.407  1.00 93.73  ? 130 GLU C O   1 
ATOM   5036  C CB  . GLU C 1 132 ? -14.326 76.333  15.509  1.00 96.78  ? 130 GLU C CB  1 
ATOM   5037  C CG  . GLU C 1 132 ? -15.632 77.006  15.115  1.00 96.84  ? 130 GLU C CG  1 
ATOM   5038  C CD  . GLU C 1 132 ? -16.811 76.650  16.036  1.00 99.94  ? 130 GLU C CD  1 
ATOM   5039  O OE1 . GLU C 1 132 ? -17.913 77.209  15.834  1.00 102.99 ? 130 GLU C OE1 1 
ATOM   5040  O OE2 . GLU C 1 132 ? -16.648 75.818  16.957  1.00 98.18  ? 130 GLU C OE2 1 
ATOM   5041  N N   . GLY C 1 133 ? -12.274 75.845  18.555  1.00 90.13  ? 131 GLY C N   1 
ATOM   5042  C CA  . GLY C 1 133 ? -11.115 75.104  18.966  1.00 89.60  ? 131 GLY C CA  1 
ATOM   5043  C C   . GLY C 1 133 ? -11.660 74.161  20.007  1.00 91.74  ? 131 GLY C C   1 
ATOM   5044  O O   . GLY C 1 133 ? -12.591 74.513  20.723  1.00 91.23  ? 131 GLY C O   1 
ATOM   5045  N N   . ALA C 1 134 ? -11.129 72.947  20.059  1.00 94.69  ? 132 ALA C N   1 
ATOM   5046  C CA  . ALA C 1 134 ? -11.543 71.967  21.070  1.00 95.60  ? 132 ALA C CA  1 
ATOM   5047  C C   . ALA C 1 134 ? -10.410 72.075  22.070  1.00 95.99  ? 132 ALA C C   1 
ATOM   5048  O O   . ALA C 1 134 ? -9.268  71.760  21.735  1.00 96.25  ? 132 ALA C O   1 
ATOM   5049  C CB  . ALA C 1 134 ? -11.597 70.551  20.478  1.00 96.39  ? 132 ALA C CB  1 
ATOM   5050  N N   . THR C 1 135 ? -10.715 72.518  23.288  1.00 96.38  ? 133 THR C N   1 
ATOM   5051  C CA  . THR C 1 135 ? -9.677  72.722  24.296  1.00 97.15  ? 133 THR C CA  1 
ATOM   5052  C C   . THR C 1 135 ? -9.999  72.101  25.674  1.00 102.36 ? 133 THR C C   1 
ATOM   5053  O O   . THR C 1 135 ? -11.144 72.154  26.127  1.00 101.48 ? 133 THR C O   1 
ATOM   5054  C CB  . THR C 1 135 ? -9.447  74.239  24.444  1.00 91.26  ? 133 THR C CB  1 
ATOM   5055  O OG1 . THR C 1 135 ? -10.624 74.828  25.000  1.00 87.89  ? 133 THR C OG1 1 
ATOM   5056  C CG2 . THR C 1 135 ? -9.225  74.889  23.082  1.00 87.19  ? 133 THR C CG2 1 
ATOM   5057  N N   . VAL C 1 136 ? -8.996  71.495  26.325  1.00 108.10 ? 134 VAL C N   1 
ATOM   5058  C CA  . VAL C 1 136 ? -9.185  70.890  27.657  1.00 113.82 ? 134 VAL C CA  1 
ATOM   5059  C C   . VAL C 1 136 ? -8.061  71.233  28.634  1.00 120.20 ? 134 VAL C C   1 
ATOM   5060  O O   . VAL C 1 136 ? -6.886  71.298  28.252  1.00 121.13 ? 134 VAL C O   1 
ATOM   5061  C CB  . VAL C 1 136 ? -9.297  69.355  27.615  1.00 111.54 ? 134 VAL C CB  1 
ATOM   5062  C CG1 . VAL C 1 136 ? -9.720  68.827  28.989  1.00 111.68 ? 134 VAL C CG1 1 
ATOM   5063  C CG2 . VAL C 1 136 ? -10.316 68.949  26.603  1.00 112.33 ? 134 VAL C CG2 1 
ATOM   5064  N N   . TYR C 1 137 ? -8.437  71.413  29.902  1.00 126.82 ? 135 TYR C N   1 
ATOM   5065  C CA  . TYR C 1 137 ? -7.511  71.789  30.983  1.00 132.23 ? 135 TYR C CA  1 
ATOM   5066  C C   . TYR C 1 137 ? -7.461  70.791  32.176  1.00 137.09 ? 135 TYR C C   1 
ATOM   5067  O O   . TYR C 1 137 ? -8.367  69.954  32.346  1.00 137.24 ? 135 TYR C O   1 
ATOM   5068  C CB  . TYR C 1 137 ? -7.910  73.179  31.503  1.00 129.74 ? 135 TYR C CB  1 
ATOM   5069  C CG  . TYR C 1 137 ? -9.298  73.198  32.134  1.00 127.15 ? 135 TYR C CG  1 
ATOM   5070  C CD1 . TYR C 1 137 ? -9.567  72.486  33.313  1.00 125.02 ? 135 TYR C CD1 1 
ATOM   5071  C CD2 . TYR C 1 137 ? -10.351 73.872  31.529  1.00 125.46 ? 135 TYR C CD2 1 
ATOM   5072  C CE1 . TYR C 1 137 ? -10.838 72.444  33.861  1.00 123.01 ? 135 TYR C CE1 1 
ATOM   5073  C CE2 . TYR C 1 137 ? -11.635 73.829  32.075  1.00 124.86 ? 135 TYR C CE2 1 
ATOM   5074  C CZ  . TYR C 1 137 ? -11.870 73.112  33.236  1.00 124.49 ? 135 TYR C CZ  1 
ATOM   5075  O OH  . TYR C 1 137 ? -13.141 73.045  33.756  1.00 125.96 ? 135 TYR C OH  1 
ATOM   5076  N N   . ALA C 1 138 ? -6.416  70.921  33.006  1.00 142.05 ? 136 ALA C N   1 
ATOM   5077  C CA  . ALA C 1 138 ? -6.200  70.063  34.189  1.00 145.36 ? 136 ALA C CA  1 
ATOM   5078  C C   . ALA C 1 138 ? -5.835  70.837  35.489  1.00 146.66 ? 136 ALA C C   1 
ATOM   5079  O O   . ALA C 1 138 ? -4.716  71.365  35.614  1.00 148.33 ? 136 ALA C O   1 
ATOM   5080  C CB  . ALA C 1 138 ? -5.098  69.009  33.875  1.00 145.04 ? 136 ALA C CB  1 
ATOM   5081  N N   . THR C 1 139 ? -6.767  70.876  36.452  1.00 145.52 ? 137 THR C N   1 
ATOM   5082  C CA  . THR C 1 139 ? -6.555  71.570  37.728  1.00 142.38 ? 137 THR C CA  1 
ATOM   5083  C C   . THR C 1 139 ? -5.794  70.739  38.747  1.00 143.33 ? 137 THR C C   1 
ATOM   5084  O O   . THR C 1 139 ? -6.382  69.946  39.491  1.00 142.41 ? 137 THR C O   1 
ATOM   5085  C CB  . THR C 1 139 ? -7.880  71.975  38.391  1.00 139.98 ? 137 THR C CB  1 
ATOM   5086  O OG1 . THR C 1 139 ? -8.673  70.805  38.636  1.00 134.97 ? 137 THR C OG1 1 
ATOM   5087  C CG2 . THR C 1 139 ? -8.634  72.937  37.511  1.00 138.53 ? 137 THR C CG2 1 
ATOM   5088  N N   . GLY C 1 140 ? -4.484  70.950  38.790  1.00 144.13 ? 138 GLY C N   1 
ATOM   5089  C CA  . GLY C 1 140 ? -3.654  70.223  39.726  1.00 145.47 ? 138 GLY C CA  1 
ATOM   5090  C C   . GLY C 1 140 ? -3.369  70.992  41.003  1.00 146.09 ? 138 GLY C C   1 
ATOM   5091  O O   . GLY C 1 140 ? -3.156  72.210  40.981  1.00 145.84 ? 138 GLY C O   1 
ATOM   5092  N N   . THR C 1 141 ? -3.371  70.261  42.116  1.00 145.84 ? 139 THR C N   1 
ATOM   5093  C CA  . THR C 1 141 ? -3.116  70.797  43.452  1.00 142.86 ? 139 THR C CA  1 
ATOM   5094  C C   . THR C 1 141 ? -3.550  72.247  43.698  1.00 142.28 ? 139 THR C C   1 
ATOM   5095  O O   . THR C 1 141 ? -4.710  72.501  44.045  1.00 141.11 ? 139 THR C O   1 
ATOM   5096  C CB  . THR C 1 141 ? -1.610  70.642  43.831  1.00 140.81 ? 139 THR C CB  1 
ATOM   5097  O OG1 . THR C 1 141 ? -0.780  71.323  42.877  1.00 139.88 ? 139 THR C OG1 1 
ATOM   5098  C CG2 . THR C 1 141 ? -1.226  69.178  43.867  1.00 138.60 ? 139 THR C CG2 1 
ATOM   5099  N N   . HIS C 1 142 ? -2.616  73.182  43.519  1.00 141.37 ? 140 HIS C N   1 
ATOM   5100  C CA  . HIS C 1 142 ? -2.867  74.604  43.740  1.00 139.78 ? 140 HIS C CA  1 
ATOM   5101  C C   . HIS C 1 142 ? -3.908  75.160  42.735  1.00 139.36 ? 140 HIS C C   1 
ATOM   5102  O O   . HIS C 1 142 ? -3.599  76.005  41.905  1.00 138.28 ? 140 HIS C O   1 
ATOM   5103  C CB  . HIS C 1 142 ? -1.527  75.383  43.660  1.00 138.10 ? 140 HIS C CB  1 
ATOM   5104  C CG  . HIS C 1 142 ? -0.359  74.685  44.317  1.00 137.51 ? 140 HIS C CG  1 
ATOM   5105  N ND1 . HIS C 1 142 ? -0.290  74.443  45.675  1.00 137.49 ? 140 HIS C ND1 1 
ATOM   5106  C CD2 . HIS C 1 142 ? 0.774   74.154  43.791  1.00 135.82 ? 140 HIS C CD2 1 
ATOM   5107  C CE1 . HIS C 1 142 ? 0.826   73.791  45.953  1.00 135.44 ? 140 HIS C CE1 1 
ATOM   5108  N NE2 . HIS C 1 142 ? 1.490   73.603  44.827  1.00 134.21 ? 140 HIS C NE2 1 
ATOM   5109  N N   . ALA C 1 143 ? -5.144  74.669  42.825  1.00 140.00 ? 141 ALA C N   1 
ATOM   5110  C CA  . ALA C 1 143 ? -6.238  75.098  41.949  1.00 139.82 ? 141 ALA C CA  1 
ATOM   5111  C C   . ALA C 1 143 ? -7.594  74.926  42.645  1.00 141.67 ? 141 ALA C C   1 
ATOM   5112  O O   . ALA C 1 143 ? -8.231  73.864  42.551  1.00 140.37 ? 141 ALA C O   1 
ATOM   5113  C CB  . ALA C 1 143 ? -6.215  74.297  40.654  1.00 136.61 ? 141 ALA C CB  1 
ATOM   5114  N N   . GLN C 1 144 ? -8.019  75.978  43.345  1.00 144.46 ? 142 GLN C N   1 
ATOM   5115  C CA  . GLN C 1 144 ? -9.283  75.996  44.073  1.00 147.37 ? 142 GLN C CA  1 
ATOM   5116  C C   . GLN C 1 144 ? -10.493 75.572  43.271  1.00 147.48 ? 142 GLN C C   1 
ATOM   5117  O O   . GLN C 1 144 ? -10.392 75.198  42.111  1.00 147.03 ? 142 GLN C O   1 
ATOM   5118  C CB  . GLN C 1 144 ? -9.558  77.387  44.617  1.00 150.22 ? 142 GLN C CB  1 
ATOM   5119  C CG  . GLN C 1 144 ? -8.777  77.730  45.843  1.00 157.55 ? 142 GLN C CG  1 
ATOM   5120  C CD  . GLN C 1 144 ? -9.210  79.055  46.411  1.00 162.13 ? 142 GLN C CD  1 
ATOM   5121  O OE1 . GLN C 1 144 ? -9.081  80.091  45.757  1.00 165.90 ? 142 GLN C OE1 1 
ATOM   5122  N NE2 . GLN C 1 144 ? -9.739  79.034  47.628  1.00 164.44 ? 142 GLN C NE2 1 
ATOM   5123  N N   . VAL C 1 145 ? -11.648 75.663  43.922  1.00 149.11 ? 143 VAL C N   1 
ATOM   5124  C CA  . VAL C 1 145 ? -12.944 75.303  43.340  1.00 149.81 ? 143 VAL C CA  1 
ATOM   5125  C C   . VAL C 1 145 ? -13.420 76.402  42.385  1.00 149.29 ? 143 VAL C C   1 
ATOM   5126  O O   . VAL C 1 145 ? -14.500 76.316  41.790  1.00 146.96 ? 143 VAL C O   1 
ATOM   5127  C CB  . VAL C 1 145 ? -14.013 75.104  44.466  1.00 149.88 ? 143 VAL C CB  1 
ATOM   5128  C CG1 . VAL C 1 145 ? -15.316 74.579  43.887  1.00 148.36 ? 143 VAL C CG1 1 
ATOM   5129  C CG2 . VAL C 1 145 ? -13.473 74.153  45.531  1.00 148.67 ? 143 VAL C CG2 1 
ATOM   5130  N N   . GLU C 1 146 ? -12.599 77.434  42.238  1.00 149.26 ? 144 GLU C N   1 
ATOM   5131  C CA  . GLU C 1 146 ? -12.946 78.536  41.363  1.00 150.20 ? 144 GLU C CA  1 
ATOM   5132  C C   . GLU C 1 146 ? -11.823 78.772  40.384  1.00 150.38 ? 144 GLU C C   1 
ATOM   5133  O O   . GLU C 1 146 ? -11.979 79.528  39.427  1.00 150.57 ? 144 GLU C O   1 
ATOM   5134  C CB  . GLU C 1 146 ? -13.171 79.793  42.173  1.00 151.92 ? 144 GLU C CB  1 
ATOM   5135  C CG  . GLU C 1 146 ? -13.932 79.530  43.432  1.00 156.37 ? 144 GLU C CG  1 
ATOM   5136  C CD  . GLU C 1 146 ? -13.733 80.628  44.438  1.00 159.99 ? 144 GLU C CD  1 
ATOM   5137  O OE1 . GLU C 1 146 ? -14.228 81.750  44.200  1.00 161.75 ? 144 GLU C OE1 1 
ATOM   5138  O OE2 . GLU C 1 146 ? -13.066 80.372  45.464  1.00 162.53 ? 144 GLU C OE2 1 
ATOM   5139  N N   . ASP C 1 147 ? -10.680 78.136  40.631  1.00 150.63 ? 145 ASP C N   1 
ATOM   5140  C CA  . ASP C 1 147 ? -9.536  78.277  39.730  1.00 150.31 ? 145 ASP C CA  1 
ATOM   5141  C C   . ASP C 1 147 ? -9.847  77.498  38.451  1.00 149.31 ? 145 ASP C C   1 
ATOM   5142  O O   . ASP C 1 147 ? -8.985  77.344  37.581  1.00 149.71 ? 145 ASP C O   1 
ATOM   5143  C CB  . ASP C 1 147 ? -8.242  77.714  40.352  1.00 150.66 ? 145 ASP C CB  1 
ATOM   5144  C CG  . ASP C 1 147 ? -7.849  78.411  41.634  1.00 149.93 ? 145 ASP C CG  1 
ATOM   5145  O OD1 . ASP C 1 147 ? -6.710  78.182  42.102  1.00 149.27 ? 145 ASP C OD1 1 
ATOM   5146  O OD2 . ASP C 1 147 ? -8.677  79.174  42.173  1.00 150.55 ? 145 ASP C OD2 1 
ATOM   5147  N N   . GLY C 1 148 ? -11.079 77.002  38.354  1.00 147.06 ? 146 GLY C N   1 
ATOM   5148  C CA  . GLY C 1 148 ? -11.484 76.239  37.190  1.00 144.02 ? 146 GLY C CA  1 
ATOM   5149  C C   . GLY C 1 148 ? -12.666 76.890  36.523  1.00 141.97 ? 146 GLY C C   1 
ATOM   5150  O O   . GLY C 1 148 ? -12.748 76.962  35.303  1.00 142.05 ? 146 GLY C O   1 
ATOM   5151  N N   . ARG C 1 149 ? -13.596 77.361  37.334  1.00 139.92 ? 147 ARG C N   1 
ATOM   5152  C CA  . ARG C 1 149 ? -14.761 78.021  36.803  1.00 138.48 ? 147 ARG C CA  1 
ATOM   5153  C C   . ARG C 1 149 ? -14.387 79.070  35.764  1.00 139.23 ? 147 ARG C C   1 
ATOM   5154  O O   . ARG C 1 149 ? -14.871 79.013  34.637  1.00 141.38 ? 147 ARG C O   1 
ATOM   5155  C CB  . ARG C 1 149 ? -15.503 78.685  37.925  1.00 136.70 ? 147 ARG C CB  1 
ATOM   5156  C CG  . ARG C 1 149 ? -16.454 79.727  37.469  1.00 136.07 ? 147 ARG C CG  1 
ATOM   5157  C CD  . ARG C 1 149 ? -17.167 80.139  38.674  1.00 137.05 ? 147 ARG C CD  1 
ATOM   5158  N NE  . ARG C 1 149 ? -17.516 78.912  39.371  1.00 142.28 ? 147 ARG C NE  1 
ATOM   5159  C CZ  . ARG C 1 149 ? -18.245 78.861  40.473  1.00 144.51 ? 147 ARG C CZ  1 
ATOM   5160  N NH1 . ARG C 1 149 ? -18.703 79.984  41.008  1.00 145.47 ? 147 ARG C NH1 1 
ATOM   5161  N NH2 . ARG C 1 149 ? -18.526 77.689  41.027  1.00 147.09 ? 147 ARG C NH2 1 
ATOM   5162  N N   . LEU C 1 150 ? -13.539 80.028  36.144  1.00 137.74 ? 148 LEU C N   1 
ATOM   5163  C CA  . LEU C 1 150 ? -13.113 81.103  35.235  1.00 135.40 ? 148 LEU C CA  1 
ATOM   5164  C C   . LEU C 1 150 ? -12.541 80.546  33.923  1.00 132.80 ? 148 LEU C C   1 
ATOM   5165  O O   . LEU C 1 150 ? -12.648 81.169  32.860  1.00 132.58 ? 148 LEU C O   1 
ATOM   5166  C CB  . LEU C 1 150 ? -12.077 81.996  35.934  1.00 137.30 ? 148 LEU C CB  1 
ATOM   5167  C CG  . LEU C 1 150 ? -11.644 83.327  35.296  1.00 138.88 ? 148 LEU C CG  1 
ATOM   5168  C CD1 . LEU C 1 150 ? -12.864 84.220  35.037  1.00 138.80 ? 148 LEU C CD1 1 
ATOM   5169  C CD2 . LEU C 1 150 ? -10.640 84.025  36.232  1.00 137.72 ? 148 LEU C CD2 1 
ATOM   5170  N N   . MET C 1 151 ? -11.935 79.367  34.001  1.00 129.11 ? 149 MET C N   1 
ATOM   5171  C CA  . MET C 1 151 ? -11.384 78.735  32.811  1.00 125.09 ? 149 MET C CA  1 
ATOM   5172  C C   . MET C 1 151 ? -12.525 78.226  31.921  1.00 120.99 ? 149 MET C C   1 
ATOM   5173  O O   . MET C 1 151 ? -12.680 78.715  30.798  1.00 121.23 ? 149 MET C O   1 
ATOM   5174  C CB  . MET C 1 151 ? -10.463 77.575  33.193  1.00 129.42 ? 149 MET C CB  1 
ATOM   5175  C CG  . MET C 1 151 ? -9.107  77.970  33.792  1.00 133.05 ? 149 MET C CG  1 
ATOM   5176  S SD  . MET C 1 151 ? -7.880  78.660  32.639  1.00 138.42 ? 149 MET C SD  1 
ATOM   5177  C CE  . MET C 1 151 ? -7.212  77.150  31.785  1.00 135.01 ? 149 MET C CE  1 
ATOM   5178  N N   . GLU C 1 152 ? -13.325 77.273  32.424  1.00 114.75 ? 150 GLU C N   1 
ATOM   5179  C CA  . GLU C 1 152 ? -14.442 76.711  31.653  1.00 109.10 ? 150 GLU C CA  1 
ATOM   5180  C C   . GLU C 1 152 ? -15.498 77.774  31.298  1.00 109.71 ? 150 GLU C C   1 
ATOM   5181  O O   . GLU C 1 152 ? -16.687 77.461  31.168  1.00 110.34 ? 150 GLU C O   1 
ATOM   5182  C CB  . GLU C 1 152 ? -15.108 75.538  32.410  1.00 102.21 ? 150 GLU C CB  1 
ATOM   5183  C CG  . GLU C 1 152 ? -15.468 74.348  31.512  1.00 95.21  ? 150 GLU C CG  1 
ATOM   5184  C CD  . GLU C 1 152 ? -16.322 73.260  32.189  1.00 96.64  ? 150 GLU C CD  1 
ATOM   5185  O OE1 . GLU C 1 152 ? -17.571 73.366  32.154  1.00 95.57  ? 150 GLU C OE1 1 
ATOM   5186  O OE2 . GLU C 1 152 ? -15.752 72.292  32.753  1.00 93.93  ? 150 GLU C OE2 1 
ATOM   5187  N N   . GLN C 1 153 ? -15.043 79.024  31.132  1.00 109.04 ? 151 GLN C N   1 
ATOM   5188  C CA  . GLN C 1 153 ? -15.878 80.184  30.790  1.00 105.18 ? 151 GLN C CA  1 
ATOM   5189  C C   . GLN C 1 153 ? -15.094 81.080  29.873  1.00 100.31 ? 151 GLN C C   1 
ATOM   5190  O O   . GLN C 1 153 ? -15.619 81.584  28.898  1.00 98.13  ? 151 GLN C O   1 
ATOM   5191  C CB  . GLN C 1 153 ? -16.175 81.035  32.008  1.00 110.38 ? 151 GLN C CB  1 
ATOM   5192  C CG  . GLN C 1 153 ? -16.865 80.345  33.131  1.00 119.83 ? 151 GLN C CG  1 
ATOM   5193  C CD  . GLN C 1 153 ? -16.998 81.255  34.337  1.00 124.83 ? 151 GLN C CD  1 
ATOM   5194  O OE1 . GLN C 1 153 ? -16.011 81.828  34.816  1.00 125.99 ? 151 GLN C OE1 1 
ATOM   5195  N NE2 . GLN C 1 153 ? -18.222 81.395  34.837  1.00 129.59 ? 151 GLN C NE2 1 
ATOM   5196  N N   . LEU C 1 154 ? -13.842 81.316  30.251  1.00 96.98  ? 152 LEU C N   1 
ATOM   5197  C CA  . LEU C 1 154 ? -12.961 82.160  29.481  1.00 97.92  ? 152 LEU C CA  1 
ATOM   5198  C C   . LEU C 1 154 ? -12.675 81.466  28.182  1.00 101.35 ? 152 LEU C C   1 
ATOM   5199  O O   . LEU C 1 154 ? -12.869 82.012  27.095  1.00 102.33 ? 152 LEU C O   1 
ATOM   5200  C CB  . LEU C 1 154 ? -11.634 82.392  30.200  1.00 96.61  ? 152 LEU C CB  1 
ATOM   5201  C CG  . LEU C 1 154 ? -10.453 82.611  29.229  1.00 99.12  ? 152 LEU C CG  1 
ATOM   5202  C CD1 . LEU C 1 154 ? -10.812 83.673  28.199  1.00 100.01 ? 152 LEU C CD1 1 
ATOM   5203  C CD2 . LEU C 1 154 ? -9.188  83.007  29.977  1.00 96.89  ? 152 LEU C CD2 1 
ATOM   5204  N N   . LEU C 1 155 ? -12.178 80.249  28.307  1.00 105.50 ? 153 LEU C N   1 
ATOM   5205  C CA  . LEU C 1 155 ? -11.847 79.455  27.141  1.00 108.47 ? 153 LEU C CA  1 
ATOM   5206  C C   . LEU C 1 155 ? -13.053 78.618  26.685  1.00 108.16 ? 153 LEU C C   1 
ATOM   5207  O O   . LEU C 1 155 ? -12.959 77.813  25.759  1.00 107.91 ? 153 LEU C O   1 
ATOM   5208  C CB  . LEU C 1 155 ? -10.623 78.576  27.471  1.00 110.49 ? 153 LEU C CB  1 
ATOM   5209  C CG  . LEU C 1 155 ? -9.329  79.355  27.838  1.00 112.08 ? 153 LEU C CG  1 
ATOM   5210  C CD1 . LEU C 1 155 ? -8.208  78.443  28.394  1.00 110.33 ? 153 LEU C CD1 1 
ATOM   5211  C CD2 . LEU C 1 155 ? -8.835  80.080  26.594  1.00 112.41 ? 153 LEU C CD2 1 
ATOM   5212  N N   . SER C 1 156 ? -14.193 78.835  27.332  1.00 109.44 ? 154 SER C N   1 
ATOM   5213  C CA  . SER C 1 156 ? -15.414 78.110  27.005  1.00 111.79 ? 154 SER C CA  1 
ATOM   5214  C C   . SER C 1 156 ? -16.277 78.937  26.060  1.00 112.29 ? 154 SER C C   1 
ATOM   5215  O O   . SER C 1 156 ? -17.324 78.478  25.591  1.00 113.22 ? 154 SER C O   1 
ATOM   5216  C CB  . SER C 1 156 ? -16.199 77.781  28.289  1.00 112.78 ? 154 SER C CB  1 
ATOM   5217  O OG  . SER C 1 156 ? -17.408 77.082  28.017  1.00 113.67 ? 154 SER C OG  1 
ATOM   5218  N N   . SER C 1 157 ? -15.838 80.158  25.778  1.00 111.48 ? 155 SER C N   1 
ATOM   5219  C CA  . SER C 1 157 ? -16.591 81.021  24.881  1.00 111.18 ? 155 SER C CA  1 
ATOM   5220  C C   . SER C 1 157 ? -16.061 80.849  23.477  1.00 110.07 ? 155 SER C C   1 
ATOM   5221  O O   . SER C 1 157 ? -16.819 80.876  22.515  1.00 109.60 ? 155 SER C O   1 
ATOM   5222  C CB  . SER C 1 157 ? -16.450 82.484  25.283  1.00 112.99 ? 155 SER C CB  1 
ATOM   5223  O OG  . SER C 1 157 ? -15.129 82.943  25.048  1.00 114.26 ? 155 SER C OG  1 
ATOM   5224  N N   . VAL C 1 158 ? -14.746 80.677  23.372  1.00 109.67 ? 156 VAL C N   1 
ATOM   5225  C CA  . VAL C 1 158 ? -14.094 80.501  22.075  1.00 109.95 ? 156 VAL C CA  1 
ATOM   5226  C C   . VAL C 1 158 ? -13.667 79.046  21.846  1.00 108.72 ? 156 VAL C C   1 
ATOM   5227  O O   . VAL C 1 158 ? -12.492 78.716  21.916  1.00 110.51 ? 156 VAL C O   1 
ATOM   5228  C CB  . VAL C 1 158 ? -12.840 81.415  21.933  1.00 110.87 ? 156 VAL C CB  1 
ATOM   5229  C CG1 . VAL C 1 158 ? -12.431 81.520  20.463  1.00 110.93 ? 156 VAL C CG1 1 
ATOM   5230  C CG2 . VAL C 1 158 ? -13.121 82.797  22.515  1.00 111.85 ? 156 VAL C CG2 1 
ATOM   5231  N N   . GLY C 1 159 ? -14.634 78.180  21.570  1.00 106.68 ? 157 GLY C N   1 
ATOM   5232  C CA  . GLY C 1 159 ? -14.340 76.784  21.334  1.00 101.85 ? 157 GLY C CA  1 
ATOM   5233  C C   . GLY C 1 159 ? -15.203 75.919  22.217  1.00 100.94 ? 157 GLY C C   1 
ATOM   5234  O O   . GLY C 1 159 ? -16.336 76.250  22.545  1.00 97.69  ? 157 GLY C O   1 
ATOM   5235  N N   . PHE C 1 160 ? -14.643 74.797  22.619  1.00 103.95 ? 158 PHE C N   1 
ATOM   5236  C CA  . PHE C 1 160 ? -15.355 73.852  23.452  1.00 108.81 ? 158 PHE C CA  1 
ATOM   5237  C C   . PHE C 1 160 ? -14.572 73.596  24.743  1.00 110.28 ? 158 PHE C C   1 
ATOM   5238  O O   . PHE C 1 160 ? -13.336 73.684  24.734  1.00 111.16 ? 158 PHE C O   1 
ATOM   5239  C CB  . PHE C 1 160 ? -15.524 72.570  22.664  1.00 113.22 ? 158 PHE C CB  1 
ATOM   5240  C CG  . PHE C 1 160 ? -15.857 71.405  23.504  1.00 118.35 ? 158 PHE C CG  1 
ATOM   5241  C CD1 . PHE C 1 160 ? -17.098 71.330  24.136  1.00 121.18 ? 158 PHE C CD1 1 
ATOM   5242  C CD2 . PHE C 1 160 ? -14.918 70.387  23.695  1.00 118.56 ? 158 PHE C CD2 1 
ATOM   5243  C CE1 . PHE C 1 160 ? -17.407 70.262  24.952  1.00 123.33 ? 158 PHE C CE1 1 
ATOM   5244  C CE2 . PHE C 1 160 ? -15.212 69.314  24.507  1.00 120.84 ? 158 PHE C CE2 1 
ATOM   5245  C CZ  . PHE C 1 160 ? -16.464 69.244  25.142  1.00 122.62 ? 158 PHE C CZ  1 
ATOM   5246  N N   . CYS C 1 161 ? -15.265 73.254  25.840  1.00 110.14 ? 159 CYS C N   1 
ATOM   5247  C CA  . CYS C 1 161 ? -14.562 73.057  27.125  1.00 107.90 ? 159 CYS C CA  1 
ATOM   5248  C C   . CYS C 1 161 ? -15.166 72.229  28.314  1.00 106.31 ? 159 CYS C C   1 
ATOM   5249  O O   . CYS C 1 161 ? -16.372 72.326  28.622  1.00 105.62 ? 159 CYS C O   1 
ATOM   5250  C CB  . CYS C 1 161 ? -14.172 74.451  27.638  1.00 108.69 ? 159 CYS C CB  1 
ATOM   5251  S SG  . CYS C 1 161 ? -13.153 74.491  29.107  1.00 111.52 ? 159 CYS C SG  1 
ATOM   5252  N N   . THR C 1 162 ? -14.290 71.427  28.952  1.00 104.29 ? 160 THR C N   1 
ATOM   5253  C CA  . THR C 1 162 ? -14.556 70.585  30.143  1.00 102.53 ? 160 THR C CA  1 
ATOM   5254  C C   . THR C 1 162 ? -13.217 70.059  30.672  1.00 101.24 ? 160 THR C C   1 
ATOM   5255  O O   . THR C 1 162 ? -12.217 70.027  29.951  1.00 100.66 ? 160 THR C O   1 
ATOM   5256  C CB  . THR C 1 162 ? -15.472 69.369  29.871  1.00 102.79 ? 160 THR C CB  1 
ATOM   5257  O OG1 . THR C 1 162 ? -16.810 69.815  29.606  1.00 105.22 ? 160 THR C OG1 1 
ATOM   5258  C CG2 . THR C 1 162 ? -15.503 68.460  31.088  1.00 99.37  ? 160 THR C CG2 1 
ATOM   5259  N N   . GLU C 1 163 ? -13.196 69.645  31.931  1.00 100.88 ? 161 GLU C N   1 
ATOM   5260  C CA  . GLU C 1 163 ? -11.967 69.168  32.539  1.00 99.75  ? 161 GLU C CA  1 
ATOM   5261  C C   . GLU C 1 163 ? -11.838 67.666  32.601  1.00 96.10  ? 161 GLU C C   1 
ATOM   5262  O O   . GLU C 1 163 ? -12.813 66.949  32.814  1.00 93.76  ? 161 GLU C O   1 
ATOM   5263  C CB  . GLU C 1 163 ? -11.874 69.717  33.947  1.00 104.89 ? 161 GLU C CB  1 
ATOM   5264  C CG  . GLU C 1 163 ? -13.081 69.350  34.800  1.00 112.78 ? 161 GLU C CG  1 
ATOM   5265  C CD  . GLU C 1 163 ? -13.132 70.127  36.106  1.00 116.49 ? 161 GLU C CD  1 
ATOM   5266  O OE1 . GLU C 1 163 ? -12.115 70.101  36.842  1.00 119.05 ? 161 GLU C OE1 1 
ATOM   5267  O OE2 . GLU C 1 163 ? -14.186 70.756  36.386  1.00 116.64 ? 161 GLU C OE2 1 
ATOM   5268  N N   . VAL C 1 164 ? -10.605 67.205  32.447  1.00 93.66  ? 162 VAL C N   1 
ATOM   5269  C CA  . VAL C 1 164 ? -10.295 65.785  32.493  1.00 94.16  ? 162 VAL C CA  1 
ATOM   5270  C C   . VAL C 1 164 ? -8.863  65.578  33.022  1.00 96.83  ? 162 VAL C C   1 
ATOM   5271  O O   . VAL C 1 164 ? -7.981  66.388  32.734  1.00 98.28  ? 162 VAL C O   1 
ATOM   5272  C CB  . VAL C 1 164 ? -10.428 65.184  31.093  1.00 92.77  ? 162 VAL C CB  1 
ATOM   5273  C CG1 . VAL C 1 164 ? -11.772 65.583  30.489  1.00 89.93  ? 162 VAL C CG1 1 
ATOM   5274  C CG2 . VAL C 1 164 ? -9.290  65.672  30.215  1.00 91.49  ? 162 VAL C CG2 1 
ATOM   5275  N N   . GLU C 1 165 ? -8.627  64.509  33.793  1.00 98.32  ? 163 GLU C N   1 
ATOM   5276  C CA  . GLU C 1 165 ? -7.293  64.247  34.366  1.00 98.89  ? 163 GLU C CA  1 
ATOM   5277  C C   . GLU C 1 165 ? -6.161  64.391  33.353  1.00 98.10  ? 163 GLU C C   1 
ATOM   5278  O O   . GLU C 1 165 ? -6.365  64.232  32.148  1.00 97.08  ? 163 GLU C O   1 
ATOM   5279  C CB  . GLU C 1 165 ? -7.255  62.863  35.026  1.00 103.16 ? 163 GLU C CB  1 
ATOM   5280  C CG  . GLU C 1 165 ? -8.148  62.747  36.283  1.00 113.68 ? 163 GLU C CG  1 
ATOM   5281  C CD  . GLU C 1 165 ? -8.054  61.388  37.030  1.00 120.11 ? 163 GLU C CD  1 
ATOM   5282  O OE1 . GLU C 1 165 ? -6.952  61.020  37.510  1.00 122.07 ? 163 GLU C OE1 1 
ATOM   5283  O OE2 . GLU C 1 165 ? -9.095  60.690  37.153  1.00 121.41 ? 163 GLU C OE2 1 
ATOM   5284  N N   . GLU C 1 166 ? -4.968  64.699  33.844  1.00 99.90  ? 164 GLU C N   1 
ATOM   5285  C CA  . GLU C 1 166 ? -3.827  64.904  32.965  1.00 102.98 ? 164 GLU C CA  1 
ATOM   5286  C C   . GLU C 1 166 ? -3.240  63.650  32.287  1.00 103.06 ? 164 GLU C C   1 
ATOM   5287  O O   . GLU C 1 166 ? -2.187  63.702  31.634  1.00 103.79 ? 164 GLU C O   1 
ATOM   5288  C CB  . GLU C 1 166 ? -2.736  65.662  33.724  1.00 106.24 ? 164 GLU C CB  1 
ATOM   5289  C CG  . GLU C 1 166 ? -1.586  66.134  32.838  1.00 109.81 ? 164 GLU C CG  1 
ATOM   5290  C CD  . GLU C 1 166 ? -0.618  67.022  33.570  1.00 111.12 ? 164 GLU C CD  1 
ATOM   5291  O OE1 . GLU C 1 166 ? -1.056  68.104  34.010  1.00 114.23 ? 164 GLU C OE1 1 
ATOM   5292  O OE2 . GLU C 1 166 ? 0.569   66.643  33.701  1.00 110.38 ? 164 GLU C OE2 1 
ATOM   5293  N N   . ASP C 1 167 ? -3.912  62.519  32.442  1.00 102.21 ? 165 ASP C N   1 
ATOM   5294  C CA  . ASP C 1 167 ? -3.467  61.276  31.796  1.00 101.32 ? 165 ASP C CA  1 
ATOM   5295  C C   . ASP C 1 167 ? -4.198  61.177  30.424  1.00 97.07  ? 165 ASP C C   1 
ATOM   5296  O O   . ASP C 1 167 ? -3.856  60.363  29.529  1.00 96.71  ? 165 ASP C O   1 
ATOM   5297  C CB  . ASP C 1 167 ? -3.783  60.044  32.696  1.00 104.67 ? 165 ASP C CB  1 
ATOM   5298  C CG  . ASP C 1 167 ? -5.211  60.068  33.316  1.00 103.90 ? 165 ASP C CG  1 
ATOM   5299  O OD1 . ASP C 1 167 ? -5.599  59.036  33.935  1.00 98.12  ? 165 ASP C OD1 1 
ATOM   5300  O OD2 . ASP C 1 167 ? -5.929  61.095  33.195  1.00 106.04 ? 165 ASP C OD2 1 
ATOM   5301  N N   . LEU C 1 168 ? -5.202  62.047  30.298  1.00 87.52  ? 166 LEU C N   1 
ATOM   5302  C CA  . LEU C 1 168 ? -6.036  62.169  29.131  1.00 74.80  ? 166 LEU C CA  1 
ATOM   5303  C C   . LEU C 1 168 ? -5.432  63.195  28.219  1.00 73.35  ? 166 LEU C C   1 
ATOM   5304  O O   . LEU C 1 168 ? -5.156  62.929  27.064  1.00 69.08  ? 166 LEU C O   1 
ATOM   5305  C CB  . LEU C 1 168 ? -7.433  62.591  29.565  1.00 64.53  ? 166 LEU C CB  1 
ATOM   5306  C CG  . LEU C 1 168 ? -8.122  61.461  30.335  1.00 61.27  ? 166 LEU C CG  1 
ATOM   5307  C CD1 . LEU C 1 168 ? -9.645  61.619  30.304  1.00 52.11  ? 166 LEU C CD1 1 
ATOM   5308  C CD2 . LEU C 1 168 ? -7.718  60.127  29.685  1.00 62.85  ? 166 LEU C CD2 1 
ATOM   5309  N N   . ILE C 1 169 ? -5.211  64.380  28.761  1.00 76.68  ? 167 ILE C N   1 
ATOM   5310  C CA  . ILE C 1 169 ? -4.628  65.484  28.002  1.00 80.46  ? 167 ILE C CA  1 
ATOM   5311  C C   . ILE C 1 169 ? -3.625  65.013  26.939  1.00 79.61  ? 167 ILE C C   1 
ATOM   5312  O O   . ILE C 1 169 ? -3.509  65.601  25.854  1.00 77.06  ? 167 ILE C O   1 
ATOM   5313  C CB  . ILE C 1 169 ? -3.953  66.506  28.958  1.00 82.28  ? 167 ILE C CB  1 
ATOM   5314  C CG1 . ILE C 1 169 ? -5.043  67.305  29.698  1.00 82.39  ? 167 ILE C CG1 1 
ATOM   5315  C CG2 . ILE C 1 169 ? -3.042  67.465  28.183  1.00 86.53  ? 167 ILE C CG2 1 
ATOM   5316  C CD1 . ILE C 1 169 ? -4.494  68.392  30.597  1.00 84.06  ? 167 ILE C CD1 1 
ATOM   5317  N N   . ASP C 1 170 ? -2.900  63.945  27.227  1.00 78.02  ? 168 ASP C N   1 
ATOM   5318  C CA  . ASP C 1 170 ? -1.945  63.480  26.237  1.00 76.48  ? 168 ASP C CA  1 
ATOM   5319  C C   . ASP C 1 170 ? -2.663  62.862  25.073  1.00 69.55  ? 168 ASP C C   1 
ATOM   5320  O O   . ASP C 1 170 ? -2.201  62.956  23.951  1.00 67.19  ? 168 ASP C O   1 
ATOM   5321  C CB  . ASP C 1 170 ? -0.988  62.489  26.867  1.00 84.61  ? 168 ASP C CB  1 
ATOM   5322  C CG  . ASP C 1 170 ? -0.162  63.130  27.970  1.00 92.83  ? 168 ASP C CG  1 
ATOM   5323  O OD1 . ASP C 1 170 ? 0.530   64.121  27.645  1.00 93.56  ? 168 ASP C OD1 1 
ATOM   5324  O OD2 . ASP C 1 170 ? -0.206  62.668  29.142  1.00 100.78 ? 168 ASP C OD2 1 
ATOM   5325  N N   . ALA C 1 171 ? -3.801  62.238  25.349  1.00 66.06  ? 169 ALA C N   1 
ATOM   5326  C CA  . ALA C 1 171 ? -4.610  61.595  24.308  1.00 61.86  ? 169 ALA C CA  1 
ATOM   5327  C C   . ALA C 1 171 ? -5.311  62.678  23.527  1.00 59.14  ? 169 ALA C C   1 
ATOM   5328  O O   . ALA C 1 171 ? -5.255  62.738  22.301  1.00 58.42  ? 169 ALA C O   1 
ATOM   5329  C CB  . ALA C 1 171 ? -5.652  60.687  24.926  1.00 59.82  ? 169 ALA C CB  1 
ATOM   5330  N N   . VAL C 1 172 ? -5.988  63.548  24.255  1.00 54.74  ? 170 VAL C N   1 
ATOM   5331  C CA  . VAL C 1 172 ? -6.690  64.630  23.609  1.00 54.13  ? 170 VAL C CA  1 
ATOM   5332  C C   . VAL C 1 172 ? -5.803  65.178  22.492  1.00 57.36  ? 170 VAL C C   1 
ATOM   5333  O O   . VAL C 1 172 ? -6.230  65.332  21.332  1.00 61.65  ? 170 VAL C O   1 
ATOM   5334  C CB  . VAL C 1 172 ? -7.022  65.742  24.623  1.00 49.90  ? 170 VAL C CB  1 
ATOM   5335  C CG1 . VAL C 1 172 ? -7.804  66.833  23.948  1.00 51.13  ? 170 VAL C CG1 1 
ATOM   5336  C CG2 . VAL C 1 172 ? -7.837  65.181  25.769  1.00 51.65  ? 170 VAL C CG2 1 
ATOM   5337  N N   . THR C 1 173 ? -4.553  65.444  22.848  1.00 58.42  ? 171 THR C N   1 
ATOM   5338  C CA  . THR C 1 173 ? -3.566  65.965  21.910  1.00 59.51  ? 171 THR C CA  1 
ATOM   5339  C C   . THR C 1 173 ? -3.675  65.240  20.576  1.00 60.53  ? 171 THR C C   1 
ATOM   5340  O O   . THR C 1 173 ? -3.946  65.851  19.531  1.00 62.81  ? 171 THR C O   1 
ATOM   5341  C CB  . THR C 1 173 ? -2.130  65.743  22.412  1.00 58.86  ? 171 THR C CB  1 
ATOM   5342  O OG1 . THR C 1 173 ? -2.070  65.956  23.833  1.00 66.20  ? 171 THR C OG1 1 
ATOM   5343  C CG2 . THR C 1 173 ? -1.175  66.690  21.702  1.00 56.32  ? 171 THR C CG2 1 
ATOM   5344  N N   . GLY C 1 174 ? -3.445  63.932  20.631  1.00 58.74  ? 172 GLY C N   1 
ATOM   5345  C CA  . GLY C 1 174 ? -3.508  63.108  19.436  1.00 56.12  ? 172 GLY C CA  1 
ATOM   5346  C C   . GLY C 1 174 ? -4.805  63.291  18.678  1.00 52.57  ? 172 GLY C C   1 
ATOM   5347  O O   . GLY C 1 174 ? -4.796  63.303  17.445  1.00 49.90  ? 172 GLY C O   1 
ATOM   5348  N N   . LEU C 1 175 ? -5.917  63.444  19.397  1.00 49.50  ? 173 LEU C N   1 
ATOM   5349  C CA  . LEU C 1 175 ? -7.197  63.620  18.730  1.00 49.03  ? 173 LEU C CA  1 
ATOM   5350  C C   . LEU C 1 175 ? -7.369  65.067  18.241  1.00 49.43  ? 173 LEU C C   1 
ATOM   5351  O O   . LEU C 1 175 ? -6.773  65.483  17.243  1.00 45.03  ? 173 LEU C O   1 
ATOM   5352  C CB  . LEU C 1 175 ? -8.345  63.211  19.669  1.00 46.13  ? 173 LEU C CB  1 
ATOM   5353  C CG  . LEU C 1 175 ? -9.700  62.893  19.009  1.00 44.61  ? 173 LEU C CG  1 
ATOM   5354  C CD1 . LEU C 1 175 ? -9.496  61.867  17.921  1.00 53.53  ? 173 LEU C CD1 1 
ATOM   5355  C CD2 . LEU C 1 175 ? -10.691 62.349  20.016  1.00 46.58  ? 173 LEU C CD2 1 
ATOM   5356  N N   . SER C 1 176 ? -8.170  65.837  18.953  1.00 51.07  ? 174 SER C N   1 
ATOM   5357  C CA  . SER C 1 176 ? -8.401  67.218  18.580  1.00 53.77  ? 174 SER C CA  1 
ATOM   5358  C C   . SER C 1 176 ? -7.102  67.999  18.449  1.00 57.33  ? 174 SER C C   1 
ATOM   5359  O O   . SER C 1 176 ? -7.012  68.931  17.649  1.00 61.53  ? 174 SER C O   1 
ATOM   5360  C CB  . SER C 1 176 ? -9.253  67.894  19.629  1.00 55.38  ? 174 SER C CB  1 
ATOM   5361  O OG  . SER C 1 176 ? -8.489  68.085  20.803  1.00 54.83  ? 174 SER C OG  1 
ATOM   5362  N N   . GLY C 1 177 ? -6.099  67.631  19.243  1.00 57.86  ? 175 GLY C N   1 
ATOM   5363  C CA  . GLY C 1 177 ? -4.827  68.331  19.180  1.00 61.77  ? 175 GLY C CA  1 
ATOM   5364  C C   . GLY C 1 177 ? -4.160  68.398  17.809  1.00 64.91  ? 175 GLY C C   1 
ATOM   5365  O O   . GLY C 1 177 ? -3.838  69.484  17.286  1.00 64.88  ? 175 GLY C O   1 
ATOM   5366  N N   . SER C 1 178 ? -3.923  67.222  17.233  1.00 67.27  ? 176 SER C N   1 
ATOM   5367  C CA  . SER C 1 178 ? -3.306  67.128  15.909  1.00 68.84  ? 176 SER C CA  1 
ATOM   5368  C C   . SER C 1 178 ? -4.392  66.988  14.822  1.00 68.67  ? 176 SER C C   1 
ATOM   5369  O O   . SER C 1 178 ? -4.156  67.288  13.645  1.00 68.82  ? 176 SER C O   1 
ATOM   5370  C CB  . SER C 1 178 ? -2.323  65.941  15.873  1.00 66.82  ? 176 SER C CB  1 
ATOM   5371  O OG  . SER C 1 178 ? -1.232  66.173  16.746  1.00 63.72  ? 176 SER C OG  1 
ATOM   5372  N N   . GLY C 1 179 ? -5.581  66.558  15.245  1.00 66.05  ? 177 GLY C N   1 
ATOM   5373  C CA  . GLY C 1 179 ? -6.709  66.388  14.341  1.00 64.82  ? 177 GLY C CA  1 
ATOM   5374  C C   . GLY C 1 179 ? -6.790  67.282  13.107  1.00 65.85  ? 177 GLY C C   1 
ATOM   5375  O O   . GLY C 1 179 ? -6.921  66.795  11.988  1.00 66.00  ? 177 GLY C O   1 
ATOM   5376  N N   . PRO C 1 180 ? -6.725  68.609  13.285  1.00 66.92  ? 178 PRO C N   1 
ATOM   5377  C CA  . PRO C 1 180 ? -6.784  69.670  12.263  1.00 62.48  ? 178 PRO C CA  1 
ATOM   5378  C C   . PRO C 1 180 ? -5.821  69.485  11.119  1.00 59.39  ? 178 PRO C C   1 
ATOM   5379  O O   . PRO C 1 180 ? -5.967  70.093  10.055  1.00 57.35  ? 178 PRO C O   1 
ATOM   5380  C CB  . PRO C 1 180 ? -6.453  70.914  13.055  1.00 65.21  ? 178 PRO C CB  1 
ATOM   5381  C CG  . PRO C 1 180 ? -7.055  70.608  14.406  1.00 67.89  ? 178 PRO C CG  1 
ATOM   5382  C CD  . PRO C 1 180 ? -6.600  69.198  14.633  1.00 69.45  ? 178 PRO C CD  1 
ATOM   5383  N N   . ALA C 1 181 ? -4.800  68.685  11.359  1.00 55.09  ? 179 ALA C N   1 
ATOM   5384  C CA  . ALA C 1 181 ? -3.854  68.440  10.316  1.00 52.02  ? 179 ALA C CA  1 
ATOM   5385  C C   . ALA C 1 181 ? -4.355  67.179  9.583   1.00 51.69  ? 179 ALA C C   1 
ATOM   5386  O O   . ALA C 1 181 ? -3.992  66.889  8.443   1.00 51.55  ? 179 ALA C O   1 
ATOM   5387  C CB  . ALA C 1 181 ? -2.474  68.252  10.930  1.00 54.67  ? 179 ALA C CB  1 
ATOM   5388  N N   . TYR C 1 182 ? -5.194  66.401  10.234  1.00 49.14  ? 180 TYR C N   1 
ATOM   5389  C CA  . TYR C 1 182 ? -5.705  65.247  9.532   1.00 48.47  ? 180 TYR C CA  1 
ATOM   5390  C C   . TYR C 1 182 ? -6.611  65.866  8.515   1.00 44.90  ? 180 TYR C C   1 
ATOM   5391  O O   . TYR C 1 182 ? -6.547  65.543  7.351   1.00 46.08  ? 180 TYR C O   1 
ATOM   5392  C CB  . TYR C 1 182 ? -6.536  64.413  10.462  1.00 51.29  ? 180 TYR C CB  1 
ATOM   5393  C CG  . TYR C 1 182 ? -5.773  64.052  11.686  1.00 58.91  ? 180 TYR C CG  1 
ATOM   5394  C CD1 . TYR C 1 182 ? -6.425  63.564  12.820  1.00 61.25  ? 180 TYR C CD1 1 
ATOM   5395  C CD2 . TYR C 1 182 ? -4.370  64.152  11.704  1.00 61.72  ? 180 TYR C CD2 1 
ATOM   5396  C CE1 . TYR C 1 182 ? -5.695  63.178  13.945  1.00 62.37  ? 180 TYR C CE1 1 
ATOM   5397  C CE2 . TYR C 1 182 ? -3.637  63.770  12.816  1.00 59.71  ? 180 TYR C CE2 1 
ATOM   5398  C CZ  . TYR C 1 182 ? -4.316  63.280  13.931  1.00 61.13  ? 180 TYR C CZ  1 
ATOM   5399  O OH  . TYR C 1 182 ? -3.654  62.852  15.041  1.00 64.67  ? 180 TYR C OH  1 
ATOM   5400  N N   . ALA C 1 183 ? -7.453  66.770  9.013   1.00 44.22  ? 181 ALA C N   1 
ATOM   5401  C CA  . ALA C 1 183 ? -8.450  67.524  8.248   1.00 42.57  ? 181 ALA C CA  1 
ATOM   5402  C C   . ALA C 1 183 ? -7.871  68.311  7.063   1.00 43.26  ? 181 ALA C C   1 
ATOM   5403  O O   . ALA C 1 183 ? -8.336  68.150  5.924   1.00 41.31  ? 181 ALA C O   1 
ATOM   5404  C CB  . ALA C 1 183 ? -9.198  68.452  9.179   1.00 36.59  ? 181 ALA C CB  1 
ATOM   5405  N N   . PHE C 1 184 ? -6.866  69.147  7.305   1.00 41.76  ? 182 PHE C N   1 
ATOM   5406  C CA  . PHE C 1 184 ? -6.288  69.881  6.194   1.00 45.30  ? 182 PHE C CA  1 
ATOM   5407  C C   . PHE C 1 184 ? -5.845  68.929  5.124   1.00 45.64  ? 182 PHE C C   1 
ATOM   5408  O O   . PHE C 1 184 ? -5.936  69.236  3.934   1.00 49.85  ? 182 PHE C O   1 
ATOM   5409  C CB  . PHE C 1 184 ? -5.090  70.706  6.638   1.00 48.27  ? 182 PHE C CB  1 
ATOM   5410  C CG  . PHE C 1 184 ? -5.456  71.783  7.587   1.00 57.71  ? 182 PHE C CG  1 
ATOM   5411  C CD1 . PHE C 1 184 ? -4.546  72.250  8.525   1.00 60.69  ? 182 PHE C CD1 1 
ATOM   5412  C CD2 . PHE C 1 184 ? -6.764  72.291  7.588   1.00 59.26  ? 182 PHE C CD2 1 
ATOM   5413  C CE1 . PHE C 1 184 ? -4.947  73.204  9.457   1.00 60.45  ? 182 PHE C CE1 1 
ATOM   5414  C CE2 . PHE C 1 184 ? -7.176  73.242  8.511   1.00 58.71  ? 182 PHE C CE2 1 
ATOM   5415  C CZ  . PHE C 1 184 ? -6.276  73.697  9.447   1.00 58.31  ? 182 PHE C CZ  1 
ATOM   5416  N N   . THR C 1 185 ? -5.371  67.762  5.546   1.00 47.40  ? 183 THR C N   1 
ATOM   5417  C CA  . THR C 1 185 ? -4.889  66.749  4.617   1.00 47.52  ? 183 THR C CA  1 
ATOM   5418  C C   . THR C 1 185 ? -6.114  66.194  3.882   1.00 52.10  ? 183 THR C C   1 
ATOM   5419  O O   . THR C 1 185 ? -6.132  66.165  2.645   1.00 54.31  ? 183 THR C O   1 
ATOM   5420  C CB  . THR C 1 185 ? -4.129  65.621  5.362   1.00 47.02  ? 183 THR C CB  1 
ATOM   5421  O OG1 . THR C 1 185 ? -2.933  66.156  5.940   1.00 40.77  ? 183 THR C OG1 1 
ATOM   5422  C CG2 . THR C 1 185 ? -3.751  64.477  4.389   1.00 46.20  ? 183 THR C CG2 1 
ATOM   5423  N N   . ALA C 1 186 ? -7.146  65.798  4.628   1.00 50.87  ? 184 ALA C N   1 
ATOM   5424  C CA  . ALA C 1 186 ? -8.357  65.278  4.007   1.00 53.71  ? 184 ALA C CA  1 
ATOM   5425  C C   . ALA C 1 186 ? -8.959  66.242  2.960   1.00 54.25  ? 184 ALA C C   1 
ATOM   5426  O O   . ALA C 1 186 ? -9.727  65.816  2.097   1.00 56.50  ? 184 ALA C O   1 
ATOM   5427  C CB  . ALA C 1 186 ? -9.383  64.955  5.065   1.00 52.23  ? 184 ALA C CB  1 
ATOM   5428  N N   . LEU C 1 187 ? -8.628  67.530  3.049   1.00 52.64  ? 185 LEU C N   1 
ATOM   5429  C CA  . LEU C 1 187 ? -9.121  68.508  2.089   1.00 48.79  ? 185 LEU C CA  1 
ATOM   5430  C C   . LEU C 1 187 ? -8.265  68.555  0.860   1.00 48.07  ? 185 LEU C C   1 
ATOM   5431  O O   . LEU C 1 187 ? -8.784  68.400  -0.236  1.00 54.01  ? 185 LEU C O   1 
ATOM   5432  C CB  . LEU C 1 187 ? -9.207  69.887  2.705   1.00 49.80  ? 185 LEU C CB  1 
ATOM   5433  C CG  . LEU C 1 187 ? -10.339 69.860  3.756   1.00 56.53  ? 185 LEU C CG  1 
ATOM   5434  C CD1 . LEU C 1 187 ? -10.695 71.253  4.285   1.00 52.17  ? 185 LEU C CD1 1 
ATOM   5435  C CD2 . LEU C 1 187 ? -11.591 69.255  3.101   1.00 63.73  ? 185 LEU C CD2 1 
ATOM   5436  N N   . ASP C 1 188 ? -6.956  68.748  0.997   1.00 43.65  ? 186 ASP C N   1 
ATOM   5437  C CA  . ASP C 1 188 ? -6.147  68.767  -0.217  1.00 42.76  ? 186 ASP C CA  1 
ATOM   5438  C C   . ASP C 1 188 ? -6.479  67.521  -1.040  1.00 45.03  ? 186 ASP C C   1 
ATOM   5439  O O   . ASP C 1 188 ? -6.380  67.525  -2.256  1.00 49.42  ? 186 ASP C O   1 
ATOM   5440  C CB  . ASP C 1 188 ? -4.643  68.797  0.096   1.00 47.42  ? 186 ASP C CB  1 
ATOM   5441  C CG  . ASP C 1 188 ? -3.810  69.456  -1.023  1.00 56.19  ? 186 ASP C CG  1 
ATOM   5442  O OD1 . ASP C 1 188 ? -4.391  70.222  -1.835  1.00 66.45  ? 186 ASP C OD1 1 
ATOM   5443  O OD2 . ASP C 1 188 ? -2.567  69.242  -1.088  1.00 54.68  ? 186 ASP C OD2 1 
ATOM   5444  N N   . ALA C 1 189 ? -6.902  66.445  -0.381  1.00 47.87  ? 187 ALA C N   1 
ATOM   5445  C CA  . ALA C 1 189 ? -7.230  65.188  -1.074  1.00 41.04  ? 187 ALA C CA  1 
ATOM   5446  C C   . ALA C 1 189 ? -8.550  65.316  -1.768  1.00 43.40  ? 187 ALA C C   1 
ATOM   5447  O O   . ALA C 1 189 ? -8.597  65.365  -2.983  1.00 44.63  ? 187 ALA C O   1 
ATOM   5448  C CB  . ALA C 1 189 ? -7.308  64.048  -0.093  1.00 36.73  ? 187 ALA C CB  1 
ATOM   5449  N N   . LEU C 1 190 ? -9.626  65.324  -0.987  1.00 43.25  ? 188 LEU C N   1 
ATOM   5450  C CA  . LEU C 1 190 ? -10.959 65.482  -1.527  1.00 43.42  ? 188 LEU C CA  1 
ATOM   5451  C C   . LEU C 1 190 ? -10.934 66.498  -2.641  1.00 47.75  ? 188 LEU C C   1 
ATOM   5452  O O   . LEU C 1 190 ? -11.286 66.195  -3.781  1.00 52.45  ? 188 LEU C O   1 
ATOM   5453  C CB  . LEU C 1 190 ? -11.875 66.002  -0.459  1.00 38.66  ? 188 LEU C CB  1 
ATOM   5454  C CG  . LEU C 1 190 ? -12.162 64.933  0.546   1.00 40.30  ? 188 LEU C CG  1 
ATOM   5455  C CD1 . LEU C 1 190 ? -13.051 65.555  1.597   1.00 41.46  ? 188 LEU C CD1 1 
ATOM   5456  C CD2 . LEU C 1 190 ? -12.849 63.736  -0.119  1.00 41.10  ? 188 LEU C CD2 1 
ATOM   5457  N N   . ALA C 1 191 ? -10.529 67.714  -2.288  1.00 47.13  ? 189 ALA C N   1 
ATOM   5458  C CA  . ALA C 1 191 ? -10.457 68.821  -3.223  1.00 44.19  ? 189 ALA C CA  1 
ATOM   5459  C C   . ALA C 1 191 ? -9.281  68.695  -4.154  1.00 45.32  ? 189 ALA C C   1 
ATOM   5460  O O   . ALA C 1 191 ? -8.511  69.620  -4.328  1.00 45.70  ? 189 ALA C O   1 
ATOM   5461  C CB  . ALA C 1 191 ? -10.368 70.108  -2.463  1.00 52.11  ? 189 ALA C CB  1 
ATOM   5462  N N   . ASP C 1 192 ? -9.141  67.522  -4.745  1.00 52.69  ? 190 ASP C N   1 
ATOM   5463  C CA  . ASP C 1 192 ? -8.052  67.192  -5.662  1.00 55.23  ? 190 ASP C CA  1 
ATOM   5464  C C   . ASP C 1 192 ? -8.668  66.063  -6.411  1.00 55.08  ? 190 ASP C C   1 
ATOM   5465  O O   . ASP C 1 192 ? -8.471  65.907  -7.611  1.00 56.46  ? 190 ASP C O   1 
ATOM   5466  C CB  . ASP C 1 192 ? -6.820  66.681  -4.916  1.00 55.15  ? 190 ASP C CB  1 
ATOM   5467  C CG  . ASP C 1 192 ? -5.584  67.477  -5.241  1.00 61.66  ? 190 ASP C CG  1 
ATOM   5468  O OD1 . ASP C 1 192 ? -4.490  67.080  -4.805  1.00 62.77  ? 190 ASP C OD1 1 
ATOM   5469  O OD2 . ASP C 1 192 ? -5.698  68.511  -5.937  1.00 68.05  ? 190 ASP C OD2 1 
ATOM   5470  N N   . GLY C 1 193 ? -9.395  65.248  -5.665  1.00 54.14  ? 191 GLY C N   1 
ATOM   5471  C CA  . GLY C 1 193 ? -10.114 64.183  -6.296  1.00 56.22  ? 191 GLY C CA  1 
ATOM   5472  C C   . GLY C 1 193 ? -11.057 65.032  -7.130  1.00 58.95  ? 191 GLY C C   1 
ATOM   5473  O O   . GLY C 1 193 ? -11.070 64.962  -8.368  1.00 61.51  ? 191 GLY C O   1 
ATOM   5474  N N   . GLY C 1 194 ? -11.806 65.895  -6.446  1.00 58.38  ? 192 GLY C N   1 
ATOM   5475  C CA  . GLY C 1 194 ? -12.761 66.753  -7.137  1.00 58.13  ? 192 GLY C CA  1 
ATOM   5476  C C   . GLY C 1 194 ? -12.245 67.483  -8.377  1.00 56.10  ? 192 GLY C C   1 
ATOM   5477  O O   . GLY C 1 194 ? -12.976 67.755  -9.348  1.00 51.92  ? 192 GLY C O   1 
ATOM   5478  N N   . VAL C 1 195 ? -10.971 67.822  -8.358  1.00 53.36  ? 193 VAL C N   1 
ATOM   5479  C CA  . VAL C 1 195 ? -10.449 68.503  -9.498  1.00 51.27  ? 193 VAL C CA  1 
ATOM   5480  C C   . VAL C 1 195 ? -10.417 67.478  -10.615 1.00 53.30  ? 193 VAL C C   1 
ATOM   5481  O O   . VAL C 1 195 ? -10.809 67.764  -11.749 1.00 57.32  ? 193 VAL C O   1 
ATOM   5482  C CB  . VAL C 1 195 ? -9.048  69.071  -9.211  1.00 47.26  ? 193 VAL C CB  1 
ATOM   5483  C CG1 . VAL C 1 195 ? -8.491  69.734  -10.439 1.00 40.90  ? 193 VAL C CG1 1 
ATOM   5484  C CG2 . VAL C 1 195 ? -9.143  70.090  -8.105  1.00 48.23  ? 193 VAL C CG2 1 
ATOM   5485  N N   . LYS C 1 196 ? -9.986  66.265  -10.286 1.00 53.34  ? 194 LYS C N   1 
ATOM   5486  C CA  . LYS C 1 196 ? -9.873  65.192  -11.280 1.00 51.71  ? 194 LYS C CA  1 
ATOM   5487  C C   . LYS C 1 196 ? -11.211 64.920  -11.972 1.00 48.94  ? 194 LYS C C   1 
ATOM   5488  O O   . LYS C 1 196 ? -11.241 64.455  -13.097 1.00 52.17  ? 194 LYS C O   1 
ATOM   5489  C CB  . LYS C 1 196 ? -9.347  63.920  -10.591 1.00 52.25  ? 194 LYS C CB  1 
ATOM   5490  C CG  . LYS C 1 196 ? -8.876  62.807  -11.541 1.00 54.14  ? 194 LYS C CG  1 
ATOM   5491  C CD  . LYS C 1 196 ? -8.626  61.437  -10.840 1.00 49.71  ? 194 LYS C CD  1 
ATOM   5492  C CE  . LYS C 1 196 ? -8.384  60.285  -11.845 1.00 48.04  ? 194 LYS C CE  1 
ATOM   5493  N NZ  . LYS C 1 196 ? -8.333  58.907  -11.269 1.00 51.96  ? 194 LYS C NZ  1 
ATOM   5494  N N   . MET C 1 197 ? -12.306 65.207  -11.285 1.00 43.60  ? 195 MET C N   1 
ATOM   5495  C CA  . MET C 1 197 ? -13.616 65.000  -11.839 1.00 45.75  ? 195 MET C CA  1 
ATOM   5496  C C   . MET C 1 197 ? -14.159 66.275  -12.508 1.00 51.38  ? 195 MET C C   1 
ATOM   5497  O O   . MET C 1 197 ? -15.378 66.444  -12.672 1.00 55.61  ? 195 MET C O   1 
ATOM   5498  C CB  . MET C 1 197 ? -14.549 64.530  -10.736 1.00 42.27  ? 195 MET C CB  1 
ATOM   5499  C CG  . MET C 1 197 ? -14.815 63.067  -10.769 1.00 53.06  ? 195 MET C CG  1 
ATOM   5500  S SD  . MET C 1 197 ? -13.338 62.173  -11.054 1.00 64.32  ? 195 MET C SD  1 
ATOM   5501  C CE  . MET C 1 197 ? -13.686 61.428  -12.652 1.00 60.81  ? 195 MET C CE  1 
ATOM   5502  N N   . GLY C 1 198 ? -13.264 67.181  -12.903 1.00 51.34  ? 196 GLY C N   1 
ATOM   5503  C CA  . GLY C 1 198 ? -13.717 68.406  -13.532 1.00 49.13  ? 196 GLY C CA  1 
ATOM   5504  C C   . GLY C 1 198 ? -13.479 69.654  -12.708 1.00 49.56  ? 196 GLY C C   1 
ATOM   5505  O O   . GLY C 1 198 ? -12.451 70.254  -12.874 1.00 53.83  ? 196 GLY C O   1 
ATOM   5506  N N   . LEU C 1 199 ? -14.395 70.032  -11.819 1.00 47.48  ? 197 LEU C N   1 
ATOM   5507  C CA  . LEU C 1 199 ? -14.269 71.249  -10.990 1.00 51.42  ? 197 LEU C CA  1 
ATOM   5508  C C   . LEU C 1 199 ? -12.962 72.095  -10.923 1.00 56.47  ? 197 LEU C C   1 
ATOM   5509  O O   . LEU C 1 199 ? -11.836 71.568  -11.003 1.00 56.84  ? 197 LEU C O   1 
ATOM   5510  C CB  . LEU C 1 199 ? -14.590 70.935  -9.535  1.00 50.00  ? 197 LEU C CB  1 
ATOM   5511  C CG  . LEU C 1 199 ? -15.722 70.011  -9.142  1.00 55.57  ? 197 LEU C CG  1 
ATOM   5512  C CD1 . LEU C 1 199 ? -15.962 70.166  -7.623  1.00 55.00  ? 197 LEU C CD1 1 
ATOM   5513  C CD2 . LEU C 1 199 ? -16.974 70.361  -9.931  1.00 57.12  ? 197 LEU C CD2 1 
ATOM   5514  N N   . PRO C 1 200 ? -13.105 73.429  -10.724 1.00 57.26  ? 198 PRO C N   1 
ATOM   5515  C CA  . PRO C 1 200 ? -11.978 74.361  -10.609 1.00 55.09  ? 198 PRO C CA  1 
ATOM   5516  C C   . PRO C 1 200 ? -11.466 74.215  -9.176  1.00 54.70  ? 198 PRO C C   1 
ATOM   5517  O O   . PRO C 1 200 ? -12.245 74.063  -8.226  1.00 47.43  ? 198 PRO C O   1 
ATOM   5518  C CB  . PRO C 1 200 ? -12.622 75.711  -10.852 1.00 56.09  ? 198 PRO C CB  1 
ATOM   5519  C CG  . PRO C 1 200 ? -13.938 75.550  -10.231 1.00 57.69  ? 198 PRO C CG  1 
ATOM   5520  C CD  . PRO C 1 200 ? -14.361 74.188  -10.793 1.00 57.20  ? 198 PRO C CD  1 
ATOM   5521  N N   . ARG C 1 201 ? -10.151 74.227  -9.041  1.00 55.52  ? 199 ARG C N   1 
ATOM   5522  C CA  . ARG C 1 201 ? -9.512  74.025  -7.761  1.00 60.94  ? 199 ARG C CA  1 
ATOM   5523  C C   . ARG C 1 201 ? -10.158 74.790  -6.617  1.00 65.14  ? 199 ARG C C   1 
ATOM   5524  O O   . ARG C 1 201 ? -10.600 74.189  -5.642  1.00 69.67  ? 199 ARG C O   1 
ATOM   5525  C CB  . ARG C 1 201 ? -8.020  74.361  -7.851  1.00 57.77  ? 199 ARG C CB  1 
ATOM   5526  C CG  . ARG C 1 201 ? -7.286  74.115  -6.554  1.00 60.20  ? 199 ARG C CG  1 
ATOM   5527  C CD  . ARG C 1 201 ? -7.268  72.656  -6.133  1.00 60.45  ? 199 ARG C CD  1 
ATOM   5528  N NE  . ARG C 1 201 ? -7.217  72.516  -4.674  1.00 71.33  ? 199 ARG C NE  1 
ATOM   5529  C CZ  . ARG C 1 201 ? -6.332  71.772  -3.998  1.00 75.55  ? 199 ARG C CZ  1 
ATOM   5530  N NH1 . ARG C 1 201 ? -5.395  71.092  -4.652  1.00 75.06  ? 199 ARG C NH1 1 
ATOM   5531  N NH2 . ARG C 1 201 ? -6.395  71.681  -2.665  1.00 69.47  ? 199 ARG C NH2 1 
ATOM   5532  N N   . ARG C 1 202 ? -10.218 76.109  -6.732  1.00 65.83  ? 200 ARG C N   1 
ATOM   5533  C CA  . ARG C 1 202 ? -10.773 76.912  -5.667  1.00 63.20  ? 200 ARG C CA  1 
ATOM   5534  C C   . ARG C 1 202 ? -12.069 76.361  -5.179  1.00 57.83  ? 200 ARG C C   1 
ATOM   5535  O O   . ARG C 1 202 ? -12.360 76.341  -3.985  1.00 55.48  ? 200 ARG C O   1 
ATOM   5536  C CB  . ARG C 1 202 ? -10.993 78.318  -6.147  1.00 73.30  ? 200 ARG C CB  1 
ATOM   5537  C CG  . ARG C 1 202 ? -10.150 79.320  -5.415  1.00 84.12  ? 200 ARG C CG  1 
ATOM   5538  C CD  . ARG C 1 202 ? -10.974 80.046  -4.385  1.00 90.72  ? 200 ARG C CD  1 
ATOM   5539  N NE  . ARG C 1 202 ? -10.453 81.395  -4.212  1.00 99.13  ? 200 ARG C NE  1 
ATOM   5540  C CZ  . ARG C 1 202 ? -11.081 82.356  -3.549  1.00 102.74 ? 200 ARG C CZ  1 
ATOM   5541  N NH1 . ARG C 1 202 ? -12.262 82.114  -2.991  1.00 103.67 ? 200 ARG C NH1 1 
ATOM   5542  N NH2 . ARG C 1 202 ? -10.528 83.558  -3.451  1.00 106.46 ? 200 ARG C NH2 1 
ATOM   5543  N N   . LEU C 1 203 ? -12.852 75.895  -6.132  1.00 56.60  ? 201 LEU C N   1 
ATOM   5544  C CA  . LEU C 1 203 ? -14.168 75.333  -5.849  1.00 54.66  ? 201 LEU C CA  1 
ATOM   5545  C C   . LEU C 1 203 ? -14.163 73.942  -5.196  1.00 53.93  ? 201 LEU C C   1 
ATOM   5546  O O   . LEU C 1 203 ? -15.038 73.627  -4.355  1.00 49.72  ? 201 LEU C O   1 
ATOM   5547  C CB  . LEU C 1 203 ? -15.011 75.317  -7.132  1.00 53.26  ? 201 LEU C CB  1 
ATOM   5548  C CG  . LEU C 1 203 ? -16.441 74.779  -6.949  1.00 51.10  ? 201 LEU C CG  1 
ATOM   5549  C CD1 . LEU C 1 203 ? -17.125 75.475  -5.773  1.00 49.19  ? 201 LEU C CD1 1 
ATOM   5550  C CD2 . LEU C 1 203 ? -17.223 74.949  -8.241  1.00 52.14  ? 201 LEU C CD2 1 
ATOM   5551  N N   . ALA C 1 204 ? -13.203 73.106  -5.584  1.00 50.31  ? 202 ALA C N   1 
ATOM   5552  C CA  . ALA C 1 204 ? -13.125 71.796  -4.965  1.00 49.82  ? 202 ALA C CA  1 
ATOM   5553  C C   . ALA C 1 204 ? -12.935 72.035  -3.443  1.00 50.49  ? 202 ALA C C   1 
ATOM   5554  O O   . ALA C 1 204 ? -13.645 71.471  -2.583  1.00 46.27  ? 202 ALA C O   1 
ATOM   5555  C CB  . ALA C 1 204 ? -11.937 71.032  -5.536  1.00 46.69  ? 202 ALA C CB  1 
ATOM   5556  N N   . VAL C 1 205 ? -11.986 72.919  -3.146  1.00 47.45  ? 203 VAL C N   1 
ATOM   5557  C CA  . VAL C 1 205 ? -11.606 73.246  -1.798  1.00 47.31  ? 203 VAL C CA  1 
ATOM   5558  C C   . VAL C 1 205 ? -12.679 73.727  -0.857  1.00 52.29  ? 203 VAL C C   1 
ATOM   5559  O O   . VAL C 1 205 ? -12.919 73.100  0.184   1.00 52.79  ? 203 VAL C O   1 
ATOM   5560  C CB  . VAL C 1 205 ? -10.522 74.271  -1.818  1.00 47.56  ? 203 VAL C CB  1 
ATOM   5561  C CG1 . VAL C 1 205 ? -9.891  74.348  -0.471  1.00 51.84  ? 203 VAL C CG1 1 
ATOM   5562  C CG2 . VAL C 1 205 ? -9.516  73.926  -2.896  1.00 51.08  ? 203 VAL C CG2 1 
ATOM   5563  N N   . ARG C 1 206 ? -13.311 74.850  -1.206  1.00 58.56  ? 204 ARG C N   1 
ATOM   5564  C CA  . ARG C 1 206 ? -14.359 75.439  -0.356  1.00 62.17  ? 204 ARG C CA  1 
ATOM   5565  C C   . ARG C 1 206 ? -15.539 74.492  -0.204  1.00 59.58  ? 204 ARG C C   1 
ATOM   5566  O O   . ARG C 1 206 ? -16.202 74.436  0.837   1.00 59.87  ? 204 ARG C O   1 
ATOM   5567  C CB  . ARG C 1 206 ? -14.864 76.785  -0.920  1.00 68.69  ? 204 ARG C CB  1 
ATOM   5568  C CG  . ARG C 1 206 ? -13.785 77.830  -1.321  1.00 74.78  ? 204 ARG C CG  1 
ATOM   5569  C CD  . ARG C 1 206 ? -12.704 78.005  -0.260  1.00 80.04  ? 204 ARG C CD  1 
ATOM   5570  N NE  . ARG C 1 206 ? -11.948 79.243  -0.451  1.00 83.86  ? 204 ARG C NE  1 
ATOM   5571  C CZ  . ARG C 1 206 ? -12.233 80.405  0.139   1.00 87.54  ? 204 ARG C CZ  1 
ATOM   5572  N NH1 . ARG C 1 206 ? -13.262 80.510  0.971   1.00 85.99  ? 204 ARG C NH1 1 
ATOM   5573  N NH2 . ARG C 1 206 ? -11.481 81.472  -0.096  1.00 88.48  ? 204 ARG C NH2 1 
ATOM   5574  N N   . LEU C 1 207 ? -15.787 73.732  -1.255  1.00 56.80  ? 205 LEU C N   1 
ATOM   5575  C CA  . LEU C 1 207 ? -16.875 72.780  -1.255  1.00 52.78  ? 205 LEU C CA  1 
ATOM   5576  C C   . LEU C 1 207 ? -16.618 71.671  -0.234  1.00 52.82  ? 205 LEU C C   1 
ATOM   5577  O O   . LEU C 1 207 ? -17.446 71.456  0.686   1.00 45.81  ? 205 LEU C O   1 
ATOM   5578  C CB  . LEU C 1 207 ? -17.005 72.194  -2.648  1.00 53.95  ? 205 LEU C CB  1 
ATOM   5579  C CG  . LEU C 1 207 ? -18.013 72.880  -3.553  1.00 49.20  ? 205 LEU C CG  1 
ATOM   5580  C CD1 . LEU C 1 207 ? -18.099 72.148  -4.916  1.00 51.85  ? 205 LEU C CD1 1 
ATOM   5581  C CD2 . LEU C 1 207 ? -19.356 72.871  -2.839  1.00 43.89  ? 205 LEU C CD2 1 
ATOM   5582  N N   . GLY C 1 208 ? -15.482 70.972  -0.414  1.00 50.06  ? 206 GLY C N   1 
ATOM   5583  C CA  . GLY C 1 208 ? -15.097 69.899  0.496   1.00 47.54  ? 206 GLY C CA  1 
ATOM   5584  C C   . GLY C 1 208 ? -15.105 70.454  1.907   1.00 49.26  ? 206 GLY C C   1 
ATOM   5585  O O   . GLY C 1 208 ? -15.635 69.858  2.874   1.00 45.11  ? 206 GLY C O   1 
ATOM   5586  N N   . ALA C 1 209 ? -14.523 71.646  2.004   1.00 47.30  ? 207 ALA C N   1 
ATOM   5587  C CA  . ALA C 1 209 ? -14.439 72.360  3.260   1.00 47.77  ? 207 ALA C CA  1 
ATOM   5588  C C   . ALA C 1 209 ? -15.810 72.380  3.922   1.00 47.77  ? 207 ALA C C   1 
ATOM   5589  O O   . ALA C 1 209 ? -16.026 71.811  5.005   1.00 52.64  ? 207 ALA C O   1 
ATOM   5590  C CB  . ALA C 1 209 ? -13.949 73.768  2.995   1.00 49.59  ? 207 ALA C CB  1 
ATOM   5591  N N   . GLN C 1 210 ? -16.742 73.032  3.249   1.00 46.99  ? 208 GLN C N   1 
ATOM   5592  C CA  . GLN C 1 210 ? -18.104 73.155  3.742   1.00 45.88  ? 208 GLN C CA  1 
ATOM   5593  C C   . GLN C 1 210 ? -18.679 71.776  4.013   1.00 44.02  ? 208 GLN C C   1 
ATOM   5594  O O   . GLN C 1 210 ? -19.376 71.567  4.990   1.00 39.70  ? 208 GLN C O   1 
ATOM   5595  C CB  . GLN C 1 210 ? -18.960 73.890  2.690   1.00 45.14  ? 208 GLN C CB  1 
ATOM   5596  C CG  . GLN C 1 210 ? -20.328 74.356  3.146   1.00 42.27  ? 208 GLN C CG  1 
ATOM   5597  C CD  . GLN C 1 210 ? -20.256 75.212  4.408   1.00 43.47  ? 208 GLN C CD  1 
ATOM   5598  O OE1 . GLN C 1 210 ? -19.692 76.295  4.408   1.00 47.51  ? 208 GLN C OE1 1 
ATOM   5599  N NE2 . GLN C 1 210 ? -20.818 74.715  5.488   1.00 44.19  ? 208 GLN C NE2 1 
ATOM   5600  N N   . ALA C 1 211 ? -18.383 70.827  3.146   1.00 46.72  ? 209 ALA C N   1 
ATOM   5601  C CA  . ALA C 1 211 ? -18.926 69.502  3.336   1.00 48.97  ? 209 ALA C CA  1 
ATOM   5602  C C   . ALA C 1 211 ? -18.547 69.033  4.719   1.00 47.17  ? 209 ALA C C   1 
ATOM   5603  O O   . ALA C 1 211 ? -19.420 68.626  5.517   1.00 46.02  ? 209 ALA C O   1 
ATOM   5604  C CB  . ALA C 1 211 ? -18.382 68.557  2.259   1.00 54.77  ? 209 ALA C CB  1 
ATOM   5605  N N   . LEU C 1 212 ? -17.244 69.093  4.995   1.00 42.59  ? 210 LEU C N   1 
ATOM   5606  C CA  . LEU C 1 212 ? -16.742 68.672  6.284   1.00 42.01  ? 210 LEU C CA  1 
ATOM   5607  C C   . LEU C 1 212 ? -17.393 69.484  7.344   1.00 43.23  ? 210 LEU C C   1 
ATOM   5608  O O   . LEU C 1 212 ? -18.098 68.983  8.201   1.00 47.09  ? 210 LEU C O   1 
ATOM   5609  C CB  . LEU C 1 212 ? -15.246 68.864  6.342   1.00 43.05  ? 210 LEU C CB  1 
ATOM   5610  C CG  . LEU C 1 212 ? -14.650 67.655  5.643   1.00 51.20  ? 210 LEU C CG  1 
ATOM   5611  C CD1 . LEU C 1 212 ? -13.173 67.757  5.662   1.00 50.74  ? 210 LEU C CD1 1 
ATOM   5612  C CD2 . LEU C 1 212 ? -15.132 66.371  6.348   1.00 47.92  ? 210 LEU C CD2 1 
ATOM   5613  N N   . LEU C 1 213 ? -17.128 70.765  7.276   1.00 42.95  ? 211 LEU C N   1 
ATOM   5614  C CA  . LEU C 1 213 ? -17.704 71.705  8.198   1.00 45.26  ? 211 LEU C CA  1 
ATOM   5615  C C   . LEU C 1 213 ? -19.135 71.272  8.588   1.00 42.97  ? 211 LEU C C   1 
ATOM   5616  O O   . LEU C 1 213 ? -19.437 71.009  9.762   1.00 42.73  ? 211 LEU C O   1 
ATOM   5617  C CB  . LEU C 1 213 ? -17.734 73.072  7.496   1.00 45.66  ? 211 LEU C CB  1 
ATOM   5618  C CG  . LEU C 1 213 ? -18.131 74.321  8.301   1.00 47.11  ? 211 LEU C CG  1 
ATOM   5619  C CD1 . LEU C 1 213 ? -19.378 74.020  9.177   1.00 36.31  ? 211 LEU C CD1 1 
ATOM   5620  C CD2 . LEU C 1 213 ? -16.942 74.792  9.162   1.00 48.26  ? 211 LEU C CD2 1 
ATOM   5621  N N   . GLY C 1 214 ? -20.011 71.245  7.583   1.00 44.15  ? 212 GLY C N   1 
ATOM   5622  C CA  . GLY C 1 214 ? -21.405 70.884  7.779   1.00 40.53  ? 212 GLY C CA  1 
ATOM   5623  C C   . GLY C 1 214 ? -21.599 69.566  8.463   1.00 39.02  ? 212 GLY C C   1 
ATOM   5624  O O   . GLY C 1 214 ? -22.395 69.459  9.399   1.00 36.16  ? 212 GLY C O   1 
ATOM   5625  N N   . ALA C 1 215 ? -20.864 68.563  7.986   1.00 40.60  ? 213 ALA C N   1 
ATOM   5626  C CA  . ALA C 1 215 ? -20.906 67.206  8.530   1.00 38.21  ? 213 ALA C CA  1 
ATOM   5627  C C   . ALA C 1 215 ? -20.730 67.219  10.062  1.00 39.57  ? 213 ALA C C   1 
ATOM   5628  O O   . ALA C 1 215 ? -21.578 66.717  10.825  1.00 29.23  ? 213 ALA C O   1 
ATOM   5629  C CB  . ALA C 1 215 ? -19.818 66.417  7.883   1.00 38.24  ? 213 ALA C CB  1 
ATOM   5630  N N   . ALA C 1 216 ? -19.600 67.805  10.477  1.00 46.83  ? 214 ALA C N   1 
ATOM   5631  C CA  . ALA C 1 216 ? -19.207 67.984  11.880  1.00 48.11  ? 214 ALA C CA  1 
ATOM   5632  C C   . ALA C 1 216 ? -20.288 68.693  12.690  1.00 49.76  ? 214 ALA C C   1 
ATOM   5633  O O   . ALA C 1 216 ? -20.763 68.154  13.702  1.00 50.82  ? 214 ALA C O   1 
ATOM   5634  C CB  . ALA C 1 216 ? -17.896 68.779  11.956  1.00 49.81  ? 214 ALA C CB  1 
ATOM   5635  N N   . LYS C 1 217 ? -20.653 69.908  12.279  1.00 49.79  ? 215 LYS C N   1 
ATOM   5636  C CA  . LYS C 1 217 ? -21.695 70.609  13.007  1.00 57.43  ? 215 LYS C CA  1 
ATOM   5637  C C   . LYS C 1 217 ? -22.857 69.635  13.109  1.00 57.85  ? 215 LYS C C   1 
ATOM   5638  O O   . LYS C 1 217 ? -23.519 69.522  14.141  1.00 55.14  ? 215 LYS C O   1 
ATOM   5639  C CB  . LYS C 1 217 ? -22.170 71.848  12.252  1.00 62.64  ? 215 LYS C CB  1 
ATOM   5640  C CG  . LYS C 1 217 ? -23.153 72.690  13.090  1.00 63.77  ? 215 LYS C CG  1 
ATOM   5641  C CD  . LYS C 1 217 ? -23.636 73.936  12.346  1.00 73.65  ? 215 LYS C CD  1 
ATOM   5642  C CE  . LYS C 1 217 ? -24.486 74.879  13.239  1.00 75.50  ? 215 LYS C CE  1 
ATOM   5643  N NZ  . LYS C 1 217 ? -25.141 76.029  12.500  1.00 78.31  ? 215 LYS C NZ  1 
ATOM   5644  N N   . MET C 1 218 ? -23.087 68.932  12.010  1.00 60.58  ? 216 MET C N   1 
ATOM   5645  C CA  . MET C 1 218 ? -24.167 67.973  11.939  1.00 62.21  ? 216 MET C CA  1 
ATOM   5646  C C   . MET C 1 218 ? -24.047 66.930  13.046  1.00 64.51  ? 216 MET C C   1 
ATOM   5647  O O   . MET C 1 218 ? -25.021 66.649  13.760  1.00 60.76  ? 216 MET C O   1 
ATOM   5648  C CB  . MET C 1 218 ? -24.182 67.313  10.556  1.00 62.61  ? 216 MET C CB  1 
ATOM   5649  C CG  . MET C 1 218 ? -25.421 67.570  9.749   1.00 59.36  ? 216 MET C CG  1 
ATOM   5650  S SD  . MET C 1 218 ? -25.965 66.024  9.050   1.00 61.39  ? 216 MET C SD  1 
ATOM   5651  C CE  . MET C 1 218 ? -27.196 65.485  10.192  1.00 53.21  ? 216 MET C CE  1 
ATOM   5652  N N   . LEU C 1 219 ? -22.860 66.345  13.194  1.00 66.90  ? 217 LEU C N   1 
ATOM   5653  C CA  . LEU C 1 219 ? -22.671 65.351  14.243  1.00 70.27  ? 217 LEU C CA  1 
ATOM   5654  C C   . LEU C 1 219 ? -22.932 66.003  15.569  1.00 72.30  ? 217 LEU C C   1 
ATOM   5655  O O   . LEU C 1 219 ? -23.799 65.556  16.303  1.00 73.46  ? 217 LEU C O   1 
ATOM   5656  C CB  . LEU C 1 219 ? -21.249 64.800  14.271  1.00 73.62  ? 217 LEU C CB  1 
ATOM   5657  C CG  . LEU C 1 219 ? -21.116 63.587  15.220  1.00 75.12  ? 217 LEU C CG  1 
ATOM   5658  C CD1 . LEU C 1 219 ? -22.194 62.533  14.886  1.00 73.57  ? 217 LEU C CD1 1 
ATOM   5659  C CD2 . LEU C 1 219 ? -19.700 62.976  15.113  1.00 78.62  ? 217 LEU C CD2 1 
ATOM   5660  N N   . LEU C 1 220 ? -22.177 67.062  15.864  1.00 73.97  ? 218 LEU C N   1 
ATOM   5661  C CA  . LEU C 1 220 ? -22.307 67.805  17.116  1.00 75.46  ? 218 LEU C CA  1 
ATOM   5662  C C   . LEU C 1 220 ? -23.711 68.102  17.670  1.00 78.15  ? 218 LEU C C   1 
ATOM   5663  O O   . LEU C 1 220 ? -24.000 67.675  18.783  1.00 80.06  ? 218 LEU C O   1 
ATOM   5664  C CB  . LEU C 1 220 ? -21.535 69.111  17.016  1.00 76.27  ? 218 LEU C CB  1 
ATOM   5665  C CG  . LEU C 1 220 ? -20.008 69.007  16.933  1.00 73.79  ? 218 LEU C CG  1 
ATOM   5666  C CD1 . LEU C 1 220 ? -19.459 70.418  16.801  1.00 74.09  ? 218 LEU C CD1 1 
ATOM   5667  C CD2 . LEU C 1 220 ? -19.419 68.333  18.171  1.00 72.84  ? 218 LEU C CD2 1 
ATOM   5668  N N   . HIS C 1 221 ? -24.572 68.825  16.935  1.00 81.34  ? 219 HIS C N   1 
ATOM   5669  C CA  . HIS C 1 221 ? -25.942 69.138  17.426  1.00 85.86  ? 219 HIS C CA  1 
ATOM   5670  C C   . HIS C 1 221 ? -26.891 67.920  17.391  1.00 84.09  ? 219 HIS C C   1 
ATOM   5671  O O   . HIS C 1 221 ? -28.072 68.015  17.740  1.00 81.82  ? 219 HIS C O   1 
ATOM   5672  C CB  . HIS C 1 221 ? -26.616 70.245  16.598  1.00 92.70  ? 219 HIS C CB  1 
ATOM   5673  C CG  . HIS C 1 221 ? -25.891 71.550  16.594  1.00 97.14  ? 219 HIS C CG  1 
ATOM   5674  N ND1 . HIS C 1 221 ? -24.595 71.688  16.143  1.00 99.16  ? 219 HIS C ND1 1 
ATOM   5675  C CD2 . HIS C 1 221 ? -26.313 72.792  16.925  1.00 99.13  ? 219 HIS C CD2 1 
ATOM   5676  C CE1 . HIS C 1 221 ? -24.250 72.963  16.193  1.00 101.29 ? 219 HIS C CE1 1 
ATOM   5677  N NE2 . HIS C 1 221 ? -25.274 73.653  16.662  1.00 102.89 ? 219 HIS C NE2 1 
ATOM   5678  N N   . SER C 1 222 ? -26.369 66.795  16.925  1.00 84.80  ? 220 SER C N   1 
ATOM   5679  C CA  . SER C 1 222 ? -27.104 65.549  16.819  1.00 82.08  ? 220 SER C CA  1 
ATOM   5680  C C   . SER C 1 222 ? -27.052 64.711  18.092  1.00 81.95  ? 220 SER C C   1 
ATOM   5681  O O   . SER C 1 222 ? -26.256 64.935  19.006  1.00 75.42  ? 220 SER C O   1 
ATOM   5682  C CB  . SER C 1 222 ? -26.520 64.729  15.669  1.00 80.25  ? 220 SER C CB  1 
ATOM   5683  O OG  . SER C 1 222 ? -26.906 63.375  15.785  1.00 80.99  ? 220 SER C OG  1 
ATOM   5684  N N   . GLU C 1 223 ? -27.929 63.727  18.129  1.00 86.44  ? 221 GLU C N   1 
ATOM   5685  C CA  . GLU C 1 223 ? -27.977 62.802  19.238  1.00 90.91  ? 221 GLU C CA  1 
ATOM   5686  C C   . GLU C 1 223 ? -27.495 61.494  18.599  1.00 89.24  ? 221 GLU C C   1 
ATOM   5687  O O   . GLU C 1 223 ? -26.962 60.580  19.270  1.00 89.91  ? 221 GLU C O   1 
ATOM   5688  C CB  . GLU C 1 223 ? -29.414 62.668  19.762  1.00 96.34  ? 221 GLU C CB  1 
ATOM   5689  C CG  . GLU C 1 223 ? -29.532 61.912  21.106  1.00 102.04 ? 221 GLU C CG  1 
ATOM   5690  C CD  . GLU C 1 223 ? -28.609 62.449  22.235  1.00 102.42 ? 221 GLU C CD  1 
ATOM   5691  O OE1 . GLU C 1 223 ? -28.884 62.092  23.414  1.00 103.70 ? 221 GLU C OE1 1 
ATOM   5692  O OE2 . GLU C 1 223 ? -27.626 63.200  21.959  1.00 97.83  ? 221 GLU C OE2 1 
ATOM   5693  N N   . GLN C 1 224 ? -27.669 61.456  17.278  1.00 83.54  ? 222 GLN C N   1 
ATOM   5694  C CA  . GLN C 1 224 ? -27.295 60.329  16.454  1.00 77.14  ? 222 GLN C CA  1 
ATOM   5695  C C   . GLN C 1 224 ? -25.827 59.927  16.610  1.00 72.81  ? 222 GLN C C   1 
ATOM   5696  O O   . GLN C 1 224 ? -25.001 60.655  17.183  1.00 68.00  ? 222 GLN C O   1 
ATOM   5697  C CB  . GLN C 1 224 ? -27.601 60.641  14.985  1.00 79.43  ? 222 GLN C CB  1 
ATOM   5698  C CG  . GLN C 1 224 ? -29.073 60.875  14.657  1.00 80.71  ? 222 GLN C CG  1 
ATOM   5699  C CD  . GLN C 1 224 ? -29.946 59.675  14.982  1.00 86.00  ? 222 GLN C CD  1 
ATOM   5700  O OE1 . GLN C 1 224 ? -30.011 59.233  16.128  1.00 88.70  ? 222 GLN C OE1 1 
ATOM   5701  N NE2 . GLN C 1 224 ? -30.622 59.142  13.970  1.00 86.43  ? 222 GLN C NE2 1 
ATOM   5702  N N   . HIS C 1 225 ? -25.534 58.747  16.074  1.00 67.61  ? 223 HIS C N   1 
ATOM   5703  C CA  . HIS C 1 225 ? -24.218 58.128  16.117  1.00 64.33  ? 223 HIS C CA  1 
ATOM   5704  C C   . HIS C 1 225 ? -23.596 58.342  14.737  1.00 62.72  ? 223 HIS C C   1 
ATOM   5705  O O   . HIS C 1 225 ? -24.296 58.293  13.723  1.00 64.02  ? 223 HIS C O   1 
ATOM   5706  C CB  . HIS C 1 225 ? -24.433 56.650  16.421  1.00 62.84  ? 223 HIS C CB  1 
ATOM   5707  C CG  . HIS C 1 225 ? -23.180 55.845  16.532  1.00 61.22  ? 223 HIS C CG  1 
ATOM   5708  N ND1 . HIS C 1 225 ? -22.154 55.929  15.616  1.00 60.08  ? 223 HIS C ND1 1 
ATOM   5709  C CD2 . HIS C 1 225 ? -22.826 54.880  17.411  1.00 57.03  ? 223 HIS C CD2 1 
ATOM   5710  C CE1 . HIS C 1 225 ? -21.222 55.049  15.927  1.00 58.92  ? 223 HIS C CE1 1 
ATOM   5711  N NE2 . HIS C 1 225 ? -21.606 54.399  17.011  1.00 58.17  ? 223 HIS C NE2 1 
ATOM   5712  N N   . PRO C 1 226 ? -22.272 58.570  14.674  1.00 59.91  ? 224 PRO C N   1 
ATOM   5713  C CA  . PRO C 1 226 ? -21.606 58.796  13.385  1.00 60.34  ? 224 PRO C CA  1 
ATOM   5714  C C   . PRO C 1 226 ? -22.122 57.916  12.264  1.00 60.81  ? 224 PRO C C   1 
ATOM   5715  O O   . PRO C 1 226 ? -22.398 58.390  11.143  1.00 63.38  ? 224 PRO C O   1 
ATOM   5716  C CB  . PRO C 1 226 ? -20.142 58.526  13.699  1.00 57.83  ? 224 PRO C CB  1 
ATOM   5717  C CG  . PRO C 1 226 ? -20.020 58.984  15.079  1.00 57.99  ? 224 PRO C CG  1 
ATOM   5718  C CD  . PRO C 1 226 ? -21.275 58.477  15.754  1.00 59.55  ? 224 PRO C CD  1 
ATOM   5719  N N   . GLY C 1 227 ? -22.248 56.631  12.579  1.00 59.15  ? 225 GLY C N   1 
ATOM   5720  C CA  . GLY C 1 227 ? -22.737 55.673  11.614  1.00 61.61  ? 225 GLY C CA  1 
ATOM   5721  C C   . GLY C 1 227 ? -24.196 55.883  11.275  1.00 62.78  ? 225 GLY C C   1 
ATOM   5722  O O   . GLY C 1 227 ? -24.589 55.874  10.107  1.00 63.48  ? 225 GLY C O   1 
ATOM   5723  N N   . GLN C 1 228 ? -25.005 56.102  12.297  1.00 63.98  ? 226 GLN C N   1 
ATOM   5724  C CA  . GLN C 1 228 ? -26.424 56.293  12.082  1.00 65.06  ? 226 GLN C CA  1 
ATOM   5725  C C   . GLN C 1 228 ? -26.734 57.351  11.048  1.00 61.26  ? 226 GLN C C   1 
ATOM   5726  O O   . GLN C 1 228 ? -27.823 57.348  10.488  1.00 61.78  ? 226 GLN C O   1 
ATOM   5727  C CB  . GLN C 1 228 ? -27.113 56.622  13.394  1.00 67.27  ? 226 GLN C CB  1 
ATOM   5728  C CG  . GLN C 1 228 ? -28.608 56.754  13.282  1.00 74.67  ? 226 GLN C CG  1 
ATOM   5729  C CD  . GLN C 1 228 ? -29.258 55.584  12.579  1.00 79.22  ? 226 GLN C CD  1 
ATOM   5730  O OE1 . GLN C 1 228 ? -29.237 54.446  13.071  1.00 82.02  ? 226 GLN C OE1 1 
ATOM   5731  N NE2 . GLN C 1 228 ? -29.848 55.858  11.414  1.00 76.45  ? 226 GLN C NE2 1 
ATOM   5732  N N   . LEU C 1 229 ? -25.783 58.251  10.811  1.00 59.08  ? 227 LEU C N   1 
ATOM   5733  C CA  . LEU C 1 229 ? -25.938 59.301  9.809   1.00 57.04  ? 227 LEU C CA  1 
ATOM   5734  C C   . LEU C 1 229 ? -25.308 58.821  8.473   1.00 61.98  ? 227 LEU C C   1 
ATOM   5735  O O   . LEU C 1 229 ? -25.778 59.159  7.362   1.00 62.53  ? 227 LEU C O   1 
ATOM   5736  C CB  . LEU C 1 229 ? -25.253 60.551  10.309  1.00 50.46  ? 227 LEU C CB  1 
ATOM   5737  C CG  . LEU C 1 229 ? -25.751 60.984  11.676  1.00 48.10  ? 227 LEU C CG  1 
ATOM   5738  C CD1 . LEU C 1 229 ? -24.988 62.188  12.188  1.00 41.65  ? 227 LEU C CD1 1 
ATOM   5739  C CD2 . LEU C 1 229 ? -27.222 61.272  11.553  1.00 48.40  ? 227 LEU C CD2 1 
ATOM   5740  N N   . LYS C 1 230 ? -24.242 58.030  8.583   1.00 60.12  ? 228 LYS C N   1 
ATOM   5741  C CA  . LYS C 1 230 ? -23.595 57.467  7.404   1.00 57.69  ? 228 LYS C CA  1 
ATOM   5742  C C   . LYS C 1 230 ? -24.706 56.727  6.651   1.00 57.88  ? 228 LYS C C   1 
ATOM   5743  O O   . LYS C 1 230 ? -24.838 56.858  5.449   1.00 58.64  ? 228 LYS C O   1 
ATOM   5744  C CB  . LYS C 1 230 ? -22.513 56.492  7.850   1.00 56.27  ? 228 LYS C CB  1 
ATOM   5745  C CG  . LYS C 1 230 ? -21.729 55.806  6.755   1.00 57.62  ? 228 LYS C CG  1 
ATOM   5746  C CD  . LYS C 1 230 ? -20.744 54.771  7.358   1.00 57.27  ? 228 LYS C CD  1 
ATOM   5747  C CE  . LYS C 1 230 ? -21.279 53.324  7.273   1.00 60.23  ? 228 LYS C CE  1 
ATOM   5748  N NZ  . LYS C 1 230 ? -22.547 53.038  8.035   1.00 60.75  ? 228 LYS C NZ  1 
ATOM   5749  N N   . ASP C 1 231 ? -25.525 55.988  7.392   1.00 58.84  ? 229 ASP C N   1 
ATOM   5750  C CA  . ASP C 1 231 ? -26.616 55.222  6.815   1.00 63.20  ? 229 ASP C CA  1 
ATOM   5751  C C   . ASP C 1 231 ? -27.672 56.149  6.248   1.00 66.41  ? 229 ASP C C   1 
ATOM   5752  O O   . ASP C 1 231 ? -28.289 55.856  5.234   1.00 70.25  ? 229 ASP C O   1 
ATOM   5753  C CB  . ASP C 1 231 ? -27.250 54.318  7.869   1.00 66.53  ? 229 ASP C CB  1 
ATOM   5754  C CG  . ASP C 1 231 ? -26.224 53.460  8.617   1.00 73.44  ? 229 ASP C CG  1 
ATOM   5755  O OD1 . ASP C 1 231 ? -25.009 53.521  8.285   1.00 77.31  ? 229 ASP C OD1 1 
ATOM   5756  O OD2 . ASP C 1 231 ? -26.631 52.710  9.546   1.00 73.07  ? 229 ASP C OD2 1 
ATOM   5757  N N   . ASN C 1 232 ? -27.879 57.281  6.908   1.00 67.65  ? 230 ASN C N   1 
ATOM   5758  C CA  . ASN C 1 232 ? -28.855 58.281  6.466   1.00 66.00  ? 230 ASN C CA  1 
ATOM   5759  C C   . ASN C 1 232 ? -28.445 58.867  5.116   1.00 68.14  ? 230 ASN C C   1 
ATOM   5760  O O   . ASN C 1 232 ? -29.261 58.993  4.217   1.00 69.46  ? 230 ASN C O   1 
ATOM   5761  C CB  . ASN C 1 232 ? -28.949 59.431  7.484   1.00 62.37  ? 230 ASN C CB  1 
ATOM   5762  C CG  . ASN C 1 232 ? -29.829 59.104  8.682   1.00 59.00  ? 230 ASN C CG  1 
ATOM   5763  O OD1 . ASN C 1 232 ? -30.185 57.944  8.896   1.00 61.40  ? 230 ASN C OD1 1 
ATOM   5764  N ND2 . ASN C 1 232 ? -30.176 60.129  9.481   1.00 53.36  ? 230 ASN C ND2 1 
ATOM   5765  N N   . VAL C 1 233 ? -27.170 59.214  4.981   1.00 70.20  ? 231 VAL C N   1 
ATOM   5766  C CA  . VAL C 1 233 ? -26.654 59.821  3.756   1.00 75.46  ? 231 VAL C CA  1 
ATOM   5767  C C   . VAL C 1 233 ? -26.246 58.778  2.702   1.00 75.00  ? 231 VAL C C   1 
ATOM   5768  O O   . VAL C 1 233 ? -25.369 58.998  1.856   1.00 76.35  ? 231 VAL C O   1 
ATOM   5769  C CB  . VAL C 1 233 ? -25.445 60.763  4.119   1.00 79.61  ? 231 VAL C CB  1 
ATOM   5770  C CG1 . VAL C 1 233 ? -24.863 61.475  2.867   1.00 79.75  ? 231 VAL C CG1 1 
ATOM   5771  C CG2 . VAL C 1 233 ? -25.915 61.794  5.140   1.00 80.41  ? 231 VAL C CG2 1 
ATOM   5772  N N   . SER C 1 234 ? -26.897 57.629  2.748   1.00 72.98  ? 232 SER C N   1 
ATOM   5773  C CA  . SER C 1 234 ? -26.587 56.564  1.805   1.00 69.94  ? 232 SER C CA  1 
ATOM   5774  C C   . SER C 1 234 ? -27.823 56.114  1.037   1.00 67.16  ? 232 SER C C   1 
ATOM   5775  O O   . SER C 1 234 ? -28.887 55.824  1.599   1.00 59.88  ? 232 SER C O   1 
ATOM   5776  C CB  . SER C 1 234 ? -25.949 55.369  2.538   1.00 73.78  ? 232 SER C CB  1 
ATOM   5777  O OG  . SER C 1 234 ? -24.530 55.373  2.404   1.00 73.43  ? 232 SER C OG  1 
ATOM   5778  N N   . SER C 1 235 ? -27.659 56.095  -0.277  1.00 68.82  ? 233 SER C N   1 
ATOM   5779  C CA  . SER C 1 235 ? -28.707 55.672  -1.192  1.00 70.29  ? 233 SER C CA  1 
ATOM   5780  C C   . SER C 1 235 ? -28.334 54.253  -1.623  1.00 68.09  ? 233 SER C C   1 
ATOM   5781  O O   . SER C 1 235 ? -27.211 54.016  -2.128  1.00 68.67  ? 233 SER C O   1 
ATOM   5782  C CB  . SER C 1 235 ? -28.767 56.589  -2.426  1.00 74.00  ? 233 SER C CB  1 
ATOM   5783  O OG  . SER C 1 235 ? -29.238 57.884  -2.083  1.00 79.80  ? 233 SER C OG  1 
ATOM   5784  N N   . PRO C 1 236 ? -29.263 53.292  -1.424  1.00 61.38  ? 234 PRO C N   1 
ATOM   5785  C CA  . PRO C 1 236 ? -29.029 51.896  -1.790  1.00 58.34  ? 234 PRO C CA  1 
ATOM   5786  C C   . PRO C 1 236 ? -28.383 51.902  -3.147  1.00 58.80  ? 234 PRO C C   1 
ATOM   5787  O O   . PRO C 1 236 ? -27.335 51.288  -3.345  1.00 57.92  ? 234 PRO C O   1 
ATOM   5788  C CB  . PRO C 1 236 ? -30.420 51.310  -1.771  1.00 58.71  ? 234 PRO C CB  1 
ATOM   5789  C CG  . PRO C 1 236 ? -31.081 52.088  -0.641  1.00 55.87  ? 234 PRO C CG  1 
ATOM   5790  C CD  . PRO C 1 236 ? -30.641 53.492  -0.942  1.00 55.58  ? 234 PRO C CD  1 
ATOM   5791  N N   . GLY C 1 237 ? -28.992 52.639  -4.071  1.00 60.34  ? 235 GLY C N   1 
ATOM   5792  C CA  . GLY C 1 237 ? -28.412 52.764  -5.392  1.00 61.47  ? 235 GLY C CA  1 
ATOM   5793  C C   . GLY C 1 237 ? -26.920 52.925  -5.154  1.00 60.00  ? 235 GLY C C   1 
ATOM   5794  O O   . GLY C 1 237 ? -26.157 51.969  -5.332  1.00 57.61  ? 235 GLY C O   1 
ATOM   5795  N N   . GLY C 1 238 ? -26.489 54.104  -4.717  1.00 57.83  ? 236 GLY C N   1 
ATOM   5796  C CA  . GLY C 1 238 ? -25.071 54.267  -4.469  1.00 55.59  ? 236 GLY C CA  1 
ATOM   5797  C C   . GLY C 1 238 ? -24.532 55.671  -4.527  1.00 52.34  ? 236 GLY C C   1 
ATOM   5798  O O   . GLY C 1 238 ? -25.082 56.607  -3.910  1.00 57.38  ? 236 GLY C O   1 
ATOM   5799  N N   . ALA C 1 239 ? -23.464 55.828  -5.302  1.00 47.50  ? 237 ALA C N   1 
ATOM   5800  C CA  . ALA C 1 239 ? -22.796 57.123  -5.400  1.00 49.98  ? 237 ALA C CA  1 
ATOM   5801  C C   . ALA C 1 239 ? -22.032 57.342  -4.057  1.00 50.74  ? 237 ALA C C   1 
ATOM   5802  O O   . ALA C 1 239 ? -20.803 57.349  -4.048  1.00 49.25  ? 237 ALA C O   1 
ATOM   5803  C CB  . ALA C 1 239 ? -23.820 58.226  -5.655  1.00 51.89  ? 237 ALA C CB  1 
ATOM   5804  N N   . THR C 1 240 ? -22.757 57.491  -2.941  1.00 49.92  ? 238 THR C N   1 
ATOM   5805  C CA  . THR C 1 240 ? -22.153 57.629  -1.609  1.00 45.10  ? 238 THR C CA  1 
ATOM   5806  C C   . THR C 1 240 ? -21.675 56.258  -1.156  1.00 44.18  ? 238 THR C C   1 
ATOM   5807  O O   . THR C 1 240 ? -20.473 56.028  -0.984  1.00 41.59  ? 238 THR C O   1 
ATOM   5808  C CB  . THR C 1 240 ? -23.171 58.114  -0.571  1.00 46.87  ? 238 THR C CB  1 
ATOM   5809  O OG1 . THR C 1 240 ? -23.374 59.517  -0.737  1.00 54.89  ? 238 THR C OG1 1 
ATOM   5810  C CG2 . THR C 1 240 ? -22.701 57.793  0.858   1.00 40.87  ? 238 THR C CG2 1 
ATOM   5811  N N   . ILE C 1 241 ? -22.623 55.334  -1.004  1.00 40.05  ? 239 ILE C N   1 
ATOM   5812  C CA  . ILE C 1 241 ? -22.273 54.002  -0.570  1.00 41.56  ? 239 ILE C CA  1 
ATOM   5813  C C   . ILE C 1 241 ? -21.241 53.372  -1.485  1.00 41.70  ? 239 ILE C C   1 
ATOM   5814  O O   . ILE C 1 241 ? -20.506 52.477  -1.083  1.00 41.94  ? 239 ILE C O   1 
ATOM   5815  C CB  . ILE C 1 241 ? -23.480 53.083  -0.497  1.00 42.52  ? 239 ILE C CB  1 
ATOM   5816  C CG1 . ILE C 1 241 ? -23.115 51.883  0.364   1.00 36.79  ? 239 ILE C CG1 1 
ATOM   5817  C CG2 . ILE C 1 241 ? -23.884 52.619  -1.885  1.00 43.29  ? 239 ILE C CG2 1 
ATOM   5818  C CD1 . ILE C 1 241 ? -24.309 51.239  0.939   1.00 42.82  ? 239 ILE C CD1 1 
ATOM   5819  N N   . HIS C 1 242 ? -21.171 53.814  -2.722  1.00 39.02  ? 240 HIS C N   1 
ATOM   5820  C CA  . HIS C 1 242 ? -20.176 53.211  -3.544  1.00 42.02  ? 240 HIS C CA  1 
ATOM   5821  C C   . HIS C 1 242 ? -18.885 53.812  -3.113  1.00 42.20  ? 240 HIS C C   1 
ATOM   5822  O O   . HIS C 1 242 ? -17.885 53.093  -2.952  1.00 41.44  ? 240 HIS C O   1 
ATOM   5823  C CB  . HIS C 1 242 ? -20.465 53.470  -5.016  1.00 45.08  ? 240 HIS C CB  1 
ATOM   5824  C CG  . HIS C 1 242 ? -21.243 52.360  -5.674  1.00 48.42  ? 240 HIS C CG  1 
ATOM   5825  N ND1 . HIS C 1 242 ? -20.640 51.297  -6.321  1.00 40.29  ? 240 HIS C ND1 1 
ATOM   5826  C CD2 . HIS C 1 242 ? -22.576 52.130  -5.735  1.00 45.89  ? 240 HIS C CD2 1 
ATOM   5827  C CE1 . HIS C 1 242 ? -21.570 50.465  -6.749  1.00 46.11  ? 240 HIS C CE1 1 
ATOM   5828  N NE2 . HIS C 1 242 ? -22.752 50.946  -6.405  1.00 46.44  ? 240 HIS C NE2 1 
ATOM   5829  N N   . ALA C 1 243 ? -18.920 55.130  -2.901  1.00 45.41  ? 241 ALA C N   1 
ATOM   5830  C CA  . ALA C 1 243 ? -17.736 55.903  -2.464  1.00 42.04  ? 241 ALA C CA  1 
ATOM   5831  C C   . ALA C 1 243 ? -17.222 55.294  -1.153  1.00 39.48  ? 241 ALA C C   1 
ATOM   5832  O O   . ALA C 1 243 ? -16.040 54.919  -1.041  1.00 37.83  ? 241 ALA C O   1 
ATOM   5833  C CB  . ALA C 1 243 ? -18.095 57.381  -2.254  1.00 37.19  ? 241 ALA C CB  1 
ATOM   5834  N N   . LEU C 1 244 ? -18.105 55.208  -0.165  1.00 30.33  ? 242 LEU C N   1 
ATOM   5835  C CA  . LEU C 1 244 ? -17.721 54.598  1.075   1.00 31.27  ? 242 LEU C CA  1 
ATOM   5836  C C   . LEU C 1 244 ? -16.966 53.295  0.815   1.00 39.66  ? 242 LEU C C   1 
ATOM   5837  O O   . LEU C 1 244 ? -15.827 53.138  1.252   1.00 45.28  ? 242 LEU C O   1 
ATOM   5838  C CB  . LEU C 1 244 ? -18.944 54.295  1.898   1.00 26.85  ? 242 LEU C CB  1 
ATOM   5839  C CG  . LEU C 1 244 ? -19.484 55.625  2.348   1.00 22.18  ? 242 LEU C CG  1 
ATOM   5840  C CD1 . LEU C 1 244 ? -20.605 55.415  3.323   1.00 13.65  ? 242 LEU C CD1 1 
ATOM   5841  C CD2 . LEU C 1 244 ? -18.321 56.423  2.964   1.00 25.01  ? 242 LEU C CD2 1 
ATOM   5842  N N   . HIS C 1 245 ? -17.590 52.361  0.099   1.00 39.40  ? 243 HIS C N   1 
ATOM   5843  C CA  . HIS C 1 245 ? -16.974 51.059  -0.177  1.00 37.33  ? 243 HIS C CA  1 
ATOM   5844  C C   . HIS C 1 245 ? -15.536 51.102  -0.574  1.00 33.74  ? 243 HIS C C   1 
ATOM   5845  O O   . HIS C 1 245 ? -14.798 50.150  -0.414  1.00 35.49  ? 243 HIS C O   1 
ATOM   5846  C CB  . HIS C 1 245 ? -17.675 50.335  -1.315  1.00 46.04  ? 243 HIS C CB  1 
ATOM   5847  C CG  . HIS C 1 245 ? -17.122 48.957  -1.570  1.00 49.36  ? 243 HIS C CG  1 
ATOM   5848  N ND1 . HIS C 1 245 ? -17.570 47.833  -0.912  1.00 49.87  ? 243 HIS C ND1 1 
ATOM   5849  C CD2 . HIS C 1 245 ? -16.118 48.536  -2.374  1.00 53.83  ? 243 HIS C CD2 1 
ATOM   5850  C CE1 . HIS C 1 245 ? -16.873 46.780  -1.300  1.00 50.72  ? 243 HIS C CE1 1 
ATOM   5851  N NE2 . HIS C 1 245 ? -15.983 47.180  -2.187  1.00 53.75  ? 243 HIS C NE2 1 
ATOM   5852  N N   . VAL C 1 246 ? -15.135 52.208  -1.139  1.00 34.46  ? 244 VAL C N   1 
ATOM   5853  C CA  . VAL C 1 246 ? -13.773 52.288  -1.601  1.00 38.54  ? 244 VAL C CA  1 
ATOM   5854  C C   . VAL C 1 246 ? -12.827 52.775  -0.524  1.00 37.86  ? 244 VAL C C   1 
ATOM   5855  O O   . VAL C 1 246 ? -11.624 52.512  -0.605  1.00 31.89  ? 244 VAL C O   1 
ATOM   5856  C CB  . VAL C 1 246 ? -13.654 53.226  -2.816  1.00 41.96  ? 244 VAL C CB  1 
ATOM   5857  C CG1 . VAL C 1 246 ? -13.500 54.686  -2.344  1.00 42.11  ? 244 VAL C CG1 1 
ATOM   5858  C CG2 . VAL C 1 246 ? -12.483 52.817  -3.657  1.00 43.22  ? 244 VAL C CG2 1 
ATOM   5859  N N   . LEU C 1 247 ? -13.362 53.519  0.457   1.00 37.29  ? 245 LEU C N   1 
ATOM   5860  C CA  . LEU C 1 247 ? -12.550 54.024  1.576   1.00 31.34  ? 245 LEU C CA  1 
ATOM   5861  C C   . LEU C 1 247 ? -12.366 52.788  2.418   1.00 35.17  ? 245 LEU C C   1 
ATOM   5862  O O   . LEU C 1 247 ? -11.274 52.526  2.910   1.00 38.15  ? 245 LEU C O   1 
ATOM   5863  C CB  . LEU C 1 247 ? -13.289 55.055  2.461   1.00 18.24  ? 245 LEU C CB  1 
ATOM   5864  C CG  . LEU C 1 247 ? -13.720 56.423  1.876   1.00 16.95  ? 245 LEU C CG  1 
ATOM   5865  C CD1 . LEU C 1 247 ? -14.673 57.167  2.820   1.00 5.49   ? 245 LEU C CD1 1 
ATOM   5866  C CD2 . LEU C 1 247 ? -12.520 57.237  1.506   1.00 4.12   ? 245 LEU C CD2 1 
ATOM   5867  N N   . GLU C 1 248 ? -13.448 52.026  2.574   1.00 35.72  ? 246 GLU C N   1 
ATOM   5868  C CA  . GLU C 1 248 ? -13.402 50.835  3.397   1.00 36.60  ? 246 GLU C CA  1 
ATOM   5869  C C   . GLU C 1 248 ? -12.369 49.843  2.864   1.00 39.84  ? 246 GLU C C   1 
ATOM   5870  O O   . GLU C 1 248 ? -11.715 49.132  3.652   1.00 39.45  ? 246 GLU C O   1 
ATOM   5871  C CB  . GLU C 1 248 ? -14.785 50.196  3.490   1.00 36.05  ? 246 GLU C CB  1 
ATOM   5872  C CG  . GLU C 1 248 ? -15.925 51.006  4.209   1.00 39.93  ? 246 GLU C CG  1 
ATOM   5873  C CD  . GLU C 1 248 ? -15.724 51.184  5.690   1.00 31.81  ? 246 GLU C CD  1 
ATOM   5874  O OE1 . GLU C 1 248 ? -16.727 51.445  6.401   1.00 22.02  ? 246 GLU C OE1 1 
ATOM   5875  O OE2 . GLU C 1 248 ? -14.560 51.072  6.131   1.00 33.20  ? 246 GLU C OE2 1 
ATOM   5876  N N   . SER C 1 249 ? -12.183 49.825  1.544   1.00 40.32  ? 247 SER C N   1 
ATOM   5877  C CA  . SER C 1 249 ? -11.222 48.919  0.959   1.00 42.85  ? 247 SER C CA  1 
ATOM   5878  C C   . SER C 1 249 ? -9.860  49.583  0.946   1.00 47.13  ? 247 SER C C   1 
ATOM   5879  O O   . SER C 1 249 ? -9.154  49.574  -0.056  1.00 50.93  ? 247 SER C O   1 
ATOM   5880  C CB  . SER C 1 249 ? -11.648 48.539  -0.448  1.00 42.87  ? 247 SER C CB  1 
ATOM   5881  O OG  . SER C 1 249 ? -12.303 47.279  -0.450  1.00 37.83  ? 247 SER C OG  1 
ATOM   5882  N N   . GLY C 1 250 ? -9.507  50.181  2.077   1.00 50.71  ? 248 GLY C N   1 
ATOM   5883  C CA  . GLY C 1 250 ? -8.234  50.862  2.203   1.00 52.82  ? 248 GLY C CA  1 
ATOM   5884  C C   . GLY C 1 250 ? -7.835  51.035  3.650   1.00 56.18  ? 248 GLY C C   1 
ATOM   5885  O O   . GLY C 1 250 ? -6.716  51.449  3.962   1.00 57.03  ? 248 GLY C O   1 
ATOM   5886  N N   . GLY C 1 251 ? -8.754  50.731  4.550   1.00 54.12  ? 249 GLY C N   1 
ATOM   5887  C CA  . GLY C 1 251 ? -8.410  50.867  5.944   1.00 56.73  ? 249 GLY C CA  1 
ATOM   5888  C C   . GLY C 1 251 ? -8.537  52.296  6.417   1.00 57.81  ? 249 GLY C C   1 
ATOM   5889  O O   . GLY C 1 251 ? -7.874  52.703  7.390   1.00 63.92  ? 249 GLY C O   1 
ATOM   5890  N N   . PHE C 1 252 ? -9.374  53.062  5.715   1.00 52.19  ? 250 PHE C N   1 
ATOM   5891  C CA  . PHE C 1 252 ? -9.634  54.461  6.060   1.00 45.84  ? 250 PHE C CA  1 
ATOM   5892  C C   . PHE C 1 252 ? -9.903  54.561  7.575   1.00 44.77  ? 250 PHE C C   1 
ATOM   5893  O O   . PHE C 1 252 ? -9.365  55.428  8.279   1.00 40.64  ? 250 PHE C O   1 
ATOM   5894  C CB  . PHE C 1 252 ? -10.859 54.955  5.282   1.00 47.01  ? 250 PHE C CB  1 
ATOM   5895  C CG  . PHE C 1 252 ? -11.123 56.419  5.431   1.00 43.58  ? 250 PHE C CG  1 
ATOM   5896  C CD1 . PHE C 1 252 ? -10.198 57.349  4.955   1.00 40.76  ? 250 PHE C CD1 1 
ATOM   5897  C CD2 . PHE C 1 252 ? -12.292 56.870  6.054   1.00 40.80  ? 250 PHE C CD2 1 
ATOM   5898  C CE1 . PHE C 1 252 ? -10.423 58.710  5.094   1.00 36.32  ? 250 PHE C CE1 1 
ATOM   5899  C CE2 . PHE C 1 252 ? -12.531 58.231  6.203   1.00 42.34  ? 250 PHE C CE2 1 
ATOM   5900  C CZ  . PHE C 1 252 ? -11.585 59.155  5.713   1.00 41.79  ? 250 PHE C CZ  1 
ATOM   5901  N N   . ARG C 1 253 ? -10.781 53.684  8.060   1.00 45.83  ? 251 ARG C N   1 
ATOM   5902  C CA  . ARG C 1 253 ? -11.099 53.618  9.484   1.00 45.17  ? 251 ARG C CA  1 
ATOM   5903  C C   . ARG C 1 253 ? -9.736  53.503  10.197  1.00 43.20  ? 251 ARG C C   1 
ATOM   5904  O O   . ARG C 1 253 ? -9.463  54.266  11.121  1.00 45.07  ? 251 ARG C O   1 
ATOM   5905  C CB  . ARG C 1 253 ? -11.955 52.398  9.792   1.00 42.50  ? 251 ARG C CB  1 
ATOM   5906  C CG  . ARG C 1 253 ? -13.231 52.397  9.054   1.00 45.22  ? 251 ARG C CG  1 
ATOM   5907  C CD  . ARG C 1 253 ? -14.299 52.921  9.926   1.00 43.88  ? 251 ARG C CD  1 
ATOM   5908  N NE  . ARG C 1 253 ? -15.606 52.572  9.403   1.00 42.71  ? 251 ARG C NE  1 
ATOM   5909  C CZ  . ARG C 1 253 ? -16.728 53.077  9.896   1.00 47.72  ? 251 ARG C CZ  1 
ATOM   5910  N NH1 . ARG C 1 253 ? -16.639 53.929  10.907  1.00 54.75  ? 251 ARG C NH1 1 
ATOM   5911  N NH2 . ARG C 1 253 ? -17.924 52.759  9.395   1.00 41.44  ? 251 ARG C NH2 1 
ATOM   5912  N N   . SER C 1 254 ? -8.904  52.540  9.793   1.00 33.56  ? 252 SER C N   1 
ATOM   5913  C CA  . SER C 1 254 ? -7.577  52.411  10.362  1.00 33.47  ? 252 SER C CA  1 
ATOM   5914  C C   . SER C 1 254 ? -6.988  53.735  10.037  1.00 27.68  ? 252 SER C C   1 
ATOM   5915  O O   . SER C 1 254 ? -7.632  54.750  10.147  1.00 33.09  ? 252 SER C O   1 
ATOM   5916  C CB  . SER C 1 254 ? -6.758  51.358  9.622   1.00 35.54  ? 252 SER C CB  1 
ATOM   5917  O OG  . SER C 1 254 ? -7.232  50.045  9.864   1.00 43.24  ? 252 SER C OG  1 
ATOM   5918  N N   . LEU C 1 255 ? -5.771  53.726  9.553   1.00 23.10  ? 253 LEU C N   1 
ATOM   5919  C CA  . LEU C 1 255 ? -5.138  54.990  9.207   1.00 26.81  ? 253 LEU C CA  1 
ATOM   5920  C C   . LEU C 1 255 ? -5.491  56.122  10.189  1.00 25.07  ? 253 LEU C C   1 
ATOM   5921  O O   . LEU C 1 255 ? -4.646  56.534  10.952  1.00 23.31  ? 253 LEU C O   1 
ATOM   5922  C CB  . LEU C 1 255 ? -5.503  55.393  7.773   1.00 31.21  ? 253 LEU C CB  1 
ATOM   5923  C CG  . LEU C 1 255 ? -4.761  54.583  6.679   1.00 32.07  ? 253 LEU C CG  1 
ATOM   5924  C CD1 . LEU C 1 255 ? -5.391  53.193  6.636   1.00 36.15  ? 253 LEU C CD1 1 
ATOM   5925  C CD2 . LEU C 1 255 ? -4.799  55.291  5.281   1.00 31.22  ? 253 LEU C CD2 1 
ATOM   5926  N N   . LEU C 1 256 ? -6.722  56.621  10.167  1.00 27.43  ? 254 LEU C N   1 
ATOM   5927  C CA  . LEU C 1 256 ? -7.103  57.682  11.095  1.00 35.07  ? 254 LEU C CA  1 
ATOM   5928  C C   . LEU C 1 256 ? -6.745  57.350  12.531  1.00 38.07  ? 254 LEU C C   1 
ATOM   5929  O O   . LEU C 1 256 ? -6.331  58.233  13.318  1.00 41.89  ? 254 LEU C O   1 
ATOM   5930  C CB  . LEU C 1 256 ? -8.598  57.967  11.058  1.00 33.06  ? 254 LEU C CB  1 
ATOM   5931  C CG  . LEU C 1 256 ? -9.134  58.906  9.971   1.00 37.71  ? 254 LEU C CG  1 
ATOM   5932  C CD1 . LEU C 1 256 ? -10.513 59.377  10.421  1.00 39.13  ? 254 LEU C CD1 1 
ATOM   5933  C CD2 . LEU C 1 256 ? -8.219  60.102  9.747   1.00 30.44  ? 254 LEU C CD2 1 
ATOM   5934  N N   . ILE C 1 257 ? -6.932  56.080  12.887  1.00 36.68  ? 255 ILE C N   1 
ATOM   5935  C CA  . ILE C 1 257 ? -6.614  55.626  14.236  1.00 33.69  ? 255 ILE C CA  1 
ATOM   5936  C C   . ILE C 1 257 ? -5.103  55.552  14.369  1.00 35.99  ? 255 ILE C C   1 
ATOM   5937  O O   . ILE C 1 257 ? -4.522  55.931  15.381  1.00 41.11  ? 255 ILE C O   1 
ATOM   5938  C CB  . ILE C 1 257 ? -7.101  54.247  14.486  1.00 29.36  ? 255 ILE C CB  1 
ATOM   5939  C CG1 . ILE C 1 257 ? -8.611  54.189  14.309  1.00 28.16  ? 255 ILE C CG1 1 
ATOM   5940  C CG2 . ILE C 1 257 ? -6.736  53.830  15.909  1.00 30.46  ? 255 ILE C CG2 1 
ATOM   5941  C CD1 . ILE C 1 257 ? -9.099  52.753  14.174  1.00 36.95  ? 255 ILE C CD1 1 
ATOM   5942  N N   . ASN C 1 258 ? -4.467  55.031  13.340  1.00 33.60  ? 256 ASN C N   1 
ATOM   5943  C CA  . ASN C 1 258 ? -3.038  54.916  13.383  1.00 36.37  ? 256 ASN C CA  1 
ATOM   5944  C C   . ASN C 1 258 ? -2.465  56.305  13.522  1.00 39.61  ? 256 ASN C C   1 
ATOM   5945  O O   . ASN C 1 258 ? -1.262  56.454  13.604  1.00 45.14  ? 256 ASN C O   1 
ATOM   5946  C CB  . ASN C 1 258 ? -2.540  54.267  12.107  1.00 31.95  ? 256 ASN C CB  1 
ATOM   5947  C CG  . ASN C 1 258 ? -3.224  52.938  11.835  1.00 37.58  ? 256 ASN C CG  1 
ATOM   5948  O OD1 . ASN C 1 258 ? -4.438  52.807  12.005  1.00 46.90  ? 256 ASN C OD1 1 
ATOM   5949  N ND2 . ASN C 1 258 ? -2.462  51.956  11.387  1.00 35.72  ? 256 ASN C ND2 1 
ATOM   5950  N N   . ALA C 1 259 ? -3.320  57.326  13.542  1.00 37.86  ? 257 ALA C N   1 
ATOM   5951  C CA  . ALA C 1 259 ? -2.865  58.720  13.649  1.00 39.18  ? 257 ALA C CA  1 
ATOM   5952  C C   . ALA C 1 259 ? -3.121  59.280  15.036  1.00 38.63  ? 257 ALA C C   1 
ATOM   5953  O O   . ALA C 1 259 ? -2.197  59.784  15.661  1.00 40.82  ? 257 ALA C O   1 
ATOM   5954  C CB  . ALA C 1 259 ? -3.547  59.605  12.575  1.00 39.07  ? 257 ALA C CB  1 
ATOM   5955  N N   . VAL C 1 260 ? -4.365  59.201  15.509  1.00 37.35  ? 258 VAL C N   1 
ATOM   5956  C CA  . VAL C 1 260 ? -4.695  59.661  16.850  1.00 37.38  ? 258 VAL C CA  1 
ATOM   5957  C C   . VAL C 1 260 ? -4.172  58.543  17.718  1.00 43.18  ? 258 VAL C C   1 
ATOM   5958  O O   . VAL C 1 260 ? -4.956  57.941  18.481  1.00 48.81  ? 258 VAL C O   1 
ATOM   5959  C CB  . VAL C 1 260 ? -6.238  59.785  17.052  1.00 35.64  ? 258 VAL C CB  1 
ATOM   5960  C CG1 . VAL C 1 260 ? -6.614  59.772  18.546  1.00 27.45  ? 258 VAL C CG1 1 
ATOM   5961  C CG2 . VAL C 1 260 ? -6.695  61.074  16.437  1.00 36.74  ? 258 VAL C CG2 1 
ATOM   5962  N N   . GLU C 1 261 ? -2.880  58.223  17.583  1.00 40.37  ? 259 GLU C N   1 
ATOM   5963  C CA  . GLU C 1 261 ? -2.292  57.131  18.350  1.00 40.52  ? 259 GLU C CA  1 
ATOM   5964  C C   . GLU C 1 261 ? -0.837  57.341  18.267  1.00 41.79  ? 259 GLU C C   1 
ATOM   5965  O O   . GLU C 1 261 ? -0.101  57.041  19.167  1.00 40.66  ? 259 GLU C O   1 
ATOM   5966  C CB  . GLU C 1 261 ? -2.571  55.752  17.738  1.00 40.59  ? 259 GLU C CB  1 
ATOM   5967  C CG  . GLU C 1 261 ? -2.132  54.557  18.673  1.00 42.62  ? 259 GLU C CG  1 
ATOM   5968  C CD  . GLU C 1 261 ? -1.577  53.323  17.924  1.00 47.11  ? 259 GLU C CD  1 
ATOM   5969  O OE1 . GLU C 1 261 ? -1.771  52.150  18.378  1.00 37.55  ? 259 GLU C OE1 1 
ATOM   5970  O OE2 . GLU C 1 261 ? -0.928  53.537  16.869  1.00 50.24  ? 259 GLU C OE2 1 
ATOM   5971  N N   . ALA C 1 262 ? -0.397  57.802  17.124  1.00 45.16  ? 260 ALA C N   1 
ATOM   5972  C CA  . ALA C 1 262 ? 1.012   58.054  17.007  1.00 51.55  ? 260 ALA C CA  1 
ATOM   5973  C C   . ALA C 1 262 ? 1.192   59.468  17.495  1.00 55.92  ? 260 ALA C C   1 
ATOM   5974  O O   . ALA C 1 262 ? 2.184   59.797  18.139  1.00 59.91  ? 260 ALA C O   1 
ATOM   5975  C CB  . ALA C 1 262 ? 1.464   57.911  15.566  1.00 57.13  ? 260 ALA C CB  1 
ATOM   5976  N N   . SER C 1 263 ? 0.207   60.306  17.195  1.00 57.22  ? 261 SER C N   1 
ATOM   5977  C CA  . SER C 1 263 ? 0.241   61.697  17.624  1.00 56.37  ? 261 SER C CA  1 
ATOM   5978  C C   . SER C 1 263 ? 0.353   61.568  19.105  1.00 58.83  ? 261 SER C C   1 
ATOM   5979  O O   . SER C 1 263 ? 1.311   62.068  19.721  1.00 60.64  ? 261 SER C O   1 
ATOM   5980  C CB  . SER C 1 263 ? -1.074  62.406  17.289  1.00 58.68  ? 261 SER C CB  1 
ATOM   5981  O OG  . SER C 1 263 ? -1.212  63.637  17.984  1.00 57.27  ? 261 SER C OG  1 
ATOM   5982  N N   . CYS C 1 264 ? -0.624  60.858  19.670  1.00 56.44  ? 262 CYS C N   1 
ATOM   5983  C CA  . CYS C 1 264 ? -0.616  60.645  21.102  1.00 54.20  ? 262 CYS C CA  1 
ATOM   5984  C C   . CYS C 1 264 ? 0.757   60.093  21.557  1.00 50.23  ? 262 CYS C C   1 
ATOM   5985  O O   . CYS C 1 264 ? 1.618   60.831  21.983  1.00 52.84  ? 262 CYS C O   1 
ATOM   5986  C CB  . CYS C 1 264 ? -1.701  59.686  21.482  1.00 53.80  ? 262 CYS C CB  1 
ATOM   5987  S SG  . CYS C 1 264 ? -1.354  59.048  23.091  1.00 64.87  ? 262 CYS C SG  1 
ATOM   5988  N N   . ILE C 1 265 ? 0.959   58.794  21.447  1.00 45.94  ? 263 ILE C N   1 
ATOM   5989  C CA  . ILE C 1 265 ? 2.233   58.179  21.804  1.00 42.72  ? 263 ILE C CA  1 
ATOM   5990  C C   . ILE C 1 265 ? 3.442   59.101  21.656  1.00 45.01  ? 263 ILE C C   1 
ATOM   5991  O O   . ILE C 1 265 ? 4.279   59.187  22.549  1.00 45.86  ? 263 ILE C O   1 
ATOM   5992  C CB  . ILE C 1 265 ? 2.515   56.946  20.921  1.00 38.65  ? 263 ILE C CB  1 
ATOM   5993  C CG1 . ILE C 1 265 ? 1.793   55.728  21.479  1.00 29.54  ? 263 ILE C CG1 1 
ATOM   5994  C CG2 . ILE C 1 265 ? 4.036   56.754  20.747  1.00 36.13  ? 263 ILE C CG2 1 
ATOM   5995  C CD1 . ILE C 1 265 ? 2.141   54.441  20.757  1.00 39.99  ? 263 ILE C CD1 1 
ATOM   5996  N N   . ARG C 1 266 ? 3.570   59.774  20.521  1.00 48.37  ? 264 ARG C N   1 
ATOM   5997  C CA  . ARG C 1 266 ? 4.718   60.660  20.374  1.00 50.40  ? 264 ARG C CA  1 
ATOM   5998  C C   . ARG C 1 266 ? 4.578   61.790  21.375  1.00 50.30  ? 264 ARG C C   1 
ATOM   5999  O O   . ARG C 1 266 ? 5.549   62.302  21.904  1.00 48.25  ? 264 ARG C O   1 
ATOM   6000  C CB  . ARG C 1 266 ? 4.797   61.265  18.989  1.00 52.34  ? 264 ARG C CB  1 
ATOM   6001  C CG  . ARG C 1 266 ? 5.859   62.360  18.889  1.00 53.37  ? 264 ARG C CG  1 
ATOM   6002  C CD  . ARG C 1 266 ? 7.220   61.828  19.320  1.00 60.27  ? 264 ARG C CD  1 
ATOM   6003  N NE  . ARG C 1 266 ? 8.312   62.745  18.988  1.00 65.85  ? 264 ARG C NE  1 
ATOM   6004  C CZ  . ARG C 1 266 ? 9.606   62.435  19.076  1.00 68.59  ? 264 ARG C CZ  1 
ATOM   6005  N NH1 . ARG C 1 266 ? 9.972   61.225  19.486  1.00 68.10  ? 264 ARG C NH1 1 
ATOM   6006  N NH2 . ARG C 1 266 ? 10.539  63.329  18.754  1.00 68.41  ? 264 ARG C NH2 1 
ATOM   6007  N N   . THR C 1 267 ? 3.354   62.202  21.636  1.00 52.58  ? 265 THR C N   1 
ATOM   6008  C CA  . THR C 1 267 ? 3.184   63.247  22.618  1.00 57.88  ? 265 THR C CA  1 
ATOM   6009  C C   . THR C 1 267 ? 3.776   62.716  23.925  1.00 60.39  ? 265 THR C C   1 
ATOM   6010  O O   . THR C 1 267 ? 4.397   63.467  24.673  1.00 61.02  ? 265 THR C O   1 
ATOM   6011  C CB  . THR C 1 267 ? 1.694   63.618  22.848  1.00 59.11  ? 265 THR C CB  1 
ATOM   6012  O OG1 . THR C 1 267 ? 1.613   64.974  23.302  1.00 61.94  ? 265 THR C OG1 1 
ATOM   6013  C CG2 . THR C 1 267 ? 1.050   62.723  23.924  1.00 62.63  ? 265 THR C CG2 1 
ATOM   6014  N N   . ARG C 1 268 ? 3.601   61.417  24.180  1.00 62.71  ? 266 ARG C N   1 
ATOM   6015  C CA  . ARG C 1 268 ? 4.122   60.797  25.401  1.00 67.10  ? 266 ARG C CA  1 
ATOM   6016  C C   . ARG C 1 268 ? 5.647   60.690  25.353  1.00 68.41  ? 266 ARG C C   1 
ATOM   6017  O O   . ARG C 1 268 ? 6.330   61.026  26.314  1.00 66.87  ? 266 ARG C O   1 
ATOM   6018  C CB  . ARG C 1 268 ? 3.487   59.414  25.633  1.00 70.47  ? 266 ARG C CB  1 
ATOM   6019  C CG  . ARG C 1 268 ? 1.955   59.435  25.866  1.00 82.95  ? 266 ARG C CG  1 
ATOM   6020  C CD  . ARG C 1 268 ? 1.399   58.138  26.500  1.00 93.72  ? 266 ARG C CD  1 
ATOM   6021  N NE  . ARG C 1 268 ? -0.060  58.136  26.707  1.00 104.27 ? 266 ARG C NE  1 
ATOM   6022  C CZ  . ARG C 1 268 ? -0.729  59.038  27.430  1.00 108.39 ? 266 ARG C CZ  1 
ATOM   6023  N NH1 . ARG C 1 268 ? -0.073  60.027  28.016  1.00 111.27 ? 266 ARG C NH1 1 
ATOM   6024  N NH2 . ARG C 1 268 ? -2.048  58.945  27.599  1.00 106.89 ? 266 ARG C NH2 1 
ATOM   6025  N N   . GLU C 1 269 ? 6.180   60.261  24.215  1.00 71.45  ? 267 GLU C N   1 
ATOM   6026  C CA  . GLU C 1 269 ? 7.619   60.143  24.044  1.00 73.48  ? 267 GLU C CA  1 
ATOM   6027  C C   . GLU C 1 269 ? 8.281   61.478  24.336  1.00 74.29  ? 267 GLU C C   1 
ATOM   6028  O O   . GLU C 1 269 ? 9.480   61.535  24.589  1.00 75.47  ? 267 GLU C O   1 
ATOM   6029  C CB  . GLU C 1 269 ? 7.940   59.750  22.606  1.00 75.90  ? 267 GLU C CB  1 
ATOM   6030  C CG  . GLU C 1 269 ? 7.534   58.345  22.209  1.00 82.03  ? 267 GLU C CG  1 
ATOM   6031  C CD  . GLU C 1 269 ? 8.717   57.532  21.721  1.00 85.58  ? 267 GLU C CD  1 
ATOM   6032  O OE1 . GLU C 1 269 ? 9.390   58.021  20.779  1.00 82.94  ? 267 GLU C OE1 1 
ATOM   6033  O OE2 . GLU C 1 269 ? 8.963   56.421  22.273  1.00 87.58  ? 267 GLU C OE2 1 
ATOM   6034  N N   . LEU C 1 270 ? 7.490   62.549  24.290  1.00 75.66  ? 268 LEU C N   1 
ATOM   6035  C CA  . LEU C 1 270 ? 7.987   63.904  24.519  1.00 76.23  ? 268 LEU C CA  1 
ATOM   6036  C C   . LEU C 1 270 ? 8.069   64.366  25.972  1.00 78.10  ? 268 LEU C C   1 
ATOM   6037  O O   . LEU C 1 270 ? 9.080   64.922  26.377  1.00 80.03  ? 268 LEU C O   1 
ATOM   6038  C CB  . LEU C 1 270 ? 7.151   64.894  23.713  1.00 71.90  ? 268 LEU C CB  1 
ATOM   6039  C CG  . LEU C 1 270 ? 7.364   64.753  22.201  1.00 70.64  ? 268 LEU C CG  1 
ATOM   6040  C CD1 . LEU C 1 270 ? 6.684   65.896  21.416  1.00 70.83  ? 268 LEU C CD1 1 
ATOM   6041  C CD2 . LEU C 1 270 ? 8.846   64.753  21.928  1.00 64.83  ? 268 LEU C CD2 1 
ATOM   6042  N N   . GLN C 1 271 ? 7.009   64.169  26.747  1.00 82.54  ? 269 GLN C N   1 
ATOM   6043  C CA  . GLN C 1 271 ? 7.032   64.554  28.158  1.00 87.06  ? 269 GLN C CA  1 
ATOM   6044  C C   . GLN C 1 271 ? 8.043   63.651  28.875  1.00 87.89  ? 269 GLN C C   1 
ATOM   6045  O O   . GLN C 1 271 ? 9.024   64.125  29.441  1.00 88.78  ? 269 GLN C O   1 
ATOM   6046  C CB  . GLN C 1 271 ? 5.643   64.390  28.800  1.00 89.33  ? 269 GLN C CB  1 
ATOM   6047  C CG  . GLN C 1 271 ? 5.033   62.994  28.626  1.00 92.71  ? 269 GLN C CG  1 
ATOM   6048  C CD  . GLN C 1 271 ? 3.738   62.809  29.375  1.00 95.10  ? 269 GLN C CD  1 
ATOM   6049  O OE1 . GLN C 1 271 ? 2.833   63.636  29.269  1.00 95.18  ? 269 GLN C OE1 1 
ATOM   6050  N NE2 . GLN C 1 271 ? 3.632   61.705  30.125  1.00 97.69  ? 269 GLN C NE2 1 
ATOM   6051  N N   . SER C 1 272 ? 7.802   62.344  28.831  1.00 89.78  ? 270 SER C N   1 
ATOM   6052  C CA  . SER C 1 272 ? 8.686   61.367  29.458  1.00 94.98  ? 270 SER C CA  1 
ATOM   6053  C C   . SER C 1 272 ? 10.116  61.627  29.015  1.00 96.69  ? 270 SER C C   1 
ATOM   6054  O O   . SER C 1 272 ? 11.053  61.077  29.562  1.00 97.45  ? 270 SER C O   1 
ATOM   6055  C CB  . SER C 1 272 ? 8.289   59.932  29.071  1.00 96.86  ? 270 SER C CB  1 
ATOM   6056  O OG  . SER C 1 272 ? 8.967   59.470  27.903  1.00 96.62  ? 270 SER C OG  1 
ATOM   6057  N N   . MET C 1 273 ? 10.271  62.467  28.008  1.00 98.60  ? 271 MET C N   1 
ATOM   6058  C CA  . MET C 1 273 ? 11.577  62.823  27.496  1.00 102.62 ? 271 MET C CA  1 
ATOM   6059  C C   . MET C 1 273 ? 11.962  64.145  28.126  1.00 104.69 ? 271 MET C C   1 
ATOM   6060  O O   . MET C 1 273 ? 13.114  64.376  28.448  1.00 103.89 ? 271 MET C O   1 
ATOM   6061  C CB  . MET C 1 273 ? 11.498  62.975  25.985  1.00 107.96 ? 271 MET C CB  1 
ATOM   6062  C CG  . MET C 1 273 ? 12.674  63.667  25.331  1.00 114.56 ? 271 MET C CG  1 
ATOM   6063  S SD  . MET C 1 273 ? 12.255  64.271  23.649  1.00 119.94 ? 271 MET C SD  1 
ATOM   6064  C CE  . MET C 1 273 ? 12.959  62.921  22.590  1.00 119.87 ? 271 MET C CE  1 
ATOM   6065  N N   . ALA C 1 274 ? 10.985  65.025  28.286  1.00 109.97 ? 272 ALA C N   1 
ATOM   6066  C CA  . ALA C 1 274 ? 11.232  66.324  28.892  1.00 116.02 ? 272 ALA C CA  1 
ATOM   6067  C C   . ALA C 1 274 ? 11.818  66.116  30.283  1.00 120.78 ? 272 ALA C C   1 
ATOM   6068  O O   . ALA C 1 274 ? 12.458  67.017  30.832  1.00 124.01 ? 272 ALA C O   1 
ATOM   6069  C CB  . ALA C 1 274 ? 9.938   67.123  28.984  1.00 116.51 ? 272 ALA C CB  1 
ATOM   6070  N N   . ASP C 1 275 ? 11.596  64.931  30.853  1.00 123.54 ? 273 ASP C N   1 
ATOM   6071  C CA  . ASP C 1 275 ? 12.132  64.613  32.177  1.00 125.11 ? 273 ASP C CA  1 
ATOM   6072  C C   . ASP C 1 275 ? 13.074  63.410  32.117  1.00 127.89 ? 273 ASP C C   1 
ATOM   6073  O O   . ASP C 1 275 ? 13.710  63.040  33.104  1.00 126.25 ? 273 ASP C O   1 
ATOM   6074  C CB  . ASP C 1 275 ? 10.988  64.364  33.175  1.00 121.53 ? 273 ASP C CB  1 
ATOM   6075  C CG  . ASP C 1 275 ? 9.668   64.051  32.494  1.00 118.36 ? 273 ASP C CG  1 
ATOM   6076  O OD1 . ASP C 1 275 ? 9.445   62.880  32.105  1.00 117.75 ? 273 ASP C OD1 1 
ATOM   6077  O OD2 . ASP C 1 275 ? 8.846   64.984  32.343  1.00 115.41 ? 273 ASP C OD2 1 
ATOM   6078  N N   . GLN C 1 276 ? 13.159  62.820  30.930  1.00 133.97 ? 274 GLN C N   1 
ATOM   6079  C CA  . GLN C 1 276 ? 14.004  61.652  30.656  1.00 140.52 ? 274 GLN C CA  1 
ATOM   6080  C C   . GLN C 1 276 ? 15.475  62.043  30.482  1.00 144.67 ? 274 GLN C C   1 
ATOM   6081  O O   . GLN C 1 276 ? 16.317  61.191  30.179  1.00 145.19 ? 274 GLN C O   1 
ATOM   6082  C CB  . GLN C 1 276 ? 13.519  60.954  29.369  1.00 140.48 ? 274 GLN C CB  1 
ATOM   6083  C CG  . GLN C 1 276 ? 14.225  59.651  29.002  1.00 138.91 ? 274 GLN C CG  1 
ATOM   6084  C CD  . GLN C 1 276 ? 13.719  59.056  27.700  1.00 137.22 ? 274 GLN C CD  1 
ATOM   6085  O OE1 . GLN C 1 276 ? 12.523  58.784  27.551  1.00 136.10 ? 274 GLN C OE1 1 
ATOM   6086  N NE2 . GLN C 1 276 ? 14.632  58.842  26.751  1.00 135.21 ? 274 GLN C NE2 1 
ATOM   6087  N N   . GLU C 1 277 ? 15.788  63.321  30.682  1.00 148.80 ? 275 GLU C N   1 
ATOM   6088  C CA  . GLU C 1 277 ? 17.157  63.789  30.494  1.00 153.20 ? 275 GLU C CA  1 
ATOM   6089  C C   . GLU C 1 277 ? 17.221  65.258  30.947  1.00 154.09 ? 275 GLU C C   1 
ATOM   6090  O O   . GLU C 1 277 ? 16.173  65.779  31.412  1.00 153.38 ? 275 GLU C O   1 
ATOM   6091  C CB  . GLU C 1 277 ? 17.529  63.621  28.995  1.00 156.79 ? 275 GLU C CB  1 
ATOM   6092  C CG  . GLU C 1 277 ? 19.022  63.441  28.638  1.00 160.70 ? 275 GLU C CG  1 
ATOM   6093  C CD  . GLU C 1 277 ? 19.240  62.681  27.306  1.00 162.11 ? 275 GLU C CD  1 
ATOM   6094  O OE1 . GLU C 1 277 ? 18.913  61.470  27.250  1.00 163.47 ? 275 GLU C OE1 1 
ATOM   6095  O OE2 . GLU C 1 277 ? 19.737  63.284  26.320  1.00 161.10 ? 275 GLU C OE2 1 
ATOM   6096  N N   . ARG D 1 1   ? -32.898 32.334  46.680  1.00 76.14  ? -1  ARG D N   1 
ATOM   6097  C CA  . ARG D 1 1   ? -34.326 32.331  47.145  1.00 85.33  ? -1  ARG D CA  1 
ATOM   6098  C C   . ARG D 1 1   ? -34.769 33.636  47.834  1.00 83.18  ? -1  ARG D C   1 
ATOM   6099  O O   . ARG D 1 1   ? -35.742 34.260  47.433  1.00 79.38  ? -1  ARG D O   1 
ATOM   6100  C CB  . ARG D 1 1   ? -34.548 31.184  48.105  1.00 93.44  ? -1  ARG D CB  1 
ATOM   6101  C CG  . ARG D 1 1   ? -34.204 29.810  47.527  1.00 104.96 ? -1  ARG D CG  1 
ATOM   6102  C CD  . ARG D 1 1   ? -34.916 28.785  48.377  1.00 113.82 ? -1  ARG D CD  1 
ATOM   6103  N NE  . ARG D 1 1   ? -34.501 27.407  48.106  1.00 125.28 ? -1  ARG D NE  1 
ATOM   6104  C CZ  . ARG D 1 1   ? -35.156 26.344  48.575  1.00 131.93 ? -1  ARG D CZ  1 
ATOM   6105  N NH1 . ARG D 1 1   ? -36.244 26.524  49.320  1.00 135.06 ? -1  ARG D NH1 1 
ATOM   6106  N NH2 . ARG D 1 1   ? -34.729 25.110  48.319  1.00 134.80 ? -1  ARG D NH2 1 
ATOM   6107  N N   . ALA D 1 2   ? -34.056 34.042  48.884  1.00 85.18  ? 0   ALA D N   1 
ATOM   6108  C CA  . ALA D 1 2   ? -34.362 35.286  49.587  1.00 83.81  ? 0   ALA D CA  1 
ATOM   6109  C C   . ALA D 1 2   ? -33.130 36.134  49.380  1.00 83.00  ? 0   ALA D C   1 
ATOM   6110  O O   . ALA D 1 2   ? -32.756 36.996  50.206  1.00 83.61  ? 0   ALA D O   1 
ATOM   6111  N N   . MET D 1 3   ? -32.508 35.851  48.235  1.00 80.71  ? 1   MET D N   1 
ATOM   6112  C CA  . MET D 1 3   ? -31.288 36.502  47.797  1.00 79.81  ? 1   MET D CA  1 
ATOM   6113  C C   . MET D 1 3   ? -31.462 37.934  47.308  1.00 79.16  ? 1   MET D C   1 
ATOM   6114  O O   . MET D 1 3   ? -32.545 38.380  46.956  1.00 77.59  ? 1   MET D O   1 
ATOM   6115  C CB  . MET D 1 3   ? -30.611 35.680  46.717  1.00 80.52  ? 1   MET D CB  1 
ATOM   6116  C CG  . MET D 1 3   ? -29.186 36.104  46.436  1.00 84.85  ? 1   MET D CG  1 
ATOM   6117  S SD  . MET D 1 3   ? -28.606 35.503  44.841  1.00 90.42  ? 1   MET D SD  1 
ATOM   6118  C CE  . MET D 1 3   ? -29.575 36.601  43.752  1.00 84.13  ? 1   MET D CE  1 
ATOM   6119  N N   . SER D 1 4   ? -30.350 38.647  47.280  1.00 78.63  ? 2   SER D N   1 
ATOM   6120  C CA  . SER D 1 4   ? -30.330 40.049  46.915  1.00 78.40  ? 2   SER D CA  1 
ATOM   6121  C C   . SER D 1 4   ? -28.954 40.379  46.271  1.00 75.03  ? 2   SER D C   1 
ATOM   6122  O O   . SER D 1 4   ? -27.918 39.890  46.741  1.00 75.60  ? 2   SER D O   1 
ATOM   6123  C CB  . SER D 1 4   ? -30.577 40.867  48.211  1.00 87.39  ? 2   SER D CB  1 
ATOM   6124  O OG  . SER D 1 4   ? -30.920 40.051  49.365  1.00 92.02  ? 2   SER D OG  1 
ATOM   6125  N N   . VAL D 1 5   ? -28.932 41.190  45.202  1.00 68.94  ? 3   VAL D N   1 
ATOM   6126  C CA  . VAL D 1 5   ? -27.670 41.513  44.517  1.00 60.44  ? 3   VAL D CA  1 
ATOM   6127  C C   . VAL D 1 5   ? -27.276 42.980  44.368  1.00 57.11  ? 3   VAL D C   1 
ATOM   6128  O O   . VAL D 1 5   ? -28.100 43.846  44.078  1.00 56.06  ? 3   VAL D O   1 
ATOM   6129  C CB  . VAL D 1 5   ? -27.629 40.913  43.087  1.00 58.32  ? 3   VAL D CB  1 
ATOM   6130  C CG1 . VAL D 1 5   ? -26.264 41.182  42.458  1.00 61.11  ? 3   VAL D CG1 1 
ATOM   6131  C CG2 . VAL D 1 5   ? -27.912 39.446  43.127  1.00 52.63  ? 3   VAL D CG2 1 
ATOM   6132  N N   . GLY D 1 6   ? -25.989 43.236  44.539  1.00 52.49  ? 4   GLY D N   1 
ATOM   6133  C CA  . GLY D 1 6   ? -25.511 44.576  44.384  1.00 53.47  ? 4   GLY D CA  1 
ATOM   6134  C C   . GLY D 1 6   ? -24.289 44.521  43.506  1.00 57.99  ? 4   GLY D C   1 
ATOM   6135  O O   . GLY D 1 6   ? -23.547 43.520  43.470  1.00 52.70  ? 4   GLY D O   1 
ATOM   6136  N N   . PHE D 1 7   ? -24.096 45.614  42.777  1.00 60.91  ? 5   PHE D N   1 
ATOM   6137  C CA  . PHE D 1 7   ? -22.950 45.769  41.896  1.00 63.16  ? 5   PHE D CA  1 
ATOM   6138  C C   . PHE D 1 7   ? -22.245 47.038  42.282  1.00 63.22  ? 5   PHE D C   1 
ATOM   6139  O O   . PHE D 1 7   ? -22.866 48.082  42.440  1.00 61.83  ? 5   PHE D O   1 
ATOM   6140  C CB  . PHE D 1 7   ? -23.355 45.985  40.454  1.00 67.00  ? 5   PHE D CB  1 
ATOM   6141  C CG  . PHE D 1 7   ? -24.169 44.884  39.848  1.00 69.93  ? 5   PHE D CG  1 
ATOM   6142  C CD1 . PHE D 1 7   ? -25.529 44.775  40.119  1.00 68.81  ? 5   PHE D CD1 1 
ATOM   6143  C CD2 . PHE D 1 7   ? -23.602 44.039  38.887  1.00 67.44  ? 5   PHE D CD2 1 
ATOM   6144  C CE1 . PHE D 1 7   ? -26.306 43.848  39.422  1.00 72.67  ? 5   PHE D CE1 1 
ATOM   6145  C CE2 . PHE D 1 7   ? -24.372 43.112  38.192  1.00 69.67  ? 5   PHE D CE2 1 
ATOM   6146  C CZ  . PHE D 1 7   ? -25.722 43.014  38.448  1.00 69.59  ? 5   PHE D CZ  1 
ATOM   6147  N N   . ILE D 1 8   ? -20.942 46.961  42.400  1.00 63.11  ? 6   ILE D N   1 
ATOM   6148  C CA  . ILE D 1 8   ? -20.194 48.135  42.729  1.00 70.46  ? 6   ILE D CA  1 
ATOM   6149  C C   . ILE D 1 8   ? -19.768 48.825  41.470  1.00 77.05  ? 6   ILE D C   1 
ATOM   6150  O O   . ILE D 1 8   ? -18.970 48.303  40.690  1.00 75.73  ? 6   ILE D O   1 
ATOM   6151  C CB  . ILE D 1 8   ? -19.013 47.786  43.536  1.00 70.37  ? 6   ILE D CB  1 
ATOM   6152  C CG1 . ILE D 1 8   ? -19.520 47.333  44.889  1.00 74.13  ? 6   ILE D CG1 1 
ATOM   6153  C CG2 . ILE D 1 8   ? -18.078 48.978  43.649  1.00 67.05  ? 6   ILE D CG2 1 
ATOM   6154  C CD1 . ILE D 1 8   ? -18.476 46.707  45.691  1.00 82.87  ? 6   ILE D CD1 1 
ATOM   6155  N N   . GLY D 1 9   ? -20.294 50.028  41.294  1.00 82.64  ? 7   GLY D N   1 
ATOM   6156  C CA  . GLY D 1 9   ? -20.014 50.779  40.097  1.00 86.90  ? 7   GLY D CA  1 
ATOM   6157  C C   . GLY D 1 9   ? -21.096 50.322  39.136  1.00 88.24  ? 7   GLY D C   1 
ATOM   6158  O O   . GLY D 1 9   ? -21.508 49.148  39.165  1.00 84.94  ? 7   GLY D O   1 
ATOM   6159  N N   . ALA D 1 10  ? -21.569 51.249  38.302  1.00 90.97  ? 8   ALA D N   1 
ATOM   6160  C CA  . ALA D 1 10  ? -22.596 50.934  37.319  1.00 91.90  ? 8   ALA D CA  1 
ATOM   6161  C C   . ALA D 1 10  ? -21.912 50.433  36.023  1.00 93.03  ? 8   ALA D C   1 
ATOM   6162  O O   . ALA D 1 10  ? -21.025 49.561  36.065  1.00 94.93  ? 8   ALA D O   1 
ATOM   6163  C CB  . ALA D 1 10  ? -23.459 52.172  37.054  1.00 84.89  ? 8   ALA D CB  1 
ATOM   6164  N N   . GLY D 1 11  ? -22.324 50.945  34.870  1.00 89.76  ? 9   GLY D N   1 
ATOM   6165  C CA  . GLY D 1 11  ? -21.682 50.490  33.656  1.00 83.21  ? 9   GLY D CA  1 
ATOM   6166  C C   . GLY D 1 11  ? -22.541 49.705  32.705  1.00 78.17  ? 9   GLY D C   1 
ATOM   6167  O O   . GLY D 1 11  ? -23.626 49.224  33.035  1.00 74.24  ? 9   GLY D O   1 
ATOM   6168  N N   . GLN D 1 12  ? -22.041 49.610  31.485  1.00 75.87  ? 10  GLN D N   1 
ATOM   6169  C CA  . GLN D 1 12  ? -22.744 48.879  30.467  1.00 74.93  ? 10  GLN D CA  1 
ATOM   6170  C C   . GLN D 1 12  ? -23.013 47.540  31.087  1.00 72.36  ? 10  GLN D C   1 
ATOM   6171  O O   . GLN D 1 12  ? -24.167 47.206  31.403  1.00 72.92  ? 10  GLN D O   1 
ATOM   6172  C CB  . GLN D 1 12  ? -21.865 48.689  29.229  1.00 76.10  ? 10  GLN D CB  1 
ATOM   6173  C CG  . GLN D 1 12  ? -22.361 49.432  28.018  1.00 76.91  ? 10  GLN D CG  1 
ATOM   6174  C CD  . GLN D 1 12  ? -22.557 50.930  28.271  1.00 77.89  ? 10  GLN D CD  1 
ATOM   6175  O OE1 . GLN D 1 12  ? -21.621 51.660  28.595  1.00 75.11  ? 10  GLN D OE1 1 
ATOM   6176  N NE2 . GLN D 1 12  ? -23.785 51.389  28.108  1.00 78.07  ? 10  GLN D NE2 1 
ATOM   6177  N N   . LEU D 1 13  ? -21.926 46.804  31.304  1.00 65.89  ? 11  LEU D N   1 
ATOM   6178  C CA  . LEU D 1 13  ? -22.046 45.473  31.828  1.00 60.52  ? 11  LEU D CA  1 
ATOM   6179  C C   . LEU D 1 13  ? -22.872 45.378  33.094  1.00 59.07  ? 11  LEU D C   1 
ATOM   6180  O O   . LEU D 1 13  ? -23.335 44.298  33.463  1.00 57.64  ? 11  LEU D O   1 
ATOM   6181  C CB  . LEU D 1 13  ? -20.673 44.857  32.018  1.00 63.10  ? 11  LEU D CB  1 
ATOM   6182  C CG  . LEU D 1 13  ? -20.660 43.313  32.015  1.00 66.89  ? 11  LEU D CG  1 
ATOM   6183  C CD1 . LEU D 1 13  ? -21.883 42.750  31.289  1.00 69.95  ? 11  LEU D CD1 1 
ATOM   6184  C CD2 . LEU D 1 13  ? -19.385 42.823  31.325  1.00 66.55  ? 11  LEU D CD2 1 
ATOM   6185  N N   . ALA D 1 14  ? -23.091 46.502  33.758  1.00 54.37  ? 12  ALA D N   1 
ATOM   6186  C CA  . ALA D 1 14  ? -23.901 46.478  34.971  1.00 49.66  ? 12  ALA D CA  1 
ATOM   6187  C C   . ALA D 1 14  ? -25.338 46.407  34.531  1.00 50.28  ? 12  ALA D C   1 
ATOM   6188  O O   . ALA D 1 14  ? -26.071 45.483  34.882  1.00 44.02  ? 12  ALA D O   1 
ATOM   6189  C CB  . ALA D 1 14  ? -23.688 47.728  35.745  1.00 51.89  ? 12  ALA D CB  1 
ATOM   6190  N N   . PHE D 1 15  ? -25.725 47.426  33.762  1.00 52.62  ? 13  PHE D N   1 
ATOM   6191  C CA  . PHE D 1 15  ? -27.069 47.541  33.206  1.00 52.81  ? 13  PHE D CA  1 
ATOM   6192  C C   . PHE D 1 15  ? -27.394 46.268  32.463  1.00 48.03  ? 13  PHE D C   1 
ATOM   6193  O O   . PHE D 1 15  ? -28.517 45.814  32.492  1.00 42.15  ? 13  PHE D O   1 
ATOM   6194  C CB  . PHE D 1 15  ? -27.151 48.713  32.221  1.00 62.38  ? 13  PHE D CB  1 
ATOM   6195  C CG  . PHE D 1 15  ? -28.404 48.707  31.329  1.00 69.33  ? 13  PHE D CG  1 
ATOM   6196  C CD1 . PHE D 1 15  ? -29.681 48.913  31.863  1.00 72.03  ? 13  PHE D CD1 1 
ATOM   6197  C CD2 . PHE D 1 15  ? -28.285 48.570  29.935  1.00 70.68  ? 13  PHE D CD2 1 
ATOM   6198  C CE1 . PHE D 1 15  ? -30.806 48.994  31.031  1.00 72.32  ? 13  PHE D CE1 1 
ATOM   6199  C CE2 . PHE D 1 15  ? -29.405 48.649  29.098  1.00 70.68  ? 13  PHE D CE2 1 
ATOM   6200  C CZ  . PHE D 1 15  ? -30.662 48.864  29.645  1.00 71.69  ? 13  PHE D CZ  1 
ATOM   6201  N N   . ALA D 1 16  ? -26.403 45.708  31.778  1.00 47.40  ? 14  ALA D N   1 
ATOM   6202  C CA  . ALA D 1 16  ? -26.639 44.471  31.044  1.00 49.78  ? 14  ALA D CA  1 
ATOM   6203  C C   . ALA D 1 16  ? -27.104 43.384  32.012  1.00 50.03  ? 14  ALA D C   1 
ATOM   6204  O O   . ALA D 1 16  ? -28.271 43.003  32.006  1.00 49.55  ? 14  ALA D O   1 
ATOM   6205  C CB  . ALA D 1 16  ? -25.380 44.026  30.280  1.00 45.99  ? 14  ALA D CB  1 
ATOM   6206  N N   . LEU D 1 17  ? -26.209 42.909  32.870  1.00 54.29  ? 15  LEU D N   1 
ATOM   6207  C CA  . LEU D 1 17  ? -26.575 41.872  33.833  1.00 55.38  ? 15  LEU D CA  1 
ATOM   6208  C C   . LEU D 1 17  ? -27.722 42.350  34.685  1.00 55.85  ? 15  LEU D C   1 
ATOM   6209  O O   . LEU D 1 17  ? -28.566 41.563  35.095  1.00 55.04  ? 15  LEU D O   1 
ATOM   6210  C CB  . LEU D 1 17  ? -25.381 41.498  34.711  1.00 53.59  ? 15  LEU D CB  1 
ATOM   6211  C CG  . LEU D 1 17  ? -24.502 40.467  33.979  1.00 59.04  ? 15  LEU D CG  1 
ATOM   6212  C CD1 . LEU D 1 17  ? -23.049 40.874  34.078  1.00 62.70  ? 15  LEU D CD1 1 
ATOM   6213  C CD2 . LEU D 1 17  ? -24.708 39.064  34.532  1.00 56.63  ? 15  LEU D CD2 1 
ATOM   6214  N N   . ALA D 1 18  ? -27.759 43.654  34.934  1.00 57.35  ? 16  ALA D N   1 
ATOM   6215  C CA  . ALA D 1 18  ? -28.829 44.233  35.722  1.00 58.38  ? 16  ALA D CA  1 
ATOM   6216  C C   . ALA D 1 18  ? -30.156 43.852  35.088  1.00 60.92  ? 16  ALA D C   1 
ATOM   6217  O O   . ALA D 1 18  ? -31.055 43.340  35.731  1.00 59.91  ? 16  ALA D O   1 
ATOM   6218  C CB  . ALA D 1 18  ? -28.692 45.711  35.727  1.00 56.57  ? 16  ALA D CB  1 
ATOM   6219  N N   . LYS D 1 19  ? -30.246 44.101  33.792  1.00 66.40  ? 17  LYS D N   1 
ATOM   6220  C CA  . LYS D 1 19  ? -31.452 43.833  33.040  1.00 69.26  ? 17  LYS D CA  1 
ATOM   6221  C C   . LYS D 1 19  ? -31.726 42.362  32.751  1.00 68.55  ? 17  LYS D C   1 
ATOM   6222  O O   . LYS D 1 19  ? -32.873 41.925  32.813  1.00 65.59  ? 17  LYS D O   1 
ATOM   6223  C CB  . LYS D 1 19  ? -31.410 44.629  31.731  1.00 72.78  ? 17  LYS D CB  1 
ATOM   6224  C CG  . LYS D 1 19  ? -32.613 44.388  30.874  1.00 77.32  ? 17  LYS D CG  1 
ATOM   6225  C CD  . LYS D 1 19  ? -32.673 45.398  29.782  1.00 83.01  ? 17  LYS D CD  1 
ATOM   6226  C CE  . LYS D 1 19  ? -32.980 46.762  30.361  1.00 87.20  ? 17  LYS D CE  1 
ATOM   6227  N NZ  . LYS D 1 19  ? -33.176 47.766  29.283  1.00 88.93  ? 17  LYS D NZ  1 
ATOM   6228  N N   . GLY D 1 20  ? -30.680 41.609  32.418  1.00 70.09  ? 18  GLY D N   1 
ATOM   6229  C CA  . GLY D 1 20  ? -30.849 40.192  32.122  1.00 73.81  ? 18  GLY D CA  1 
ATOM   6230  C C   . GLY D 1 20  ? -31.487 39.399  33.260  1.00 75.28  ? 18  GLY D C   1 
ATOM   6231  O O   . GLY D 1 20  ? -32.355 38.539  33.073  1.00 74.97  ? 18  GLY D O   1 
ATOM   6232  N N   . PHE D 1 21  ? -31.040 39.681  34.468  1.00 76.25  ? 19  PHE D N   1 
ATOM   6233  C CA  . PHE D 1 21  ? -31.572 38.999  35.622  1.00 75.76  ? 19  PHE D CA  1 
ATOM   6234  C C   . PHE D 1 21  ? -32.995 39.497  35.797  1.00 77.12  ? 19  PHE D C   1 
ATOM   6235  O O   . PHE D 1 21  ? -33.899 38.707  36.056  1.00 77.94  ? 19  PHE D O   1 
ATOM   6236  C CB  . PHE D 1 21  ? -30.751 39.338  36.861  1.00 75.88  ? 19  PHE D CB  1 
ATOM   6237  C CG  . PHE D 1 21  ? -29.306 38.876  36.815  1.00 75.67  ? 19  PHE D CG  1 
ATOM   6238  C CD1 . PHE D 1 21  ? -28.301 39.646  37.414  1.00 74.88  ? 19  PHE D CD1 1 
ATOM   6239  C CD2 . PHE D 1 21  ? -28.953 37.669  36.239  1.00 77.47  ? 19  PHE D CD2 1 
ATOM   6240  C CE1 . PHE D 1 21  ? -26.969 39.228  37.448  1.00 74.73  ? 19  PHE D CE1 1 
ATOM   6241  C CE2 . PHE D 1 21  ? -27.610 37.235  36.268  1.00 81.82  ? 19  PHE D CE2 1 
ATOM   6242  C CZ  . PHE D 1 21  ? -26.620 38.030  36.882  1.00 78.27  ? 19  PHE D CZ  1 
ATOM   6243  N N   . THR D 1 22  ? -33.182 40.809  35.643  1.00 77.82  ? 20  THR D N   1 
ATOM   6244  C CA  . THR D 1 22  ? -34.503 41.436  35.778  1.00 80.99  ? 20  THR D CA  1 
ATOM   6245  C C   . THR D 1 22  ? -35.465 40.634  34.949  1.00 83.27  ? 20  THR D C   1 
ATOM   6246  O O   . THR D 1 22  ? -36.500 40.168  35.424  1.00 83.24  ? 20  THR D O   1 
ATOM   6247  C CB  . THR D 1 22  ? -34.553 42.853  35.168  1.00 83.62  ? 20  THR D CB  1 
ATOM   6248  O OG1 . THR D 1 22  ? -33.613 43.702  35.820  1.00 88.29  ? 20  THR D OG1 1 
ATOM   6249  C CG2 . THR D 1 22  ? -35.950 43.441  35.284  1.00 84.93  ? 20  THR D CG2 1 
ATOM   6250  N N   . ALA D 1 23  ? -35.074 40.506  33.684  1.00 87.00  ? 21  ALA D N   1 
ATOM   6251  C CA  . ALA D 1 23  ? -35.803 39.814  32.638  1.00 85.44  ? 21  ALA D CA  1 
ATOM   6252  C C   . ALA D 1 23  ? -35.979 38.317  32.866  1.00 86.58  ? 21  ALA D C   1 
ATOM   6253  O O   . ALA D 1 23  ? -37.054 37.779  32.594  1.00 88.07  ? 21  ALA D O   1 
ATOM   6254  C CB  . ALA D 1 23  ? -35.110 40.060  31.309  1.00 87.11  ? 21  ALA D CB  1 
ATOM   6255  N N   . ALA D 1 24  ? -34.943 37.632  33.347  1.00 86.94  ? 22  ALA D N   1 
ATOM   6256  C CA  . ALA D 1 24  ? -35.083 36.194  33.588  1.00 87.27  ? 22  ALA D CA  1 
ATOM   6257  C C   . ALA D 1 24  ? -36.110 35.938  34.704  1.00 87.88  ? 22  ALA D C   1 
ATOM   6258  O O   . ALA D 1 24  ? -36.616 34.818  34.847  1.00 89.99  ? 22  ALA D O   1 
ATOM   6259  C CB  . ALA D 1 24  ? -33.728 35.563  33.946  1.00 83.88  ? 22  ALA D CB  1 
ATOM   6260  N N   . GLY D 1 25  ? -36.433 36.981  35.473  1.00 88.17  ? 23  GLY D N   1 
ATOM   6261  C CA  . GLY D 1 25  ? -37.395 36.854  36.567  1.00 87.65  ? 23  GLY D CA  1 
ATOM   6262  C C   . GLY D 1 25  ? -36.743 36.342  37.841  1.00 86.84  ? 23  GLY D C   1 
ATOM   6263  O O   . GLY D 1 25  ? -37.393 35.926  38.803  1.00 86.43  ? 23  GLY D O   1 
ATOM   6264  N N   . VAL D 1 26  ? -35.421 36.380  37.815  1.00 85.99  ? 24  VAL D N   1 
ATOM   6265  C CA  . VAL D 1 26  ? -34.589 35.923  38.900  1.00 85.49  ? 24  VAL D CA  1 
ATOM   6266  C C   . VAL D 1 26  ? -34.868 36.677  40.179  1.00 82.96  ? 24  VAL D C   1 
ATOM   6267  O O   . VAL D 1 26  ? -35.157 36.081  41.212  1.00 81.36  ? 24  VAL D O   1 
ATOM   6268  C CB  . VAL D 1 26  ? -33.130 36.112  38.547  1.00 88.91  ? 24  VAL D CB  1 
ATOM   6269  C CG1 . VAL D 1 26  ? -32.280 35.535  39.651  1.00 91.05  ? 24  VAL D CG1 1 
ATOM   6270  C CG2 . VAL D 1 26  ? -32.832 35.454  37.198  1.00 93.12  ? 24  VAL D CG2 1 
ATOM   6271  N N   . LEU D 1 27  ? -34.759 37.996  40.088  1.00 81.30  ? 25  LEU D N   1 
ATOM   6272  C CA  . LEU D 1 27  ? -34.990 38.881  41.209  1.00 82.00  ? 25  LEU D CA  1 
ATOM   6273  C C   . LEU D 1 27  ? -36.001 39.907  40.795  1.00 82.52  ? 25  LEU D C   1 
ATOM   6274  O O   . LEU D 1 27  ? -36.575 39.825  39.704  1.00 81.93  ? 25  LEU D O   1 
ATOM   6275  C CB  . LEU D 1 27  ? -33.736 39.650  41.567  1.00 86.41  ? 25  LEU D CB  1 
ATOM   6276  C CG  . LEU D 1 27  ? -32.422 38.891  41.583  1.00 90.03  ? 25  LEU D CG  1 
ATOM   6277  C CD1 . LEU D 1 27  ? -31.316 39.811  42.104  1.00 92.58  ? 25  LEU D CD1 1 
ATOM   6278  C CD2 . LEU D 1 27  ? -32.570 37.665  42.479  1.00 99.57  ? 25  LEU D CD2 1 
ATOM   6279  N N   . ALA D 1 28  ? -36.191 40.896  41.664  1.00 80.89  ? 26  ALA D N   1 
ATOM   6280  C CA  . ALA D 1 28  ? -37.123 41.958  41.376  1.00 79.41  ? 26  ALA D CA  1 
ATOM   6281  C C   . ALA D 1 28  ? -36.259 43.143  41.030  1.00 78.73  ? 26  ALA D C   1 
ATOM   6282  O O   . ALA D 1 28  ? -35.053 43.138  41.273  1.00 70.90  ? 26  ALA D O   1 
ATOM   6283  C CB  . ALA D 1 28  ? -37.976 42.239  42.594  1.00 78.95  ? 26  ALA D CB  1 
ATOM   6284  N N   . ALA D 1 29  ? -36.878 44.143  40.421  1.00 83.55  ? 27  ALA D N   1 
ATOM   6285  C CA  . ALA D 1 29  ? -36.168 45.361  40.078  1.00 89.55  ? 27  ALA D CA  1 
ATOM   6286  C C   . ALA D 1 29  ? -35.666 45.989  41.416  1.00 93.30  ? 27  ALA D C   1 
ATOM   6287  O O   . ALA D 1 29  ? -34.488 46.359  41.558  1.00 92.20  ? 27  ALA D O   1 
ATOM   6288  C CB  . ALA D 1 29  ? -37.131 46.327  39.326  1.00 85.45  ? 27  ALA D CB  1 
ATOM   6289  N N   . HIS D 1 30  ? -36.584 46.045  42.387  1.00 94.82  ? 28  HIS D N   1 
ATOM   6290  C CA  . HIS D 1 30  ? -36.391 46.580  43.738  1.00 91.57  ? 28  HIS D CA  1 
ATOM   6291  C C   . HIS D 1 30  ? -35.545 45.674  44.653  1.00 89.56  ? 28  HIS D C   1 
ATOM   6292  O O   . HIS D 1 30  ? -35.736 45.644  45.871  1.00 92.14  ? 28  HIS D O   1 
ATOM   6293  C CB  . HIS D 1 30  ? -37.780 46.819  44.380  1.00 95.03  ? 28  HIS D CB  1 
ATOM   6294  C CG  . HIS D 1 30  ? -38.536 45.565  44.757  1.00 96.02  ? 28  HIS D CG  1 
ATOM   6295  N ND1 . HIS D 1 30  ? -39.843 45.591  45.204  1.00 97.54  ? 28  HIS D ND1 1 
ATOM   6296  C CD2 . HIS D 1 30  ? -38.155 44.267  44.810  1.00 95.99  ? 28  HIS D CD2 1 
ATOM   6297  C CE1 . HIS D 1 30  ? -40.229 44.366  45.518  1.00 98.82  ? 28  HIS D CE1 1 
ATOM   6298  N NE2 . HIS D 1 30  ? -39.222 43.543  45.288  1.00 98.50  ? 28  HIS D NE2 1 
ATOM   6299  N N   . LYS D 1 31  ? -34.611 44.933  44.071  1.00 85.01  ? 29  LYS D N   1 
ATOM   6300  C CA  . LYS D 1 31  ? -33.780 44.033  44.860  1.00 78.34  ? 29  LYS D CA  1 
ATOM   6301  C C   . LYS D 1 31  ? -32.332 44.093  44.405  1.00 75.29  ? 29  LYS D C   1 
ATOM   6302  O O   . LYS D 1 31  ? -31.534 43.214  44.708  1.00 71.10  ? 29  LYS D O   1 
ATOM   6303  C CB  . LYS D 1 31  ? -34.320 42.607  44.740  1.00 80.65  ? 29  LYS D CB  1 
ATOM   6304  C CG  . LYS D 1 31  ? -35.231 42.154  45.899  1.00 83.33  ? 29  LYS D CG  1 
ATOM   6305  C CD  . LYS D 1 31  ? -34.373 41.782  47.132  1.00 85.42  ? 29  LYS D CD  1 
ATOM   6306  C CE  . LYS D 1 31  ? -35.150 41.114  48.276  1.00 81.92  ? 29  LYS D CE  1 
ATOM   6307  N NZ  . LYS D 1 31  ? -34.201 40.678  49.365  1.00 81.77  ? 29  LYS D NZ  1 
ATOM   6308  N N   . ILE D 1 32  ? -31.996 45.149  43.674  1.00 74.46  ? 30  ILE D N   1 
ATOM   6309  C CA  . ILE D 1 32  ? -30.646 45.325  43.177  1.00 71.41  ? 30  ILE D CA  1 
ATOM   6310  C C   . ILE D 1 32  ? -29.999 46.616  43.616  1.00 73.76  ? 30  ILE D C   1 
ATOM   6311  O O   . ILE D 1 32  ? -30.622 47.668  43.653  1.00 72.84  ? 30  ILE D O   1 
ATOM   6312  C CB  . ILE D 1 32  ? -30.621 45.303  41.688  1.00 69.19  ? 30  ILE D CB  1 
ATOM   6313  C CG1 . ILE D 1 32  ? -31.324 44.040  41.207  1.00 67.83  ? 30  ILE D CG1 1 
ATOM   6314  C CG2 . ILE D 1 32  ? -29.179 45.424  41.215  1.00 65.38  ? 30  ILE D CG2 1 
ATOM   6315  C CD1 . ILE D 1 32  ? -31.270 43.835  39.742  1.00 67.02  ? 30  ILE D CD1 1 
ATOM   6316  N N   . MET D 1 33  ? -28.717 46.534  43.915  1.00 76.34  ? 31  MET D N   1 
ATOM   6317  C CA  . MET D 1 33  ? -28.006 47.698  44.370  1.00 80.53  ? 31  MET D CA  1 
ATOM   6318  C C   . MET D 1 33  ? -26.843 48.003  43.463  1.00 81.72  ? 31  MET D C   1 
ATOM   6319  O O   . MET D 1 33  ? -26.115 47.090  43.070  1.00 80.48  ? 31  MET D O   1 
ATOM   6320  C CB  . MET D 1 33  ? -27.477 47.452  45.767  1.00 86.78  ? 31  MET D CB  1 
ATOM   6321  C CG  . MET D 1 33  ? -27.120 48.717  46.511  1.00 92.90  ? 31  MET D CG  1 
ATOM   6322  S SD  . MET D 1 33  ? -28.539 49.299  47.450  1.00 96.10  ? 31  MET D SD  1 
ATOM   6323  C CE  . MET D 1 33  ? -27.725 49.811  49.013  1.00 97.92  ? 31  MET D CE  1 
ATOM   6324  N N   . ALA D 1 34  ? -26.670 49.283  43.133  1.00 81.95  ? 32  ALA D N   1 
ATOM   6325  C CA  . ALA D 1 34  ? -25.565 49.705  42.284  1.00 84.54  ? 32  ALA D CA  1 
ATOM   6326  C C   . ALA D 1 34  ? -24.896 50.983  42.792  1.00 87.14  ? 32  ALA D C   1 
ATOM   6327  O O   . ALA D 1 34  ? -25.575 51.955  43.116  1.00 87.67  ? 32  ALA D O   1 
ATOM   6328  C CB  . ALA D 1 34  ? -26.055 49.908  40.897  1.00 84.90  ? 32  ALA D CB  1 
ATOM   6329  N N   . SER D 1 35  ? -23.561 50.964  42.847  1.00 90.55  ? 33  SER D N   1 
ATOM   6330  C CA  . SER D 1 35  ? -22.749 52.090  43.318  1.00 92.14  ? 33  SER D CA  1 
ATOM   6331  C C   . SER D 1 35  ? -22.462 53.025  42.172  1.00 95.73  ? 33  SER D C   1 
ATOM   6332  O O   . SER D 1 35  ? -21.787 52.659  41.215  1.00 97.05  ? 33  SER D O   1 
ATOM   6333  C CB  . SER D 1 35  ? -21.406 51.613  43.856  1.00 90.89  ? 33  SER D CB  1 
ATOM   6334  O OG  . SER D 1 35  ? -21.543 50.514  44.736  1.00 90.95  ? 33  SER D OG  1 
ATOM   6335  N N   . SER D 1 36  ? -22.966 54.243  42.267  1.00 100.51 ? 34  SER D N   1 
ATOM   6336  C CA  . SER D 1 36  ? -22.750 55.209  41.204  1.00 103.48 ? 34  SER D CA  1 
ATOM   6337  C C   . SER D 1 36  ? -21.589 56.134  41.500  1.00 105.86 ? 34  SER D C   1 
ATOM   6338  O O   . SER D 1 36  ? -21.758 57.233  42.049  1.00 105.48 ? 34  SER D O   1 
ATOM   6339  C CB  . SER D 1 36  ? -24.031 56.035  40.940  1.00 105.13 ? 34  SER D CB  1 
ATOM   6340  O OG  . SER D 1 36  ? -24.457 56.833  42.041  1.00 101.36 ? 34  SER D OG  1 
ATOM   6341  N N   . PRO D 1 37  ? -20.377 55.691  41.183  1.00 109.20 ? 35  PRO D N   1 
ATOM   6342  C CA  . PRO D 1 37  ? -19.329 56.654  41.488  1.00 114.23 ? 35  PRO D CA  1 
ATOM   6343  C C   . PRO D 1 37  ? -19.574 57.949  40.673  1.00 119.46 ? 35  PRO D C   1 
ATOM   6344  O O   . PRO D 1 37  ? -19.017 59.012  40.989  1.00 118.27 ? 35  PRO D O   1 
ATOM   6345  C CB  . PRO D 1 37  ? -18.047 55.886  41.128  1.00 113.53 ? 35  PRO D CB  1 
ATOM   6346  C CG  . PRO D 1 37  ? -18.522 54.711  40.260  1.00 113.38 ? 35  PRO D CG  1 
ATOM   6347  C CD  . PRO D 1 37  ? -19.821 54.364  40.885  1.00 110.94 ? 35  PRO D CD  1 
ATOM   6348  N N   . ASP D 1 38  ? -20.440 57.833  39.652  1.00 126.01 ? 36  ASP D N   1 
ATOM   6349  C CA  . ASP D 1 38  ? -20.857 58.938  38.758  1.00 129.65 ? 36  ASP D CA  1 
ATOM   6350  C C   . ASP D 1 38  ? -22.331 58.832  38.348  1.00 130.88 ? 36  ASP D C   1 
ATOM   6351  O O   . ASP D 1 38  ? -23.093 58.071  38.941  1.00 132.45 ? 36  ASP D O   1 
ATOM   6352  C CB  . ASP D 1 38  ? -20.035 58.969  37.470  1.00 130.07 ? 36  ASP D CB  1 
ATOM   6353  C CG  . ASP D 1 38  ? -18.702 59.614  37.656  1.00 132.72 ? 36  ASP D CG  1 
ATOM   6354  O OD1 . ASP D 1 38  ? -18.664 60.797  38.074  1.00 132.25 ? 36  ASP D OD1 1 
ATOM   6355  O OD2 . ASP D 1 38  ? -17.694 58.929  37.381  1.00 136.33 ? 36  ASP D OD2 1 
ATOM   6356  N N   . MET D 1 39  ? -22.722 59.578  37.312  1.00 131.94 ? 37  MET D N   1 
ATOM   6357  C CA  . MET D 1 39  ? -24.103 59.556  36.824  1.00 131.12 ? 37  MET D CA  1 
ATOM   6358  C C   . MET D 1 39  ? -24.322 59.888  35.361  1.00 129.13 ? 37  MET D C   1 
ATOM   6359  O O   . MET D 1 39  ? -24.756 60.992  35.042  1.00 125.55 ? 37  MET D O   1 
ATOM   6360  C CB  . MET D 1 39  ? -24.966 60.499  37.634  1.00 134.47 ? 37  MET D CB  1 
ATOM   6361  C CG  . MET D 1 39  ? -25.640 59.826  38.787  1.00 140.57 ? 37  MET D CG  1 
ATOM   6362  S SD  . MET D 1 39  ? -27.304 60.459  38.928  1.00 149.95 ? 37  MET D SD  1 
ATOM   6363  C CE  . MET D 1 39  ? -28.195 59.545  37.599  1.00 145.41 ? 37  MET D CE  1 
ATOM   6364  N N   . ASP D 1 40  ? -24.064 58.920  34.486  1.00 129.46 ? 38  ASP D N   1 
ATOM   6365  C CA  . ASP D 1 40  ? -24.242 59.107  33.048  1.00 129.71 ? 38  ASP D CA  1 
ATOM   6366  C C   . ASP D 1 40  ? -25.620 58.637  32.579  1.00 130.77 ? 38  ASP D C   1 
ATOM   6367  O O   . ASP D 1 40  ? -25.885 57.432  32.519  1.00 128.71 ? 38  ASP D O   1 
ATOM   6368  C CB  . ASP D 1 40  ? -23.171 58.342  32.270  1.00 127.96 ? 38  ASP D CB  1 
ATOM   6369  C CG  . ASP D 1 40  ? -23.358 56.838  32.351  1.00 126.82 ? 38  ASP D CG  1 
ATOM   6370  O OD1 . ASP D 1 40  ? -23.129 56.277  33.439  1.00 126.48 ? 38  ASP D OD1 1 
ATOM   6371  O OD2 . ASP D 1 40  ? -23.750 56.209  31.340  1.00 124.59 ? 38  ASP D OD2 1 
ATOM   6372  N N   . LEU D 1 41  ? -26.486 59.596  32.248  1.00 133.08 ? 39  LEU D N   1 
ATOM   6373  C CA  . LEU D 1 41  ? -27.852 59.316  31.772  1.00 134.64 ? 39  LEU D CA  1 
ATOM   6374  C C   . LEU D 1 41  ? -27.988 57.859  31.351  1.00 133.68 ? 39  LEU D C   1 
ATOM   6375  O O   . LEU D 1 41  ? -28.807 57.107  31.879  1.00 133.72 ? 39  LEU D O   1 
ATOM   6376  C CB  . LEU D 1 41  ? -28.203 60.178  30.543  1.00 136.03 ? 39  LEU D CB  1 
ATOM   6377  C CG  . LEU D 1 41  ? -27.884 61.673  30.476  1.00 136.69 ? 39  LEU D CG  1 
ATOM   6378  C CD1 . LEU D 1 41  ? -28.313 62.216  29.105  1.00 133.52 ? 39  LEU D CD1 1 
ATOM   6379  C CD2 . LEU D 1 41  ? -28.578 62.404  31.622  1.00 136.07 ? 39  LEU D CD2 1 
ATOM   6380  N N   . ALA D 1 42  ? -27.176 57.493  30.365  1.00 131.54 ? 40  ALA D N   1 
ATOM   6381  C CA  . ALA D 1 42  ? -27.163 56.153  29.822  1.00 128.65 ? 40  ALA D CA  1 
ATOM   6382  C C   . ALA D 1 42  ? -27.357 55.131  30.918  1.00 125.93 ? 40  ALA D C   1 
ATOM   6383  O O   . ALA D 1 42  ? -28.489 54.804  31.280  1.00 127.23 ? 40  ALA D O   1 
ATOM   6384  C CB  . ALA D 1 42  ? -25.842 55.895  29.093  1.00 129.29 ? 40  ALA D CB  1 
ATOM   6385  N N   . THR D 1 43  ? -26.239 54.654  31.454  1.00 121.53 ? 41  THR D N   1 
ATOM   6386  C CA  . THR D 1 43  ? -26.259 53.637  32.486  1.00 117.54 ? 41  THR D CA  1 
ATOM   6387  C C   . THR D 1 43  ? -26.939 54.097  33.763  1.00 115.44 ? 41  THR D C   1 
ATOM   6388  O O   . THR D 1 43  ? -28.106 53.804  33.993  1.00 117.02 ? 41  THR D O   1 
ATOM   6389  C CB  . THR D 1 43  ? -24.831 53.156  32.809  1.00 117.23 ? 41  THR D CB  1 
ATOM   6390  O OG1 . THR D 1 43  ? -24.214 52.657  31.613  1.00 116.97 ? 41  THR D OG1 1 
ATOM   6391  C CG2 . THR D 1 43  ? -24.865 52.043  33.851  1.00 119.41 ? 41  THR D CG2 1 
ATOM   6392  N N   . VAL D 1 44  ? -26.208 54.830  34.589  1.00 112.17 ? 42  VAL D N   1 
ATOM   6393  C CA  . VAL D 1 44  ? -26.726 55.312  35.859  1.00 107.01 ? 42  VAL D CA  1 
ATOM   6394  C C   . VAL D 1 44  ? -28.213 55.670  35.867  1.00 106.48 ? 42  VAL D C   1 
ATOM   6395  O O   . VAL D 1 44  ? -28.965 55.118  36.660  1.00 104.05 ? 42  VAL D O   1 
ATOM   6396  C CB  . VAL D 1 44  ? -25.916 56.518  36.351  1.00 106.07 ? 42  VAL D CB  1 
ATOM   6397  C CG1 . VAL D 1 44  ? -26.452 56.966  37.677  1.00 107.38 ? 42  VAL D CG1 1 
ATOM   6398  C CG2 . VAL D 1 44  ? -24.450 56.142  36.493  1.00 104.30 ? 42  VAL D CG2 1 
ATOM   6399  N N   . SER D 1 45  ? -28.635 56.575  34.982  1.00 107.98 ? 43  SER D N   1 
ATOM   6400  C CA  . SER D 1 45  ? -30.040 57.012  34.910  1.00 109.05 ? 43  SER D CA  1 
ATOM   6401  C C   . SER D 1 45  ? -31.070 55.993  34.402  1.00 109.66 ? 43  SER D C   1 
ATOM   6402  O O   . SER D 1 45  ? -32.192 55.941  34.909  1.00 110.43 ? 43  SER D O   1 
ATOM   6403  C CB  . SER D 1 45  ? -30.165 58.277  34.064  1.00 108.54 ? 43  SER D CB  1 
ATOM   6404  O OG  . SER D 1 45  ? -31.493 58.408  33.569  1.00 107.66 ? 43  SER D OG  1 
ATOM   6405  N N   . ALA D 1 46  ? -30.708 55.202  33.396  1.00 109.61 ? 44  ALA D N   1 
ATOM   6406  C CA  . ALA D 1 46  ? -31.618 54.189  32.857  1.00 108.55 ? 44  ALA D CA  1 
ATOM   6407  C C   . ALA D 1 46  ? -32.053 53.253  33.979  1.00 108.90 ? 44  ALA D C   1 
ATOM   6408  O O   . ALA D 1 46  ? -33.239 53.037  34.209  1.00 109.11 ? 44  ALA D O   1 
ATOM   6409  C CB  . ALA D 1 46  ? -30.926 53.391  31.767  1.00 106.99 ? 44  ALA D CB  1 
ATOM   6410  N N   . LEU D 1 47  ? -31.067 52.703  34.679  1.00 109.32 ? 45  LEU D N   1 
ATOM   6411  C CA  . LEU D 1 47  ? -31.309 51.797  35.790  1.00 108.80 ? 45  LEU D CA  1 
ATOM   6412  C C   . LEU D 1 47  ? -32.397 52.385  36.709  1.00 109.49 ? 45  LEU D C   1 
ATOM   6413  O O   . LEU D 1 47  ? -33.414 51.733  36.946  1.00 109.38 ? 45  LEU D O   1 
ATOM   6414  C CB  . LEU D 1 47  ? -29.981 51.548  36.548  1.00 107.20 ? 45  LEU D CB  1 
ATOM   6415  C CG  . LEU D 1 47  ? -28.795 50.839  35.819  1.00 108.14 ? 45  LEU D CG  1 
ATOM   6416  C CD1 . LEU D 1 47  ? -27.432 51.302  36.373  1.00 105.65 ? 45  LEU D CD1 1 
ATOM   6417  C CD2 . LEU D 1 47  ? -28.908 49.321  35.953  1.00 106.04 ? 45  LEU D CD2 1 
ATOM   6418  N N   . ARG D 1 48  ? -32.195 53.612  37.199  1.00 111.33 ? 46  ARG D N   1 
ATOM   6419  C CA  . ARG D 1 48  ? -33.169 54.281  38.080  1.00 112.72 ? 46  ARG D CA  1 
ATOM   6420  C C   . ARG D 1 48  ? -34.563 53.937  37.628  1.00 108.89 ? 46  ARG D C   1 
ATOM   6421  O O   . ARG D 1 48  ? -35.456 53.660  38.432  1.00 106.66 ? 46  ARG D O   1 
ATOM   6422  C CB  . ARG D 1 48  ? -33.050 55.812  38.011  1.00 118.88 ? 46  ARG D CB  1 
ATOM   6423  C CG  . ARG D 1 48  ? -31.907 56.448  38.782  1.00 126.19 ? 46  ARG D CG  1 
ATOM   6424  C CD  . ARG D 1 48  ? -32.291 57.863  39.216  1.00 131.68 ? 46  ARG D CD  1 
ATOM   6425  N NE  . ARG D 1 48  ? -31.149 58.686  39.619  1.00 136.61 ? 46  ARG D NE  1 
ATOM   6426  C CZ  . ARG D 1 48  ? -31.259 59.855  40.249  1.00 140.79 ? 46  ARG D CZ  1 
ATOM   6427  N NH1 . ARG D 1 48  ? -32.460 60.341  40.557  1.00 142.12 ? 46  ARG D NH1 1 
ATOM   6428  N NH2 . ARG D 1 48  ? -30.172 60.545  40.564  1.00 143.46 ? 46  ARG D NH2 1 
ATOM   6429  N N   . LYS D 1 49  ? -34.727 53.998  36.315  1.00 106.21 ? 47  LYS D N   1 
ATOM   6430  C CA  . LYS D 1 49  ? -35.991 53.715  35.687  1.00 105.08 ? 47  LYS D CA  1 
ATOM   6431  C C   . LYS D 1 49  ? -36.306 52.221  35.772  1.00 102.53 ? 47  LYS D C   1 
ATOM   6432  O O   . LYS D 1 49  ? -37.391 51.833  36.208  1.00 103.35 ? 47  LYS D O   1 
ATOM   6433  C CB  . LYS D 1 49  ? -35.940 54.172  34.228  1.00 108.03 ? 47  LYS D CB  1 
ATOM   6434  C CG  . LYS D 1 49  ? -35.464 55.594  34.043  1.00 109.72 ? 47  LYS D CG  1 
ATOM   6435  C CD  . LYS D 1 49  ? -35.512 55.952  32.570  1.00 113.65 ? 47  LYS D CD  1 
ATOM   6436  C CE  . LYS D 1 49  ? -34.925 57.328  32.301  1.00 115.94 ? 47  LYS D CE  1 
ATOM   6437  N NZ  . LYS D 1 49  ? -34.977 57.683  30.850  1.00 118.15 ? 47  LYS D NZ  1 
ATOM   6438  N N   . MET D 1 50  ? -35.360 51.386  35.360  1.00 98.27  ? 48  MET D N   1 
ATOM   6439  C CA  . MET D 1 50  ? -35.581 49.959  35.390  1.00 94.05  ? 48  MET D CA  1 
ATOM   6440  C C   . MET D 1 50  ? -36.177 49.531  36.723  1.00 92.88  ? 48  MET D C   1 
ATOM   6441  O O   . MET D 1 50  ? -37.059 48.657  36.773  1.00 93.23  ? 48  MET D O   1 
ATOM   6442  C CB  . MET D 1 50  ? -34.280 49.228  35.141  1.00 93.39  ? 48  MET D CB  1 
ATOM   6443  C CG  . MET D 1 50  ? -34.484 47.752  35.038  1.00 96.91  ? 48  MET D CG  1 
ATOM   6444  S SD  . MET D 1 50  ? -33.054 46.989  34.319  1.00 105.88 ? 48  MET D SD  1 
ATOM   6445  C CE  . MET D 1 50  ? -32.398 46.130  35.695  1.00 103.39 ? 48  MET D CE  1 
ATOM   6446  N N   . GLY D 1 51  ? -35.692 50.160  37.796  1.00 92.74  ? 49  GLY D N   1 
ATOM   6447  C CA  . GLY D 1 51  ? -36.166 49.869  39.148  1.00 92.42  ? 49  GLY D CA  1 
ATOM   6448  C C   . GLY D 1 51  ? -35.074 49.491  40.147  1.00 89.58  ? 49  GLY D C   1 
ATOM   6449  O O   . GLY D 1 51  ? -35.327 49.207  41.334  1.00 88.61  ? 49  GLY D O   1 
ATOM   6450  N N   . VAL D 1 52  ? -33.849 49.473  39.640  1.00 85.21  ? 50  VAL D N   1 
ATOM   6451  C CA  . VAL D 1 52  ? -32.698 49.125  40.434  1.00 82.15  ? 50  VAL D CA  1 
ATOM   6452  C C   . VAL D 1 52  ? -32.515 50.165  41.505  1.00 82.00  ? 50  VAL D C   1 
ATOM   6453  O O   . VAL D 1 52  ? -33.043 51.274  41.383  1.00 82.08  ? 50  VAL D O   1 
ATOM   6454  C CB  . VAL D 1 52  ? -31.450 49.067  39.562  1.00 81.23  ? 50  VAL D CB  1 
ATOM   6455  C CG1 . VAL D 1 52  ? -30.411 50.045  40.054  1.00 81.72  ? 50  VAL D CG1 1 
ATOM   6456  C CG2 . VAL D 1 52  ? -30.889 47.682  39.587  1.00 85.05  ? 50  VAL D CG2 1 
ATOM   6457  N N   . LYS D 1 53  ? -31.773 49.804  42.549  1.00 81.67  ? 51  LYS D N   1 
ATOM   6458  C CA  . LYS D 1 53  ? -31.512 50.713  43.643  1.00 80.64  ? 51  LYS D CA  1 
ATOM   6459  C C   . LYS D 1 53  ? -30.069 51.187  43.568  1.00 79.10  ? 51  LYS D C   1 
ATOM   6460  O O   . LYS D 1 53  ? -29.126 50.380  43.563  1.00 72.96  ? 51  LYS D O   1 
ATOM   6461  C CB  . LYS D 1 53  ? -31.857 50.035  44.973  1.00 85.44  ? 51  LYS D CB  1 
ATOM   6462  C CG  . LYS D 1 53  ? -33.377 50.056  45.241  1.00 89.91  ? 51  LYS D CG  1 
ATOM   6463  C CD  . LYS D 1 53  ? -33.773 49.553  46.629  1.00 96.53  ? 51  LYS D CD  1 
ATOM   6464  C CE  . LYS D 1 53  ? -35.241 49.892  46.943  1.00 98.34  ? 51  LYS D CE  1 
ATOM   6465  N NZ  . LYS D 1 53  ? -35.720 49.266  48.216  1.00 99.78  ? 51  LYS D NZ  1 
ATOM   6466  N N   . LEU D 1 54  ? -29.932 52.513  43.461  1.00 80.93  ? 52  LEU D N   1 
ATOM   6467  C CA  . LEU D 1 54  ? -28.643 53.206  43.332  1.00 84.46  ? 52  LEU D CA  1 
ATOM   6468  C C   . LEU D 1 54  ? -28.138 54.051  44.502  1.00 86.03  ? 52  LEU D C   1 
ATOM   6469  O O   . LEU D 1 54  ? -28.833 54.939  45.002  1.00 86.49  ? 52  LEU D O   1 
ATOM   6470  C CB  . LEU D 1 54  ? -28.692 54.109  42.118  1.00 83.91  ? 52  LEU D CB  1 
ATOM   6471  C CG  . LEU D 1 54  ? -28.904 53.294  40.864  1.00 84.68  ? 52  LEU D CG  1 
ATOM   6472  C CD1 . LEU D 1 54  ? -29.214 54.187  39.695  1.00 86.62  ? 52  LEU D CD1 1 
ATOM   6473  C CD2 . LEU D 1 54  ? -27.654 52.497  40.626  1.00 85.60  ? 52  LEU D CD2 1 
ATOM   6474  N N   . THR D 1 55  ? -26.896 53.809  44.897  1.00 87.17  ? 53  THR D N   1 
ATOM   6475  C CA  . THR D 1 55  ? -26.314 54.553  45.996  1.00 90.59  ? 53  THR D CA  1 
ATOM   6476  C C   . THR D 1 55  ? -24.906 54.975  45.649  1.00 90.52  ? 53  THR D C   1 
ATOM   6477  O O   . THR D 1 55  ? -24.069 54.144  45.293  1.00 88.06  ? 53  THR D O   1 
ATOM   6478  C CB  . THR D 1 55  ? -26.259 53.704  47.268  1.00 92.84  ? 53  THR D CB  1 
ATOM   6479  O OG1 . THR D 1 55  ? -27.588 53.419  47.714  1.00 97.98  ? 53  THR D OG1 1 
ATOM   6480  C CG2 . THR D 1 55  ? -25.518 54.438  48.358  1.00 96.30  ? 53  THR D CG2 1 
ATOM   6481  N N   . PRO D 1 56  ? -24.628 56.283  45.733  1.00 92.22  ? 54  PRO D N   1 
ATOM   6482  C CA  . PRO D 1 56  ? -23.285 56.772  45.422  1.00 94.28  ? 54  PRO D CA  1 
ATOM   6483  C C   . PRO D 1 56  ? -22.314 56.145  46.403  1.00 97.42  ? 54  PRO D C   1 
ATOM   6484  O O   . PRO D 1 56  ? -21.130 55.968  46.100  1.00 100.14 ? 54  PRO D O   1 
ATOM   6485  C CB  . PRO D 1 56  ? -23.412 58.284  45.601  1.00 92.67  ? 54  PRO D CB  1 
ATOM   6486  C CG  . PRO D 1 56  ? -24.513 58.427  46.608  1.00 90.96  ? 54  PRO D CG  1 
ATOM   6487  C CD  . PRO D 1 56  ? -25.510 57.389  46.140  1.00 91.84  ? 54  PRO D CD  1 
ATOM   6488  N N   . HIS D 1 57  ? -22.840 55.786  47.575  1.00 99.52  ? 55  HIS D N   1 
ATOM   6489  C CA  . HIS D 1 57  ? -22.046 55.165  48.642  1.00 100.74 ? 55  HIS D CA  1 
ATOM   6490  C C   . HIS D 1 57  ? -21.926 53.655  48.429  1.00 97.43  ? 55  HIS D C   1 
ATOM   6491  O O   . HIS D 1 57  ? -22.918 52.941  48.479  1.00 96.23  ? 55  HIS D O   1 
ATOM   6492  C CB  . HIS D 1 57  ? -22.669 55.413  50.038  1.00 105.95 ? 55  HIS D CB  1 
ATOM   6493  C CG  . HIS D 1 57  ? -23.281 56.779  50.233  1.00 109.94 ? 55  HIS D CG  1 
ATOM   6494  N ND1 . HIS D 1 57  ? -22.655 57.954  49.867  1.00 110.01 ? 55  HIS D ND1 1 
ATOM   6495  C CD2 . HIS D 1 57  ? -24.447 57.146  50.824  1.00 110.49 ? 55  HIS D CD2 1 
ATOM   6496  C CE1 . HIS D 1 57  ? -23.408 58.983  50.225  1.00 109.99 ? 55  HIS D CE1 1 
ATOM   6497  N NE2 . HIS D 1 57  ? -24.500 58.520  50.809  1.00 110.30 ? 55  HIS D NE2 1 
ATOM   6498  N N   . ASN D 1 58  ? -20.702 53.173  48.237  1.00 95.66  ? 56  ASN D N   1 
ATOM   6499  C CA  . ASN D 1 58  ? -20.445 51.753  47.993  1.00 96.78  ? 56  ASN D CA  1 
ATOM   6500  C C   . ASN D 1 58  ? -20.780 50.754  49.126  1.00 97.34  ? 56  ASN D C   1 
ATOM   6501  O O   . ASN D 1 58  ? -21.293 49.661  48.851  1.00 100.31 ? 56  ASN D O   1 
ATOM   6502  C CB  . ASN D 1 58  ? -18.987 51.576  47.523  1.00 94.87  ? 56  ASN D CB  1 
ATOM   6503  C CG  . ASN D 1 58  ? -18.698 52.320  46.207  1.00 97.39  ? 56  ASN D CG  1 
ATOM   6504  O OD1 . ASN D 1 58  ? -19.049 51.860  45.121  1.00 97.27  ? 56  ASN D OD1 1 
ATOM   6505  N ND2 . ASN D 1 58  ? -18.066 53.482  46.310  1.00 98.52  ? 56  ASN D ND2 1 
ATOM   6506  N N   . LYS D 1 59  ? -20.527 51.102  50.388  1.00 96.90  ? 57  LYS D N   1 
ATOM   6507  C CA  . LYS D 1 59  ? -20.833 50.162  51.483  1.00 95.21  ? 57  LYS D CA  1 
ATOM   6508  C C   . LYS D 1 59  ? -22.286 49.692  51.507  1.00 93.12  ? 57  LYS D C   1 
ATOM   6509  O O   . LYS D 1 59  ? -22.555 48.494  51.581  1.00 91.73  ? 57  LYS D O   1 
ATOM   6510  C CB  . LYS D 1 59  ? -20.453 50.752  52.849  1.00 97.12  ? 57  LYS D CB  1 
ATOM   6511  C CG  . LYS D 1 59  ? -18.934 50.882  53.038  1.00 103.19 ? 57  LYS D CG  1 
ATOM   6512  C CD  . LYS D 1 59  ? -18.508 51.327  54.448  1.00 105.32 ? 57  LYS D CD  1 
ATOM   6513  C CE  . LYS D 1 59  ? -16.980 51.587  54.494  1.00 106.80 ? 57  LYS D CE  1 
ATOM   6514  N NZ  . LYS D 1 59  ? -16.474 52.189  55.779  1.00 108.37 ? 57  LYS D NZ  1 
ATOM   6515  N N   . GLU D 1 60  ? -23.218 50.633  51.423  1.00 92.67  ? 58  GLU D N   1 
ATOM   6516  C CA  . GLU D 1 60  ? -24.644 50.308  51.415  1.00 93.83  ? 58  GLU D CA  1 
ATOM   6517  C C   . GLU D 1 60  ? -24.926 49.146  50.483  1.00 90.28  ? 58  GLU D C   1 
ATOM   6518  O O   . GLU D 1 60  ? -25.702 48.247  50.810  1.00 87.25  ? 58  GLU D O   1 
ATOM   6519  C CB  . GLU D 1 60  ? -25.468 51.509  50.957  1.00 97.97  ? 58  GLU D CB  1 
ATOM   6520  C CG  . GLU D 1 60  ? -25.553 52.627  51.965  1.00 106.97 ? 58  GLU D CG  1 
ATOM   6521  C CD  . GLU D 1 60  ? -26.865 53.372  51.853  1.00 113.64 ? 58  GLU D CD  1 
ATOM   6522  O OE1 . GLU D 1 60  ? -27.059 54.077  50.839  1.00 120.18 ? 58  GLU D OE1 1 
ATOM   6523  O OE2 . GLU D 1 60  ? -27.720 53.247  52.767  1.00 118.53 ? 58  GLU D OE2 1 
ATOM   6524  N N   . THR D 1 61  ? -24.310 49.197  49.307  1.00 87.05  ? 59  THR D N   1 
ATOM   6525  C CA  . THR D 1 61  ? -24.467 48.142  48.326  1.00 85.59  ? 59  THR D CA  1 
ATOM   6526  C C   . THR D 1 61  ? -24.161 46.878  49.092  1.00 85.01  ? 59  THR D C   1 
ATOM   6527  O O   . THR D 1 61  ? -25.065 46.097  49.380  1.00 86.66  ? 59  THR D O   1 
ATOM   6528  C CB  . THR D 1 61  ? -23.458 48.268  47.141  1.00 85.17  ? 59  THR D CB  1 
ATOM   6529  O OG1 . THR D 1 61  ? -23.761 49.428  46.360  1.00 83.91  ? 59  THR D OG1 1 
ATOM   6530  C CG2 . THR D 1 61  ? -23.545 47.053  46.221  1.00 87.06  ? 59  THR D CG2 1 
ATOM   6531  N N   . VAL D 1 62  ? -22.888 46.712  49.447  1.00 80.71  ? 60  VAL D N   1 
ATOM   6532  C CA  . VAL D 1 62  ? -22.432 45.542  50.175  1.00 78.49  ? 60  VAL D CA  1 
ATOM   6533  C C   . VAL D 1 62  ? -23.383 45.049  51.266  1.00 82.43  ? 60  VAL D C   1 
ATOM   6534  O O   . VAL D 1 62  ? -23.642 43.848  51.390  1.00 84.01  ? 60  VAL D O   1 
ATOM   6535  C CB  . VAL D 1 62  ? -21.085 45.803  50.816  1.00 73.94  ? 60  VAL D CB  1 
ATOM   6536  C CG1 . VAL D 1 62  ? -20.514 44.511  51.336  1.00 72.02  ? 60  VAL D CG1 1 
ATOM   6537  C CG2 . VAL D 1 62  ? -20.166 46.434  49.825  1.00 70.97  ? 60  VAL D CG2 1 
ATOM   6538  N N   . GLN D 1 63  ? -23.905 45.962  52.070  1.00 85.11  ? 61  GLN D N   1 
ATOM   6539  C CA  . GLN D 1 63  ? -24.800 45.545  53.136  1.00 86.70  ? 61  GLN D CA  1 
ATOM   6540  C C   . GLN D 1 63  ? -26.110 45.122  52.522  1.00 85.48  ? 61  GLN D C   1 
ATOM   6541  O O   . GLN D 1 63  ? -26.946 44.494  53.154  1.00 86.01  ? 61  GLN D O   1 
ATOM   6542  C CB  . GLN D 1 63  ? -25.046 46.714  54.052  1.00 88.72  ? 61  GLN D CB  1 
ATOM   6543  C CG  . GLN D 1 63  ? -23.871 47.623  54.135  1.00 87.26  ? 61  GLN D CG  1 
ATOM   6544  C CD  . GLN D 1 63  ? -24.180 48.815  54.973  1.00 92.54  ? 61  GLN D CD  1 
ATOM   6545  O OE1 . GLN D 1 63  ? -25.133 49.563  54.704  1.00 95.82  ? 61  GLN D OE1 1 
ATOM   6546  N NE2 . GLN D 1 63  ? -23.384 49.014  56.005  1.00 95.41  ? 61  GLN D NE2 1 
ATOM   6547  N N   . HIS D 1 64  ? -26.276 45.488  51.270  1.00 85.50  ? 62  HIS D N   1 
ATOM   6548  C CA  . HIS D 1 64  ? -27.495 45.207  50.564  1.00 86.91  ? 62  HIS D CA  1 
ATOM   6549  C C   . HIS D 1 64  ? -27.381 44.038  49.609  1.00 82.69  ? 62  HIS D C   1 
ATOM   6550  O O   . HIS D 1 64  ? -28.330 43.718  48.891  1.00 77.86  ? 62  HIS D O   1 
ATOM   6551  C CB  . HIS D 1 64  ? -27.909 46.472  49.828  1.00 94.59  ? 62  HIS D CB  1 
ATOM   6552  C CG  . HIS D 1 64  ? -29.343 46.483  49.415  1.00 104.87 ? 62  HIS D CG  1 
ATOM   6553  N ND1 . HIS D 1 64  ? -29.780 45.884  48.250  1.00 105.68 ? 62  HIS D ND1 1 
ATOM   6554  C CD2 . HIS D 1 64  ? -30.439 47.020  50.003  1.00 108.13 ? 62  HIS D CD2 1 
ATOM   6555  C CE1 . HIS D 1 64  ? -31.085 46.058  48.139  1.00 109.49 ? 62  HIS D CE1 1 
ATOM   6556  N NE2 . HIS D 1 64  ? -31.512 46.742  49.188  1.00 111.63 ? 62  HIS D NE2 1 
ATOM   6557  N N   . SER D 1 65  ? -26.233 43.372  49.632  1.00 81.19  ? 63  SER D N   1 
ATOM   6558  C CA  . SER D 1 65  ? -26.029 42.251  48.727  1.00 82.14  ? 63  SER D CA  1 
ATOM   6559  C C   . SER D 1 65  ? -25.436 40.988  49.351  1.00 83.37  ? 63  SER D C   1 
ATOM   6560  O O   . SER D 1 65  ? -24.422 41.070  50.064  1.00 83.82  ? 63  SER D O   1 
ATOM   6561  C CB  . SER D 1 65  ? -25.148 42.687  47.544  1.00 82.96  ? 63  SER D CB  1 
ATOM   6562  O OG  . SER D 1 65  ? -23.819 42.964  47.945  1.00 81.53  ? 63  SER D OG  1 
ATOM   6563  N N   . ASP D 1 66  ? -26.076 39.837  49.075  1.00 81.56  ? 64  ASP D N   1 
ATOM   6564  C CA  . ASP D 1 66  ? -25.628 38.527  49.554  1.00 82.33  ? 64  ASP D CA  1 
ATOM   6565  C C   . ASP D 1 66  ? -24.497 38.151  48.548  1.00 83.59  ? 64  ASP D C   1 
ATOM   6566  O O   . ASP D 1 66  ? -23.427 37.596  48.907  1.00 83.31  ? 64  ASP D O   1 
ATOM   6567  C CB  . ASP D 1 66  ? -26.786 37.492  49.500  1.00 81.64  ? 64  ASP D CB  1 
ATOM   6568  C CG  . ASP D 1 66  ? -28.014 37.876  50.372  1.00 83.80  ? 64  ASP D CG  1 
ATOM   6569  O OD1 . ASP D 1 66  ? -28.145 39.036  50.796  1.00 82.22  ? 64  ASP D OD1 1 
ATOM   6570  O OD2 . ASP D 1 66  ? -28.885 37.002  50.622  1.00 87.53  ? 64  ASP D OD2 1 
ATOM   6571  N N   . VAL D 1 67  ? -24.752 38.487  47.282  1.00 82.84  ? 65  VAL D N   1 
ATOM   6572  C CA  . VAL D 1 67  ? -23.810 38.253  46.171  1.00 81.45  ? 65  VAL D CA  1 
ATOM   6573  C C   . VAL D 1 67  ? -23.500 39.630  45.610  1.00 79.68  ? 65  VAL D C   1 
ATOM   6574  O O   . VAL D 1 67  ? -24.404 40.415  45.301  1.00 81.53  ? 65  VAL D O   1 
ATOM   6575  C CB  . VAL D 1 67  ? -24.441 37.379  45.022  1.00 79.37  ? 65  VAL D CB  1 
ATOM   6576  C CG1 . VAL D 1 67  ? -25.889 37.740  44.849  1.00 78.10  ? 65  VAL D CG1 1 
ATOM   6577  C CG2 . VAL D 1 67  ? -23.700 37.590  43.694  1.00 77.14  ? 65  VAL D CG2 1 
ATOM   6578  N N   . LEU D 1 68  ? -22.233 39.946  45.456  1.00 73.89  ? 66  LEU D N   1 
ATOM   6579  C CA  . LEU D 1 68  ? -21.965 41.263  44.961  1.00 72.70  ? 66  LEU D CA  1 
ATOM   6580  C C   . LEU D 1 68  ? -21.075 41.264  43.731  1.00 70.06  ? 66  LEU D C   1 
ATOM   6581  O O   . LEU D 1 68  ? -20.098 40.505  43.633  1.00 71.19  ? 66  LEU D O   1 
ATOM   6582  C CB  . LEU D 1 68  ? -21.371 42.075  46.095  1.00 71.19  ? 66  LEU D CB  1 
ATOM   6583  C CG  . LEU D 1 68  ? -20.714 43.351  45.646  1.00 72.58  ? 66  LEU D CG  1 
ATOM   6584  C CD1 . LEU D 1 68  ? -21.707 44.494  45.737  1.00 72.58  ? 66  LEU D CD1 1 
ATOM   6585  C CD2 . LEU D 1 68  ? -19.527 43.583  46.525  1.00 71.73  ? 66  LEU D CD2 1 
ATOM   6586  N N   . PHE D 1 69  ? -21.418 42.098  42.764  1.00 64.16  ? 67  PHE D N   1 
ATOM   6587  C CA  . PHE D 1 69  ? -20.599 42.113  41.581  1.00 60.62  ? 67  PHE D CA  1 
ATOM   6588  C C   . PHE D 1 69  ? -19.716 43.313  41.631  1.00 59.13  ? 67  PHE D C   1 
ATOM   6589  O O   . PHE D 1 69  ? -20.082 44.334  42.213  1.00 56.60  ? 67  PHE D O   1 
ATOM   6590  C CB  . PHE D 1 69  ? -21.480 42.126  40.336  1.00 60.10  ? 67  PHE D CB  1 
ATOM   6591  C CG  . PHE D 1 69  ? -22.325 40.888  40.193  1.00 56.62  ? 67  PHE D CG  1 
ATOM   6592  C CD1 . PHE D 1 69  ? -23.511 40.765  40.875  1.00 56.17  ? 67  PHE D CD1 1 
ATOM   6593  C CD2 . PHE D 1 69  ? -21.881 39.819  39.425  1.00 55.76  ? 67  PHE D CD2 1 
ATOM   6594  C CE1 . PHE D 1 69  ? -24.224 39.593  40.815  1.00 59.98  ? 67  PHE D CE1 1 
ATOM   6595  C CE2 . PHE D 1 69  ? -22.579 38.637  39.350  1.00 52.28  ? 67  PHE D CE2 1 
ATOM   6596  C CZ  . PHE D 1 69  ? -23.753 38.516  40.038  1.00 57.76  ? 67  PHE D CZ  1 
ATOM   6597  N N   . LEU D 1 70  ? -18.552 43.155  41.018  1.00 57.89  ? 68  LEU D N   1 
ATOM   6598  C CA  . LEU D 1 70  ? -17.531 44.178  40.933  1.00 60.27  ? 68  LEU D CA  1 
ATOM   6599  C C   . LEU D 1 70  ? -17.390 44.693  39.521  1.00 62.80  ? 68  LEU D C   1 
ATOM   6600  O O   . LEU D 1 70  ? -16.338 44.552  38.896  1.00 65.34  ? 68  LEU D O   1 
ATOM   6601  C CB  . LEU D 1 70  ? -16.201 43.608  41.386  1.00 56.32  ? 68  LEU D CB  1 
ATOM   6602  C CG  . LEU D 1 70  ? -16.388 42.669  42.558  1.00 52.13  ? 68  LEU D CG  1 
ATOM   6603  C CD1 . LEU D 1 70  ? -15.081 42.529  43.254  1.00 49.79  ? 68  LEU D CD1 1 
ATOM   6604  C CD2 . LEU D 1 70  ? -17.411 43.229  43.516  1.00 53.56  ? 68  LEU D CD2 1 
ATOM   6605  N N   . ALA D 1 71  ? -18.471 45.279  39.029  1.00 67.06  ? 69  ALA D N   1 
ATOM   6606  C CA  . ALA D 1 71  ? -18.552 45.854  37.687  1.00 74.60  ? 69  ALA D CA  1 
ATOM   6607  C C   . ALA D 1 71  ? -17.702 47.100  37.605  1.00 79.48  ? 69  ALA D C   1 
ATOM   6608  O O   . ALA D 1 71  ? -18.144 48.154  37.124  1.00 77.32  ? 69  ALA D O   1 
ATOM   6609  C CB  . ALA D 1 71  ? -19.996 46.222  37.361  1.00 70.58  ? 69  ALA D CB  1 
ATOM   6610  N N   . VAL D 1 72  ? -16.475 46.984  38.073  1.00 86.72  ? 70  VAL D N   1 
ATOM   6611  C CA  . VAL D 1 72  ? -15.619 48.135  38.048  1.00 92.56  ? 70  VAL D CA  1 
ATOM   6612  C C   . VAL D 1 72  ? -14.398 47.906  37.201  1.00 92.74  ? 70  VAL D C   1 
ATOM   6613  O O   . VAL D 1 72  ? -13.790 46.825  37.235  1.00 90.32  ? 70  VAL D O   1 
ATOM   6614  C CB  . VAL D 1 72  ? -15.160 48.527  39.459  1.00 97.33  ? 70  VAL D CB  1 
ATOM   6615  C CG1 . VAL D 1 72  ? -14.482 49.877  39.405  1.00 101.26 ? 70  VAL D CG1 1 
ATOM   6616  C CG2 . VAL D 1 72  ? -16.348 48.578  40.409  1.00 98.39  ? 70  VAL D CG2 1 
ATOM   6617  N N   . LYS D 1 73  ? -14.055 48.940  36.444  1.00 93.39  ? 71  LYS D N   1 
ATOM   6618  C CA  . LYS D 1 73  ? -12.899 48.907  35.582  1.00 93.41  ? 71  LYS D CA  1 
ATOM   6619  C C   . LYS D 1 73  ? -11.765 48.146  36.296  1.00 91.59  ? 71  LYS D C   1 
ATOM   6620  O O   . LYS D 1 73  ? -11.534 48.326  37.491  1.00 89.56  ? 71  LYS D O   1 
ATOM   6621  C CB  . LYS D 1 73  ? -12.531 50.349  35.262  1.00 94.69  ? 71  LYS D CB  1 
ATOM   6622  C CG  . LYS D 1 73  ? -13.768 51.207  34.975  1.00 99.85  ? 71  LYS D CG  1 
ATOM   6623  C CD  . LYS D 1 73  ? -13.401 52.629  34.557  1.00 105.42 ? 71  LYS D CD  1 
ATOM   6624  C CE  . LYS D 1 73  ? -14.641 53.483  34.294  1.00 105.61 ? 71  LYS D CE  1 
ATOM   6625  N NZ  . LYS D 1 73  ? -14.297 54.854  33.821  1.00 105.17 ? 71  LYS D NZ  1 
ATOM   6626  N N   . PRO D 1 74  ? -11.066 47.252  35.570  1.00 92.74  ? 72  PRO D N   1 
ATOM   6627  C CA  . PRO D 1 74  ? -9.964  46.461  36.146  1.00 92.35  ? 72  PRO D CA  1 
ATOM   6628  C C   . PRO D 1 74  ? -8.955  47.154  37.086  1.00 90.34  ? 72  PRO D C   1 
ATOM   6629  O O   . PRO D 1 74  ? -8.400  46.506  37.984  1.00 88.00  ? 72  PRO D O   1 
ATOM   6630  C CB  . PRO D 1 74  ? -9.294  45.868  34.901  1.00 94.11  ? 72  PRO D CB  1 
ATOM   6631  C CG  . PRO D 1 74  ? -10.487 45.563  34.005  1.00 92.51  ? 72  PRO D CG  1 
ATOM   6632  C CD  . PRO D 1 74  ? -11.370 46.807  34.186  1.00 93.18  ? 72  PRO D CD  1 
ATOM   6633  N N   . HIS D 1 75  ? -8.735  48.456  36.883  1.00 91.29  ? 73  HIS D N   1 
ATOM   6634  C CA  . HIS D 1 75  ? -7.786  49.234  37.691  1.00 91.57  ? 73  HIS D CA  1 
ATOM   6635  C C   . HIS D 1 75  ? -8.367  49.923  38.907  1.00 89.50  ? 73  HIS D C   1 
ATOM   6636  O O   . HIS D 1 75  ? -7.628  50.503  39.708  1.00 89.94  ? 73  HIS D O   1 
ATOM   6637  C CB  . HIS D 1 75  ? -7.041  50.295  36.850  1.00 96.15  ? 73  HIS D CB  1 
ATOM   6638  C CG  . HIS D 1 75  ? -7.896  51.421  36.335  1.00 102.43 ? 73  HIS D CG  1 
ATOM   6639  N ND1 . HIS D 1 75  ? -8.878  52.042  37.082  1.00 104.17 ? 73  HIS D ND1 1 
ATOM   6640  C CD2 . HIS D 1 75  ? -7.870  52.075  35.147  1.00 106.77 ? 73  HIS D CD2 1 
ATOM   6641  C CE1 . HIS D 1 75  ? -9.417  53.024  36.377  1.00 106.32 ? 73  HIS D CE1 1 
ATOM   6642  N NE2 . HIS D 1 75  ? -8.822  53.067  35.199  1.00 107.30 ? 73  HIS D NE2 1 
ATOM   6643  N N   . ILE D 1 76  ? -9.684  49.877  39.042  1.00 86.64  ? 74  ILE D N   1 
ATOM   6644  C CA  . ILE D 1 76  ? -10.316 50.500  40.186  1.00 83.99  ? 74  ILE D CA  1 
ATOM   6645  C C   . ILE D 1 76  ? -10.465 49.472  41.290  1.00 83.02  ? 74  ILE D C   1 
ATOM   6646  O O   . ILE D 1 76  ? -10.377 49.787  42.471  1.00 80.50  ? 74  ILE D O   1 
ATOM   6647  C CB  . ILE D 1 76  ? -11.687 51.038  39.832  1.00 81.98  ? 74  ILE D CB  1 
ATOM   6648  C CG1 . ILE D 1 76  ? -11.569 52.039  38.685  1.00 84.21  ? 74  ILE D CG1 1 
ATOM   6649  C CG2 . ILE D 1 76  ? -12.294 51.688  41.055  1.00 81.03  ? 74  ILE D CG2 1 
ATOM   6650  C CD1 . ILE D 1 76  ? -12.911 52.512  38.107  1.00 89.04  ? 74  ILE D CD1 1 
ATOM   6651  N N   . ILE D 1 77  ? -10.693 48.234  40.881  1.00 82.19  ? 75  ILE D N   1 
ATOM   6652  C CA  . ILE D 1 77  ? -10.843 47.151  41.811  1.00 81.48  ? 75  ILE D CA  1 
ATOM   6653  C C   . ILE D 1 77  ? -9.833  47.342  42.906  1.00 82.80  ? 75  ILE D C   1 
ATOM   6654  O O   . ILE D 1 77  ? -10.192 47.451  44.065  1.00 84.27  ? 75  ILE D O   1 
ATOM   6655  C CB  . ILE D 1 77  ? -10.592 45.822  41.138  1.00 81.41  ? 75  ILE D CB  1 
ATOM   6656  C CG1 . ILE D 1 77  ? -11.817 45.442  40.307  1.00 84.80  ? 75  ILE D CG1 1 
ATOM   6657  C CG2 . ILE D 1 77  ? -10.257 44.772  42.181  1.00 82.33  ? 75  ILE D CG2 1 
ATOM   6658  C CD1 . ILE D 1 77  ? -11.778 44.012  39.736  1.00 85.83  ? 75  ILE D CD1 1 
ATOM   6659  N N   . PRO D 1 78  ? -8.546  47.405  42.552  1.00 84.29  ? 76  PRO D N   1 
ATOM   6660  C CA  . PRO D 1 78  ? -7.510  47.591  43.566  1.00 86.89  ? 76  PRO D CA  1 
ATOM   6661  C C   . PRO D 1 78  ? -7.905  48.569  44.667  1.00 90.58  ? 76  PRO D C   1 
ATOM   6662  O O   . PRO D 1 78  ? -7.511  48.405  45.817  1.00 94.17  ? 76  PRO D O   1 
ATOM   6663  C CB  . PRO D 1 78  ? -6.325  48.074  42.748  1.00 86.33  ? 76  PRO D CB  1 
ATOM   6664  C CG  . PRO D 1 78  ? -6.457  47.235  41.515  1.00 85.44  ? 76  PRO D CG  1 
ATOM   6665  C CD  . PRO D 1 78  ? -7.943  47.341  41.210  1.00 84.96  ? 76  PRO D CD  1 
ATOM   6666  N N   . PHE D 1 79  ? -8.694  49.576  44.332  1.00 92.69  ? 77  PHE D N   1 
ATOM   6667  C CA  . PHE D 1 79  ? -9.124  50.522  45.349  1.00 97.13  ? 77  PHE D CA  1 
ATOM   6668  C C   . PHE D 1 79  ? -10.247 49.898  46.121  1.00 97.64  ? 77  PHE D C   1 
ATOM   6669  O O   . PHE D 1 79  ? -10.105 49.486  47.268  1.00 98.37  ? 77  PHE D O   1 
ATOM   6670  C CB  . PHE D 1 79  ? -9.627  51.803  44.706  1.00 101.82 ? 77  PHE D CB  1 
ATOM   6671  C CG  . PHE D 1 79  ? -8.560  52.587  44.083  1.00 108.29 ? 77  PHE D CG  1 
ATOM   6672  C CD1 . PHE D 1 79  ? -7.474  51.919  43.489  1.00 108.39 ? 77  PHE D CD1 1 
ATOM   6673  C CD2 . PHE D 1 79  ? -8.598  53.982  44.101  1.00 111.23 ? 77  PHE D CD2 1 
ATOM   6674  C CE1 . PHE D 1 79  ? -6.428  52.620  42.922  1.00 111.64 ? 77  PHE D CE1 1 
ATOM   6675  C CE2 . PHE D 1 79  ? -7.547  54.712  43.529  1.00 116.95 ? 77  PHE D CE2 1 
ATOM   6676  C CZ  . PHE D 1 79  ? -6.452  54.027  42.936  1.00 116.11 ? 77  PHE D CZ  1 
ATOM   6677  N N   . ILE D 1 80  ? -11.383 49.860  45.457  1.00 99.52  ? 78  ILE D N   1 
ATOM   6678  C CA  . ILE D 1 80  ? -12.593 49.305  45.999  1.00 100.78 ? 78  ILE D CA  1 
ATOM   6679  C C   . ILE D 1 80  ? -12.313 48.068  46.849  1.00 99.42  ? 78  ILE D C   1 
ATOM   6680  O O   . ILE D 1 80  ? -12.750 47.969  48.006  1.00 100.54 ? 78  ILE D O   1 
ATOM   6681  C CB  . ILE D 1 80  ? -13.531 48.982  44.826  1.00 102.97 ? 78  ILE D CB  1 
ATOM   6682  C CG1 . ILE D 1 80  ? -13.598 50.212  43.909  1.00 106.97 ? 78  ILE D CG1 1 
ATOM   6683  C CG2 . ILE D 1 80  ? -14.913 48.622  45.328  1.00 103.67 ? 78  ILE D CG2 1 
ATOM   6684  C CD1 . ILE D 1 80  ? -14.546 50.086  42.733  1.00 111.72 ? 78  ILE D CD1 1 
ATOM   6685  N N   . LEU D 1 81  ? -11.556 47.140  46.281  1.00 96.09  ? 79  LEU D N   1 
ATOM   6686  C CA  . LEU D 1 81  ? -11.226 45.905  46.967  1.00 92.18  ? 79  LEU D CA  1 
ATOM   6687  C C   . LEU D 1 81  ? -10.822 46.182  48.420  1.00 92.25  ? 79  LEU D C   1 
ATOM   6688  O O   . LEU D 1 81  ? -10.995 45.326  49.285  1.00 92.88  ? 79  LEU D O   1 
ATOM   6689  C CB  . LEU D 1 81  ? -10.122 45.174  46.186  1.00 93.15  ? 79  LEU D CB  1 
ATOM   6690  C CG  . LEU D 1 81  ? -10.030 43.630  46.242  1.00 96.62  ? 79  LEU D CG  1 
ATOM   6691  C CD1 . LEU D 1 81  ? -11.373 42.974  46.472  1.00 94.56  ? 79  LEU D CD1 1 
ATOM   6692  C CD2 . LEU D 1 81  ? -9.452  43.123  44.925  1.00 99.62  ? 79  LEU D CD2 1 
ATOM   6693  N N   . ASP D 1 82  ? -10.310 47.386  48.689  1.00 91.30  ? 80  ASP D N   1 
ATOM   6694  C CA  . ASP D 1 82  ? -9.910  47.762  50.044  1.00 88.38  ? 80  ASP D CA  1 
ATOM   6695  C C   . ASP D 1 82  ? -11.116 48.272  50.796  1.00 85.13  ? 80  ASP D C   1 
ATOM   6696  O O   . ASP D 1 82  ? -11.729 47.540  51.569  1.00 83.65  ? 80  ASP D O   1 
ATOM   6697  C CB  . ASP D 1 82  ? -8.812  48.839  50.029  1.00 91.58  ? 80  ASP D CB  1 
ATOM   6698  C CG  . ASP D 1 82  ? -7.415  48.254  49.775  1.00 95.94  ? 80  ASP D CG  1 
ATOM   6699  O OD1 . ASP D 1 82  ? -7.027  47.295  50.482  1.00 95.34  ? 80  ASP D OD1 1 
ATOM   6700  O OD2 . ASP D 1 82  ? -6.703  48.750  48.874  1.00 98.32  ? 80  ASP D OD2 1 
ATOM   6701  N N   . GLU D 1 83  ? -11.440 49.535  50.558  1.00 82.98  ? 81  GLU D N   1 
ATOM   6702  C CA  . GLU D 1 83  ? -12.575 50.208  51.170  1.00 82.79  ? 81  GLU D CA  1 
ATOM   6703  C C   . GLU D 1 83  ? -13.692 49.323  51.702  1.00 81.47  ? 81  GLU D C   1 
ATOM   6704  O O   . GLU D 1 83  ? -14.469 49.725  52.573  1.00 78.89  ? 81  GLU D O   1 
ATOM   6705  C CB  . GLU D 1 83  ? -13.197 51.130  50.152  1.00 86.04  ? 81  GLU D CB  1 
ATOM   6706  C CG  . GLU D 1 83  ? -14.535 51.655  50.610  1.00 96.11  ? 81  GLU D CG  1 
ATOM   6707  C CD  . GLU D 1 83  ? -15.316 52.326  49.508  1.00 102.01 ? 81  GLU D CD  1 
ATOM   6708  O OE1 . GLU D 1 83  ? -16.381 52.926  49.823  1.00 104.29 ? 81  GLU D OE1 1 
ATOM   6709  O OE2 . GLU D 1 83  ? -14.867 52.245  48.334  1.00 103.96 ? 81  GLU D OE2 1 
ATOM   6710  N N   . ILE D 1 84  ? -13.791 48.120  51.161  1.00 80.80  ? 82  ILE D N   1 
ATOM   6711  C CA  . ILE D 1 84  ? -14.852 47.241  51.577  1.00 80.69  ? 82  ILE D CA  1 
ATOM   6712  C C   . ILE D 1 84  ? -14.460 45.888  52.129  1.00 81.45  ? 82  ILE D C   1 
ATOM   6713  O O   . ILE D 1 84  ? -15.263 45.244  52.805  1.00 80.68  ? 82  ILE D O   1 
ATOM   6714  C CB  . ILE D 1 84  ? -15.830 47.065  50.428  1.00 82.54  ? 82  ILE D CB  1 
ATOM   6715  C CG1 . ILE D 1 84  ? -16.366 48.443  50.043  1.00 80.72  ? 82  ILE D CG1 1 
ATOM   6716  C CG2 . ILE D 1 84  ? -16.978 46.128  50.830  1.00 83.96  ? 82  ILE D CG2 1 
ATOM   6717  C CD1 . ILE D 1 84  ? -17.525 48.405  49.079  1.00 83.46  ? 82  ILE D CD1 1 
ATOM   6718  N N   . GLY D 1 85  ? -13.241 45.442  51.862  1.00 82.97  ? 83  GLY D N   1 
ATOM   6719  C CA  . GLY D 1 85  ? -12.835 44.151  52.396  1.00 86.98  ? 83  GLY D CA  1 
ATOM   6720  C C   . GLY D 1 85  ? -13.219 44.094  53.863  1.00 89.74  ? 83  GLY D C   1 
ATOM   6721  O O   . GLY D 1 85  ? -13.411 43.021  54.466  1.00 89.72  ? 83  GLY D O   1 
ATOM   6722  N N   . ALA D 1 86  ? -13.332 45.294  54.428  1.00 91.22  ? 84  ALA D N   1 
ATOM   6723  C CA  . ALA D 1 86  ? -13.691 45.500  55.824  1.00 89.05  ? 84  ALA D CA  1 
ATOM   6724  C C   . ALA D 1 86  ? -15.178 45.257  56.063  1.00 87.61  ? 84  ALA D C   1 
ATOM   6725  O O   . ALA D 1 86  ? -15.573 44.689  57.091  1.00 88.04  ? 84  ALA D O   1 
ATOM   6726  C CB  . ALA D 1 86  ? -13.323 46.932  56.229  1.00 85.67  ? 84  ALA D CB  1 
ATOM   6727  N N   . ASP D 1 87  ? -15.983 45.684  55.094  1.00 85.20  ? 85  ASP D N   1 
ATOM   6728  C CA  . ASP D 1 87  ? -17.439 45.580  55.144  1.00 83.50  ? 85  ASP D CA  1 
ATOM   6729  C C   . ASP D 1 87  ? -17.969 44.253  54.598  1.00 80.03  ? 85  ASP D C   1 
ATOM   6730  O O   . ASP D 1 87  ? -19.170 43.974  54.592  1.00 76.25  ? 85  ASP D O   1 
ATOM   6731  C CB  . ASP D 1 87  ? -18.010 46.771  54.383  1.00 87.30  ? 85  ASP D CB  1 
ATOM   6732  C CG  . ASP D 1 87  ? -17.425 48.093  54.874  1.00 94.62  ? 85  ASP D CG  1 
ATOM   6733  O OD1 . ASP D 1 87  ? -17.773 48.520  56.004  1.00 102.66 ? 85  ASP D OD1 1 
ATOM   6734  O OD2 . ASP D 1 87  ? -16.598 48.693  54.146  1.00 95.51  ? 85  ASP D OD2 1 
ATOM   6735  N N   . ILE D 1 88  ? -17.044 43.422  54.154  1.00 80.27  ? 86  ILE D N   1 
ATOM   6736  C CA  . ILE D 1 88  ? -17.393 42.124  53.620  1.00 82.38  ? 86  ILE D CA  1 
ATOM   6737  C C   . ILE D 1 88  ? -17.775 41.285  54.843  1.00 82.61  ? 86  ILE D C   1 
ATOM   6738  O O   . ILE D 1 88  ? -17.147 41.377  55.908  1.00 82.47  ? 86  ILE D O   1 
ATOM   6739  C CB  . ILE D 1 88  ? -16.169 41.512  52.869  1.00 80.81  ? 86  ILE D CB  1 
ATOM   6740  C CG1 . ILE D 1 88  ? -16.578 40.270  52.106  1.00 78.48  ? 86  ILE D CG1 1 
ATOM   6741  C CG2 . ILE D 1 88  ? -15.064 41.131  53.847  1.00 83.36  ? 86  ILE D CG2 1 
ATOM   6742  C CD1 . ILE D 1 88  ? -15.367 39.443  51.674  1.00 83.38  ? 86  ILE D CD1 1 
ATOM   6743  N N   . GLU D 1 89  ? -18.820 40.491  54.718  1.00 82.41  ? 87  GLU D N   1 
ATOM   6744  C CA  . GLU D 1 89  ? -19.205 39.680  55.842  1.00 84.49  ? 87  GLU D CA  1 
ATOM   6745  C C   . GLU D 1 89  ? -19.006 38.217  55.528  1.00 84.43  ? 87  GLU D C   1 
ATOM   6746  O O   . GLU D 1 89  ? -18.068 37.878  54.800  1.00 82.69  ? 87  GLU D O   1 
ATOM   6747  C CB  . GLU D 1 89  ? -20.630 40.000  56.225  1.00 86.34  ? 87  GLU D CB  1 
ATOM   6748  C CG  . GLU D 1 89  ? -20.771 41.482  56.492  1.00 92.94  ? 87  GLU D CG  1 
ATOM   6749  C CD  . GLU D 1 89  ? -21.521 41.748  57.764  1.00 95.89  ? 87  GLU D CD  1 
ATOM   6750  O OE1 . GLU D 1 89  ? -22.654 41.233  57.873  1.00 97.13  ? 87  GLU D OE1 1 
ATOM   6751  O OE2 . GLU D 1 89  ? -20.991 42.463  58.649  1.00 97.94  ? 87  GLU D OE2 1 
ATOM   6752  N N   . ASP D 1 90  ? -19.854 37.348  56.072  1.00 86.11  ? 88  ASP D N   1 
ATOM   6753  C CA  . ASP D 1 90  ? -19.686 35.917  55.826  1.00 87.05  ? 88  ASP D CA  1 
ATOM   6754  C C   . ASP D 1 90  ? -20.421 35.412  54.604  1.00 86.79  ? 88  ASP D C   1 
ATOM   6755  O O   . ASP D 1 90  ? -19.787 34.907  53.680  1.00 90.98  ? 88  ASP D O   1 
ATOM   6756  C CB  . ASP D 1 90  ? -20.107 35.095  57.039  1.00 89.10  ? 88  ASP D CB  1 
ATOM   6757  C CG  . ASP D 1 90  ? -19.159 35.263  58.203  1.00 90.92  ? 88  ASP D CG  1 
ATOM   6758  O OD1 . ASP D 1 90  ? -17.922 35.377  57.980  1.00 86.70  ? 88  ASP D OD1 1 
ATOM   6759  O OD2 . ASP D 1 90  ? -19.671 35.261  59.342  1.00 95.06  ? 88  ASP D OD2 1 
ATOM   6760  N N   . ARG D 1 91  ? -21.748 35.551  54.583  1.00 82.76  ? 89  ARG D N   1 
ATOM   6761  C CA  . ARG D 1 91  ? -22.537 35.094  53.440  1.00 77.65  ? 89  ARG D CA  1 
ATOM   6762  C C   . ARG D 1 91  ? -21.894 35.559  52.122  1.00 79.53  ? 89  ARG D C   1 
ATOM   6763  O O   . ARG D 1 91  ? -21.442 34.742  51.302  1.00 78.68  ? 89  ARG D O   1 
ATOM   6764  C CB  . ARG D 1 91  ? -23.959 35.638  53.552  1.00 73.65  ? 89  ARG D CB  1 
ATOM   6765  C CG  . ARG D 1 91  ? -24.050 37.153  53.726  1.00 70.36  ? 89  ARG D CG  1 
ATOM   6766  C CD  . ARG D 1 91  ? -25.507 37.579  53.933  1.00 73.48  ? 89  ARG D CD  1 
ATOM   6767  N NE  . ARG D 1 91  ? -25.780 38.950  53.500  1.00 72.22  ? 89  ARG D NE  1 
ATOM   6768  C CZ  . ARG D 1 91  ? -25.154 40.034  53.961  1.00 71.36  ? 89  ARG D CZ  1 
ATOM   6769  N NH1 . ARG D 1 91  ? -24.205 39.904  54.887  1.00 70.16  ? 89  ARG D NH1 1 
ATOM   6770  N NH2 . ARG D 1 91  ? -25.465 41.244  53.484  1.00 60.69  ? 89  ARG D NH2 1 
ATOM   6771  N N   . HIS D 1 92  ? -21.828 36.883  51.962  1.00 81.05  ? 90  HIS D N   1 
ATOM   6772  C CA  . HIS D 1 92  ? -21.272 37.554  50.781  1.00 77.24  ? 90  HIS D CA  1 
ATOM   6773  C C   . HIS D 1 92  ? -20.412 36.700  49.876  1.00 74.30  ? 90  HIS D C   1 
ATOM   6774  O O   . HIS D 1 92  ? -19.421 36.085  50.331  1.00 70.58  ? 90  HIS D O   1 
ATOM   6775  C CB  . HIS D 1 92  ? -20.438 38.794  51.176  1.00 78.89  ? 90  HIS D CB  1 
ATOM   6776  C CG  . HIS D 1 92  ? -21.237 40.050  51.375  1.00 83.79  ? 90  HIS D CG  1 
ATOM   6777  N ND1 . HIS D 1 92  ? -21.970 40.304  52.517  1.00 89.93  ? 90  HIS D ND1 1 
ATOM   6778  C CD2 . HIS D 1 92  ? -21.397 41.137  50.586  1.00 86.02  ? 90  HIS D CD2 1 
ATOM   6779  C CE1 . HIS D 1 92  ? -22.540 41.490  52.421  1.00 89.69  ? 90  HIS D CE1 1 
ATOM   6780  N NE2 . HIS D 1 92  ? -22.208 42.019  51.257  1.00 88.13  ? 90  HIS D NE2 1 
ATOM   6781  N N   . ILE D 1 93  ? -20.808 36.640  48.603  1.00 71.70  ? 91  ILE D N   1 
ATOM   6782  C CA  . ILE D 1 93  ? -19.986 35.939  47.625  1.00 70.51  ? 91  ILE D CA  1 
ATOM   6783  C C   . ILE D 1 93  ? -19.536 37.090  46.776  1.00 72.52  ? 91  ILE D C   1 
ATOM   6784  O O   . ILE D 1 93  ? -20.354 37.998  46.479  1.00 70.38  ? 91  ILE D O   1 
ATOM   6785  C CB  . ILE D 1 93  ? -20.723 35.036  46.664  1.00 64.10  ? 91  ILE D CB  1 
ATOM   6786  C CG1 . ILE D 1 93  ? -21.577 34.048  47.395  1.00 60.63  ? 91  ILE D CG1 1 
ATOM   6787  C CG2 . ILE D 1 93  ? -19.711 34.255  45.845  1.00 59.36  ? 91  ILE D CG2 1 
ATOM   6788  C CD1 . ILE D 1 93  ? -22.179 33.088  46.434  1.00 60.66  ? 91  ILE D CD1 1 
ATOM   6789  N N   . VAL D 1 94  ? -18.264 37.037  46.376  1.00 72.05  ? 92  VAL D N   1 
ATOM   6790  C CA  . VAL D 1 94  ? -17.676 38.075  45.549  1.00 73.49  ? 92  VAL D CA  1 
ATOM   6791  C C   . VAL D 1 94  ? -17.251 37.606  44.151  1.00 75.34  ? 92  VAL D C   1 
ATOM   6792  O O   . VAL D 1 94  ? -16.175 36.996  43.973  1.00 75.81  ? 92  VAL D O   1 
ATOM   6793  C CB  . VAL D 1 94  ? -16.470 38.706  46.261  1.00 71.73  ? 92  VAL D CB  1 
ATOM   6794  C CG1 . VAL D 1 94  ? -15.888 39.856  45.426  1.00 70.44  ? 92  VAL D CG1 1 
ATOM   6795  C CG2 . VAL D 1 94  ? -16.898 39.197  47.625  1.00 66.05  ? 92  VAL D CG2 1 
ATOM   6796  N N   . VAL D 1 95  ? -18.121 37.856  43.175  1.00 73.11  ? 93  VAL D N   1 
ATOM   6797  C CA  . VAL D 1 95  ? -17.824 37.510  41.806  1.00 70.05  ? 93  VAL D CA  1 
ATOM   6798  C C   . VAL D 1 95  ? -17.277 38.827  41.315  1.00 66.47  ? 93  VAL D C   1 
ATOM   6799  O O   . VAL D 1 95  ? -17.815 39.893  41.617  1.00 65.89  ? 93  VAL D O   1 
ATOM   6800  C CB  . VAL D 1 95  ? -19.102 37.125  41.043  1.00 69.53  ? 93  VAL D CB  1 
ATOM   6801  C CG1 . VAL D 1 95  ? -19.461 35.685  41.310  1.00 71.05  ? 93  VAL D CG1 1 
ATOM   6802  C CG2 . VAL D 1 95  ? -20.238 37.983  41.518  1.00 73.95  ? 93  VAL D CG2 1 
ATOM   6803  N N   . SER D 1 96  ? -16.175 38.758  40.598  1.00 62.96  ? 94  SER D N   1 
ATOM   6804  C CA  . SER D 1 96  ? -15.577 39.956  40.072  1.00 63.50  ? 94  SER D CA  1 
ATOM   6805  C C   . SER D 1 96  ? -15.348 39.732  38.601  1.00 62.75  ? 94  SER D C   1 
ATOM   6806  O O   . SER D 1 96  ? -14.881 38.683  38.182  1.00 64.23  ? 94  SER D O   1 
ATOM   6807  C CB  . SER D 1 96  ? -14.238 40.241  40.753  1.00 65.28  ? 94  SER D CB  1 
ATOM   6808  O OG  . SER D 1 96  ? -13.634 41.419  40.231  1.00 70.58  ? 94  SER D OG  1 
ATOM   6809  N N   . CYS D 1 97  ? -15.685 40.713  37.795  1.00 60.55  ? 95  CYS D N   1 
ATOM   6810  C CA  . CYS D 1 97  ? -15.445 40.535  36.395  1.00 61.90  ? 95  CYS D CA  1 
ATOM   6811  C C   . CYS D 1 97  ? -14.742 41.773  35.985  1.00 59.74  ? 95  CYS D C   1 
ATOM   6812  O O   . CYS D 1 97  ? -15.147 42.878  36.313  1.00 55.93  ? 95  CYS D O   1 
ATOM   6813  C CB  . CYS D 1 97  ? -16.745 40.369  35.654  1.00 67.32  ? 95  CYS D CB  1 
ATOM   6814  S SG  . CYS D 1 97  ? -18.069 39.640  36.675  1.00 74.64  ? 95  CYS D SG  1 
ATOM   6815  N N   . ALA D 1 98  ? -13.649 41.559  35.283  1.00 60.99  ? 96  ALA D N   1 
ATOM   6816  C CA  . ALA D 1 98  ? -12.820 42.643  34.832  1.00 66.12  ? 96  ALA D CA  1 
ATOM   6817  C C   . ALA D 1 98  ? -11.615 41.960  34.255  1.00 66.17  ? 96  ALA D C   1 
ATOM   6818  O O   . ALA D 1 98  ? -11.089 41.044  34.853  1.00 69.26  ? 96  ALA D O   1 
ATOM   6819  C CB  . ALA D 1 98  ? -12.431 43.519  36.010  1.00 65.61  ? 96  ALA D CB  1 
ATOM   6820  N N   . ALA D 1 99  ? -11.185 42.386  33.081  1.00 67.02  ? 97  ALA D N   1 
ATOM   6821  C CA  . ALA D 1 99  ? -10.038 41.754  32.463  1.00 68.31  ? 97  ALA D CA  1 
ATOM   6822  C C   . ALA D 1 99  ? -8.893  41.647  33.457  1.00 69.60  ? 97  ALA D C   1 
ATOM   6823  O O   . ALA D 1 99  ? -8.685  42.547  34.295  1.00 68.28  ? 97  ALA D O   1 
ATOM   6824  C CB  . ALA D 1 99  ? -9.588  42.554  31.220  1.00 71.14  ? 97  ALA D CB  1 
ATOM   6825  N N   . GLY D 1 100 ? -8.181  40.524  33.369  1.00 70.90  ? 98  GLY D N   1 
ATOM   6826  C CA  . GLY D 1 100 ? -7.013  40.295  34.196  1.00 73.53  ? 98  GLY D CA  1 
ATOM   6827  C C   . GLY D 1 100 ? -7.201  40.021  35.666  1.00 75.68  ? 98  GLY D C   1 
ATOM   6828  O O   . GLY D 1 100 ? -6.985  38.888  36.097  1.00 80.42  ? 98  GLY D O   1 
ATOM   6829  N N   . VAL D 1 101 ? -7.563  41.054  36.430  1.00 73.51  ? 99  VAL D N   1 
ATOM   6830  C CA  . VAL D 1 101 ? -7.791  40.957  37.871  1.00 67.65  ? 99  VAL D CA  1 
ATOM   6831  C C   . VAL D 1 101 ? -7.958  39.512  38.354  1.00 64.38  ? 99  VAL D C   1 
ATOM   6832  O O   . VAL D 1 101 ? -9.047  38.938  38.264  1.00 59.85  ? 99  VAL D O   1 
ATOM   6833  C CB  . VAL D 1 101 ? -9.025  41.807  38.253  1.00 70.39  ? 99  VAL D CB  1 
ATOM   6834  C CG1 . VAL D 1 101 ? -9.225  41.781  39.759  1.00 72.27  ? 99  VAL D CG1 1 
ATOM   6835  C CG2 . VAL D 1 101 ? -8.833  43.252  37.747  1.00 66.15  ? 99  VAL D CG2 1 
ATOM   6836  N N   . THR D 1 102 ? -6.858  38.950  38.863  1.00 62.52  ? 100 THR D N   1 
ATOM   6837  C CA  . THR D 1 102 ? -6.774  37.574  39.355  1.00 62.22  ? 100 THR D CA  1 
ATOM   6838  C C   . THR D 1 102 ? -7.668  37.300  40.558  1.00 67.75  ? 100 THR D C   1 
ATOM   6839  O O   . THR D 1 102 ? -8.167  38.212  41.218  1.00 71.18  ? 100 THR D O   1 
ATOM   6840  C CB  . THR D 1 102 ? -5.337  37.262  39.772  1.00 59.10  ? 100 THR D CB  1 
ATOM   6841  O OG1 . THR D 1 102 ? -4.445  37.979  38.913  1.00 58.52  ? 100 THR D OG1 1 
ATOM   6842  C CG2 . THR D 1 102 ? -5.036  35.758  39.674  1.00 59.54  ? 100 THR D CG2 1 
ATOM   6843  N N   . ILE D 1 103 ? -7.898  36.022  40.821  1.00 72.05  ? 101 ILE D N   1 
ATOM   6844  C CA  . ILE D 1 103 ? -8.696  35.631  41.976  1.00 74.47  ? 101 ILE D CA  1 
ATOM   6845  C C   . ILE D 1 103 ? -7.689  35.817  43.080  1.00 74.15  ? 101 ILE D C   1 
ATOM   6846  O O   . ILE D 1 103 ? -7.913  36.553  44.042  1.00 73.96  ? 101 ILE D O   1 
ATOM   6847  C CB  . ILE D 1 103 ? -9.094  34.124  41.946  1.00 78.47  ? 101 ILE D CB  1 
ATOM   6848  C CG1 . ILE D 1 103 ? -10.505 33.950  41.380  1.00 80.80  ? 101 ILE D CG1 1 
ATOM   6849  C CG2 . ILE D 1 103 ? -9.011  33.535  43.347  1.00 79.68  ? 101 ILE D CG2 1 
ATOM   6850  C CD1 . ILE D 1 103 ? -10.980 32.519  41.350  1.00 78.21  ? 101 ILE D CD1 1 
ATOM   6851  N N   . SER D 1 104 ? -6.553  35.151  42.891  1.00 74.50  ? 102 SER D N   1 
ATOM   6852  C CA  . SER D 1 104 ? -5.455  35.218  43.832  1.00 74.87  ? 102 SER D CA  1 
ATOM   6853  C C   . SER D 1 104 ? -5.330  36.652  44.314  1.00 75.32  ? 102 SER D C   1 
ATOM   6854  O O   . SER D 1 104 ? -5.508  36.945  45.487  1.00 79.64  ? 102 SER D O   1 
ATOM   6855  C CB  . SER D 1 104 ? -4.161  34.801  43.145  1.00 72.04  ? 102 SER D CB  1 
ATOM   6856  O OG  . SER D 1 104 ? -3.046  35.163  43.937  1.00 73.67  ? 102 SER D OG  1 
ATOM   6857  N N   . SER D 1 105 ? -5.036  37.533  43.372  1.00 72.85  ? 103 SER D N   1 
ATOM   6858  C CA  . SER D 1 105 ? -4.873  38.948  43.618  1.00 70.93  ? 103 SER D CA  1 
ATOM   6859  C C   . SER D 1 105 ? -5.992  39.508  44.450  1.00 69.58  ? 103 SER D C   1 
ATOM   6860  O O   . SER D 1 105 ? -5.766  40.114  45.483  1.00 71.79  ? 103 SER D O   1 
ATOM   6861  C CB  . SER D 1 105 ? -4.845  39.693  42.282  1.00 76.09  ? 103 SER D CB  1 
ATOM   6862  O OG  . SER D 1 105 ? -6.095  39.597  41.601  1.00 75.40  ? 103 SER D OG  1 
ATOM   6863  N N   . ILE D 1 106 ? -7.206  39.337  43.957  1.00 68.51  ? 104 ILE D N   1 
ATOM   6864  C CA  . ILE D 1 106 ? -8.382  39.826  44.638  1.00 70.50  ? 104 ILE D CA  1 
ATOM   6865  C C   . ILE D 1 106 ? -8.461  39.304  46.058  1.00 72.18  ? 104 ILE D C   1 
ATOM   6866  O O   . ILE D 1 106 ? -9.047  39.951  46.924  1.00 73.57  ? 104 ILE D O   1 
ATOM   6867  C CB  . ILE D 1 106 ? -9.653  39.441  43.864  1.00 71.00  ? 104 ILE D CB  1 
ATOM   6868  C CG1 . ILE D 1 106 ? -9.782  40.345  42.635  1.00 70.15  ? 104 ILE D CG1 1 
ATOM   6869  C CG2 . ILE D 1 106 ? -10.882 39.552  44.759  1.00 70.63  ? 104 ILE D CG2 1 
ATOM   6870  C CD1 . ILE D 1 106 ? -11.038 40.108  41.834  1.00 72.98  ? 104 ILE D CD1 1 
ATOM   6871  N N   . GLU D 1 107 ? -7.862  38.139  46.303  1.00 74.63  ? 105 GLU D N   1 
ATOM   6872  C CA  . GLU D 1 107 ? -7.856  37.540  47.649  1.00 75.20  ? 105 GLU D CA  1 
ATOM   6873  C C   . GLU D 1 107 ? -6.834  38.225  48.581  1.00 76.78  ? 105 GLU D C   1 
ATOM   6874  O O   . GLU D 1 107 ? -7.193  38.739  49.640  1.00 77.21  ? 105 GLU D O   1 
ATOM   6875  C CB  . GLU D 1 107 ? -7.575  36.030  47.561  1.00 69.85  ? 105 GLU D CB  1 
ATOM   6876  C CG  . GLU D 1 107 ? -8.663  35.292  46.807  1.00 70.88  ? 105 GLU D CG  1 
ATOM   6877  C CD  . GLU D 1 107 ? -8.425  33.812  46.712  1.00 71.90  ? 105 GLU D CD  1 
ATOM   6878  O OE1 . GLU D 1 107 ? -7.258  33.409  46.442  1.00 75.95  ? 105 GLU D OE1 1 
ATOM   6879  O OE2 . GLU D 1 107 ? -9.415  33.056  46.890  1.00 65.56  ? 105 GLU D OE2 1 
ATOM   6880  N N   . LYS D 1 108 ? -5.568  38.242  48.170  1.00 76.58  ? 106 LYS D N   1 
ATOM   6881  C CA  . LYS D 1 108 ? -4.492  38.862  48.943  1.00 75.53  ? 106 LYS D CA  1 
ATOM   6882  C C   . LYS D 1 108 ? -4.777  40.333  49.207  1.00 72.64  ? 106 LYS D C   1 
ATOM   6883  O O   . LYS D 1 108 ? -3.915  41.191  49.084  1.00 74.92  ? 106 LYS D O   1 
ATOM   6884  C CB  . LYS D 1 108 ? -3.176  38.709  48.186  1.00 75.90  ? 106 LYS D CB  1 
ATOM   6885  C CG  . LYS D 1 108 ? -2.992  37.295  47.690  1.00 83.27  ? 106 LYS D CG  1 
ATOM   6886  C CD  . LYS D 1 108 ? -1.720  37.132  46.899  1.00 87.97  ? 106 LYS D CD  1 
ATOM   6887  C CE  . LYS D 1 108 ? -1.459  35.670  46.606  1.00 88.92  ? 106 LYS D CE  1 
ATOM   6888  N NZ  . LYS D 1 108 ? -0.069  35.491  46.096  1.00 94.60  ? 106 LYS D NZ  1 
ATOM   6889  N N   . LYS D 1 109 ? -6.008  40.607  49.574  1.00 69.56  ? 107 LYS D N   1 
ATOM   6890  C CA  . LYS D 1 109 ? -6.446  41.938  49.862  1.00 74.88  ? 107 LYS D CA  1 
ATOM   6891  C C   . LYS D 1 109 ? -7.533  41.764  50.879  1.00 80.63  ? 107 LYS D C   1 
ATOM   6892  O O   . LYS D 1 109 ? -7.496  42.363  51.952  1.00 84.09  ? 107 LYS D O   1 
ATOM   6893  C CB  . LYS D 1 109 ? -7.022  42.560  48.620  1.00 73.85  ? 107 LYS D CB  1 
ATOM   6894  C CG  . LYS D 1 109 ? -6.012  43.231  47.752  1.00 74.94  ? 107 LYS D CG  1 
ATOM   6895  C CD  . LYS D 1 109 ? -5.494  44.484  48.421  1.00 77.83  ? 107 LYS D CD  1 
ATOM   6896  C CE  . LYS D 1 109 ? -5.344  45.595  47.391  1.00 74.67  ? 107 LYS D CE  1 
ATOM   6897  N NZ  . LYS D 1 109 ? -5.149  46.935  48.003  1.00 71.72  ? 107 LYS D NZ  1 
ATOM   6898  N N   . LEU D 1 110 ? -8.520  40.950  50.518  1.00 85.75  ? 108 LEU D N   1 
ATOM   6899  C CA  . LEU D 1 110 ? -9.623  40.632  51.412  1.00 91.35  ? 108 LEU D CA  1 
ATOM   6900  C C   . LEU D 1 110 ? -9.020  39.732  52.476  1.00 98.75  ? 108 LEU D C   1 
ATOM   6901  O O   . LEU D 1 110 ? -9.634  39.482  53.518  1.00 101.87 ? 108 LEU D O   1 
ATOM   6902  C CB  . LEU D 1 110 ? -10.706 39.841  50.701  1.00 87.41  ? 108 LEU D CB  1 
ATOM   6903  C CG  . LEU D 1 110 ? -11.519 40.543  49.645  1.00 82.40  ? 108 LEU D CG  1 
ATOM   6904  C CD1 . LEU D 1 110 ? -12.636 39.616  49.222  1.00 80.36  ? 108 LEU D CD1 1 
ATOM   6905  C CD2 . LEU D 1 110 ? -12.062 41.833  50.219  1.00 81.87  ? 108 LEU D CD2 1 
ATOM   6906  N N   . SER D 1 111 ? -7.835  39.201  52.175  1.00 103.94 ? 109 SER D N   1 
ATOM   6907  C CA  . SER D 1 111 ? -7.125  38.364  53.131  1.00 107.78 ? 109 SER D CA  1 
ATOM   6908  C C   . SER D 1 111 ? -6.906  39.298  54.323  1.00 107.98 ? 109 SER D C   1 
ATOM   6909  O O   . SER D 1 111 ? -7.035  38.884  55.477  1.00 109.70 ? 109 SER D O   1 
ATOM   6910  C CB  . SER D 1 111 ? -5.777  37.886  52.555  1.00 110.88 ? 109 SER D CB  1 
ATOM   6911  O OG  . SER D 1 111 ? -5.975  37.006  51.453  1.00 116.62 ? 109 SER D OG  1 
ATOM   6912  N N   . ALA D 1 112 ? -6.608  40.568  54.019  1.00 106.02 ? 110 ALA D N   1 
ATOM   6913  C CA  . ALA D 1 112 ? -6.391  41.608  55.019  1.00 103.43 ? 110 ALA D CA  1 
ATOM   6914  C C   . ALA D 1 112 ? -7.704  41.883  55.757  1.00 104.18 ? 110 ALA D C   1 
ATOM   6915  O O   . ALA D 1 112 ? -7.909  42.966  56.295  1.00 105.12 ? 110 ALA D O   1 
ATOM   6916  C CB  . ALA D 1 112 ? -5.878  42.893  54.343  1.00 98.94  ? 110 ALA D CB  1 
ATOM   6917  N N   . PHE D 1 113 ? -8.598  40.895  55.751  1.00 105.72 ? 111 PHE D N   1 
ATOM   6918  C CA  . PHE D 1 113 ? -9.905  40.966  56.413  1.00 107.74 ? 111 PHE D CA  1 
ATOM   6919  C C   . PHE D 1 113 ? -10.400 39.519  56.631  1.00 111.08 ? 111 PHE D C   1 
ATOM   6920  O O   . PHE D 1 113 ? -9.586  38.588  56.684  1.00 110.02 ? 111 PHE D O   1 
ATOM   6921  C CB  . PHE D 1 113 ? -10.911 41.749  55.548  1.00 107.63 ? 111 PHE D CB  1 
ATOM   6922  C CG  . PHE D 1 113 ? -10.410 43.106  55.093  1.00 106.43 ? 111 PHE D CG  1 
ATOM   6923  C CD1 . PHE D 1 113 ? -9.630  43.236  53.943  1.00 109.03 ? 111 PHE D CD1 1 
ATOM   6924  C CD2 . PHE D 1 113 ? -10.708 44.250  55.814  1.00 103.48 ? 111 PHE D CD2 1 
ATOM   6925  C CE1 . PHE D 1 113 ? -9.153  44.488  53.529  1.00 106.30 ? 111 PHE D CE1 1 
ATOM   6926  C CE2 . PHE D 1 113 ? -10.236 45.500  55.404  1.00 102.92 ? 111 PHE D CE2 1 
ATOM   6927  C CZ  . PHE D 1 113 ? -9.460  45.616  54.261  1.00 103.83 ? 111 PHE D CZ  1 
ATOM   6928  N N   . ARG D 1 114 ? -11.720 39.329  56.748  1.00 115.44 ? 112 ARG D N   1 
ATOM   6929  C CA  . ARG D 1 114 ? -12.311 37.990  56.957  1.00 118.60 ? 112 ARG D CA  1 
ATOM   6930  C C   . ARG D 1 114 ? -11.338 36.885  56.481  1.00 119.18 ? 112 ARG D C   1 
ATOM   6931  O O   . ARG D 1 114 ? -10.798 36.953  55.369  1.00 120.31 ? 112 ARG D O   1 
ATOM   6932  C CB  . ARG D 1 114 ? -13.685 37.855  56.220  1.00 119.28 ? 112 ARG D CB  1 
ATOM   6933  C CG  . ARG D 1 114 ? -14.845 38.768  56.723  1.00 118.42 ? 112 ARG D CG  1 
ATOM   6934  C CD  . ARG D 1 114 ? -15.634 38.185  57.924  1.00 118.66 ? 112 ARG D CD  1 
ATOM   6935  N NE  . ARG D 1 114 ? -16.540 39.175  58.552  1.00 118.31 ? 112 ARG D NE  1 
ATOM   6936  C CZ  . ARG D 1 114 ? -17.347 38.931  59.593  1.00 114.70 ? 112 ARG D CZ  1 
ATOM   6937  N NH1 . ARG D 1 114 ? -17.384 37.724  60.150  1.00 115.66 ? 112 ARG D NH1 1 
ATOM   6938  N NH2 . ARG D 1 114 ? -18.117 39.895  60.089  1.00 108.84 ? 112 ARG D NH2 1 
ATOM   6939  N N   . PRO D 1 115 ? -11.095 35.867  57.333  1.00 118.66 ? 113 PRO D N   1 
ATOM   6940  C CA  . PRO D 1 115 ? -10.218 34.698  57.133  1.00 116.34 ? 113 PRO D CA  1 
ATOM   6941  C C   . PRO D 1 115 ? -10.144 34.052  55.726  1.00 112.14 ? 113 PRO D C   1 
ATOM   6942  O O   . PRO D 1 115 ? -9.063  33.989  55.115  1.00 112.50 ? 113 PRO D O   1 
ATOM   6943  C CB  . PRO D 1 115 ? -10.730 33.719  58.189  1.00 117.96 ? 113 PRO D CB  1 
ATOM   6944  C CG  . PRO D 1 115 ? -11.051 34.630  59.324  1.00 119.00 ? 113 PRO D CG  1 
ATOM   6945  C CD  . PRO D 1 115 ? -11.782 35.773  58.638  1.00 119.06 ? 113 PRO D CD  1 
ATOM   6946  N N   . ALA D 1 116 ? -11.286 33.570  55.231  1.00 105.18 ? 114 ALA D N   1 
ATOM   6947  C CA  . ALA D 1 116 ? -11.363 32.927  53.924  1.00 98.96  ? 114 ALA D CA  1 
ATOM   6948  C C   . ALA D 1 116 ? -12.494 33.522  53.091  1.00 95.41  ? 114 ALA D C   1 
ATOM   6949  O O   . ALA D 1 116 ? -13.618 33.008  53.113  1.00 94.99  ? 114 ALA D O   1 
ATOM   6950  C CB  . ALA D 1 116 ? -11.587 31.440  54.104  1.00 100.07 ? 114 ALA D CB  1 
ATOM   6951  N N   . PRO D 1 117 ? -12.211 34.604  52.331  1.00 91.14  ? 115 PRO D N   1 
ATOM   6952  C CA  . PRO D 1 117 ? -13.247 35.238  51.503  1.00 86.42  ? 115 PRO D CA  1 
ATOM   6953  C C   . PRO D 1 117 ? -13.772 34.307  50.408  1.00 82.55  ? 115 PRO D C   1 
ATOM   6954  O O   . PRO D 1 117 ? -13.044 33.449  49.903  1.00 82.45  ? 115 PRO D O   1 
ATOM   6955  C CB  . PRO D 1 117 ? -12.525 36.447  50.913  1.00 86.00  ? 115 PRO D CB  1 
ATOM   6956  C CG  . PRO D 1 117 ? -11.450 36.743  51.904  1.00 86.52  ? 115 PRO D CG  1 
ATOM   6957  C CD  . PRO D 1 117 ? -10.952 35.369  52.254  1.00 86.89  ? 115 PRO D CD  1 
ATOM   6958  N N   . ARG D 1 118 ? -15.032 34.482  50.042  1.00 76.79  ? 116 ARG D N   1 
ATOM   6959  C CA  . ARG D 1 118 ? -15.624 33.668  48.992  1.00 73.22  ? 116 ARG D CA  1 
ATOM   6960  C C   . ARG D 1 118 ? -15.529 34.428  47.652  1.00 70.61  ? 116 ARG D C   1 
ATOM   6961  O O   . ARG D 1 118 ? -16.291 35.360  47.423  1.00 69.34  ? 116 ARG D O   1 
ATOM   6962  C CB  . ARG D 1 118 ? -17.082 33.425  49.329  1.00 73.82  ? 116 ARG D CB  1 
ATOM   6963  C CG  . ARG D 1 118 ? -17.338 32.717  50.626  1.00 71.34  ? 116 ARG D CG  1 
ATOM   6964  C CD  . ARG D 1 118 ? -18.822 32.680  50.825  1.00 75.54  ? 116 ARG D CD  1 
ATOM   6965  N NE  . ARG D 1 118 ? -19.235 31.752  51.870  1.00 84.16  ? 116 ARG D NE  1 
ATOM   6966  C CZ  . ARG D 1 118 ? -20.510 31.510  52.181  1.00 90.07  ? 116 ARG D CZ  1 
ATOM   6967  N NH1 . ARG D 1 118 ? -21.483 32.131  51.513  1.00 88.13  ? 116 ARG D NH1 1 
ATOM   6968  N NH2 . ARG D 1 118 ? -20.818 30.667  53.169  1.00 92.03  ? 116 ARG D NH2 1 
ATOM   6969  N N   . VAL D 1 119 ? -14.632 34.026  46.752  1.00 68.14  ? 117 VAL D N   1 
ATOM   6970  C CA  . VAL D 1 119 ? -14.462 34.750  45.480  1.00 65.50  ? 117 VAL D CA  1 
ATOM   6971  C C   . VAL D 1 119 ? -14.441 33.925  44.180  1.00 63.10  ? 117 VAL D C   1 
ATOM   6972  O O   . VAL D 1 119 ? -13.560 33.081  44.011  1.00 62.33  ? 117 VAL D O   1 
ATOM   6973  C CB  . VAL D 1 119 ? -13.141 35.612  45.543  1.00 65.46  ? 117 VAL D CB  1 
ATOM   6974  C CG1 . VAL D 1 119 ? -12.962 36.442  44.289  1.00 66.75  ? 117 VAL D CG1 1 
ATOM   6975  C CG2 . VAL D 1 119 ? -13.182 36.534  46.752  1.00 65.47  ? 117 VAL D CG2 1 
ATOM   6976  N N   . ILE D 1 120 ? -15.398 34.171  43.268  1.00 63.83  ? 118 ILE D N   1 
ATOM   6977  C CA  . ILE D 1 120 ? -15.450 33.486  41.946  1.00 63.45  ? 118 ILE D CA  1 
ATOM   6978  C C   . ILE D 1 120 ? -15.252 34.477  40.813  1.00 64.54  ? 118 ILE D C   1 
ATOM   6979  O O   . ILE D 1 120 ? -16.017 35.442  40.675  1.00 67.48  ? 118 ILE D O   1 
ATOM   6980  C CB  . ILE D 1 120 ? -16.781 32.758  41.666  1.00 60.60  ? 118 ILE D CB  1 
ATOM   6981  C CG1 . ILE D 1 120 ? -17.876 33.323  42.578  1.00 58.45  ? 118 ILE D CG1 1 
ATOM   6982  C CG2 . ILE D 1 120 ? -16.560 31.246  41.744  1.00 62.84  ? 118 ILE D CG2 1 
ATOM   6983  C CD1 . ILE D 1 120 ? -19.187 32.560  42.559  1.00 56.19  ? 118 ILE D CD1 1 
ATOM   6984  N N   . ARG D 1 121 ? -14.202 34.243  40.025  1.00 64.29  ? 119 ARG D N   1 
ATOM   6985  C CA  . ARG D 1 121 ? -13.863 35.102  38.899  1.00 61.55  ? 119 ARG D CA  1 
ATOM   6986  C C   . ARG D 1 121 ? -14.857 34.890  37.791  1.00 61.06  ? 119 ARG D C   1 
ATOM   6987  O O   . ARG D 1 121 ? -15.197 33.764  37.424  1.00 59.60  ? 119 ARG D O   1 
ATOM   6988  C CB  . ARG D 1 121 ? -12.463 34.802  38.394  1.00 59.68  ? 119 ARG D CB  1 
ATOM   6989  C CG  . ARG D 1 121 ? -12.013 35.695  37.257  1.00 61.32  ? 119 ARG D CG  1 
ATOM   6990  C CD  . ARG D 1 121 ? -10.508 35.570  37.069  1.00 58.71  ? 119 ARG D CD  1 
ATOM   6991  N NE  . ARG D 1 121 ? -10.034 36.383  35.962  1.00 63.78  ? 119 ARG D NE  1 
ATOM   6992  C CZ  . ARG D 1 121 ? -8.762  36.487  35.592  1.00 67.50  ? 119 ARG D CZ  1 
ATOM   6993  N NH1 . ARG D 1 121 ? -7.817  35.821  36.248  1.00 70.44  ? 119 ARG D NH1 1 
ATOM   6994  N NH2 . ARG D 1 121 ? -8.438  37.266  34.563  1.00 66.34  ? 119 ARG D NH2 1 
ATOM   6995  N N   . CYS D 1 122 ? -15.290 35.993  37.222  1.00 62.65  ? 120 CYS D N   1 
ATOM   6996  C CA  . CYS D 1 122 ? -16.301 35.918  36.212  1.00 63.77  ? 120 CYS D CA  1 
ATOM   6997  C C   . CYS D 1 122 ? -15.938 36.621  34.936  1.00 59.15  ? 120 CYS D C   1 
ATOM   6998  O O   . CYS D 1 122 ? -15.081 37.528  34.908  1.00 58.50  ? 120 CYS D O   1 
ATOM   6999  C CB  . CYS D 1 122 ? -17.577 36.484  36.807  1.00 66.62  ? 120 CYS D CB  1 
ATOM   7000  S SG  . CYS D 1 122 ? -18.427 37.776  35.843  1.00 82.58  ? 120 CYS D SG  1 
ATOM   7001  N N   . MET D 1 123 ? -16.608 36.173  33.883  1.00 56.64  ? 121 MET D N   1 
ATOM   7002  C CA  . MET D 1 123 ? -16.430 36.694  32.530  1.00 55.67  ? 121 MET D CA  1 
ATOM   7003  C C   . MET D 1 123 ? -17.683 36.530  31.642  1.00 53.52  ? 121 MET D C   1 
ATOM   7004  O O   . MET D 1 123 ? -18.050 35.408  31.273  1.00 50.86  ? 121 MET D O   1 
ATOM   7005  C CB  . MET D 1 123 ? -15.256 35.991  31.858  1.00 54.23  ? 121 MET D CB  1 
ATOM   7006  C CG  . MET D 1 123 ? -15.232 36.274  30.379  1.00 59.23  ? 121 MET D CG  1 
ATOM   7007  S SD  . MET D 1 123 ? -15.499 38.058  30.118  1.00 66.93  ? 121 MET D SD  1 
ATOM   7008  C CE  . MET D 1 123 ? -13.984 38.566  29.383  1.00 56.35  ? 121 MET D CE  1 
ATOM   7009  N N   . THR D 1 124 ? -18.331 37.643  31.308  1.00 49.39  ? 122 THR D N   1 
ATOM   7010  C CA  . THR D 1 124 ? -19.515 37.607  30.457  1.00 48.71  ? 122 THR D CA  1 
ATOM   7011  C C   . THR D 1 124 ? -19.257 38.511  29.272  1.00 51.14  ? 122 THR D C   1 
ATOM   7012  O O   . THR D 1 124 ? -18.129 38.594  28.782  1.00 54.28  ? 122 THR D O   1 
ATOM   7013  C CB  . THR D 1 124 ? -20.719 38.185  31.162  1.00 47.08  ? 122 THR D CB  1 
ATOM   7014  O OG1 . THR D 1 124 ? -20.249 38.882  32.323  1.00 48.35  ? 122 THR D OG1 1 
ATOM   7015  C CG2 . THR D 1 124 ? -21.761 37.106  31.491  1.00 37.64  ? 122 THR D CG2 1 
ATOM   7016  N N   . ASN D 1 125 ? -20.343 39.182  28.848  1.00 51.02  ? 123 ASN D N   1 
ATOM   7017  C CA  . ASN D 1 125 ? -20.437 40.159  27.738  1.00 45.89  ? 123 ASN D CA  1 
ATOM   7018  C C   . ASN D 1 125 ? -21.801 40.807  27.786  1.00 44.68  ? 123 ASN D C   1 
ATOM   7019  O O   . ASN D 1 125 ? -22.697 40.343  28.486  1.00 46.75  ? 123 ASN D O   1 
ATOM   7020  C CB  . ASN D 1 125 ? -20.300 39.517  26.354  1.00 44.14  ? 123 ASN D CB  1 
ATOM   7021  C CG  . ASN D 1 125 ? -20.945 38.141  26.276  1.00 42.59  ? 123 ASN D CG  1 
ATOM   7022  O OD1 . ASN D 1 125 ? -21.997 37.879  26.902  1.00 33.58  ? 123 ASN D OD1 1 
ATOM   7023  N ND2 . ASN D 1 125 ? -20.321 37.251  25.509  1.00 33.95  ? 123 ASN D ND2 1 
ATOM   7024  N N   . THR D 1 126 ? -21.977 41.869  27.024  1.00 42.71  ? 124 THR D N   1 
ATOM   7025  C CA  . THR D 1 126 ? -23.265 42.563  26.999  1.00 45.36  ? 124 THR D CA  1 
ATOM   7026  C C   . THR D 1 126 ? -24.486 41.711  26.645  1.00 47.05  ? 124 THR D C   1 
ATOM   7027  O O   . THR D 1 126 ? -25.527 41.872  27.261  1.00 44.22  ? 124 THR D O   1 
ATOM   7028  C CB  . THR D 1 126 ? -23.227 43.709  26.006  1.00 47.36  ? 124 THR D CB  1 
ATOM   7029  O OG1 . THR D 1 126 ? -21.972 43.667  25.299  1.00 51.48  ? 124 THR D OG1 1 
ATOM   7030  C CG2 . THR D 1 126 ? -23.429 45.033  26.726  1.00 46.72  ? 124 THR D CG2 1 
ATOM   7031  N N   . PRO D 1 127 ? -24.377 40.801  25.638  1.00 53.48  ? 125 PRO D N   1 
ATOM   7032  C CA  . PRO D 1 127 ? -25.477 39.910  25.182  1.00 55.38  ? 125 PRO D CA  1 
ATOM   7033  C C   . PRO D 1 127 ? -26.384 39.410  26.302  1.00 56.55  ? 125 PRO D C   1 
ATOM   7034  O O   . PRO D 1 127 ? -27.526 39.003  26.108  1.00 53.01  ? 125 PRO D O   1 
ATOM   7035  C CB  . PRO D 1 127 ? -24.738 38.791  24.486  1.00 55.25  ? 125 PRO D CB  1 
ATOM   7036  C CG  . PRO D 1 127 ? -23.636 39.545  23.813  1.00 55.25  ? 125 PRO D CG  1 
ATOM   7037  C CD  . PRO D 1 127 ? -23.145 40.533  24.861  1.00 54.20  ? 125 PRO D CD  1 
ATOM   7038  N N   . VAL D 1 128 ? -25.824 39.445  27.492  1.00 62.05  ? 126 VAL D N   1 
ATOM   7039  C CA  . VAL D 1 128 ? -26.519 39.088  28.697  1.00 63.39  ? 126 VAL D CA  1 
ATOM   7040  C C   . VAL D 1 128 ? -27.904 39.741  28.617  1.00 61.84  ? 126 VAL D C   1 
ATOM   7041  O O   . VAL D 1 128 ? -28.900 39.134  28.962  1.00 62.48  ? 126 VAL D O   1 
ATOM   7042  C CB  . VAL D 1 128 ? -25.712 39.656  29.923  1.00 63.82  ? 126 VAL D CB  1 
ATOM   7043  C CG1 . VAL D 1 128 ? -26.584 39.686  31.174  1.00 63.58  ? 126 VAL D CG1 1 
ATOM   7044  C CG2 . VAL D 1 128 ? -24.448 38.816  30.144  1.00 61.99  ? 126 VAL D CG2 1 
ATOM   7045  N N   . VAL D 1 129 ? -27.960 40.974  28.129  1.00 60.77  ? 127 VAL D N   1 
ATOM   7046  C CA  . VAL D 1 129 ? -29.221 41.703  28.080  1.00 62.52  ? 127 VAL D CA  1 
ATOM   7047  C C   . VAL D 1 129 ? -30.376 40.934  27.486  1.00 64.92  ? 127 VAL D C   1 
ATOM   7048  O O   . VAL D 1 129 ? -31.514 41.186  27.838  1.00 64.39  ? 127 VAL D O   1 
ATOM   7049  C CB  . VAL D 1 129 ? -29.087 43.038  27.348  1.00 58.83  ? 127 VAL D CB  1 
ATOM   7050  C CG1 . VAL D 1 129 ? -30.029 44.054  27.980  1.00 59.59  ? 127 VAL D CG1 1 
ATOM   7051  C CG2 . VAL D 1 129 ? -27.661 43.525  27.431  1.00 61.59  ? 127 VAL D CG2 1 
ATOM   7052  N N   . VAL D 1 130 ? -30.106 40.003  26.580  1.00 68.27  ? 128 VAL D N   1 
ATOM   7053  C CA  . VAL D 1 130 ? -31.198 39.205  26.026  1.00 70.15  ? 128 VAL D CA  1 
ATOM   7054  C C   . VAL D 1 130 ? -31.323 37.897  26.810  1.00 71.61  ? 128 VAL D C   1 
ATOM   7055  O O   . VAL D 1 130 ? -32.419 37.449  27.092  1.00 78.60  ? 128 VAL D O   1 
ATOM   7056  C CB  . VAL D 1 130 ? -30.992 38.839  24.552  1.00 69.36  ? 128 VAL D CB  1 
ATOM   7057  C CG1 . VAL D 1 130 ? -29.602 38.302  24.348  1.00 76.51  ? 128 VAL D CG1 1 
ATOM   7058  C CG2 . VAL D 1 130 ? -32.000 37.761  24.153  1.00 65.80  ? 128 VAL D CG2 1 
ATOM   7059  N N   . ARG D 1 131 ? -30.188 37.306  27.158  1.00 68.55  ? 129 ARG D N   1 
ATOM   7060  C CA  . ARG D 1 131 ? -30.086 36.063  27.903  1.00 66.33  ? 129 ARG D CA  1 
ATOM   7061  C C   . ARG D 1 131 ? -29.421 35.146  26.969  1.00 67.64  ? 129 ARG D C   1 
ATOM   7062  O O   . ARG D 1 131 ? -29.738 33.940  26.914  1.00 68.32  ? 129 ARG D O   1 
ATOM   7063  C CB  . ARG D 1 131 ? -31.419 35.462  28.302  1.00 68.79  ? 129 ARG D CB  1 
ATOM   7064  C CG  . ARG D 1 131 ? -32.016 36.104  29.525  1.00 74.47  ? 129 ARG D CG  1 
ATOM   7065  C CD  . ARG D 1 131 ? -32.814 35.104  30.287  1.00 75.96  ? 129 ARG D CD  1 
ATOM   7066  N NE  . ARG D 1 131 ? -34.235 35.330  30.172  1.00 76.00  ? 129 ARG D NE  1 
ATOM   7067  C CZ  . ARG D 1 131 ? -35.140 34.406  30.458  1.00 81.40  ? 129 ARG D CZ  1 
ATOM   7068  N NH1 . ARG D 1 131 ? -34.766 33.188  30.877  1.00 77.95  ? 129 ARG D NH1 1 
ATOM   7069  N NH2 . ARG D 1 131 ? -36.425 34.699  30.308  1.00 84.67  ? 129 ARG D NH2 1 
ATOM   7070  N N   . GLU D 1 132 ? -28.517 35.742  26.204  1.00 66.89  ? 130 GLU D N   1 
ATOM   7071  C CA  . GLU D 1 132 ? -27.729 34.986  25.268  1.00 72.98  ? 130 GLU D CA  1 
ATOM   7072  C C   . GLU D 1 132 ? -26.276 35.377  25.447  1.00 73.89  ? 130 GLU D C   1 
ATOM   7073  O O   . GLU D 1 132 ? -25.471 35.324  24.528  1.00 78.44  ? 130 GLU D O   1 
ATOM   7074  C CB  . GLU D 1 132 ? -28.224 35.202  23.846  1.00 73.47  ? 130 GLU D CB  1 
ATOM   7075  C CG  . GLU D 1 132 ? -29.552 34.498  23.582  1.00 72.49  ? 130 GLU D CG  1 
ATOM   7076  C CD  . GLU D 1 132 ? -29.573 33.064  24.076  1.00 69.22  ? 130 GLU D CD  1 
ATOM   7077  O OE1 . GLU D 1 132 ? -28.587 32.322  23.828  1.00 65.65  ? 130 GLU D OE1 1 
ATOM   7078  O OE2 . GLU D 1 132 ? -30.591 32.684  24.709  1.00 70.19  ? 130 GLU D OE2 1 
ATOM   7079  N N   . GLY D 1 133 ? -25.958 35.778  26.669  1.00 73.21  ? 131 GLY D N   1 
ATOM   7080  C CA  . GLY D 1 133 ? -24.594 36.117  26.991  1.00 71.20  ? 131 GLY D CA  1 
ATOM   7081  C C   . GLY D 1 133 ? -23.806 34.821  26.987  1.00 68.78  ? 131 GLY D C   1 
ATOM   7082  O O   . GLY D 1 133 ? -24.358 33.739  26.885  1.00 68.21  ? 131 GLY D O   1 
ATOM   7083  N N   . ALA D 1 134 ? -22.497 34.928  27.071  1.00 68.45  ? 132 ALA D N   1 
ATOM   7084  C CA  . ALA D 1 134 ? -21.654 33.750  27.083  1.00 67.61  ? 132 ALA D CA  1 
ATOM   7085  C C   . ALA D 1 134 ? -20.700 33.999  28.223  1.00 66.70  ? 132 ALA D C   1 
ATOM   7086  O O   . ALA D 1 134 ? -19.709 34.755  28.095  1.00 67.59  ? 132 ALA D O   1 
ATOM   7087  C CB  . ALA D 1 134 ? -20.898 33.630  25.766  1.00 68.68  ? 132 ALA D CB  1 
ATOM   7088  N N   . THR D 1 135 ? -21.005 33.382  29.354  1.00 61.41  ? 133 THR D N   1 
ATOM   7089  C CA  . THR D 1 135 ? -20.159 33.610  30.492  1.00 61.69  ? 133 THR D CA  1 
ATOM   7090  C C   . THR D 1 135 ? -19.456 32.393  31.065  1.00 64.91  ? 133 THR D C   1 
ATOM   7091  O O   . THR D 1 135 ? -19.960 31.267  31.001  1.00 69.06  ? 133 THR D O   1 
ATOM   7092  C CB  . THR D 1 135 ? -20.928 34.330  31.571  1.00 56.58  ? 133 THR D CB  1 
ATOM   7093  O OG1 . THR D 1 135 ? -20.080 34.464  32.707  1.00 54.10  ? 133 THR D OG1 1 
ATOM   7094  C CG2 . THR D 1 135 ? -22.200 33.604  31.923  1.00 47.92  ? 133 THR D CG2 1 
ATOM   7095  N N   . VAL D 1 136 ? -18.266 32.638  31.608  1.00 65.21  ? 134 VAL D N   1 
ATOM   7096  C CA  . VAL D 1 136 ? -17.439 31.587  32.185  1.00 63.69  ? 134 VAL D CA  1 
ATOM   7097  C C   . VAL D 1 136 ? -16.923 32.042  33.569  1.00 69.25  ? 134 VAL D C   1 
ATOM   7098  O O   . VAL D 1 136 ? -16.606 33.234  33.795  1.00 68.13  ? 134 VAL D O   1 
ATOM   7099  C CB  . VAL D 1 136 ? -16.269 31.258  31.244  1.00 59.49  ? 134 VAL D CB  1 
ATOM   7100  C CG1 . VAL D 1 136 ? -15.239 32.358  31.287  1.00 58.21  ? 134 VAL D CG1 1 
ATOM   7101  C CG2 . VAL D 1 136 ? -15.673 29.963  31.608  1.00 57.08  ? 134 VAL D CG2 1 
ATOM   7102  N N   . TYR D 1 137 ? -16.870 31.100  34.512  1.00 72.43  ? 135 TYR D N   1 
ATOM   7103  C CA  . TYR D 1 137 ? -16.426 31.433  35.868  1.00 72.65  ? 135 TYR D CA  1 
ATOM   7104  C C   . TYR D 1 137 ? -15.343 30.523  36.405  1.00 74.58  ? 135 TYR D C   1 
ATOM   7105  O O   . TYR D 1 137 ? -15.258 29.334  36.061  1.00 72.81  ? 135 TYR D O   1 
ATOM   7106  C CB  . TYR D 1 137 ? -17.603 31.432  36.850  1.00 68.55  ? 135 TYR D CB  1 
ATOM   7107  C CG  . TYR D 1 137 ? -18.227 30.087  37.072  1.00 66.87  ? 135 TYR D CG  1 
ATOM   7108  C CD1 . TYR D 1 137 ? -17.520 29.056  37.694  1.00 70.64  ? 135 TYR D CD1 1 
ATOM   7109  C CD2 . TYR D 1 137 ? -19.521 29.835  36.659  1.00 63.86  ? 135 TYR D CD2 1 
ATOM   7110  C CE1 . TYR D 1 137 ? -18.101 27.800  37.896  1.00 69.25  ? 135 TYR D CE1 1 
ATOM   7111  C CE2 . TYR D 1 137 ? -20.113 28.580  36.853  1.00 65.73  ? 135 TYR D CE2 1 
ATOM   7112  C CZ  . TYR D 1 137 ? -19.404 27.567  37.469  1.00 67.03  ? 135 TYR D CZ  1 
ATOM   7113  O OH  . TYR D 1 137 ? -20.004 26.334  37.650  1.00 67.08  ? 135 TYR D OH  1 
ATOM   7114  N N   . ALA D 1 138 ? -14.521 31.115  37.259  1.00 76.35  ? 136 ALA D N   1 
ATOM   7115  C CA  . ALA D 1 138 ? -13.440 30.410  37.895  1.00 78.60  ? 136 ALA D CA  1 
ATOM   7116  C C   . ALA D 1 138 ? -13.729 30.443  39.386  1.00 81.70  ? 136 ALA D C   1 
ATOM   7117  O O   . ALA D 1 138 ? -13.912 31.505  39.986  1.00 84.39  ? 136 ALA D O   1 
ATOM   7118  C CB  . ALA D 1 138 ? -12.141 31.089  37.594  1.00 78.26  ? 136 ALA D CB  1 
ATOM   7119  N N   . THR D 1 139 ? -13.769 29.263  39.981  1.00 82.30  ? 137 THR D N   1 
ATOM   7120  C CA  . THR D 1 139 ? -14.055 29.130  41.392  1.00 79.85  ? 137 THR D CA  1 
ATOM   7121  C C   . THR D 1 139 ? -12.848 29.505  42.260  1.00 82.15  ? 137 THR D C   1 
ATOM   7122  O O   . THR D 1 139 ? -11.743 28.971  42.065  1.00 86.42  ? 137 THR D O   1 
ATOM   7123  C CB  . THR D 1 139 ? -14.466 27.706  41.670  1.00 77.85  ? 137 THR D CB  1 
ATOM   7124  O OG1 . THR D 1 139 ? -15.074 27.658  42.951  1.00 79.21  ? 137 THR D OG1 1 
ATOM   7125  C CG2 . THR D 1 139 ? -13.250 26.753  41.629  1.00 81.37  ? 137 THR D CG2 1 
ATOM   7126  N N   . GLY D 1 140 ? -13.059 30.410  43.219  1.00 80.94  ? 138 GLY D N   1 
ATOM   7127  C CA  . GLY D 1 140 ? -11.978 30.852  44.092  1.00 80.53  ? 138 GLY D CA  1 
ATOM   7128  C C   . GLY D 1 140 ? -11.387 29.823  45.046  1.00 81.61  ? 138 GLY D C   1 
ATOM   7129  O O   . GLY D 1 140 ? -11.672 28.632  44.966  1.00 83.23  ? 138 GLY D O   1 
ATOM   7130  N N   . THR D 1 141 ? -10.543 30.284  45.961  1.00 82.34  ? 139 THR D N   1 
ATOM   7131  C CA  . THR D 1 141 ? -9.905  29.382  46.923  1.00 84.64  ? 139 THR D CA  1 
ATOM   7132  C C   . THR D 1 141 ? -10.852 28.986  48.066  1.00 84.67  ? 139 THR D C   1 
ATOM   7133  O O   . THR D 1 141 ? -10.910 27.831  48.465  1.00 82.25  ? 139 THR D O   1 
ATOM   7134  C CB  . THR D 1 141 ? -8.615  30.017  47.527  1.00 86.61  ? 139 THR D CB  1 
ATOM   7135  O OG1 . THR D 1 141 ? -7.813  30.564  46.472  1.00 89.25  ? 139 THR D OG1 1 
ATOM   7136  C CG2 . THR D 1 141 ? -7.781  28.954  48.279  1.00 86.40  ? 139 THR D CG2 1 
ATOM   7137  N N   . HIS D 1 142 ? -11.603 29.944  48.584  1.00 86.07  ? 140 HIS D N   1 
ATOM   7138  C CA  . HIS D 1 142 ? -12.518 29.667  49.676  1.00 87.53  ? 140 HIS D CA  1 
ATOM   7139  C C   . HIS D 1 142 ? -13.933 29.657  49.180  1.00 90.92  ? 140 HIS D C   1 
ATOM   7140  O O   . HIS D 1 142 ? -14.779 30.437  49.633  1.00 93.16  ? 140 HIS D O   1 
ATOM   7141  C CB  . HIS D 1 142 ? -12.386 30.726  50.755  1.00 87.01  ? 140 HIS D CB  1 
ATOM   7142  C CG  . HIS D 1 142 ? -10.979 31.158  50.994  1.00 87.60  ? 140 HIS D CG  1 
ATOM   7143  N ND1 . HIS D 1 142 ? -9.981  30.275  51.343  1.00 89.05  ? 140 HIS D ND1 1 
ATOM   7144  C CD2 . HIS D 1 142 ? -10.402 32.381  50.954  1.00 89.34  ? 140 HIS D CD2 1 
ATOM   7145  C CE1 . HIS D 1 142 ? -8.850  30.934  51.511  1.00 89.24  ? 140 HIS D CE1 1 
ATOM   7146  N NE2 . HIS D 1 142 ? -9.078  32.214  51.282  1.00 92.28  ? 140 HIS D NE2 1 
ATOM   7147  N N   . ALA D 1 143 ? -14.200 28.780  48.233  1.00 92.92  ? 141 ALA D N   1 
ATOM   7148  C CA  . ALA D 1 143 ? -15.540 28.703  47.701  1.00 94.11  ? 141 ALA D CA  1 
ATOM   7149  C C   . ALA D 1 143 ? -16.004 27.264  47.825  1.00 95.30  ? 141 ALA D C   1 
ATOM   7150  O O   . ALA D 1 143 ? -15.365 26.347  47.303  1.00 93.98  ? 141 ALA D O   1 
ATOM   7151  C CB  . ALA D 1 143 ? -15.540 29.149  46.262  1.00 95.10  ? 141 ALA D CB  1 
ATOM   7152  N N   . GLN D 1 144 ? -17.108 27.082  48.545  1.00 97.34  ? 142 GLN D N   1 
ATOM   7153  C CA  . GLN D 1 144 ? -17.704 25.771  48.767  1.00 102.02 ? 142 GLN D CA  1 
ATOM   7154  C C   . GLN D 1 144 ? -18.320 25.275  47.465  1.00 103.72 ? 142 GLN D C   1 
ATOM   7155  O O   . GLN D 1 144 ? -18.084 25.840  46.405  1.00 103.78 ? 142 GLN D O   1 
ATOM   7156  C CB  . GLN D 1 144 ? -18.810 25.867  49.803  1.00 101.63 ? 142 GLN D CB  1 
ATOM   7157  C CG  . GLN D 1 144 ? -18.519 26.812  50.907  1.00 103.34 ? 142 GLN D CG  1 
ATOM   7158  C CD  . GLN D 1 144 ? -19.782 27.464  51.398  1.00 108.60 ? 142 GLN D CD  1 
ATOM   7159  O OE1 . GLN D 1 144 ? -19.754 28.347  52.258  1.00 111.65 ? 142 GLN D OE1 1 
ATOM   7160  N NE2 . GLN D 1 144 ? -20.914 27.036  50.844  1.00 109.66 ? 142 GLN D NE2 1 
ATOM   7161  N N   . VAL D 1 145 ? -19.126 24.226  47.553  1.00 104.92 ? 143 VAL D N   1 
ATOM   7162  C CA  . VAL D 1 145 ? -19.767 23.683  46.371  1.00 105.12 ? 143 VAL D CA  1 
ATOM   7163  C C   . VAL D 1 145 ? -20.999 24.493  46.014  1.00 103.92 ? 143 VAL D C   1 
ATOM   7164  O O   . VAL D 1 145 ? -21.000 25.206  45.024  1.00 102.62 ? 143 VAL D O   1 
ATOM   7165  C CB  . VAL D 1 145 ? -20.161 22.207  46.578  1.00 107.52 ? 143 VAL D CB  1 
ATOM   7166  C CG1 . VAL D 1 145 ? -21.011 21.708  45.385  1.00 107.33 ? 143 VAL D CG1 1 
ATOM   7167  C CG2 . VAL D 1 145 ? -18.902 21.366  46.756  1.00 105.78 ? 143 VAL D CG2 1 
ATOM   7168  N N   . GLU D 1 146 ? -22.040 24.392  46.831  1.00 105.11 ? 144 GLU D N   1 
ATOM   7169  C CA  . GLU D 1 146 ? -23.281 25.122  46.565  1.00 107.23 ? 144 GLU D CA  1 
ATOM   7170  C C   . GLU D 1 146 ? -22.963 26.616  46.436  1.00 102.64 ? 144 GLU D C   1 
ATOM   7171  O O   . GLU D 1 146 ? -23.829 27.436  46.109  1.00 102.07 ? 144 GLU D O   1 
ATOM   7172  C CB  . GLU D 1 146 ? -24.307 24.879  47.695  1.00 114.87 ? 144 GLU D CB  1 
ATOM   7173  C CG  . GLU D 1 146 ? -25.746 24.455  47.245  1.00 121.37 ? 144 GLU D CG  1 
ATOM   7174  C CD  . GLU D 1 146 ? -26.572 25.585  46.610  1.00 125.11 ? 144 GLU D CD  1 
ATOM   7175  O OE1 . GLU D 1 146 ? -26.217 26.048  45.503  1.00 126.39 ? 144 GLU D OE1 1 
ATOM   7176  O OE2 . GLU D 1 146 ? -27.585 26.007  47.219  1.00 127.36 ? 144 GLU D OE2 1 
ATOM   7177  N N   . ASP D 1 147 ? -21.707 26.951  46.695  1.00 97.41  ? 145 ASP D N   1 
ATOM   7178  C CA  . ASP D 1 147 ? -21.223 28.322  46.610  1.00 94.40  ? 145 ASP D CA  1 
ATOM   7179  C C   . ASP D 1 147 ? -21.209 28.653  45.102  1.00 92.16  ? 145 ASP D C   1 
ATOM   7180  O O   . ASP D 1 147 ? -21.795 29.639  44.638  1.00 89.53  ? 145 ASP D O   1 
ATOM   7181  C CB  . ASP D 1 147 ? -19.796 28.355  47.200  1.00 93.29  ? 145 ASP D CB  1 
ATOM   7182  C CG  . ASP D 1 147 ? -19.524 29.560  48.116  1.00 88.41  ? 145 ASP D CG  1 
ATOM   7183  O OD1 . ASP D 1 147 ? -20.475 30.099  48.735  1.00 82.82  ? 145 ASP D OD1 1 
ATOM   7184  O OD2 . ASP D 1 147 ? -18.322 29.930  48.230  1.00 85.98  ? 145 ASP D OD2 1 
ATOM   7185  N N   . GLY D 1 148 ? -20.536 27.795  44.343  1.00 90.49  ? 146 GLY D N   1 
ATOM   7186  C CA  . GLY D 1 148 ? -20.438 27.988  42.912  1.00 89.36  ? 146 GLY D CA  1 
ATOM   7187  C C   . GLY D 1 148 ? -21.719 27.619  42.206  1.00 90.75  ? 146 GLY D C   1 
ATOM   7188  O O   . GLY D 1 148 ? -22.191 28.376  41.371  1.00 90.93  ? 146 GLY D O   1 
ATOM   7189  N N   . ARG D 1 149 ? -22.276 26.454  42.528  1.00 92.43  ? 147 ARG D N   1 
ATOM   7190  C CA  . ARG D 1 149 ? -23.517 26.004  41.908  1.00 93.88  ? 147 ARG D CA  1 
ATOM   7191  C C   . ARG D 1 149 ? -24.533 27.128  41.862  1.00 90.88  ? 147 ARG D C   1 
ATOM   7192  O O   . ARG D 1 149 ? -25.325 27.212  40.923  1.00 90.87  ? 147 ARG D O   1 
ATOM   7193  C CB  . ARG D 1 149 ? -24.117 24.822  42.664  1.00 100.05 ? 147 ARG D CB  1 
ATOM   7194  C CG  . ARG D 1 149 ? -23.302 23.547  42.613  1.00 108.77 ? 147 ARG D CG  1 
ATOM   7195  C CD  . ARG D 1 149 ? -24.066 22.475  43.354  1.00 119.13 ? 147 ARG D CD  1 
ATOM   7196  N NE  . ARG D 1 149 ? -23.480 21.144  43.236  1.00 126.14 ? 147 ARG D NE  1 
ATOM   7197  C CZ  . ARG D 1 149 ? -24.191 20.020  43.303  1.00 130.10 ? 147 ARG D CZ  1 
ATOM   7198  N NH1 . ARG D 1 149 ? -25.511 20.061  43.486  1.00 130.09 ? 147 ARG D NH1 1 
ATOM   7199  N NH2 . ARG D 1 149 ? -23.585 18.852  43.168  1.00 132.78 ? 147 ARG D NH2 1 
ATOM   7200  N N   . LEU D 1 150 ? -24.510 27.992  42.868  1.00 87.24  ? 148 LEU D N   1 
ATOM   7201  C CA  . LEU D 1 150 ? -25.432 29.111  42.893  1.00 86.61  ? 148 LEU D CA  1 
ATOM   7202  C C   . LEU D 1 150 ? -24.988 30.135  41.851  1.00 83.94  ? 148 LEU D C   1 
ATOM   7203  O O   . LEU D 1 150 ? -25.788 30.850  41.259  1.00 79.35  ? 148 LEU D O   1 
ATOM   7204  C CB  . LEU D 1 150 ? -25.454 29.748  44.276  1.00 90.06  ? 148 LEU D CB  1 
ATOM   7205  C CG  . LEU D 1 150 ? -25.997 31.181  44.313  1.00 92.49  ? 148 LEU D CG  1 
ATOM   7206  C CD1 . LEU D 1 150 ? -27.376 31.256  43.713  1.00 94.34  ? 148 LEU D CD1 1 
ATOM   7207  C CD2 . LEU D 1 150 ? -26.040 31.642  45.731  1.00 93.95  ? 148 LEU D CD2 1 
ATOM   7208  N N   . MET D 1 151 ? -23.694 30.208  41.633  1.00 82.64  ? 149 MET D N   1 
ATOM   7209  C CA  . MET D 1 151 ? -23.167 31.121  40.649  1.00 83.78  ? 149 MET D CA  1 
ATOM   7210  C C   . MET D 1 151 ? -23.605 30.724  39.207  1.00 82.54  ? 149 MET D C   1 
ATOM   7211  O O   . MET D 1 151 ? -24.140 31.537  38.431  1.00 78.25  ? 149 MET D O   1 
ATOM   7212  C CB  . MET D 1 151 ? -21.651 31.107  40.792  1.00 88.64  ? 149 MET D CB  1 
ATOM   7213  C CG  . MET D 1 151 ? -20.940 31.556  39.561  1.00 96.77  ? 149 MET D CG  1 
ATOM   7214  S SD  . MET D 1 151 ? -21.291 33.265  39.306  1.00 103.84 ? 149 MET D SD  1 
ATOM   7215  C CE  . MET D 1 151 ? -19.667 33.755  38.613  1.00 105.26 ? 149 MET D CE  1 
ATOM   7216  N N   . GLU D 1 152 ? -23.369 29.462  38.856  1.00 81.32  ? 150 GLU D N   1 
ATOM   7217  C CA  . GLU D 1 152 ? -23.722 28.982  37.539  1.00 76.83  ? 150 GLU D CA  1 
ATOM   7218  C C   . GLU D 1 152 ? -25.209 28.939  37.338  1.00 74.40  ? 150 GLU D C   1 
ATOM   7219  O O   . GLU D 1 152 ? -25.660 28.606  36.272  1.00 76.63  ? 150 GLU D O   1 
ATOM   7220  C CB  . GLU D 1 152 ? -23.182 27.587  37.297  1.00 75.96  ? 150 GLU D CB  1 
ATOM   7221  C CG  . GLU D 1 152 ? -23.140 27.310  35.818  1.00 80.72  ? 150 GLU D CG  1 
ATOM   7222  C CD  . GLU D 1 152 ? -23.127 25.854  35.472  1.00 82.93  ? 150 GLU D CD  1 
ATOM   7223  O OE1 . GLU D 1 152 ? -24.192 25.215  35.611  1.00 85.47  ? 150 GLU D OE1 1 
ATOM   7224  O OE2 . GLU D 1 152 ? -22.061 25.350  35.054  1.00 84.50  ? 150 GLU D OE2 1 
ATOM   7225  N N   . GLN D 1 153 ? -25.978 29.248  38.365  1.00 74.45  ? 151 GLN D N   1 
ATOM   7226  C CA  . GLN D 1 153 ? -27.428 29.224  38.237  1.00 76.01  ? 151 GLN D CA  1 
ATOM   7227  C C   . GLN D 1 153 ? -27.872 30.593  37.882  1.00 73.02  ? 151 GLN D C   1 
ATOM   7228  O O   . GLN D 1 153 ? -28.957 30.774  37.373  1.00 74.30  ? 151 GLN D O   1 
ATOM   7229  C CB  . GLN D 1 153 ? -28.143 28.864  39.549  1.00 84.88  ? 151 GLN D CB  1 
ATOM   7230  C CG  . GLN D 1 153 ? -28.300 27.365  39.916  1.00 96.80  ? 151 GLN D CG  1 
ATOM   7231  C CD  . GLN D 1 153 ? -29.117 27.127  41.226  1.00 102.17 ? 151 GLN D CD  1 
ATOM   7232  O OE1 . GLN D 1 153 ? -30.332 27.393  41.280  1.00 101.08 ? 151 GLN D OE1 1 
ATOM   7233  N NE2 . GLN D 1 153 ? -28.440 26.625  42.278  1.00 102.73 ? 151 GLN D NE2 1 
ATOM   7234  N N   . LEU D 1 154 ? -27.042 31.576  38.171  1.00 70.23  ? 152 LEU D N   1 
ATOM   7235  C CA  . LEU D 1 154 ? -27.426 32.944  37.880  1.00 70.72  ? 152 LEU D CA  1 
ATOM   7236  C C   . LEU D 1 154 ? -27.166 33.264  36.441  1.00 72.30  ? 152 LEU D C   1 
ATOM   7237  O O   . LEU D 1 154 ? -28.050 33.728  35.709  1.00 71.02  ? 152 LEU D O   1 
ATOM   7238  C CB  . LEU D 1 154 ? -26.602 33.929  38.696  1.00 70.22  ? 152 LEU D CB  1 
ATOM   7239  C CG  . LEU D 1 154 ? -26.938 34.174  40.144  1.00 67.34  ? 152 LEU D CG  1 
ATOM   7240  C CD1 . LEU D 1 154 ? -25.875 35.073  40.763  1.00 69.08  ? 152 LEU D CD1 1 
ATOM   7241  C CD2 . LEU D 1 154 ? -28.306 34.783  40.211  1.00 62.09  ? 152 LEU D CD2 1 
ATOM   7242  N N   . LEU D 1 155 ? -25.927 33.013  36.052  1.00 72.91  ? 153 LEU D N   1 
ATOM   7243  C CA  . LEU D 1 155 ? -25.519 33.345  34.727  1.00 73.87  ? 153 LEU D CA  1 
ATOM   7244  C C   . LEU D 1 155 ? -25.987 32.371  33.660  1.00 72.93  ? 153 LEU D C   1 
ATOM   7245  O O   . LEU D 1 155 ? -25.583 32.428  32.490  1.00 76.42  ? 153 LEU D O   1 
ATOM   7246  C CB  . LEU D 1 155 ? -24.014 33.562  34.733  1.00 73.61  ? 153 LEU D CB  1 
ATOM   7247  C CG  . LEU D 1 155 ? -23.570 34.706  35.670  1.00 70.14  ? 153 LEU D CG  1 
ATOM   7248  C CD1 . LEU D 1 155 ? -22.513 35.512  34.949  1.00 73.23  ? 153 LEU D CD1 1 
ATOM   7249  C CD2 . LEU D 1 155 ? -24.695 35.645  36.038  1.00 65.82  ? 153 LEU D CD2 1 
ATOM   7250  N N   . SER D 1 156 ? -26.885 31.493  34.058  1.00 69.21  ? 154 SER D N   1 
ATOM   7251  C CA  . SER D 1 156 ? -27.410 30.550  33.124  1.00 69.39  ? 154 SER D CA  1 
ATOM   7252  C C   . SER D 1 156 ? -28.792 31.034  32.804  1.00 70.69  ? 154 SER D C   1 
ATOM   7253  O O   . SER D 1 156 ? -29.297 30.818  31.712  1.00 75.83  ? 154 SER D O   1 
ATOM   7254  C CB  . SER D 1 156 ? -27.435 29.184  33.764  1.00 65.78  ? 154 SER D CB  1 
ATOM   7255  O OG  . SER D 1 156 ? -26.114 28.771  34.003  1.00 70.19  ? 154 SER D OG  1 
ATOM   7256  N N   . SER D 1 157 ? -29.384 31.736  33.762  1.00 69.32  ? 155 SER D N   1 
ATOM   7257  C CA  . SER D 1 157 ? -30.734 32.268  33.601  1.00 69.90  ? 155 SER D CA  1 
ATOM   7258  C C   . SER D 1 157 ? -30.662 33.384  32.596  1.00 72.35  ? 155 SER D C   1 
ATOM   7259  O O   . SER D 1 157 ? -31.676 33.965  32.214  1.00 75.84  ? 155 SER D O   1 
ATOM   7260  C CB  . SER D 1 157 ? -31.278 32.829  34.917  1.00 66.48  ? 155 SER D CB  1 
ATOM   7261  O OG  . SER D 1 157 ? -30.568 33.987  35.300  1.00 57.19  ? 155 SER D OG  1 
ATOM   7262  N N   . VAL D 1 158 ? -29.444 33.678  32.171  1.00 71.62  ? 156 VAL D N   1 
ATOM   7263  C CA  . VAL D 1 158 ? -29.226 34.738  31.215  1.00 71.83  ? 156 VAL D CA  1 
ATOM   7264  C C   . VAL D 1 158 ? -28.061 34.386  30.317  1.00 71.48  ? 156 VAL D C   1 
ATOM   7265  O O   . VAL D 1 158 ? -27.060 35.086  30.250  1.00 76.10  ? 156 VAL D O   1 
ATOM   7266  C CB  . VAL D 1 158 ? -28.974 36.077  31.937  1.00 70.79  ? 156 VAL D CB  1 
ATOM   7267  C CG1 . VAL D 1 158 ? -28.699 37.169  30.930  1.00 76.94  ? 156 VAL D CG1 1 
ATOM   7268  C CG2 . VAL D 1 158 ? -30.199 36.457  32.745  1.00 73.44  ? 156 VAL D CG2 1 
ATOM   7269  N N   . GLY D 1 159 ? -28.186 33.277  29.619  1.00 69.10  ? 157 GLY D N   1 
ATOM   7270  C CA  . GLY D 1 159 ? -27.120 32.904  28.735  1.00 66.18  ? 157 GLY D CA  1 
ATOM   7271  C C   . GLY D 1 159 ? -26.420 31.618  29.057  1.00 66.71  ? 157 GLY D C   1 
ATOM   7272  O O   . GLY D 1 159 ? -26.952 30.679  29.633  1.00 67.47  ? 157 GLY D O   1 
ATOM   7273  N N   . PHE D 1 160 ? -25.174 31.601  28.645  1.00 66.06  ? 158 PHE D N   1 
ATOM   7274  C CA  . PHE D 1 160 ? -24.326 30.455  28.816  1.00 64.30  ? 158 PHE D CA  1 
ATOM   7275  C C   . PHE D 1 160 ? -23.415 30.612  30.025  1.00 66.82  ? 158 PHE D C   1 
ATOM   7276  O O   . PHE D 1 160 ? -22.931 31.719  30.320  1.00 66.93  ? 158 PHE D O   1 
ATOM   7277  C CB  . PHE D 1 160 ? -23.492 30.272  27.550  1.00 59.05  ? 158 PHE D CB  1 
ATOM   7278  C CG  . PHE D 1 160 ? -22.635 29.043  27.553  1.00 47.54  ? 158 PHE D CG  1 
ATOM   7279  C CD1 . PHE D 1 160 ? -23.206 27.777  27.369  1.00 42.10  ? 158 PHE D CD1 1 
ATOM   7280  C CD2 . PHE D 1 160 ? -21.246 29.159  27.700  1.00 37.25  ? 158 PHE D CD2 1 
ATOM   7281  C CE1 . PHE D 1 160 ? -22.397 26.640  27.328  1.00 43.77  ? 158 PHE D CE1 1 
ATOM   7282  C CE2 . PHE D 1 160 ? -20.433 28.052  27.662  1.00 37.69  ? 158 PHE D CE2 1 
ATOM   7283  C CZ  . PHE D 1 160 ? -20.999 26.775  27.478  1.00 39.22  ? 158 PHE D CZ  1 
ATOM   7284  N N   . CYS D 1 161 ? -23.165 29.481  30.692  1.00 65.83  ? 159 CYS D N   1 
ATOM   7285  C CA  . CYS D 1 161 ? -22.340 29.432  31.885  1.00 61.15  ? 159 CYS D CA  1 
ATOM   7286  C C   . CYS D 1 161 ? -21.664 28.112  32.104  1.00 57.89  ? 159 CYS D C   1 
ATOM   7287  O O   . CYS D 1 161 ? -22.278 27.069  32.004  1.00 56.84  ? 159 CYS D O   1 
ATOM   7288  C CB  . CYS D 1 161 ? -23.206 29.738  33.091  1.00 64.96  ? 159 CYS D CB  1 
ATOM   7289  S SG  . CYS D 1 161 ? -22.373 30.838  34.166  1.00 66.33  ? 159 CYS D SG  1 
ATOM   7290  N N   . THR D 1 162 ? -20.386 28.177  32.418  1.00 60.52  ? 160 THR D N   1 
ATOM   7291  C CA  . THR D 1 162 ? -19.612 26.987  32.714  1.00 67.30  ? 160 THR D CA  1 
ATOM   7292  C C   . THR D 1 162 ? -18.380 27.338  33.546  1.00 68.93  ? 160 THR D C   1 
ATOM   7293  O O   . THR D 1 162 ? -17.866 28.450  33.492  1.00 66.84  ? 160 THR D O   1 
ATOM   7294  C CB  . THR D 1 162 ? -19.125 26.271  31.448  1.00 68.23  ? 160 THR D CB  1 
ATOM   7295  O OG1 . THR D 1 162 ? -18.419 25.065  31.805  1.00 72.51  ? 160 THR D OG1 1 
ATOM   7296  C CG2 . THR D 1 162 ? -18.177 27.179  30.677  1.00 73.51  ? 160 THR D CG2 1 
ATOM   7297  N N   . GLU D 1 163 ? -17.907 26.375  34.326  1.00 74.22  ? 161 GLU D N   1 
ATOM   7298  C CA  . GLU D 1 163 ? -16.737 26.604  35.152  1.00 77.64  ? 161 GLU D CA  1 
ATOM   7299  C C   . GLU D 1 163 ? -15.520 26.391  34.289  1.00 78.51  ? 161 GLU D C   1 
ATOM   7300  O O   . GLU D 1 163 ? -15.508 25.525  33.402  1.00 81.00  ? 161 GLU D O   1 
ATOM   7301  C CB  . GLU D 1 163 ? -16.689 25.642  36.336  1.00 79.07  ? 161 GLU D CB  1 
ATOM   7302  C CG  . GLU D 1 163 ? -15.490 25.902  37.209  1.00 80.38  ? 161 GLU D CG  1 
ATOM   7303  C CD  . GLU D 1 163 ? -15.599 25.202  38.531  1.00 83.30  ? 161 GLU D CD  1 
ATOM   7304  O OE1 . GLU D 1 163 ? -14.580 25.204  39.261  1.00 85.62  ? 161 GLU D OE1 1 
ATOM   7305  O OE2 . GLU D 1 163 ? -16.698 24.659  38.834  1.00 83.08  ? 161 GLU D OE2 1 
ATOM   7306  N N   . VAL D 1 164 ? -14.496 27.189  34.547  1.00 78.50  ? 162 VAL D N   1 
ATOM   7307  C CA  . VAL D 1 164 ? -13.264 27.096  33.791  1.00 78.47  ? 162 VAL D CA  1 
ATOM   7308  C C   . VAL D 1 164 ? -12.103 27.414  34.700  1.00 79.55  ? 162 VAL D C   1 
ATOM   7309  O O   . VAL D 1 164 ? -12.239 28.172  35.656  1.00 82.22  ? 162 VAL D O   1 
ATOM   7310  C CB  . VAL D 1 164 ? -13.283 28.080  32.594  1.00 78.23  ? 162 VAL D CB  1 
ATOM   7311  C CG1 . VAL D 1 164 ? -11.869 28.472  32.180  1.00 77.08  ? 162 VAL D CG1 1 
ATOM   7312  C CG2 . VAL D 1 164 ? -14.004 27.433  31.431  1.00 74.83  ? 162 VAL D CG2 1 
ATOM   7313  N N   . GLU D 1 165 ? -10.965 26.812  34.413  1.00 80.52  ? 163 GLU D N   1 
ATOM   7314  C CA  . GLU D 1 165 ? -9.794  27.076  35.201  1.00 83.43  ? 163 GLU D CA  1 
ATOM   7315  C C   . GLU D 1 165 ? -9.265  28.459  34.837  1.00 77.51  ? 163 GLU D C   1 
ATOM   7316  O O   . GLU D 1 165 ? -8.809  28.696  33.735  1.00 76.90  ? 163 GLU D O   1 
ATOM   7317  C CB  . GLU D 1 165 ? -8.747  26.002  34.940  1.00 93.82  ? 163 GLU D CB  1 
ATOM   7318  C CG  . GLU D 1 165 ? -8.610  24.982  36.072  1.00 106.08 ? 163 GLU D CG  1 
ATOM   7319  C CD  . GLU D 1 165 ? -7.802  23.756  35.652  1.00 115.28 ? 163 GLU D CD  1 
ATOM   7320  O OE1 . GLU D 1 165 ? -6.792  23.929  34.916  1.00 119.10 ? 163 GLU D OE1 1 
ATOM   7321  O OE2 . GLU D 1 165 ? -8.167  22.616  36.061  1.00 119.05 ? 163 GLU D OE2 1 
ATOM   7322  N N   . GLU D 1 166 ? -9.342  29.367  35.793  1.00 73.86  ? 164 GLU D N   1 
ATOM   7323  C CA  . GLU D 1 166 ? -8.898  30.731  35.622  1.00 70.47  ? 164 GLU D CA  1 
ATOM   7324  C C   . GLU D 1 166 ? -7.879  30.996  34.517  1.00 68.07  ? 164 GLU D C   1 
ATOM   7325  O O   . GLU D 1 166 ? -8.072  31.913  33.712  1.00 67.39  ? 164 GLU D O   1 
ATOM   7326  C CB  . GLU D 1 166 ? -8.354  31.257  36.957  1.00 72.51  ? 164 GLU D CB  1 
ATOM   7327  C CG  . GLU D 1 166 ? -8.019  32.753  36.933  1.00 73.63  ? 164 GLU D CG  1 
ATOM   7328  C CD  . GLU D 1 166 ? -8.036  33.394  38.307  1.00 71.92  ? 164 GLU D CD  1 
ATOM   7329  O OE1 . GLU D 1 166 ? -9.079  33.333  38.987  1.00 70.27  ? 164 GLU D OE1 1 
ATOM   7330  O OE2 . GLU D 1 166 ? -7.011  33.973  38.712  1.00 74.44  ? 164 GLU D OE2 1 
ATOM   7331  N N   . ASP D 1 167 ? -6.787  30.234  34.464  1.00 66.64  ? 165 ASP D N   1 
ATOM   7332  C CA  . ASP D 1 167 ? -5.780  30.518  33.424  1.00 66.93  ? 165 ASP D CA  1 
ATOM   7333  C C   . ASP D 1 167 ? -6.378  30.712  32.028  1.00 63.29  ? 165 ASP D C   1 
ATOM   7334  O O   . ASP D 1 167 ? -5.811  31.425  31.183  1.00 62.47  ? 165 ASP D O   1 
ATOM   7335  C CB  . ASP D 1 167 ? -4.615  29.479  33.402  1.00 71.27  ? 165 ASP D CB  1 
ATOM   7336  C CG  . ASP D 1 167 ? -5.077  28.005  33.505  1.00 74.34  ? 165 ASP D CG  1 
ATOM   7337  O OD1 . ASP D 1 167 ? -4.205  27.110  33.317  1.00 70.77  ? 165 ASP D OD1 1 
ATOM   7338  O OD2 . ASP D 1 167 ? -6.277  27.736  33.781  1.00 75.05  ? 165 ASP D OD2 1 
ATOM   7339  N N   . LEU D 1 168 ? -7.522  30.076  31.796  1.00 58.31  ? 166 LEU D N   1 
ATOM   7340  C CA  . LEU D 1 168 ? -8.235  30.217  30.543  1.00 53.57  ? 166 LEU D CA  1 
ATOM   7341  C C   . LEU D 1 168 ? -8.760  31.648  30.534  1.00 51.84  ? 166 LEU D C   1 
ATOM   7342  O O   . LEU D 1 168 ? -8.231  32.495  29.854  1.00 53.00  ? 166 LEU D O   1 
ATOM   7343  C CB  . LEU D 1 168 ? -9.413  29.236  30.459  1.00 48.82  ? 166 LEU D CB  1 
ATOM   7344  C CG  . LEU D 1 168 ? -9.069  27.766  30.179  1.00 49.65  ? 166 LEU D CG  1 
ATOM   7345  C CD1 . LEU D 1 168 ? -10.328 26.981  29.795  1.00 47.76  ? 166 LEU D CD1 1 
ATOM   7346  C CD2 . LEU D 1 168 ? -8.047  27.680  29.044  1.00 47.89  ? 166 LEU D CD2 1 
ATOM   7347  N N   . ILE D 1 169 ? -9.802  31.883  31.309  1.00 52.91  ? 167 ILE D N   1 
ATOM   7348  C CA  . ILE D 1 169 ? -10.456 33.177  31.438  1.00 56.78  ? 167 ILE D CA  1 
ATOM   7349  C C   . ILE D 1 169 ? -9.872  34.270  30.525  1.00 58.40  ? 167 ILE D C   1 
ATOM   7350  O O   . ILE D 1 169 ? -10.601 34.889  29.756  1.00 58.57  ? 167 ILE D O   1 
ATOM   7351  C CB  . ILE D 1 169 ? -10.463 33.648  32.948  1.00 53.47  ? 167 ILE D CB  1 
ATOM   7352  C CG1 . ILE D 1 169 ? -10.976 32.540  33.885  1.00 49.16  ? 167 ILE D CG1 1 
ATOM   7353  C CG2 . ILE D 1 169 ? -11.336 34.891  33.113  1.00 52.53  ? 167 ILE D CG2 1 
ATOM   7354  C CD1 . ILE D 1 169 ? -12.447 32.235  33.848  1.00 42.48  ? 167 ILE D CD1 1 
ATOM   7355  N N   . ASP D 1 170 ? -8.565  34.508  30.611  1.00 63.24  ? 168 ASP D N   1 
ATOM   7356  C CA  . ASP D 1 170 ? -7.900  35.500  29.764  1.00 64.87  ? 168 ASP D CA  1 
ATOM   7357  C C   . ASP D 1 170 ? -8.255  35.300  28.288  1.00 63.10  ? 168 ASP D C   1 
ATOM   7358  O O   . ASP D 1 170 ? -8.547  36.255  27.569  1.00 63.93  ? 168 ASP D O   1 
ATOM   7359  C CB  . ASP D 1 170 ? -6.386  35.423  29.962  1.00 72.93  ? 168 ASP D CB  1 
ATOM   7360  C CG  . ASP D 1 170 ? -5.974  35.765  31.390  1.00 79.27  ? 168 ASP D CG  1 
ATOM   7361  O OD1 . ASP D 1 170 ? -6.533  35.143  32.326  1.00 81.32  ? 168 ASP D OD1 1 
ATOM   7362  O OD2 . ASP D 1 170 ? -5.092  36.642  31.599  1.00 83.42  ? 168 ASP D OD2 1 
ATOM   7363  N N   . ALA D 1 171 ? -8.250  34.051  27.839  1.00 60.41  ? 169 ALA D N   1 
ATOM   7364  C CA  . ALA D 1 171 ? -8.603  33.733  26.450  1.00 58.67  ? 169 ALA D CA  1 
ATOM   7365  C C   . ALA D 1 171 ? -10.122 33.897  26.183  1.00 56.04  ? 169 ALA D C   1 
ATOM   7366  O O   . ALA D 1 171 ? -10.534 34.502  25.192  1.00 55.45  ? 169 ALA D O   1 
ATOM   7367  C CB  . ALA D 1 171 ? -8.162  32.306  26.133  1.00 57.82  ? 169 ALA D CB  1 
ATOM   7368  N N   . VAL D 1 172 ? -10.949 33.375  27.083  1.00 53.07  ? 170 VAL D N   1 
ATOM   7369  C CA  . VAL D 1 172 ? -12.395 33.457  26.931  1.00 49.17  ? 170 VAL D CA  1 
ATOM   7370  C C   . VAL D 1 172 ? -12.783 34.892  26.919  1.00 47.10  ? 170 VAL D C   1 
ATOM   7371  O O   . VAL D 1 172 ? -13.912 35.234  27.195  1.00 51.32  ? 170 VAL D O   1 
ATOM   7372  C CB  . VAL D 1 172 ? -13.123 32.773  28.113  1.00 51.82  ? 170 VAL D CB  1 
ATOM   7373  C CG1 . VAL D 1 172 ? -14.624 33.047  28.057  1.00 53.76  ? 170 VAL D CG1 1 
ATOM   7374  C CG2 . VAL D 1 172 ? -12.859 31.244  28.086  1.00 49.60  ? 170 VAL D CG2 1 
ATOM   7375  N N   . THR D 1 173 ? -11.845 35.753  26.589  1.00 46.16  ? 171 THR D N   1 
ATOM   7376  C CA  . THR D 1 173 ? -12.113 37.185  26.603  1.00 49.82  ? 171 THR D CA  1 
ATOM   7377  C C   . THR D 1 173 ? -11.975 37.751  25.209  1.00 48.60  ? 171 THR D C   1 
ATOM   7378  O O   . THR D 1 173 ? -12.797 38.555  24.738  1.00 40.51  ? 171 THR D O   1 
ATOM   7379  C CB  . THR D 1 173 ? -11.091 37.905  27.498  1.00 47.66  ? 171 THR D CB  1 
ATOM   7380  O OG1 . THR D 1 173 ? -10.864 37.120  28.668  1.00 49.18  ? 171 THR D OG1 1 
ATOM   7381  C CG2 . THR D 1 173 ? -11.582 39.280  27.879  1.00 47.79  ? 171 THR D CG2 1 
ATOM   7382  N N   . GLY D 1 174 ? -10.876 37.339  24.585  1.00 50.33  ? 172 GLY D N   1 
ATOM   7383  C CA  . GLY D 1 174 ? -10.560 37.770  23.247  1.00 51.34  ? 172 GLY D CA  1 
ATOM   7384  C C   . GLY D 1 174 ? -11.732 37.257  22.482  1.00 54.22  ? 172 GLY D C   1 
ATOM   7385  O O   . GLY D 1 174 ? -12.238 37.899  21.566  1.00 60.30  ? 172 GLY D O   1 
ATOM   7386  N N   . LEU D 1 175 ? -12.209 36.107  22.920  1.00 48.88  ? 173 LEU D N   1 
ATOM   7387  C CA  . LEU D 1 175 ? -13.302 35.489  22.231  1.00 46.98  ? 173 LEU D CA  1 
ATOM   7388  C C   . LEU D 1 175 ? -14.673 35.895  22.758  1.00 45.88  ? 173 LEU D C   1 
ATOM   7389  O O   . LEU D 1 175 ? -15.310 36.789  22.236  1.00 39.60  ? 173 LEU D O   1 
ATOM   7390  C CB  . LEU D 1 175 ? -13.137 33.986  22.325  1.00 48.58  ? 173 LEU D CB  1 
ATOM   7391  C CG  . LEU D 1 175 ? -13.815 33.114  21.279  1.00 45.66  ? 173 LEU D CG  1 
ATOM   7392  C CD1 . LEU D 1 175 ? -13.299 31.696  21.383  1.00 44.10  ? 173 LEU D CD1 1 
ATOM   7393  C CD2 . LEU D 1 175 ? -15.316 33.144  21.471  1.00 50.56  ? 173 LEU D CD2 1 
ATOM   7394  N N   . SER D 1 176 ? -15.129 35.219  23.803  1.00 48.23  ? 174 SER D N   1 
ATOM   7395  C CA  . SER D 1 176 ? -16.451 35.485  24.366  1.00 46.69  ? 174 SER D CA  1 
ATOM   7396  C C   . SER D 1 176 ? -16.596 36.931  24.873  1.00 46.43  ? 174 SER D C   1 
ATOM   7397  O O   . SER D 1 176 ? -17.699 37.496  25.000  1.00 40.50  ? 174 SER D O   1 
ATOM   7398  C CB  . SER D 1 176 ? -16.723 34.490  25.508  1.00 46.27  ? 174 SER D CB  1 
ATOM   7399  O OG  . SER D 1 176 ? -18.110 34.472  25.840  1.00 51.05  ? 174 SER D OG  1 
ATOM   7400  N N   . GLY D 1 177 ? -15.453 37.536  25.155  1.00 50.20  ? 175 GLY D N   1 
ATOM   7401  C CA  . GLY D 1 177 ? -15.453 38.880  25.684  1.00 52.79  ? 175 GLY D CA  1 
ATOM   7402  C C   . GLY D 1 177 ? -15.758 39.876  24.608  1.00 55.58  ? 175 GLY D C   1 
ATOM   7403  O O   . GLY D 1 177 ? -16.899 40.352  24.466  1.00 58.14  ? 175 GLY D O   1 
ATOM   7404  N N   . SER D 1 178 ? -14.704 40.188  23.863  1.00 54.60  ? 176 SER D N   1 
ATOM   7405  C CA  . SER D 1 178 ? -14.736 41.129  22.754  1.00 54.67  ? 176 SER D CA  1 
ATOM   7406  C C   . SER D 1 178 ? -15.379 40.477  21.507  1.00 55.13  ? 176 SER D C   1 
ATOM   7407  O O   . SER D 1 178 ? -15.039 40.811  20.372  1.00 60.92  ? 176 SER D O   1 
ATOM   7408  C CB  . SER D 1 178 ? -13.292 41.557  22.417  1.00 56.84  ? 176 SER D CB  1 
ATOM   7409  O OG  . SER D 1 178 ? -12.522 41.803  23.586  1.00 52.36  ? 176 SER D OG  1 
ATOM   7410  N N   . GLY D 1 179 ? -16.292 39.534  21.693  1.00 48.59  ? 177 GLY D N   1 
ATOM   7411  C CA  . GLY D 1 179 ? -16.875 38.883  20.530  1.00 43.09  ? 177 GLY D CA  1 
ATOM   7412  C C   . GLY D 1 179 ? -18.000 39.669  19.918  1.00 39.46  ? 177 GLY D C   1 
ATOM   7413  O O   . GLY D 1 179 ? -17.972 39.991  18.750  1.00 37.17  ? 177 GLY D O   1 
ATOM   7414  N N   . PRO D 1 180 ? -19.029 39.969  20.688  1.00 41.46  ? 178 PRO D N   1 
ATOM   7415  C CA  . PRO D 1 180 ? -20.148 40.737  20.164  1.00 45.55  ? 178 PRO D CA  1 
ATOM   7416  C C   . PRO D 1 180 ? -19.546 42.019  19.596  1.00 48.73  ? 178 PRO D C   1 
ATOM   7417  O O   . PRO D 1 180 ? -20.074 42.647  18.666  1.00 45.90  ? 178 PRO D O   1 
ATOM   7418  C CB  . PRO D 1 180 ? -20.991 40.993  21.411  1.00 46.82  ? 178 PRO D CB  1 
ATOM   7419  C CG  . PRO D 1 180 ? -20.688 39.802  22.274  1.00 50.20  ? 178 PRO D CG  1 
ATOM   7420  C CD  . PRO D 1 180 ? -19.197 39.716  22.124  1.00 48.04  ? 178 PRO D CD  1 
ATOM   7421  N N   . ALA D 1 181 ? -18.414 42.392  20.178  1.00 51.53  ? 179 ALA D N   1 
ATOM   7422  C CA  . ALA D 1 181 ? -17.693 43.582  19.776  1.00 50.95  ? 179 ALA D CA  1 
ATOM   7423  C C   . ALA D 1 181 ? -17.376 43.473  18.274  1.00 49.98  ? 179 ALA D C   1 
ATOM   7424  O O   . ALA D 1 181 ? -17.664 44.365  17.479  1.00 52.01  ? 179 ALA D O   1 
ATOM   7425  C CB  . ALA D 1 181 ? -16.398 43.675  20.599  1.00 44.78  ? 179 ALA D CB  1 
ATOM   7426  N N   . TYR D 1 182 ? -16.780 42.352  17.908  1.00 46.62  ? 180 TYR D N   1 
ATOM   7427  C CA  . TYR D 1 182 ? -16.372 42.083  16.550  1.00 45.36  ? 180 TYR D CA  1 
ATOM   7428  C C   . TYR D 1 182 ? -17.624 41.967  15.694  1.00 45.15  ? 180 TYR D C   1 
ATOM   7429  O O   . TYR D 1 182 ? -17.694 42.475  14.576  1.00 40.60  ? 180 TYR D O   1 
ATOM   7430  C CB  . TYR D 1 182 ? -15.630 40.747  16.512  1.00 49.58  ? 180 TYR D CB  1 
ATOM   7431  C CG  . TYR D 1 182 ? -14.456 40.588  17.469  1.00 56.91  ? 180 TYR D CG  1 
ATOM   7432  C CD1 . TYR D 1 182 ? -14.162 39.332  18.044  1.00 54.97  ? 180 TYR D CD1 1 
ATOM   7433  C CD2 . TYR D 1 182 ? -13.576 41.651  17.716  1.00 58.68  ? 180 TYR D CD2 1 
ATOM   7434  C CE1 . TYR D 1 182 ? -13.025 39.137  18.822  1.00 59.06  ? 180 TYR D CE1 1 
ATOM   7435  C CE2 . TYR D 1 182 ? -12.428 41.462  18.497  1.00 60.32  ? 180 TYR D CE2 1 
ATOM   7436  C CZ  . TYR D 1 182 ? -12.147 40.194  19.042  1.00 60.27  ? 180 TYR D CZ  1 
ATOM   7437  O OH  . TYR D 1 182 ? -10.944 39.963  19.705  1.00 54.45  ? 180 TYR D OH  1 
ATOM   7438  N N   . ALA D 1 183 ? -18.598 41.246  16.230  1.00 44.59  ? 181 ALA D N   1 
ATOM   7439  C CA  . ALA D 1 183 ? -19.842 40.994  15.542  1.00 46.88  ? 181 ALA D CA  1 
ATOM   7440  C C   . ALA D 1 183 ? -20.480 42.277  15.068  1.00 52.81  ? 181 ALA D C   1 
ATOM   7441  O O   . ALA D 1 183 ? -20.783 42.420  13.893  1.00 62.51  ? 181 ALA D O   1 
ATOM   7442  C CB  . ALA D 1 183 ? -20.813 40.237  16.446  1.00 42.15  ? 181 ALA D CB  1 
ATOM   7443  N N   . PHE D 1 184 ? -20.706 43.228  15.968  1.00 55.34  ? 182 PHE D N   1 
ATOM   7444  C CA  . PHE D 1 184 ? -21.345 44.499  15.592  1.00 49.62  ? 182 PHE D CA  1 
ATOM   7445  C C   . PHE D 1 184 ? -20.628 45.192  14.476  1.00 49.55  ? 182 PHE D C   1 
ATOM   7446  O O   . PHE D 1 184 ? -21.284 45.911  13.723  1.00 54.65  ? 182 PHE D O   1 
ATOM   7447  C CB  . PHE D 1 184 ? -21.444 45.419  16.798  1.00 51.15  ? 182 PHE D CB  1 
ATOM   7448  C CG  . PHE D 1 184 ? -22.251 44.836  17.914  1.00 52.43  ? 182 PHE D CG  1 
ATOM   7449  C CD1 . PHE D 1 184 ? -22.090 45.284  19.204  1.00 53.60  ? 182 PHE D CD1 1 
ATOM   7450  C CD2 . PHE D 1 184 ? -23.183 43.831  17.662  1.00 54.50  ? 182 PHE D CD2 1 
ATOM   7451  C CE1 . PHE D 1 184 ? -22.839 44.746  20.224  1.00 51.14  ? 182 PHE D CE1 1 
ATOM   7452  C CE2 . PHE D 1 184 ? -23.954 43.273  18.681  1.00 50.62  ? 182 PHE D CE2 1 
ATOM   7453  C CZ  . PHE D 1 184 ? -23.779 43.733  19.959  1.00 53.27  ? 182 PHE D CZ  1 
ATOM   7454  N N   . THR D 1 185 ? -19.317 44.962  14.352  1.00 43.19  ? 183 THR D N   1 
ATOM   7455  C CA  . THR D 1 185 ? -18.553 45.560  13.285  1.00 42.77  ? 183 THR D CA  1 
ATOM   7456  C C   . THR D 1 185 ? -18.838 44.770  12.005  1.00 46.85  ? 183 THR D C   1 
ATOM   7457  O O   . THR D 1 185 ? -18.733 45.291  10.890  1.00 49.42  ? 183 THR D O   1 
ATOM   7458  C CB  . THR D 1 185 ? -17.080 45.456  13.526  1.00 41.09  ? 183 THR D CB  1 
ATOM   7459  O OG1 . THR D 1 185 ? -16.764 45.993  14.803  1.00 45.01  ? 183 THR D OG1 1 
ATOM   7460  C CG2 . THR D 1 185 ? -16.319 46.196  12.455  1.00 43.93  ? 183 THR D CG2 1 
ATOM   7461  N N   . ALA D 1 186 ? -19.183 43.499  12.151  1.00 47.88  ? 184 ALA D N   1 
ATOM   7462  C CA  . ALA D 1 186 ? -19.474 42.667  10.991  1.00 47.84  ? 184 ALA D CA  1 
ATOM   7463  C C   . ALA D 1 186 ? -20.865 42.938  10.467  1.00 50.08  ? 184 ALA D C   1 
ATOM   7464  O O   . ALA D 1 186 ? -21.007 43.072  9.262   1.00 55.07  ? 184 ALA D O   1 
ATOM   7465  C CB  . ALA D 1 186 ? -19.342 41.227  11.340  1.00 48.42  ? 184 ALA D CB  1 
ATOM   7466  N N   . LEU D 1 187 ? -21.871 43.029  11.346  1.00 48.73  ? 185 LEU D N   1 
ATOM   7467  C CA  . LEU D 1 187 ? -23.235 43.311  10.895  1.00 50.29  ? 185 LEU D CA  1 
ATOM   7468  C C   . LEU D 1 187 ? -23.404 44.714  10.311  1.00 49.32  ? 185 LEU D C   1 
ATOM   7469  O O   . LEU D 1 187 ? -24.429 45.038  9.736   1.00 55.95  ? 185 LEU D O   1 
ATOM   7470  C CB  . LEU D 1 187 ? -24.257 43.128  12.012  1.00 49.68  ? 185 LEU D CB  1 
ATOM   7471  C CG  . LEU D 1 187 ? -24.521 41.706  12.514  1.00 54.73  ? 185 LEU D CG  1 
ATOM   7472  C CD1 . LEU D 1 187 ? -25.766 41.708  13.390  1.00 59.26  ? 185 LEU D CD1 1 
ATOM   7473  C CD2 . LEU D 1 187 ? -24.729 40.764  11.352  1.00 61.94  ? 185 LEU D CD2 1 
ATOM   7474  N N   . ASP D 1 188 ? -22.415 45.562  10.458  1.00 44.64  ? 186 ASP D N   1 
ATOM   7475  C CA  . ASP D 1 188 ? -22.567 46.860  9.889   1.00 48.05  ? 186 ASP D CA  1 
ATOM   7476  C C   . ASP D 1 188 ? -22.004 46.797  8.479   1.00 48.81  ? 186 ASP D C   1 
ATOM   7477  O O   . ASP D 1 188 ? -22.527 47.382  7.528   1.00 44.81  ? 186 ASP D O   1 
ATOM   7478  C CB  . ASP D 1 188 ? -21.794 47.872  10.712  1.00 50.74  ? 186 ASP D CB  1 
ATOM   7479  C CG  . ASP D 1 188 ? -22.008 49.274  10.222  1.00 57.08  ? 186 ASP D CG  1 
ATOM   7480  O OD1 . ASP D 1 188 ? -23.133 49.776  10.404  1.00 63.50  ? 186 ASP D OD1 1 
ATOM   7481  O OD2 . ASP D 1 188 ? -21.066 49.872  9.653   1.00 62.01  ? 186 ASP D OD2 1 
ATOM   7482  N N   . ALA D 1 189 ? -20.897 46.084  8.359   1.00 52.32  ? 187 ALA D N   1 
ATOM   7483  C CA  . ALA D 1 189 ? -20.223 45.954  7.075   1.00 52.09  ? 187 ALA D CA  1 
ATOM   7484  C C   . ALA D 1 189 ? -21.131 45.233  6.102   1.00 52.37  ? 187 ALA D C   1 
ATOM   7485  O O   . ALA D 1 189 ? -21.167 45.578  4.919   1.00 60.04  ? 187 ALA D O   1 
ATOM   7486  C CB  . ALA D 1 189 ? -18.929 45.191  7.237   1.00 50.01  ? 187 ALA D CB  1 
ATOM   7487  N N   . LEU D 1 190 ? -21.856 44.235  6.600   1.00 46.14  ? 188 LEU D N   1 
ATOM   7488  C CA  . LEU D 1 190 ? -22.774 43.461  5.782   1.00 43.50  ? 188 LEU D CA  1 
ATOM   7489  C C   . LEU D 1 190 ? -23.917 44.329  5.334   1.00 46.53  ? 188 LEU D C   1 
ATOM   7490  O O   . LEU D 1 190 ? -24.228 44.403  4.133   1.00 46.74  ? 188 LEU D O   1 
ATOM   7491  C CB  . LEU D 1 190 ? -23.314 42.281  6.571   1.00 45.55  ? 188 LEU D CB  1 
ATOM   7492  C CG  . LEU D 1 190 ? -22.369 41.080  6.686   1.00 36.20  ? 188 LEU D CG  1 
ATOM   7493  C CD1 . LEU D 1 190 ? -22.800 40.174  7.861   1.00 39.06  ? 188 LEU D CD1 1 
ATOM   7494  C CD2 . LEU D 1 190 ? -22.370 40.331  5.374   1.00 31.56  ? 188 LEU D CD2 1 
ATOM   7495  N N   . ALA D 1 191 ? -24.546 44.976  6.317   1.00 43.68  ? 189 ALA D N   1 
ATOM   7496  C CA  . ALA D 1 191 ? -25.650 45.922  6.097   1.00 38.52  ? 189 ALA D CA  1 
ATOM   7497  C C   . ALA D 1 191 ? -25.196 46.972  5.096   1.00 37.29  ? 189 ALA D C   1 
ATOM   7498  O O   . ALA D 1 191 ? -25.987 47.529  4.345   1.00 39.34  ? 189 ALA D O   1 
ATOM   7499  C CB  . ALA D 1 191 ? -26.009 46.605  7.421   1.00 37.99  ? 189 ALA D CB  1 
ATOM   7500  N N   . ASP D 1 192 ? -23.899 47.237  5.114   1.00 36.79  ? 190 ASP D N   1 
ATOM   7501  C CA  . ASP D 1 192 ? -23.313 48.209  4.233   1.00 37.77  ? 190 ASP D CA  1 
ATOM   7502  C C   . ASP D 1 192 ? -23.329 47.654  2.841   1.00 41.42  ? 190 ASP D C   1 
ATOM   7503  O O   . ASP D 1 192 ? -23.847 48.292  1.920   1.00 41.30  ? 190 ASP D O   1 
ATOM   7504  C CB  . ASP D 1 192 ? -21.884 48.499  4.649   1.00 40.36  ? 190 ASP D CB  1 
ATOM   7505  C CG  . ASP D 1 192 ? -21.760 49.772  5.469   1.00 45.34  ? 190 ASP D CG  1 
ATOM   7506  O OD1 . ASP D 1 192 ? -22.784 50.294  5.963   1.00 44.45  ? 190 ASP D OD1 1 
ATOM   7507  O OD2 . ASP D 1 192 ? -20.614 50.255  5.627   1.00 51.35  ? 190 ASP D OD2 1 
ATOM   7508  N N   . GLY D 1 193 ? -22.734 46.467  2.699   1.00 43.09  ? 191 GLY D N   1 
ATOM   7509  C CA  . GLY D 1 193 ? -22.690 45.791  1.417   1.00 41.92  ? 191 GLY D CA  1 
ATOM   7510  C C   . GLY D 1 193 ? -24.112 45.603  0.918   1.00 44.32  ? 191 GLY D C   1 
ATOM   7511  O O   . GLY D 1 193 ? -24.476 45.993  -0.205  1.00 45.34  ? 191 GLY D O   1 
ATOM   7512  N N   . GLY D 1 194 ? -24.938 45.022  1.773   1.00 43.06  ? 192 GLY D N   1 
ATOM   7513  C CA  . GLY D 1 194 ? -26.315 44.812  1.398   1.00 43.09  ? 192 GLY D CA  1 
ATOM   7514  C C   . GLY D 1 194 ? -26.883 46.055  0.748   1.00 43.67  ? 192 GLY D C   1 
ATOM   7515  O O   . GLY D 1 194 ? -27.525 46.001  -0.282  1.00 52.49  ? 192 GLY D O   1 
ATOM   7516  N N   . VAL D 1 195 ? -26.613 47.201  1.331   1.00 43.30  ? 193 VAL D N   1 
ATOM   7517  C CA  . VAL D 1 195 ? -27.134 48.423  0.782   1.00 37.67  ? 193 VAL D CA  1 
ATOM   7518  C C   . VAL D 1 195 ? -26.517 48.773  -0.549  1.00 36.75  ? 193 VAL D C   1 
ATOM   7519  O O   . VAL D 1 195 ? -27.226 49.112  -1.487  1.00 40.95  ? 193 VAL D O   1 
ATOM   7520  C CB  . VAL D 1 195 ? -26.935 49.575  1.749   1.00 33.00  ? 193 VAL D CB  1 
ATOM   7521  C CG1 . VAL D 1 195 ? -27.361 50.849  1.093   1.00 26.57  ? 193 VAL D CG1 1 
ATOM   7522  C CG2 . VAL D 1 195 ? -27.749 49.334  3.012   1.00 23.01  ? 193 VAL D CG2 1 
ATOM   7523  N N   . LYS D 1 196 ? -25.206 48.696  -0.655  1.00 34.98  ? 194 LYS D N   1 
ATOM   7524  C CA  . LYS D 1 196 ? -24.566 49.037  -1.917  1.00 34.47  ? 194 LYS D CA  1 
ATOM   7525  C C   . LYS D 1 196 ? -25.126 48.168  -3.035  1.00 40.32  ? 194 LYS D C   1 
ATOM   7526  O O   . LYS D 1 196 ? -24.803 48.380  -4.201  1.00 43.94  ? 194 LYS D O   1 
ATOM   7527  C CB  . LYS D 1 196 ? -23.053 48.821  -1.840  1.00 26.78  ? 194 LYS D CB  1 
ATOM   7528  C CG  . LYS D 1 196 ? -22.293 49.240  -3.093  1.00 17.16  ? 194 LYS D CG  1 
ATOM   7529  C CD  . LYS D 1 196 ? -21.101 48.317  -3.367  1.00 9.45   ? 194 LYS D CD  1 
ATOM   7530  C CE  . LYS D 1 196 ? -20.196 48.840  -4.428  1.00 10.74  ? 194 LYS D CE  1 
ATOM   7531  N NZ  . LYS D 1 196 ? -19.037 47.923  -4.764  1.00 14.20  ? 194 LYS D NZ  1 
ATOM   7532  N N   . MET D 1 197 ? -25.943 47.178  -2.694  1.00 43.77  ? 195 MET D N   1 
ATOM   7533  C CA  . MET D 1 197 ? -26.491 46.304  -3.706  1.00 44.51  ? 195 MET D CA  1 
ATOM   7534  C C   . MET D 1 197 ? -27.968 46.570  -3.852  1.00 52.17  ? 195 MET D C   1 
ATOM   7535  O O   . MET D 1 197 ? -28.717 45.686  -4.316  1.00 53.78  ? 195 MET D O   1 
ATOM   7536  C CB  . MET D 1 197 ? -26.287 44.870  -3.306  1.00 43.88  ? 195 MET D CB  1 
ATOM   7537  C CG  . MET D 1 197 ? -24.865 44.493  -3.128  1.00 47.47  ? 195 MET D CG  1 
ATOM   7538  S SD  . MET D 1 197 ? -24.028 44.291  -4.682  1.00 53.25  ? 195 MET D SD  1 
ATOM   7539  C CE  . MET D 1 197 ? -23.042 45.751  -4.684  1.00 59.28  ? 195 MET D CE  1 
ATOM   7540  N N   . GLY D 1 198 ? -28.369 47.775  -3.427  1.00 59.17  ? 196 GLY D N   1 
ATOM   7541  C CA  . GLY D 1 198 ? -29.749 48.225  -3.524  1.00 64.27  ? 196 GLY D CA  1 
ATOM   7542  C C   . GLY D 1 198 ? -30.696 47.871  -2.388  1.00 67.62  ? 196 GLY D C   1 
ATOM   7543  O O   . GLY D 1 198 ? -31.907 48.163  -2.447  1.00 71.71  ? 196 GLY D O   1 
ATOM   7544  N N   . LEU D 1 199 ? -30.172 47.220  -1.361  1.00 65.47  ? 197 LEU D N   1 
ATOM   7545  C CA  . LEU D 1 199 ? -30.988 46.865  -0.229  1.00 65.06  ? 197 LEU D CA  1 
ATOM   7546  C C   . LEU D 1 199 ? -31.268 48.058  0.676   1.00 67.39  ? 197 LEU D C   1 
ATOM   7547  O O   . LEU D 1 199 ? -30.385 48.877  0.928   1.00 69.42  ? 197 LEU D O   1 
ATOM   7548  C CB  . LEU D 1 199 ? -30.278 45.779  0.555   1.00 62.76  ? 197 LEU D CB  1 
ATOM   7549  C CG  . LEU D 1 199 ? -30.627 44.409  0.018   1.00 66.40  ? 197 LEU D CG  1 
ATOM   7550  C CD1 . LEU D 1 199 ? -30.015 43.316  0.859   1.00 67.01  ? 197 LEU D CD1 1 
ATOM   7551  C CD2 . LEU D 1 199 ? -32.131 44.288  0.054   1.00 73.97  ? 197 LEU D CD2 1 
ATOM   7552  N N   . PRO D 1 200 ? -32.524 48.212  1.120   1.00 68.35  ? 198 PRO D N   1 
ATOM   7553  C CA  . PRO D 1 200 ? -32.797 49.339  2.011   1.00 70.76  ? 198 PRO D CA  1 
ATOM   7554  C C   . PRO D 1 200 ? -32.177 48.991  3.404   1.00 72.16  ? 198 PRO D C   1 
ATOM   7555  O O   . PRO D 1 200 ? -32.281 47.840  3.891   1.00 72.02  ? 198 PRO D O   1 
ATOM   7556  C CB  . PRO D 1 200 ? -34.337 49.420  1.998   1.00 68.37  ? 198 PRO D CB  1 
ATOM   7557  C CG  . PRO D 1 200 ? -34.755 48.006  1.708   1.00 64.43  ? 198 PRO D CG  1 
ATOM   7558  C CD  . PRO D 1 200 ? -33.781 47.610  0.638   1.00 68.60  ? 198 PRO D CD  1 
ATOM   7559  N N   . ARG D 1 201 ? -31.531 49.978  4.032   1.00 70.66  ? 199 ARG D N   1 
ATOM   7560  C CA  . ARG D 1 201 ? -30.852 49.773  5.318   1.00 68.75  ? 199 ARG D CA  1 
ATOM   7561  C C   . ARG D 1 201 ? -31.575 48.877  6.315   1.00 67.29  ? 199 ARG D C   1 
ATOM   7562  O O   . ARG D 1 201 ? -31.241 47.702  6.451   1.00 69.02  ? 199 ARG D O   1 
ATOM   7563  C CB  . ARG D 1 201 ? -30.542 51.123  5.997   1.00 72.40  ? 199 ARG D CB  1 
ATOM   7564  C CG  . ARG D 1 201 ? -29.379 51.094  7.030   1.00 69.27  ? 199 ARG D CG  1 
ATOM   7565  C CD  . ARG D 1 201 ? -28.021 50.987  6.358   1.00 67.29  ? 199 ARG D CD  1 
ATOM   7566  N NE  . ARG D 1 201 ? -27.004 50.453  7.256   1.00 67.21  ? 199 ARG D NE  1 
ATOM   7567  C CZ  . ARG D 1 201 ? -25.719 50.331  6.933   1.00 67.25  ? 199 ARG D CZ  1 
ATOM   7568  N NH1 . ARG D 1 201 ? -25.304 50.707  5.727   1.00 64.24  ? 199 ARG D NH1 1 
ATOM   7569  N NH2 . ARG D 1 201 ? -24.845 49.855  7.819   1.00 65.23  ? 199 ARG D NH2 1 
ATOM   7570  N N   . ARG D 1 202 ? -32.554 49.441  7.013   1.00 64.34  ? 200 ARG D N   1 
ATOM   7571  C CA  . ARG D 1 202 ? -33.276 48.692  8.018   1.00 64.92  ? 200 ARG D CA  1 
ATOM   7572  C C   . ARG D 1 202 ? -33.346 47.220  7.692   1.00 61.39  ? 200 ARG D C   1 
ATOM   7573  O O   . ARG D 1 202 ? -33.063 46.374  8.550   1.00 60.82  ? 200 ARG D O   1 
ATOM   7574  C CB  . ARG D 1 202 ? -34.690 49.259  8.213   1.00 72.97  ? 200 ARG D CB  1 
ATOM   7575  C CG  . ARG D 1 202 ? -34.790 50.397  9.250   1.00 86.31  ? 200 ARG D CG  1 
ATOM   7576  C CD  . ARG D 1 202 ? -34.422 49.911  10.676  1.00 95.87  ? 200 ARG D CD  1 
ATOM   7577  N NE  . ARG D 1 202 ? -34.123 51.012  11.612  1.00 105.18 ? 200 ARG D NE  1 
ATOM   7578  C CZ  . ARG D 1 202 ? -33.524 50.875  12.805  1.00 107.62 ? 200 ARG D CZ  1 
ATOM   7579  N NH1 . ARG D 1 202 ? -33.144 49.676  13.229  1.00 107.00 ? 200 ARG D NH1 1 
ATOM   7580  N NH2 . ARG D 1 202 ? -33.296 51.935  13.585  1.00 106.12 ? 200 ARG D NH2 1 
ATOM   7581  N N   . LEU D 1 203 ? -33.690 46.916  6.443   1.00 56.30  ? 201 LEU D N   1 
ATOM   7582  C CA  . LEU D 1 203 ? -33.831 45.529  6.032   1.00 52.76  ? 201 LEU D CA  1 
ATOM   7583  C C   . LEU D 1 203 ? -32.528 44.825  6.105   1.00 48.80  ? 201 LEU D C   1 
ATOM   7584  O O   . LEU D 1 203 ? -32.400 43.850  6.834   1.00 45.59  ? 201 LEU D O   1 
ATOM   7585  C CB  . LEU D 1 203 ? -34.369 45.403  4.603   1.00 54.27  ? 201 LEU D CB  1 
ATOM   7586  C CG  . LEU D 1 203 ? -34.564 43.965  4.077   1.00 50.69  ? 201 LEU D CG  1 
ATOM   7587  C CD1 . LEU D 1 203 ? -35.853 43.323  4.579   1.00 45.46  ? 201 LEU D CD1 1 
ATOM   7588  C CD2 . LEU D 1 203 ? -34.583 44.047  2.589   1.00 50.85  ? 201 LEU D CD2 1 
ATOM   7589  N N   . ALA D 1 204 ? -31.579 45.327  5.321   1.00 50.21  ? 202 ALA D N   1 
ATOM   7590  C CA  . ALA D 1 204 ? -30.214 44.786  5.235   1.00 53.60  ? 202 ALA D CA  1 
ATOM   7591  C C   . ALA D 1 204 ? -29.628 44.456  6.619   1.00 53.59  ? 202 ALA D C   1 
ATOM   7592  O O   . ALA D 1 204 ? -29.006 43.397  6.833   1.00 51.69  ? 202 ALA D O   1 
ATOM   7593  C CB  . ALA D 1 204 ? -29.290 45.807  4.504   1.00 49.07  ? 202 ALA D CB  1 
ATOM   7594  N N   . VAL D 1 205 ? -29.845 45.377  7.550   1.00 51.16  ? 203 VAL D N   1 
ATOM   7595  C CA  . VAL D 1 205 ? -29.343 45.226  8.879   1.00 50.01  ? 203 VAL D CA  1 
ATOM   7596  C C   . VAL D 1 205 ? -30.059 44.033  9.565   1.00 48.84  ? 203 VAL D C   1 
ATOM   7597  O O   . VAL D 1 205 ? -29.403 43.160  10.127  1.00 46.05  ? 203 VAL D O   1 
ATOM   7598  C CB  . VAL D 1 205 ? -29.472 46.609  9.590   1.00 50.56  ? 203 VAL D CB  1 
ATOM   7599  C CG1 . VAL D 1 205 ? -30.387 46.543  10.763  1.00 54.39  ? 203 VAL D CG1 1 
ATOM   7600  C CG2 . VAL D 1 205 ? -28.107 47.100  9.984   1.00 46.56  ? 203 VAL D CG2 1 
ATOM   7601  N N   . ARG D 1 206 ? -31.384 43.951  9.498   1.00 50.78  ? 204 ARG D N   1 
ATOM   7602  C CA  . ARG D 1 206 ? -32.058 42.804  10.116  1.00 55.84  ? 204 ARG D CA  1 
ATOM   7603  C C   . ARG D 1 206 ? -31.867 41.415  9.419   1.00 55.79  ? 204 ARG D C   1 
ATOM   7604  O O   . ARG D 1 206 ? -31.978 40.354  10.057  1.00 49.21  ? 204 ARG D O   1 
ATOM   7605  C CB  . ARG D 1 206 ? -33.538 43.146  10.343  1.00 62.71  ? 204 ARG D CB  1 
ATOM   7606  C CG  . ARG D 1 206 ? -33.701 44.263  11.418  1.00 74.29  ? 204 ARG D CG  1 
ATOM   7607  C CD  . ARG D 1 206 ? -35.145 44.500  11.932  1.00 83.96  ? 204 ARG D CD  1 
ATOM   7608  N NE  . ARG D 1 206 ? -35.248 45.630  12.874  1.00 90.96  ? 204 ARG D NE  1 
ATOM   7609  C CZ  . ARG D 1 206 ? -36.390 46.133  13.362  1.00 94.78  ? 204 ARG D CZ  1 
ATOM   7610  N NH1 . ARG D 1 206 ? -37.577 45.621  13.014  1.00 96.47  ? 204 ARG D NH1 1 
ATOM   7611  N NH2 . ARG D 1 206 ? -36.339 47.170  14.200  1.00 95.97  ? 204 ARG D NH2 1 
ATOM   7612  N N   . LEU D 1 207 ? -31.562 41.416  8.123   1.00 54.22  ? 205 LEU D N   1 
ATOM   7613  C CA  . LEU D 1 207 ? -31.306 40.167  7.424   1.00 52.09  ? 205 LEU D CA  1 
ATOM   7614  C C   . LEU D 1 207 ? -29.940 39.711  7.848   1.00 49.90  ? 205 LEU D C   1 
ATOM   7615  O O   . LEU D 1 207 ? -29.764 38.544  8.200   1.00 48.01  ? 205 LEU D O   1 
ATOM   7616  C CB  . LEU D 1 207 ? -31.314 40.368  5.924   1.00 52.97  ? 205 LEU D CB  1 
ATOM   7617  C CG  . LEU D 1 207 ? -32.624 40.856  5.334   1.00 55.07  ? 205 LEU D CG  1 
ATOM   7618  C CD1 . LEU D 1 207 ? -32.404 40.979  3.833   1.00 55.84  ? 205 LEU D CD1 1 
ATOM   7619  C CD2 . LEU D 1 207 ? -33.770 39.910  5.669   1.00 54.80  ? 205 LEU D CD2 1 
ATOM   7620  N N   . GLY D 1 208 ? -28.975 40.628  7.798   1.00 44.84  ? 206 GLY D N   1 
ATOM   7621  C CA  . GLY D 1 208 ? -27.640 40.275  8.228   1.00 44.24  ? 206 GLY D CA  1 
ATOM   7622  C C   . GLY D 1 208 ? -27.669 39.695  9.654   1.00 49.26  ? 206 GLY D C   1 
ATOM   7623  O O   . GLY D 1 208 ? -27.003 38.691  9.964   1.00 46.88  ? 206 GLY D O   1 
ATOM   7624  N N   . ALA D 1 209 ? -28.455 40.293  10.540  1.00 46.30  ? 207 ALA D N   1 
ATOM   7625  C CA  . ALA D 1 209 ? -28.494 39.794  11.894  1.00 46.08  ? 207 ALA D CA  1 
ATOM   7626  C C   . ALA D 1 209 ? -29.083 38.380  11.898  1.00 49.49  ? 207 ALA D C   1 
ATOM   7627  O O   . ALA D 1 209 ? -28.436 37.414  12.251  1.00 48.67  ? 207 ALA D O   1 
ATOM   7628  C CB  . ALA D 1 209 ? -29.329 40.719  12.743  1.00 41.84  ? 207 ALA D CB  1 
ATOM   7629  N N   . GLN D 1 210 ? -30.336 38.279  11.479  1.00 54.24  ? 208 GLN D N   1 
ATOM   7630  C CA  . GLN D 1 210 ? -31.077 37.014  11.440  1.00 52.29  ? 208 GLN D CA  1 
ATOM   7631  C C   . GLN D 1 210 ? -30.276 35.956  10.748  1.00 48.38  ? 208 GLN D C   1 
ATOM   7632  O O   . GLN D 1 210 ? -30.435 34.773  10.985  1.00 47.15  ? 208 GLN D O   1 
ATOM   7633  C CB  . GLN D 1 210 ? -32.392 37.208  10.675  1.00 56.13  ? 208 GLN D CB  1 
ATOM   7634  C CG  . GLN D 1 210 ? -33.634 36.847  11.467  1.00 60.60  ? 208 GLN D CG  1 
ATOM   7635  C CD  . GLN D 1 210 ? -33.524 35.482  12.131  1.00 67.87  ? 208 GLN D CD  1 
ATOM   7636  O OE1 . GLN D 1 210 ? -32.827 34.598  11.628  1.00 66.89  ? 208 GLN D OE1 1 
ATOM   7637  N NE2 . GLN D 1 210 ? -34.232 35.298  13.260  1.00 69.48  ? 208 GLN D NE2 1 
ATOM   7638  N N   . ALA D 1 211 ? -29.425 36.410  9.852   1.00 49.47  ? 209 ALA D N   1 
ATOM   7639  C CA  . ALA D 1 211 ? -28.614 35.497  9.100   1.00 53.32  ? 209 ALA D CA  1 
ATOM   7640  C C   . ALA D 1 211 ? -27.609 34.804  10.014  1.00 56.67  ? 209 ALA D C   1 
ATOM   7641  O O   . ALA D 1 211 ? -27.543 33.558  10.036  1.00 56.57  ? 209 ALA D O   1 
ATOM   7642  C CB  . ALA D 1 211 ? -27.923 36.237  7.973   1.00 51.91  ? 209 ALA D CB  1 
ATOM   7643  N N   . LEU D 1 212 ? -26.836 35.599  10.765  1.00 56.93  ? 210 LEU D N   1 
ATOM   7644  C CA  . LEU D 1 212 ? -25.833 35.063  11.704  1.00 57.20  ? 210 LEU D CA  1 
ATOM   7645  C C   . LEU D 1 212 ? -26.538 34.330  12.820  1.00 55.75  ? 210 LEU D C   1 
ATOM   7646  O O   . LEU D 1 212 ? -26.352 33.131  13.020  1.00 56.91  ? 210 LEU D O   1 
ATOM   7647  C CB  . LEU D 1 212 ? -25.017 36.177  12.329  1.00 61.28  ? 210 LEU D CB  1 
ATOM   7648  C CG  . LEU D 1 212 ? -24.289 37.112  11.356  1.00 68.41  ? 210 LEU D CG  1 
ATOM   7649  C CD1 . LEU D 1 212 ? -23.526 38.184  12.139  1.00 65.44  ? 210 LEU D CD1 1 
ATOM   7650  C CD2 . LEU D 1 212 ? -23.333 36.306  10.475  1.00 66.99  ? 210 LEU D CD2 1 
ATOM   7651  N N   . LEU D 1 213 ? -27.353 35.061  13.560  1.00 52.79  ? 211 LEU D N   1 
ATOM   7652  C CA  . LEU D 1 213 ? -28.102 34.432  14.617  1.00 51.96  ? 211 LEU D CA  1 
ATOM   7653  C C   . LEU D 1 213 ? -28.547 33.019  14.129  1.00 50.14  ? 211 LEU D C   1 
ATOM   7654  O O   . LEU D 1 213 ? -28.510 32.029  14.878  1.00 48.37  ? 211 LEU D O   1 
ATOM   7655  C CB  . LEU D 1 213 ? -29.279 35.347  15.016  1.00 44.86  ? 211 LEU D CB  1 
ATOM   7656  C CG  . LEU D 1 213 ? -30.558 34.724  15.588  1.00 47.40  ? 211 LEU D CG  1 
ATOM   7657  C CD1 . LEU D 1 213 ? -30.226 33.594  16.524  1.00 49.73  ? 211 LEU D CD1 1 
ATOM   7658  C CD2 . LEU D 1 213 ? -31.358 35.792  16.322  1.00 50.67  ? 211 LEU D CD2 1 
ATOM   7659  N N   . GLY D 1 214 ? -28.916 32.912  12.860  1.00 44.96  ? 212 GLY D N   1 
ATOM   7660  C CA  . GLY D 1 214 ? -29.313 31.611  12.363  1.00 42.92  ? 212 GLY D CA  1 
ATOM   7661  C C   . GLY D 1 214 ? -28.146 30.628  12.342  1.00 41.12  ? 212 GLY D C   1 
ATOM   7662  O O   . GLY D 1 214 ? -28.162 29.598  13.008  1.00 36.95  ? 212 GLY D O   1 
ATOM   7663  N N   . ALA D 1 215 ? -27.117 30.963  11.573  1.00 43.15  ? 213 ALA D N   1 
ATOM   7664  C CA  . ALA D 1 215 ? -25.958 30.089  11.434  1.00 46.00  ? 213 ALA D CA  1 
ATOM   7665  C C   . ALA D 1 215 ? -25.403 29.707  12.794  1.00 46.73  ? 213 ALA D C   1 
ATOM   7666  O O   . ALA D 1 215 ? -24.891 28.605  12.982  1.00 49.31  ? 213 ALA D O   1 
ATOM   7667  C CB  . ALA D 1 215 ? -24.870 30.768  10.563  1.00 37.79  ? 213 ALA D CB  1 
ATOM   7668  N N   . ALA D 1 216 ? -25.524 30.618  13.751  1.00 48.49  ? 214 ALA D N   1 
ATOM   7669  C CA  . ALA D 1 216 ? -25.022 30.378  15.101  1.00 46.28  ? 214 ALA D CA  1 
ATOM   7670  C C   . ALA D 1 216 ? -25.847 29.272  15.680  1.00 43.49  ? 214 ALA D C   1 
ATOM   7671  O O   . ALA D 1 216 ? -25.353 28.167  15.804  1.00 42.49  ? 214 ALA D O   1 
ATOM   7672  C CB  . ALA D 1 216 ? -25.165 31.643  15.959  1.00 44.60  ? 214 ALA D CB  1 
ATOM   7673  N N   . LYS D 1 217 ? -27.094 29.590  16.035  1.00 42.81  ? 215 LYS D N   1 
ATOM   7674  C CA  . LYS D 1 217 ? -28.034 28.626  16.600  1.00 43.66  ? 215 LYS D CA  1 
ATOM   7675  C C   . LYS D 1 217 ? -27.824 27.287  15.904  1.00 49.53  ? 215 LYS D C   1 
ATOM   7676  O O   . LYS D 1 217 ? -27.592 26.243  16.525  1.00 47.84  ? 215 LYS D O   1 
ATOM   7677  C CB  . LYS D 1 217 ? -29.445 29.077  16.328  1.00 40.52  ? 215 LYS D CB  1 
ATOM   7678  C CG  . LYS D 1 217 ? -30.501 28.293  17.033  1.00 43.89  ? 215 LYS D CG  1 
ATOM   7679  C CD  . LYS D 1 217 ? -31.038 29.117  18.202  1.00 61.83  ? 215 LYS D CD  1 
ATOM   7680  C CE  . LYS D 1 217 ? -32.557 29.394  18.139  1.00 67.16  ? 215 LYS D CE  1 
ATOM   7681  N NZ  . LYS D 1 217 ? -33.335 28.141  18.447  1.00 72.17  ? 215 LYS D NZ  1 
ATOM   7682  N N   . MET D 1 218 ? -27.870 27.348  14.579  1.00 53.70  ? 216 MET D N   1 
ATOM   7683  C CA  . MET D 1 218 ? -27.687 26.186  13.710  1.00 59.08  ? 216 MET D CA  1 
ATOM   7684  C C   . MET D 1 218 ? -26.454 25.359  14.080  1.00 59.94  ? 216 MET D C   1 
ATOM   7685  O O   . MET D 1 218 ? -26.482 24.117  14.145  1.00 56.50  ? 216 MET D O   1 
ATOM   7686  C CB  . MET D 1 218 ? -27.554 26.652  12.253  1.00 61.82  ? 216 MET D CB  1 
ATOM   7687  C CG  . MET D 1 218 ? -28.027 25.618  11.246  1.00 63.67  ? 216 MET D CG  1 
ATOM   7688  S SD  . MET D 1 218 ? -27.867 26.223  9.587   1.00 72.95  ? 216 MET D SD  1 
ATOM   7689  C CE  . MET D 1 218 ? -26.943 24.817  8.811   1.00 72.66  ? 216 MET D CE  1 
ATOM   7690  N N   . LEU D 1 219 ? -25.360 26.073  14.280  1.00 63.40  ? 217 LEU D N   1 
ATOM   7691  C CA  . LEU D 1 219 ? -24.114 25.443  14.638  1.00 65.58  ? 217 LEU D CA  1 
ATOM   7692  C C   . LEU D 1 219 ? -24.203 24.972  16.067  1.00 66.97  ? 217 LEU D C   1 
ATOM   7693  O O   . LEU D 1 219 ? -23.837 23.848  16.344  1.00 71.56  ? 217 LEU D O   1 
ATOM   7694  C CB  . LEU D 1 219 ? -22.937 26.419  14.464  1.00 66.89  ? 217 LEU D CB  1 
ATOM   7695  C CG  . LEU D 1 219 ? -21.644 26.203  15.280  1.00 64.24  ? 217 LEU D CG  1 
ATOM   7696  C CD1 . LEU D 1 219 ? -21.212 24.755  15.277  1.00 56.29  ? 217 LEU D CD1 1 
ATOM   7697  C CD2 . LEU D 1 219 ? -20.531 27.080  14.705  1.00 62.94  ? 217 LEU D CD2 1 
ATOM   7698  N N   . LEU D 1 220 ? -24.699 25.800  16.981  1.00 68.12  ? 218 LEU D N   1 
ATOM   7699  C CA  . LEU D 1 220 ? -24.769 25.381  18.387  1.00 68.76  ? 218 LEU D CA  1 
ATOM   7700  C C   . LEU D 1 220 ? -25.512 24.054  18.584  1.00 69.95  ? 218 LEU D C   1 
ATOM   7701  O O   . LEU D 1 220 ? -25.072 23.197  19.375  1.00 71.37  ? 218 LEU D O   1 
ATOM   7702  C CB  . LEU D 1 220 ? -25.399 26.488  19.278  1.00 63.81  ? 218 LEU D CB  1 
ATOM   7703  C CG  . LEU D 1 220 ? -24.500 27.694  19.598  1.00 62.68  ? 218 LEU D CG  1 
ATOM   7704  C CD1 . LEU D 1 220 ? -25.259 28.728  20.428  1.00 63.21  ? 218 LEU D CD1 1 
ATOM   7705  C CD2 . LEU D 1 220 ? -23.250 27.201  20.312  1.00 57.78  ? 218 LEU D CD2 1 
ATOM   7706  N N   . HIS D 1 221 ? -26.611 23.867  17.853  1.00 69.08  ? 219 HIS D N   1 
ATOM   7707  C CA  . HIS D 1 221 ? -27.411 22.653  18.004  1.00 70.76  ? 219 HIS D CA  1 
ATOM   7708  C C   . HIS D 1 221 ? -26.975 21.538  17.054  1.00 70.34  ? 219 HIS D C   1 
ATOM   7709  O O   . HIS D 1 221 ? -27.832 20.920  16.464  1.00 72.92  ? 219 HIS D O   1 
ATOM   7710  C CB  . HIS D 1 221 ? -28.907 22.948  17.753  1.00 74.14  ? 219 HIS D CB  1 
ATOM   7711  C CG  . HIS D 1 221 ? -29.462 24.094  18.556  1.00 79.61  ? 219 HIS D CG  1 
ATOM   7712  N ND1 . HIS D 1 221 ? -28.928 25.367  18.515  1.00 83.71  ? 219 HIS D ND1 1 
ATOM   7713  C CD2 . HIS D 1 221 ? -30.535 24.169  19.380  1.00 80.83  ? 219 HIS D CD2 1 
ATOM   7714  C CE1 . HIS D 1 221 ? -29.648 26.173  19.278  1.00 84.81  ? 219 HIS D CE1 1 
ATOM   7715  N NE2 . HIS D 1 221 ? -30.629 25.472  19.815  1.00 81.85  ? 219 HIS D NE2 1 
ATOM   7716  N N   . SER D 1 222 ? -25.678 21.272  16.897  1.00 70.97  ? 220 SER D N   1 
ATOM   7717  C CA  . SER D 1 222 ? -25.214 20.212  15.997  1.00 73.63  ? 220 SER D CA  1 
ATOM   7718  C C   . SER D 1 222 ? -23.740 20.082  16.116  1.00 79.75  ? 220 SER D C   1 
ATOM   7719  O O   . SER D 1 222 ? -23.034 21.034  15.891  1.00 82.22  ? 220 SER D O   1 
ATOM   7720  C CB  . SER D 1 222 ? -25.511 20.552  14.546  1.00 73.94  ? 220 SER D CB  1 
ATOM   7721  O OG  . SER D 1 222 ? -24.662 21.591  14.075  1.00 68.78  ? 220 SER D OG  1 
ATOM   7722  N N   . GLU D 1 223 ? -23.229 18.915  16.442  1.00 88.77  ? 221 GLU D N   1 
ATOM   7723  C CA  . GLU D 1 223 ? -21.779 18.852  16.552  1.00 99.78  ? 221 GLU D CA  1 
ATOM   7724  C C   . GLU D 1 223 ? -21.114 18.647  15.186  1.00 99.43  ? 221 GLU D C   1 
ATOM   7725  O O   . GLU D 1 223 ? -20.135 17.914  15.054  1.00 101.43 ? 221 GLU D O   1 
ATOM   7726  C CB  . GLU D 1 223 ? -21.376 17.762  17.533  1.00 110.18 ? 221 GLU D CB  1 
ATOM   7727  C CG  . GLU D 1 223 ? -22.089 16.449  17.301  1.00 127.56 ? 221 GLU D CG  1 
ATOM   7728  C CD  . GLU D 1 223 ? -21.571 15.353  18.199  1.00 136.31 ? 221 GLU D CD  1 
ATOM   7729  O OE1 . GLU D 1 223 ? -20.356 15.058  18.126  1.00 141.71 ? 221 GLU D OE1 1 
ATOM   7730  O OE2 . GLU D 1 223 ? -22.380 14.779  18.963  1.00 142.89 ? 221 GLU D OE2 1 
ATOM   7731  N N   . GLN D 1 224 ? -21.639 19.358  14.187  1.00 97.42  ? 222 GLN D N   1 
ATOM   7732  C CA  . GLN D 1 224 ? -21.168 19.303  12.799  1.00 93.35  ? 222 GLN D CA  1 
ATOM   7733  C C   . GLN D 1 224 ? -19.720 19.683  12.464  1.00 88.87  ? 222 GLN D C   1 
ATOM   7734  O O   . GLN D 1 224 ? -19.012 18.896  11.826  1.00 90.87  ? 222 GLN D O   1 
ATOM   7735  C CB  . GLN D 1 224 ? -22.104 20.131  11.910  1.00 95.81  ? 222 GLN D CB  1 
ATOM   7736  C CG  . GLN D 1 224 ? -23.488 19.522  11.757  1.00 100.57 ? 222 GLN D CG  1 
ATOM   7737  C CD  . GLN D 1 224 ? -23.439 18.056  11.311  1.00 105.02 ? 222 GLN D CD  1 
ATOM   7738  O OE1 . GLN D 1 224 ? -22.830 17.714  10.284  1.00 103.32 ? 222 GLN D OE1 1 
ATOM   7739  N NE2 . GLN D 1 224 ? -24.092 17.184  12.082  1.00 108.36 ? 222 GLN D NE2 1 
ATOM   7740  N N   . HIS D 1 225 ? -19.311 20.884  12.881  1.00 81.10  ? 223 HIS D N   1 
ATOM   7741  C CA  . HIS D 1 225 ? -17.981 21.492  12.648  1.00 76.05  ? 223 HIS D CA  1 
ATOM   7742  C C   . HIS D 1 225 ? -18.166 22.584  11.591  1.00 75.43  ? 223 HIS D C   1 
ATOM   7743  O O   . HIS D 1 225 ? -18.847 22.375  10.583  1.00 76.24  ? 223 HIS D O   1 
ATOM   7744  C CB  . HIS D 1 225 ? -16.944 20.461  12.176  1.00 69.22  ? 223 HIS D CB  1 
ATOM   7745  C CG  . HIS D 1 225 ? -15.614 21.050  11.827  1.00 62.70  ? 223 HIS D CG  1 
ATOM   7746  N ND1 . HIS D 1 225 ? -15.460 21.986  10.832  1.00 62.70  ? 223 HIS D ND1 1 
ATOM   7747  C CD2 . HIS D 1 225 ? -14.378 20.849  12.345  1.00 64.60  ? 223 HIS D CD2 1 
ATOM   7748  C CE1 . HIS D 1 225 ? -14.190 22.341  10.753  1.00 62.56  ? 223 HIS D CE1 1 
ATOM   7749  N NE2 . HIS D 1 225 ? -13.511 21.666  11.661  1.00 61.62  ? 223 HIS D NE2 1 
ATOM   7750  N N   . PRO D 1 226 ? -17.554 23.765  11.798  1.00 74.23  ? 224 PRO D N   1 
ATOM   7751  C CA  . PRO D 1 226 ? -17.710 24.856  10.826  1.00 71.74  ? 224 PRO D CA  1 
ATOM   7752  C C   . PRO D 1 226 ? -17.666 24.461  9.348   1.00 67.97  ? 224 PRO D C   1 
ATOM   7753  O O   . PRO D 1 226 ? -18.701 24.434  8.664   1.00 64.30  ? 224 PRO D O   1 
ATOM   7754  C CB  . PRO D 1 226 ? -16.586 25.826  11.208  1.00 75.29  ? 224 PRO D CB  1 
ATOM   7755  C CG  . PRO D 1 226 ? -16.465 25.627  12.700  1.00 74.35  ? 224 PRO D CG  1 
ATOM   7756  C CD  . PRO D 1 226 ? -16.539 24.109  12.814  1.00 75.10  ? 224 PRO D CD  1 
ATOM   7757  N N   . GLY D 1 227 ? -16.456 24.166  8.871   1.00 66.44  ? 225 GLY D N   1 
ATOM   7758  C CA  . GLY D 1 227 ? -16.241 23.794  7.483   1.00 63.96  ? 225 GLY D CA  1 
ATOM   7759  C C   . GLY D 1 227 ? -17.350 22.984  6.852   1.00 61.48  ? 225 GLY D C   1 
ATOM   7760  O O   . GLY D 1 227 ? -17.663 23.158  5.679   1.00 59.12  ? 225 GLY D O   1 
ATOM   7761  N N   . GLN D 1 228 ? -17.939 22.088  7.633   1.00 59.40  ? 226 GLN D N   1 
ATOM   7762  C CA  . GLN D 1 228 ? -19.005 21.227  7.145   1.00 57.36  ? 226 GLN D CA  1 
ATOM   7763  C C   . GLN D 1 228 ? -20.231 21.995  6.677   1.00 51.62  ? 226 GLN D C   1 
ATOM   7764  O O   . GLN D 1 228 ? -20.491 22.081  5.471   1.00 54.89  ? 226 GLN D O   1 
ATOM   7765  C CB  . GLN D 1 228 ? -19.407 20.239  8.226   1.00 65.68  ? 226 GLN D CB  1 
ATOM   7766  C CG  . GLN D 1 228 ? -20.250 19.047  7.735   1.00 72.80  ? 226 GLN D CG  1 
ATOM   7767  C CD  . GLN D 1 228 ? -19.602 18.307  6.562   1.00 77.20  ? 226 GLN D CD  1 
ATOM   7768  O OE1 . GLN D 1 228 ? -18.424 17.951  6.608   1.00 81.48  ? 226 GLN D OE1 1 
ATOM   7769  N NE2 . GLN D 1 228 ? -20.373 18.077  5.507   1.00 77.66  ? 226 GLN D NE2 1 
ATOM   7770  N N   . LEU D 1 229 ? -20.987 22.531  7.628   1.00 43.91  ? 227 LEU D N   1 
ATOM   7771  C CA  . LEU D 1 229 ? -22.165 23.332  7.318   1.00 42.90  ? 227 LEU D CA  1 
ATOM   7772  C C   . LEU D 1 229 ? -21.883 24.386  6.253   1.00 44.43  ? 227 LEU D C   1 
ATOM   7773  O O   . LEU D 1 229 ? -22.773 24.772  5.472   1.00 41.50  ? 227 LEU D O   1 
ATOM   7774  C CB  . LEU D 1 229 ? -22.624 24.063  8.551   1.00 41.96  ? 227 LEU D CB  1 
ATOM   7775  C CG  . LEU D 1 229 ? -22.947 23.134  9.684   1.00 47.67  ? 227 LEU D CG  1 
ATOM   7776  C CD1 . LEU D 1 229 ? -23.436 23.915  10.885  1.00 49.59  ? 227 LEU D CD1 1 
ATOM   7777  C CD2 . LEU D 1 229 ? -23.998 22.172  9.189   1.00 49.91  ? 227 LEU D CD2 1 
ATOM   7778  N N   . LYS D 1 230 ? -20.654 24.895  6.282   1.00 46.10  ? 228 LYS D N   1 
ATOM   7779  C CA  . LYS D 1 230 ? -20.227 25.883  5.317   1.00 46.81  ? 228 LYS D CA  1 
ATOM   7780  C C   . LYS D 1 230 ? -20.545 25.195  3.964   1.00 48.15  ? 228 LYS D C   1 
ATOM   7781  O O   . LYS D 1 230 ? -21.384 25.672  3.176   1.00 43.26  ? 228 LYS D O   1 
ATOM   7782  C CB  . LYS D 1 230 ? -18.725 26.128  5.509   1.00 47.56  ? 228 LYS D CB  1 
ATOM   7783  C CG  . LYS D 1 230 ? -18.144 27.287  4.731   1.00 52.96  ? 228 LYS D CG  1 
ATOM   7784  C CD  . LYS D 1 230 ? -16.649 27.112  4.455   1.00 58.28  ? 228 LYS D CD  1 
ATOM   7785  C CE  . LYS D 1 230 ? -16.401 26.377  3.128   1.00 62.05  ? 228 LYS D CE  1 
ATOM   7786  N NZ  . LYS D 1 230 ? -14.985 26.485  2.664   1.00 67.71  ? 228 LYS D NZ  1 
ATOM   7787  N N   . ASP D 1 231 ? -19.894 24.047  3.736   1.00 49.27  ? 229 ASP D N   1 
ATOM   7788  C CA  . ASP D 1 231 ? -20.079 23.246  2.535   1.00 49.32  ? 229 ASP D CA  1 
ATOM   7789  C C   . ASP D 1 231 ? -21.539 23.139  2.166   1.00 51.60  ? 229 ASP D C   1 
ATOM   7790  O O   . ASP D 1 231 ? -21.947 23.477  1.059   1.00 53.90  ? 229 ASP D O   1 
ATOM   7791  C CB  . ASP D 1 231 ? -19.524 21.866  2.774   1.00 52.80  ? 229 ASP D CB  1 
ATOM   7792  C CG  . ASP D 1 231 ? -18.032 21.896  2.967   1.00 64.45  ? 229 ASP D CG  1 
ATOM   7793  O OD1 . ASP D 1 231 ? -17.408 22.778  2.318   1.00 66.71  ? 229 ASP D OD1 1 
ATOM   7794  O OD2 . ASP D 1 231 ? -17.475 21.063  3.742   1.00 69.04  ? 229 ASP D OD2 1 
ATOM   7795  N N   . ASN D 1 232 ? -22.317 22.664  3.119   1.00 47.09  ? 230 ASN D N   1 
ATOM   7796  C CA  . ASN D 1 232 ? -23.737 22.510  2.951   1.00 51.57  ? 230 ASN D CA  1 
ATOM   7797  C C   . ASN D 1 232 ? -24.454 23.687  2.351   1.00 55.55  ? 230 ASN D C   1 
ATOM   7798  O O   . ASN D 1 232 ? -25.545 23.533  1.792   1.00 53.39  ? 230 ASN D O   1 
ATOM   7799  C CB  . ASN D 1 232 ? -24.366 22.239  4.288   1.00 51.50  ? 230 ASN D CB  1 
ATOM   7800  C CG  . ASN D 1 232 ? -24.054 20.879  4.777   1.00 58.20  ? 230 ASN D CG  1 
ATOM   7801  O OD1 . ASN D 1 232 ? -23.062 20.271  4.344   1.00 57.29  ? 230 ASN D OD1 1 
ATOM   7802  N ND2 . ASN D 1 232 ? -24.885 20.369  5.696   1.00 58.93  ? 230 ASN D ND2 1 
ATOM   7803  N N   . VAL D 1 233 ? -23.861 24.867  2.458   1.00 58.27  ? 231 VAL D N   1 
ATOM   7804  C CA  . VAL D 1 233 ? -24.545 26.051  1.947   1.00 65.84  ? 231 VAL D CA  1 
ATOM   7805  C C   . VAL D 1 233 ? -23.958 26.547  0.620   1.00 68.71  ? 231 VAL D C   1 
ATOM   7806  O O   . VAL D 1 233 ? -24.114 27.721  0.244   1.00 70.15  ? 231 VAL D O   1 
ATOM   7807  C CB  . VAL D 1 233 ? -24.517 27.220  3.002   1.00 66.15  ? 231 VAL D CB  1 
ATOM   7808  C CG1 . VAL D 1 233 ? -25.720 28.129  2.815   1.00 65.33  ? 231 VAL D CG1 1 
ATOM   7809  C CG2 . VAL D 1 233 ? -24.503 26.661  4.406   1.00 66.80  ? 231 VAL D CG2 1 
ATOM   7810  N N   . SER D 1 234 ? -23.308 25.646  -0.108  1.00 68.75  ? 232 SER D N   1 
ATOM   7811  C CA  . SER D 1 234 ? -22.679 26.043  -1.357  1.00 68.42  ? 232 SER D CA  1 
ATOM   7812  C C   . SER D 1 234 ? -22.920 25.169  -2.583  1.00 68.04  ? 232 SER D C   1 
ATOM   7813  O O   . SER D 1 234 ? -22.208 24.187  -2.754  1.00 69.41  ? 232 SER D O   1 
ATOM   7814  C CB  . SER D 1 234 ? -21.171 26.137  -1.138  1.00 67.65  ? 232 SER D CB  1 
ATOM   7815  O OG  . SER D 1 234 ? -20.876 27.081  -0.132  1.00 71.45  ? 232 SER D OG  1 
ATOM   7816  N N   . SER D 1 235 ? -23.897 25.518  -3.433  1.00 68.75  ? 233 SER D N   1 
ATOM   7817  C CA  . SER D 1 235 ? -24.159 24.778  -4.696  1.00 66.47  ? 233 SER D CA  1 
ATOM   7818  C C   . SER D 1 235 ? -22.894 24.971  -5.570  1.00 61.33  ? 233 SER D C   1 
ATOM   7819  O O   . SER D 1 235 ? -22.461 26.111  -5.793  1.00 57.94  ? 233 SER D O   1 
ATOM   7820  C CB  . SER D 1 235 ? -25.416 25.334  -5.398  1.00 75.33  ? 233 SER D CB  1 
ATOM   7821  O OG  . SER D 1 235 ? -25.474 26.765  -5.367  1.00 77.19  ? 233 SER D OG  1 
ATOM   7822  N N   . PRO D 1 236 ? -22.314 23.867  -6.104  1.00 55.71  ? 234 PRO D N   1 
ATOM   7823  C CA  . PRO D 1 236 ? -21.096 23.961  -6.913  1.00 54.57  ? 234 PRO D CA  1 
ATOM   7824  C C   . PRO D 1 236 ? -21.017 25.134  -7.869  1.00 57.01  ? 234 PRO D C   1 
ATOM   7825  O O   . PRO D 1 236 ? -19.933 25.535  -8.310  1.00 57.05  ? 234 PRO D O   1 
ATOM   7826  C CB  . PRO D 1 236 ? -21.040 22.596  -7.599  1.00 53.95  ? 234 PRO D CB  1 
ATOM   7827  C CG  . PRO D 1 236 ? -21.615 21.694  -6.563  1.00 50.89  ? 234 PRO D CG  1 
ATOM   7828  C CD  . PRO D 1 236 ? -22.851 22.500  -6.182  1.00 53.25  ? 234 PRO D CD  1 
ATOM   7829  N N   . GLY D 1 237 ? -22.182 25.701  -8.166  1.00 60.52  ? 235 GLY D N   1 
ATOM   7830  C CA  . GLY D 1 237 ? -22.275 26.824  -9.080  1.00 56.03  ? 235 GLY D CA  1 
ATOM   7831  C C   . GLY D 1 237 ? -21.645 28.077  -8.559  1.00 52.42  ? 235 GLY D C   1 
ATOM   7832  O O   . GLY D 1 237 ? -20.579 28.476  -8.997  1.00 52.18  ? 235 GLY D O   1 
ATOM   7833  N N   . GLY D 1 238 ? -22.301 28.722  -7.621  1.00 51.17  ? 236 GLY D N   1 
ATOM   7834  C CA  . GLY D 1 238 ? -21.706 29.929  -7.133  1.00 52.34  ? 236 GLY D CA  1 
ATOM   7835  C C   . GLY D 1 238 ? -22.508 30.759  -6.167  1.00 57.69  ? 236 GLY D C   1 
ATOM   7836  O O   . GLY D 1 238 ? -23.056 30.243  -5.189  1.00 60.15  ? 236 GLY D O   1 
ATOM   7837  N N   . ALA D 1 239 ? -22.546 32.064  -6.450  1.00 58.58  ? 237 ALA D N   1 
ATOM   7838  C CA  . ALA D 1 239 ? -23.203 33.037  -5.606  1.00 56.31  ? 237 ALA D CA  1 
ATOM   7839  C C   . ALA D 1 239 ? -22.333 33.013  -4.332  1.00 55.92  ? 237 ALA D C   1 
ATOM   7840  O O   . ALA D 1 239 ? -21.389 33.799  -4.208  1.00 55.83  ? 237 ALA D O   1 
ATOM   7841  C CB  . ALA D 1 239 ? -24.647 32.599  -5.312  1.00 58.08  ? 237 ALA D CB  1 
ATOM   7842  N N   . THR D 1 240 ? -22.643 32.065  -3.443  1.00 51.32  ? 238 THR D N   1 
ATOM   7843  C CA  . THR D 1 240 ? -21.981 31.838  -2.167  1.00 44.86  ? 238 THR D CA  1 
ATOM   7844  C C   . THR D 1 240 ? -20.484 31.586  -2.219  1.00 44.31  ? 238 THR D C   1 
ATOM   7845  O O   . THR D 1 240 ? -19.670 32.347  -1.717  1.00 44.31  ? 238 THR D O   1 
ATOM   7846  C CB  . THR D 1 240 ? -22.604 30.642  -1.486  1.00 44.37  ? 238 THR D CB  1 
ATOM   7847  O OG1 . THR D 1 240 ? -23.963 30.946  -1.175  1.00 39.22  ? 238 THR D OG1 1 
ATOM   7848  C CG2 . THR D 1 240 ? -21.821 30.255  -0.222  1.00 45.42  ? 238 THR D CG2 1 
ATOM   7849  N N   . ILE D 1 241 ? -20.118 30.484  -2.818  1.00 43.32  ? 239 ILE D N   1 
ATOM   7850  C CA  . ILE D 1 241 ? -18.716 30.120  -2.902  1.00 43.25  ? 239 ILE D CA  1 
ATOM   7851  C C   . ILE D 1 241 ? -17.876 31.245  -3.472  1.00 41.76  ? 239 ILE D C   1 
ATOM   7852  O O   . ILE D 1 241 ? -16.740 31.504  -3.056  1.00 45.12  ? 239 ILE D O   1 
ATOM   7853  C CB  . ILE D 1 241 ? -18.536 28.892  -3.792  1.00 36.45  ? 239 ILE D CB  1 
ATOM   7854  C CG1 . ILE D 1 241 ? -19.616 27.853  -3.448  1.00 42.04  ? 239 ILE D CG1 1 
ATOM   7855  C CG2 . ILE D 1 241 ? -17.145 28.371  -3.631  1.00 28.08  ? 239 ILE D CG2 1 
ATOM   7856  C CD1 . ILE D 1 241 ? -21.152 28.325  -3.619  1.00 41.83  ? 239 ILE D CD1 1 
ATOM   7857  N N   . HIS D 1 242 ? -18.434 31.911  -4.451  1.00 35.83  ? 240 HIS D N   1 
ATOM   7858  C CA  . HIS D 1 242 ? -17.726 32.995  -5.082  1.00 38.58  ? 240 HIS D CA  1 
ATOM   7859  C C   . HIS D 1 242 ? -17.439 34.014  -4.015  1.00 36.79  ? 240 HIS D C   1 
ATOM   7860  O O   . HIS D 1 242 ? -16.356 34.628  -4.026  1.00 36.22  ? 240 HIS D O   1 
ATOM   7861  C CB  . HIS D 1 242 ? -18.583 33.561  -6.230  1.00 47.11  ? 240 HIS D CB  1 
ATOM   7862  C CG  . HIS D 1 242 ? -18.424 32.796  -7.514  1.00 53.02  ? 240 HIS D CG  1 
ATOM   7863  N ND1 . HIS D 1 242 ? -17.433 33.071  -8.436  1.00 56.78  ? 240 HIS D ND1 1 
ATOM   7864  C CD2 . HIS D 1 242 ? -19.039 31.673  -7.954  1.00 55.26  ? 240 HIS D CD2 1 
ATOM   7865  C CE1 . HIS D 1 242 ? -17.441 32.145  -9.382  1.00 56.84  ? 240 HIS D CE1 1 
ATOM   7866  N NE2 . HIS D 1 242 ? -18.404 31.283  -9.112  1.00 57.28  ? 240 HIS D NE2 1 
ATOM   7867  N N   . ALA D 1 243 ? -18.428 34.209  -3.123  1.00 29.76  ? 241 ALA D N   1 
ATOM   7868  C CA  . ALA D 1 243 ? -18.289 35.132  -1.993  1.00 24.28  ? 241 ALA D CA  1 
ATOM   7869  C C   . ALA D 1 243 ? -17.106 34.568  -1.169  1.00 26.24  ? 241 ALA D C   1 
ATOM   7870  O O   . ALA D 1 243 ? -16.037 35.159  -1.113  1.00 24.04  ? 241 ALA D O   1 
ATOM   7871  C CB  . ALA D 1 243 ? -19.574 35.165  -1.162  1.00 13.84  ? 241 ALA D CB  1 
ATOM   7872  N N   . LEU D 1 244 ? -17.295 33.379  -0.609  1.00 29.00  ? 242 LEU D N   1 
ATOM   7873  C CA  . LEU D 1 244 ? -16.264 32.715  0.159   1.00 28.79  ? 242 LEU D CA  1 
ATOM   7874  C C   . LEU D 1 244 ? -14.860 32.870  -0.407  1.00 31.97  ? 242 LEU D C   1 
ATOM   7875  O O   . LEU D 1 244 ? -13.934 33.237  0.319   1.00 37.91  ? 242 LEU D O   1 
ATOM   7876  C CB  . LEU D 1 244 ? -16.579 31.240  0.309   1.00 30.50  ? 242 LEU D CB  1 
ATOM   7877  C CG  . LEU D 1 244 ? -17.886 30.953  1.042   1.00 32.58  ? 242 LEU D CG  1 
ATOM   7878  C CD1 . LEU D 1 244 ? -18.035 29.460  1.351   1.00 34.15  ? 242 LEU D CD1 1 
ATOM   7879  C CD2 . LEU D 1 244 ? -17.898 31.740  2.306   1.00 31.01  ? 242 LEU D CD2 1 
ATOM   7880  N N   . HIS D 1 245 ? -14.658 32.630  -1.692  1.00 30.95  ? 243 HIS D N   1 
ATOM   7881  C CA  . HIS D 1 245 ? -13.302 32.779  -2.233  1.00 34.25  ? 243 HIS D CA  1 
ATOM   7882  C C   . HIS D 1 245 ? -12.875 34.261  -2.130  1.00 33.82  ? 243 HIS D C   1 
ATOM   7883  O O   . HIS D 1 245 ? -11.691 34.617  -2.120  1.00 29.99  ? 243 HIS D O   1 
ATOM   7884  C CB  . HIS D 1 245 ? -13.269 32.306  -3.712  1.00 40.14  ? 243 HIS D CB  1 
ATOM   7885  C CG  . HIS D 1 245 ? -11.928 32.449  -4.404  1.00 41.63  ? 243 HIS D CG  1 
ATOM   7886  N ND1 . HIS D 1 245 ? -11.822 32.748  -5.749  1.00 44.35  ? 243 HIS D ND1 1 
ATOM   7887  C CD2 . HIS D 1 245 ? -10.652 32.325  -3.952  1.00 44.50  ? 243 HIS D CD2 1 
ATOM   7888  C CE1 . HIS D 1 245 ? -10.547 32.801  -6.093  1.00 44.14  ? 243 HIS D CE1 1 
ATOM   7889  N NE2 . HIS D 1 245 ? -9.815  32.547  -5.022  1.00 44.90  ? 243 HIS D NE2 1 
ATOM   7890  N N   . VAL D 1 246 ? -13.841 35.145  -2.043  1.00 29.12  ? 244 VAL D N   1 
ATOM   7891  C CA  . VAL D 1 246 ? -13.440 36.530  -1.993  1.00 33.25  ? 244 VAL D CA  1 
ATOM   7892  C C   . VAL D 1 246 ? -13.027 36.925  -0.587  1.00 35.14  ? 244 VAL D C   1 
ATOM   7893  O O   . VAL D 1 246 ? -12.047 37.670  -0.389  1.00 38.14  ? 244 VAL D O   1 
ATOM   7894  C CB  . VAL D 1 246 ? -14.562 37.431  -2.559  1.00 36.30  ? 244 VAL D CB  1 
ATOM   7895  C CG1 . VAL D 1 246 ? -15.168 38.364  -1.472  1.00 36.88  ? 244 VAL D CG1 1 
ATOM   7896  C CG2 . VAL D 1 246 ? -14.009 38.188  -3.721  1.00 33.94  ? 244 VAL D CG2 1 
ATOM   7897  N N   . LEU D 1 247 ? -13.797 36.441  0.388   1.00 35.04  ? 245 LEU D N   1 
ATOM   7898  C CA  . LEU D 1 247 ? -13.512 36.670  1.798   1.00 37.74  ? 245 LEU D CA  1 
ATOM   7899  C C   . LEU D 1 247 ? -12.170 35.965  1.949   1.00 42.60  ? 245 LEU D C   1 
ATOM   7900  O O   . LEU D 1 247 ? -11.193 36.521  2.422   1.00 49.04  ? 245 LEU D O   1 
ATOM   7901  C CB  . LEU D 1 247 ? -14.518 35.958  2.722   1.00 28.13  ? 245 LEU D CB  1 
ATOM   7902  C CG  . LEU D 1 247 ? -15.923 36.520  2.966   1.00 32.90  ? 245 LEU D CG  1 
ATOM   7903  C CD1 . LEU D 1 247 ? -16.526 35.689  4.053   1.00 23.52  ? 245 LEU D CD1 1 
ATOM   7904  C CD2 . LEU D 1 247 ? -15.925 38.011  3.369   1.00 25.64  ? 245 LEU D CD2 1 
ATOM   7905  N N   . GLU D 1 248 ? -12.122 34.725  1.510   1.00 37.93  ? 246 GLU D N   1 
ATOM   7906  C CA  . GLU D 1 248 ? -10.909 33.954  1.631   1.00 37.71  ? 246 GLU D CA  1 
ATOM   7907  C C   . GLU D 1 248 ? -9.737  34.750  1.168   1.00 37.01  ? 246 GLU D C   1 
ATOM   7908  O O   . GLU D 1 248 ? -8.679  34.698  1.761   1.00 44.21  ? 246 GLU D O   1 
ATOM   7909  C CB  . GLU D 1 248 ? -11.016 32.676  0.788   1.00 41.82  ? 246 GLU D CB  1 
ATOM   7910  C CG  . GLU D 1 248 ? -10.373 31.444  1.438   1.00 41.07  ? 246 GLU D CG  1 
ATOM   7911  C CD  . GLU D 1 248 ? -11.026 31.050  2.767   1.00 47.30  ? 246 GLU D CD  1 
ATOM   7912  O OE1 . GLU D 1 248 ? -10.356 30.291  3.515   1.00 56.96  ? 246 GLU D OE1 1 
ATOM   7913  O OE2 . GLU D 1 248 ? -12.187 31.471  3.065   1.00 28.75  ? 246 GLU D OE2 1 
ATOM   7914  N N   . SER D 1 249 ? -9.923  35.496  0.096   1.00 40.14  ? 247 SER D N   1 
ATOM   7915  C CA  . SER D 1 249 ? -8.829  36.251  -0.480  1.00 42.64  ? 247 SER D CA  1 
ATOM   7916  C C   . SER D 1 249 ? -8.354  37.503  0.240   1.00 44.96  ? 247 SER D C   1 
ATOM   7917  O O   . SER D 1 249 ? -7.372  38.119  -0.160  1.00 44.44  ? 247 SER D O   1 
ATOM   7918  C CB  . SER D 1 249 ? -9.168  36.548  -1.933  1.00 44.77  ? 247 SER D CB  1 
ATOM   7919  O OG  . SER D 1 249 ? -9.011  35.376  -2.719  1.00 37.17  ? 247 SER D OG  1 
ATOM   7920  N N   . GLY D 1 250 ? -9.045  37.863  1.309   1.00 47.75  ? 248 GLY D N   1 
ATOM   7921  C CA  . GLY D 1 250 ? -8.669  39.024  2.082   1.00 48.54  ? 248 GLY D CA  1 
ATOM   7922  C C   . GLY D 1 250 ? -8.025  38.568  3.371   1.00 52.32  ? 248 GLY D C   1 
ATOM   7923  O O   . GLY D 1 250 ? -7.573  39.382  4.197   1.00 57.91  ? 248 GLY D O   1 
ATOM   7924  N N   . GLY D 1 251 ? -7.975  37.245  3.523   1.00 53.31  ? 249 GLY D N   1 
ATOM   7925  C CA  . GLY D 1 251 ? -7.411  36.622  4.713   1.00 53.63  ? 249 GLY D CA  1 
ATOM   7926  C C   . GLY D 1 251 ? -8.363  36.801  5.888   1.00 50.45  ? 249 GLY D C   1 
ATOM   7927  O O   . GLY D 1 251 ? -7.948  36.950  7.054   1.00 55.92  ? 249 GLY D O   1 
ATOM   7928  N N   . PHE D 1 252 ? -9.651  36.790  5.584   1.00 43.31  ? 250 PHE D N   1 
ATOM   7929  C CA  . PHE D 1 252 ? -10.683 36.986  6.584   1.00 38.74  ? 250 PHE D CA  1 
ATOM   7930  C C   . PHE D 1 252 ? -10.526 36.113  7.828   1.00 40.01  ? 250 PHE D C   1 
ATOM   7931  O O   . PHE D 1 252 ? -10.866 36.535  8.940   1.00 38.40  ? 250 PHE D O   1 
ATOM   7932  C CB  . PHE D 1 252 ? -12.020 36.755  5.886   1.00 33.00  ? 250 PHE D CB  1 
ATOM   7933  C CG  . PHE D 1 252 ? -13.233 36.944  6.745   1.00 24.78  ? 250 PHE D CG  1 
ATOM   7934  C CD1 . PHE D 1 252 ? -13.595 38.203  7.201   1.00 20.37  ? 250 PHE D CD1 1 
ATOM   7935  C CD2 . PHE D 1 252 ? -14.097 35.879  6.977   1.00 23.19  ? 250 PHE D CD2 1 
ATOM   7936  C CE1 . PHE D 1 252 ? -14.830 38.416  7.882   1.00 18.15  ? 250 PHE D CE1 1 
ATOM   7937  C CE2 . PHE D 1 252 ? -15.317 36.084  7.646   1.00 18.57  ? 250 PHE D CE2 1 
ATOM   7938  C CZ  . PHE D 1 252 ? -15.664 37.344  8.083   1.00 19.59  ? 250 PHE D CZ  1 
ATOM   7939  N N   . ARG D 1 253 ? -10.054 34.883  7.647   1.00 42.14  ? 251 ARG D N   1 
ATOM   7940  C CA  . ARG D 1 253 ? -9.876  34.003  8.796   1.00 42.33  ? 251 ARG D CA  1 
ATOM   7941  C C   . ARG D 1 253 ? -8.844  34.616  9.745   1.00 41.93  ? 251 ARG D C   1 
ATOM   7942  O O   . ARG D 1 253 ? -9.116  34.758  10.933  1.00 41.43  ? 251 ARG D O   1 
ATOM   7943  C CB  . ARG D 1 253 ? -9.409  32.623  8.349   1.00 38.56  ? 251 ARG D CB  1 
ATOM   7944  C CG  . ARG D 1 253 ? -10.467 31.769  7.786   1.00 44.48  ? 251 ARG D CG  1 
ATOM   7945  C CD  . ARG D 1 253 ? -9.859  30.451  7.402   1.00 46.53  ? 251 ARG D CD  1 
ATOM   7946  N NE  . ARG D 1 253 ? -10.802 29.555  6.770   1.00 46.39  ? 251 ARG D NE  1 
ATOM   7947  C CZ  . ARG D 1 253 ? -11.860 29.039  7.377   1.00 51.49  ? 251 ARG D CZ  1 
ATOM   7948  N NH1 . ARG D 1 253 ? -12.097 29.331  8.648   1.00 54.70  ? 251 ARG D NH1 1 
ATOM   7949  N NH2 . ARG D 1 253 ? -12.704 28.271  6.696   1.00 48.82  ? 251 ARG D NH2 1 
ATOM   7950  N N   . SER D 1 254 ? -7.675  34.994  9.224   1.00 39.57  ? 252 SER D N   1 
ATOM   7951  C CA  . SER D 1 254 ? -6.660  35.579  10.073  1.00 37.93  ? 252 SER D CA  1 
ATOM   7952  C C   . SER D 1 254 ? -7.200  36.800  10.818  1.00 39.44  ? 252 SER D C   1 
ATOM   7953  O O   . SER D 1 254 ? -7.299  36.803  12.034  1.00 42.28  ? 252 SER D O   1 
ATOM   7954  C CB  . SER D 1 254 ? -5.424  35.948  9.260   1.00 34.41  ? 252 SER D CB  1 
ATOM   7955  O OG  . SER D 1 254 ? -5.564  37.217  8.667   1.00 41.91  ? 252 SER D OG  1 
ATOM   7956  N N   . LEU D 1 255 ? -7.591  37.836  10.097  1.00 42.18  ? 253 LEU D N   1 
ATOM   7957  C CA  . LEU D 1 255 ? -8.130  39.046  10.746  1.00 44.44  ? 253 LEU D CA  1 
ATOM   7958  C C   . LEU D 1 255 ? -9.015  38.785  11.975  1.00 41.31  ? 253 LEU D C   1 
ATOM   7959  O O   . LEU D 1 255 ? -9.162  39.616  12.872  1.00 42.54  ? 253 LEU D O   1 
ATOM   7960  C CB  . LEU D 1 255 ? -8.961  39.859  9.747   1.00 47.98  ? 253 LEU D CB  1 
ATOM   7961  C CG  . LEU D 1 255 ? -8.281  40.267  8.443   1.00 47.99  ? 253 LEU D CG  1 
ATOM   7962  C CD1 . LEU D 1 255 ? -9.015  41.486  7.919   1.00 51.12  ? 253 LEU D CD1 1 
ATOM   7963  C CD2 . LEU D 1 255 ? -6.799  40.580  8.664   1.00 50.45  ? 253 LEU D CD2 1 
ATOM   7964  N N   . LEU D 1 256 ? -9.643  37.638  11.983  1.00 40.05  ? 254 LEU D N   1 
ATOM   7965  C CA  . LEU D 1 256 ? -10.498 37.303  13.072  1.00 45.28  ? 254 LEU D CA  1 
ATOM   7966  C C   . LEU D 1 256 ? -9.695  36.686  14.233  1.00 49.84  ? 254 LEU D C   1 
ATOM   7967  O O   . LEU D 1 256 ? -10.060 36.797  15.414  1.00 52.13  ? 254 LEU D O   1 
ATOM   7968  C CB  . LEU D 1 256 ? -11.553 36.347  12.572  1.00 46.58  ? 254 LEU D CB  1 
ATOM   7969  C CG  . LEU D 1 256 ? -12.712 37.067  11.918  1.00 45.34  ? 254 LEU D CG  1 
ATOM   7970  C CD1 . LEU D 1 256 ? -13.736 36.049  11.404  1.00 51.57  ? 254 LEU D CD1 1 
ATOM   7971  C CD2 . LEU D 1 256 ? -13.336 37.986  12.955  1.00 49.12  ? 254 LEU D CD2 1 
ATOM   7972  N N   . ILE D 1 257 ? -8.627  35.978  13.890  1.00 46.16  ? 255 ILE D N   1 
ATOM   7973  C CA  . ILE D 1 257 ? -7.760  35.391  14.899  1.00 44.80  ? 255 ILE D CA  1 
ATOM   7974  C C   . ILE D 1 257 ? -7.119  36.677  15.446  1.00 48.74  ? 255 ILE D C   1 
ATOM   7975  O O   . ILE D 1 257 ? -7.387  37.084  16.578  1.00 50.96  ? 255 ILE D O   1 
ATOM   7976  C CB  . ILE D 1 257 ? -6.718  34.482  14.227  1.00 39.39  ? 255 ILE D CB  1 
ATOM   7977  C CG1 . ILE D 1 257 ? -7.453  33.290  13.607  1.00 37.95  ? 255 ILE D CG1 1 
ATOM   7978  C CG2 . ILE D 1 257 ? -5.703  34.012  15.216  1.00 35.54  ? 255 ILE D CG2 1 
ATOM   7979  C CD1 . ILE D 1 257 ? -6.648  32.582  12.532  1.00 22.88  ? 255 ILE D CD1 1 
ATOM   7980  N N   . ASN D 1 258 ? -6.297  37.321  14.617  1.00 45.88  ? 256 ASN D N   1 
ATOM   7981  C CA  . ASN D 1 258 ? -5.650  38.583  14.938  1.00 41.75  ? 256 ASN D CA  1 
ATOM   7982  C C   . ASN D 1 258 ? -6.500  39.390  15.965  1.00 43.58  ? 256 ASN D C   1 
ATOM   7983  O O   . ASN D 1 258 ? -5.966  39.956  16.937  1.00 37.48  ? 256 ASN D O   1 
ATOM   7984  C CB  . ASN D 1 258 ? -5.497  39.383  13.634  1.00 40.11  ? 256 ASN D CB  1 
ATOM   7985  C CG  . ASN D 1 258 ? -4.329  38.931  12.794  1.00 41.78  ? 256 ASN D CG  1 
ATOM   7986  O OD1 . ASN D 1 258 ? -3.995  37.764  12.797  1.00 44.88  ? 256 ASN D OD1 1 
ATOM   7987  N ND2 . ASN D 1 258 ? -3.713  39.855  12.050  1.00 46.65  ? 256 ASN D ND2 1 
ATOM   7988  N N   . ALA D 1 259 ? -7.814  39.437  15.743  1.00 39.41  ? 257 ALA D N   1 
ATOM   7989  C CA  . ALA D 1 259 ? -8.677  40.171  16.645  1.00 41.43  ? 257 ALA D CA  1 
ATOM   7990  C C   . ALA D 1 259 ? -8.633  39.492  17.991  1.00 39.08  ? 257 ALA D C   1 
ATOM   7991  O O   . ALA D 1 259 ? -8.098  40.033  18.955  1.00 41.47  ? 257 ALA D O   1 
ATOM   7992  C CB  . ALA D 1 259 ? -10.105 40.207  16.116  1.00 39.98  ? 257 ALA D CB  1 
ATOM   7993  N N   . VAL D 1 260 ? -9.214  38.304  18.063  1.00 38.40  ? 258 VAL D N   1 
ATOM   7994  C CA  . VAL D 1 260 ? -9.218  37.551  19.310  1.00 35.95  ? 258 VAL D CA  1 
ATOM   7995  C C   . VAL D 1 260 ? -7.821  37.589  19.971  1.00 37.69  ? 258 VAL D C   1 
ATOM   7996  O O   . VAL D 1 260 ? -7.650  38.104  21.066  1.00 36.08  ? 258 VAL D O   1 
ATOM   7997  C CB  . VAL D 1 260 ? -9.659  36.060  19.071  1.00 26.66  ? 258 VAL D CB  1 
ATOM   7998  C CG1 . VAL D 1 260 ? -8.582  35.055  19.523  1.00 18.32  ? 258 VAL D CG1 1 
ATOM   7999  C CG2 . VAL D 1 260 ? -10.909 35.798  19.847  1.00 24.54  ? 258 VAL D CG2 1 
ATOM   8000  N N   . GLU D 1 261 ? -6.833  37.037  19.293  1.00 35.44  ? 259 GLU D N   1 
ATOM   8001  C CA  . GLU D 1 261 ? -5.512  37.013  19.830  1.00 39.44  ? 259 GLU D CA  1 
ATOM   8002  C C   . GLU D 1 261 ? -5.206  38.307  20.528  1.00 43.54  ? 259 GLU D C   1 
ATOM   8003  O O   . GLU D 1 261 ? -5.088  38.353  21.754  1.00 48.19  ? 259 GLU D O   1 
ATOM   8004  C CB  . GLU D 1 261 ? -4.497  36.778  18.712  1.00 39.63  ? 259 GLU D CB  1 
ATOM   8005  C CG  . GLU D 1 261 ? -3.083  37.295  18.980  1.00 37.09  ? 259 GLU D CG  1 
ATOM   8006  C CD  . GLU D 1 261 ? -2.016  36.460  18.288  1.00 45.23  ? 259 GLU D CD  1 
ATOM   8007  O OE1 . GLU D 1 261 ? -2.070  35.208  18.388  1.00 54.31  ? 259 GLU D OE1 1 
ATOM   8008  O OE2 . GLU D 1 261 ? -1.091  37.019  17.656  1.00 44.56  ? 259 GLU D OE2 1 
ATOM   8009  N N   . ALA D 1 262 ? -5.077  39.366  19.741  1.00 47.18  ? 260 ALA D N   1 
ATOM   8010  C CA  . ALA D 1 262 ? -4.714  40.671  20.277  1.00 48.19  ? 260 ALA D CA  1 
ATOM   8011  C C   . ALA D 1 262 ? -5.529  41.148  21.455  1.00 46.87  ? 260 ALA D C   1 
ATOM   8012  O O   . ALA D 1 262 ? -5.006  41.849  22.295  1.00 50.90  ? 260 ALA D O   1 
ATOM   8013  C CB  . ALA D 1 262 ? -4.772  41.700  19.199  1.00 51.64  ? 260 ALA D CB  1 
ATOM   8014  N N   . SER D 1 263 ? -6.810  40.805  21.512  1.00 46.37  ? 261 SER D N   1 
ATOM   8015  C CA  . SER D 1 263 ? -7.659  41.240  22.626  1.00 44.27  ? 261 SER D CA  1 
ATOM   8016  C C   . SER D 1 263 ? -7.190  40.564  23.871  1.00 44.22  ? 261 SER D C   1 
ATOM   8017  O O   . SER D 1 263 ? -7.232  41.124  24.964  1.00 44.91  ? 261 SER D O   1 
ATOM   8018  C CB  . SER D 1 263 ? -9.100  40.821  22.415  1.00 43.89  ? 261 SER D CB  1 
ATOM   8019  O OG  . SER D 1 263 ? -9.841  40.973  23.618  1.00 37.14  ? 261 SER D OG  1 
ATOM   8020  N N   . CYS D 1 264 ? -6.776  39.318  23.674  1.00 47.56  ? 262 CYS D N   1 
ATOM   8021  C CA  . CYS D 1 264 ? -6.277  38.468  24.742  1.00 49.93  ? 262 CYS D CA  1 
ATOM   8022  C C   . CYS D 1 264 ? -4.961  38.989  25.301  1.00 49.66  ? 262 CYS D C   1 
ATOM   8023  O O   . CYS D 1 264 ? -4.798  39.162  26.505  1.00 54.45  ? 262 CYS D O   1 
ATOM   8024  C CB  . CYS D 1 264 ? -6.063  37.038  24.263  1.00 53.36  ? 262 CYS D CB  1 
ATOM   8025  S SG  . CYS D 1 264 ? -5.808  35.921  25.676  1.00 67.44  ? 262 CYS D SG  1 
ATOM   8026  N N   . ILE D 1 265 ? -4.021  39.237  24.415  1.00 45.11  ? 263 ILE D N   1 
ATOM   8027  C CA  . ILE D 1 265 ? -2.737  39.754  24.798  1.00 44.37  ? 263 ILE D CA  1 
ATOM   8028  C C   . ILE D 1 265 ? -2.868  41.065  25.575  1.00 47.24  ? 263 ILE D C   1 
ATOM   8029  O O   . ILE D 1 265 ? -2.142  41.303  26.533  1.00 49.18  ? 263 ILE D O   1 
ATOM   8030  C CB  . ILE D 1 265 ? -1.946  39.979  23.552  1.00 44.12  ? 263 ILE D CB  1 
ATOM   8031  C CG1 . ILE D 1 265 ? -1.939  38.686  22.770  1.00 44.16  ? 263 ILE D CG1 1 
ATOM   8032  C CG2 . ILE D 1 265 ? -0.559  40.467  23.867  1.00 45.80  ? 263 ILE D CG2 1 
ATOM   8033  C CD1 . ILE D 1 265 ? -0.896  38.656  21.706  1.00 54.69  ? 263 ILE D CD1 1 
ATOM   8034  N N   . ARG D 1 266 ? -3.800  41.922  25.168  1.00 49.34  ? 264 ARG D N   1 
ATOM   8035  C CA  . ARG D 1 266 ? -4.014  43.199  25.841  1.00 47.33  ? 264 ARG D CA  1 
ATOM   8036  C C   . ARG D 1 266 ? -4.586  42.935  27.233  1.00 51.11  ? 264 ARG D C   1 
ATOM   8037  O O   . ARG D 1 266 ? -4.256  43.623  28.194  1.00 50.23  ? 264 ARG D O   1 
ATOM   8038  C CB  . ARG D 1 266 ? -5.004  44.066  25.047  1.00 43.98  ? 264 ARG D CB  1 
ATOM   8039  C CG  . ARG D 1 266 ? -5.409  45.357  25.741  1.00 38.37  ? 264 ARG D CG  1 
ATOM   8040  C CD  . ARG D 1 266 ? -4.200  46.250  25.905  1.00 43.09  ? 264 ARG D CD  1 
ATOM   8041  N NE  . ARG D 1 266 ? -4.471  47.463  26.686  1.00 50.15  ? 264 ARG D NE  1 
ATOM   8042  C CZ  . ARG D 1 266 ? -3.571  48.416  26.958  1.00 53.53  ? 264 ARG D CZ  1 
ATOM   8043  N NH1 . ARG D 1 266 ? -2.324  48.304  26.516  1.00 57.97  ? 264 ARG D NH1 1 
ATOM   8044  N NH2 . ARG D 1 266 ? -3.904  49.496  27.665  1.00 52.99  ? 264 ARG D NH2 1 
ATOM   8045  N N   . THR D 1 267 ? -5.458  41.935  27.346  1.00 54.01  ? 265 THR D N   1 
ATOM   8046  C CA  . THR D 1 267 ? -6.049  41.674  28.643  1.00 55.29  ? 265 THR D CA  1 
ATOM   8047  C C   . THR D 1 267 ? -5.001  41.084  29.564  1.00 59.10  ? 265 THR D C   1 
ATOM   8048  O O   . THR D 1 267 ? -5.154  41.123  30.766  1.00 66.06  ? 265 THR D O   1 
ATOM   8049  C CB  . THR D 1 267 ? -7.299  40.792  28.526  1.00 52.48  ? 265 THR D CB  1 
ATOM   8050  O OG1 . THR D 1 267 ? -8.373  41.597  28.041  1.00 58.19  ? 265 THR D OG1 1 
ATOM   8051  C CG2 . THR D 1 267 ? -7.715  40.232  29.867  1.00 54.29  ? 265 THR D CG2 1 
ATOM   8052  N N   . ARG D 1 268 ? -3.916  40.555  29.016  1.00 59.42  ? 266 ARG D N   1 
ATOM   8053  C CA  . ARG D 1 268 ? -2.848  40.039  29.861  1.00 61.62  ? 266 ARG D CA  1 
ATOM   8054  C C   . ARG D 1 268 ? -1.994  41.258  30.179  1.00 65.47  ? 266 ARG D C   1 
ATOM   8055  O O   . ARG D 1 268 ? -1.951  41.691  31.309  1.00 72.12  ? 266 ARG D O   1 
ATOM   8056  C CB  . ARG D 1 268 ? -2.014  38.983  29.133  1.00 63.88  ? 266 ARG D CB  1 
ATOM   8057  C CG  . ARG D 1 268 ? -2.710  37.626  28.987  1.00 67.61  ? 266 ARG D CG  1 
ATOM   8058  C CD  . ARG D 1 268 ? -2.028  36.746  27.936  1.00 69.28  ? 266 ARG D CD  1 
ATOM   8059  N NE  . ARG D 1 268 ? -2.773  35.498  27.745  1.00 71.76  ? 266 ARG D NE  1 
ATOM   8060  C CZ  . ARG D 1 268 ? -2.433  34.548  26.880  1.00 72.46  ? 266 ARG D CZ  1 
ATOM   8061  N NH1 . ARG D 1 268 ? -1.350  34.706  26.119  1.00 69.32  ? 266 ARG D NH1 1 
ATOM   8062  N NH2 . ARG D 1 268 ? -3.173  33.447  26.779  1.00 70.89  ? 266 ARG D NH2 1 
ATOM   8063  N N   . GLU D 1 269 ? -1.346  41.838  29.179  1.00 68.50  ? 267 GLU D N   1 
ATOM   8064  C CA  . GLU D 1 269 ? -0.499  43.011  29.396  1.00 70.36  ? 267 GLU D CA  1 
ATOM   8065  C C   . GLU D 1 269 ? -1.167  44.053  30.284  1.00 69.71  ? 267 GLU D C   1 
ATOM   8066  O O   . GLU D 1 269 ? -0.528  44.922  30.841  1.00 72.35  ? 267 GLU D O   1 
ATOM   8067  C CB  . GLU D 1 269 ? -0.148  43.649  28.056  1.00 75.82  ? 267 GLU D CB  1 
ATOM   8068  C CG  . GLU D 1 269 ? 0.393   42.656  27.031  1.00 86.37  ? 267 GLU D CG  1 
ATOM   8069  C CD  . GLU D 1 269 ? 1.225   43.328  25.953  1.00 91.04  ? 267 GLU D CD  1 
ATOM   8070  O OE1 . GLU D 1 269 ? 0.717   44.268  25.290  1.00 94.65  ? 267 GLU D OE1 1 
ATOM   8071  O OE2 . GLU D 1 269 ? 2.396   42.910  25.773  1.00 91.80  ? 267 GLU D OE2 1 
ATOM   8072  N N   . LEU D 1 270 ? -2.472  43.959  30.406  1.00 70.93  ? 268 LEU D N   1 
ATOM   8073  C CA  . LEU D 1 270 ? -3.243  44.873  31.231  1.00 74.37  ? 268 LEU D CA  1 
ATOM   8074  C C   . LEU D 1 270 ? -2.927  44.478  32.678  1.00 80.01  ? 268 LEU D C   1 
ATOM   8075  O O   . LEU D 1 270 ? -2.330  45.229  33.434  1.00 77.80  ? 268 LEU D O   1 
ATOM   8076  C CB  . LEU D 1 270 ? -4.728  44.639  30.938  1.00 70.83  ? 268 LEU D CB  1 
ATOM   8077  C CG  . LEU D 1 270 ? -5.780  45.733  31.080  1.00 63.42  ? 268 LEU D CG  1 
ATOM   8078  C CD1 . LEU D 1 270 ? -5.447  46.848  30.073  1.00 57.34  ? 268 LEU D CD1 1 
ATOM   8079  C CD2 . LEU D 1 270 ? -7.181  45.125  30.847  1.00 59.21  ? 268 LEU D CD2 1 
ATOM   8080  N N   . GLN D 1 271 ? -3.347  43.261  33.014  1.00 89.12  ? 269 GLN D N   1 
ATOM   8081  C CA  . GLN D 1 271 ? -3.186  42.605  34.306  1.00 95.75  ? 269 GLN D CA  1 
ATOM   8082  C C   . GLN D 1 271 ? -1.742  42.168  34.581  1.00 100.55 ? 269 GLN D C   1 
ATOM   8083  O O   . GLN D 1 271 ? -1.360  42.012  35.724  1.00 101.87 ? 269 GLN D O   1 
ATOM   8084  C CB  . GLN D 1 271 ? -4.104  41.386  34.328  1.00 97.26  ? 269 GLN D CB  1 
ATOM   8085  C CG  . GLN D 1 271 ? -3.748  40.348  35.348  1.00 103.59 ? 269 GLN D CG  1 
ATOM   8086  C CD  . GLN D 1 271 ? -3.919  40.857  36.764  1.00 106.82 ? 269 GLN D CD  1 
ATOM   8087  O OE1 . GLN D 1 271 ? -4.897  41.552  37.076  1.00 106.99 ? 269 GLN D OE1 1 
ATOM   8088  N NE2 . GLN D 1 271 ? -2.979  40.498  37.641  1.00 107.68 ? 269 GLN D NE2 1 
ATOM   8089  N N   . SER D 1 272 ? -0.946  41.971  33.532  1.00 108.83 ? 270 SER D N   1 
ATOM   8090  C CA  . SER D 1 272 ? 0.452   41.541  33.668  1.00 115.81 ? 270 SER D CA  1 
ATOM   8091  C C   . SER D 1 272 ? 1.282   42.692  34.188  1.00 118.61 ? 270 SER D C   1 
ATOM   8092  O O   . SER D 1 272 ? 2.508   42.745  33.993  1.00 115.81 ? 270 SER D O   1 
ATOM   8093  C CB  . SER D 1 272 ? 1.022   41.073  32.325  1.00 120.72 ? 270 SER D CB  1 
ATOM   8094  O OG  . SER D 1 272 ? 0.301   39.952  31.811  1.00 126.69 ? 270 SER D OG  1 
ATOM   8095  N N   . MET D 1 273 ? 0.563   43.621  34.818  1.00 124.30 ? 271 MET D N   1 
ATOM   8096  C CA  . MET D 1 273 ? 1.111   44.813  35.453  1.00 130.15 ? 271 MET D CA  1 
ATOM   8097  C C   . MET D 1 273 ? 0.070   45.433  36.408  1.00 131.91 ? 271 MET D C   1 
ATOM   8098  O O   . MET D 1 273 ? 0.225   46.563  36.863  1.00 129.81 ? 271 MET D O   1 
ATOM   8099  C CB  . MET D 1 273 ? 1.585   45.834  34.403  1.00 133.01 ? 271 MET D CB  1 
ATOM   8100  C CG  . MET D 1 273 ? 0.540   46.351  33.437  1.00 137.58 ? 271 MET D CG  1 
ATOM   8101  S SD  . MET D 1 273 ? 1.273   47.584  32.317  1.00 145.15 ? 271 MET D SD  1 
ATOM   8102  C CE  . MET D 1 273 ? 2.329   46.544  31.272  1.00 143.07 ? 271 MET D CE  1 
ATOM   8103  N N   . ALA D 1 274 ? -0.975  44.664  36.721  1.00 136.06 ? 272 ALA D N   1 
ATOM   8104  C CA  . ALA D 1 274 ? -2.044  45.087  37.639  1.00 141.13 ? 272 ALA D CA  1 
ATOM   8105  C C   . ALA D 1 274 ? -1.776  44.467  39.015  1.00 144.86 ? 272 ALA D C   1 
ATOM   8106  O O   . ALA D 1 274 ? -2.552  44.624  39.963  1.00 145.25 ? 272 ALA D O   1 
ATOM   8107  C CB  . ALA D 1 274 ? -3.426  44.630  37.110  1.00 141.34 ? 272 ALA D CB  1 
ATOM   8108  N N   . ASP D 1 275 ? -0.665  43.743  39.097  1.00 148.70 ? 273 ASP D N   1 
ATOM   8109  C CA  . ASP D 1 275 ? -0.228  43.075  40.317  1.00 152.54 ? 273 ASP D CA  1 
ATOM   8110  C C   . ASP D 1 275 ? 1.195   43.543  40.646  1.00 155.42 ? 273 ASP D C   1 
ATOM   8111  O O   . ASP D 1 275 ? 1.670   43.422  41.785  1.00 155.17 ? 273 ASP D O   1 
ATOM   8112  C CB  . ASP D 1 275 ? -0.271  41.538  40.132  1.00 152.84 ? 273 ASP D CB  1 
ATOM   8113  C CG  . ASP D 1 275 ? 0.231   41.064  38.740  1.00 153.27 ? 273 ASP D CG  1 
ATOM   8114  O OD1 . ASP D 1 275 ? 1.316   41.493  38.284  1.00 153.26 ? 273 ASP D OD1 1 
ATOM   8115  O OD2 . ASP D 1 275 ? -0.456  40.227  38.104  1.00 151.85 ? 273 ASP D OD2 1 
ATOM   8116  N N   . GLN D 1 276 ? 1.842   44.105  39.625  1.00 158.11 ? 274 GLN D N   1 
ATOM   8117  C CA  . GLN D 1 276 ? 3.217   44.606  39.694  1.00 161.17 ? 274 GLN D CA  1 
ATOM   8118  C C   . GLN D 1 276 ? 3.315   46.053  40.190  1.00 163.17 ? 274 GLN D C   1 
ATOM   8119  O O   . GLN D 1 276 ? 3.463   46.323  41.390  1.00 164.37 ? 274 GLN D O   1 
ATOM   8120  C CB  . GLN D 1 276 ? 3.887   44.550  38.297  1.00 161.23 ? 274 GLN D CB  1 
ATOM   8121  C CG  . GLN D 1 276 ? 3.801   43.216  37.514  1.00 161.40 ? 274 GLN D CG  1 
ATOM   8122  C CD  . GLN D 1 276 ? 4.420   43.294  36.098  1.00 161.12 ? 274 GLN D CD  1 
ATOM   8123  O OE1 . GLN D 1 276 ? 3.995   44.090  35.264  1.00 162.64 ? 274 GLN D OE1 1 
ATOM   8124  N NE2 . GLN D 1 276 ? 5.420   42.458  35.835  1.00 160.66 ? 274 GLN D NE2 1 
ATOM   8125  N N   . GLU D 1 277 ? 3.254   46.962  39.214  1.00 164.38 ? 275 GLU D N   1 
ATOM   8126  C CA  . GLU D 1 277 ? 3.365   48.414  39.386  1.00 165.83 ? 275 GLU D CA  1 
ATOM   8127  C C   . GLU D 1 277 ? 2.320   49.088  40.304  1.00 167.05 ? 275 GLU D C   1 
ATOM   8128  O O   . GLU D 1 277 ? 1.516   49.902  39.793  1.00 168.17 ? 275 GLU D O   1 
ATOM   8129  C CB  . GLU D 1 277 ? 3.368   49.083  37.984  1.00 164.89 ? 275 GLU D CB  1 
ATOM   8130  C CG  . GLU D 1 277 ? 4.358   48.451  36.949  1.00 162.03 ? 275 GLU D CG  1 
ATOM   8131  C CD  . GLU D 1 277 ? 4.407   49.168  35.592  1.00 159.92 ? 275 GLU D CD  1 
ATOM   8132  O OE1 . GLU D 1 277 ? 3.334   49.412  34.999  1.00 159.39 ? 275 GLU D OE1 1 
ATOM   8133  O OE2 . GLU D 1 277 ? 5.525   49.472  35.109  1.00 157.09 ? 275 GLU D OE2 1 
ATOM   8134  N N   . ARG E 1 1   ? 54.389  25.019  -6.753  1.00 82.98  ? -1  ARG E N   1 
ATOM   8135  C CA  . ARG E 1 1   ? 55.331  24.294  -7.659  1.00 88.65  ? -1  ARG E CA  1 
ATOM   8136  C C   . ARG E 1 1   ? 55.646  22.839  -7.298  1.00 87.89  ? -1  ARG E C   1 
ATOM   8137  O O   . ARG E 1 1   ? 55.568  21.944  -8.149  1.00 83.93  ? -1  ARG E O   1 
ATOM   8138  C CB  . ARG E 1 1   ? 56.636  25.039  -7.741  1.00 92.96  ? -1  ARG E CB  1 
ATOM   8139  C CG  . ARG E 1 1   ? 56.439  26.408  -8.196  1.00 97.71  ? -1  ARG E CG  1 
ATOM   8140  C CD  . ARG E 1 1   ? 57.774  26.868  -8.557  1.00 102.70 ? -1  ARG E CD  1 
ATOM   8141  N NE  . ARG E 1 1   ? 57.758  28.281  -8.807  1.00 111.26 ? -1  ARG E NE  1 
ATOM   8142  C CZ  . ARG E 1 1   ? 58.822  29.041  -8.624  1.00 118.45 ? -1  ARG E CZ  1 
ATOM   8143  N NH1 . ARG E 1 1   ? 59.954  28.488  -8.198  1.00 120.59 ? -1  ARG E NH1 1 
ATOM   8144  N NH2 . ARG E 1 1   ? 58.749  30.346  -8.842  1.00 124.25 ? -1  ARG E NH2 1 
ATOM   8145  N N   . ALA E 1 2   ? 56.092  22.623  -6.063  1.00 89.11  ? 0   ALA E N   1 
ATOM   8146  C CA  . ALA E 1 2   ? 56.387  21.275  -5.600  1.00 89.37  ? 0   ALA E CA  1 
ATOM   8147  C C   . ALA E 1 2   ? 55.406  21.088  -4.471  1.00 89.25  ? 0   ALA E C   1 
ATOM   8148  O O   . ALA E 1 2   ? 55.586  20.269  -3.570  1.00 87.48  ? 0   ALA E O   1 
ATOM   8149  N N   . MET E 1 3   ? 54.342  21.883  -4.574  1.00 88.55  ? 1   MET E N   1 
ATOM   8150  C CA  . MET E 1 3   ? 53.251  21.958  -3.603  1.00 87.46  ? 1   MET E CA  1 
ATOM   8151  C C   . MET E 1 3   ? 52.186  20.877  -3.718  1.00 85.38  ? 1   MET E C   1 
ATOM   8152  O O   . MET E 1 3   ? 52.021  20.267  -4.768  1.00 82.64  ? 1   MET E O   1 
ATOM   8153  C CB  . MET E 1 3   ? 52.586  23.339  -3.710  1.00 88.44  ? 1   MET E CB  1 
ATOM   8154  C CG  . MET E 1 3   ? 51.410  23.597  -2.758  1.00 91.05  ? 1   MET E CG  1 
ATOM   8155  S SD  . MET E 1 3   ? 50.358  25.053  -3.186  1.00 92.20  ? 1   MET E SD  1 
ATOM   8156  C CE  . MET E 1 3   ? 48.957  24.217  -4.004  1.00 86.80  ? 1   MET E CE  1 
ATOM   8157  N N   . SER E 1 4   ? 51.479  20.670  -2.607  1.00 86.39  ? 2   SER E N   1 
ATOM   8158  C CA  . SER E 1 4   ? 50.399  19.687  -2.466  1.00 89.72  ? 2   SER E CA  1 
ATOM   8159  C C   . SER E 1 4   ? 49.292  20.315  -1.611  1.00 87.90  ? 2   SER E C   1 
ATOM   8160  O O   . SER E 1 4   ? 49.524  21.317  -0.940  1.00 86.62  ? 2   SER E O   1 
ATOM   8161  C CB  . SER E 1 4   ? 50.901  18.419  -1.762  1.00 94.23  ? 2   SER E CB  1 
ATOM   8162  O OG  . SER E 1 4   ? 51.954  17.793  -2.481  1.00 100.82 ? 2   SER E OG  1 
ATOM   8163  N N   . VAL E 1 5   ? 48.105  19.714  -1.593  1.00 84.34  ? 3   VAL E N   1 
ATOM   8164  C CA  . VAL E 1 5   ? 47.005  20.310  -0.842  1.00 76.16  ? 3   VAL E CA  1 
ATOM   8165  C C   . VAL E 1 5   ? 46.023  19.324  -0.304  1.00 70.90  ? 3   VAL E C   1 
ATOM   8166  O O   . VAL E 1 5   ? 45.910  18.201  -0.773  1.00 67.07  ? 3   VAL E O   1 
ATOM   8167  C CB  . VAL E 1 5   ? 46.204  21.300  -1.709  1.00 76.19  ? 3   VAL E CB  1 
ATOM   8168  C CG1 . VAL E 1 5   ? 44.969  21.771  -0.968  1.00 74.05  ? 3   VAL E CG1 1 
ATOM   8169  C CG2 . VAL E 1 5   ? 47.062  22.476  -2.063  1.00 75.34  ? 3   VAL E CG2 1 
ATOM   8170  N N   . GLY E 1 6   ? 45.288  19.794  0.681   1.00 67.98  ? 4   GLY E N   1 
ATOM   8171  C CA  . GLY E 1 6   ? 44.292  18.970  1.300   1.00 70.57  ? 4   GLY E CA  1 
ATOM   8172  C C   . GLY E 1 6   ? 43.227  19.848  1.932   1.00 72.45  ? 4   GLY E C   1 
ATOM   8173  O O   . GLY E 1 6   ? 43.477  21.027  2.261   1.00 70.18  ? 4   GLY E O   1 
ATOM   8174  N N   . PHE E 1 7   ? 42.039  19.257  2.087   1.00 72.50  ? 5   PHE E N   1 
ATOM   8175  C CA  . PHE E 1 7   ? 40.878  19.904  2.678   1.00 73.77  ? 5   PHE E CA  1 
ATOM   8176  C C   . PHE E 1 7   ? 40.443  19.134  3.885   1.00 73.09  ? 5   PHE E C   1 
ATOM   8177  O O   . PHE E 1 7   ? 40.253  17.921  3.830   1.00 73.92  ? 5   PHE E O   1 
ATOM   8178  C CB  . PHE E 1 7   ? 39.678  19.912  1.726   1.00 77.25  ? 5   PHE E CB  1 
ATOM   8179  C CG  . PHE E 1 7   ? 39.903  20.695  0.472   1.00 79.50  ? 5   PHE E CG  1 
ATOM   8180  C CD1 . PHE E 1 7   ? 40.786  20.226  -0.495  1.00 78.97  ? 5   PHE E CD1 1 
ATOM   8181  C CD2 . PHE E 1 7   ? 39.275  21.920  0.276   1.00 76.84  ? 5   PHE E CD2 1 
ATOM   8182  C CE1 . PHE E 1 7   ? 41.045  20.961  -1.630  1.00 75.92  ? 5   PHE E CE1 1 
ATOM   8183  C CE2 . PHE E 1 7   ? 39.534  22.659  -0.862  1.00 76.95  ? 5   PHE E CE2 1 
ATOM   8184  C CZ  . PHE E 1 7   ? 40.423  22.178  -1.814  1.00 75.12  ? 5   PHE E CZ  1 
ATOM   8185  N N   . ILE E 1 8   ? 40.256  19.829  4.980   1.00 73.39  ? 6   ILE E N   1 
ATOM   8186  C CA  . ILE E 1 8   ? 39.802  19.127  6.145   1.00 78.92  ? 6   ILE E CA  1 
ATOM   8187  C C   . ILE E 1 8   ? 38.306  18.915  6.004   1.00 83.79  ? 6   ILE E C   1 
ATOM   8188  O O   . ILE E 1 8   ? 37.504  19.844  6.068   1.00 84.17  ? 6   ILE E O   1 
ATOM   8189  C CB  . ILE E 1 8   ? 40.131  19.893  7.391   1.00 79.11  ? 6   ILE E CB  1 
ATOM   8190  C CG1 . ILE E 1 8   ? 41.643  19.824  7.607   1.00 79.44  ? 6   ILE E CG1 1 
ATOM   8191  C CG2 . ILE E 1 8   ? 39.371  19.317  8.561   1.00 78.97  ? 6   ILE E CG2 1 
ATOM   8192  C CD1 . ILE E 1 8   ? 42.131  20.690  8.730   1.00 80.78  ? 6   ILE E CD1 1 
ATOM   8193  N N   . GLY E 1 9   ? 37.946  17.656  5.807   1.00 89.85  ? 7   GLY E N   1 
ATOM   8194  C CA  . GLY E 1 9   ? 36.558  17.303  5.615   1.00 93.72  ? 7   GLY E CA  1 
ATOM   8195  C C   . GLY E 1 9   ? 36.302  17.430  4.131   1.00 94.77  ? 7   GLY E C   1 
ATOM   8196  O O   . GLY E 1 9   ? 37.180  17.853  3.379   1.00 93.67  ? 7   GLY E O   1 
ATOM   8197  N N   . ALA E 1 10  ? 35.103  17.055  3.711   1.00 97.79  ? 8   ALA E N   1 
ATOM   8198  C CA  . ALA E 1 10  ? 34.722  17.158  2.314   1.00 102.48 ? 8   ALA E CA  1 
ATOM   8199  C C   . ALA E 1 10  ? 33.754  18.338  2.195   1.00 105.47 ? 8   ALA E C   1 
ATOM   8200  O O   . ALA E 1 10  ? 34.013  19.439  2.711   1.00 108.13 ? 8   ALA E O   1 
ATOM   8201  C CB  . ALA E 1 10  ? 34.045  15.871  1.861   1.00 99.94  ? 8   ALA E CB  1 
ATOM   8202  N N   . GLY E 1 11  ? 32.630  18.107  1.529   1.00 106.88 ? 9   GLY E N   1 
ATOM   8203  C CA  . GLY E 1 11  ? 31.656  19.169  1.378   1.00 106.16 ? 9   GLY E CA  1 
ATOM   8204  C C   . GLY E 1 11  ? 31.602  19.680  -0.042  1.00 106.52 ? 9   GLY E C   1 
ATOM   8205  O O   . GLY E 1 11  ? 32.541  19.508  -0.840  1.00 106.50 ? 9   GLY E O   1 
ATOM   8206  N N   . GLN E 1 12  ? 30.473  20.289  -0.370  1.00 105.41 ? 10  GLN E N   1 
ATOM   8207  C CA  . GLN E 1 12  ? 30.300  20.833  -1.693  1.00 103.22 ? 10  GLN E CA  1 
ATOM   8208  C C   . GLN E 1 12  ? 31.531  21.670  -1.990  1.00 100.85 ? 10  GLN E C   1 
ATOM   8209  O O   . GLN E 1 12  ? 32.250  21.423  -2.954  1.00 99.06  ? 10  GLN E O   1 
ATOM   8210  C CB  . GLN E 1 12  ? 29.044  21.693  -1.722  1.00 104.47 ? 10  GLN E CB  1 
ATOM   8211  C CG  . GLN E 1 12  ? 27.821  20.927  -2.146  1.00 108.66 ? 10  GLN E CG  1 
ATOM   8212  C CD  . GLN E 1 12  ? 28.023  20.227  -3.492  1.00 114.17 ? 10  GLN E CD  1 
ATOM   8213  O OE1 . GLN E 1 12  ? 28.654  20.772  -4.410  1.00 114.51 ? 10  GLN E OE1 1 
ATOM   8214  N NE2 . GLN E 1 12  ? 27.473  19.020  -3.619  1.00 115.49 ? 10  GLN E NE2 1 
ATOM   8215  N N   . LEU E 1 13  ? 31.778  22.635  -1.115  1.00 98.68  ? 11  LEU E N   1 
ATOM   8216  C CA  . LEU E 1 13  ? 32.897  23.553  -1.247  1.00 98.41  ? 11  LEU E CA  1 
ATOM   8217  C C   . LEU E 1 13  ? 34.237  22.881  -1.498  1.00 95.51  ? 11  LEU E C   1 
ATOM   8218  O O   . LEU E 1 13  ? 35.097  23.420  -2.205  1.00 97.00  ? 11  LEU E O   1 
ATOM   8219  C CB  . LEU E 1 13  ? 32.992  24.428  0.000   1.00 102.58 ? 11  LEU E CB  1 
ATOM   8220  C CG  . LEU E 1 13  ? 33.774  25.739  -0.133  1.00 104.78 ? 11  LEU E CG  1 
ATOM   8221  C CD1 . LEU E 1 13  ? 33.356  26.473  -1.411  1.00 105.61 ? 11  LEU E CD1 1 
ATOM   8222  C CD2 . LEU E 1 13  ? 33.518  26.594  1.118   1.00 107.35 ? 11  LEU E CD2 1 
ATOM   8223  N N   . ALA E 1 14  ? 34.418  21.707  -0.910  1.00 91.63  ? 12  ALA E N   1 
ATOM   8224  C CA  . ALA E 1 14  ? 35.661  20.961  -1.076  1.00 87.43  ? 12  ALA E CA  1 
ATOM   8225  C C   . ALA E 1 14  ? 35.669  20.389  -2.470  1.00 83.17  ? 12  ALA E C   1 
ATOM   8226  O O   . ALA E 1 14  ? 36.566  20.676  -3.270  1.00 78.24  ? 12  ALA E O   1 
ATOM   8227  C CB  . ALA E 1 14  ? 35.743  19.840  -0.057  1.00 89.31  ? 12  ALA E CB  1 
ATOM   8228  N N   . PHE E 1 15  ? 34.660  19.572  -2.748  1.00 81.69  ? 13  PHE E N   1 
ATOM   8229  C CA  . PHE E 1 15  ? 34.513  18.980  -4.059  1.00 80.59  ? 13  PHE E CA  1 
ATOM   8230  C C   . PHE E 1 15  ? 34.810  20.097  -5.044  1.00 76.76  ? 13  PHE E C   1 
ATOM   8231  O O   . PHE E 1 15  ? 35.794  20.071  -5.769  1.00 72.92  ? 13  PHE E O   1 
ATOM   8232  C CB  . PHE E 1 15  ? 33.081  18.520  -4.271  1.00 84.30  ? 13  PHE E CB  1 
ATOM   8233  C CG  . PHE E 1 15  ? 32.785  18.187  -5.694  1.00 90.31  ? 13  PHE E CG  1 
ATOM   8234  C CD1 . PHE E 1 15  ? 33.312  17.034  -6.277  1.00 92.49  ? 13  PHE E CD1 1 
ATOM   8235  C CD2 . PHE E 1 15  ? 32.052  19.062  -6.486  1.00 97.34  ? 13  PHE E CD2 1 
ATOM   8236  C CE1 . PHE E 1 15  ? 33.123  16.751  -7.639  1.00 95.89  ? 13  PHE E CE1 1 
ATOM   8237  C CE2 . PHE E 1 15  ? 31.850  18.798  -7.851  1.00 100.18 ? 13  PHE E CE2 1 
ATOM   8238  C CZ  . PHE E 1 15  ? 32.391  17.633  -8.431  1.00 99.75  ? 13  PHE E CZ  1 
ATOM   8239  N N   . ALA E 1 16  ? 33.926  21.087  -5.039  1.00 74.62  ? 14  ALA E N   1 
ATOM   8240  C CA  . ALA E 1 16  ? 34.058  22.253  -5.882  1.00 70.23  ? 14  ALA E CA  1 
ATOM   8241  C C   . ALA E 1 16  ? 35.530  22.559  -6.199  1.00 70.14  ? 14  ALA E C   1 
ATOM   8242  O O   . ALA E 1 16  ? 36.008  22.265  -7.308  1.00 74.61  ? 14  ALA E O   1 
ATOM   8243  C CB  . ALA E 1 16  ? 33.409  23.442  -5.185  1.00 71.21  ? 14  ALA E CB  1 
ATOM   8244  N N   . LEU E 1 17  ? 36.224  23.168  -5.235  1.00 63.25  ? 15  LEU E N   1 
ATOM   8245  C CA  . LEU E 1 17  ? 37.620  23.533  -5.384  1.00 56.94  ? 15  LEU E CA  1 
ATOM   8246  C C   . LEU E 1 17  ? 38.441  22.388  -5.918  1.00 60.46  ? 15  LEU E C   1 
ATOM   8247  O O   . LEU E 1 17  ? 39.302  22.569  -6.785  1.00 59.93  ? 15  LEU E O   1 
ATOM   8248  C CB  . LEU E 1 17  ? 38.164  23.971  -4.053  1.00 49.91  ? 15  LEU E CB  1 
ATOM   8249  C CG  . LEU E 1 17  ? 37.520  25.289  -3.720  1.00 51.58  ? 15  LEU E CG  1 
ATOM   8250  C CD1 . LEU E 1 17  ? 37.304  25.393  -2.240  1.00 56.68  ? 15  LEU E CD1 1 
ATOM   8251  C CD2 . LEU E 1 17  ? 38.393  26.417  -4.264  1.00 52.23  ? 15  LEU E CD2 1 
ATOM   8252  N N   . ALA E 1 18  ? 38.168  21.193  -5.413  1.00 63.41  ? 16  ALA E N   1 
ATOM   8253  C CA  . ALA E 1 18  ? 38.899  20.025  -5.876  1.00 66.91  ? 16  ALA E CA  1 
ATOM   8254  C C   . ALA E 1 18  ? 38.863  19.992  -7.417  1.00 68.62  ? 16  ALA E C   1 
ATOM   8255  O O   . ALA E 1 18  ? 39.885  20.242  -8.071  1.00 66.73  ? 16  ALA E O   1 
ATOM   8256  C CB  . ALA E 1 18  ? 38.276  18.765  -5.283  1.00 70.36  ? 16  ALA E CB  1 
ATOM   8257  N N   . LYS E 1 19  ? 37.680  19.732  -7.985  1.00 67.55  ? 17  LYS E N   1 
ATOM   8258  C CA  . LYS E 1 19  ? 37.531  19.686  -9.433  1.00 65.51  ? 17  LYS E CA  1 
ATOM   8259  C C   . LYS E 1 19  ? 38.065  20.946  -10.036 1.00 63.54  ? 17  LYS E C   1 
ATOM   8260  O O   . LYS E 1 19  ? 38.768  20.893  -11.026 1.00 67.61  ? 17  LYS E O   1 
ATOM   8261  C CB  . LYS E 1 19  ? 36.080  19.562  -9.868  1.00 64.24  ? 17  LYS E CB  1 
ATOM   8262  C CG  . LYS E 1 19  ? 35.936  19.585  -11.363 1.00 69.43  ? 17  LYS E CG  1 
ATOM   8263  C CD  . LYS E 1 19  ? 34.541  19.202  -11.739 1.00 77.52  ? 17  LYS E CD  1 
ATOM   8264  C CE  . LYS E 1 19  ? 34.244  17.830  -11.182 1.00 82.97  ? 17  LYS E CE  1 
ATOM   8265  N NZ  . LYS E 1 19  ? 32.922  17.313  -11.623 1.00 88.88  ? 17  LYS E NZ  1 
ATOM   8266  N N   . GLY E 1 20  ? 37.710  22.084  -9.464  1.00 58.24  ? 18  GLY E N   1 
ATOM   8267  C CA  . GLY E 1 20  ? 38.220  23.301  -10.031 1.00 58.07  ? 18  GLY E CA  1 
ATOM   8268  C C   . GLY E 1 20  ? 39.715  23.170  -10.268 1.00 59.64  ? 18  GLY E C   1 
ATOM   8269  O O   . GLY E 1 20  ? 40.180  23.082  -11.402 1.00 53.80  ? 18  GLY E O   1 
ATOM   8270  N N   . PHE E 1 21  ? 40.466  23.140  -9.170  1.00 64.01  ? 19  PHE E N   1 
ATOM   8271  C CA  . PHE E 1 21  ? 41.926  23.065  -9.195  1.00 62.16  ? 19  PHE E CA  1 
ATOM   8272  C C   . PHE E 1 21  ? 42.437  22.010  -10.150 1.00 60.75  ? 19  PHE E C   1 
ATOM   8273  O O   . PHE E 1 21  ? 43.316  22.281  -10.971 1.00 55.16  ? 19  PHE E O   1 
ATOM   8274  C CB  . PHE E 1 21  ? 42.451  22.770  -7.793  1.00 64.15  ? 19  PHE E CB  1 
ATOM   8275  C CG  . PHE E 1 21  ? 42.234  23.891  -6.802  1.00 68.09  ? 19  PHE E CG  1 
ATOM   8276  C CD1 . PHE E 1 21  ? 41.634  23.644  -5.573  1.00 71.30  ? 19  PHE E CD1 1 
ATOM   8277  C CD2 . PHE E 1 21  ? 42.657  25.194  -7.080  1.00 73.24  ? 19  PHE E CD2 1 
ATOM   8278  C CE1 . PHE E 1 21  ? 41.455  24.681  -4.620  1.00 73.09  ? 19  PHE E CE1 1 
ATOM   8279  C CE2 . PHE E 1 21  ? 42.487  26.239  -6.137  1.00 72.02  ? 19  PHE E CE2 1 
ATOM   8280  C CZ  . PHE E 1 21  ? 41.885  25.978  -4.907  1.00 69.26  ? 19  PHE E CZ  1 
ATOM   8281  N N   . THR E 1 22  ? 41.896  20.797  -10.024 1.00 62.29  ? 20  THR E N   1 
ATOM   8282  C CA  . THR E 1 22  ? 42.309  19.668  -10.871 1.00 63.89  ? 20  THR E CA  1 
ATOM   8283  C C   . THR E 1 22  ? 42.007  19.941  -12.321 1.00 64.91  ? 20  THR E C   1 
ATOM   8284  O O   . THR E 1 22  ? 42.846  19.722  -13.206 1.00 65.34  ? 20  THR E O   1 
ATOM   8285  C CB  . THR E 1 22  ? 41.571  18.358  -10.517 1.00 63.21  ? 20  THR E CB  1 
ATOM   8286  O OG1 . THR E 1 22  ? 40.160  18.516  -10.721 1.00 66.84  ? 20  THR E OG1 1 
ATOM   8287  C CG2 . THR E 1 22  ? 41.819  17.982  -9.093  1.00 64.86  ? 20  THR E CG2 1 
ATOM   8288  N N   . ALA E 1 23  ? 40.783  20.407  -12.546 1.00 68.27  ? 21  ALA E N   1 
ATOM   8289  C CA  . ALA E 1 23  ? 40.306  20.739  -13.879 1.00 69.79  ? 21  ALA E CA  1 
ATOM   8290  C C   . ALA E 1 23  ? 41.085  21.927  -14.431 1.00 69.60  ? 21  ALA E C   1 
ATOM   8291  O O   . ALA E 1 23  ? 41.344  21.998  -15.616 1.00 70.88  ? 21  ALA E O   1 
ATOM   8292  C CB  . ALA E 1 23  ? 38.791  21.044  -13.848 1.00 67.64  ? 21  ALA E CB  1 
ATOM   8293  N N   . ALA E 1 24  ? 41.479  22.858  -13.579 1.00 73.02  ? 22  ALA E N   1 
ATOM   8294  C CA  . ALA E 1 24  ? 42.225  23.999  -14.088 1.00 76.43  ? 22  ALA E CA  1 
ATOM   8295  C C   . ALA E 1 24  ? 43.603  23.536  -14.545 1.00 77.05  ? 22  ALA E C   1 
ATOM   8296  O O   . ALA E 1 24  ? 44.365  24.313  -15.159 1.00 76.64  ? 22  ALA E O   1 
ATOM   8297  C CB  . ALA E 1 24  ? 42.353  25.099  -13.012 1.00 80.34  ? 22  ALA E CB  1 
ATOM   8298  N N   . GLY E 1 25  ? 43.902  22.265  -14.259 1.00 76.06  ? 23  GLY E N   1 
ATOM   8299  C CA  . GLY E 1 25  ? 45.192  21.693  -14.614 1.00 76.70  ? 23  GLY E CA  1 
ATOM   8300  C C   . GLY E 1 25  ? 46.311  22.225  -13.728 1.00 75.68  ? 23  GLY E C   1 
ATOM   8301  O O   . GLY E 1 25  ? 47.465  22.370  -14.158 1.00 72.22  ? 23  GLY E O   1 
ATOM   8302  N N   . VAL E 1 26  ? 45.955  22.512  -12.480 1.00 77.01  ? 24  VAL E N   1 
ATOM   8303  C CA  . VAL E 1 26  ? 46.887  23.071  -11.525 1.00 79.77  ? 24  VAL E CA  1 
ATOM   8304  C C   . VAL E 1 26  ? 47.804  22.005  -10.967 1.00 82.24  ? 24  VAL E C   1 
ATOM   8305  O O   . VAL E 1 26  ? 49.020  22.085  -11.132 1.00 83.39  ? 24  VAL E O   1 
ATOM   8306  C CB  . VAL E 1 26  ? 46.153  23.724  -10.356 1.00 79.54  ? 24  VAL E CB  1 
ATOM   8307  C CG1 . VAL E 1 26  ? 47.131  24.562  -9.580  1.00 80.72  ? 24  VAL E CG1 1 
ATOM   8308  C CG2 . VAL E 1 26  ? 44.988  24.561  -10.841 1.00 78.12  ? 24  VAL E CG2 1 
ATOM   8309  N N   . LEU E 1 27  ? 47.212  21.019  -10.298 1.00 84.71  ? 25  LEU E N   1 
ATOM   8310  C CA  . LEU E 1 27  ? 47.961  19.910  -9.713  1.00 88.74  ? 25  LEU E CA  1 
ATOM   8311  C C   . LEU E 1 27  ? 47.167  18.630  -9.884  1.00 91.96  ? 25  LEU E C   1 
ATOM   8312  O O   . LEU E 1 27  ? 45.941  18.664  -9.926  1.00 93.53  ? 25  LEU E O   1 
ATOM   8313  C CB  . LEU E 1 27  ? 48.179  20.119  -8.230  1.00 87.17  ? 25  LEU E CB  1 
ATOM   8314  C CG  . LEU E 1 27  ? 46.877  19.909  -7.459  1.00 88.92  ? 25  LEU E CG  1 
ATOM   8315  C CD1 . LEU E 1 27  ? 47.146  20.013  -5.960  1.00 91.47  ? 25  LEU E CD1 1 
ATOM   8316  C CD2 . LEU E 1 27  ? 45.832  20.926  -7.916  1.00 84.77  ? 25  LEU E CD2 1 
ATOM   8317  N N   . ALA E 1 28  ? 47.870  17.505  -9.951  1.00 94.97  ? 26  ALA E N   1 
ATOM   8318  C CA  . ALA E 1 28  ? 47.238  16.204  -10.128 1.00 95.67  ? 26  ALA E CA  1 
ATOM   8319  C C   . ALA E 1 28  ? 46.194  15.927  -9.048  1.00 96.57  ? 26  ALA E C   1 
ATOM   8320  O O   . ALA E 1 28  ? 46.422  16.198  -7.869  1.00 97.50  ? 26  ALA E O   1 
ATOM   8321  C CB  . ALA E 1 28  ? 48.305  15.128  -10.124 1.00 96.50  ? 26  ALA E CB  1 
ATOM   8322  N N   . ALA E 1 29  ? 45.046  15.387  -9.458  1.00 97.62  ? 27  ALA E N   1 
ATOM   8323  C CA  . ALA E 1 29  ? 43.958  15.064  -8.524  1.00 98.11  ? 27  ALA E CA  1 
ATOM   8324  C C   . ALA E 1 29  ? 44.466  14.315  -7.289  1.00 97.31  ? 27  ALA E C   1 
ATOM   8325  O O   . ALA E 1 29  ? 43.992  14.526  -6.174  1.00 96.26  ? 27  ALA E O   1 
ATOM   8326  C CB  . ALA E 1 29  ? 42.891  14.215  -9.236  1.00 99.54  ? 27  ALA E CB  1 
ATOM   8327  N N   . HIS E 1 30  ? 45.439  13.441  -7.504  1.00 98.60  ? 28  HIS E N   1 
ATOM   8328  C CA  . HIS E 1 30  ? 46.004  12.646  -6.430  1.00 98.75  ? 28  HIS E CA  1 
ATOM   8329  C C   . HIS E 1 30  ? 46.886  13.410  -5.447  1.00 96.79  ? 28  HIS E C   1 
ATOM   8330  O O   . HIS E 1 30  ? 47.230  12.887  -4.393  1.00 97.44  ? 28  HIS E O   1 
ATOM   8331  C CB  . HIS E 1 30  ? 46.797  11.470  -6.996  1.00 98.38  ? 28  HIS E CB  1 
ATOM   8332  C CG  . HIS E 1 30  ? 47.941  11.867  -7.874  1.00 97.10  ? 28  HIS E CG  1 
ATOM   8333  N ND1 . HIS E 1 30  ? 47.958  11.615  -9.229  1.00 95.50  ? 28  HIS E ND1 1 
ATOM   8334  C CD2 . HIS E 1 30  ? 49.128  12.447  -7.583  1.00 96.25  ? 28  HIS E CD2 1 
ATOM   8335  C CE1 . HIS E 1 30  ? 49.111  12.018  -9.732  1.00 96.20  ? 28  HIS E CE1 1 
ATOM   8336  N NE2 . HIS E 1 30  ? 49.839  12.526  -8.755  1.00 97.45  ? 28  HIS E NE2 1 
ATOM   8337  N N   . LYS E 1 31  ? 47.277  14.634  -5.775  1.00 94.00  ? 29  LYS E N   1 
ATOM   8338  C CA  . LYS E 1 31  ? 48.098  15.387  -4.834  1.00 92.16  ? 29  LYS E CA  1 
ATOM   8339  C C   . LYS E 1 31  ? 47.175  16.218  -3.943  1.00 90.22  ? 29  LYS E C   1 
ATOM   8340  O O   . LYS E 1 31  ? 47.476  17.368  -3.594  1.00 85.43  ? 29  LYS E O   1 
ATOM   8341  C CB  . LYS E 1 31  ? 49.110  16.283  -5.561  1.00 92.64  ? 29  LYS E CB  1 
ATOM   8342  C CG  . LYS E 1 31  ? 50.531  16.136  -4.996  1.00 94.70  ? 29  LYS E CG  1 
ATOM   8343  C CD  . LYS E 1 31  ? 51.519  17.081  -5.648  1.00 98.44  ? 29  LYS E CD  1 
ATOM   8344  C CE  . LYS E 1 31  ? 51.537  16.931  -7.170  1.00 102.55 ? 29  LYS E CE  1 
ATOM   8345  N NZ  . LYS E 1 31  ? 52.370  17.984  -7.839  1.00 101.98 ? 29  LYS E NZ  1 
ATOM   8346  N N   . ILE E 1 32  ? 46.054  15.598  -3.573  1.00 89.86  ? 30  ILE E N   1 
ATOM   8347  C CA  . ILE E 1 32  ? 45.073  16.230  -2.716  1.00 91.34  ? 30  ILE E CA  1 
ATOM   8348  C C   . ILE E 1 32  ? 44.345  15.254  -1.836  1.00 91.97  ? 30  ILE E C   1 
ATOM   8349  O O   . ILE E 1 32  ? 43.845  14.223  -2.291  1.00 92.02  ? 30  ILE E O   1 
ATOM   8350  C CB  . ILE E 1 32  ? 43.986  16.917  -3.492  1.00 92.87  ? 30  ILE E CB  1 
ATOM   8351  C CG1 . ILE E 1 32  ? 44.591  17.808  -4.565  1.00 94.29  ? 30  ILE E CG1 1 
ATOM   8352  C CG2 . ILE E 1 32  ? 43.099  17.686  -2.518  1.00 93.05  ? 30  ILE E CG2 1 
ATOM   8353  C CD1 . ILE E 1 32  ? 43.671  18.033  -5.745  1.00 92.61  ? 30  ILE E CD1 1 
ATOM   8354  N N   . MET E 1 33  ? 44.258  15.604  -0.567  1.00 93.21  ? 31  MET E N   1 
ATOM   8355  C CA  . MET E 1 33  ? 43.552  14.763  0.366   1.00 96.03  ? 31  MET E CA  1 
ATOM   8356  C C   . MET E 1 33  ? 42.495  15.596  1.037   1.00 96.16  ? 31  MET E C   1 
ATOM   8357  O O   . MET E 1 33  ? 42.695  16.780  1.311   1.00 95.53  ? 31  MET E O   1 
ATOM   8358  C CB  . MET E 1 33  ? 44.474  14.213  1.457   1.00 99.34  ? 31  MET E CB  1 
ATOM   8359  C CG  . MET E 1 33  ? 45.435  13.115  1.043   1.00 102.33 ? 31  MET E CG  1 
ATOM   8360  S SD  . MET E 1 33  ? 45.993  12.184  2.500   1.00 105.57 ? 31  MET E SD  1 
ATOM   8361  C CE  . MET E 1 33  ? 45.754  10.429  1.969   1.00 102.79 ? 31  MET E CE  1 
ATOM   8362  N N   . ALA E 1 34  ? 41.360  14.973  1.290   1.00 96.17  ? 32  ALA E N   1 
ATOM   8363  C CA  . ALA E 1 34  ? 40.299  15.637  1.994   1.00 98.50  ? 32  ALA E CA  1 
ATOM   8364  C C   . ALA E 1 34  ? 40.054  14.599  3.034   1.00 102.24 ? 32  ALA E C   1 
ATOM   8365  O O   . ALA E 1 34  ? 40.295  13.411  2.794   1.00 100.73 ? 32  ALA E O   1 
ATOM   8366  C CB  . ALA E 1 34  ? 39.104  15.789  1.133   1.00 99.69  ? 32  ALA E CB  1 
ATOM   8367  N N   . SER E 1 35  ? 39.582  15.032  4.191   1.00 108.34 ? 33  SER E N   1 
ATOM   8368  C CA  . SER E 1 35  ? 39.322  14.103  5.275   1.00 115.41 ? 33  SER E CA  1 
ATOM   8369  C C   . SER E 1 35  ? 37.890  13.583  5.238   1.00 119.51 ? 33  SER E C   1 
ATOM   8370  O O   . SER E 1 35  ? 36.944  14.311  4.914   1.00 118.40 ? 33  SER E O   1 
ATOM   8371  C CB  . SER E 1 35  ? 39.613  14.771  6.607   1.00 115.84 ? 33  SER E CB  1 
ATOM   8372  O OG  . SER E 1 35  ? 40.943  15.261  6.602   1.00 117.43 ? 33  SER E OG  1 
ATOM   8373  N N   . SER E 1 36  ? 37.752  12.309  5.590   1.00 125.98 ? 34  SER E N   1 
ATOM   8374  C CA  . SER E 1 36  ? 36.471  11.599  5.568   1.00 130.19 ? 34  SER E CA  1 
ATOM   8375  C C   . SER E 1 36  ? 35.723  11.549  6.902   1.00 130.62 ? 34  SER E C   1 
ATOM   8376  O O   . SER E 1 36  ? 35.671  10.497  7.551   1.00 131.49 ? 34  SER E O   1 
ATOM   8377  C CB  . SER E 1 36  ? 36.708  10.162  5.049   1.00 131.90 ? 34  SER E CB  1 
ATOM   8378  O OG  . SER E 1 36  ? 35.508  9.398   4.958   1.00 130.86 ? 34  SER E OG  1 
ATOM   8379  N N   . PRO E 1 37  ? 35.146  12.685  7.342   1.00 129.93 ? 35  PRO E N   1 
ATOM   8380  C CA  . PRO E 1 37  ? 34.446  12.535  8.617   1.00 129.42 ? 35  PRO E CA  1 
ATOM   8381  C C   . PRO E 1 37  ? 33.182  11.694  8.451   1.00 129.33 ? 35  PRO E C   1 
ATOM   8382  O O   . PRO E 1 37  ? 32.389  11.546  9.380   1.00 127.91 ? 35  PRO E O   1 
ATOM   8383  C CB  . PRO E 1 37  ? 34.186  13.982  9.050   1.00 129.53 ? 35  PRO E CB  1 
ATOM   8384  C CG  . PRO E 1 37  ? 34.206  14.745  7.795   1.00 130.13 ? 35  PRO E CG  1 
ATOM   8385  C CD  . PRO E 1 37  ? 35.299  14.107  6.990   1.00 128.88 ? 35  PRO E CD  1 
ATOM   8386  N N   . ASP E 1 38  ? 33.008  11.142  7.253   1.00 131.26 ? 36  ASP E N   1 
ATOM   8387  C CA  . ASP E 1 38  ? 31.872  10.281  6.985   1.00 133.17 ? 36  ASP E CA  1 
ATOM   8388  C C   . ASP E 1 38  ? 31.974  9.455   5.708   1.00 133.79 ? 36  ASP E C   1 
ATOM   8389  O O   . ASP E 1 38  ? 33.007  8.852   5.429   1.00 132.48 ? 36  ASP E O   1 
ATOM   8390  C CB  . ASP E 1 38  ? 30.575  11.078  6.973   1.00 134.13 ? 36  ASP E CB  1 
ATOM   8391  C CG  . ASP E 1 38  ? 29.366  10.197  7.244   1.00 136.50 ? 36  ASP E CG  1 
ATOM   8392  O OD1 . ASP E 1 38  ? 29.148  9.230   6.473   1.00 137.40 ? 36  ASP E OD1 1 
ATOM   8393  O OD2 . ASP E 1 38  ? 28.640  10.459  8.234   1.00 137.07 ? 36  ASP E OD2 1 
ATOM   8394  N N   . MET E 1 39  ? 30.895  9.429   4.935   1.00 136.11 ? 37  MET E N   1 
ATOM   8395  C CA  . MET E 1 39  ? 30.863  8.631   3.720   1.00 139.35 ? 37  MET E CA  1 
ATOM   8396  C C   . MET E 1 39  ? 29.718  9.016   2.777   1.00 140.34 ? 37  MET E C   1 
ATOM   8397  O O   . MET E 1 39  ? 28.642  8.405   2.797   1.00 139.04 ? 37  MET E O   1 
ATOM   8398  C CB  . MET E 1 39  ? 30.748  7.152   4.096   1.00 140.06 ? 37  MET E CB  1 
ATOM   8399  C CG  . MET E 1 39  ? 31.053  6.249   2.935   1.00 140.08 ? 37  MET E CG  1 
ATOM   8400  S SD  . MET E 1 39  ? 32.411  6.994   1.997   1.00 141.12 ? 37  MET E SD  1 
ATOM   8401  C CE  . MET E 1 39  ? 33.797  6.663   3.087   1.00 138.55 ? 37  MET E CE  1 
ATOM   8402  N N   . ASP E 1 40  ? 29.974  10.005  1.924   1.00 141.86 ? 38  ASP E N   1 
ATOM   8403  C CA  . ASP E 1 40  ? 28.967  10.498  0.991   1.00 143.64 ? 38  ASP E CA  1 
ATOM   8404  C C   . ASP E 1 40  ? 29.238  10.378  -0.498  1.00 143.58 ? 38  ASP E C   1 
ATOM   8405  O O   . ASP E 1 40  ? 30.371  10.512  -0.964  1.00 143.77 ? 38  ASP E O   1 
ATOM   8406  C CB  . ASP E 1 40  ? 28.684  11.976  1.260   1.00 145.48 ? 38  ASP E CB  1 
ATOM   8407  C CG  . ASP E 1 40  ? 27.704  12.184  2.369   1.00 148.87 ? 38  ASP E CG  1 
ATOM   8408  O OD1 . ASP E 1 40  ? 26.659  11.496  2.345   1.00 152.22 ? 38  ASP E OD1 1 
ATOM   8409  O OD2 . ASP E 1 40  ? 27.966  13.041  3.243   1.00 150.72 ? 38  ASP E OD2 1 
ATOM   8410  N N   . LEU E 1 41  ? 28.166  10.132  -1.246  1.00 143.75 ? 39  LEU E N   1 
ATOM   8411  C CA  . LEU E 1 41  ? 28.238  10.101  -2.703  1.00 142.29 ? 39  LEU E CA  1 
ATOM   8412  C C   . LEU E 1 41  ? 27.922  11.577  -2.947  1.00 141.07 ? 39  LEU E C   1 
ATOM   8413  O O   . LEU E 1 41  ? 28.064  12.108  -4.055  1.00 139.01 ? 39  LEU E O   1 
ATOM   8414  C CB  . LEU E 1 41  ? 27.141  9.192   -3.300  1.00 142.20 ? 39  LEU E CB  1 
ATOM   8415  C CG  . LEU E 1 41  ? 25.639  9.483   -3.097  1.00 142.14 ? 39  LEU E CG  1 
ATOM   8416  C CD1 . LEU E 1 41  ? 24.816  8.486   -3.899  1.00 137.98 ? 39  LEU E CD1 1 
ATOM   8417  C CD2 . LEU E 1 41  ? 25.269  9.395   -1.614  1.00 141.50 ? 39  LEU E CD2 1 
ATOM   8418  N N   . ALA E 1 42  ? 27.511  12.208  -1.842  1.00 140.64 ? 40  ALA E N   1 
ATOM   8419  C CA  . ALA E 1 42  ? 27.148  13.615  -1.760  1.00 140.49 ? 40  ALA E CA  1 
ATOM   8420  C C   . ALA E 1 42  ? 28.398  14.478  -1.860  1.00 139.55 ? 40  ALA E C   1 
ATOM   8421  O O   . ALA E 1 42  ? 28.306  15.696  -1.992  1.00 142.07 ? 40  ALA E O   1 
ATOM   8422  C CB  . ALA E 1 42  ? 26.421  13.896  -0.437  1.00 139.09 ? 40  ALA E CB  1 
ATOM   8423  N N   . THR E 1 43  ? 29.563  13.848  -1.779  1.00 136.16 ? 41  THR E N   1 
ATOM   8424  C CA  . THR E 1 43  ? 30.823  14.565  -1.896  1.00 132.42 ? 41  THR E CA  1 
ATOM   8425  C C   . THR E 1 43  ? 31.923  13.540  -1.994  1.00 131.09 ? 41  THR E C   1 
ATOM   8426  O O   . THR E 1 43  ? 32.591  13.414  -3.021  1.00 131.73 ? 41  THR E O   1 
ATOM   8427  C CB  . THR E 1 43  ? 31.131  15.437  -0.669  1.00 131.50 ? 41  THR E CB  1 
ATOM   8428  O OG1 . THR E 1 43  ? 30.004  16.259  -0.363  1.00 132.72 ? 41  THR E OG1 1 
ATOM   8429  C CG2 . THR E 1 43  ? 32.335  16.326  -0.949  1.00 131.38 ? 41  THR E CG2 1 
ATOM   8430  N N   . VAL E 1 44  ? 32.082  12.793  -0.910  1.00 128.90 ? 42  VAL E N   1 
ATOM   8431  C CA  . VAL E 1 44  ? 33.109  11.770  -0.811  1.00 125.60 ? 42  VAL E CA  1 
ATOM   8432  C C   . VAL E 1 44  ? 33.308  10.948  -2.102  1.00 123.86 ? 42  VAL E C   1 
ATOM   8433  O O   . VAL E 1 44  ? 34.232  11.219  -2.870  1.00 122.42 ? 42  VAL E O   1 
ATOM   8434  C CB  . VAL E 1 44  ? 32.828  10.842  0.415   1.00 124.58 ? 42  VAL E CB  1 
ATOM   8435  C CG1 . VAL E 1 44  ? 33.987  9.886   0.626   1.00 125.18 ? 42  VAL E CG1 1 
ATOM   8436  C CG2 . VAL E 1 44  ? 32.634  11.692  1.677   1.00 121.76 ? 42  VAL E CG2 1 
ATOM   8437  N N   . SER E 1 45  ? 32.453  9.963   -2.351  1.00 122.11 ? 43  SER E N   1 
ATOM   8438  C CA  . SER E 1 45  ? 32.588  9.123   -3.538  1.00 121.02 ? 43  SER E CA  1 
ATOM   8439  C C   . SER E 1 45  ? 33.318  9.789   -4.697  1.00 122.06 ? 43  SER E C   1 
ATOM   8440  O O   . SER E 1 45  ? 34.537  9.655   -4.828  1.00 122.68 ? 43  SER E O   1 
ATOM   8441  C CB  . SER E 1 45  ? 31.219  8.661   -4.003  1.00 119.06 ? 43  SER E CB  1 
ATOM   8442  O OG  . SER E 1 45  ? 30.524  8.092   -2.912  1.00 117.29 ? 43  SER E OG  1 
ATOM   8443  N N   . ALA E 1 46  ? 32.569  10.509  -5.527  1.00 123.12 ? 44  ALA E N   1 
ATOM   8444  C CA  . ALA E 1 46  ? 33.121  11.205  -6.693  1.00 124.29 ? 44  ALA E CA  1 
ATOM   8445  C C   . ALA E 1 46  ? 34.594  11.610  -6.554  1.00 124.48 ? 44  ALA E C   1 
ATOM   8446  O O   . ALA E 1 46  ? 35.376  11.447  -7.492  1.00 127.17 ? 44  ALA E O   1 
ATOM   8447  C CB  . ALA E 1 46  ? 32.275  12.432  -6.998  1.00 124.27 ? 44  ALA E CB  1 
ATOM   8448  N N   . LEU E 1 47  ? 34.965  12.138  -5.390  1.00 121.74 ? 45  LEU E N   1 
ATOM   8449  C CA  . LEU E 1 47  ? 36.342  12.544  -5.155  1.00 118.52 ? 45  LEU E CA  1 
ATOM   8450  C C   . LEU E 1 47  ? 37.315  11.399  -5.452  1.00 119.09 ? 45  LEU E C   1 
ATOM   8451  O O   . LEU E 1 47  ? 38.509  11.631  -5.631  1.00 119.82 ? 45  LEU E O   1 
ATOM   8452  C CB  . LEU E 1 47  ? 36.511  13.033  -3.719  1.00 113.42 ? 45  LEU E CB  1 
ATOM   8453  C CG  . LEU E 1 47  ? 35.794  14.348  -3.403  1.00 109.91 ? 45  LEU E CG  1 
ATOM   8454  C CD1 . LEU E 1 47  ? 35.776  14.606  -1.906  1.00 109.67 ? 45  LEU E CD1 1 
ATOM   8455  C CD2 . LEU E 1 47  ? 36.488  15.486  -4.123  1.00 108.09 ? 45  LEU E CD2 1 
ATOM   8456  N N   . ARG E 1 48  ? 36.808  10.168  -5.479  1.00 118.00 ? 46  ARG E N   1 
ATOM   8457  C CA  . ARG E 1 48  ? 37.630  9.009   -5.818  1.00 118.60 ? 46  ARG E CA  1 
ATOM   8458  C C   . ARG E 1 48  ? 37.714  9.007   -7.333  1.00 118.32 ? 46  ARG E C   1 
ATOM   8459  O O   . ARG E 1 48  ? 38.793  9.040   -7.912  1.00 119.93 ? 46  ARG E O   1 
ATOM   8460  C CB  . ARG E 1 48  ? 36.964  7.698   -5.414  1.00 119.59 ? 46  ARG E CB  1 
ATOM   8461  C CG  . ARG E 1 48  ? 36.960  7.404   -3.959  1.00 122.47 ? 46  ARG E CG  1 
ATOM   8462  C CD  . ARG E 1 48  ? 36.449  6.006   -3.730  1.00 125.30 ? 46  ARG E CD  1 
ATOM   8463  N NE  . ARG E 1 48  ? 36.415  5.739   -2.302  1.00 133.67 ? 46  ARG E NE  1 
ATOM   8464  C CZ  . ARG E 1 48  ? 35.617  6.375   -1.448  1.00 137.07 ? 46  ARG E CZ  1 
ATOM   8465  N NH1 . ARG E 1 48  ? 34.783  7.310   -1.900  1.00 141.07 ? 46  ARG E NH1 1 
ATOM   8466  N NH2 . ARG E 1 48  ? 35.662  6.090   -0.145  1.00 137.22 ? 46  ARG E NH2 1 
ATOM   8467  N N   . LYS E 1 49  ? 36.545  8.962   -7.962  1.00 117.24 ? 47  LYS E N   1 
ATOM   8468  C CA  . LYS E 1 49  ? 36.436  8.939   -9.413  1.00 117.88 ? 47  LYS E CA  1 
ATOM   8469  C C   . LYS E 1 49  ? 37.142  10.112  -10.071 1.00 117.21 ? 47  LYS E C   1 
ATOM   8470  O O   . LYS E 1 49  ? 37.298  10.175  -11.295 1.00 118.89 ? 47  LYS E O   1 
ATOM   8471  C CB  . LYS E 1 49  ? 34.959  8.887   -9.803  1.00 118.80 ? 47  LYS E CB  1 
ATOM   8472  C CG  . LYS E 1 49  ? 34.355  7.550   -9.429  1.00 122.83 ? 47  LYS E CG  1 
ATOM   8473  C CD  . LYS E 1 49  ? 32.888  7.440   -9.714  1.00 125.80 ? 47  LYS E CD  1 
ATOM   8474  C CE  . LYS E 1 49  ? 32.402  6.064   -9.290  1.00 126.04 ? 47  LYS E CE  1 
ATOM   8475  N NZ  . LYS E 1 49  ? 30.968  5.897   -9.606  1.00 126.31 ? 47  LYS E NZ  1 
ATOM   8476  N N   . MET E 1 50  ? 37.577  11.039  -9.231  1.00 116.11 ? 48  MET E N   1 
ATOM   8477  C CA  . MET E 1 50  ? 38.295  12.221  -9.664  1.00 115.92 ? 48  MET E CA  1 
ATOM   8478  C C   . MET E 1 50  ? 39.595  12.197  -8.865  1.00 116.92 ? 48  MET E C   1 
ATOM   8479  O O   . MET E 1 50  ? 39.925  13.147  -8.158  1.00 120.25 ? 48  MET E O   1 
ATOM   8480  C CB  . MET E 1 50  ? 37.490  13.474  -9.317  1.00 113.14 ? 48  MET E CB  1 
ATOM   8481  C CG  . MET E 1 50  ? 38.144  14.800  -9.715  1.00 112.54 ? 48  MET E CG  1 
ATOM   8482  S SD  . MET E 1 50  ? 37.748  16.139  -8.538  1.00 107.87 ? 48  MET E SD  1 
ATOM   8483  C CE  . MET E 1 50  ? 36.498  15.292  -7.525  1.00 104.75 ? 48  MET E CE  1 
ATOM   8484  N N   . GLY E 1 51  ? 40.324  11.092  -8.959  1.00 115.82 ? 49  GLY E N   1 
ATOM   8485  C CA  . GLY E 1 51  ? 41.566  10.978  -8.215  1.00 111.54 ? 49  GLY E CA  1 
ATOM   8486  C C   . GLY E 1 51  ? 41.346  11.356  -6.766  1.00 107.71 ? 49  GLY E C   1 
ATOM   8487  O O   . GLY E 1 51  ? 40.479  10.811  -6.097  1.00 106.67 ? 49  GLY E O   1 
ATOM   8488  N N   . VAL E 1 52  ? 42.154  12.274  -6.268  1.00 105.38 ? 50  VAL E N   1 
ATOM   8489  C CA  . VAL E 1 52  ? 41.980  12.746  -4.908  1.00 105.10 ? 50  VAL E CA  1 
ATOM   8490  C C   . VAL E 1 52  ? 41.886  11.658  -3.851  1.00 106.62 ? 50  VAL E C   1 
ATOM   8491  O O   . VAL E 1 52  ? 40.951  10.844  -3.851  1.00 106.83 ? 50  VAL E O   1 
ATOM   8492  C CB  . VAL E 1 52  ? 40.727  13.582  -4.829  1.00 102.76 ? 50  VAL E CB  1 
ATOM   8493  C CG1 . VAL E 1 52  ? 40.432  13.941  -3.399  1.00 103.35 ? 50  VAL E CG1 1 
ATOM   8494  C CG2 . VAL E 1 52  ? 40.904  14.826  -5.668  1.00 104.66 ? 50  VAL E CG2 1 
ATOM   8495  N N   . LYS E 1 53  ? 42.836  11.682  -2.920  1.00 106.70 ? 51  LYS E N   1 
ATOM   8496  C CA  . LYS E 1 53  ? 42.892  10.688  -1.857  1.00 105.63 ? 51  LYS E CA  1 
ATOM   8497  C C   . LYS E 1 53  ? 41.902  10.986  -0.721  1.00 104.01 ? 51  LYS E C   1 
ATOM   8498  O O   . LYS E 1 53  ? 41.685  12.156  -0.379  1.00 101.63 ? 51  LYS E O   1 
ATOM   8499  C CB  . LYS E 1 53  ? 44.321  10.615  -1.299  1.00 108.82 ? 51  LYS E CB  1 
ATOM   8500  C CG  . LYS E 1 53  ? 45.426  10.276  -2.312  1.00 109.81 ? 51  LYS E CG  1 
ATOM   8501  C CD  . LYS E 1 53  ? 46.812  10.517  -1.686  1.00 113.55 ? 51  LYS E CD  1 
ATOM   8502  C CE  . LYS E 1 53  ? 47.980  10.456  -2.693  1.00 116.96 ? 51  LYS E CE  1 
ATOM   8503  N NZ  . LYS E 1 53  ? 49.284  11.045  -2.176  1.00 116.29 ? 51  LYS E NZ  1 
ATOM   8504  N N   . LEU E 1 54  ? 41.317  9.926   -0.143  1.00 103.75 ? 52  LEU E N   1 
ATOM   8505  C CA  . LEU E 1 54  ? 40.346  10.041  0.963   1.00 102.88 ? 52  LEU E CA  1 
ATOM   8506  C C   . LEU E 1 54  ? 40.790  9.360   2.245   1.00 101.27 ? 52  LEU E C   1 
ATOM   8507  O O   . LEU E 1 54  ? 41.001  8.140   2.274   1.00 100.73 ? 52  LEU E O   1 
ATOM   8508  C CB  . LEU E 1 54  ? 39.006  9.461   0.548   1.00 103.92 ? 52  LEU E CB  1 
ATOM   8509  C CG  . LEU E 1 54  ? 38.425  10.284  -0.601  1.00 104.11 ? 52  LEU E CG  1 
ATOM   8510  C CD1 . LEU E 1 54  ? 37.176  9.617   -1.116  1.00 102.59 ? 52  LEU E CD1 1 
ATOM   8511  C CD2 . LEU E 1 54  ? 38.155  11.716  -0.122  1.00 100.95 ? 52  LEU E CD2 1 
ATOM   8512  N N   . THR E 1 55  ? 40.900  10.162  3.300   1.00 99.92  ? 53  THR E N   1 
ATOM   8513  C CA  . THR E 1 55  ? 41.358  9.686   4.599   1.00 101.95 ? 53  THR E CA  1 
ATOM   8514  C C   . THR E 1 55  ? 40.401  9.978   5.722   1.00 101.95 ? 53  THR E C   1 
ATOM   8515  O O   . THR E 1 55  ? 40.223  11.136  6.072   1.00 102.57 ? 53  THR E O   1 
ATOM   8516  C CB  . THR E 1 55  ? 42.619  10.401  5.027   1.00 103.08 ? 53  THR E CB  1 
ATOM   8517  O OG1 . THR E 1 55  ? 43.600  10.301  3.994   1.00 109.88 ? 53  THR E OG1 1 
ATOM   8518  C CG2 . THR E 1 55  ? 43.132  9.824   6.339   1.00 105.32 ? 53  THR E CG2 1 
ATOM   8519  N N   . PRO E 1 56  ? 39.807  8.950   6.344   1.00 102.31 ? 54  PRO E N   1 
ATOM   8520  C CA  . PRO E 1 56  ? 38.895  9.326   7.434   1.00 102.93 ? 54  PRO E CA  1 
ATOM   8521  C C   . PRO E 1 56  ? 39.614  10.199  8.484   1.00 104.79 ? 54  PRO E C   1 
ATOM   8522  O O   . PRO E 1 56  ? 38.989  10.910  9.280   1.00 101.69 ? 54  PRO E O   1 
ATOM   8523  C CB  . PRO E 1 56  ? 38.440  7.969   7.988   1.00 100.31 ? 54  PRO E CB  1 
ATOM   8524  C CG  . PRO E 1 56  ? 39.582  7.045   7.636   1.00 97.80  ? 54  PRO E CG  1 
ATOM   8525  C CD  . PRO E 1 56  ? 39.963  7.489   6.249   1.00 100.39 ? 54  PRO E CD  1 
ATOM   8526  N N   . HIS E 1 57  ? 40.941  10.170  8.443   1.00 108.01 ? 55  HIS E N   1 
ATOM   8527  C CA  . HIS E 1 57  ? 41.749  10.910  9.398   1.00 109.74 ? 55  HIS E CA  1 
ATOM   8528  C C   . HIS E 1 57  ? 42.384  12.192  8.921   1.00 107.61 ? 55  HIS E C   1 
ATOM   8529  O O   . HIS E 1 57  ? 43.223  12.213  8.017   1.00 103.69 ? 55  HIS E O   1 
ATOM   8530  C CB  . HIS E 1 57  ? 42.808  9.977   9.966   1.00 116.04 ? 55  HIS E CB  1 
ATOM   8531  C CG  . HIS E 1 57  ? 42.235  8.702   10.500  1.00 122.07 ? 55  HIS E CG  1 
ATOM   8532  N ND1 . HIS E 1 57  ? 41.394  8.660   11.597  1.00 124.20 ? 55  HIS E ND1 1 
ATOM   8533  C CD2 . HIS E 1 57  ? 42.314  7.429   10.043  1.00 124.28 ? 55  HIS E CD2 1 
ATOM   8534  C CE1 . HIS E 1 57  ? 40.982  7.421   11.788  1.00 126.09 ? 55  HIS E CE1 1 
ATOM   8535  N NE2 . HIS E 1 57  ? 41.525  6.653   10.857  1.00 126.76 ? 55  HIS E NE2 1 
ATOM   8536  N N   . ASN E 1 58  ? 41.965  13.256  9.599   1.00 109.21 ? 56  ASN E N   1 
ATOM   8537  C CA  . ASN E 1 58  ? 42.398  14.637  9.367   1.00 109.98 ? 56  ASN E CA  1 
ATOM   8538  C C   . ASN E 1 58  ? 43.904  14.757  9.578   1.00 105.82 ? 56  ASN E C   1 
ATOM   8539  O O   . ASN E 1 58  ? 44.546  15.717  9.166   1.00 106.16 ? 56  ASN E O   1 
ATOM   8540  C CB  . ASN E 1 58  ? 41.653  15.569  10.341  1.00 113.11 ? 56  ASN E CB  1 
ATOM   8541  C CG  . ASN E 1 58  ? 40.157  15.229  10.455  1.00 117.38 ? 56  ASN E CG  1 
ATOM   8542  O OD1 . ASN E 1 58  ? 39.394  15.384  9.494   1.00 119.14 ? 56  ASN E OD1 1 
ATOM   8543  N ND2 . ASN E 1 58  ? 39.742  14.744  11.631  1.00 121.91 ? 56  ASN E ND2 1 
ATOM   8544  N N   . LYS E 1 59  ? 44.460  13.761  10.236  1.00 101.19 ? 57  LYS E N   1 
ATOM   8545  C CA  . LYS E 1 59  ? 45.871  13.752  10.493  1.00 96.25  ? 57  LYS E CA  1 
ATOM   8546  C C   . LYS E 1 59  ? 46.588  13.557  9.168   1.00 93.58  ? 57  LYS E C   1 
ATOM   8547  O O   . LYS E 1 59  ? 47.329  14.439  8.726   1.00 86.47  ? 57  LYS E O   1 
ATOM   8548  C CB  . LYS E 1 59  ? 46.206  12.628  11.484  1.00 97.72  ? 57  LYS E CB  1 
ATOM   8549  C CG  . LYS E 1 59  ? 45.069  11.586  11.736  1.00 94.93  ? 57  LYS E CG  1 
ATOM   8550  C CD  . LYS E 1 59  ? 43.839  12.140  12.500  1.00 89.98  ? 57  LYS E CD  1 
ATOM   8551  C CE  . LYS E 1 59  ? 42.900  11.029  13.001  1.00 86.29  ? 57  LYS E CE  1 
ATOM   8552  N NZ  . LYS E 1 59  ? 41.659  11.550  13.653  1.00 84.38  ? 57  LYS E NZ  1 
ATOM   8553  N N   . GLU E 1 60  ? 46.341  12.411  8.530   1.00 95.60  ? 58  GLU E N   1 
ATOM   8554  C CA  . GLU E 1 60  ? 46.979  12.085  7.254   1.00 98.75  ? 58  GLU E CA  1 
ATOM   8555  C C   . GLU E 1 60  ? 46.945  13.314  6.350   1.00 96.34  ? 58  GLU E C   1 
ATOM   8556  O O   . GLU E 1 60  ? 47.971  13.711  5.788   1.00 94.77  ? 58  GLU E O   1 
ATOM   8557  C CB  . GLU E 1 60  ? 46.295  10.861  6.599   1.00 103.32 ? 58  GLU E CB  1 
ATOM   8558  C CG  . GLU E 1 60  ? 47.212  9.585   6.558   1.00 110.08 ? 58  GLU E CG  1 
ATOM   8559  C CD  . GLU E 1 60  ? 46.503  8.268   6.137   1.00 112.79 ? 58  GLU E CD  1 
ATOM   8560  O OE1 . GLU E 1 60  ? 45.500  7.874   6.780   1.00 113.44 ? 58  GLU E OE1 1 
ATOM   8561  O OE2 . GLU E 1 60  ? 46.958  7.607   5.170   1.00 113.89 ? 58  GLU E OE2 1 
ATOM   8562  N N   . THR E 1 61  ? 45.772  13.929  6.241   1.00 93.98  ? 59  THR E N   1 
ATOM   8563  C CA  . THR E 1 61  ? 45.606  15.148  5.446   1.00 89.92  ? 59  THR E CA  1 
ATOM   8564  C C   . THR E 1 61  ? 46.736  16.153  5.701   1.00 90.18  ? 59  THR E C   1 
ATOM   8565  O O   . THR E 1 61  ? 47.691  16.249  4.930   1.00 93.67  ? 59  THR E O   1 
ATOM   8566  C CB  . THR E 1 61  ? 44.278  15.858  5.789   1.00 86.29  ? 59  THR E CB  1 
ATOM   8567  O OG1 . THR E 1 61  ? 43.172  15.034  5.404   1.00 79.90  ? 59  THR E OG1 1 
ATOM   8568  C CG2 . THR E 1 61  ? 44.188  17.199  5.084   1.00 86.36  ? 59  THR E CG2 1 
ATOM   8569  N N   . VAL E 1 62  ? 46.597  16.888  6.801   1.00 85.73  ? 60  VAL E N   1 
ATOM   8570  C CA  . VAL E 1 62  ? 47.536  17.914  7.223   1.00 81.45  ? 60  VAL E CA  1 
ATOM   8571  C C   . VAL E 1 62  ? 48.985  17.621  6.907   1.00 82.47  ? 60  VAL E C   1 
ATOM   8572  O O   . VAL E 1 62  ? 49.697  18.461  6.365   1.00 81.62  ? 60  VAL E O   1 
ATOM   8573  C CB  . VAL E 1 62  ? 47.417  18.136  8.705   1.00 76.99  ? 60  VAL E CB  1 
ATOM   8574  C CG1 . VAL E 1 62  ? 48.170  19.382  9.090   1.00 77.76  ? 60  VAL E CG1 1 
ATOM   8575  C CG2 . VAL E 1 62  ? 45.960  18.231  9.086   1.00 75.33  ? 60  VAL E CG2 1 
ATOM   8576  N N   . GLN E 1 63  ? 49.426  16.428  7.264   1.00 85.69  ? 61  GLN E N   1 
ATOM   8577  C CA  . GLN E 1 63  ? 50.797  16.035  7.001   1.00 91.42  ? 61  GLN E CA  1 
ATOM   8578  C C   . GLN E 1 63  ? 51.035  16.154  5.521   1.00 91.13  ? 61  GLN E C   1 
ATOM   8579  O O   . GLN E 1 63  ? 52.018  16.755  5.071   1.00 92.06  ? 61  GLN E O   1 
ATOM   8580  C CB  . GLN E 1 63  ? 51.017  14.589  7.392   1.00 97.60  ? 61  GLN E CB  1 
ATOM   8581  C CG  . GLN E 1 63  ? 50.736  14.266  8.826   1.00 105.66 ? 61  GLN E CG  1 
ATOM   8582  C CD  . GLN E 1 63  ? 51.359  12.950  9.200   1.00 109.16 ? 61  GLN E CD  1 
ATOM   8583  O OE1 . GLN E 1 63  ? 52.578  12.799  9.115   1.00 114.87 ? 61  GLN E OE1 1 
ATOM   8584  N NE2 . GLN E 1 63  ? 50.537  11.982  9.605   1.00 111.36 ? 61  GLN E NE2 1 
ATOM   8585  N N   . HIS E 1 64  ? 50.108  15.551  4.786   1.00 89.83  ? 62  HIS E N   1 
ATOM   8586  C CA  . HIS E 1 64  ? 50.098  15.530  3.332   1.00 89.91  ? 62  HIS E CA  1 
ATOM   8587  C C   . HIS E 1 64  ? 50.105  16.922  2.712   1.00 88.68  ? 62  HIS E C   1 
ATOM   8588  O O   . HIS E 1 64  ? 50.893  17.219  1.805   1.00 89.23  ? 62  HIS E O   1 
ATOM   8589  C CB  . HIS E 1 64  ? 48.843  14.778  2.868   1.00 92.31  ? 62  HIS E CB  1 
ATOM   8590  C CG  . HIS E 1 64  ? 48.713  14.646  1.380   1.00 96.95  ? 62  HIS E CG  1 
ATOM   8591  N ND1 . HIS E 1 64  ? 48.364  15.697  0.562   1.00 97.87  ? 62  HIS E ND1 1 
ATOM   8592  C CD2 . HIS E 1 64  ? 48.908  13.578  0.563   1.00 97.08  ? 62  HIS E CD2 1 
ATOM   8593  C CE1 . HIS E 1 64  ? 48.352  15.286  -0.696  1.00 101.51 ? 62  HIS E CE1 1 
ATOM   8594  N NE2 . HIS E 1 64  ? 48.680  14.005  -0.720  1.00 99.57  ? 62  HIS E NE2 1 
ATOM   8595  N N   . SER E 1 65  ? 49.223  17.772  3.227   1.00 86.61  ? 63  SER E N   1 
ATOM   8596  C CA  . SER E 1 65  ? 49.041  19.120  2.720   1.00 84.99  ? 63  SER E CA  1 
ATOM   8597  C C   . SER E 1 65  ? 50.040  20.210  3.068   1.00 83.93  ? 63  SER E C   1 
ATOM   8598  O O   . SER E 1 65  ? 50.505  20.314  4.193   1.00 83.33  ? 63  SER E O   1 
ATOM   8599  C CB  . SER E 1 65  ? 47.643  19.602  3.104   1.00 85.85  ? 63  SER E CB  1 
ATOM   8600  O OG  . SER E 1 65  ? 47.432  19.445  4.490   1.00 83.65  ? 63  SER E OG  1 
ATOM   8601  N N   . ASP E 1 66  ? 50.348  21.025  2.058   1.00 84.52  ? 64  ASP E N   1 
ATOM   8602  C CA  . ASP E 1 66  ? 51.232  22.190  2.171   1.00 81.09  ? 64  ASP E CA  1 
ATOM   8603  C C   . ASP E 1 66  ? 50.240  23.371  2.346   1.00 79.23  ? 64  ASP E C   1 
ATOM   8604  O O   . ASP E 1 66  ? 50.508  24.329  3.082   1.00 78.91  ? 64  ASP E O   1 
ATOM   8605  C CB  . ASP E 1 66  ? 52.066  22.388  0.889   1.00 81.36  ? 64  ASP E CB  1 
ATOM   8606  C CG  . ASP E 1 66  ? 53.068  21.252  0.634   1.00 81.98  ? 64  ASP E CG  1 
ATOM   8607  O OD1 . ASP E 1 66  ? 52.671  20.069  0.537   1.00 81.72  ? 64  ASP E OD1 1 
ATOM   8608  O OD2 . ASP E 1 66  ? 54.270  21.552  0.512   1.00 85.90  ? 64  ASP E OD2 1 
ATOM   8609  N N   . VAL E 1 67  ? 49.098  23.296  1.653   1.00 74.68  ? 65  VAL E N   1 
ATOM   8610  C CA  . VAL E 1 67  ? 48.045  24.303  1.762   1.00 69.20  ? 65  VAL E CA  1 
ATOM   8611  C C   . VAL E 1 67  ? 46.836  23.558  2.177   1.00 67.36  ? 65  VAL E C   1 
ATOM   8612  O O   . VAL E 1 67  ? 46.194  22.862  1.386   1.00 63.66  ? 65  VAL E O   1 
ATOM   8613  C CB  . VAL E 1 67  ? 47.682  24.963  0.463   1.00 66.91  ? 65  VAL E CB  1 
ATOM   8614  C CG1 . VAL E 1 67  ? 46.464  25.829  0.669   1.00 64.34  ? 65  VAL E CG1 1 
ATOM   8615  C CG2 . VAL E 1 67  ? 48.824  25.791  -0.012  1.00 68.17  ? 65  VAL E CG2 1 
ATOM   8616  N N   . LEU E 1 68  ? 46.524  23.701  3.440   1.00 67.08  ? 66  LEU E N   1 
ATOM   8617  C CA  . LEU E 1 68  ? 45.395  22.995  3.940   1.00 70.30  ? 66  LEU E CA  1 
ATOM   8618  C C   . LEU E 1 68  ? 44.175  23.880  3.872   1.00 72.12  ? 66  LEU E C   1 
ATOM   8619  O O   . LEU E 1 68  ? 44.254  25.061  4.213   1.00 74.53  ? 66  LEU E O   1 
ATOM   8620  C CB  . LEU E 1 68  ? 45.687  22.563  5.365   1.00 67.17  ? 66  LEU E CB  1 
ATOM   8621  C CG  . LEU E 1 68  ? 44.618  21.631  5.891   1.00 66.38  ? 66  LEU E CG  1 
ATOM   8622  C CD1 . LEU E 1 68  ? 44.176  20.645  4.829   1.00 65.59  ? 66  LEU E CD1 1 
ATOM   8623  C CD2 . LEU E 1 68  ? 45.179  20.931  7.071   1.00 66.61  ? 66  LEU E CD2 1 
ATOM   8624  N N   . PHE E 1 69  ? 43.059  23.327  3.408   1.00 70.42  ? 67  PHE E N   1 
ATOM   8625  C CA  . PHE E 1 69  ? 41.846  24.113  3.339   1.00 70.45  ? 67  PHE E CA  1 
ATOM   8626  C C   . PHE E 1 69  ? 40.900  23.766  4.443   1.00 71.75  ? 67  PHE E C   1 
ATOM   8627  O O   . PHE E 1 69  ? 40.860  22.622  4.878   1.00 71.06  ? 67  PHE E O   1 
ATOM   8628  C CB  . PHE E 1 69  ? 41.138  23.902  2.024   1.00 68.53  ? 67  PHE E CB  1 
ATOM   8629  C CG  . PHE E 1 69  ? 41.752  24.651  0.905   1.00 68.52  ? 67  PHE E CG  1 
ATOM   8630  C CD1 . PHE E 1 69  ? 42.774  24.090  0.170   1.00 67.72  ? 67  PHE E CD1 1 
ATOM   8631  C CD2 . PHE E 1 69  ? 41.306  25.932  0.582   1.00 67.75  ? 67  PHE E CD2 1 
ATOM   8632  C CE1 . PHE E 1 69  ? 43.349  24.796  -0.886  1.00 69.44  ? 67  PHE E CE1 1 
ATOM   8633  C CE2 . PHE E 1 69  ? 41.869  26.646  -0.470  1.00 65.00  ? 67  PHE E CE2 1 
ATOM   8634  C CZ  . PHE E 1 69  ? 42.892  26.077  -1.207  1.00 65.23  ? 67  PHE E CZ  1 
ATOM   8635  N N   . LEU E 1 70  ? 40.137  24.748  4.904   1.00 72.06  ? 68  LEU E N   1 
ATOM   8636  C CA  . LEU E 1 70  ? 39.174  24.476  5.945   1.00 75.27  ? 68  LEU E CA  1 
ATOM   8637  C C   . LEU E 1 70  ? 37.777  24.585  5.403   1.00 80.69  ? 68  LEU E C   1 
ATOM   8638  O O   . LEU E 1 70  ? 37.303  25.671  5.088   1.00 86.22  ? 68  LEU E O   1 
ATOM   8639  C CB  . LEU E 1 70  ? 39.364  25.421  7.102   1.00 73.94  ? 68  LEU E CB  1 
ATOM   8640  C CG  . LEU E 1 70  ? 40.653  25.100  7.842   1.00 71.13  ? 68  LEU E CG  1 
ATOM   8641  C CD1 . LEU E 1 70  ? 40.579  25.608  9.245   1.00 71.28  ? 68  LEU E CD1 1 
ATOM   8642  C CD2 . LEU E 1 70  ? 40.857  23.613  7.842   1.00 70.55  ? 68  LEU E CD2 1 
ATOM   8643  N N   . ALA E 1 71  ? 37.122  23.441  5.290   1.00 83.82  ? 69  ALA E N   1 
ATOM   8644  C CA  . ALA E 1 71  ? 35.773  23.360  4.755   1.00 86.50  ? 69  ALA E CA  1 
ATOM   8645  C C   . ALA E 1 71  ? 34.946  22.351  5.537   1.00 89.66  ? 69  ALA E C   1 
ATOM   8646  O O   . ALA E 1 71  ? 34.809  21.196  5.131   1.00 87.48  ? 69  ALA E O   1 
ATOM   8647  C CB  . ALA E 1 71  ? 35.830  22.946  3.298   1.00 84.49  ? 69  ALA E CB  1 
ATOM   8648  N N   . VAL E 1 72  ? 34.404  22.783  6.666   1.00 94.61  ? 70  VAL E N   1 
ATOM   8649  C CA  . VAL E 1 72  ? 33.617  21.894  7.497   1.00 98.87  ? 70  VAL E CA  1 
ATOM   8650  C C   . VAL E 1 72  ? 32.544  22.680  8.230   1.00 101.45 ? 70  VAL E C   1 
ATOM   8651  O O   . VAL E 1 72  ? 32.020  22.225  9.248   1.00 103.52 ? 70  VAL E O   1 
ATOM   8652  C CB  . VAL E 1 72  ? 34.508  21.198  8.547   1.00 99.49  ? 70  VAL E CB  1 
ATOM   8653  C CG1 . VAL E 1 72  ? 33.910  19.841  8.929   1.00 99.51  ? 70  VAL E CG1 1 
ATOM   8654  C CG2 . VAL E 1 72  ? 35.922  21.058  8.014   1.00 100.28 ? 70  VAL E CG2 1 
ATOM   8655  N N   . LYS E 1 73  ? 32.211  23.855  7.710   1.00 101.31 ? 71  LYS E N   1 
ATOM   8656  C CA  . LYS E 1 73  ? 31.214  24.694  8.350   1.00 102.90 ? 71  LYS E CA  1 
ATOM   8657  C C   . LYS E 1 73  ? 31.851  25.335  9.579   1.00 104.78 ? 71  LYS E C   1 
ATOM   8658  O O   . LYS E 1 73  ? 32.735  24.754  10.209  1.00 104.04 ? 71  LYS E O   1 
ATOM   8659  C CB  . LYS E 1 73  ? 30.016  23.878  8.808   1.00 100.95 ? 71  LYS E CB  1 
ATOM   8660  C CG  . LYS E 1 73  ? 29.408  22.949  7.785   1.00 97.57  ? 71  LYS E CG  1 
ATOM   8661  C CD  . LYS E 1 73  ? 28.352  22.168  8.521   1.00 97.32  ? 71  LYS E CD  1 
ATOM   8662  C CE  . LYS E 1 73  ? 27.528  21.295  7.631   1.00 94.57  ? 71  LYS E CE  1 
ATOM   8663  N NZ  . LYS E 1 73  ? 26.419  20.684  8.432   1.00 91.19  ? 71  LYS E NZ  1 
ATOM   8664  N N   . PRO E 1 74  ? 31.409  26.551  9.925   1.00 107.38 ? 72  PRO E N   1 
ATOM   8665  C CA  . PRO E 1 74  ? 31.914  27.315  11.077  1.00 108.35 ? 72  PRO E CA  1 
ATOM   8666  C C   . PRO E 1 74  ? 31.610  26.755  12.476  1.00 107.90 ? 72  PRO E C   1 
ATOM   8667  O O   . PRO E 1 74  ? 32.425  26.878  13.386  1.00 107.29 ? 72  PRO E O   1 
ATOM   8668  C CB  . PRO E 1 74  ? 31.308  28.706  10.853  1.00 109.84 ? 72  PRO E CB  1 
ATOM   8669  C CG  . PRO E 1 74  ? 31.179  28.788  9.335   1.00 108.05 ? 72  PRO E CG  1 
ATOM   8670  C CD  . PRO E 1 74  ? 30.649  27.420  8.999   1.00 107.92 ? 72  PRO E CD  1 
ATOM   8671  N N   . HIS E 1 75  ? 30.433  26.162  12.646  1.00 109.41 ? 73  HIS E N   1 
ATOM   8672  C CA  . HIS E 1 75  ? 30.030  25.590  13.932  1.00 110.88 ? 73  HIS E CA  1 
ATOM   8673  C C   . HIS E 1 75  ? 30.701  24.241  14.003  1.00 106.06 ? 73  HIS E C   1 
ATOM   8674  O O   . HIS E 1 75  ? 30.043  23.229  14.206  1.00 106.77 ? 73  HIS E O   1 
ATOM   8675  C CB  . HIS E 1 75  ? 28.507  25.361  14.007  1.00 122.31 ? 73  HIS E CB  1 
ATOM   8676  C CG  . HIS E 1 75  ? 27.668  26.614  14.076  1.00 135.52 ? 73  HIS E CG  1 
ATOM   8677  N ND1 . HIS E 1 75  ? 27.686  27.481  15.152  1.00 140.94 ? 73  HIS E ND1 1 
ATOM   8678  C CD2 . HIS E 1 75  ? 26.728  27.105  13.225  1.00 139.47 ? 73  HIS E CD2 1 
ATOM   8679  C CE1 . HIS E 1 75  ? 26.797  28.444  14.962  1.00 142.09 ? 73  HIS E CE1 1 
ATOM   8680  N NE2 . HIS E 1 75  ? 26.201  28.238  13.800  1.00 141.86 ? 73  HIS E NE2 1 
ATOM   8681  N N   . ILE E 1 76  ? 32.008  24.221  13.809  1.00 100.74 ? 74  ILE E N   1 
ATOM   8682  C CA  . ILE E 1 76  ? 32.751  22.970  13.836  1.00 95.53  ? 74  ILE E CA  1 
ATOM   8683  C C   . ILE E 1 76  ? 34.215  23.255  13.948  1.00 95.96  ? 74  ILE E C   1 
ATOM   8684  O O   . ILE E 1 76  ? 34.914  22.664  14.764  1.00 98.13  ? 74  ILE E O   1 
ATOM   8685  C CB  . ILE E 1 76  ? 32.561  22.168  12.552  1.00 92.47  ? 74  ILE E CB  1 
ATOM   8686  C CG1 . ILE E 1 76  ? 31.347  21.257  12.673  1.00 94.16  ? 74  ILE E CG1 1 
ATOM   8687  C CG2 . ILE E 1 76  ? 33.806  21.373  12.258  1.00 85.58  ? 74  ILE E CG2 1 
ATOM   8688  C CD1 . ILE E 1 76  ? 31.078  20.459  11.410  1.00 98.39  ? 74  ILE E CD1 1 
ATOM   8689  N N   . ILE E 1 77  ? 34.665  24.168  13.100  1.00 96.13  ? 75  ILE E N   1 
ATOM   8690  C CA  . ILE E 1 77  ? 36.058  24.574  13.050  1.00 96.79  ? 75  ILE E CA  1 
ATOM   8691  C C   . ILE E 1 77  ? 36.737  24.685  14.411  1.00 100.20 ? 75  ILE E C   1 
ATOM   8692  O O   . ILE E 1 77  ? 37.930  24.406  14.535  1.00 101.98 ? 75  ILE E O   1 
ATOM   8693  C CB  . ILE E 1 77  ? 36.195  25.888  12.266  1.00 94.49  ? 75  ILE E CB  1 
ATOM   8694  C CG1 . ILE E 1 77  ? 36.130  25.575  10.767  1.00 93.05  ? 75  ILE E CG1 1 
ATOM   8695  C CG2 . ILE E 1 77  ? 37.470  26.600  12.643  1.00 88.67  ? 75  ILE E CG2 1 
ATOM   8696  C CD1 . ILE E 1 77  ? 36.072  26.787  9.874   1.00 95.68  ? 75  ILE E CD1 1 
ATOM   8697  N N   . PRO E 1 78  ? 35.992  25.091  15.453  1.00 102.56 ? 76  PRO E N   1 
ATOM   8698  C CA  . PRO E 1 78  ? 36.628  25.189  16.769  1.00 103.26 ? 76  PRO E CA  1 
ATOM   8699  C C   . PRO E 1 78  ? 37.264  23.837  17.111  1.00 104.77 ? 76  PRO E C   1 
ATOM   8700  O O   . PRO E 1 78  ? 38.453  23.753  17.415  1.00 104.38 ? 76  PRO E O   1 
ATOM   8701  C CB  . PRO E 1 78  ? 35.457  25.528  17.682  1.00 103.44 ? 76  PRO E CB  1 
ATOM   8702  C CG  . PRO E 1 78  ? 34.621  26.387  16.810  1.00 104.32 ? 76  PRO E CG  1 
ATOM   8703  C CD  . PRO E 1 78  ? 34.635  25.663  15.488  1.00 103.65 ? 76  PRO E CD  1 
ATOM   8704  N N   . PHE E 1 79  ? 36.462  22.778  17.051  1.00 107.67 ? 77  PHE E N   1 
ATOM   8705  C CA  . PHE E 1 79  ? 36.962  21.437  17.322  1.00 110.22 ? 77  PHE E CA  1 
ATOM   8706  C C   . PHE E 1 79  ? 38.209  21.311  16.457  1.00 108.71 ? 77  PHE E C   1 
ATOM   8707  O O   . PHE E 1 79  ? 39.334  21.316  16.955  1.00 108.31 ? 77  PHE E O   1 
ATOM   8708  C CB  . PHE E 1 79  ? 35.929  20.373  16.898  1.00 115.62 ? 77  PHE E CB  1 
ATOM   8709  C CG  . PHE E 1 79  ? 34.596  20.496  17.598  1.00 122.32 ? 77  PHE E CG  1 
ATOM   8710  C CD1 . PHE E 1 79  ? 33.936  21.731  17.664  1.00 124.82 ? 77  PHE E CD1 1 
ATOM   8711  C CD2 . PHE E 1 79  ? 33.992  19.376  18.179  1.00 126.17 ? 77  PHE E CD2 1 
ATOM   8712  C CE1 . PHE E 1 79  ? 32.696  21.857  18.300  1.00 127.79 ? 77  PHE E CE1 1 
ATOM   8713  C CE2 . PHE E 1 79  ? 32.735  19.482  18.827  1.00 128.98 ? 77  PHE E CE2 1 
ATOM   8714  C CZ  . PHE E 1 79  ? 32.089  20.725  18.887  1.00 129.29 ? 77  PHE E CZ  1 
ATOM   8715  N N   . ILE E 1 80  ? 37.975  21.199  15.154  1.00 107.69 ? 78  ILE E N   1 
ATOM   8716  C CA  . ILE E 1 80  ? 39.019  21.083  14.139  1.00 106.96 ? 78  ILE E CA  1 
ATOM   8717  C C   . ILE E 1 80  ? 40.384  21.533  14.629  1.00 104.61 ? 78  ILE E C   1 
ATOM   8718  O O   . ILE E 1 80  ? 41.322  20.750  14.681  1.00 103.16 ? 78  ILE E O   1 
ATOM   8719  C CB  . ILE E 1 80  ? 38.652  21.921  12.895  1.00 109.80 ? 78  ILE E CB  1 
ATOM   8720  C CG1 . ILE E 1 80  ? 37.369  21.374  12.256  1.00 111.99 ? 78  ILE E CG1 1 
ATOM   8721  C CG2 . ILE E 1 80  ? 39.812  21.940  11.922  1.00 109.03 ? 78  ILE E CG2 1 
ATOM   8722  C CD1 . ILE E 1 80  ? 36.831  22.207  11.083  1.00 116.62 ? 78  ILE E CD1 1 
ATOM   8723  N N   . LEU E 1 81  ? 40.486  22.807  14.983  1.00 104.51 ? 79  LEU E N   1 
ATOM   8724  C CA  . LEU E 1 81  ? 41.736  23.364  15.483  1.00 106.73 ? 79  LEU E CA  1 
ATOM   8725  C C   . LEU E 1 81  ? 42.332  22.464  16.570  1.00 109.16 ? 79  LEU E C   1 
ATOM   8726  O O   . LEU E 1 81  ? 43.397  21.869  16.378  1.00 108.10 ? 79  LEU E O   1 
ATOM   8727  C CB  . LEU E 1 81  ? 41.491  24.762  16.058  1.00 104.36 ? 79  LEU E CB  1 
ATOM   8728  C CG  . LEU E 1 81  ? 40.735  25.697  15.112  1.00 101.14 ? 79  LEU E CG  1 
ATOM   8729  C CD1 . LEU E 1 81  ? 40.395  27.016  15.788  1.00 101.84 ? 79  LEU E CD1 1 
ATOM   8730  C CD2 . LEU E 1 81  ? 41.590  25.938  13.917  1.00 99.11  ? 79  LEU E CD2 1 
ATOM   8731  N N   . ASP E 1 82  ? 41.646  22.374  17.710  1.00 111.90 ? 80  ASP E N   1 
ATOM   8732  C CA  . ASP E 1 82  ? 42.112  21.554  18.817  1.00 115.65 ? 80  ASP E CA  1 
ATOM   8733  C C   . ASP E 1 82  ? 42.187  20.098  18.414  1.00 115.21 ? 80  ASP E C   1 
ATOM   8734  O O   . ASP E 1 82  ? 41.680  19.217  19.104  1.00 117.35 ? 80  ASP E O   1 
ATOM   8735  C CB  . ASP E 1 82  ? 41.200  21.700  20.041  1.00 121.94 ? 80  ASP E CB  1 
ATOM   8736  C CG  . ASP E 1 82  ? 41.211  23.110  20.625  1.00 129.12 ? 80  ASP E CG  1 
ATOM   8737  O OD1 . ASP E 1 82  ? 42.303  23.700  20.794  1.00 134.18 ? 80  ASP E OD1 1 
ATOM   8738  O OD2 . ASP E 1 82  ? 40.118  23.627  20.933  1.00 132.23 ? 80  ASP E OD2 1 
ATOM   8739  N N   . GLU E 1 83  ? 42.818  19.851  17.280  1.00 113.08 ? 81  GLU E N   1 
ATOM   8740  C CA  . GLU E 1 83  ? 42.987  18.506  16.785  1.00 112.31 ? 81  GLU E CA  1 
ATOM   8741  C C   . GLU E 1 83  ? 44.118  18.588  15.810  1.00 112.63 ? 81  GLU E C   1 
ATOM   8742  O O   . GLU E 1 83  ? 44.506  17.577  15.227  1.00 113.63 ? 81  GLU E O   1 
ATOM   8743  C CB  . GLU E 1 83  ? 41.779  18.046  16.009  1.00 112.78 ? 81  GLU E CB  1 
ATOM   8744  C CG  . GLU E 1 83  ? 40.484  18.202  16.690  1.00 119.56 ? 81  GLU E CG  1 
ATOM   8745  C CD  . GLU E 1 83  ? 39.366  18.074  15.699  1.00 123.65 ? 81  GLU E CD  1 
ATOM   8746  O OE1 . GLU E 1 83  ? 39.530  17.265  14.757  1.00 125.58 ? 81  GLU E OE1 1 
ATOM   8747  O OE2 . GLU E 1 83  ? 38.335  18.764  15.855  1.00 124.99 ? 81  GLU E OE2 1 
ATOM   8748  N N   . ILE E 1 84  ? 44.645  19.793  15.606  1.00 111.08 ? 82  ILE E N   1 
ATOM   8749  C CA  . ILE E 1 84  ? 45.719  19.925  14.639  1.00 109.39 ? 82  ILE E CA  1 
ATOM   8750  C C   . ILE E 1 84  ? 46.823  20.926  14.915  1.00 108.39 ? 82  ILE E C   1 
ATOM   8751  O O   . ILE E 1 84  ? 47.899  20.839  14.335  1.00 108.63 ? 82  ILE E O   1 
ATOM   8752  C CB  . ILE E 1 84  ? 45.137  20.183  13.236  1.00 109.75 ? 82  ILE E CB  1 
ATOM   8753  C CG1 . ILE E 1 84  ? 44.193  19.025  12.864  1.00 110.27 ? 82  ILE E CG1 1 
ATOM   8754  C CG2 . ILE E 1 84  ? 46.265  20.276  12.210  1.00 111.28 ? 82  ILE E CG2 1 
ATOM   8755  C CD1 . ILE E 1 84  ? 43.737  19.002  11.434  1.00 108.06 ? 82  ILE E CD1 1 
ATOM   8756  N N   . GLY E 1 85  ? 46.580  21.867  15.807  1.00 109.99 ? 83  GLY E N   1 
ATOM   8757  C CA  . GLY E 1 85  ? 47.608  22.853  16.103  1.00 113.91 ? 83  GLY E CA  1 
ATOM   8758  C C   . GLY E 1 85  ? 49.002  22.308  16.415  1.00 115.85 ? 83  GLY E C   1 
ATOM   8759  O O   . GLY E 1 85  ? 49.996  23.042  16.302  1.00 116.61 ? 83  GLY E O   1 
ATOM   8760  N N   . ALA E 1 86  ? 49.062  21.029  16.803  1.00 116.71 ? 84  ALA E N   1 
ATOM   8761  C CA  . ALA E 1 86  ? 50.293  20.315  17.180  1.00 116.89 ? 84  ALA E CA  1 
ATOM   8762  C C   . ALA E 1 86  ? 50.964  19.674  15.975  1.00 118.31 ? 84  ALA E C   1 
ATOM   8763  O O   . ALA E 1 86  ? 52.070  19.127  16.061  1.00 118.79 ? 84  ALA E O   1 
ATOM   8764  C CB  . ALA E 1 86  ? 49.960  19.235  18.200  1.00 116.58 ? 84  ALA E CB  1 
ATOM   8765  N N   . ASP E 1 87  ? 50.257  19.725  14.854  1.00 119.04 ? 85  ASP E N   1 
ATOM   8766  C CA  . ASP E 1 87  ? 50.724  19.169  13.597  1.00 118.78 ? 85  ASP E CA  1 
ATOM   8767  C C   . ASP E 1 87  ? 51.138  20.315  12.670  1.00 119.35 ? 85  ASP E C   1 
ATOM   8768  O O   . ASP E 1 87  ? 52.007  20.151  11.803  1.00 120.90 ? 85  ASP E O   1 
ATOM   8769  C CB  . ASP E 1 87  ? 49.604  18.327  12.998  1.00 116.72 ? 85  ASP E CB  1 
ATOM   8770  C CG  . ASP E 1 87  ? 49.062  17.323  13.990  1.00 118.56 ? 85  ASP E CG  1 
ATOM   8771  O OD1 . ASP E 1 87  ? 49.794  16.373  14.359  1.00 120.27 ? 85  ASP E OD1 1 
ATOM   8772  O OD2 . ASP E 1 87  ? 47.905  17.496  14.421  1.00 120.94 ? 85  ASP E OD2 1 
ATOM   8773  N N   . ILE E 1 88  ? 50.525  21.482  12.878  1.00 118.37 ? 86  ILE E N   1 
ATOM   8774  C CA  . ILE E 1 88  ? 50.841  22.677  12.097  1.00 117.24 ? 86  ILE E CA  1 
ATOM   8775  C C   . ILE E 1 88  ? 52.346  22.837  12.223  1.00 115.92 ? 86  ILE E C   1 
ATOM   8776  O O   . ILE E 1 88  ? 52.866  22.976  13.337  1.00 116.10 ? 86  ILE E O   1 
ATOM   8777  C CB  . ILE E 1 88  ? 50.213  23.954  12.702  1.00 117.31 ? 86  ILE E CB  1 
ATOM   8778  C CG1 . ILE E 1 88  ? 48.742  23.724  13.014  1.00 116.35 ? 86  ILE E CG1 1 
ATOM   8779  C CG2 . ILE E 1 88  ? 50.349  25.124  11.734  1.00 116.66 ? 86  ILE E CG2 1 
ATOM   8780  C CD1 . ILE E 1 88  ? 48.133  24.883  13.748  1.00 117.37 ? 86  ILE E CD1 1 
ATOM   8781  N N   . GLU E 1 89  ? 53.049  22.838  11.096  1.00 113.03 ? 87  GLU E N   1 
ATOM   8782  C CA  . GLU E 1 89  ? 54.483  22.970  11.170  1.00 110.68 ? 87  GLU E CA  1 
ATOM   8783  C C   . GLU E 1 89  ? 55.173  23.883  10.189  1.00 108.92 ? 87  GLU E C   1 
ATOM   8784  O O   . GLU E 1 89  ? 55.607  23.472  9.118   1.00 107.21 ? 87  GLU E O   1 
ATOM   8785  C CB  . GLU E 1 89  ? 55.145  21.588  11.152  1.00 110.14 ? 87  GLU E CB  1 
ATOM   8786  C CG  . GLU E 1 89  ? 54.621  20.619  10.110  1.00 108.30 ? 87  GLU E CG  1 
ATOM   8787  C CD  . GLU E 1 89  ? 55.327  19.287  10.195  1.00 106.09 ? 87  GLU E CD  1 
ATOM   8788  O OE1 . GLU E 1 89  ? 56.573  19.275  10.051  1.00 106.75 ? 87  GLU E OE1 1 
ATOM   8789  O OE2 . GLU E 1 89  ? 54.640  18.263  10.408  1.00 99.08  ? 87  GLU E OE2 1 
ATOM   8790  N N   . ASP E 1 90  ? 55.252  25.140  10.598  1.00 109.15 ? 88  ASP E N   1 
ATOM   8791  C CA  . ASP E 1 90  ? 55.949  26.167  9.869   1.00 110.66 ? 88  ASP E CA  1 
ATOM   8792  C C   . ASP E 1 90  ? 55.528  26.372  8.435   1.00 108.99 ? 88  ASP E C   1 
ATOM   8793  O O   . ASP E 1 90  ? 54.882  27.373  8.129   1.00 111.45 ? 88  ASP E O   1 
ATOM   8794  C CB  . ASP E 1 90  ? 57.451  25.879  9.950   1.00 116.66 ? 88  ASP E CB  1 
ATOM   8795  C CG  . ASP E 1 90  ? 57.889  25.473  11.361  1.00 121.03 ? 88  ASP E CG  1 
ATOM   8796  O OD1 . ASP E 1 90  ? 57.637  26.252  12.319  1.00 121.28 ? 88  ASP E OD1 1 
ATOM   8797  O OD2 . ASP E 1 90  ? 58.483  24.375  11.517  1.00 122.83 ? 88  ASP E OD2 1 
ATOM   8798  N N   . ARG E 1 91  ? 55.896  25.445  7.552   1.00 104.45 ? 89  ARG E N   1 
ATOM   8799  C CA  . ARG E 1 91  ? 55.552  25.572  6.131   1.00 99.01  ? 89  ARG E CA  1 
ATOM   8800  C C   . ARG E 1 91  ? 54.046  25.738  5.862   1.00 97.61  ? 89  ARG E C   1 
ATOM   8801  O O   . ARG E 1 91  ? 53.648  26.567  5.042   1.00 96.29  ? 89  ARG E O   1 
ATOM   8802  C CB  . ARG E 1 91  ? 56.099  24.371  5.341   1.00 94.55  ? 89  ARG E CB  1 
ATOM   8803  C CG  . ARG E 1 91  ? 55.330  23.070  5.473   1.00 88.59  ? 89  ARG E CG  1 
ATOM   8804  C CD  . ARG E 1 91  ? 55.832  22.021  4.464   1.00 88.80  ? 89  ARG E CD  1 
ATOM   8805  N NE  . ARG E 1 91  ? 54.851  20.955  4.281   1.00 86.07  ? 89  ARG E NE  1 
ATOM   8806  C CZ  . ARG E 1 91  ? 54.448  20.142  5.254   1.00 85.68  ? 89  ARG E CZ  1 
ATOM   8807  N NH1 . ARG E 1 91  ? 54.953  20.264  6.475   1.00 85.84  ? 89  ARG E NH1 1 
ATOM   8808  N NH2 . ARG E 1 91  ? 53.517  19.225  5.021   1.00 86.27  ? 89  ARG E NH2 1 
ATOM   8809  N N   . HIS E 1 92  ? 53.230  24.948  6.564   1.00 94.30  ? 90  HIS E N   1 
ATOM   8810  C CA  . HIS E 1 92  ? 51.774  24.965  6.435   1.00 88.97  ? 90  HIS E CA  1 
ATOM   8811  C C   . HIS E 1 92  ? 51.101  26.298  6.242   1.00 87.27  ? 90  HIS E C   1 
ATOM   8812  O O   . HIS E 1 92  ? 51.456  27.297  6.863   1.00 86.72  ? 90  HIS E O   1 
ATOM   8813  C CB  . HIS E 1 92  ? 51.120  24.307  7.641   1.00 87.03  ? 90  HIS E CB  1 
ATOM   8814  C CG  . HIS E 1 92  ? 50.877  22.845  7.467   1.00 86.03  ? 90  HIS E CG  1 
ATOM   8815  N ND1 . HIS E 1 92  ? 51.829  21.996  6.949   1.00 89.97  ? 90  HIS E ND1 1 
ATOM   8816  C CD2 . HIS E 1 92  ? 49.820  22.068  7.791   1.00 87.53  ? 90  HIS E CD2 1 
ATOM   8817  C CE1 . HIS E 1 92  ? 51.372  20.758  6.963   1.00 89.61  ? 90  HIS E CE1 1 
ATOM   8818  N NE2 . HIS E 1 92  ? 50.153  20.773  7.471   1.00 88.94  ? 90  HIS E NE2 1 
ATOM   8819  N N   . ILE E 1 93  ? 50.108  26.293  5.366   1.00 87.06  ? 91  ILE E N   1 
ATOM   8820  C CA  . ILE E 1 93  ? 49.330  27.486  5.122   1.00 84.05  ? 91  ILE E CA  1 
ATOM   8821  C C   . ILE E 1 93  ? 47.868  27.125  5.204   1.00 81.94  ? 91  ILE E C   1 
ATOM   8822  O O   . ILE E 1 93  ? 47.283  26.490  4.310   1.00 81.09  ? 91  ILE E O   1 
ATOM   8823  C CB  . ILE E 1 93  ? 49.629  28.116  3.777   1.00 83.06  ? 91  ILE E CB  1 
ATOM   8824  C CG1 . ILE E 1 93  ? 51.134  28.365  3.644   1.00 85.76  ? 91  ILE E CG1 1 
ATOM   8825  C CG2 . ILE E 1 93  ? 48.901  29.436  3.699   1.00 80.56  ? 91  ILE E CG2 1 
ATOM   8826  C CD1 . ILE E 1 93  ? 51.569  29.038  2.348   1.00 81.37  ? 91  ILE E CD1 1 
ATOM   8827  N N   . VAL E 1 94  ? 47.289  27.528  6.321   1.00 80.91  ? 92  VAL E N   1 
ATOM   8828  C CA  . VAL E 1 94  ? 45.899  27.250  6.579   1.00 81.44  ? 92  VAL E CA  1 
ATOM   8829  C C   . VAL E 1 94  ? 44.981  28.267  5.920   1.00 78.82  ? 92  VAL E C   1 
ATOM   8830  O O   . VAL E 1 94  ? 44.938  29.448  6.280   1.00 78.64  ? 92  VAL E O   1 
ATOM   8831  C CB  . VAL E 1 94  ? 45.614  27.228  8.071   1.00 83.73  ? 92  VAL E CB  1 
ATOM   8832  C CG1 . VAL E 1 94  ? 44.169  26.832  8.301   1.00 85.47  ? 92  VAL E CG1 1 
ATOM   8833  C CG2 . VAL E 1 94  ? 46.555  26.253  8.763   1.00 86.07  ? 92  VAL E CG2 1 
ATOM   8834  N N   . VAL E 1 95  ? 44.242  27.775  4.944   1.00 74.32  ? 93  VAL E N   1 
ATOM   8835  C CA  . VAL E 1 95  ? 43.324  28.579  4.196   1.00 69.96  ? 93  VAL E CA  1 
ATOM   8836  C C   . VAL E 1 95  ? 41.938  28.072  4.483   1.00 69.64  ? 93  VAL E C   1 
ATOM   8837  O O   . VAL E 1 95  ? 41.417  27.158  3.839   1.00 68.10  ? 93  VAL E O   1 
ATOM   8838  C CB  . VAL E 1 95  ? 43.626  28.457  2.736   1.00 71.51  ? 93  VAL E CB  1 
ATOM   8839  C CG1 . VAL E 1 95  ? 42.563  29.169  1.932   1.00 73.44  ? 93  VAL E CG1 1 
ATOM   8840  C CG2 . VAL E 1 95  ? 45.028  29.006  2.463   1.00 70.02  ? 93  VAL E CG2 1 
ATOM   8841  N N   . SER E 1 96  ? 41.360  28.681  5.499   1.00 70.36  ? 94  SER E N   1 
ATOM   8842  C CA  . SER E 1 96  ? 40.015  28.378  5.956   1.00 70.32  ? 94  SER E CA  1 
ATOM   8843  C C   . SER E 1 96  ? 38.951  29.247  5.267   1.00 70.67  ? 94  SER E C   1 
ATOM   8844  O O   . SER E 1 96  ? 39.013  30.483  5.267   1.00 63.21  ? 94  SER E O   1 
ATOM   8845  C CB  . SER E 1 96  ? 39.932  28.600  7.461   1.00 70.29  ? 94  SER E CB  1 
ATOM   8846  O OG  . SER E 1 96  ? 38.584  28.711  7.904   1.00 69.55  ? 94  SER E OG  1 
ATOM   8847  N N   . CYS E 1 97  ? 37.969  28.575  4.681   1.00 74.35  ? 95  CYS E N   1 
ATOM   8848  C CA  . CYS E 1 97  ? 36.889  29.252  4.014   1.00 80.47  ? 95  CYS E CA  1 
ATOM   8849  C C   . CYS E 1 97  ? 35.573  28.808  4.620   1.00 82.69  ? 95  CYS E C   1 
ATOM   8850  O O   . CYS E 1 97  ? 34.941  27.842  4.175   1.00 80.54  ? 95  CYS E O   1 
ATOM   8851  C CB  . CYS E 1 97  ? 36.936  28.945  2.531   1.00 83.91  ? 95  CYS E CB  1 
ATOM   8852  S SG  . CYS E 1 97  ? 38.617  29.131  1.841   1.00 90.84  ? 95  CYS E SG  1 
ATOM   8853  N N   . ALA E 1 98  ? 35.193  29.525  5.667   1.00 87.20  ? 96  ALA E N   1 
ATOM   8854  C CA  . ALA E 1 98  ? 33.959  29.282  6.384   1.00 90.22  ? 96  ALA E CA  1 
ATOM   8855  C C   . ALA E 1 98  ? 33.448  30.653  6.798   1.00 90.85  ? 96  ALA E C   1 
ATOM   8856  O O   . ALA E 1 98  ? 34.229  31.597  7.000   1.00 86.73  ? 96  ALA E O   1 
ATOM   8857  C CB  . ALA E 1 98  ? 34.209  28.417  7.603   1.00 90.37  ? 96  ALA E CB  1 
ATOM   8858  N N   . ALA E 1 99  ? 32.130  30.739  6.922   1.00 93.12  ? 97  ALA E N   1 
ATOM   8859  C CA  . ALA E 1 99  ? 31.461  31.972  7.281   1.00 98.12  ? 97  ALA E CA  1 
ATOM   8860  C C   . ALA E 1 99  ? 31.701  32.441  8.738   1.00 100.24 ? 97  ALA E C   1 
ATOM   8861  O O   . ALA E 1 99  ? 31.669  31.629  9.672   1.00 101.21 ? 97  ALA E O   1 
ATOM   8862  C CB  . ALA E 1 99  ? 29.929  31.821  6.991   1.00 98.98  ? 97  ALA E CB  1 
ATOM   8863  N N   . GLY E 1 100 ? 31.951  33.746  8.924   1.00 100.95 ? 98  GLY E N   1 
ATOM   8864  C CA  . GLY E 1 100 ? 32.137  34.323  10.260  1.00 102.83 ? 98  GLY E CA  1 
ATOM   8865  C C   . GLY E 1 100 ? 33.191  33.732  11.187  1.00 102.59 ? 98  GLY E C   1 
ATOM   8866  O O   . GLY E 1 100 ? 33.186  33.985  12.389  1.00 106.30 ? 98  GLY E O   1 
ATOM   8867  N N   . VAL E 1 101 ? 34.094  32.937  10.636  1.00 98.59  ? 99  VAL E N   1 
ATOM   8868  C CA  . VAL E 1 101 ? 35.158  32.343  11.423  1.00 91.54  ? 99  VAL E CA  1 
ATOM   8869  C C   . VAL E 1 101 ? 36.337  33.302  11.401  1.00 87.56  ? 99  VAL E C   1 
ATOM   8870  O O   . VAL E 1 101 ? 37.317  33.087  10.709  1.00 88.90  ? 99  VAL E O   1 
ATOM   8871  C CB  . VAL E 1 101 ? 35.579  31.022  10.816  1.00 93.76  ? 99  VAL E CB  1 
ATOM   8872  C CG1 . VAL E 1 101 ? 36.797  30.493  11.539  1.00 96.96  ? 99  VAL E CG1 1 
ATOM   8873  C CG2 . VAL E 1 101 ? 34.420  30.043  10.883  1.00 92.54  ? 99  VAL E CG2 1 
ATOM   8874  N N   . THR E 1 102 ? 36.226  34.375  12.162  1.00 83.53  ? 100 THR E N   1 
ATOM   8875  C CA  . THR E 1 102 ? 37.258  35.390  12.212  1.00 80.56  ? 100 THR E CA  1 
ATOM   8876  C C   . THR E 1 102 ? 38.646  34.819  12.059  1.00 81.45  ? 100 THR E C   1 
ATOM   8877  O O   . THR E 1 102 ? 38.924  33.719  12.530  1.00 82.58  ? 100 THR E O   1 
ATOM   8878  C CB  . THR E 1 102 ? 37.230  36.100  13.518  1.00 80.02  ? 100 THR E CB  1 
ATOM   8879  O OG1 . THR E 1 102 ? 35.869  36.333  13.911  1.00 79.63  ? 100 THR E OG1 1 
ATOM   8880  C CG2 . THR E 1 102 ? 37.990  37.412  13.388  1.00 80.61  ? 100 THR E CG2 1 
ATOM   8881  N N   . ILE E 1 103 ? 39.514  35.565  11.392  1.00 81.12  ? 101 ILE E N   1 
ATOM   8882  C CA  . ILE E 1 103 ? 40.892  35.133  11.188  1.00 81.43  ? 101 ILE E CA  1 
ATOM   8883  C C   . ILE E 1 103 ? 41.504  34.827  12.552  1.00 85.12  ? 101 ILE E C   1 
ATOM   8884  O O   . ILE E 1 103 ? 42.110  33.767  12.756  1.00 87.09  ? 101 ILE E O   1 
ATOM   8885  C CB  . ILE E 1 103 ? 41.710  36.263  10.513  1.00 78.50  ? 101 ILE E CB  1 
ATOM   8886  C CG1 . ILE E 1 103 ? 42.980  35.726  9.878   1.00 72.69  ? 101 ILE E CG1 1 
ATOM   8887  C CG2 . ILE E 1 103 ? 42.135  37.299  11.543  1.00 80.03  ? 101 ILE E CG2 1 
ATOM   8888  C CD1 . ILE E 1 103 ? 43.704  36.787  9.103   1.00 65.12  ? 101 ILE E CD1 1 
ATOM   8889  N N   . SER E 1 104 ? 41.282  35.760  13.482  1.00 87.94  ? 102 SER E N   1 
ATOM   8890  C CA  . SER E 1 104 ? 41.795  35.712  14.856  1.00 90.83  ? 102 SER E CA  1 
ATOM   8891  C C   . SER E 1 104 ? 41.192  34.634  15.729  1.00 92.49  ? 102 SER E C   1 
ATOM   8892  O O   . SER E 1 104 ? 41.910  33.944  16.434  1.00 94.21  ? 102 SER E O   1 
ATOM   8893  C CB  . SER E 1 104 ? 41.625  37.074  15.544  1.00 90.43  ? 102 SER E CB  1 
ATOM   8894  O OG  . SER E 1 104 ? 42.464  38.045  14.929  1.00 91.55  ? 102 SER E OG  1 
ATOM   8895  N N   . SER E 1 105 ? 39.878  34.488  15.711  1.00 95.07  ? 103 SER E N   1 
ATOM   8896  C CA  . SER E 1 105 ? 39.282  33.442  16.513  1.00 97.90  ? 103 SER E CA  1 
ATOM   8897  C C   . SER E 1 105 ? 40.184  32.241  16.293  1.00 97.09  ? 103 SER E C   1 
ATOM   8898  O O   . SER E 1 105 ? 40.460  31.476  17.216  1.00 101.41 ? 103 SER E O   1 
ATOM   8899  C CB  . SER E 1 105 ? 37.878  33.100  16.008  1.00 103.02 ? 103 SER E CB  1 
ATOM   8900  O OG  . SER E 1 105 ? 37.045  34.244  15.949  1.00 110.01 ? 103 SER E OG  1 
ATOM   8901  N N   . ILE E 1 106 ? 40.676  32.102  15.066  1.00 93.43  ? 104 ILE E N   1 
ATOM   8902  C CA  . ILE E 1 106 ? 41.516  30.973  14.734  1.00 91.57  ? 104 ILE E CA  1 
ATOM   8903  C C   . ILE E 1 106 ? 43.014  31.100  14.981  1.00 92.28  ? 104 ILE E C   1 
ATOM   8904  O O   . ILE E 1 106 ? 43.664  30.117  15.301  1.00 91.35  ? 104 ILE E O   1 
ATOM   8905  C CB  . ILE E 1 106 ? 41.238  30.541  13.304  1.00 90.29  ? 104 ILE E CB  1 
ATOM   8906  C CG1 . ILE E 1 106 ? 40.196  29.430  13.346  1.00 90.00  ? 104 ILE E CG1 1 
ATOM   8907  C CG2 . ILE E 1 106 ? 42.505  30.133  12.613  1.00 90.60  ? 104 ILE E CG2 1 
ATOM   8908  C CD1 . ILE E 1 106 ? 39.785  28.934  12.021  1.00 89.40  ? 104 ILE E CD1 1 
ATOM   8909  N N   . GLU E 1 107 ? 43.579  32.289  14.838  1.00 94.27  ? 105 GLU E N   1 
ATOM   8910  C CA  . GLU E 1 107 ? 45.006  32.444  15.096  1.00 95.62  ? 105 GLU E CA  1 
ATOM   8911  C C   . GLU E 1 107 ? 45.299  32.247  16.580  1.00 98.18  ? 105 GLU E C   1 
ATOM   8912  O O   . GLU E 1 107 ? 46.418  31.889  16.957  1.00 101.84 ? 105 GLU E O   1 
ATOM   8913  C CB  . GLU E 1 107 ? 45.497  33.822  14.663  1.00 93.22  ? 105 GLU E CB  1 
ATOM   8914  C CG  . GLU E 1 107 ? 45.463  34.047  13.182  1.00 92.57  ? 105 GLU E CG  1 
ATOM   8915  C CD  . GLU E 1 107 ? 46.385  35.162  12.784  1.00 94.58  ? 105 GLU E CD  1 
ATOM   8916  O OE1 . GLU E 1 107 ? 46.298  36.246  13.397  1.00 94.03  ? 105 GLU E OE1 1 
ATOM   8917  O OE2 . GLU E 1 107 ? 47.201  34.955  11.863  1.00 98.00  ? 105 GLU E OE2 1 
ATOM   8918  N N   . LYS E 1 108 ? 44.304  32.508  17.425  1.00 98.43  ? 106 LYS E N   1 
ATOM   8919  C CA  . LYS E 1 108 ? 44.464  32.314  18.861  1.00 97.00  ? 106 LYS E CA  1 
ATOM   8920  C C   . LYS E 1 108 ? 44.527  30.813  19.134  1.00 93.62  ? 106 LYS E C   1 
ATOM   8921  O O   . LYS E 1 108 ? 45.552  30.313  19.580  1.00 94.87  ? 106 LYS E O   1 
ATOM   8922  C CB  . LYS E 1 108 ? 43.295  32.926  19.638  1.00 101.71 ? 106 LYS E CB  1 
ATOM   8923  C CG  . LYS E 1 108 ? 43.415  34.426  19.914  1.00 109.13 ? 106 LYS E CG  1 
ATOM   8924  C CD  . LYS E 1 108 ? 42.347  34.853  20.928  1.00 115.41 ? 106 LYS E CD  1 
ATOM   8925  C CE  . LYS E 1 108 ? 42.479  36.328  21.309  1.00 119.84 ? 106 LYS E CE  1 
ATOM   8926  N NZ  . LYS E 1 108 ? 41.489  36.736  22.359  1.00 119.83 ? 106 LYS E NZ  1 
ATOM   8927  N N   . LYS E 1 109 ? 43.445  30.092  18.850  1.00 89.02  ? 107 LYS E N   1 
ATOM   8928  C CA  . LYS E 1 109 ? 43.418  28.653  19.079  1.00 90.16  ? 107 LYS E CA  1 
ATOM   8929  C C   . LYS E 1 109 ? 44.640  27.901  18.576  1.00 93.01  ? 107 LYS E C   1 
ATOM   8930  O O   . LYS E 1 109 ? 44.954  26.824  19.075  1.00 94.88  ? 107 LYS E O   1 
ATOM   8931  C CB  . LYS E 1 109 ? 42.193  28.022  18.442  1.00 88.06  ? 107 LYS E CB  1 
ATOM   8932  C CG  . LYS E 1 109 ? 41.042  27.891  19.387  1.00 89.94  ? 107 LYS E CG  1 
ATOM   8933  C CD  . LYS E 1 109 ? 40.391  26.520  19.248  1.00 91.37  ? 107 LYS E CD  1 
ATOM   8934  C CE  . LYS E 1 109 ? 39.273  26.341  20.281  1.00 93.57  ? 107 LYS E CE  1 
ATOM   8935  N NZ  . LYS E 1 109 ? 38.474  25.087  20.096  1.00 93.56  ? 107 LYS E NZ  1 
ATOM   8936  N N   . LEU E 1 110 ? 45.322  28.462  17.580  1.00 94.36  ? 108 LEU E N   1 
ATOM   8937  C CA  . LEU E 1 110 ? 46.507  27.837  16.982  1.00 94.71  ? 108 LEU E CA  1 
ATOM   8938  C C   . LEU E 1 110 ? 47.813  28.346  17.487  1.00 96.58  ? 108 LEU E C   1 
ATOM   8939  O O   . LEU E 1 110 ? 48.805  27.632  17.444  1.00 97.69  ? 108 LEU E O   1 
ATOM   8940  C CB  . LEU E 1 110 ? 46.542  28.044  15.487  1.00 94.80  ? 108 LEU E CB  1 
ATOM   8941  C CG  . LEU E 1 110 ? 45.463  27.329  14.714  1.00 93.43  ? 108 LEU E CG  1 
ATOM   8942  C CD1 . LEU E 1 110 ? 45.738  27.519  13.241  1.00 90.48  ? 108 LEU E CD1 1 
ATOM   8943  C CD2 . LEU E 1 110 ? 45.436  25.863  15.114  1.00 91.07  ? 108 LEU E CD2 1 
ATOM   8944  N N   . SER E 1 111 ? 47.821  29.610  17.897  1.00 99.88  ? 109 SER E N   1 
ATOM   8945  C CA  . SER E 1 111 ? 49.020  30.244  18.438  1.00 102.62 ? 109 SER E CA  1 
ATOM   8946  C C   . SER E 1 111 ? 49.317  29.508  19.747  1.00 104.64 ? 109 SER E C   1 
ATOM   8947  O O   . SER E 1 111 ? 50.439  29.583  20.278  1.00 106.62 ? 109 SER E O   1 
ATOM   8948  C CB  . SER E 1 111 ? 48.784  31.751  18.729  1.00 101.84 ? 109 SER E CB  1 
ATOM   8949  O OG  . SER E 1 111 ? 48.721  32.565  17.564  1.00 97.94  ? 109 SER E OG  1 
ATOM   8950  N N   . ALA E 1 112 ? 48.295  28.812  20.258  1.00 103.67 ? 110 ALA E N   1 
ATOM   8951  C CA  . ALA E 1 112 ? 48.404  28.044  21.495  1.00 101.81 ? 110 ALA E CA  1 
ATOM   8952  C C   . ALA E 1 112 ? 49.324  26.829  21.276  1.00 101.91 ? 110 ALA E C   1 
ATOM   8953  O O   . ALA E 1 112 ? 49.515  26.009  22.182  1.00 104.23 ? 110 ALA E O   1 
ATOM   8954  C CB  . ALA E 1 112 ? 47.016  27.587  21.942  1.00 100.87 ? 110 ALA E CB  1 
ATOM   8955  N N   . PHE E 1 113 ? 49.873  26.729  20.062  1.00 100.44 ? 111 PHE E N   1 
ATOM   8956  C CA  . PHE E 1 113 ? 50.777  25.657  19.638  1.00 95.95  ? 111 PHE E CA  1 
ATOM   8957  C C   . PHE E 1 113 ? 51.934  26.364  18.953  1.00 95.12  ? 111 PHE E C   1 
ATOM   8958  O O   . PHE E 1 113 ? 52.578  27.238  19.531  1.00 94.67  ? 111 PHE E O   1 
ATOM   8959  C CB  . PHE E 1 113 ? 50.092  24.756  18.610  1.00 96.87  ? 111 PHE E CB  1 
ATOM   8960  C CG  . PHE E 1 113 ? 48.829  24.116  19.100  1.00 101.38 ? 111 PHE E CG  1 
ATOM   8961  C CD1 . PHE E 1 113 ? 47.720  24.882  19.463  1.00 105.54 ? 111 PHE E CD1 1 
ATOM   8962  C CD2 . PHE E 1 113 ? 48.740  22.731  19.195  1.00 103.92 ? 111 PHE E CD2 1 
ATOM   8963  C CE1 . PHE E 1 113 ? 46.537  24.267  19.922  1.00 110.13 ? 111 PHE E CE1 1 
ATOM   8964  C CE2 . PHE E 1 113 ? 47.563  22.107  19.648  1.00 106.76 ? 111 PHE E CE2 1 
ATOM   8965  C CZ  . PHE E 1 113 ? 46.465  22.875  20.010  1.00 108.06 ? 111 PHE E CZ  1 
ATOM   8966  N N   . ARG E 1 114 ? 52.182  25.996  17.702  1.00 97.33  ? 112 ARG E N   1 
ATOM   8967  C CA  . ARG E 1 114 ? 53.237  26.629  16.913  1.00 98.09  ? 112 ARG E CA  1 
ATOM   8968  C C   . ARG E 1 114 ? 53.131  28.145  17.161  1.00 98.25  ? 112 ARG E C   1 
ATOM   8969  O O   . ARG E 1 114 ? 52.038  28.721  17.154  1.00 95.02  ? 112 ARG E O   1 
ATOM   8970  C CB  . ARG E 1 114 ? 53.043  26.323  15.409  1.00 98.46  ? 112 ARG E CB  1 
ATOM   8971  C CG  . ARG E 1 114 ? 54.314  26.001  14.647  1.00 97.08  ? 112 ARG E CG  1 
ATOM   8972  C CD  . ARG E 1 114 ? 54.783  24.575  14.950  1.00 102.60 ? 112 ARG E CD  1 
ATOM   8973  N NE  . ARG E 1 114 ? 56.008  24.208  14.219  1.00 109.04 ? 112 ARG E NE  1 
ATOM   8974  C CZ  . ARG E 1 114 ? 56.596  23.002  14.251  1.00 109.02 ? 112 ARG E CZ  1 
ATOM   8975  N NH1 . ARG E 1 114 ? 56.080  22.020  14.983  1.00 106.21 ? 112 ARG E NH1 1 
ATOM   8976  N NH2 . ARG E 1 114 ? 57.704  22.766  13.547  1.00 106.67 ? 112 ARG E NH2 1 
ATOM   8977  N N   . PRO E 1 115 ? 54.271  28.800  17.401  1.00 98.76  ? 113 PRO E N   1 
ATOM   8978  C CA  . PRO E 1 115 ? 54.335  30.238  17.654  1.00 97.56  ? 113 PRO E CA  1 
ATOM   8979  C C   . PRO E 1 115 ? 53.425  31.132  16.800  1.00 97.21  ? 113 PRO E C   1 
ATOM   8980  O O   . PRO E 1 115 ? 52.326  31.493  17.209  1.00 98.44  ? 113 PRO E O   1 
ATOM   8981  C CB  . PRO E 1 115 ? 55.816  30.541  17.449  1.00 98.17  ? 113 PRO E CB  1 
ATOM   8982  C CG  . PRO E 1 115 ? 56.465  29.323  18.030  1.00 98.74  ? 113 PRO E CG  1 
ATOM   8983  C CD  . PRO E 1 115 ? 55.619  28.197  17.459  1.00 99.87  ? 113 PRO E CD  1 
ATOM   8984  N N   . ALA E 1 116 ? 53.902  31.509  15.621  1.00 96.95  ? 114 ALA E N   1 
ATOM   8985  C CA  . ALA E 1 116 ? 53.147  32.379  14.727  1.00 95.94  ? 114 ALA E CA  1 
ATOM   8986  C C   . ALA E 1 116 ? 52.734  31.660  13.439  1.00 96.26  ? 114 ALA E C   1 
ATOM   8987  O O   . ALA E 1 116 ? 53.489  31.615  12.450  1.00 95.42  ? 114 ALA E O   1 
ATOM   8988  C CB  . ALA E 1 116 ? 53.975  33.613  14.400  1.00 95.57  ? 114 ALA E CB  1 
ATOM   8989  N N   . PRO E 1 117 ? 51.517  31.095  13.438  1.00 96.37  ? 115 PRO E N   1 
ATOM   8990  C CA  . PRO E 1 117 ? 50.920  30.359  12.320  1.00 97.45  ? 115 PRO E CA  1 
ATOM   8991  C C   . PRO E 1 117 ? 50.558  31.262  11.129  1.00 99.35  ? 115 PRO E C   1 
ATOM   8992  O O   . PRO E 1 117 ? 50.442  32.485  11.277  1.00 102.36 ? 115 PRO E O   1 
ATOM   8993  C CB  . PRO E 1 117 ? 49.694  29.718  12.964  1.00 94.02  ? 115 PRO E CB  1 
ATOM   8994  C CG  . PRO E 1 117 ? 49.266  30.755  13.934  1.00 93.43  ? 115 PRO E CG  1 
ATOM   8995  C CD  . PRO E 1 117 ? 50.582  31.147  14.575  1.00 95.21  ? 115 PRO E CD  1 
ATOM   8996  N N   . ARG E 1 118 ? 50.380  30.660  9.951   1.00 98.46  ? 116 ARG E N   1 
ATOM   8997  C CA  . ARG E 1 118 ? 50.035  31.419  8.745   1.00 96.32  ? 116 ARG E CA  1 
ATOM   8998  C C   . ARG E 1 118 ? 48.634  31.141  8.206   1.00 95.17  ? 116 ARG E C   1 
ATOM   8999  O O   . ARG E 1 118 ? 48.415  30.177  7.467   1.00 97.06  ? 116 ARG E O   1 
ATOM   9000  C CB  . ARG E 1 118 ? 51.080  31.165  7.663   1.00 95.34  ? 116 ARG E CB  1 
ATOM   9001  C CG  . ARG E 1 118 ? 52.458  31.561  8.140   1.00 96.78  ? 116 ARG E CG  1 
ATOM   9002  C CD  . ARG E 1 118 ? 53.446  31.572  7.014   1.00 100.38 ? 116 ARG E CD  1 
ATOM   9003  N NE  . ARG E 1 118 ? 53.503  30.303  6.302   1.00 99.20  ? 116 ARG E NE  1 
ATOM   9004  C CZ  . ARG E 1 118 ? 54.451  30.014  5.420   1.00 101.12 ? 116 ARG E CZ  1 
ATOM   9005  N NH1 . ARG E 1 118 ? 55.405  30.908  5.159   1.00 102.00 ? 116 ARG E NH1 1 
ATOM   9006  N NH2 . ARG E 1 118 ? 54.452  28.841  4.803   1.00 100.67 ? 116 ARG E NH2 1 
ATOM   9007  N N   . VAL E 1 119 ? 47.697  32.017  8.581   1.00 91.88  ? 117 VAL E N   1 
ATOM   9008  C CA  . VAL E 1 119 ? 46.285  31.923  8.177   1.00 88.96  ? 117 VAL E CA  1 
ATOM   9009  C C   . VAL E 1 119 ? 45.756  33.027  7.266   1.00 88.64  ? 117 VAL E C   1 
ATOM   9010  O O   . VAL E 1 119 ? 45.874  34.233  7.563   1.00 87.02  ? 117 VAL E O   1 
ATOM   9011  C CB  . VAL E 1 119 ? 45.333  31.868  9.404   1.00 87.26  ? 117 VAL E CB  1 
ATOM   9012  C CG1 . VAL E 1 119 ? 43.991  32.517  9.094   1.00 87.23  ? 117 VAL E CG1 1 
ATOM   9013  C CG2 . VAL E 1 119 ? 45.080  30.434  9.778   1.00 85.13  ? 117 VAL E CG2 1 
ATOM   9014  N N   . ILE E 1 120 ? 45.163  32.591  6.156   1.00 86.52  ? 118 ILE E N   1 
ATOM   9015  C CA  . ILE E 1 120 ? 44.565  33.501  5.194   1.00 82.12  ? 118 ILE E CA  1 
ATOM   9016  C C   . ILE E 1 120 ? 43.082  33.134  5.174   1.00 82.61  ? 118 ILE E C   1 
ATOM   9017  O O   . ILE E 1 120 ? 42.739  31.990  4.838   1.00 82.73  ? 118 ILE E O   1 
ATOM   9018  C CB  . ILE E 1 120 ? 45.145  33.295  3.794   1.00 74.97  ? 118 ILE E CB  1 
ATOM   9019  C CG1 . ILE E 1 120 ? 46.658  33.156  3.890   1.00 72.56  ? 118 ILE E CG1 1 
ATOM   9020  C CG2 . ILE E 1 120 ? 44.773  34.469  2.904   1.00 71.41  ? 118 ILE E CG2 1 
ATOM   9021  C CD1 . ILE E 1 120 ? 47.328  33.036  2.558   1.00 71.98  ? 118 ILE E CD1 1 
ATOM   9022  N N   . ARG E 1 121 ? 42.230  34.091  5.565   1.00 80.59  ? 119 ARG E N   1 
ATOM   9023  C CA  . ARG E 1 121 ? 40.779  33.914  5.601   1.00 76.80  ? 119 ARG E CA  1 
ATOM   9024  C C   . ARG E 1 121 ? 40.211  34.011  4.182   1.00 75.52  ? 119 ARG E C   1 
ATOM   9025  O O   . ARG E 1 121 ? 40.729  34.765  3.354   1.00 76.45  ? 119 ARG E O   1 
ATOM   9026  C CB  . ARG E 1 121 ? 40.163  34.968  6.499   1.00 75.41  ? 119 ARG E CB  1 
ATOM   9027  C CG  . ARG E 1 121 ? 38.732  34.732  6.698   1.00 69.64  ? 119 ARG E CG  1 
ATOM   9028  C CD  . ARG E 1 121 ? 38.099  35.722  7.602   1.00 60.88  ? 119 ARG E CD  1 
ATOM   9029  N NE  . ARG E 1 121 ? 36.705  35.361  7.658   1.00 59.78  ? 119 ARG E NE  1 
ATOM   9030  C CZ  . ARG E 1 121 ? 35.821  35.941  8.441   1.00 63.95  ? 119 ARG E CZ  1 
ATOM   9031  N NH1 . ARG E 1 121 ? 36.219  36.929  9.237   1.00 68.14  ? 119 ARG E NH1 1 
ATOM   9032  N NH2 . ARG E 1 121 ? 34.552  35.522  8.437   1.00 64.39  ? 119 ARG E NH2 1 
ATOM   9033  N N   . CYS E 1 122 ? 39.123  33.306  3.898   1.00 71.42  ? 120 CYS E N   1 
ATOM   9034  C CA  . CYS E 1 122 ? 38.667  33.290  2.525   1.00 71.92  ? 120 CYS E CA  1 
ATOM   9035  C C   . CYS E 1 122 ? 37.195  33.081  2.332   1.00 73.91  ? 120 CYS E C   1 
ATOM   9036  O O   . CYS E 1 122 ? 36.499  32.646  3.249   1.00 75.50  ? 120 CYS E O   1 
ATOM   9037  C CB  . CYS E 1 122 ? 39.467  32.193  1.834   1.00 76.36  ? 120 CYS E CB  1 
ATOM   9038  S SG  . CYS E 1 122 ? 38.644  30.916  0.818   1.00 88.24  ? 120 CYS E SG  1 
ATOM   9039  N N   . MET E 1 123 ? 36.729  33.393  1.123   1.00 75.31  ? 121 MET E N   1 
ATOM   9040  C CA  . MET E 1 123 ? 35.313  33.253  0.744   1.00 77.63  ? 121 MET E CA  1 
ATOM   9041  C C   . MET E 1 123 ? 35.151  32.960  -0.760  1.00 75.02  ? 121 MET E C   1 
ATOM   9042  O O   . MET E 1 123 ? 35.715  33.696  -1.576  1.00 74.07  ? 121 MET E O   1 
ATOM   9043  C CB  . MET E 1 123 ? 34.540  34.544  1.073   1.00 81.63  ? 121 MET E CB  1 
ATOM   9044  C CG  . MET E 1 123 ? 33.117  34.550  0.515   1.00 86.67  ? 121 MET E CG  1 
ATOM   9045  S SD  . MET E 1 123 ? 31.930  33.469  1.416   1.00 89.28  ? 121 MET E SD  1 
ATOM   9046  C CE  . MET E 1 123 ? 32.442  31.837  0.979   1.00 89.21  ? 121 MET E CE  1 
ATOM   9047  N N   . THR E 1 124 ? 34.404  31.906  -1.122  1.00 71.13  ? 122 THR E N   1 
ATOM   9048  C CA  . THR E 1 124 ? 34.166  31.561  -2.532  1.00 72.08  ? 122 THR E CA  1 
ATOM   9049  C C   . THR E 1 124 ? 32.821  30.873  -2.754  1.00 70.38  ? 122 THR E C   1 
ATOM   9050  O O   . THR E 1 124 ? 32.165  30.403  -1.822  1.00 73.76  ? 122 THR E O   1 
ATOM   9051  C CB  . THR E 1 124 ? 35.233  30.604  -3.095  1.00 74.83  ? 122 THR E CB  1 
ATOM   9052  O OG1 . THR E 1 124 ? 35.002  29.290  -2.587  1.00 77.66  ? 122 THR E OG1 1 
ATOM   9053  C CG2 . THR E 1 124 ? 36.607  31.021  -2.677  1.00 77.96  ? 122 THR E CG2 1 
ATOM   9054  N N   . ASN E 1 125 ? 32.411  30.781  -4.006  1.00 63.90  ? 123 ASN E N   1 
ATOM   9055  C CA  . ASN E 1 125 ? 31.154  30.124  -4.276  1.00 60.22  ? 123 ASN E CA  1 
ATOM   9056  C C   . ASN E 1 125 ? 31.335  28.823  -5.052  1.00 56.74  ? 123 ASN E C   1 
ATOM   9057  O O   . ASN E 1 125 ? 32.417  28.491  -5.515  1.00 51.71  ? 123 ASN E O   1 
ATOM   9058  C CB  . ASN E 1 125 ? 30.202  31.074  -5.018  1.00 60.06  ? 123 ASN E CB  1 
ATOM   9059  C CG  . ASN E 1 125 ? 30.930  32.096  -5.882  1.00 59.68  ? 123 ASN E CG  1 
ATOM   9060  O OD1 . ASN E 1 125 ? 32.088  31.896  -6.267  1.00 61.43  ? 123 ASN E OD1 1 
ATOM   9061  N ND2 . ASN E 1 125 ? 30.238  33.195  -6.209  1.00 52.94  ? 123 ASN E ND2 1 
ATOM   9062  N N   . THR E 1 126 ? 30.239  28.093  -5.174  1.00 56.75  ? 124 THR E N   1 
ATOM   9063  C CA  . THR E 1 126 ? 30.202  26.818  -5.874  1.00 57.14  ? 124 THR E CA  1 
ATOM   9064  C C   . THR E 1 126 ? 30.774  26.837  -7.284  1.00 55.63  ? 124 THR E C   1 
ATOM   9065  O O   . THR E 1 126 ? 31.641  26.042  -7.606  1.00 51.61  ? 124 THR E O   1 
ATOM   9066  C CB  . THR E 1 126 ? 28.755  26.280  -6.003  1.00 58.75  ? 124 THR E CB  1 
ATOM   9067  O OG1 . THR E 1 126 ? 27.987  26.622  -4.840  1.00 61.34  ? 124 THR E OG1 1 
ATOM   9068  C CG2 . THR E 1 126 ? 28.777  24.775  -6.169  1.00 61.47  ? 124 THR E CG2 1 
ATOM   9069  N N   . PRO E 1 127 ? 30.297  27.757  -8.138  1.00 59.99  ? 125 PRO E N   1 
ATOM   9070  C CA  . PRO E 1 127 ? 30.751  27.874  -9.534  1.00 62.33  ? 125 PRO E CA  1 
ATOM   9071  C C   . PRO E 1 127 ? 32.246  27.762  -9.751  1.00 65.33  ? 125 PRO E C   1 
ATOM   9072  O O   . PRO E 1 127 ? 32.724  27.659  -10.895 1.00 68.57  ? 125 PRO E O   1 
ATOM   9073  C CB  . PRO E 1 127 ? 30.170  29.219  -10.003 1.00 60.31  ? 125 PRO E CB  1 
ATOM   9074  C CG  . PRO E 1 127 ? 29.890  29.966  -8.727  1.00 64.54  ? 125 PRO E CG  1 
ATOM   9075  C CD  . PRO E 1 127 ? 29.406  28.877  -7.789  1.00 63.73  ? 125 PRO E CD  1 
ATOM   9076  N N   . VAL E 1 128 ? 32.994  27.777  -8.661  1.00 65.86  ? 126 VAL E N   1 
ATOM   9077  C CA  . VAL E 1 128 ? 34.422  27.634  -8.784  1.00 65.45  ? 126 VAL E CA  1 
ATOM   9078  C C   . VAL E 1 128 ? 34.612  26.294  -9.569  1.00 62.76  ? 126 VAL E C   1 
ATOM   9079  O O   . VAL E 1 128 ? 35.655  26.055  -10.166 1.00 58.57  ? 126 VAL E O   1 
ATOM   9080  C CB  . VAL E 1 128 ? 35.066  27.625  -7.347  1.00 66.85  ? 126 VAL E CB  1 
ATOM   9081  C CG1 . VAL E 1 128 ? 36.567  27.451  -7.406  1.00 70.09  ? 126 VAL E CG1 1 
ATOM   9082  C CG2 . VAL E 1 128 ? 34.771  28.915  -6.655  1.00 69.20  ? 126 VAL E CG2 1 
ATOM   9083  N N   . VAL E 1 129 ? 33.574  25.447  -9.595  1.00 60.11  ? 127 VAL E N   1 
ATOM   9084  C CA  . VAL E 1 129 ? 33.639  24.148  -10.274 1.00 59.99  ? 127 VAL E CA  1 
ATOM   9085  C C   . VAL E 1 129 ? 33.861  24.239  -11.786 1.00 62.70  ? 127 VAL E C   1 
ATOM   9086  O O   . VAL E 1 129 ? 34.243  23.258  -12.422 1.00 60.68  ? 127 VAL E O   1 
ATOM   9087  C CB  . VAL E 1 129 ? 32.352  23.307  -10.040 1.00 54.44  ? 127 VAL E CB  1 
ATOM   9088  C CG1 . VAL E 1 129 ? 32.658  21.837  -10.250 1.00 54.17  ? 127 VAL E CG1 1 
ATOM   9089  C CG2 . VAL E 1 129 ? 31.816  23.529  -8.656  1.00 57.71  ? 127 VAL E CG2 1 
ATOM   9090  N N   . VAL E 1 130 ? 33.606  25.413  -12.352 1.00 64.39  ? 128 VAL E N   1 
ATOM   9091  C CA  . VAL E 1 130 ? 33.755  25.657  -13.783 1.00 69.26  ? 128 VAL E CA  1 
ATOM   9092  C C   . VAL E 1 130 ? 34.607  26.889  -13.863 1.00 73.84  ? 128 VAL E C   1 
ATOM   9093  O O   . VAL E 1 130 ? 34.538  27.667  -14.808 1.00 77.01  ? 128 VAL E O   1 
ATOM   9094  C CB  . VAL E 1 130 ? 32.401  26.003  -14.414 1.00 70.24  ? 128 VAL E CB  1 
ATOM   9095  C CG1 . VAL E 1 130 ? 32.557  26.215  -15.903 1.00 71.53  ? 128 VAL E CG1 1 
ATOM   9096  C CG2 . VAL E 1 130 ? 31.390  24.917  -14.116 1.00 66.42  ? 128 VAL E CG2 1 
ATOM   9097  N N   . ARG E 1 131 ? 35.425  27.051  -12.842 1.00 78.24  ? 129 ARG E N   1 
ATOM   9098  C CA  . ARG E 1 131 ? 36.257  28.228  -12.695 1.00 81.96  ? 129 ARG E CA  1 
ATOM   9099  C C   . ARG E 1 131 ? 35.317  29.314  -12.182 1.00 80.16  ? 129 ARG E C   1 
ATOM   9100  O O   . ARG E 1 131 ? 34.859  29.278  -11.031 1.00 82.55  ? 129 ARG E O   1 
ATOM   9101  C CB  . ARG E 1 131 ? 36.884  28.687  -14.016 1.00 85.52  ? 129 ARG E CB  1 
ATOM   9102  C CG  . ARG E 1 131 ? 37.559  30.037  -13.828 1.00 96.95  ? 129 ARG E CG  1 
ATOM   9103  C CD  . ARG E 1 131 ? 38.433  30.521  -14.970 1.00 105.88 ? 129 ARG E CD  1 
ATOM   9104  N NE  . ARG E 1 131 ? 38.991  31.841  -14.636 1.00 112.08 ? 129 ARG E NE  1 
ATOM   9105  C CZ  . ARG E 1 131 ? 39.993  32.430  -15.281 1.00 112.74 ? 129 ARG E CZ  1 
ATOM   9106  N NH1 . ARG E 1 131 ? 40.573  31.827  -16.313 1.00 113.71 ? 129 ARG E NH1 1 
ATOM   9107  N NH2 . ARG E 1 131 ? 40.415  33.625  -14.889 1.00 114.75 ? 129 ARG E NH2 1 
ATOM   9108  N N   . GLU E 1 132 ? 35.000  30.251  -13.062 1.00 76.16  ? 130 GLU E N   1 
ATOM   9109  C CA  . GLU E 1 132 ? 34.137  31.366  -12.732 1.00 76.09  ? 130 GLU E CA  1 
ATOM   9110  C C   . GLU E 1 132 ? 33.520  31.399  -11.292 1.00 74.06  ? 130 GLU E C   1 
ATOM   9111  O O   . GLU E 1 132 ? 32.301  31.380  -11.065 1.00 74.66  ? 130 GLU E O   1 
ATOM   9112  C CB  . GLU E 1 132 ? 33.088  31.472  -13.831 1.00 77.82  ? 130 GLU E CB  1 
ATOM   9113  C CG  . GLU E 1 132 ? 33.700  31.424  -15.244 1.00 77.77  ? 130 GLU E CG  1 
ATOM   9114  C CD  . GLU E 1 132 ? 34.769  32.487  -15.505 1.00 78.44  ? 130 GLU E CD  1 
ATOM   9115  O OE1 . GLU E 1 132 ? 34.838  33.502  -14.772 1.00 73.22  ? 130 GLU E OE1 1 
ATOM   9116  O OE2 . GLU E 1 132 ? 35.537  32.307  -16.478 1.00 74.87  ? 130 GLU E OE2 1 
ATOM   9117  N N   . GLY E 1 133 ? 34.408  31.458  -10.312 1.00 70.68  ? 131 GLY E N   1 
ATOM   9118  C CA  . GLY E 1 133 ? 33.976  31.541  -8.947  1.00 66.84  ? 131 GLY E CA  1 
ATOM   9119  C C   . GLY E 1 133 ? 34.497  32.881  -8.499  1.00 68.07  ? 131 GLY E C   1 
ATOM   9120  O O   . GLY E 1 133 ? 35.581  33.288  -8.911  1.00 64.63  ? 131 GLY E O   1 
ATOM   9121  N N   . ALA E 1 134 ? 33.709  33.584  -7.694  1.00 70.14  ? 132 ALA E N   1 
ATOM   9122  C CA  . ALA E 1 134 ? 34.096  34.883  -7.145  1.00 70.37  ? 132 ALA E CA  1 
ATOM   9123  C C   . ALA E 1 134 ? 34.661  34.544  -5.792  1.00 72.28  ? 132 ALA E C   1 
ATOM   9124  O O   . ALA E 1 134 ? 33.974  33.988  -4.951  1.00 71.42  ? 132 ALA E O   1 
ATOM   9125  C CB  . ALA E 1 134 ? 32.891  35.771  -6.974  1.00 71.63  ? 132 ALA E CB  1 
ATOM   9126  N N   . THR E 1 135 ? 35.919  34.881  -5.578  1.00 74.76  ? 133 THR E N   1 
ATOM   9127  C CA  . THR E 1 135 ? 36.566  34.539  -4.330  1.00 78.50  ? 133 THR E CA  1 
ATOM   9128  C C   . THR E 1 135 ? 37.381  35.703  -3.747  1.00 79.91  ? 133 THR E C   1 
ATOM   9129  O O   . THR E 1 135 ? 38.120  36.390  -4.445  1.00 80.81  ? 133 THR E O   1 
ATOM   9130  C CB  . THR E 1 135 ? 37.445  33.283  -4.563  1.00 80.12  ? 133 THR E CB  1 
ATOM   9131  O OG1 . THR E 1 135 ? 38.561  33.628  -5.388  1.00 87.89  ? 133 THR E OG1 1 
ATOM   9132  C CG2 . THR E 1 135 ? 36.645  32.209  -5.312  1.00 77.15  ? 133 THR E CG2 1 
ATOM   9133  N N   . VAL E 1 136 ? 37.215  35.917  -2.449  1.00 80.85  ? 134 VAL E N   1 
ATOM   9134  C CA  . VAL E 1 136 ? 37.872  37.001  -1.740  1.00 79.59  ? 134 VAL E CA  1 
ATOM   9135  C C   . VAL E 1 136 ? 38.597  36.441  -0.532  1.00 80.68  ? 134 VAL E C   1 
ATOM   9136  O O   . VAL E 1 136 ? 38.094  35.517  0.121   1.00 81.84  ? 134 VAL E O   1 
ATOM   9137  C CB  . VAL E 1 136 ? 36.817  38.026  -1.262  1.00 79.08  ? 134 VAL E CB  1 
ATOM   9138  C CG1 . VAL E 1 136 ? 37.399  38.917  -0.213  1.00 83.48  ? 134 VAL E CG1 1 
ATOM   9139  C CG2 . VAL E 1 136 ? 36.334  38.858  -2.444  1.00 77.95  ? 134 VAL E CG2 1 
ATOM   9140  N N   . TYR E 1 137 ? 39.773  36.987  -0.225  1.00 80.53  ? 135 TYR E N   1 
ATOM   9141  C CA  . TYR E 1 137 ? 40.513  36.501  0.936   1.00 77.91  ? 135 TYR E CA  1 
ATOM   9142  C C   . TYR E 1 137 ? 41.260  37.585  1.691   1.00 77.31  ? 135 TYR E C   1 
ATOM   9143  O O   . TYR E 1 137 ? 41.719  38.570  1.128   1.00 74.98  ? 135 TYR E O   1 
ATOM   9144  C CB  . TYR E 1 137 ? 41.494  35.422  0.515   1.00 74.80  ? 135 TYR E CB  1 
ATOM   9145  C CG  . TYR E 1 137 ? 42.632  35.992  -0.266  1.00 71.84  ? 135 TYR E CG  1 
ATOM   9146  C CD1 . TYR E 1 137 ? 43.752  36.478  0.376   1.00 72.68  ? 135 TYR E CD1 1 
ATOM   9147  C CD2 . TYR E 1 137 ? 42.569  36.084  -1.652  1.00 70.59  ? 135 TYR E CD2 1 
ATOM   9148  C CE1 . TYR E 1 137 ? 44.777  37.035  -0.338  1.00 71.63  ? 135 TYR E CE1 1 
ATOM   9149  C CE2 . TYR E 1 137 ? 43.586  36.638  -2.372  1.00 67.40  ? 135 TYR E CE2 1 
ATOM   9150  C CZ  . TYR E 1 137 ? 44.688  37.116  -1.714  1.00 68.99  ? 135 TYR E CZ  1 
ATOM   9151  O OH  . TYR E 1 137 ? 45.688  37.694  -2.451  1.00 74.64  ? 135 TYR E OH  1 
ATOM   9152  N N   . ALA E 1 138 ? 41.406  37.353  2.981   1.00 80.05  ? 136 ALA E N   1 
ATOM   9153  C CA  . ALA E 1 138 ? 42.072  38.281  3.864   1.00 83.26  ? 136 ALA E CA  1 
ATOM   9154  C C   . ALA E 1 138 ? 43.359  37.706  4.436   1.00 84.91  ? 136 ALA E C   1 
ATOM   9155  O O   . ALA E 1 138 ? 43.314  36.759  5.217   1.00 84.94  ? 136 ALA E O   1 
ATOM   9156  C CB  . ALA E 1 138 ? 41.116  38.659  5.006   1.00 84.36  ? 136 ALA E CB  1 
ATOM   9157  N N   . THR E 1 139 ? 44.489  38.300  4.065   1.00 86.04  ? 137 THR E N   1 
ATOM   9158  C CA  . THR E 1 139 ? 45.797  37.893  4.551   1.00 86.36  ? 137 THR E CA  1 
ATOM   9159  C C   . THR E 1 139 ? 45.905  37.981  6.093   1.00 90.18  ? 137 THR E C   1 
ATOM   9160  O O   . THR E 1 139 ? 45.604  39.027  6.689   1.00 91.44  ? 137 THR E O   1 
ATOM   9161  C CB  . THR E 1 139 ? 46.856  38.789  3.941   1.00 86.12  ? 137 THR E CB  1 
ATOM   9162  O OG1 . THR E 1 139 ? 48.134  38.295  4.307   1.00 92.34  ? 137 THR E OG1 1 
ATOM   9163  C CG2 . THR E 1 139 ? 46.752  40.219  4.468   1.00 84.40  ? 137 THR E CG2 1 
ATOM   9164  N N   . GLY E 1 140 ? 46.351  36.893  6.729   1.00 92.10  ? 138 GLY E N   1 
ATOM   9165  C CA  . GLY E 1 140 ? 46.486  36.845  8.181   1.00 93.41  ? 138 GLY E CA  1 
ATOM   9166  C C   . GLY E 1 140 ? 47.487  37.771  8.846   1.00 97.23  ? 138 GLY E C   1 
ATOM   9167  O O   . GLY E 1 140 ? 47.997  38.707  8.225   1.00 97.02  ? 138 GLY E O   1 
ATOM   9168  N N   . THR E 1 141 ? 47.757  37.498  10.127  1.00 102.31 ? 139 THR E N   1 
ATOM   9169  C CA  . THR E 1 141 ? 48.706  38.269  10.973  1.00 106.20 ? 139 THR E CA  1 
ATOM   9170  C C   . THR E 1 141 ? 50.174  37.885  10.746  1.00 107.28 ? 139 THR E C   1 
ATOM   9171  O O   . THR E 1 141 ? 51.011  38.725  10.380  1.00 107.22 ? 139 THR E O   1 
ATOM   9172  C CB  . THR E 1 141 ? 48.398  38.083  12.515  1.00 105.73 ? 139 THR E CB  1 
ATOM   9173  O OG1 . THR E 1 141 ? 47.309  38.933  12.898  1.00 105.09 ? 139 THR E OG1 1 
ATOM   9174  C CG2 . THR E 1 141 ? 49.625  38.393  13.381  1.00 103.36 ? 139 THR E CG2 1 
ATOM   9175  N N   . HIS E 1 142 ? 50.479  36.612  10.975  1.00 107.82 ? 140 HIS E N   1 
ATOM   9176  C CA  . HIS E 1 142 ? 51.833  36.129  10.800  1.00 108.78 ? 140 HIS E CA  1 
ATOM   9177  C C   . HIS E 1 142 ? 52.075  35.795  9.332   1.00 110.33 ? 140 HIS E C   1 
ATOM   9178  O O   . HIS E 1 142 ? 53.139  36.117  8.791   1.00 112.08 ? 140 HIS E O   1 
ATOM   9179  C CB  . HIS E 1 142 ? 52.071  34.900  11.677  1.00 106.25 ? 140 HIS E CB  1 
ATOM   9180  C CG  . HIS E 1 142 ? 51.678  35.102  13.105  1.00 104.89 ? 140 HIS E CG  1 
ATOM   9181  N ND1 . HIS E 1 142 ? 52.245  36.073  13.903  1.00 106.30 ? 140 HIS E ND1 1 
ATOM   9182  C CD2 . HIS E 1 142 ? 50.770  34.459  13.877  1.00 103.31 ? 140 HIS E CD2 1 
ATOM   9183  C CE1 . HIS E 1 142 ? 51.700  36.019  15.107  1.00 107.59 ? 140 HIS E CE1 1 
ATOM   9184  N NE2 . HIS E 1 142 ? 50.804  35.048  15.116  1.00 105.65 ? 140 HIS E NE2 1 
ATOM   9185  N N   . ALA E 1 143 ? 51.083  35.167  8.693   1.00 111.24 ? 141 ALA E N   1 
ATOM   9186  C CA  . ALA E 1 143 ? 51.154  34.772  7.273   1.00 111.42 ? 141 ALA E CA  1 
ATOM   9187  C C   . ALA E 1 143 ? 51.984  35.737  6.436   1.00 112.38 ? 141 ALA E C   1 
ATOM   9188  O O   . ALA E 1 143 ? 51.526  36.839  6.123   1.00 111.20 ? 141 ALA E O   1 
ATOM   9189  C CB  . ALA E 1 143 ? 49.744  34.672  6.685   1.00 110.03 ? 141 ALA E CB  1 
ATOM   9190  N N   . GLN E 1 144 ? 53.190  35.302  6.063   1.00 115.22 ? 142 GLN E N   1 
ATOM   9191  C CA  . GLN E 1 144 ? 54.119  36.116  5.274   1.00 117.85 ? 142 GLN E CA  1 
ATOM   9192  C C   . GLN E 1 144 ? 53.460  36.966  4.191   1.00 118.04 ? 142 GLN E C   1 
ATOM   9193  O O   . GLN E 1 144 ? 52.262  36.869  3.932   1.00 119.82 ? 142 GLN E O   1 
ATOM   9194  C CB  . GLN E 1 144 ? 55.243  35.254  4.658   1.00 119.16 ? 142 GLN E CB  1 
ATOM   9195  C CG  . GLN E 1 144 ? 56.439  35.021  5.597   1.00 123.82 ? 142 GLN E CG  1 
ATOM   9196  C CD  . GLN E 1 144 ? 57.788  35.426  4.982   1.00 127.58 ? 142 GLN E CD  1 
ATOM   9197  O OE1 . GLN E 1 144 ? 57.904  36.462  4.304   1.00 128.47 ? 142 GLN E OE1 1 
ATOM   9198  N NE2 . GLN E 1 144 ? 58.818  34.615  5.233   1.00 128.37 ? 142 GLN E NE2 1 
ATOM   9199  N N   . VAL E 1 145 ? 54.260  37.800  3.550   1.00 116.78 ? 143 VAL E N   1 
ATOM   9200  C CA  . VAL E 1 145 ? 53.742  38.708  2.545   1.00 115.11 ? 143 VAL E CA  1 
ATOM   9201  C C   . VAL E 1 145 ? 53.936  38.219  1.099   1.00 111.28 ? 143 VAL E C   1 
ATOM   9202  O O   . VAL E 1 145 ? 54.076  38.999  0.158   1.00 109.23 ? 143 VAL E O   1 
ATOM   9203  C CB  . VAL E 1 145 ? 54.398  40.098  2.761   1.00 118.96 ? 143 VAL E CB  1 
ATOM   9204  C CG1 . VAL E 1 145 ? 53.562  41.179  2.098   1.00 120.94 ? 143 VAL E CG1 1 
ATOM   9205  C CG2 . VAL E 1 145 ? 54.571  40.377  4.280   1.00 115.59 ? 143 VAL E CG2 1 
ATOM   9206  N N   . GLU E 1 146 ? 53.941  36.913  0.925   1.00 107.24 ? 144 GLU E N   1 
ATOM   9207  C CA  . GLU E 1 146 ? 54.109  36.359  -0.397  1.00 106.90 ? 144 GLU E CA  1 
ATOM   9208  C C   . GLU E 1 146 ? 53.369  35.053  -0.415  1.00 104.51 ? 144 GLU E C   1 
ATOM   9209  O O   . GLU E 1 146 ? 53.528  34.225  -1.313  1.00 105.54 ? 144 GLU E O   1 
ATOM   9210  C CB  . GLU E 1 146 ? 55.580  36.141  -0.710  1.00 112.02 ? 144 GLU E CB  1 
ATOM   9211  C CG  . GLU E 1 146 ? 56.331  37.427  -1.038  1.00 120.74 ? 144 GLU E CG  1 
ATOM   9212  C CD  . GLU E 1 146 ? 57.660  37.166  -1.740  1.00 125.30 ? 144 GLU E CD  1 
ATOM   9213  O OE1 . GLU E 1 146 ? 57.657  36.396  -2.732  1.00 126.38 ? 144 GLU E OE1 1 
ATOM   9214  O OE2 . GLU E 1 146 ? 58.697  37.734  -1.314  1.00 126.54 ? 144 GLU E OE2 1 
ATOM   9215  N N   . ASP E 1 147 ? 52.558  34.875  0.614   1.00 99.86  ? 145 ASP E N   1 
ATOM   9216  C CA  . ASP E 1 147 ? 51.733  33.696  0.720   1.00 96.28  ? 145 ASP E CA  1 
ATOM   9217  C C   . ASP E 1 147 ? 50.426  34.136  0.057   1.00 92.63  ? 145 ASP E C   1 
ATOM   9218  O O   . ASP E 1 147 ? 49.468  33.373  -0.063  1.00 91.38  ? 145 ASP E O   1 
ATOM   9219  C CB  . ASP E 1 147 ? 51.518  33.322  2.195   1.00 97.98  ? 145 ASP E CB  1 
ATOM   9220  C CG  . ASP E 1 147 ? 52.810  32.930  2.901   1.00 97.21  ? 145 ASP E CG  1 
ATOM   9221  O OD1 . ASP E 1 147 ? 53.505  32.004  2.433   1.00 100.91 ? 145 ASP E OD1 1 
ATOM   9222  O OD2 . ASP E 1 147 ? 53.132  33.545  3.934   1.00 98.04  ? 145 ASP E OD2 1 
ATOM   9223  N N   . GLY E 1 148 ? 50.406  35.402  -0.351  1.00 88.26  ? 146 GLY E N   1 
ATOM   9224  C CA  . GLY E 1 148 ? 49.254  35.960  -1.027  1.00 86.24  ? 146 GLY E CA  1 
ATOM   9225  C C   . GLY E 1 148 ? 49.498  35.663  -2.488  1.00 85.87  ? 146 GLY E C   1 
ATOM   9226  O O   . GLY E 1 148 ? 48.620  35.209  -3.205  1.00 86.50  ? 146 GLY E O   1 
ATOM   9227  N N   . ARG E 1 149 ? 50.717  35.914  -2.935  1.00 85.27  ? 147 ARG E N   1 
ATOM   9228  C CA  . ARG E 1 149 ? 51.054  35.626  -4.304  1.00 85.79  ? 147 ARG E CA  1 
ATOM   9229  C C   . ARG E 1 149 ? 50.716  34.171  -4.599  1.00 85.70  ? 147 ARG E C   1 
ATOM   9230  O O   . ARG E 1 149 ? 50.487  33.842  -5.762  1.00 90.31  ? 147 ARG E O   1 
ATOM   9231  C CB  . ARG E 1 149 ? 52.537  35.892  -4.578  1.00 87.34  ? 147 ARG E CB  1 
ATOM   9232  C CG  . ARG E 1 149 ? 52.875  37.356  -4.546  1.00 95.14  ? 147 ARG E CG  1 
ATOM   9233  C CD  . ARG E 1 149 ? 54.345  37.652  -4.786  1.00 100.39 ? 147 ARG E CD  1 
ATOM   9234  N NE  . ARG E 1 149 ? 54.436  38.971  -5.414  1.00 108.07 ? 147 ARG E NE  1 
ATOM   9235  C CZ  . ARG E 1 149 ? 55.554  39.667  -5.613  1.00 110.24 ? 147 ARG E CZ  1 
ATOM   9236  N NH1 . ARG E 1 149 ? 56.728  39.180  -5.223  1.00 111.55 ? 147 ARG E NH1 1 
ATOM   9237  N NH2 . ARG E 1 149 ? 55.494  40.849  -6.223  1.00 107.19 ? 147 ARG E NH2 1 
ATOM   9238  N N   . LEU E 1 150 ? 50.678  33.303  -3.574  1.00 81.66  ? 148 LEU E N   1 
ATOM   9239  C CA  . LEU E 1 150 ? 50.348  31.874  -3.791  1.00 78.43  ? 148 LEU E CA  1 
ATOM   9240  C C   . LEU E 1 150 ? 48.849  31.647  -3.665  1.00 79.70  ? 148 LEU E C   1 
ATOM   9241  O O   . LEU E 1 150 ? 48.188  31.239  -4.615  1.00 80.41  ? 148 LEU E O   1 
ATOM   9242  C CB  . LEU E 1 150 ? 51.078  30.927  -2.798  1.00 71.37  ? 148 LEU E CB  1 
ATOM   9243  C CG  . LEU E 1 150 ? 50.979  29.401  -3.086  1.00 65.06  ? 148 LEU E CG  1 
ATOM   9244  C CD1 . LEU E 1 150 ? 52.087  28.950  -4.042  1.00 63.67  ? 148 LEU E CD1 1 
ATOM   9245  C CD2 . LEU E 1 150 ? 51.099  28.601  -1.805  1.00 62.97  ? 148 LEU E CD2 1 
ATOM   9246  N N   . MET E 1 151 ? 48.321  31.912  -2.479  1.00 83.04  ? 149 MET E N   1 
ATOM   9247  C CA  . MET E 1 151 ? 46.898  31.758  -2.207  1.00 84.49  ? 149 MET E CA  1 
ATOM   9248  C C   . MET E 1 151 ? 46.116  32.319  -3.394  1.00 86.82  ? 149 MET E C   1 
ATOM   9249  O O   . MET E 1 151 ? 45.385  31.597  -4.075  1.00 87.05  ? 149 MET E O   1 
ATOM   9250  C CB  . MET E 1 151 ? 46.564  32.517  -0.922  1.00 82.93  ? 149 MET E CB  1 
ATOM   9251  C CG  . MET E 1 151 ? 45.130  32.881  -0.746  1.00 85.88  ? 149 MET E CG  1 
ATOM   9252  S SD  . MET E 1 151 ? 44.097  31.443  -0.853  1.00 94.36  ? 149 MET E SD  1 
ATOM   9253  C CE  . MET E 1 151 ? 42.548  32.066  -0.117  1.00 90.21  ? 149 MET E CE  1 
ATOM   9254  N N   . GLU E 1 152 ? 46.279  33.615  -3.643  1.00 87.80  ? 150 GLU E N   1 
ATOM   9255  C CA  . GLU E 1 152 ? 45.603  34.261  -4.761  1.00 88.65  ? 150 GLU E CA  1 
ATOM   9256  C C   . GLU E 1 152 ? 45.865  33.492  -6.055  1.00 88.61  ? 150 GLU E C   1 
ATOM   9257  O O   . GLU E 1 152 ? 44.953  32.906  -6.615  1.00 89.38  ? 150 GLU E O   1 
ATOM   9258  C CB  . GLU E 1 152 ? 46.091  35.706  -4.939  1.00 90.31  ? 150 GLU E CB  1 
ATOM   9259  C CG  . GLU E 1 152 ? 45.343  36.482  -6.033  1.00 93.37  ? 150 GLU E CG  1 
ATOM   9260  C CD  . GLU E 1 152 ? 45.883  37.882  -6.247  1.00 95.89  ? 150 GLU E CD  1 
ATOM   9261  O OE1 . GLU E 1 152 ? 47.089  37.986  -6.564  1.00 100.83 ? 150 GLU E OE1 1 
ATOM   9262  O OE2 . GLU E 1 152 ? 45.110  38.863  -6.097  1.00 94.38  ? 150 GLU E OE2 1 
ATOM   9263  N N   . GLN E 1 153 ? 47.110  33.524  -6.529  1.00 89.50  ? 151 GLN E N   1 
ATOM   9264  C CA  . GLN E 1 153 ? 47.516  32.849  -7.760  1.00 89.43  ? 151 GLN E CA  1 
ATOM   9265  C C   . GLN E 1 153 ? 46.850  31.496  -7.895  1.00 84.31  ? 151 GLN E C   1 
ATOM   9266  O O   . GLN E 1 153 ? 46.662  30.993  -8.990  1.00 81.49  ? 151 GLN E O   1 
ATOM   9267  C CB  . GLN E 1 153 ? 49.033  32.633  -7.778  1.00 98.77  ? 151 GLN E CB  1 
ATOM   9268  C CG  . GLN E 1 153 ? 49.746  33.033  -9.104  1.00 110.56 ? 151 GLN E CG  1 
ATOM   9269  C CD  . GLN E 1 153 ? 51.098  32.302  -9.339  1.00 114.93 ? 151 GLN E CD  1 
ATOM   9270  O OE1 . GLN E 1 153 ? 51.929  32.204  -8.431  1.00 117.72 ? 151 GLN E OE1 1 
ATOM   9271  N NE2 . GLN E 1 153 ? 51.312  31.798  -10.565 1.00 116.72 ? 151 GLN E NE2 1 
ATOM   9272  N N   . LEU E 1 154 ? 46.500  30.908  -6.767  1.00 81.13  ? 152 LEU E N   1 
ATOM   9273  C CA  . LEU E 1 154 ? 45.879  29.596  -6.758  1.00 79.50  ? 152 LEU E CA  1 
ATOM   9274  C C   . LEU E 1 154 ? 44.408  29.495  -7.183  1.00 78.88  ? 152 LEU E C   1 
ATOM   9275  O O   . LEU E 1 154 ? 44.010  28.608  -7.958  1.00 75.15  ? 152 LEU E O   1 
ATOM   9276  C CB  . LEU E 1 154 ? 46.020  29.002  -5.370  1.00 78.87  ? 152 LEU E CB  1 
ATOM   9277  C CG  . LEU E 1 154 ? 45.379  27.624  -5.318  1.00 76.71  ? 152 LEU E CG  1 
ATOM   9278  C CD1 . LEU E 1 154 ? 46.024  26.763  -6.388  1.00 75.13  ? 152 LEU E CD1 1 
ATOM   9279  C CD2 . LEU E 1 154 ? 45.526  27.029  -3.922  1.00 80.20  ? 152 LEU E CD2 1 
ATOM   9280  N N   . LEU E 1 155 ? 43.595  30.397  -6.650  1.00 79.22  ? 153 LEU E N   1 
ATOM   9281  C CA  . LEU E 1 155 ? 42.183  30.388  -6.959  1.00 76.74  ? 153 LEU E CA  1 
ATOM   9282  C C   . LEU E 1 155 ? 41.827  31.322  -8.128  1.00 78.07  ? 153 LEU E C   1 
ATOM   9283  O O   . LEU E 1 155 ? 40.716  31.252  -8.652  1.00 81.21  ? 153 LEU E O   1 
ATOM   9284  C CB  . LEU E 1 155 ? 41.370  30.667  -5.672  1.00 73.20  ? 153 LEU E CB  1 
ATOM   9285  C CG  . LEU E 1 155 ? 41.580  29.643  -4.522  1.00 70.30  ? 153 LEU E CG  1 
ATOM   9286  C CD1 . LEU E 1 155 ? 42.751  30.091  -3.649  1.00 65.71  ? 153 LEU E CD1 1 
ATOM   9287  C CD2 . LEU E 1 155 ? 40.335  29.481  -3.653  1.00 62.41  ? 153 LEU E CD2 1 
ATOM   9288  N N   . SER E 1 156 ? 42.765  32.174  -8.560  1.00 76.85  ? 154 SER E N   1 
ATOM   9289  C CA  . SER E 1 156 ? 42.521  33.035  -9.730  1.00 77.29  ? 154 SER E CA  1 
ATOM   9290  C C   . SER E 1 156 ? 42.406  32.047  -10.881 1.00 78.87  ? 154 SER E C   1 
ATOM   9291  O O   . SER E 1 156 ? 41.956  32.386  -11.988 1.00 79.47  ? 154 SER E O   1 
ATOM   9292  C CB  . SER E 1 156 ? 43.708  33.942  -10.045 1.00 72.99  ? 154 SER E CB  1 
ATOM   9293  O OG  . SER E 1 156 ? 43.949  34.869  -9.014  1.00 75.51  ? 154 SER E OG  1 
ATOM   9294  N N   . SER E 1 157 ? 42.834  30.824  -10.569 1.00 78.52  ? 155 SER E N   1 
ATOM   9295  C CA  . SER E 1 157 ? 42.869  29.683  -11.475 1.00 80.99  ? 155 SER E CA  1 
ATOM   9296  C C   . SER E 1 157 ? 41.534  28.984  -11.564 1.00 79.34  ? 155 SER E C   1 
ATOM   9297  O O   . SER E 1 157 ? 41.319  28.080  -12.387 1.00 80.65  ? 155 SER E O   1 
ATOM   9298  C CB  . SER E 1 157 ? 43.885  28.666  -10.980 1.00 82.90  ? 155 SER E CB  1 
ATOM   9299  O OG  . SER E 1 157 ? 45.115  29.310  -10.722 1.00 95.97  ? 155 SER E OG  1 
ATOM   9300  N N   . VAL E 1 158 ? 40.629  29.391  -10.700 1.00 76.15  ? 156 VAL E N   1 
ATOM   9301  C CA  . VAL E 1 158 ? 39.345  28.756  -10.687 1.00 74.76  ? 156 VAL E CA  1 
ATOM   9302  C C   . VAL E 1 158 ? 38.343  29.817  -10.336 1.00 72.67  ? 156 VAL E C   1 
ATOM   9303  O O   . VAL E 1 158 ? 37.517  29.641  -9.443  1.00 75.96  ? 156 VAL E O   1 
ATOM   9304  C CB  . VAL E 1 158 ? 39.322  27.592  -9.654  1.00 77.49  ? 156 VAL E CB  1 
ATOM   9305  C CG1 . VAL E 1 158 ? 38.151  26.694  -9.923  1.00 79.69  ? 156 VAL E CG1 1 
ATOM   9306  C CG2 . VAL E 1 158 ? 40.623  26.760  -9.751  1.00 79.24  ? 156 VAL E CG2 1 
ATOM   9307  N N   . GLY E 1 159 ? 38.427  30.927  -11.061 1.00 70.24  ? 157 GLY E N   1 
ATOM   9308  C CA  . GLY E 1 159 ? 37.525  32.041  -10.840 1.00 68.74  ? 157 GLY E CA  1 
ATOM   9309  C C   . GLY E 1 159 ? 38.263  33.357  -10.726 1.00 69.93  ? 157 GLY E C   1 
ATOM   9310  O O   . GLY E 1 159 ? 39.424  33.491  -11.104 1.00 70.71  ? 157 GLY E O   1 
ATOM   9311  N N   . PHE E 1 160 ? 37.562  34.346  -10.201 1.00 72.02  ? 158 PHE E N   1 
ATOM   9312  C CA  . PHE E 1 160 ? 38.110  35.681  -9.991  1.00 70.83  ? 158 PHE E CA  1 
ATOM   9313  C C   . PHE E 1 160 ? 38.616  35.715  -8.566  1.00 71.63  ? 158 PHE E C   1 
ATOM   9314  O O   . PHE E 1 160 ? 37.952  35.206  -7.674  1.00 70.46  ? 158 PHE E O   1 
ATOM   9315  C CB  . PHE E 1 160 ? 37.011  36.711  -10.122 1.00 70.47  ? 158 PHE E CB  1 
ATOM   9316  C CG  . PHE E 1 160 ? 37.299  37.980  -9.407  1.00 65.10  ? 158 PHE E CG  1 
ATOM   9317  C CD1 . PHE E 1 160 ? 38.250  38.851  -9.908  1.00 64.21  ? 158 PHE E CD1 1 
ATOM   9318  C CD2 . PHE E 1 160 ? 36.623  38.306  -8.232  1.00 63.96  ? 158 PHE E CD2 1 
ATOM   9319  C CE1 . PHE E 1 160 ? 38.533  40.027  -9.261  1.00 65.20  ? 158 PHE E CE1 1 
ATOM   9320  C CE2 . PHE E 1 160 ? 36.896  39.483  -7.572  1.00 62.52  ? 158 PHE E CE2 1 
ATOM   9321  C CZ  . PHE E 1 160 ? 37.858  40.352  -8.087  1.00 65.44  ? 158 PHE E CZ  1 
ATOM   9322  N N   . CYS E 1 161 ? 39.760  36.352  -8.337  1.00 75.64  ? 159 CYS E N   1 
ATOM   9323  C CA  . CYS E 1 161 ? 40.364  36.391  -6.997  1.00 75.21  ? 159 CYS E CA  1 
ATOM   9324  C C   . CYS E 1 161 ? 41.072  37.718  -6.682  1.00 72.72  ? 159 CYS E C   1 
ATOM   9325  O O   . CYS E 1 161 ? 41.701  38.333  -7.550  1.00 73.79  ? 159 CYS E O   1 
ATOM   9326  C CB  . CYS E 1 161 ? 41.363  35.215  -6.940  1.00 79.52  ? 159 CYS E CB  1 
ATOM   9327  S SG  . CYS E 1 161 ? 41.939  34.530  -5.380  1.00 86.74  ? 159 CYS E SG  1 
ATOM   9328  N N   . THR E 1 162 ? 40.934  38.159  -5.442  1.00 71.92  ? 160 THR E N   1 
ATOM   9329  C CA  . THR E 1 162 ? 41.607  39.351  -4.973  1.00 76.48  ? 160 THR E CA  1 
ATOM   9330  C C   . THR E 1 162 ? 41.400  39.455  -3.485  1.00 80.69  ? 160 THR E C   1 
ATOM   9331  O O   . THR E 1 162 ? 40.362  39.051  -2.959  1.00 82.08  ? 160 THR E O   1 
ATOM   9332  C CB  . THR E 1 162 ? 41.145  40.632  -5.696  1.00 75.90  ? 160 THR E CB  1 
ATOM   9333  O OG1 . THR E 1 162 ? 42.234  41.126  -6.498  1.00 78.26  ? 160 THR E OG1 1 
ATOM   9334  C CG2 . THR E 1 162 ? 40.743  41.717  -4.696  1.00 77.53  ? 160 THR E CG2 1 
ATOM   9335  N N   . GLU E 1 163 ? 42.420  39.970  -2.803  1.00 85.52  ? 161 GLU E N   1 
ATOM   9336  C CA  . GLU E 1 163 ? 42.378  40.103  -1.354  1.00 86.84  ? 161 GLU E CA  1 
ATOM   9337  C C   . GLU E 1 163 ? 41.543  41.297  -0.942  1.00 85.96  ? 161 GLU E C   1 
ATOM   9338  O O   . GLU E 1 163 ? 41.501  42.327  -1.629  1.00 86.07  ? 161 GLU E O   1 
ATOM   9339  C CB  . GLU E 1 163 ? 43.785  40.232  -0.789  1.00 89.62  ? 161 GLU E CB  1 
ATOM   9340  C CG  . GLU E 1 163 ? 44.526  41.459  -1.244  1.00 94.97  ? 161 GLU E CG  1 
ATOM   9341  C CD  . GLU E 1 163 ? 45.818  41.610  -0.497  1.00 97.47  ? 161 GLU E CD  1 
ATOM   9342  O OE1 . GLU E 1 163 ? 45.769  41.508  0.755   1.00 95.76  ? 161 GLU E OE1 1 
ATOM   9343  O OE2 . GLU E 1 163 ? 46.867  41.822  -1.157  1.00 100.13 ? 161 GLU E OE2 1 
ATOM   9344  N N   . VAL E 1 164 ? 40.903  41.156  0.206   1.00 84.03  ? 162 VAL E N   1 
ATOM   9345  C CA  . VAL E 1 164 ? 40.014  42.172  0.699   1.00 82.15  ? 162 VAL E CA  1 
ATOM   9346  C C   . VAL E 1 164 ? 40.207  42.339  2.172   1.00 82.45  ? 162 VAL E C   1 
ATOM   9347  O O   . VAL E 1 164 ? 40.398  41.351  2.866   1.00 84.95  ? 162 VAL E O   1 
ATOM   9348  C CB  . VAL E 1 164 ? 38.590  41.706  0.471   1.00 81.87  ? 162 VAL E CB  1 
ATOM   9349  C CG1 . VAL E 1 164 ? 37.650  42.369  1.444   1.00 83.03  ? 162 VAL E CG1 1 
ATOM   9350  C CG2 . VAL E 1 164 ? 38.195  41.969  -0.957  1.00 86.10  ? 162 VAL E CG2 1 
ATOM   9351  N N   . GLU E 1 165 ? 40.134  43.571  2.658   1.00 81.18  ? 163 GLU E N   1 
ATOM   9352  C CA  . GLU E 1 165 ? 40.254  43.795  4.086   1.00 83.56  ? 163 GLU E CA  1 
ATOM   9353  C C   . GLU E 1 165 ? 39.293  42.820  4.777   1.00 83.38  ? 163 GLU E C   1 
ATOM   9354  O O   . GLU E 1 165 ? 38.151  42.659  4.358   1.00 84.36  ? 163 GLU E O   1 
ATOM   9355  C CB  . GLU E 1 165 ? 39.883  45.227  4.421   1.00 87.30  ? 163 GLU E CB  1 
ATOM   9356  C CG  . GLU E 1 165 ? 40.877  45.890  5.351   1.00 97.87  ? 163 GLU E CG  1 
ATOM   9357  C CD  . GLU E 1 165 ? 42.316  45.721  4.877   1.00 103.90 ? 163 GLU E CD  1 
ATOM   9358  O OE1 . GLU E 1 165 ? 42.634  46.137  3.727   1.00 108.28 ? 163 GLU E OE1 1 
ATOM   9359  O OE2 . GLU E 1 165 ? 43.130  45.169  5.659   1.00 107.56 ? 163 GLU E OE2 1 
ATOM   9360  N N   . GLU E 1 166 ? 39.754  42.153  5.827   1.00 82.56  ? 164 GLU E N   1 
ATOM   9361  C CA  . GLU E 1 166 ? 38.917  41.175  6.505   1.00 80.73  ? 164 GLU E CA  1 
ATOM   9362  C C   . GLU E 1 166 ? 37.532  41.628  6.926   1.00 81.12  ? 164 GLU E C   1 
ATOM   9363  O O   . GLU E 1 166 ? 36.607  40.836  6.850   1.00 81.70  ? 164 GLU E O   1 
ATOM   9364  C CB  . GLU E 1 166 ? 39.615  40.596  7.722   1.00 82.36  ? 164 GLU E CB  1 
ATOM   9365  C CG  . GLU E 1 166 ? 38.653  39.792  8.568   1.00 84.91  ? 164 GLU E CG  1 
ATOM   9366  C CD  . GLU E 1 166 ? 39.343  38.954  9.593   1.00 86.34  ? 164 GLU E CD  1 
ATOM   9367  O OE1 . GLU E 1 166 ? 38.640  38.202  10.305  1.00 84.81  ? 164 GLU E OE1 1 
ATOM   9368  O OE2 . GLU E 1 166 ? 40.588  39.051  9.676   1.00 89.47  ? 164 GLU E OE2 1 
ATOM   9369  N N   . ASP E 1 167 ? 37.369  42.870  7.389   1.00 81.45  ? 165 ASP E N   1 
ATOM   9370  C CA  . ASP E 1 167 ? 36.031  43.355  7.798   1.00 81.48  ? 165 ASP E CA  1 
ATOM   9371  C C   . ASP E 1 167 ? 34.929  43.219  6.703   1.00 78.10  ? 165 ASP E C   1 
ATOM   9372  O O   . ASP E 1 167 ? 33.751  42.974  7.017   1.00 77.60  ? 165 ASP E O   1 
ATOM   9373  C CB  . ASP E 1 167 ? 36.099  44.823  8.373   1.00 87.94  ? 165 ASP E CB  1 
ATOM   9374  C CG  . ASP E 1 167 ? 36.830  45.853  7.450   1.00 92.20  ? 165 ASP E CG  1 
ATOM   9375  O OD1 . ASP E 1 167 ? 37.798  45.457  6.770   1.00 96.74  ? 165 ASP E OD1 1 
ATOM   9376  O OD2 . ASP E 1 167 ? 36.453  47.068  7.453   1.00 89.43  ? 165 ASP E OD2 1 
ATOM   9377  N N   . LEU E 1 168 ? 35.330  43.323  5.431   1.00 72.23  ? 166 LEU E N   1 
ATOM   9378  C CA  . LEU E 1 168 ? 34.409  43.225  4.295   1.00 64.29  ? 166 LEU E CA  1 
ATOM   9379  C C   . LEU E 1 168 ? 33.891  41.797  4.112   1.00 60.34  ? 166 LEU E C   1 
ATOM   9380  O O   . LEU E 1 168 ? 32.715  41.535  4.102   1.00 61.01  ? 166 LEU E O   1 
ATOM   9381  C CB  . LEU E 1 168 ? 35.112  43.689  3.021   1.00 61.33  ? 166 LEU E CB  1 
ATOM   9382  C CG  . LEU E 1 168 ? 35.798  45.072  3.053   1.00 62.58  ? 166 LEU E CG  1 
ATOM   9383  C CD1 . LEU E 1 168 ? 36.358  45.462  1.666   1.00 60.68  ? 166 LEU E CD1 1 
ATOM   9384  C CD2 . LEU E 1 168 ? 34.804  46.129  3.512   1.00 60.38  ? 166 LEU E CD2 1 
ATOM   9385  N N   . ILE E 1 169 ? 34.790  40.862  3.988   1.00 55.54  ? 167 ILE E N   1 
ATOM   9386  C CA  . ILE E 1 169 ? 34.399  39.484  3.828   1.00 57.97  ? 167 ILE E CA  1 
ATOM   9387  C C   . ILE E 1 169 ? 33.003  39.070  4.269   1.00 58.43  ? 167 ILE E C   1 
ATOM   9388  O O   . ILE E 1 169 ? 32.354  38.284  3.590   1.00 61.36  ? 167 ILE E O   1 
ATOM   9389  C CB  . ILE E 1 169 ? 35.418  38.564  4.531   1.00 57.29  ? 167 ILE E CB  1 
ATOM   9390  C CG1 . ILE E 1 169 ? 36.669  38.448  3.653   1.00 55.10  ? 167 ILE E CG1 1 
ATOM   9391  C CG2 . ILE E 1 169 ? 34.767  37.200  4.847   1.00 53.12  ? 167 ILE E CG2 1 
ATOM   9392  C CD1 . ILE E 1 169 ? 37.765  37.635  4.243   1.00 63.15  ? 167 ILE E CD1 1 
ATOM   9393  N N   . ASP E 1 170 ? 32.546  39.553  5.413   1.00 58.55  ? 168 ASP E N   1 
ATOM   9394  C CA  . ASP E 1 170 ? 31.220  39.148  5.856   1.00 58.71  ? 168 ASP E CA  1 
ATOM   9395  C C   . ASP E 1 170 ? 30.164  39.519  4.848   1.00 54.52  ? 168 ASP E C   1 
ATOM   9396  O O   . ASP E 1 170 ? 29.133  38.884  4.753   1.00 53.00  ? 168 ASP E O   1 
ATOM   9397  C CB  . ASP E 1 170 ? 30.861  39.757  7.203   1.00 64.42  ? 168 ASP E CB  1 
ATOM   9398  C CG  . ASP E 1 170 ? 31.442  38.974  8.362   1.00 69.13  ? 168 ASP E CG  1 
ATOM   9399  O OD1 . ASP E 1 170 ? 32.689  38.930  8.476   1.00 70.99  ? 168 ASP E OD1 1 
ATOM   9400  O OD2 . ASP E 1 170 ? 30.656  38.403  9.157   1.00 70.84  ? 168 ASP E OD2 1 
ATOM   9401  N N   . ALA E 1 171 ? 30.431  40.567  4.091   1.00 53.46  ? 169 ALA E N   1 
ATOM   9402  C CA  . ALA E 1 171 ? 29.511  41.026  3.057   1.00 52.92  ? 169 ALA E CA  1 
ATOM   9403  C C   . ALA E 1 171 ? 29.688  40.173  1.789   1.00 52.43  ? 169 ALA E C   1 
ATOM   9404  O O   . ALA E 1 171 ? 28.707  39.641  1.237   1.00 48.43  ? 169 ALA E O   1 
ATOM   9405  C CB  . ALA E 1 171 ? 29.772  42.504  2.744   1.00 47.99  ? 169 ALA E CB  1 
ATOM   9406  N N   . VAL E 1 172 ? 30.943  40.016  1.363   1.00 48.82  ? 170 VAL E N   1 
ATOM   9407  C CA  . VAL E 1 172 ? 31.260  39.242  0.165   1.00 49.20  ? 170 VAL E CA  1 
ATOM   9408  C C   . VAL E 1 172 ? 30.721  37.808  0.242   1.00 50.62  ? 170 VAL E C   1 
ATOM   9409  O O   . VAL E 1 172 ? 31.203  36.900  -0.422  1.00 53.22  ? 170 VAL E O   1 
ATOM   9410  C CB  . VAL E 1 172 ? 32.779  39.259  -0.039  1.00 46.12  ? 170 VAL E CB  1 
ATOM   9411  C CG1 . VAL E 1 172 ? 33.176  38.573  -1.331  1.00 47.48  ? 170 VAL E CG1 1 
ATOM   9412  C CG2 . VAL E 1 172 ? 33.230  40.705  -0.051  1.00 43.82  ? 170 VAL E CG2 1 
ATOM   9413  N N   . THR E 1 173 ? 29.690  37.642  1.054   1.00 49.34  ? 171 THR E N   1 
ATOM   9414  C CA  . THR E 1 173 ? 29.078  36.364  1.318   1.00 51.42  ? 171 THR E CA  1 
ATOM   9415  C C   . THR E 1 173 ? 27.621  36.525  0.985   1.00 52.20  ? 171 THR E C   1 
ATOM   9416  O O   . THR E 1 173 ? 27.022  35.679  0.352   1.00 51.51  ? 171 THR E O   1 
ATOM   9417  C CB  . THR E 1 173 ? 29.195  36.023  2.823   1.00 54.75  ? 171 THR E CB  1 
ATOM   9418  O OG1 . THR E 1 173 ? 30.565  36.142  3.237   1.00 62.22  ? 171 THR E OG1 1 
ATOM   9419  C CG2 . THR E 1 173 ? 28.708  34.594  3.100   1.00 55.14  ? 171 THR E CG2 1 
ATOM   9420  N N   . GLY E 1 174 ? 27.050  37.631  1.449   1.00 56.18  ? 172 GLY E N   1 
ATOM   9421  C CA  . GLY E 1 174 ? 25.651  37.938  1.174   1.00 53.30  ? 172 GLY E CA  1 
ATOM   9422  C C   . GLY E 1 174 ? 25.487  38.328  -0.292  1.00 53.59  ? 172 GLY E C   1 
ATOM   9423  O O   . GLY E 1 174 ? 24.360  38.479  -0.792  1.00 53.80  ? 172 GLY E O   1 
ATOM   9424  N N   . LEU E 1 175 ? 26.625  38.488  -0.975  1.00 52.16  ? 173 LEU E N   1 
ATOM   9425  C CA  . LEU E 1 175 ? 26.654  38.834  -2.380  1.00 50.60  ? 173 LEU E CA  1 
ATOM   9426  C C   . LEU E 1 175 ? 27.168  37.659  -3.192  1.00 52.69  ? 173 LEU E C   1 
ATOM   9427  O O   . LEU E 1 175 ? 26.406  36.754  -3.557  1.00 54.74  ? 173 LEU E O   1 
ATOM   9428  C CB  . LEU E 1 175 ? 27.564  40.028  -2.627  1.00 50.10  ? 173 LEU E CB  1 
ATOM   9429  C CG  . LEU E 1 175 ? 27.589  40.449  -4.099  1.00 50.78  ? 173 LEU E CG  1 
ATOM   9430  C CD1 . LEU E 1 175 ? 26.259  41.069  -4.444  1.00 53.18  ? 173 LEU E CD1 1 
ATOM   9431  C CD2 . LEU E 1 175 ? 28.704  41.416  -4.359  1.00 55.13  ? 173 LEU E CD2 1 
ATOM   9432  N N   . SER E 1 176 ? 28.472  37.664  -3.457  1.00 51.40  ? 174 SER E N   1 
ATOM   9433  C CA  . SER E 1 176 ? 29.078  36.602  -4.237  1.00 49.01  ? 174 SER E CA  1 
ATOM   9434  C C   . SER E 1 176 ? 29.008  35.299  -3.479  1.00 50.32  ? 174 SER E C   1 
ATOM   9435  O O   . SER E 1 176 ? 29.066  34.235  -4.072  1.00 54.50  ? 174 SER E O   1 
ATOM   9436  C CB  . SER E 1 176 ? 30.525  36.949  -4.571  1.00 49.75  ? 174 SER E CB  1 
ATOM   9437  O OG  . SER E 1 176 ? 31.097  37.712  -3.533  1.00 56.11  ? 174 SER E OG  1 
ATOM   9438  N N   . GLY E 1 177 ? 28.861  35.371  -2.167  1.00 48.52  ? 175 GLY E N   1 
ATOM   9439  C CA  . GLY E 1 177 ? 28.795  34.141  -1.409  1.00 49.93  ? 175 GLY E CA  1 
ATOM   9440  C C   . GLY E 1 177 ? 27.573  33.305  -1.758  1.00 51.01  ? 175 GLY E C   1 
ATOM   9441  O O   . GLY E 1 177 ? 27.670  32.200  -2.297  1.00 50.90  ? 175 GLY E O   1 
ATOM   9442  N N   . SER E 1 178 ? 26.409  33.849  -1.410  1.00 50.53  ? 176 SER E N   1 
ATOM   9443  C CA  . SER E 1 178 ? 25.100  33.226  -1.638  1.00 44.08  ? 176 SER E CA  1 
ATOM   9444  C C   . SER E 1 178 ? 24.622  33.545  -3.053  1.00 43.49  ? 176 SER E C   1 
ATOM   9445  O O   . SER E 1 178 ? 23.594  33.040  -3.500  1.00 41.41  ? 176 SER E O   1 
ATOM   9446  C CB  . SER E 1 178 ? 24.067  33.799  -0.654  1.00 41.56  ? 176 SER E CB  1 
ATOM   9447  O OG  . SER E 1 178 ? 24.613  34.004  0.631   1.00 31.41  ? 176 SER E OG  1 
ATOM   9448  N N   . GLY E 1 179 ? 25.358  34.432  -3.712  1.00 41.67  ? 177 GLY E N   1 
ATOM   9449  C CA  . GLY E 1 179 ? 25.026  34.837  -5.057  1.00 41.59  ? 177 GLY E CA  1 
ATOM   9450  C C   . GLY E 1 179 ? 24.448  33.669  -5.814  1.00 37.85  ? 177 GLY E C   1 
ATOM   9451  O O   . GLY E 1 179 ? 23.243  33.532  -5.891  1.00 33.15  ? 177 GLY E O   1 
ATOM   9452  N N   . PRO E 1 180 ? 25.298  32.795  -6.360  1.00 40.71  ? 178 PRO E N   1 
ATOM   9453  C CA  . PRO E 1 180 ? 24.999  31.592  -7.143  1.00 41.38  ? 178 PRO E CA  1 
ATOM   9454  C C   . PRO E 1 180 ? 23.632  31.013  -6.834  1.00 40.04  ? 178 PRO E C   1 
ATOM   9455  O O   . PRO E 1 180 ? 22.857  30.685  -7.755  1.00 40.63  ? 178 PRO E O   1 
ATOM   9456  C CB  . PRO E 1 180 ? 26.138  30.665  -6.764  1.00 45.23  ? 178 PRO E CB  1 
ATOM   9457  C CG  . PRO E 1 180 ? 27.305  31.621  -6.745  1.00 42.30  ? 178 PRO E CG  1 
ATOM   9458  C CD  . PRO E 1 180 ? 26.723  32.824  -5.983  1.00 44.63  ? 178 PRO E CD  1 
ATOM   9459  N N   . ALA E 1 181 ? 23.343  30.876  -5.541  1.00 38.45  ? 179 ALA E N   1 
ATOM   9460  C CA  . ALA E 1 181 ? 22.067  30.329  -5.096  1.00 38.90  ? 179 ALA E CA  1 
ATOM   9461  C C   . ALA E 1 181 ? 20.998  31.263  -5.636  1.00 40.93  ? 179 ALA E C   1 
ATOM   9462  O O   . ALA E 1 181 ? 20.093  30.835  -6.332  1.00 47.76  ? 179 ALA E O   1 
ATOM   9463  C CB  . ALA E 1 181 ? 22.023  30.276  -3.601  1.00 39.51  ? 179 ALA E CB  1 
ATOM   9464  N N   . TYR E 1 182 ? 21.101  32.551  -5.325  1.00 42.32  ? 180 TYR E N   1 
ATOM   9465  C CA  . TYR E 1 182 ? 20.161  33.557  -5.866  1.00 38.97  ? 180 TYR E CA  1 
ATOM   9466  C C   . TYR E 1 182 ? 19.920  33.290  -7.357  1.00 34.51  ? 180 TYR E C   1 
ATOM   9467  O O   . TYR E 1 182 ? 18.800  33.159  -7.760  1.00 34.38  ? 180 TYR E O   1 
ATOM   9468  C CB  . TYR E 1 182 ? 20.729  34.974  -5.742  1.00 39.67  ? 180 TYR E CB  1 
ATOM   9469  C CG  . TYR E 1 182 ? 21.083  35.430  -4.352  1.00 45.36  ? 180 TYR E CG  1 
ATOM   9470  C CD1 . TYR E 1 182 ? 22.152  36.325  -4.133  1.00 47.12  ? 180 TYR E CD1 1 
ATOM   9471  C CD2 . TYR E 1 182 ? 20.303  35.050  -3.266  1.00 45.82  ? 180 TYR E CD2 1 
ATOM   9472  C CE1 . TYR E 1 182 ? 22.421  36.841  -2.856  1.00 50.21  ? 180 TYR E CE1 1 
ATOM   9473  C CE2 . TYR E 1 182 ? 20.554  35.553  -1.986  1.00 50.60  ? 180 TYR E CE2 1 
ATOM   9474  C CZ  . TYR E 1 182 ? 21.610  36.460  -1.776  1.00 53.03  ? 180 TYR E CZ  1 
ATOM   9475  O OH  . TYR E 1 182 ? 21.790  37.027  -0.514  1.00 48.78  ? 180 TYR E OH  1 
ATOM   9476  N N   . ALA E 1 183 ? 20.991  33.205  -8.145  1.00 27.90  ? 181 ALA E N   1 
ATOM   9477  C CA  . ALA E 1 183 ? 20.894  32.952  -9.568  1.00 28.34  ? 181 ALA E CA  1 
ATOM   9478  C C   . ALA E 1 183 ? 19.992  31.782  -9.872  1.00 31.23  ? 181 ALA E C   1 
ATOM   9479  O O   . ALA E 1 183 ? 18.975  31.918  -10.543 1.00 35.31  ? 181 ALA E O   1 
ATOM   9480  C CB  . ALA E 1 183 ? 22.210  32.685  -10.126 1.00 14.64  ? 181 ALA E CB  1 
ATOM   9481  N N   . PHE E 1 184 ? 20.361  30.621  -9.368  1.00 34.02  ? 182 PHE E N   1 
ATOM   9482  C CA  . PHE E 1 184 ? 19.576  29.415  -9.595  1.00 31.99  ? 182 PHE E CA  1 
ATOM   9483  C C   . PHE E 1 184 ? 18.095  29.625  -9.446  1.00 31.47  ? 182 PHE E C   1 
ATOM   9484  O O   . PHE E 1 184 ? 17.290  28.992  -10.107 1.00 33.00  ? 182 PHE E O   1 
ATOM   9485  C CB  . PHE E 1 184 ? 20.054  28.346  -8.636  1.00 35.44  ? 182 PHE E CB  1 
ATOM   9486  C CG  . PHE E 1 184 ? 21.461  27.957  -8.885  1.00 32.39  ? 182 PHE E CG  1 
ATOM   9487  C CD1 . PHE E 1 184 ? 22.213  27.368  -7.909  1.00 34.82  ? 182 PHE E CD1 1 
ATOM   9488  C CD2 . PHE E 1 184 ? 22.045  28.227  -10.140 1.00 38.80  ? 182 PHE E CD2 1 
ATOM   9489  C CE1 . PHE E 1 184 ? 23.557  27.044  -8.167  1.00 40.28  ? 182 PHE E CE1 1 
ATOM   9490  C CE2 . PHE E 1 184 ? 23.364  27.921  -10.423 1.00 38.97  ? 182 PHE E CE2 1 
ATOM   9491  C CZ  . PHE E 1 184 ? 24.135  27.328  -9.437  1.00 41.45  ? 182 PHE E CZ  1 
ATOM   9492  N N   . THR E 1 185 ? 17.709  30.519  -8.569  1.00 33.88  ? 183 THR E N   1 
ATOM   9493  C CA  . THR E 1 185 ? 16.302  30.746  -8.404  1.00 40.65  ? 183 THR E CA  1 
ATOM   9494  C C   . THR E 1 185 ? 15.767  31.669  -9.498  1.00 41.24  ? 183 THR E C   1 
ATOM   9495  O O   . THR E 1 185 ? 14.578  31.628  -9.837  1.00 42.97  ? 183 THR E O   1 
ATOM   9496  C CB  . THR E 1 185 ? 16.013  31.306  -6.978  1.00 42.42  ? 183 THR E CB  1 
ATOM   9497  O OG1 . THR E 1 185 ? 15.992  30.224  -6.020  1.00 39.85  ? 183 THR E OG1 1 
ATOM   9498  C CG2 . THR E 1 185 ? 14.683  32.062  -6.946  1.00 40.75  ? 183 THR E CG2 1 
ATOM   9499  N N   . ALA E 1 186 ? 16.642  32.494  -10.056 1.00 40.16  ? 184 ALA E N   1 
ATOM   9500  C CA  . ALA E 1 186 ? 16.275  33.415  -11.127 1.00 40.64  ? 184 ALA E CA  1 
ATOM   9501  C C   . ALA E 1 186 ? 15.776  32.510  -12.211 1.00 41.42  ? 184 ALA E C   1 
ATOM   9502  O O   . ALA E 1 186 ? 14.604  32.498  -12.548 1.00 43.05  ? 184 ALA E O   1 
ATOM   9503  C CB  . ALA E 1 186 ? 17.510  34.107  -11.608 1.00 35.38  ? 184 ALA E CB  1 
ATOM   9504  N N   . LEU E 1 187 ? 16.724  31.705  -12.673 1.00 41.07  ? 185 LEU E N   1 
ATOM   9505  C CA  . LEU E 1 187 ? 16.572  30.713  -13.721 1.00 42.05  ? 185 LEU E CA  1 
ATOM   9506  C C   . LEU E 1 187 ? 15.348  29.791  -13.631 1.00 43.97  ? 185 LEU E C   1 
ATOM   9507  O O   . LEU E 1 187 ? 14.629  29.615  -14.610 1.00 47.03  ? 185 LEU E O   1 
ATOM   9508  C CB  . LEU E 1 187 ? 17.859  29.907  -13.783 1.00 37.38  ? 185 LEU E CB  1 
ATOM   9509  C CG  . LEU E 1 187 ? 18.997  30.958  -13.919 1.00 34.51  ? 185 LEU E CG  1 
ATOM   9510  C CD1 . LEU E 1 187 ? 20.390  30.411  -13.606 1.00 29.67  ? 185 LEU E CD1 1 
ATOM   9511  C CD2 . LEU E 1 187 ? 18.965  31.508  -15.314 1.00 35.73  ? 185 LEU E CD2 1 
ATOM   9512  N N   . ASP E 1 188 ? 15.113  29.180  -12.480 1.00 45.47  ? 186 ASP E N   1 
ATOM   9513  C CA  . ASP E 1 188 ? 13.937  28.324  -12.341 1.00 47.80  ? 186 ASP E CA  1 
ATOM   9514  C C   . ASP E 1 188 ? 12.689  29.125  -12.704 1.00 47.31  ? 186 ASP E C   1 
ATOM   9515  O O   . ASP E 1 188 ? 11.760  28.644  -13.353 1.00 51.65  ? 186 ASP E O   1 
ATOM   9516  C CB  . ASP E 1 188 ? 13.788  27.811  -10.902 1.00 50.71  ? 186 ASP E CB  1 
ATOM   9517  C CG  . ASP E 1 188 ? 12.704  26.734  -10.783 1.00 56.84  ? 186 ASP E CG  1 
ATOM   9518  O OD1 . ASP E 1 188 ? 12.915  25.660  -11.367 1.00 63.94  ? 186 ASP E OD1 1 
ATOM   9519  O OD2 . ASP E 1 188 ? 11.643  26.931  -10.139 1.00 62.47  ? 186 ASP E OD2 1 
ATOM   9520  N N   . ALA E 1 189 ? 12.670  30.371  -12.268 1.00 49.88  ? 187 ALA E N   1 
ATOM   9521  C CA  . ALA E 1 189 ? 11.555  31.282  -12.501 1.00 47.81  ? 187 ALA E CA  1 
ATOM   9522  C C   . ALA E 1 189 ? 11.513  31.691  -13.936 1.00 47.46  ? 187 ALA E C   1 
ATOM   9523  O O   . ALA E 1 189 ? 10.452  31.693  -14.531 1.00 53.79  ? 187 ALA E O   1 
ATOM   9524  C CB  . ALA E 1 189 ? 11.708  32.520  -11.622 1.00 50.05  ? 187 ALA E CB  1 
ATOM   9525  N N   . LEU E 1 190 ? 12.668  32.037  -14.476 1.00 43.83  ? 188 LEU E N   1 
ATOM   9526  C CA  . LEU E 1 190 ? 12.755  32.440  -15.854 1.00 46.72  ? 188 LEU E CA  1 
ATOM   9527  C C   . LEU E 1 190 ? 12.298  31.333  -16.788 1.00 50.88  ? 188 LEU E C   1 
ATOM   9528  O O   . LEU E 1 190 ? 11.708  31.610  -17.837 1.00 52.22  ? 188 LEU E O   1 
ATOM   9529  C CB  . LEU E 1 190 ? 14.173  32.847  -16.205 1.00 44.36  ? 188 LEU E CB  1 
ATOM   9530  C CG  . LEU E 1 190 ? 14.459  34.308  -15.854 1.00 42.15  ? 188 LEU E CG  1 
ATOM   9531  C CD1 . LEU E 1 190 ? 15.676  34.762  -16.619 1.00 43.26  ? 188 LEU E CD1 1 
ATOM   9532  C CD2 . LEU E 1 190 ? 13.248  35.185  -16.211 1.00 40.22  ? 188 LEU E CD2 1 
ATOM   9533  N N   . ALA E 1 191 ? 12.568  30.084  -16.400 1.00 53.73  ? 189 ALA E N   1 
ATOM   9534  C CA  . ALA E 1 191 ? 12.173  28.898  -17.170 1.00 50.29  ? 189 ALA E CA  1 
ATOM   9535  C C   . ALA E 1 191 ? 10.666  28.708  -16.998 1.00 54.57  ? 189 ALA E C   1 
ATOM   9536  O O   . ALA E 1 191 ? 9.942   28.474  -17.976 1.00 56.98  ? 189 ALA E O   1 
ATOM   9537  C CB  . ALA E 1 191 ? 12.904  27.676  -16.663 1.00 45.45  ? 189 ALA E CB  1 
ATOM   9538  N N   . ASP E 1 192 ? 10.193  28.805  -15.755 1.00 55.42  ? 190 ASP E N   1 
ATOM   9539  C CA  . ASP E 1 192 ? 8.769   28.669  -15.495 1.00 57.56  ? 190 ASP E CA  1 
ATOM   9540  C C   . ASP E 1 192 ? 8.040   29.678  -16.438 1.00 58.69  ? 190 ASP E C   1 
ATOM   9541  O O   . ASP E 1 192 ? 7.036   29.331  -17.082 1.00 56.63  ? 190 ASP E O   1 
ATOM   9542  C CB  . ASP E 1 192 ? 8.492   28.977  -14.013 1.00 61.49  ? 190 ASP E CB  1 
ATOM   9543  C CG  . ASP E 1 192 ? 8.807   27.795  -13.077 1.00 69.87  ? 190 ASP E CG  1 
ATOM   9544  O OD1 . ASP E 1 192 ? 8.958   28.019  -11.837 1.00 77.58  ? 190 ASP E OD1 1 
ATOM   9545  O OD2 . ASP E 1 192 ? 8.871   26.643  -13.566 1.00 74.99  ? 190 ASP E OD2 1 
ATOM   9546  N N   . GLY E 1 193 ? 8.583   30.905  -16.538 1.00 56.96  ? 191 GLY E N   1 
ATOM   9547  C CA  . GLY E 1 193 ? 8.006   31.945  -17.378 1.00 50.42  ? 191 GLY E CA  1 
ATOM   9548  C C   . GLY E 1 193 ? 8.003   31.566  -18.847 1.00 48.41  ? 191 GLY E C   1 
ATOM   9549  O O   . GLY E 1 193 ? 6.946   31.541  -19.505 1.00 42.91  ? 191 GLY E O   1 
ATOM   9550  N N   . GLY E 1 194 ? 9.204   31.305  -19.363 1.00 46.01  ? 192 GLY E N   1 
ATOM   9551  C CA  . GLY E 1 194 ? 9.361   30.908  -20.753 1.00 43.46  ? 192 GLY E CA  1 
ATOM   9552  C C   . GLY E 1 194 ? 8.370   29.818  -21.127 1.00 44.31  ? 192 GLY E C   1 
ATOM   9553  O O   . GLY E 1 194 ? 7.754   29.836  -22.204 1.00 43.39  ? 192 GLY E O   1 
ATOM   9554  N N   . VAL E 1 195 ? 8.203   28.867  -20.223 1.00 40.41  ? 193 VAL E N   1 
ATOM   9555  C CA  . VAL E 1 195 ? 7.295   27.797  -20.477 1.00 35.16  ? 193 VAL E CA  1 
ATOM   9556  C C   . VAL E 1 195 ? 5.899   28.375  -20.532 1.00 36.50  ? 193 VAL E C   1 
ATOM   9557  O O   . VAL E 1 195 ? 5.191   28.144  -21.510 1.00 43.19  ? 193 VAL E O   1 
ATOM   9558  C CB  . VAL E 1 195 ? 7.431   26.694  -19.423 1.00 29.47  ? 193 VAL E CB  1 
ATOM   9559  C CG1 . VAL E 1 195 ? 6.415   25.628  -19.666 1.00 23.43  ? 193 VAL E CG1 1 
ATOM   9560  C CG2 . VAL E 1 195 ? 8.816   26.095  -19.509 1.00 24.99  ? 193 VAL E CG2 1 
ATOM   9561  N N   . LYS E 1 196 ? 5.497   29.168  -19.543 1.00 35.21  ? 194 LYS E N   1 
ATOM   9562  C CA  . LYS E 1 196 ? 4.137   29.746  -19.583 1.00 36.35  ? 194 LYS E CA  1 
ATOM   9563  C C   . LYS E 1 196 ? 3.858   30.512  -20.912 1.00 35.23  ? 194 LYS E C   1 
ATOM   9564  O O   . LYS E 1 196 ? 2.741   30.629  -21.340 1.00 31.93  ? 194 LYS E O   1 
ATOM   9565  C CB  . LYS E 1 196 ? 3.915   30.676  -18.394 1.00 27.52  ? 194 LYS E CB  1 
ATOM   9566  C CG  . LYS E 1 196 ? 2.444   30.924  -18.095 1.00 23.82  ? 194 LYS E CG  1 
ATOM   9567  C CD  . LYS E 1 196 ? 2.247   32.355  -17.549 1.00 19.29  ? 194 LYS E CD  1 
ATOM   9568  C CE  . LYS E 1 196 ? 0.827   32.487  -17.045 1.00 22.67  ? 194 LYS E CE  1 
ATOM   9569  N NZ  . LYS E 1 196 ? 0.368   33.885  -16.704 1.00 30.34  ? 194 LYS E NZ  1 
ATOM   9570  N N   . MET E 1 197 ? 4.904   31.033  -21.530 1.00 34.61  ? 195 MET E N   1 
ATOM   9571  C CA  . MET E 1 197 ? 4.796   31.752  -22.771 1.00 37.05  ? 195 MET E CA  1 
ATOM   9572  C C   . MET E 1 197 ? 5.065   30.867  -23.989 1.00 46.02  ? 195 MET E C   1 
ATOM   9573  O O   . MET E 1 197 ? 5.617   31.315  -24.998 1.00 51.33  ? 195 MET E O   1 
ATOM   9574  C CB  . MET E 1 197 ? 5.774   32.907  -22.766 1.00 36.11  ? 195 MET E CB  1 
ATOM   9575  C CG  . MET E 1 197 ? 5.109   34.262  -22.822 1.00 35.65  ? 195 MET E CG  1 
ATOM   9576  S SD  . MET E 1 197 ? 3.863   34.459  -21.596 1.00 42.33  ? 195 MET E SD  1 
ATOM   9577  C CE  . MET E 1 197 ? 2.394   33.579  -22.290 1.00 37.26  ? 195 MET E CE  1 
ATOM   9578  N N   . GLY E 1 198 ? 4.697   29.599  -23.897 1.00 46.49  ? 196 GLY E N   1 
ATOM   9579  C CA  . GLY E 1 198 ? 4.869   28.725  -25.038 1.00 47.23  ? 196 GLY E CA  1 
ATOM   9580  C C   . GLY E 1 198 ? 6.077   27.834  -25.150 1.00 46.08  ? 196 GLY E C   1 
ATOM   9581  O O   . GLY E 1 198 ? 5.970   26.772  -25.710 1.00 52.25  ? 196 GLY E O   1 
ATOM   9582  N N   . LEU E 1 199 ? 7.222   28.222  -24.623 1.00 49.19  ? 197 LEU E N   1 
ATOM   9583  C CA  . LEU E 1 199 ? 8.429   27.396  -24.775 1.00 47.72  ? 197 LEU E CA  1 
ATOM   9584  C C   . LEU E 1 199 ? 8.527   26.030  -24.091 1.00 48.39  ? 197 LEU E C   1 
ATOM   9585  O O   . LEU E 1 199 ? 7.779   25.696  -23.172 1.00 48.03  ? 197 LEU E O   1 
ATOM   9586  C CB  . LEU E 1 199 ? 9.674   28.208  -24.363 1.00 42.41  ? 197 LEU E CB  1 
ATOM   9587  C CG  . LEU E 1 199 ? 10.024  29.335  -25.323 1.00 45.25  ? 197 LEU E CG  1 
ATOM   9588  C CD1 . LEU E 1 199 ? 10.170  30.630  -24.612 1.00 47.99  ? 197 LEU E CD1 1 
ATOM   9589  C CD2 . LEU E 1 199 ? 11.325  29.014  -25.995 1.00 54.26  ? 197 LEU E CD2 1 
ATOM   9590  N N   . PRO E 1 200 ? 9.450   25.203  -24.581 1.00 50.80  ? 198 PRO E N   1 
ATOM   9591  C CA  . PRO E 1 200 ? 9.704   23.880  -24.033 1.00 53.32  ? 198 PRO E CA  1 
ATOM   9592  C C   . PRO E 1 200 ? 10.691  24.108  -22.875 1.00 55.76  ? 198 PRO E C   1 
ATOM   9593  O O   . PRO E 1 200 ? 11.480  25.054  -22.877 1.00 55.30  ? 198 PRO E O   1 
ATOM   9594  C CB  . PRO E 1 200 ? 10.346  23.142  -25.198 1.00 53.56  ? 198 PRO E CB  1 
ATOM   9595  C CG  . PRO E 1 200 ? 11.084  24.203  -25.906 1.00 52.53  ? 198 PRO E CG  1 
ATOM   9596  C CD  . PRO E 1 200 ? 10.024  25.294  -25.934 1.00 54.73  ? 198 PRO E CD  1 
ATOM   9597  N N   . ARG E 1 201 ? 10.656  23.223  -21.894 1.00 60.22  ? 199 ARG E N   1 
ATOM   9598  C CA  . ARG E 1 201 ? 11.481  23.351  -20.702 1.00 61.14  ? 199 ARG E CA  1 
ATOM   9599  C C   . ARG E 1 201 ? 12.976  23.566  -20.949 1.00 63.97  ? 199 ARG E C   1 
ATOM   9600  O O   . ARG E 1 201 ? 13.478  24.677  -20.795 1.00 61.38  ? 199 ARG E O   1 
ATOM   9601  C CB  . ARG E 1 201 ? 11.245  22.122  -19.815 1.00 65.23  ? 199 ARG E CB  1 
ATOM   9602  C CG  . ARG E 1 201 ? 11.386  22.406  -18.319 1.00 68.17  ? 199 ARG E CG  1 
ATOM   9603  C CD  . ARG E 1 201 ? 10.294  23.314  -17.735 1.00 70.90  ? 199 ARG E CD  1 
ATOM   9604  N NE  . ARG E 1 201 ? 10.836  24.066  -16.599 1.00 70.90  ? 199 ARG E NE  1 
ATOM   9605  C CZ  . ARG E 1 201 ? 10.116  24.712  -15.687 1.00 71.75  ? 199 ARG E CZ  1 
ATOM   9606  N NH1 . ARG E 1 201 ? 8.781   24.715  -15.749 1.00 67.24  ? 199 ARG E NH1 1 
ATOM   9607  N NH2 . ARG E 1 201 ? 10.748  25.348  -14.702 1.00 70.67  ? 199 ARG E NH2 1 
ATOM   9608  N N   . ARG E 1 202 ? 13.674  22.506  -21.340 1.00 64.13  ? 200 ARG E N   1 
ATOM   9609  C CA  . ARG E 1 202 ? 15.113  22.582  -21.547 1.00 66.79  ? 200 ARG E CA  1 
ATOM   9610  C C   . ARG E 1 202 ? 15.588  23.814  -22.312 1.00 64.70  ? 200 ARG E C   1 
ATOM   9611  O O   . ARG E 1 202 ? 16.616  24.410  -21.979 1.00 64.56  ? 200 ARG E O   1 
ATOM   9612  C CB  . ARG E 1 202 ? 15.594  21.319  -22.237 1.00 72.30  ? 200 ARG E CB  1 
ATOM   9613  C CG  . ARG E 1 202 ? 14.892  20.071  -21.682 1.00 90.40  ? 200 ARG E CG  1 
ATOM   9614  C CD  . ARG E 1 202 ? 15.486  18.758  -22.210 1.00 103.68 ? 200 ARG E CD  1 
ATOM   9615  N NE  . ARG E 1 202 ? 14.793  17.558  -21.703 1.00 114.79 ? 200 ARG E NE  1 
ATOM   9616  C CZ  . ARG E 1 202 ? 15.180  16.300  -21.943 1.00 119.60 ? 200 ARG E CZ  1 
ATOM   9617  N NH1 . ARG E 1 202 ? 16.266  16.064  -22.688 1.00 123.14 ? 200 ARG E NH1 1 
ATOM   9618  N NH2 . ARG E 1 202 ? 14.478  15.279  -21.444 1.00 118.02 ? 200 ARG E NH2 1 
ATOM   9619  N N   . LEU E 1 203 ? 14.830  24.202  -23.330 1.00 62.63  ? 201 LEU E N   1 
ATOM   9620  C CA  . LEU E 1 203 ? 15.153  25.367  -24.167 1.00 56.65  ? 201 LEU E CA  1 
ATOM   9621  C C   . LEU E 1 203 ? 15.102  26.616  -23.319 1.00 54.10  ? 201 LEU E C   1 
ATOM   9622  O O   . LEU E 1 203 ? 16.019  27.447  -23.355 1.00 51.26  ? 201 LEU E O   1 
ATOM   9623  C CB  . LEU E 1 203 ? 14.134  25.519  -25.322 1.00 54.67  ? 201 LEU E CB  1 
ATOM   9624  C CG  . LEU E 1 203 ? 14.224  26.787  -26.220 1.00 48.99  ? 201 LEU E CG  1 
ATOM   9625  C CD1 . LEU E 1 203 ? 15.620  26.900  -26.878 1.00 42.56  ? 201 LEU E CD1 1 
ATOM   9626  C CD2 . LEU E 1 203 ? 13.121  26.774  -27.276 1.00 38.05  ? 201 LEU E CD2 1 
ATOM   9627  N N   . ALA E 1 204 ? 14.001  26.759  -22.587 1.00 54.18  ? 202 ALA E N   1 
ATOM   9628  C CA  . ALA E 1 204 ? 13.828  27.901  -21.709 1.00 55.74  ? 202 ALA E CA  1 
ATOM   9629  C C   . ALA E 1 204 ? 15.052  28.006  -20.784 1.00 58.76  ? 202 ALA E C   1 
ATOM   9630  O O   . ALA E 1 204 ? 15.788  29.006  -20.837 1.00 61.22  ? 202 ALA E O   1 
ATOM   9631  C CB  . ALA E 1 204 ? 12.566  27.728  -20.901 1.00 56.18  ? 202 ALA E CB  1 
ATOM   9632  N N   . VAL E 1 205 ? 15.272  26.963  -19.969 1.00 54.87  ? 203 VAL E N   1 
ATOM   9633  C CA  . VAL E 1 205 ? 16.398  26.889  -19.046 1.00 52.22  ? 203 VAL E CA  1 
ATOM   9634  C C   . VAL E 1 205 ? 17.680  27.446  -19.696 1.00 53.30  ? 203 VAL E C   1 
ATOM   9635  O O   . VAL E 1 205 ? 18.196  28.459  -19.247 1.00 58.08  ? 203 VAL E O   1 
ATOM   9636  C CB  . VAL E 1 205 ? 16.637  25.414  -18.541 1.00 51.52  ? 203 VAL E CB  1 
ATOM   9637  C CG1 . VAL E 1 205 ? 17.961  25.336  -17.872 1.00 52.41  ? 203 VAL E CG1 1 
ATOM   9638  C CG2 . VAL E 1 205 ? 15.636  24.997  -17.487 1.00 49.67  ? 203 VAL E CG2 1 
ATOM   9639  N N   . ARG E 1 206 ? 18.196  26.799  -20.736 1.00 55.67  ? 204 ARG E N   1 
ATOM   9640  C CA  . ARG E 1 206 ? 19.416  27.285  -21.385 1.00 60.75  ? 204 ARG E CA  1 
ATOM   9641  C C   . ARG E 1 206 ? 19.376  28.728  -21.864 1.00 58.18  ? 204 ARG E C   1 
ATOM   9642  O O   . ARG E 1 206 ? 20.398  29.441  -21.895 1.00 56.85  ? 204 ARG E O   1 
ATOM   9643  C CB  . ARG E 1 206 ? 19.749  26.437  -22.595 1.00 70.26  ? 204 ARG E CB  1 
ATOM   9644  C CG  . ARG E 1 206 ? 19.711  24.981  -22.317 1.00 86.87  ? 204 ARG E CG  1 
ATOM   9645  C CD  . ARG E 1 206 ? 20.744  24.245  -23.143 1.00 100.42 ? 204 ARG E CD  1 
ATOM   9646  N NE  . ARG E 1 206 ? 20.651  22.817  -22.848 1.00 109.90 ? 204 ARG E NE  1 
ATOM   9647  C CZ  . ARG E 1 206 ? 21.491  21.903  -23.308 1.00 113.48 ? 204 ARG E CZ  1 
ATOM   9648  N NH1 . ARG E 1 206 ? 22.501  22.279  -24.092 1.00 116.26 ? 204 ARG E NH1 1 
ATOM   9649  N NH2 . ARG E 1 206 ? 21.315  20.624  -22.985 1.00 115.08 ? 204 ARG E NH2 1 
ATOM   9650  N N   . LEU E 1 207 ? 18.203  29.139  -22.310 1.00 50.86  ? 205 LEU E N   1 
ATOM   9651  C CA  . LEU E 1 207 ? 18.052  30.468  -22.801 1.00 45.73  ? 205 LEU E CA  1 
ATOM   9652  C C   . LEU E 1 207 ? 18.303  31.500  -21.719 1.00 42.43  ? 205 LEU E C   1 
ATOM   9653  O O   . LEU E 1 207 ? 19.128  32.407  -21.909 1.00 34.74  ? 205 LEU E O   1 
ATOM   9654  C CB  . LEU E 1 207 ? 16.679  30.580  -23.439 1.00 48.01  ? 205 LEU E CB  1 
ATOM   9655  C CG  . LEU E 1 207 ? 16.755  30.035  -24.874 1.00 46.68  ? 205 LEU E CG  1 
ATOM   9656  C CD1 . LEU E 1 207 ? 15.375  30.028  -25.507 1.00 50.88  ? 205 LEU E CD1 1 
ATOM   9657  C CD2 . LEU E 1 207 ? 17.708  30.916  -25.703 1.00 37.65  ? 205 LEU E CD2 1 
ATOM   9658  N N   . GLY E 1 208 ? 17.608  31.362  -20.589 1.00 41.20  ? 206 GLY E N   1 
ATOM   9659  C CA  . GLY E 1 208 ? 17.816  32.296  -19.486 1.00 45.00  ? 206 GLY E CA  1 
ATOM   9660  C C   . GLY E 1 208 ? 19.296  32.317  -19.084 1.00 49.51  ? 206 GLY E C   1 
ATOM   9661  O O   . GLY E 1 208 ? 19.975  33.376  -19.105 1.00 45.00  ? 206 GLY E O   1 
ATOM   9662  N N   . ALA E 1 209 ? 19.793  31.129  -18.716 1.00 48.29  ? 207 ALA E N   1 
ATOM   9663  C CA  . ALA E 1 209 ? 21.180  30.950  -18.352 1.00 46.09  ? 207 ALA E CA  1 
ATOM   9664  C C   . ALA E 1 209 ? 22.025  31.772  -19.324 1.00 47.77  ? 207 ALA E C   1 
ATOM   9665  O O   . ALA E 1 209 ? 22.668  32.760  -18.914 1.00 43.99  ? 207 ALA E O   1 
ATOM   9666  C CB  . ALA E 1 209 ? 21.536  29.478  -18.445 1.00 46.33  ? 207 ALA E CB  1 
ATOM   9667  N N   . GLN E 1 210 ? 22.007  31.372  -20.602 1.00 49.10  ? 208 GLN E N   1 
ATOM   9668  C CA  . GLN E 1 210 ? 22.791  32.067  -21.626 1.00 49.74  ? 208 GLN E CA  1 
ATOM   9669  C C   . GLN E 1 210 ? 22.638  33.592  -21.567 1.00 47.62  ? 208 GLN E C   1 
ATOM   9670  O O   . GLN E 1 210 ? 23.593  34.304  -21.882 1.00 45.63  ? 208 GLN E O   1 
ATOM   9671  C CB  . GLN E 1 210 ? 22.453  31.536  -23.020 1.00 48.95  ? 208 GLN E CB  1 
ATOM   9672  C CG  . GLN E 1 210 ? 23.366  32.044  -24.150 1.00 51.62  ? 208 GLN E CG  1 
ATOM   9673  C CD  . GLN E 1 210 ? 24.804  31.577  -24.015 1.00 57.73  ? 208 GLN E CD  1 
ATOM   9674  O OE1 . GLN E 1 210 ? 25.086  30.377  -23.935 1.00 60.01  ? 208 GLN E OE1 1 
ATOM   9675  N NE2 . GLN E 1 210 ? 25.725  32.528  -23.985 1.00 61.74  ? 208 GLN E NE2 1 
ATOM   9676  N N   . ALA E 1 211 ? 21.458  34.074  -21.145 1.00 43.77  ? 209 ALA E N   1 
ATOM   9677  C CA  . ALA E 1 211 ? 21.189  35.515  -20.990 1.00 44.46  ? 209 ALA E CA  1 
ATOM   9678  C C   . ALA E 1 211 ? 22.080  36.069  -19.866 1.00 44.07  ? 209 ALA E C   1 
ATOM   9679  O O   . ALA E 1 211 ? 23.030  36.820  -20.122 1.00 43.95  ? 209 ALA E O   1 
ATOM   9680  C CB  . ALA E 1 211 ? 19.706  35.766  -20.663 1.00 41.84  ? 209 ALA E CB  1 
ATOM   9681  N N   . LEU E 1 212 ? 21.794  35.681  -18.626 1.00 42.67  ? 210 LEU E N   1 
ATOM   9682  C CA  . LEU E 1 212 ? 22.600  36.148  -17.498 1.00 43.81  ? 210 LEU E CA  1 
ATOM   9683  C C   . LEU E 1 212 ? 24.079  35.823  -17.710 1.00 44.27  ? 210 LEU E C   1 
ATOM   9684  O O   . LEU E 1 212 ? 24.963  36.634  -17.442 1.00 43.16  ? 210 LEU E O   1 
ATOM   9685  C CB  . LEU E 1 212 ? 22.126  35.507  -16.202 1.00 39.75  ? 210 LEU E CB  1 
ATOM   9686  C CG  . LEU E 1 212 ? 20.616  35.279  -16.211 1.00 45.96  ? 210 LEU E CG  1 
ATOM   9687  C CD1 . LEU E 1 212 ? 20.261  34.489  -14.975 1.00 40.52  ? 210 LEU E CD1 1 
ATOM   9688  C CD2 . LEU E 1 212 ? 19.806  36.606  -16.293 1.00 36.22  ? 210 LEU E CD2 1 
ATOM   9689  N N   . LEU E 1 213 ? 24.355  34.627  -18.199 1.00 46.42  ? 211 LEU E N   1 
ATOM   9690  C CA  . LEU E 1 213 ? 25.729  34.256  -18.427 1.00 49.83  ? 211 LEU E CA  1 
ATOM   9691  C C   . LEU E 1 213 ? 26.360  35.361  -19.282 1.00 49.21  ? 211 LEU E C   1 
ATOM   9692  O O   . LEU E 1 213 ? 27.397  35.923  -18.936 1.00 49.02  ? 211 LEU E O   1 
ATOM   9693  C CB  . LEU E 1 213 ? 25.765  32.906  -19.147 1.00 54.63  ? 211 LEU E CB  1 
ATOM   9694  C CG  . LEU E 1 213 ? 27.118  32.270  -19.536 1.00 60.37  ? 211 LEU E CG  1 
ATOM   9695  C CD1 . LEU E 1 213 ? 27.904  33.161  -20.549 1.00 67.63  ? 211 LEU E CD1 1 
ATOM   9696  C CD2 . LEU E 1 213 ? 27.933  32.032  -18.286 1.00 59.45  ? 211 LEU E CD2 1 
ATOM   9697  N N   . GLY E 1 214 ? 25.700  35.672  -20.392 1.00 48.29  ? 212 GLY E N   1 
ATOM   9698  C CA  . GLY E 1 214 ? 26.192  36.683  -21.299 1.00 49.96  ? 212 GLY E CA  1 
ATOM   9699  C C   . GLY E 1 214 ? 26.041  38.110  -20.799 1.00 51.40  ? 212 GLY E C   1 
ATOM   9700  O O   . GLY E 1 214 ? 26.949  38.942  -20.944 1.00 51.92  ? 212 GLY E O   1 
ATOM   9701  N N   . ALA E 1 215 ? 24.900  38.428  -20.206 1.00 50.20  ? 213 ALA E N   1 
ATOM   9702  C CA  . ALA E 1 215 ? 24.697  39.796  -19.708 1.00 50.07  ? 213 ALA E CA  1 
ATOM   9703  C C   . ALA E 1 215 ? 25.800  40.158  -18.726 1.00 51.06  ? 213 ALA E C   1 
ATOM   9704  O O   . ALA E 1 215 ? 26.371  41.230  -18.813 1.00 55.15  ? 213 ALA E O   1 
ATOM   9705  C CB  . ALA E 1 215 ? 23.306  39.942  -19.022 1.00 40.59  ? 213 ALA E CB  1 
ATOM   9706  N N   . ALA E 1 216 ? 26.098  39.231  -17.814 1.00 51.96  ? 214 ALA E N   1 
ATOM   9707  C CA  . ALA E 1 216 ? 27.108  39.402  -16.770 1.00 48.11  ? 214 ALA E CA  1 
ATOM   9708  C C   . ALA E 1 216 ? 28.460  39.561  -17.392 1.00 46.32  ? 214 ALA E C   1 
ATOM   9709  O O   . ALA E 1 216 ? 29.148  40.557  -17.170 1.00 46.22  ? 214 ALA E O   1 
ATOM   9710  C CB  . ALA E 1 216 ? 27.117  38.187  -15.815 1.00 49.95  ? 214 ALA E CB  1 
ATOM   9711  N N   . LYS E 1 217 ? 28.852  38.561  -18.164 1.00 45.89  ? 215 LYS E N   1 
ATOM   9712  C CA  . LYS E 1 217 ? 30.149  38.635  -18.801 1.00 50.77  ? 215 LYS E CA  1 
ATOM   9713  C C   . LYS E 1 217 ? 30.245  39.999  -19.480 1.00 51.96  ? 215 LYS E C   1 
ATOM   9714  O O   . LYS E 1 217 ? 31.295  40.600  -19.554 1.00 52.97  ? 215 LYS E O   1 
ATOM   9715  C CB  . LYS E 1 217 ? 30.312  37.531  -19.841 1.00 48.50  ? 215 LYS E CB  1 
ATOM   9716  C CG  . LYS E 1 217 ? 31.700  37.410  -20.419 1.00 57.22  ? 215 LYS E CG  1 
ATOM   9717  C CD  . LYS E 1 217 ? 31.727  36.244  -21.387 1.00 67.35  ? 215 LYS E CD  1 
ATOM   9718  C CE  . LYS E 1 217 ? 33.138  35.789  -21.777 1.00 76.13  ? 215 LYS E CE  1 
ATOM   9719  N NZ  . LYS E 1 217 ? 33.164  34.580  -22.696 1.00 77.83  ? 215 LYS E NZ  1 
ATOM   9720  N N   . MET E 1 218 ? 29.114  40.507  -19.940 1.00 55.41  ? 216 MET E N   1 
ATOM   9721  C CA  . MET E 1 218 ? 29.077  41.789  -20.641 1.00 55.93  ? 216 MET E CA  1 
ATOM   9722  C C   . MET E 1 218 ? 29.389  42.975  -19.723 1.00 57.64  ? 216 MET E C   1 
ATOM   9723  O O   . MET E 1 218 ? 30.115  43.921  -20.101 1.00 52.16  ? 216 MET E O   1 
ATOM   9724  C CB  . MET E 1 218 ? 27.694  41.972  -21.285 1.00 55.77  ? 216 MET E CB  1 
ATOM   9725  C CG  . MET E 1 218 ? 27.719  42.595  -22.652 1.00 52.19  ? 216 MET E CG  1 
ATOM   9726  S SD  . MET E 1 218 ? 26.041  42.565  -23.302 1.00 57.38  ? 216 MET E SD  1 
ATOM   9727  C CE  . MET E 1 218 ? 25.673  44.319  -23.446 1.00 55.13  ? 216 MET E CE  1 
ATOM   9728  N N   . LEU E 1 219 ? 28.823  42.922  -18.519 1.00 60.28  ? 217 LEU E N   1 
ATOM   9729  C CA  . LEU E 1 219 ? 29.025  43.983  -17.552 1.00 62.20  ? 217 LEU E CA  1 
ATOM   9730  C C   . LEU E 1 219 ? 30.475  43.915  -17.127 1.00 64.37  ? 217 LEU E C   1 
ATOM   9731  O O   . LEU E 1 219 ? 31.201  44.920  -17.165 1.00 69.25  ? 217 LEU E O   1 
ATOM   9732  C CB  . LEU E 1 219 ? 28.095  43.807  -16.350 1.00 58.81  ? 217 LEU E CB  1 
ATOM   9733  C CG  . LEU E 1 219 ? 28.055  44.963  -15.320 1.00 63.61  ? 217 LEU E CG  1 
ATOM   9734  C CD1 . LEU E 1 219 ? 28.556  46.306  -15.915 1.00 64.64  ? 217 LEU E CD1 1 
ATOM   9735  C CD2 . LEU E 1 219 ? 26.619  45.122  -14.795 1.00 62.91  ? 217 LEU E CD2 1 
ATOM   9736  N N   . LEU E 1 220 ? 30.897  42.709  -16.750 1.00 64.30  ? 218 LEU E N   1 
ATOM   9737  C CA  . LEU E 1 220 ? 32.266  42.443  -16.317 1.00 64.85  ? 218 LEU E CA  1 
ATOM   9738  C C   . LEU E 1 220 ? 33.275  42.863  -17.348 1.00 68.27  ? 218 LEU E C   1 
ATOM   9739  O O   . LEU E 1 220 ? 34.450  42.513  -17.234 1.00 71.18  ? 218 LEU E O   1 
ATOM   9740  C CB  . LEU E 1 220 ? 32.441  40.959  -16.074 1.00 58.57  ? 218 LEU E CB  1 
ATOM   9741  C CG  . LEU E 1 220 ? 31.753  40.638  -14.787 1.00 55.37  ? 218 LEU E CG  1 
ATOM   9742  C CD1 . LEU E 1 220 ? 31.359  39.191  -14.769 1.00 58.80  ? 218 LEU E CD1 1 
ATOM   9743  C CD2 . LEU E 1 220 ? 32.684  41.030  -13.681 1.00 51.74  ? 218 LEU E CD2 1 
ATOM   9744  N N   . HIS E 1 221 ? 32.823  43.605  -18.354 1.00 72.47  ? 219 HIS E N   1 
ATOM   9745  C CA  . HIS E 1 221 ? 33.703  44.021  -19.431 1.00 74.06  ? 219 HIS E CA  1 
ATOM   9746  C C   . HIS E 1 221 ? 33.598  45.430  -19.935 1.00 73.30  ? 219 HIS E C   1 
ATOM   9747  O O   . HIS E 1 221 ? 34.316  45.782  -20.852 1.00 74.79  ? 219 HIS E O   1 
ATOM   9748  C CB  . HIS E 1 221 ? 33.490  43.101  -20.621 1.00 76.75  ? 219 HIS E CB  1 
ATOM   9749  C CG  . HIS E 1 221 ? 34.444  41.954  -20.678 1.00 83.79  ? 219 HIS E CG  1 
ATOM   9750  N ND1 . HIS E 1 221 ? 35.745  42.092  -21.113 1.00 85.38  ? 219 HIS E ND1 1 
ATOM   9751  C CD2 . HIS E 1 221 ? 34.293  40.652  -20.328 1.00 90.28  ? 219 HIS E CD2 1 
ATOM   9752  C CE1 . HIS E 1 221 ? 36.356  40.921  -21.029 1.00 94.16  ? 219 HIS E CE1 1 
ATOM   9753  N NE2 . HIS E 1 221 ? 35.497  40.031  -20.556 1.00 95.16  ? 219 HIS E NE2 1 
ATOM   9754  N N   . SER E 1 222 ? 32.752  46.256  -19.357 1.00 74.95  ? 220 SER E N   1 
ATOM   9755  C CA  . SER E 1 222 ? 32.633  47.572  -19.936 1.00 80.71  ? 220 SER E CA  1 
ATOM   9756  C C   . SER E 1 222 ? 32.603  48.662  -18.935 1.00 81.87  ? 220 SER E C   1 
ATOM   9757  O O   . SER E 1 222 ? 32.718  49.847  -19.271 1.00 78.71  ? 220 SER E O   1 
ATOM   9758  C CB  . SER E 1 222 ? 31.337  47.637  -20.698 1.00 85.27  ? 220 SER E CB  1 
ATOM   9759  O OG  . SER E 1 222 ? 30.273  47.476  -19.771 1.00 89.08  ? 220 SER E OG  1 
ATOM   9760  N N   . GLU E 1 223 ? 32.427  48.242  -17.697 1.00 87.12  ? 221 GLU E N   1 
ATOM   9761  C CA  . GLU E 1 223 ? 32.268  49.179  -16.612 1.00 91.82  ? 221 GLU E CA  1 
ATOM   9762  C C   . GLU E 1 223 ? 30.862  49.696  -16.948 1.00 88.20  ? 221 GLU E C   1 
ATOM   9763  O O   . GLU E 1 223 ? 29.853  49.211  -16.408 1.00 84.80  ? 221 GLU E O   1 
ATOM   9764  C CB  . GLU E 1 223 ? 33.304  50.285  -16.715 1.00 96.95  ? 221 GLU E CB  1 
ATOM   9765  C CG  . GLU E 1 223 ? 34.714  49.777  -16.553 1.00 103.25 ? 221 GLU E CG  1 
ATOM   9766  C CD  . GLU E 1 223 ? 35.684  50.907  -16.379 1.00 109.15 ? 221 GLU E CD  1 
ATOM   9767  O OE1 . GLU E 1 223 ? 35.378  51.842  -15.594 1.00 111.08 ? 221 GLU E OE1 1 
ATOM   9768  O OE2 . GLU E 1 223 ? 36.754  50.859  -17.019 1.00 113.10 ? 221 GLU E OE2 1 
ATOM   9769  N N   . GLN E 1 224 ? 30.819  50.631  -17.896 1.00 83.38  ? 222 GLN E N   1 
ATOM   9770  C CA  . GLN E 1 224 ? 29.575  51.207  -18.399 1.00 77.18  ? 222 GLN E CA  1 
ATOM   9771  C C   . GLN E 1 224 ? 28.545  51.566  -17.354 1.00 70.27  ? 222 GLN E C   1 
ATOM   9772  O O   . GLN E 1 224 ? 27.905  52.612  -17.440 1.00 70.07  ? 222 GLN E O   1 
ATOM   9773  C CB  . GLN E 1 224 ? 28.945  50.255  -19.411 1.00 82.61  ? 222 GLN E CB  1 
ATOM   9774  C CG  . GLN E 1 224 ? 29.746  50.152  -20.692 1.00 86.92  ? 222 GLN E CG  1 
ATOM   9775  C CD  . GLN E 1 224 ? 29.953  51.490  -21.322 1.00 93.99  ? 222 GLN E CD  1 
ATOM   9776  O OE1 . GLN E 1 224 ? 28.977  52.192  -21.647 1.00 94.24  ? 222 GLN E OE1 1 
ATOM   9777  N NE2 . GLN E 1 224 ? 31.227  51.879  -21.496 1.00 96.35  ? 222 GLN E NE2 1 
ATOM   9778  N N   . HIS E 1 225 ? 28.404  50.693  -16.371 1.00 61.81  ? 223 HIS E N   1 
ATOM   9779  C CA  . HIS E 1 225 ? 27.471  50.859  -15.288 1.00 55.93  ? 223 HIS E CA  1 
ATOM   9780  C C   . HIS E 1 225 ? 26.235  50.079  -15.708 1.00 55.72  ? 223 HIS E C   1 
ATOM   9781  O O   . HIS E 1 225 ? 25.659  50.322  -16.758 1.00 55.74  ? 223 HIS E O   1 
ATOM   9782  C CB  . HIS E 1 225 ? 27.120  52.323  -15.054 1.00 47.60  ? 223 HIS E CB  1 
ATOM   9783  C CG  . HIS E 1 225 ? 26.191  52.502  -13.917 1.00 43.76  ? 223 HIS E CG  1 
ATOM   9784  N ND1 . HIS E 1 225 ? 25.104  51.681  -13.749 1.00 45.76  ? 223 HIS E ND1 1 
ATOM   9785  C CD2 . HIS E 1 225 ? 26.239  53.295  -12.826 1.00 44.39  ? 223 HIS E CD2 1 
ATOM   9786  C CE1 . HIS E 1 225 ? 24.524  51.952  -12.595 1.00 46.35  ? 223 HIS E CE1 1 
ATOM   9787  N NE2 . HIS E 1 225 ? 25.192  52.929  -12.015 1.00 45.94  ? 223 HIS E NE2 1 
ATOM   9788  N N   . PRO E 1 226 ? 25.828  49.113  -14.894 1.00 53.82  ? 224 PRO E N   1 
ATOM   9789  C CA  . PRO E 1 226 ? 24.679  48.248  -15.111 1.00 56.34  ? 224 PRO E CA  1 
ATOM   9790  C C   . PRO E 1 226 ? 23.528  48.909  -15.849 1.00 56.87  ? 224 PRO E C   1 
ATOM   9791  O O   . PRO E 1 226 ? 22.996  48.363  -16.828 1.00 59.70  ? 224 PRO E O   1 
ATOM   9792  C CB  . PRO E 1 226 ? 24.276  47.868  -13.687 1.00 59.48  ? 224 PRO E CB  1 
ATOM   9793  C CG  . PRO E 1 226 ? 25.545  47.800  -12.993 1.00 59.59  ? 224 PRO E CG  1 
ATOM   9794  C CD  . PRO E 1 226 ? 26.244  49.044  -13.486 1.00 59.43  ? 224 PRO E CD  1 
ATOM   9795  N N   . GLY E 1 227 ? 23.139  50.078  -15.347 1.00 53.56  ? 225 GLY E N   1 
ATOM   9796  C CA  . GLY E 1 227 ? 22.031  50.819  -15.926 1.00 57.40  ? 225 GLY E CA  1 
ATOM   9797  C C   . GLY E 1 227 ? 22.234  51.256  -17.374 1.00 59.96  ? 225 GLY E C   1 
ATOM   9798  O O   . GLY E 1 227 ? 21.348  51.093  -18.217 1.00 58.63  ? 225 GLY E O   1 
ATOM   9799  N N   . GLN E 1 228 ? 23.391  51.833  -17.669 1.00 61.01  ? 226 GLN E N   1 
ATOM   9800  C CA  . GLN E 1 228 ? 23.664  52.260  -19.019 1.00 62.70  ? 226 GLN E CA  1 
ATOM   9801  C C   . GLN E 1 228 ? 23.295  51.120  -19.971 1.00 60.69  ? 226 GLN E C   1 
ATOM   9802  O O   . GLN E 1 228 ? 22.557  51.313  -20.944 1.00 63.61  ? 226 GLN E O   1 
ATOM   9803  C CB  . GLN E 1 228 ? 25.142  52.626  -19.134 1.00 66.84  ? 226 GLN E CB  1 
ATOM   9804  C CG  . GLN E 1 228 ? 25.614  52.952  -20.535 1.00 72.78  ? 226 GLN E CG  1 
ATOM   9805  C CD  . GLN E 1 228 ? 24.869  54.120  -21.179 1.00 76.42  ? 226 GLN E CD  1 
ATOM   9806  O OE1 . GLN E 1 228 ? 24.865  54.251  -22.405 1.00 81.99  ? 226 GLN E OE1 1 
ATOM   9807  N NE2 . GLN E 1 228 ? 24.250  54.975  -20.364 1.00 76.34  ? 226 GLN E NE2 1 
ATOM   9808  N N   . LEU E 1 229 ? 23.793  49.927  -19.657 1.00 58.02  ? 227 LEU E N   1 
ATOM   9809  C CA  . LEU E 1 229 ? 23.549  48.724  -20.444 1.00 52.64  ? 227 LEU E CA  1 
ATOM   9810  C C   . LEU E 1 229 ? 22.075  48.400  -20.572 1.00 51.02  ? 227 LEU E C   1 
ATOM   9811  O O   . LEU E 1 229 ? 21.633  48.029  -21.653 1.00 55.24  ? 227 LEU E O   1 
ATOM   9812  C CB  . LEU E 1 229 ? 24.301  47.548  -19.820 1.00 51.62  ? 227 LEU E CB  1 
ATOM   9813  C CG  . LEU E 1 229 ? 25.818  47.768  -19.828 1.00 50.26  ? 227 LEU E CG  1 
ATOM   9814  C CD1 . LEU E 1 229 ? 26.540  46.495  -19.548 1.00 43.69  ? 227 LEU E CD1 1 
ATOM   9815  C CD2 . LEU E 1 229 ? 26.243  48.275  -21.188 1.00 53.32  ? 227 LEU E CD2 1 
ATOM   9816  N N   . LYS E 1 230 ? 21.331  48.553  -19.478 1.00 48.52  ? 228 LYS E N   1 
ATOM   9817  C CA  . LYS E 1 230 ? 19.901  48.285  -19.454 1.00 49.80  ? 228 LYS E CA  1 
ATOM   9818  C C   . LYS E 1 230 ? 19.184  49.276  -20.387 1.00 52.81  ? 228 LYS E C   1 
ATOM   9819  O O   . LYS E 1 230 ? 18.072  49.029  -20.868 1.00 55.89  ? 228 LYS E O   1 
ATOM   9820  C CB  . LYS E 1 230 ? 19.387  48.340  -17.983 1.00 46.63  ? 228 LYS E CB  1 
ATOM   9821  C CG  . LYS E 1 230 ? 18.002  49.028  -17.706 1.00 48.63  ? 228 LYS E CG  1 
ATOM   9822  C CD  . LYS E 1 230 ? 17.558  48.995  -16.216 1.00 38.18  ? 228 LYS E CD  1 
ATOM   9823  C CE  . LYS E 1 230 ? 16.073  49.361  -16.032 1.00 46.56  ? 228 LYS E CE  1 
ATOM   9824  N NZ  . LYS E 1 230 ? 15.564  49.139  -14.632 1.00 41.94  ? 228 LYS E NZ  1 
ATOM   9825  N N   . ASP E 1 231 ? 19.820  50.400  -20.665 1.00 53.36  ? 229 ASP E N   1 
ATOM   9826  C CA  . ASP E 1 231 ? 19.190  51.351  -21.556 1.00 54.87  ? 229 ASP E CA  1 
ATOM   9827  C C   . ASP E 1 231 ? 19.423  50.791  -22.954 1.00 54.14  ? 229 ASP E C   1 
ATOM   9828  O O   . ASP E 1 231 ? 18.489  50.491  -23.680 1.00 55.91  ? 229 ASP E O   1 
ATOM   9829  C CB  . ASP E 1 231 ? 19.833  52.735  -21.378 1.00 57.77  ? 229 ASP E CB  1 
ATOM   9830  C CG  . ASP E 1 231 ? 19.534  53.354  -19.986 1.00 61.30  ? 229 ASP E CG  1 
ATOM   9831  O OD1 . ASP E 1 231 ? 18.654  52.831  -19.253 1.00 63.97  ? 229 ASP E OD1 1 
ATOM   9832  O OD2 . ASP E 1 231 ? 20.159  54.376  -19.626 1.00 59.95  ? 229 ASP E OD2 1 
ATOM   9833  N N   . ASN E 1 232 ? 20.682  50.606  -23.300 1.00 48.85  ? 230 ASN E N   1 
ATOM   9834  C CA  . ASN E 1 232 ? 21.042  50.080  -24.595 1.00 53.67  ? 230 ASN E CA  1 
ATOM   9835  C C   . ASN E 1 232 ? 20.343  48.821  -25.088 1.00 57.85  ? 230 ASN E C   1 
ATOM   9836  O O   . ASN E 1 232 ? 20.432  48.451  -26.262 1.00 61.20  ? 230 ASN E O   1 
ATOM   9837  C CB  . ASN E 1 232 ? 22.519  49.824  -24.600 1.00 53.34  ? 230 ASN E CB  1 
ATOM   9838  C CG  . ASN E 1 232 ? 23.293  51.088  -24.656 1.00 60.84  ? 230 ASN E CG  1 
ATOM   9839  O OD1 . ASN E 1 232 ? 22.800  52.137  -24.230 1.00 65.64  ? 230 ASN E OD1 1 
ATOM   9840  N ND2 . ASN E 1 232 ? 24.518  51.021  -25.179 1.00 67.41  ? 230 ASN E ND2 1 
ATOM   9841  N N   . VAL E 1 233 ? 19.660  48.141  -24.198 1.00 60.21  ? 231 VAL E N   1 
ATOM   9842  C CA  . VAL E 1 233 ? 19.026  46.903  -24.587 1.00 64.59  ? 231 VAL E CA  1 
ATOM   9843  C C   . VAL E 1 233 ? 17.527  47.070  -24.670 1.00 64.64  ? 231 VAL E C   1 
ATOM   9844  O O   . VAL E 1 233 ? 16.799  46.143  -25.036 1.00 62.69  ? 231 VAL E O   1 
ATOM   9845  C CB  . VAL E 1 233 ? 19.394  45.783  -23.574 1.00 71.86  ? 231 VAL E CB  1 
ATOM   9846  C CG1 . VAL E 1 233 ? 18.883  44.430  -24.070 1.00 74.89  ? 231 VAL E CG1 1 
ATOM   9847  C CG2 . VAL E 1 233 ? 20.927  45.755  -23.352 1.00 73.02  ? 231 VAL E CG2 1 
ATOM   9848  N N   . SER E 1 234 ? 17.064  48.264  -24.333 1.00 65.02  ? 232 SER E N   1 
ATOM   9849  C CA  . SER E 1 234 ? 15.641  48.550  -24.388 1.00 65.79  ? 232 SER E CA  1 
ATOM   9850  C C   . SER E 1 234 ? 15.367  49.428  -25.604 1.00 66.36  ? 232 SER E C   1 
ATOM   9851  O O   . SER E 1 234 ? 16.278  50.021  -26.172 1.00 70.01  ? 232 SER E O   1 
ATOM   9852  C CB  . SER E 1 234 ? 15.204  49.256  -23.114 1.00 67.31  ? 232 SER E CB  1 
ATOM   9853  O OG  . SER E 1 234 ? 13.798  49.192  -22.921 1.00 73.36  ? 232 SER E OG  1 
ATOM   9854  N N   . SER E 1 235 ? 14.108  49.497  -26.008 1.00 64.24  ? 233 SER E N   1 
ATOM   9855  C CA  . SER E 1 235 ? 13.704  50.282  -27.161 1.00 58.87  ? 233 SER E CA  1 
ATOM   9856  C C   . SER E 1 235 ? 12.486  51.120  -26.807 1.00 55.10  ? 233 SER E C   1 
ATOM   9857  O O   . SER E 1 235 ? 11.505  50.612  -26.258 1.00 55.65  ? 233 SER E O   1 
ATOM   9858  C CB  . SER E 1 235 ? 13.379  49.364  -28.334 1.00 60.68  ? 233 SER E CB  1 
ATOM   9859  O OG  . SER E 1 235 ? 14.378  49.500  -29.341 1.00 71.41  ? 233 SER E OG  1 
ATOM   9860  N N   . PRO E 1 236 ? 12.515  52.410  -27.169 1.00 51.76  ? 234 PRO E N   1 
ATOM   9861  C CA  . PRO E 1 236 ? 11.490  53.435  -26.945 1.00 49.85  ? 234 PRO E CA  1 
ATOM   9862  C C   . PRO E 1 236 ? 10.096  52.876  -26.949 1.00 50.29  ? 234 PRO E C   1 
ATOM   9863  O O   . PRO E 1 236 ? 9.242   53.284  -26.190 1.00 50.36  ? 234 PRO E O   1 
ATOM   9864  C CB  . PRO E 1 236 ? 11.695  54.381  -28.102 1.00 49.03  ? 234 PRO E CB  1 
ATOM   9865  C CG  . PRO E 1 236 ? 13.161  54.330  -28.309 1.00 54.91  ? 234 PRO E CG  1 
ATOM   9866  C CD  . PRO E 1 236 ? 13.454  52.850  -28.214 1.00 53.26  ? 234 PRO E CD  1 
ATOM   9867  N N   . GLY E 1 237 ? 9.878   51.923  -27.837 1.00 53.32  ? 235 GLY E N   1 
ATOM   9868  C CA  . GLY E 1 237 ? 8.577   51.318  -27.974 1.00 51.46  ? 235 GLY E CA  1 
ATOM   9869  C C   . GLY E 1 237 ? 8.177   50.502  -26.788 1.00 48.75  ? 235 GLY E C   1 
ATOM   9870  O O   . GLY E 1 237 ? 7.212   50.843  -26.116 1.00 49.97  ? 235 GLY E O   1 
ATOM   9871  N N   . GLY E 1 238 ? 8.890   49.404  -26.550 1.00 50.56  ? 236 GLY E N   1 
ATOM   9872  C CA  . GLY E 1 238 ? 8.558   48.521  -25.439 1.00 53.93  ? 236 GLY E CA  1 
ATOM   9873  C C   . GLY E 1 238 ? 9.101   47.091  -25.551 1.00 55.86  ? 236 GLY E C   1 
ATOM   9874  O O   . GLY E 1 238 ? 10.180  46.859  -26.130 1.00 56.14  ? 236 GLY E O   1 
ATOM   9875  N N   . ALA E 1 239 ? 8.328   46.130  -25.020 1.00 55.74  ? 237 ALA E N   1 
ATOM   9876  C CA  . ALA E 1 239 ? 8.680   44.697  -24.982 1.00 53.19  ? 237 ALA E CA  1 
ATOM   9877  C C   . ALA E 1 239 ? 9.528   44.538  -23.716 1.00 53.58  ? 237 ALA E C   1 
ATOM   9878  O O   . ALA E 1 239 ? 9.033   44.054  -22.691 1.00 53.79  ? 237 ALA E O   1 
ATOM   9879  C CB  . ALA E 1 239 ? 9.479   44.300  -26.219 1.00 54.99  ? 237 ALA E CB  1 
ATOM   9880  N N   . THR E 1 240 ? 10.786  44.981  -23.798 1.00 52.44  ? 238 THR E N   1 
ATOM   9881  C CA  . THR E 1 240 ? 11.729  44.954  -22.684 1.00 53.23  ? 238 THR E CA  1 
ATOM   9882  C C   . THR E 1 240 ? 11.327  45.959  -21.594 1.00 54.55  ? 238 THR E C   1 
ATOM   9883  O O   . THR E 1 240 ? 11.095  45.588  -20.438 1.00 54.04  ? 238 THR E O   1 
ATOM   9884  C CB  . THR E 1 240 ? 13.145  45.308  -23.160 1.00 52.57  ? 238 THR E CB  1 
ATOM   9885  O OG1 . THR E 1 240 ? 13.538  44.394  -24.197 1.00 53.15  ? 238 THR E OG1 1 
ATOM   9886  C CG2 . THR E 1 240 ? 14.131  45.265  -21.993 1.00 47.38  ? 238 THR E CG2 1 
ATOM   9887  N N   . ILE E 1 241 ? 11.220  47.227  -21.986 1.00 56.03  ? 239 ILE E N   1 
ATOM   9888  C CA  . ILE E 1 241 ? 10.864  48.303  -21.070 1.00 56.66  ? 239 ILE E CA  1 
ATOM   9889  C C   . ILE E 1 241 ? 9.527   48.036  -20.409 1.00 56.72  ? 239 ILE E C   1 
ATOM   9890  O O   . ILE E 1 241 ? 9.282   48.463  -19.278 1.00 58.72  ? 239 ILE E O   1 
ATOM   9891  C CB  . ILE E 1 241 ? 10.795  49.657  -21.765 1.00 54.31  ? 239 ILE E CB  1 
ATOM   9892  C CG1 . ILE E 1 241 ? 10.923  50.759  -20.716 1.00 56.37  ? 239 ILE E CG1 1 
ATOM   9893  C CG2 . ILE E 1 241 ? 9.473   49.822  -22.490 1.00 48.35  ? 239 ILE E CG2 1 
ATOM   9894  C CD1 . ILE E 1 241 ? 10.964  52.137  -21.313 1.00 65.08  ? 239 ILE E CD1 1 
ATOM   9895  N N   . HIS E 1 242 ? 8.653   47.337  -21.115 1.00 53.77  ? 240 HIS E N   1 
ATOM   9896  C CA  . HIS E 1 242 ? 7.372   46.965  -20.546 1.00 53.13  ? 240 HIS E CA  1 
ATOM   9897  C C   . HIS E 1 242 ? 7.652   45.919  -19.481 1.00 49.91  ? 240 HIS E C   1 
ATOM   9898  O O   . HIS E 1 242 ? 7.133   45.995  -18.352 1.00 46.55  ? 240 HIS E O   1 
ATOM   9899  C CB  . HIS E 1 242 ? 6.501   46.349  -21.620 1.00 56.96  ? 240 HIS E CB  1 
ATOM   9900  C CG  . HIS E 1 242 ? 5.483   47.289  -22.153 1.00 62.51  ? 240 HIS E CG  1 
ATOM   9901  N ND1 . HIS E 1 242 ? 4.277   47.504  -21.526 1.00 66.44  ? 240 HIS E ND1 1 
ATOM   9902  C CD2 . HIS E 1 242 ? 5.535   48.148  -23.196 1.00 64.72  ? 240 HIS E CD2 1 
ATOM   9903  C CE1 . HIS E 1 242 ? 3.624   48.463  -22.163 1.00 69.09  ? 240 HIS E CE1 1 
ATOM   9904  N NE2 . HIS E 1 242 ? 4.366   48.870  -23.178 1.00 67.83  ? 240 HIS E NE2 1 
ATOM   9905  N N   . ALA E 1 243 ? 8.455   44.928  -19.874 1.00 43.86  ? 241 ALA E N   1 
ATOM   9906  C CA  . ALA E 1 243 ? 8.820   43.853  -18.985 1.00 37.48  ? 241 ALA E CA  1 
ATOM   9907  C C   . ALA E 1 243 ? 9.468   44.480  -17.742 1.00 35.20  ? 241 ALA E C   1 
ATOM   9908  O O   . ALA E 1 243 ? 9.000   44.221  -16.642 1.00 27.03  ? 241 ALA E O   1 
ATOM   9909  C CB  . ALA E 1 243 ? 9.759   42.930  -19.678 1.00 33.88  ? 241 ALA E CB  1 
ATOM   9910  N N   . LEU E 1 244 ? 10.520  45.293  -17.913 1.00 30.91  ? 242 LEU E N   1 
ATOM   9911  C CA  . LEU E 1 244 ? 11.155  45.969  -16.770 1.00 24.43  ? 242 LEU E CA  1 
ATOM   9912  C C   . LEU E 1 244 ? 10.134  46.655  -15.893 1.00 27.44  ? 242 LEU E C   1 
ATOM   9913  O O   . LEU E 1 244 ? 10.044  46.382  -14.711 1.00 33.50  ? 242 LEU E O   1 
ATOM   9914  C CB  . LEU E 1 244 ? 12.113  47.028  -17.223 1.00 10.17  ? 242 LEU E CB  1 
ATOM   9915  C CG  . LEU E 1 244 ? 13.337  46.399  -17.851 1.00 22.27  ? 242 LEU E CG  1 
ATOM   9916  C CD1 . LEU E 1 244 ? 14.290  47.511  -18.132 1.00 15.88  ? 242 LEU E CD1 1 
ATOM   9917  C CD2 . LEU E 1 244 ? 14.026  45.315  -16.938 1.00 21.89  ? 242 LEU E CD2 1 
ATOM   9918  N N   . HIS E 1 245 ? 9.355   47.550  -16.464 1.00 27.56  ? 243 HIS E N   1 
ATOM   9919  C CA  . HIS E 1 245 ? 8.361   48.247  -15.677 1.00 31.38  ? 243 HIS E CA  1 
ATOM   9920  C C   . HIS E 1 245 ? 7.621   47.294  -14.779 1.00 30.25  ? 243 HIS E C   1 
ATOM   9921  O O   . HIS E 1 245 ? 7.126   47.689  -13.712 1.00 29.50  ? 243 HIS E O   1 
ATOM   9922  C CB  . HIS E 1 245 ? 7.342   48.983  -16.579 1.00 39.54  ? 243 HIS E CB  1 
ATOM   9923  C CG  . HIS E 1 245 ? 6.304   49.788  -15.823 1.00 45.66  ? 243 HIS E CG  1 
ATOM   9924  N ND1 . HIS E 1 245 ? 6.612   50.907  -15.072 1.00 47.54  ? 243 HIS E ND1 1 
ATOM   9925  C CD2 . HIS E 1 245 ? 4.958   49.649  -15.740 1.00 47.12  ? 243 HIS E CD2 1 
ATOM   9926  C CE1 . HIS E 1 245 ? 5.504   51.425  -14.568 1.00 45.01  ? 243 HIS E CE1 1 
ATOM   9927  N NE2 . HIS E 1 245 ? 4.488   50.684  -14.958 1.00 47.35  ? 243 HIS E NE2 1 
ATOM   9928  N N   . VAL E 1 246 ? 7.498   46.039  -15.188 1.00 31.65  ? 244 VAL E N   1 
ATOM   9929  C CA  . VAL E 1 246 ? 6.756   45.122  -14.318 1.00 35.80  ? 244 VAL E CA  1 
ATOM   9930  C C   . VAL E 1 246 ? 7.634   44.617  -13.158 1.00 33.73  ? 244 VAL E C   1 
ATOM   9931  O O   . VAL E 1 246 ? 7.126   44.250  -12.092 1.00 33.75  ? 244 VAL E O   1 
ATOM   9932  C CB  . VAL E 1 246 ? 6.185   43.895  -15.080 1.00 37.72  ? 244 VAL E CB  1 
ATOM   9933  C CG1 . VAL E 1 246 ? 7.269   42.812  -15.314 1.00 40.27  ? 244 VAL E CG1 1 
ATOM   9934  C CG2 . VAL E 1 246 ? 5.052   43.310  -14.281 1.00 38.50  ? 244 VAL E CG2 1 
ATOM   9935  N N   . LEU E 1 247 ? 8.941   44.565  -13.384 1.00 28.32  ? 245 LEU E N   1 
ATOM   9936  C CA  . LEU E 1 247 ? 9.824   44.143  -12.332 1.00 33.15  ? 245 LEU E CA  1 
ATOM   9937  C C   . LEU E 1 247 ? 9.685   45.241  -11.255 1.00 40.00  ? 245 LEU E C   1 
ATOM   9938  O O   . LEU E 1 247 ? 9.227   45.018  -10.129 1.00 45.40  ? 245 LEU E O   1 
ATOM   9939  C CB  . LEU E 1 247 ? 11.257  44.047  -12.854 1.00 20.20  ? 245 LEU E CB  1 
ATOM   9940  C CG  . LEU E 1 247 ? 11.485  42.843  -13.768 1.00 20.29  ? 245 LEU E CG  1 
ATOM   9941  C CD1 . LEU E 1 247 ? 12.873  42.972  -14.358 1.00 9.61   ? 245 LEU E CD1 1 
ATOM   9942  C CD2 . LEU E 1 247 ? 11.248  41.464  -12.989 1.00 8.39   ? 245 LEU E CD2 1 
ATOM   9943  N N   . GLU E 1 248 ? 10.053  46.448  -11.639 1.00 41.27  ? 246 GLU E N   1 
ATOM   9944  C CA  . GLU E 1 248 ? 9.975   47.606  -10.774 1.00 38.91  ? 246 GLU E CA  1 
ATOM   9945  C C   . GLU E 1 248 ? 8.687   47.650  -9.975  1.00 38.90  ? 246 GLU E C   1 
ATOM   9946  O O   . GLU E 1 248 ? 8.718   48.037  -8.817  1.00 41.98  ? 246 GLU E O   1 
ATOM   9947  C CB  . GLU E 1 248 ? 10.118  48.867  -11.625 1.00 37.16  ? 246 GLU E CB  1 
ATOM   9948  C CG  . GLU E 1 248 ? 11.304  48.771  -12.586 1.00 41.99  ? 246 GLU E CG  1 
ATOM   9949  C CD  . GLU E 1 248 ? 12.636  48.778  -11.895 1.00 47.14  ? 246 GLU E CD  1 
ATOM   9950  O OE1 . GLU E 1 248 ? 13.672  48.736  -12.602 1.00 54.04  ? 246 GLU E OE1 1 
ATOM   9951  O OE2 . GLU E 1 248 ? 12.668  48.834  -10.649 1.00 56.50  ? 246 GLU E OE2 1 
ATOM   9952  N N   . SER E 1 249 ? 7.571   47.217  -10.545 1.00 37.44  ? 247 SER E N   1 
ATOM   9953  C CA  . SER E 1 249 ? 6.317   47.320  -9.815  1.00 41.20  ? 247 SER E CA  1 
ATOM   9954  C C   . SER E 1 249 ? 6.189   46.303  -8.713  1.00 44.83  ? 247 SER E C   1 
ATOM   9955  O O   . SER E 1 249 ? 5.405   46.482  -7.770  1.00 48.98  ? 247 SER E O   1 
ATOM   9956  C CB  . SER E 1 249 ? 5.151   47.218  -10.769 1.00 40.40  ? 247 SER E CB  1 
ATOM   9957  O OG  . SER E 1 249 ? 5.349   48.106  -11.848 1.00 38.64  ? 247 SER E OG  1 
ATOM   9958  N N   . GLY E 1 250 ? 6.995   45.250  -8.816  1.00 48.43  ? 248 GLY E N   1 
ATOM   9959  C CA  . GLY E 1 250 ? 6.992   44.188  -7.820  1.00 49.89  ? 248 GLY E CA  1 
ATOM   9960  C C   . GLY E 1 250 ? 8.057   44.421  -6.771  1.00 52.18  ? 248 GLY E C   1 
ATOM   9961  O O   . GLY E 1 250 ? 8.263   43.616  -5.877  1.00 56.55  ? 248 GLY E O   1 
ATOM   9962  N N   . GLY E 1 251 ? 8.739   45.549  -6.893  1.00 51.55  ? 249 GLY E N   1 
ATOM   9963  C CA  . GLY E 1 251 ? 9.773   45.897  -5.950  1.00 46.84  ? 249 GLY E CA  1 
ATOM   9964  C C   . GLY E 1 251 ? 10.993  45.040  -6.185  1.00 46.35  ? 249 GLY E C   1 
ATOM   9965  O O   . GLY E 1 251 ? 11.833  44.876  -5.285  1.00 49.49  ? 249 GLY E O   1 
ATOM   9966  N N   . PHE E 1 252 ? 11.100  44.512  -7.399  1.00 39.25  ? 250 PHE E N   1 
ATOM   9967  C CA  . PHE E 1 252 ? 12.232  43.662  -7.758  1.00 34.85  ? 250 PHE E CA  1 
ATOM   9968  C C   . PHE E 1 252 ? 13.582  44.068  -7.131  1.00 34.57  ? 250 PHE E C   1 
ATOM   9969  O O   . PHE E 1 252 ? 13.995  43.456  -6.170  1.00 40.17  ? 250 PHE E O   1 
ATOM   9970  C CB  . PHE E 1 252 ? 12.379  43.598  -9.282  1.00 28.85  ? 250 PHE E CB  1 
ATOM   9971  C CG  . PHE E 1 252 ? 13.413  42.591  -9.788  1.00 21.37  ? 250 PHE E CG  1 
ATOM   9972  C CD1 . PHE E 1 252 ? 13.138  41.221  -9.776  1.00 20.51  ? 250 PHE E CD1 1 
ATOM   9973  C CD2 . PHE E 1 252 ? 14.600  43.028  -10.404 1.00 13.15  ? 250 PHE E CD2 1 
ATOM   9974  C CE1 . PHE E 1 252 ? 14.030  40.329  -10.390 1.00 5.79   ? 250 PHE E CE1 1 
ATOM   9975  C CE2 . PHE E 1 252 ? 15.486  42.144  -11.010 1.00 14.98  ? 250 PHE E CE2 1 
ATOM   9976  C CZ  . PHE E 1 252 ? 15.193  40.815  -11.003 1.00 11.65  ? 250 PHE E CZ  1 
ATOM   9977  N N   . ARG E 1 253 ? 14.264  45.100  -7.631  1.00 32.32  ? 251 ARG E N   1 
ATOM   9978  C CA  . ARG E 1 253 ? 15.593  45.425  -7.101  1.00 31.13  ? 251 ARG E CA  1 
ATOM   9979  C C   . ARG E 1 253 ? 15.693  45.429  -5.565  1.00 35.08  ? 251 ARG E C   1 
ATOM   9980  O O   . ARG E 1 253 ? 16.716  45.029  -5.002  1.00 38.55  ? 251 ARG E O   1 
ATOM   9981  C CB  . ARG E 1 253 ? 16.115  46.746  -7.706  1.00 31.69  ? 251 ARG E CB  1 
ATOM   9982  C CG  . ARG E 1 253 ? 15.266  47.979  -7.514  1.00 29.81  ? 251 ARG E CG  1 
ATOM   9983  C CD  . ARG E 1 253 ? 15.417  48.924  -8.712  1.00 39.13  ? 251 ARG E CD  1 
ATOM   9984  N NE  . ARG E 1 253 ? 16.758  48.919  -9.286  1.00 39.45  ? 251 ARG E NE  1 
ATOM   9985  C CZ  . ARG E 1 253 ? 17.056  49.393  -10.491 1.00 38.62  ? 251 ARG E CZ  1 
ATOM   9986  N NH1 . ARG E 1 253 ? 16.115  49.921  -11.268 1.00 35.44  ? 251 ARG E NH1 1 
ATOM   9987  N NH2 . ARG E 1 253 ? 18.305  49.316  -10.927 1.00 35.02  ? 251 ARG E NH2 1 
ATOM   9988  N N   . SER E 1 254 ? 14.629  45.866  -4.894  1.00 35.89  ? 252 SER E N   1 
ATOM   9989  C CA  . SER E 1 254 ? 14.564  45.899  -3.446  1.00 34.01  ? 252 SER E CA  1 
ATOM   9990  C C   . SER E 1 254 ? 14.811  44.513  -2.915  1.00 35.98  ? 252 SER E C   1 
ATOM   9991  O O   . SER E 1 254 ? 15.727  44.297  -2.152  1.00 46.03  ? 252 SER E O   1 
ATOM   9992  C CB  . SER E 1 254 ? 13.179  46.330  -3.011  1.00 37.29  ? 252 SER E CB  1 
ATOM   9993  O OG  . SER E 1 254 ? 12.990  46.007  -1.641  1.00 41.00  ? 252 SER E OG  1 
ATOM   9994  N N   . LEU E 1 255 ? 13.981  43.562  -3.310  1.00 31.98  ? 253 LEU E N   1 
ATOM   9995  C CA  . LEU E 1 255 ? 14.149  42.188  -2.871  1.00 29.11  ? 253 LEU E CA  1 
ATOM   9996  C C   . LEU E 1 255 ? 15.599  41.720  -2.876  1.00 31.11  ? 253 LEU E C   1 
ATOM   9997  O O   . LEU E 1 255 ? 16.065  41.106  -1.932  1.00 24.76  ? 253 LEU E O   1 
ATOM   9998  C CB  . LEU E 1 255 ? 13.382  41.256  -3.781  1.00 31.09  ? 253 LEU E CB  1 
ATOM   9999  C CG  . LEU E 1 255 ? 11.865  41.366  -3.774  1.00 38.29  ? 253 LEU E CG  1 
ATOM   10000 C CD1 . LEU E 1 255 ? 11.328  39.981  -4.229  1.00 41.85  ? 253 LEU E CD1 1 
ATOM   10001 C CD2 . LEU E 1 255 ? 11.323  41.712  -2.373  1.00 41.64  ? 253 LEU E CD2 1 
ATOM   10002 N N   . LEU E 1 256 ? 16.301  41.989  -3.961  1.00 32.17  ? 254 LEU E N   1 
ATOM   10003 C CA  . LEU E 1 256 ? 17.667  41.551  -4.050  1.00 38.21  ? 254 LEU E CA  1 
ATOM   10004 C C   . LEU E 1 256 ? 18.489  42.074  -2.884  1.00 42.38  ? 254 LEU E C   1 
ATOM   10005 O O   . LEU E 1 256 ? 19.205  41.316  -2.165  1.00 42.39  ? 254 LEU E O   1 
ATOM   10006 C CB  . LEU E 1 256 ? 18.264  42.001  -5.373  1.00 40.37  ? 254 LEU E CB  1 
ATOM   10007 C CG  . LEU E 1 256 ? 17.748  41.125  -6.541  1.00 45.38  ? 254 LEU E CG  1 
ATOM   10008 C CD1 . LEU E 1 256 ? 18.494  41.495  -7.869  1.00 46.69  ? 254 LEU E CD1 1 
ATOM   10009 C CD2 . LEU E 1 256 ? 17.941  39.609  -6.192  1.00 39.52  ? 254 LEU E CD2 1 
ATOM   10010 N N   . ILE E 1 257 ? 18.394  43.391  -2.695  1.00 40.54  ? 255 ILE E N   1 
ATOM   10011 C CA  . ILE E 1 257 ? 19.107  44.024  -1.594  1.00 39.28  ? 255 ILE E CA  1 
ATOM   10012 C C   . ILE E 1 257 ? 18.677  43.208  -0.361  1.00 39.84  ? 255 ILE E C   1 
ATOM   10013 O O   . ILE E 1 257 ? 19.476  42.566  0.312   1.00 40.92  ? 255 ILE E O   1 
ATOM   10014 C CB  . ILE E 1 257 ? 18.691  45.473  -1.428  1.00 35.34  ? 255 ILE E CB  1 
ATOM   10015 C CG1 . ILE E 1 257 ? 18.899  46.220  -2.769  1.00 41.78  ? 255 ILE E CG1 1 
ATOM   10016 C CG2 . ILE E 1 257 ? 19.575  46.120  -0.375  1.00 34.61  ? 255 ILE E CG2 1 
ATOM   10017 C CD1 . ILE E 1 257 ? 18.366  47.682  -2.762  1.00 33.18  ? 255 ILE E CD1 1 
ATOM   10018 N N   . ASN E 1 258 ? 17.393  43.229  -0.086  1.00 38.00  ? 256 ASN E N   1 
ATOM   10019 C CA  . ASN E 1 258 ? 16.865  42.459  1.012   1.00 40.14  ? 256 ASN E CA  1 
ATOM   10020 C C   . ASN E 1 258 ? 17.615  41.134  1.247   1.00 42.40  ? 256 ASN E C   1 
ATOM   10021 O O   . ASN E 1 258 ? 17.981  40.836  2.374   1.00 49.48  ? 256 ASN E O   1 
ATOM   10022 C CB  . ASN E 1 258 ? 15.391  42.152  0.752   1.00 40.79  ? 256 ASN E CB  1 
ATOM   10023 C CG  . ASN E 1 258 ? 14.479  43.327  1.076   1.00 46.62  ? 256 ASN E CG  1 
ATOM   10024 O OD1 . ASN E 1 258 ? 14.945  44.472  1.140   1.00 45.80  ? 256 ASN E OD1 1 
ATOM   10025 N ND2 . ASN E 1 258 ? 13.163  43.051  1.289   1.00 43.97  ? 256 ASN E ND2 1 
ATOM   10026 N N   . ALA E 1 259 ? 17.831  40.346  0.197   1.00 40.20  ? 257 ALA E N   1 
ATOM   10027 C CA  . ALA E 1 259 ? 18.489  39.042  0.300   1.00 37.33  ? 257 ALA E CA  1 
ATOM   10028 C C   . ALA E 1 259 ? 19.957  39.142  0.706   1.00 38.85  ? 257 ALA E C   1 
ATOM   10029 O O   . ALA E 1 259 ? 20.404  38.419  1.617   1.00 38.73  ? 257 ALA E O   1 
ATOM   10030 C CB  . ALA E 1 259 ? 18.359  38.298  -1.027  1.00 29.56  ? 257 ALA E CB  1 
ATOM   10031 N N   . VAL E 1 260 ? 20.699  40.031  0.035   1.00 38.21  ? 258 VAL E N   1 
ATOM   10032 C CA  . VAL E 1 260 ? 22.122  40.271  0.311   1.00 35.53  ? 258 VAL E CA  1 
ATOM   10033 C C   . VAL E 1 260 ? 22.229  40.570  1.829   1.00 38.58  ? 258 VAL E C   1 
ATOM   10034 O O   . VAL E 1 260 ? 23.088  40.059  2.524   1.00 41.08  ? 258 VAL E O   1 
ATOM   10035 C CB  . VAL E 1 260 ? 22.640  41.479  -0.559  1.00 32.61  ? 258 VAL E CB  1 
ATOM   10036 C CG1 . VAL E 1 260 ? 23.785  42.197  0.117   1.00 31.04  ? 258 VAL E CG1 1 
ATOM   10037 C CG2 . VAL E 1 260 ? 23.111  40.983  -1.904  1.00 26.59  ? 258 VAL E CG2 1 
ATOM   10038 N N   . GLU E 1 261 ? 21.316  41.378  2.337   1.00 39.13  ? 259 GLU E N   1 
ATOM   10039 C CA  . GLU E 1 261 ? 21.302  41.731  3.739   1.00 40.52  ? 259 GLU E CA  1 
ATOM   10040 C C   . GLU E 1 261 ? 21.157  40.457  4.529   1.00 41.64  ? 259 GLU E C   1 
ATOM   10041 O O   . GLU E 1 261 ? 22.056  40.021  5.207   1.00 44.62  ? 259 GLU E O   1 
ATOM   10042 C CB  . GLU E 1 261 ? 20.100  42.633  4.033   1.00 40.40  ? 259 GLU E CB  1 
ATOM   10043 C CG  . GLU E 1 261 ? 20.392  43.807  4.931   1.00 40.51  ? 259 GLU E CG  1 
ATOM   10044 C CD  . GLU E 1 261 ? 19.160  44.629  5.288   1.00 42.60  ? 259 GLU E CD  1 
ATOM   10045 O OE1 . GLU E 1 261 ? 19.303  45.642  6.001   1.00 55.09  ? 259 GLU E OE1 1 
ATOM   10046 O OE2 . GLU E 1 261 ? 18.044  44.275  4.881   1.00 38.51  ? 259 GLU E OE2 1 
ATOM   10047 N N   . ALA E 1 262 ? 19.987  39.868  4.456   1.00 43.13  ? 260 ALA E N   1 
ATOM   10048 C CA  . ALA E 1 262 ? 19.708  38.639  5.177   1.00 46.25  ? 260 ALA E CA  1 
ATOM   10049 C C   . ALA E 1 262 ? 20.879  37.677  5.156   1.00 49.51  ? 260 ALA E C   1 
ATOM   10050 O O   . ALA E 1 262 ? 21.179  37.025  6.148   1.00 50.47  ? 260 ALA E O   1 
ATOM   10051 C CB  . ALA E 1 262 ? 18.512  37.964  4.559   1.00 47.11  ? 260 ALA E CB  1 
ATOM   10052 N N   . SER E 1 263 ? 21.523  37.559  4.004   1.00 50.37  ? 261 SER E N   1 
ATOM   10053 C CA  . SER E 1 263 ? 22.638  36.634  3.895   1.00 49.11  ? 261 SER E CA  1 
ATOM   10054 C C   . SER E 1 263 ? 23.712  37.058  4.846   1.00 48.63  ? 261 SER E C   1 
ATOM   10055 O O   . SER E 1 263 ? 24.138  36.276  5.692   1.00 47.31  ? 261 SER E O   1 
ATOM   10056 C CB  . SER E 1 263 ? 23.200  36.622  2.484   1.00 53.82  ? 261 SER E CB  1 
ATOM   10057 O OG  . SER E 1 263 ? 24.383  35.845  2.433   1.00 58.32  ? 261 SER E OG  1 
ATOM   10058 N N   . CYS E 1 264 ? 24.118  38.322  4.692   1.00 50.75  ? 262 CYS E N   1 
ATOM   10059 C CA  . CYS E 1 264 ? 25.150  38.993  5.498   1.00 50.09  ? 262 CYS E CA  1 
ATOM   10060 C C   . CYS E 1 264 ? 24.812  38.956  6.990   1.00 49.74  ? 262 CYS E C   1 
ATOM   10061 O O   . CYS E 1 264 ? 25.477  38.286  7.776   1.00 50.85  ? 262 CYS E O   1 
ATOM   10062 C CB  . CYS E 1 264 ? 25.283  40.443  5.050   1.00 51.10  ? 262 CYS E CB  1 
ATOM   10063 S SG  . CYS E 1 264 ? 26.598  41.394  5.848   1.00 60.15  ? 262 CYS E SG  1 
ATOM   10064 N N   . ILE E 1 265 ? 23.772  39.673  7.379   1.00 48.14  ? 263 ILE E N   1 
ATOM   10065 C CA  . ILE E 1 265 ? 23.347  39.661  8.765   1.00 44.22  ? 263 ILE E CA  1 
ATOM   10066 C C   . ILE E 1 265 ? 23.459  38.269  9.356   1.00 42.96  ? 263 ILE E C   1 
ATOM   10067 O O   . ILE E 1 265 ? 24.191  38.052  10.307  1.00 45.62  ? 263 ILE E O   1 
ATOM   10068 C CB  . ILE E 1 265 ? 21.912  40.119  8.883   1.00 42.08  ? 263 ILE E CB  1 
ATOM   10069 C CG1 . ILE E 1 265 ? 21.854  41.600  8.529   1.00 38.83  ? 263 ILE E CG1 1 
ATOM   10070 C CG2 . ILE E 1 265 ? 21.340  39.732  10.264  1.00 39.15  ? 263 ILE E CG2 1 
ATOM   10071 C CD1 . ILE E 1 265 ? 20.616  42.330  9.075   1.00 48.53  ? 263 ILE E CD1 1 
ATOM   10072 N N   . ARG E 1 266 ? 22.742  37.312  8.786   1.00 46.70  ? 264 ARG E N   1 
ATOM   10073 C CA  . ARG E 1 266 ? 22.811  35.941  9.289   1.00 49.60  ? 264 ARG E CA  1 
ATOM   10074 C C   . ARG E 1 266 ? 24.220  35.412  9.381   1.00 49.86  ? 264 ARG E C   1 
ATOM   10075 O O   . ARG E 1 266 ? 24.548  34.717  10.304  1.00 49.54  ? 264 ARG E O   1 
ATOM   10076 C CB  . ARG E 1 266 ? 22.048  34.969  8.413   1.00 51.32  ? 264 ARG E CB  1 
ATOM   10077 C CG  . ARG E 1 266 ? 22.166  33.555  8.939   1.00 51.30  ? 264 ARG E CG  1 
ATOM   10078 C CD  . ARG E 1 266 ? 21.536  33.475  10.318  1.00 52.20  ? 264 ARG E CD  1 
ATOM   10079 N NE  . ARG E 1 266 ? 21.589  32.121  10.862  1.00 54.86  ? 264 ARG E NE  1 
ATOM   10080 C CZ  . ARG E 1 266 ? 21.018  31.738  12.002  1.00 57.32  ? 264 ARG E CZ  1 
ATOM   10081 N NH1 . ARG E 1 266 ? 20.336  32.596  12.756  1.00 53.82  ? 264 ARG E NH1 1 
ATOM   10082 N NH2 . ARG E 1 266 ? 21.124  30.475  12.381  1.00 65.49  ? 264 ARG E NH2 1 
ATOM   10083 N N   . THR E 1 267 ? 25.057  35.707  8.407   1.00 52.95  ? 265 THR E N   1 
ATOM   10084 C CA  . THR E 1 267 ? 26.410  35.214  8.485   1.00 55.61  ? 265 THR E CA  1 
ATOM   10085 C C   . THR E 1 267 ? 27.036  35.814  9.726   1.00 58.63  ? 265 THR E C   1 
ATOM   10086 O O   . THR E 1 267 ? 27.867  35.175  10.377  1.00 64.98  ? 265 THR E O   1 
ATOM   10087 C CB  . THR E 1 267 ? 27.215  35.579  7.225   1.00 55.23  ? 265 THR E CB  1 
ATOM   10088 O OG1 . THR E 1 267 ? 26.769  34.775  6.119   1.00 64.32  ? 265 THR E OG1 1 
ATOM   10089 C CG2 . THR E 1 267 ? 28.690  35.315  7.433   1.00 55.30  ? 265 THR E CG2 1 
ATOM   10090 N N   . ARG E 1 268 ? 26.618  37.030  10.076  1.00 59.73  ? 266 ARG E N   1 
ATOM   10091 C CA  . ARG E 1 268 ? 27.137  37.712  11.267  1.00 57.35  ? 266 ARG E CA  1 
ATOM   10092 C C   . ARG E 1 268 ? 26.559  37.162  12.587  1.00 58.57  ? 266 ARG E C   1 
ATOM   10093 O O   . ARG E 1 268 ? 27.293  36.927  13.537  1.00 58.06  ? 266 ARG E O   1 
ATOM   10094 C CB  . ARG E 1 268 ? 26.893  39.218  11.130  1.00 57.09  ? 266 ARG E CB  1 
ATOM   10095 C CG  . ARG E 1 268 ? 28.142  39.915  10.586  1.00 62.39  ? 266 ARG E CG  1 
ATOM   10096 C CD  . ARG E 1 268 ? 27.869  40.983  9.520   1.00 64.73  ? 266 ARG E CD  1 
ATOM   10097 N NE  . ARG E 1 268 ? 27.008  42.085  9.980   1.00 66.50  ? 266 ARG E NE  1 
ATOM   10098 C CZ  . ARG E 1 268 ? 27.071  43.341  9.511   1.00 65.87  ? 266 ARG E CZ  1 
ATOM   10099 N NH1 . ARG E 1 268 ? 27.962  43.672  8.568   1.00 66.48  ? 266 ARG E NH1 1 
ATOM   10100 N NH2 . ARG E 1 268 ? 26.236  44.273  9.969   1.00 58.98  ? 266 ARG E NH2 1 
ATOM   10101 N N   . GLU E 1 269 ? 25.249  36.944  12.638  1.00 61.35  ? 267 GLU E N   1 
ATOM   10102 C CA  . GLU E 1 269 ? 24.602  36.410  13.833  1.00 63.91  ? 267 GLU E CA  1 
ATOM   10103 C C   . GLU E 1 269 ? 25.175  35.061  14.165  1.00 65.89  ? 267 GLU E C   1 
ATOM   10104 O O   . GLU E 1 269 ? 25.100  34.607  15.293  1.00 68.96  ? 267 GLU E O   1 
ATOM   10105 C CB  . GLU E 1 269 ? 23.114  36.164  13.621  1.00 65.65  ? 267 GLU E CB  1 
ATOM   10106 C CG  . GLU E 1 269 ? 22.261  37.320  13.206  1.00 70.53  ? 267 GLU E CG  1 
ATOM   10107 C CD  . GLU E 1 269 ? 20.807  36.906  13.169  1.00 72.87  ? 267 GLU E CD  1 
ATOM   10108 O OE1 . GLU E 1 269 ? 20.539  35.778  12.715  1.00 68.25  ? 267 GLU E OE1 1 
ATOM   10109 O OE2 . GLU E 1 269 ? 19.931  37.696  13.588  1.00 82.99  ? 267 GLU E OE2 1 
ATOM   10110 N N   . LEU E 1 270 ? 25.716  34.389  13.169  1.00 71.26  ? 268 LEU E N   1 
ATOM   10111 C CA  . LEU E 1 270 ? 26.253  33.058  13.396  1.00 79.81  ? 268 LEU E CA  1 
ATOM   10112 C C   . LEU E 1 270 ? 27.611  33.023  14.058  1.00 87.18  ? 268 LEU E C   1 
ATOM   10113 O O   . LEU E 1 270 ? 27.950  32.029  14.708  1.00 89.31  ? 268 LEU E O   1 
ATOM   10114 C CB  . LEU E 1 270 ? 26.323  32.288  12.091  1.00 77.01  ? 268 LEU E CB  1 
ATOM   10115 C CG  . LEU E 1 270 ? 24.969  32.038  11.439  1.00 72.20  ? 268 LEU E CG  1 
ATOM   10116 C CD1 . LEU E 1 270 ? 25.203  31.425  10.074  1.00 73.27  ? 268 LEU E CD1 1 
ATOM   10117 C CD2 . LEU E 1 270 ? 24.109  31.159  12.313  1.00 61.68  ? 268 LEU E CD2 1 
ATOM   10118 N N   . GLN E 1 271 ? 28.398  34.083  13.885  1.00 93.76  ? 269 GLN E N   1 
ATOM   10119 C CA  . GLN E 1 271 ? 29.705  34.123  14.514  1.00 99.81  ? 269 GLN E CA  1 
ATOM   10120 C C   . GLN E 1 271 ? 29.507  34.624  15.925  1.00 103.13 ? 269 GLN E C   1 
ATOM   10121 O O   . GLN E 1 271 ? 30.312  34.365  16.799  1.00 105.64 ? 269 GLN E O   1 
ATOM   10122 C CB  . GLN E 1 271 ? 30.647  35.046  13.776  1.00 101.89 ? 269 GLN E CB  1 
ATOM   10123 C CG  . GLN E 1 271 ? 30.358  36.498  14.000  1.00 112.59 ? 269 GLN E CG  1 
ATOM   10124 C CD  . GLN E 1 271 ? 31.566  37.361  13.705  1.00 121.11 ? 269 GLN E CD  1 
ATOM   10125 O OE1 . GLN E 1 271 ? 32.095  37.351  12.588  1.00 126.06 ? 269 GLN E OE1 1 
ATOM   10126 N NE2 . GLN E 1 271 ? 32.001  38.131  14.699  1.00 124.20 ? 269 GLN E NE2 1 
ATOM   10127 N N   . SER E 1 272 ? 28.420  35.348  16.146  1.00 108.51 ? 270 SER E N   1 
ATOM   10128 C CA  . SER E 1 272 ? 28.124  35.841  17.481  1.00 114.44 ? 270 SER E CA  1 
ATOM   10129 C C   . SER E 1 272 ? 28.035  34.633  18.396  1.00 117.61 ? 270 SER E C   1 
ATOM   10130 O O   . SER E 1 272 ? 28.617  34.617  19.469  1.00 120.77 ? 270 SER E O   1 
ATOM   10131 C CB  . SER E 1 272 ? 26.797  36.610  17.506  1.00 115.93 ? 270 SER E CB  1 
ATOM   10132 O OG  . SER E 1 272 ? 26.838  37.734  16.639  1.00 119.50 ? 270 SER E OG  1 
ATOM   10133 N N   . MET E 1 273 ? 27.327  33.607  17.955  1.00 121.21 ? 271 MET E N   1 
ATOM   10134 C CA  . MET E 1 273 ? 27.177  32.405  18.752  1.00 126.86 ? 271 MET E CA  1 
ATOM   10135 C C   . MET E 1 273 ? 28.439  31.554  18.803  1.00 127.58 ? 271 MET E C   1 
ATOM   10136 O O   . MET E 1 273 ? 28.735  30.948  19.822  1.00 128.96 ? 271 MET E O   1 
ATOM   10137 C CB  . MET E 1 273 ? 26.022  31.581  18.212  1.00 132.69 ? 271 MET E CB  1 
ATOM   10138 C CG  . MET E 1 273 ? 24.774  32.408  17.986  1.00 140.48 ? 271 MET E CG  1 
ATOM   10139 S SD  . MET E 1 273 ? 23.268  31.400  17.941  1.00 152.07 ? 271 MET E SD  1 
ATOM   10140 C CE  . MET E 1 273 ? 22.722  31.593  19.664  1.00 149.44 ? 271 MET E CE  1 
ATOM   10141 N N   . ALA E 1 274 ? 29.187  31.505  17.712  1.00 129.32 ? 272 ALA E N   1 
ATOM   10142 C CA  . ALA E 1 274 ? 30.411  30.710  17.692  1.00 132.39 ? 272 ALA E CA  1 
ATOM   10143 C C   . ALA E 1 274 ? 31.457  31.310  18.634  1.00 134.70 ? 272 ALA E C   1 
ATOM   10144 O O   . ALA E 1 274 ? 32.468  30.676  18.949  1.00 135.53 ? 272 ALA E O   1 
ATOM   10145 C CB  . ALA E 1 274 ? 30.964  30.632  16.269  1.00 132.52 ? 272 ALA E CB  1 
ATOM   10146 N N   . ASP E 1 275 ? 31.202  32.530  19.095  1.00 136.04 ? 273 ASP E N   1 
ATOM   10147 C CA  . ASP E 1 275 ? 32.133  33.209  19.991  1.00 137.75 ? 273 ASP E CA  1 
ATOM   10148 C C   . ASP E 1 275 ? 31.671  33.209  21.446  1.00 139.48 ? 273 ASP E C   1 
ATOM   10149 O O   . ASP E 1 275 ? 31.500  34.278  22.047  1.00 139.09 ? 273 ASP E O   1 
ATOM   10150 C CB  . ASP E 1 275 ? 32.360  34.656  19.533  1.00 137.97 ? 273 ASP E CB  1 
ATOM   10151 C CG  . ASP E 1 275 ? 33.122  34.744  18.225  1.00 139.58 ? 273 ASP E CG  1 
ATOM   10152 O OD1 . ASP E 1 275 ? 34.151  34.039  18.092  1.00 139.51 ? 273 ASP E OD1 1 
ATOM   10153 O OD2 . ASP E 1 275 ? 32.701  35.523  17.334  1.00 141.02 ? 273 ASP E OD2 1 
ATOM   10154 N N   . GLN E 1 276 ? 31.487  32.015  22.012  1.00 141.26 ? 274 GLN E N   1 
ATOM   10155 C CA  . GLN E 1 276 ? 31.038  31.872  23.398  1.00 142.31 ? 274 GLN E CA  1 
ATOM   10156 C C   . GLN E 1 276 ? 30.639  30.419  23.713  1.00 143.56 ? 274 GLN E C   1 
ATOM   10157 O O   . GLN E 1 276 ? 31.473  29.591  24.098  1.00 141.95 ? 274 GLN E O   1 
ATOM   10158 C CB  . GLN E 1 276 ? 29.843  32.817  23.653  1.00 142.09 ? 274 GLN E CB  1 
ATOM   10159 C CG  . GLN E 1 276 ? 28.789  32.827  22.516  1.00 141.83 ? 274 GLN E CG  1 
ATOM   10160 C CD  . GLN E 1 276 ? 27.539  33.684  22.791  1.00 141.99 ? 274 GLN E CD  1 
ATOM   10161 O OE1 . GLN E 1 276 ? 26.767  33.409  23.714  1.00 141.38 ? 274 GLN E OE1 1 
ATOM   10162 N NE2 . GLN E 1 276 ? 27.338  34.718  21.974  1.00 142.47 ? 274 GLN E NE2 1 
ATOM   10163 N N   . GLU E 1 277 ? 29.345  30.146  23.542  1.00 146.15 ? 275 GLU E N   1 
ATOM   10164 C CA  . GLU E 1 277 ? 28.708  28.847  23.780  1.00 148.12 ? 275 GLU E CA  1 
ATOM   10165 C C   . GLU E 1 277 ? 28.900  27.919  22.590  1.00 147.14 ? 275 GLU E C   1 
ATOM   10166 O O   . GLU E 1 277 ? 29.819  28.183  21.779  1.00 146.19 ? 275 GLU E O   1 
ATOM   10167 C CB  . GLU E 1 277 ? 27.199  29.035  24.032  1.00 152.15 ? 275 GLU E CB  1 
ATOM   10168 C CG  . GLU E 1 277 ? 26.457  29.752  22.875  1.00 160.65 ? 275 GLU E CG  1 
ATOM   10169 C CD  . GLU E 1 277 ? 24.994  30.107  23.183  1.00 165.10 ? 275 GLU E CD  1 
ATOM   10170 O OE1 . GLU E 1 277 ? 24.153  29.186  23.318  1.00 168.49 ? 275 GLU E OE1 1 
ATOM   10171 O OE2 . GLU E 1 277 ? 24.680  31.318  23.276  1.00 166.19 ? 275 GLU E OE2 1 
HETATM 10172 O O   . HOH F 2 .   ? -4.638  68.561  -14.652 1.00 22.10  ? 320 HOH A O   1 
HETATM 10173 O O   . HOH F 2 .   ? 50.764  76.868  1.814   1.00 40.41  ? 321 HOH A O   1 
HETATM 10174 O O   . HOH F 2 .   ? 39.942  64.773  4.853   1.00 95.62  ? 322 HOH A O   1 
HETATM 10175 O O   . HOH F 2 .   ? -5.962  53.544  -3.689  1.00 64.19  ? 323 HOH A O   1 
HETATM 10176 O O   . HOH F 2 .   ? 35.863  64.276  24.246  1.00 86.04  ? 324 HOH A O   1 
HETATM 10177 O O   . HOH F 2 .   ? 9.450   56.965  -13.692 1.00 150.65 ? 325 HOH A O   1 
HETATM 10178 O O   . HOH F 2 .   ? 44.481  76.288  17.284  1.00 110.35 ? 326 HOH A O   1 
HETATM 10179 O O   . HOH F 2 .   ? -1.407  59.553  0.334   1.00 37.75  ? 327 HOH A O   1 
HETATM 10180 O O   . HOH F 2 .   ? 17.156  69.566  -14.530 1.00 179.93 ? 328 HOH A O   1 
HETATM 10181 O O   . HOH F 2 .   ? 49.603  78.661  13.748  1.00 66.03  ? 329 HOH A O   1 
HETATM 10182 O O   . HOH F 2 .   ? 30.624  59.903  15.886  1.00 77.79  ? 330 HOH A O   1 
HETATM 10183 O O   . HOH F 2 .   ? 24.715  72.520  -9.201  1.00 114.21 ? 331 HOH A O   1 
HETATM 10184 O O   . HOH F 2 .   ? 52.169  75.588  4.941   1.00 90.39  ? 332 HOH A O   1 
HETATM 10185 O O   . HOH F 2 .   ? 38.908  66.227  -5.214  1.00 178.18 ? 333 HOH A O   1 
HETATM 10186 O O   . HOH F 2 .   ? 48.175  50.249  -2.047  1.00 56.49  ? 334 HOH A O   1 
HETATM 10187 O O   . HOH F 2 .   ? 19.725  57.793  -7.243  1.00 126.81 ? 335 HOH A O   1 
HETATM 10188 O O   . HOH F 2 .   ? 30.702  61.171  5.975   1.00 71.13  ? 336 HOH A O   1 
HETATM 10189 O O   . HOH F 2 .   ? 25.418  64.076  -1.647  1.00 45.93  ? 337 HOH A O   1 
HETATM 10190 O O   . HOH F 2 .   ? 31.038  66.576  10.783  1.00 56.51  ? 338 HOH A O   1 
HETATM 10191 O O   . HOH F 2 .   ? 28.642  64.278  1.160   1.00 53.09  ? 339 HOH A O   1 
HETATM 10192 O O   . HOH F 2 .   ? 2.670   77.229  -4.874  1.00 199.05 ? 340 HOH A O   1 
HETATM 10193 O O   . HOH F 2 .   ? 23.745  58.033  21.796  1.00 74.76  ? 341 HOH A O   1 
HETATM 10194 O O   . HOH F 2 .   ? 33.702  58.118  -2.454  1.00 84.80  ? 342 HOH A O   1 
HETATM 10195 O O   . HOH F 2 .   ? 33.949  59.773  15.456  1.00 53.71  ? 343 HOH A O   1 
HETATM 10196 O O   . HOH F 2 .   ? 35.520  50.108  5.993   1.00 53.64  ? 344 HOH A O   1 
HETATM 10197 O O   . HOH F 2 .   ? 30.929  64.923  20.403  1.00 93.69  ? 345 HOH A O   1 
HETATM 10198 O O   . HOH F 2 .   ? 49.261  71.882  17.714  1.00 137.16 ? 346 HOH A O   1 
HETATM 10199 O O   . HOH F 2 .   ? 34.866  61.169  -0.287  1.00 42.57  ? 347 HOH A O   1 
HETATM 10200 O O   . HOH F 2 .   ? 44.778  47.872  1.216   1.00 72.21  ? 348 HOH A O   1 
HETATM 10201 O O   . HOH F 2 .   ? 2.614   79.320  -10.934 1.00 76.93  ? 349 HOH A O   1 
HETATM 10202 O O   . HOH F 2 .   ? 38.195  80.048  15.088  1.00 111.89 ? 350 HOH A O   1 
HETATM 10203 O O   . HOH F 2 .   ? -4.023  72.979  -18.931 1.00 65.74  ? 351 HOH A O   1 
HETATM 10204 O O   . HOH F 2 .   ? 23.790  66.650  15.097  1.00 50.93  ? 352 HOH A O   1 
HETATM 10205 O O   . HOH F 2 .   ? 29.948  51.103  21.864  1.00 69.34  ? 353 HOH A O   1 
HETATM 10206 O O   . HOH F 2 .   ? 40.508  70.199  18.808  1.00 78.88  ? 354 HOH A O   1 
HETATM 10207 O O   . HOH F 2 .   ? 41.473  79.117  18.542  1.00 101.51 ? 355 HOH A O   1 
HETATM 10208 O O   . HOH F 2 .   ? -2.573  70.074  -16.387 1.00 51.95  ? 356 HOH A O   1 
HETATM 10209 O O   . HOH F 2 .   ? 41.150  63.473  18.367  1.00 65.95  ? 357 HOH A O   1 
HETATM 10210 O O   . HOH F 2 .   ? 31.384  62.587  16.550  1.00 145.33 ? 358 HOH A O   1 
HETATM 10211 O O   . HOH F 2 .   ? 35.005  65.322  8.271   1.00 117.87 ? 359 HOH A O   1 
HETATM 10212 O O   . HOH F 2 .   ? -2.932  75.290  -21.000 1.00 62.78  ? 360 HOH A O   1 
HETATM 10213 O O   . HOH F 2 .   ? 25.368  81.598  -3.433  1.00 88.04  ? 361 HOH A O   1 
HETATM 10214 O O   . HOH F 2 .   ? 39.621  65.874  -12.174 1.00 110.17 ? 362 HOH A O   1 
HETATM 10215 O O   . HOH F 2 .   ? 51.951  75.208  -0.082  1.00 55.15  ? 363 HOH A O   1 
HETATM 10216 O O   . HOH F 2 .   ? 26.548  75.543  -0.887  1.00 60.27  ? 364 HOH A O   1 
HETATM 10217 O O   . HOH F 2 .   ? 42.928  76.864  2.879   1.00 81.20  ? 365 HOH A O   1 
HETATM 10218 O O   . HOH F 2 .   ? 32.756  59.451  24.542  1.00 72.67  ? 366 HOH A O   1 
HETATM 10219 O O   . HOH F 2 .   ? -3.790  53.490  -1.484  1.00 54.82  ? 367 HOH A O   1 
HETATM 10220 O O   . HOH F 2 .   ? 39.040  74.096  7.217   1.00 160.16 ? 368 HOH A O   1 
HETATM 10221 O O   . HOH F 2 .   ? -4.202  64.741  -14.686 1.00 91.11  ? 369 HOH A O   1 
HETATM 10222 O O   . HOH F 2 .   ? 45.353  76.322  -10.568 1.00 77.02  ? 370 HOH A O   1 
HETATM 10223 O O   . HOH F 2 .   ? 30.717  77.301  -8.987  1.00 70.86  ? 371 HOH A O   1 
HETATM 10224 O O   . HOH F 2 .   ? 30.458  70.050  19.950  1.00 86.33  ? 372 HOH A O   1 
HETATM 10225 O O   . HOH F 2 .   ? 27.012  71.231  8.512   1.00 191.89 ? 373 HOH A O   1 
HETATM 10226 O O   . HOH F 2 .   ? 49.700  59.856  5.317   1.00 76.11  ? 374 HOH A O   1 
HETATM 10227 O O   . HOH F 2 .   ? 21.580  71.323  -3.745  1.00 65.36  ? 375 HOH A O   1 
HETATM 10228 O O   . HOH F 2 .   ? -1.968  68.583  -18.729 1.00 51.79  ? 376 HOH A O   1 
HETATM 10229 O O   . HOH F 2 .   ? -0.370  75.699  -21.534 1.00 66.95  ? 377 HOH A O   1 
HETATM 10230 O O   . HOH F 2 .   ? -2.873  72.265  -21.635 1.00 100.29 ? 378 HOH A O   1 
HETATM 10231 O O   . HOH F 2 .   ? 31.384  80.168  -8.710  1.00 107.64 ? 379 HOH A O   1 
HETATM 10232 O O   . HOH F 2 .   ? 25.939  80.354  -6.024  1.00 76.02  ? 380 HOH A O   1 
HETATM 10233 O O   . HOH F 2 .   ? -4.369  50.399  -1.062  1.00 39.72  ? 381 HOH A O   1 
HETATM 10234 O O   . HOH F 2 .   ? 41.639  66.529  23.530  1.00 89.41  ? 382 HOH A O   1 
HETATM 10235 O O   . HOH F 2 .   ? 12.275  55.763  7.780   1.00 40.28  ? 383 HOH A O   1 
HETATM 10236 O O   . HOH F 2 .   ? 30.630  79.837  18.206  1.00 61.09  ? 384 HOH A O   1 
HETATM 10237 O O   . HOH F 2 .   ? 30.165  74.468  19.151  1.00 87.42  ? 385 HOH A O   1 
HETATM 10238 O O   . HOH F 2 .   ? 29.499  66.399  3.809   1.00 68.37  ? 386 HOH A O   1 
HETATM 10239 O O   . HOH F 2 .   ? 2.692   56.610  -8.794  1.00 128.39 ? 387 HOH A O   1 
HETATM 10240 O O   . HOH F 2 .   ? 25.251  53.246  7.298   1.00 56.87  ? 388 HOH A O   1 
HETATM 10241 O O   . HOH F 2 .   ? 25.164  81.834  7.787   1.00 63.29  ? 389 HOH A O   1 
HETATM 10242 O O   . HOH F 2 .   ? 10.431  57.572  2.462   1.00 87.78  ? 390 HOH A O   1 
HETATM 10243 O O   . HOH F 2 .   ? 33.371  63.495  22.294  1.00 74.88  ? 391 HOH A O   1 
HETATM 10244 O O   . HOH F 2 .   ? 28.538  67.814  21.187  1.00 67.96  ? 392 HOH A O   1 
HETATM 10245 O O   . HOH F 2 .   ? 30.066  62.146  19.105  1.00 84.41  ? 393 HOH A O   1 
HETATM 10246 O O   . HOH F 2 .   ? 32.033  60.434  -0.513  1.00 49.60  ? 394 HOH A O   1 
HETATM 10247 O O   . HOH F 2 .   ? 32.633  53.506  15.738  1.00 111.28 ? 395 HOH A O   1 
HETATM 10248 O O   . HOH F 2 .   ? 49.433  78.713  -3.416  1.00 74.65  ? 396 HOH A O   1 
HETATM 10249 O O   . HOH F 2 .   ? 22.182  82.539  7.255   1.00 63.03  ? 397 HOH A O   1 
HETATM 10250 O O   . HOH F 2 .   ? 0.229   69.811  -17.604 1.00 46.43  ? 398 HOH A O   1 
HETATM 10251 O O   . HOH F 2 .   ? 22.614  82.944  4.242   1.00 86.70  ? 399 HOH A O   1 
HETATM 10252 O O   . HOH F 2 .   ? 21.028  63.675  16.660  1.00 63.77  ? 400 HOH A O   1 
HETATM 10253 O O   . HOH F 2 .   ? -6.091  51.938  0.472   1.00 126.19 ? 401 HOH A O   1 
HETATM 10254 O O   . HOH F 2 .   ? 49.414  80.361  16.030  1.00 89.96  ? 402 HOH A O   1 
HETATM 10255 O O   . HOH F 2 .   ? 54.369  73.449  -4.624  1.00 66.40  ? 403 HOH A O   1 
HETATM 10256 O O   . HOH F 2 .   ? -4.802  68.417  -19.902 1.00 54.40  ? 404 HOH A O   1 
HETATM 10257 O O   . HOH F 2 .   ? 16.825  52.276  -16.174 1.00 70.98  ? 405 HOH A O   1 
HETATM 10258 O O   . HOH F 2 .   ? 36.058  75.569  17.269  1.00 90.45  ? 406 HOH A O   1 
HETATM 10259 O O   . HOH F 2 .   ? 45.469  77.077  20.084  1.00 82.50  ? 407 HOH A O   1 
HETATM 10260 O O   . HOH F 2 .   ? 25.541  80.131  14.245  1.00 68.27  ? 408 HOH A O   1 
HETATM 10261 O O   . HOH F 2 .   ? 26.852  77.492  14.281  1.00 77.73  ? 409 HOH A O   1 
HETATM 10262 O O   . HOH F 2 .   ? 22.684  67.401  4.112   1.00 79.25  ? 410 HOH A O   1 
HETATM 10263 O O   . HOH F 2 .   ? 20.202  66.326  17.122  1.00 45.24  ? 411 HOH A O   1 
HETATM 10264 O O   . HOH F 2 .   ? -0.089  71.588  -20.294 1.00 77.58  ? 412 HOH A O   1 
HETATM 10265 O O   . HOH F 2 .   ? 32.390  80.329  21.057  1.00 79.13  ? 413 HOH A O   1 
HETATM 10266 O O   . HOH F 2 .   ? 45.181  79.757  21.250  1.00 73.69  ? 414 HOH A O   1 
HETATM 10267 O O   . HOH F 2 .   ? 52.957  72.852  -1.934  1.00 79.16  ? 415 HOH A O   1 
HETATM 10268 O O   . HOH F 2 .   ? 1.542   69.063  -20.117 1.00 116.31 ? 416 HOH A O   1 
HETATM 10269 O O   . HOH F 2 .   ? 1.857   72.796  -18.417 1.00 65.16  ? 417 HOH A O   1 
HETATM 10270 O O   . HOH F 2 .   ? 33.436  55.745  -6.027  1.00 111.34 ? 418 HOH A O   1 
HETATM 10271 O O   . HOH F 2 .   ? 16.382  62.488  3.290   1.00 62.75  ? 419 HOH A O   1 
HETATM 10272 O O   . HOH F 2 .   ? 37.105  48.135  4.115   1.00 64.52  ? 420 HOH A O   1 
HETATM 10273 O O   . HOH F 2 .   ? -4.531  68.497  -9.323  1.00 150.16 ? 421 HOH A O   1 
HETATM 10274 O O   . HOH F 2 .   ? -5.847  73.688  -9.824  1.00 100.84 ? 422 HOH A O   1 
HETATM 10275 O O   . HOH F 2 .   ? 9.321   68.601  -12.960 1.00 124.77 ? 423 HOH A O   1 
HETATM 10276 O O   . HOH F 2 .   ? 18.011  57.237  -16.637 1.00 100.90 ? 424 HOH A O   1 
HETATM 10277 O O   . HOH F 2 .   ? 51.108  79.594  10.710  1.00 94.06  ? 425 HOH A O   1 
HETATM 10278 O O   . HOH G 2 .   ? -5.396  -4.560  26.281  1.00 75.63  ? 320 HOH B O   1 
HETATM 10279 O O   . HOH G 2 .   ? 7.313   33.636  -6.725  1.00 68.27  ? 321 HOH B O   1 
HETATM 10280 O O   . HOH G 2 .   ? 20.072  8.711   34.284  1.00 69.64  ? 322 HOH B O   1 
HETATM 10281 O O   . HOH G 2 .   ? -2.825  -2.168  12.419  1.00 60.87  ? 323 HOH B O   1 
HETATM 10282 O O   . HOH G 2 .   ? 6.394   11.850  25.987  1.00 86.05  ? 324 HOH B O   1 
HETATM 10283 O O   . HOH G 2 .   ? 1.850   8.617   28.565  1.00 141.11 ? 325 HOH B O   1 
HETATM 10284 O O   . HOH G 2 .   ? 11.868  21.170  22.520  1.00 68.71  ? 326 HOH B O   1 
HETATM 10285 O O   . HOH G 2 .   ? 4.694   12.568  38.636  1.00 102.64 ? 327 HOH B O   1 
HETATM 10286 O O   . HOH G 2 .   ? 1.128   5.545   10.029  1.00 103.24 ? 328 HOH B O   1 
HETATM 10287 O O   . HOH G 2 .   ? 5.835   31.404  -4.208  1.00 57.42  ? 329 HOH B O   1 
HETATM 10288 O O   . HOH G 2 .   ? 17.041  11.393  14.951  1.00 47.38  ? 330 HOH B O   1 
HETATM 10289 O O   . HOH G 2 .   ? 15.135  9.824   33.988  1.00 138.92 ? 331 HOH B O   1 
HETATM 10290 O O   . HOH G 2 .   ? 19.270  2.198   37.015  1.00 74.65  ? 332 HOH B O   1 
HETATM 10291 O O   . HOH G 2 .   ? 0.899   -9.401  21.106  1.00 133.60 ? 333 HOH B O   1 
HETATM 10292 O O   . HOH G 2 .   ? 13.049  8.433   12.306  1.00 85.95  ? 334 HOH B O   1 
HETATM 10293 O O   . HOH G 2 .   ? 0.968   23.559  -18.534 1.00 62.71  ? 335 HOH B O   1 
HETATM 10294 O O   . HOH G 2 .   ? 7.693   28.392  9.094   1.00 56.56  ? 336 HOH B O   1 
HETATM 10295 O O   . HOH G 2 .   ? 15.567  11.579  22.195  1.00 73.41  ? 337 HOH B O   1 
HETATM 10296 O O   . HOH G 2 .   ? 2.556   23.502  -16.204 1.00 79.35  ? 338 HOH B O   1 
HETATM 10297 O O   . HOH G 2 .   ? 4.404   19.272  -11.202 1.00 155.17 ? 339 HOH B O   1 
HETATM 10298 O O   . HOH G 2 .   ? -0.933  6.747   6.635   1.00 135.48 ? 340 HOH B O   1 
HETATM 10299 O O   . HOH G 2 .   ? 5.016   21.471  11.896  1.00 78.76  ? 341 HOH B O   1 
HETATM 10300 O O   . HOH G 2 .   ? 19.997  4.528   29.432  1.00 65.14  ? 342 HOH B O   1 
HETATM 10301 O O   . HOH G 2 .   ? 8.455   22.235  15.831  1.00 136.52 ? 343 HOH B O   1 
HETATM 10302 O O   . HOH G 2 .   ? 22.477  4.848   12.752  1.00 65.22  ? 344 HOH B O   1 
HETATM 10303 O O   . HOH G 2 .   ? -14.419 2.660   24.764  1.00 93.92  ? 345 HOH B O   1 
HETATM 10304 O O   . HOH G 2 .   ? 23.617  10.581  21.538  1.00 48.14  ? 346 HOH B O   1 
HETATM 10305 O O   . HOH G 2 .   ? -2.354  13.920  31.663  1.00 127.74 ? 347 HOH B O   1 
HETATM 10306 O O   . HOH G 2 .   ? 18.039  4.448   9.408   1.00 76.76  ? 348 HOH B O   1 
HETATM 10307 O O   . HOH G 2 .   ? 6.872   6.254   11.279  1.00 68.74  ? 349 HOH B O   1 
HETATM 10308 O O   . HOH G 2 .   ? -7.532  1.336   23.103  1.00 108.44 ? 350 HOH B O   1 
HETATM 10309 O O   . HOH G 2 .   ? 4.787   33.006  20.986  1.00 84.59  ? 351 HOH B O   1 
HETATM 10310 O O   . HOH G 2 .   ? -1.638  21.279  -18.204 1.00 33.19  ? 352 HOH B O   1 
HETATM 10311 O O   . HOH G 2 .   ? 12.252  3.911   7.316   1.00 68.51  ? 353 HOH B O   1 
HETATM 10312 O O   . HOH G 2 .   ? -4.990  -8.527  19.280  1.00 81.01  ? 354 HOH B O   1 
HETATM 10313 O O   . HOH G 2 .   ? -13.346 8.633   34.842  1.00 97.39  ? 355 HOH B O   1 
HETATM 10314 O O   . HOH G 2 .   ? 25.999  17.655  19.192  1.00 79.17  ? 356 HOH B O   1 
HETATM 10315 O O   . HOH G 2 .   ? -11.760 7.691   -2.993  1.00 82.32  ? 357 HOH B O   1 
HETATM 10316 O O   . HOH G 2 .   ? -12.695 20.163  1.703   1.00 65.62  ? 358 HOH B O   1 
HETATM 10317 O O   . HOH G 2 .   ? 9.186   32.704  -4.778  1.00 43.95  ? 359 HOH B O   1 
HETATM 10318 O O   . HOH G 2 .   ? 22.633  8.729   33.132  1.00 58.59  ? 360 HOH B O   1 
HETATM 10319 O O   . HOH G 2 .   ? 4.999   16.350  26.557  1.00 121.93 ? 361 HOH B O   1 
HETATM 10320 O O   . HOH G 2 .   ? 7.958   26.450  2.049   1.00 64.97  ? 362 HOH B O   1 
HETATM 10321 O O   . HOH G 2 .   ? 1.080   20.794  -17.591 1.00 68.69  ? 363 HOH B O   1 
HETATM 10322 O O   . HOH G 2 .   ? -1.638  10.706  29.809  1.00 104.08 ? 364 HOH B O   1 
HETATM 10323 O O   . HOH G 2 .   ? 7.705   31.907  -2.243  1.00 87.78  ? 365 HOH B O   1 
HETATM 10324 O O   . HOH G 2 .   ? -9.967  1.486   27.593  1.00 89.98  ? 366 HOH B O   1 
HETATM 10325 O O   . HOH G 2 .   ? -7.570  7.463   23.789  1.00 157.77 ? 367 HOH B O   1 
HETATM 10326 O O   . HOH G 2 .   ? 7.810   31.903  10.188  1.00 40.49  ? 368 HOH B O   1 
HETATM 10327 O O   . HOH G 2 .   ? 24.760  8.321   19.759  1.00 88.83  ? 369 HOH B O   1 
HETATM 10328 O O   . HOH G 2 .   ? 2.212   28.047  2.790   1.00 135.75 ? 370 HOH B O   1 
HETATM 10329 O O   . HOH G 2 .   ? 1.736   6.369   26.038  1.00 137.81 ? 371 HOH B O   1 
HETATM 10330 O O   . HOH G 2 .   ? 7.173   8.003   -8.243  1.00 108.08 ? 372 HOH B O   1 
HETATM 10331 O O   . HOH G 2 .   ? -3.127  -2.669  40.439  1.00 100.63 ? 373 HOH B O   1 
HETATM 10332 O O   . HOH G 2 .   ? -1.627  18.383  -19.287 1.00 65.74  ? 374 HOH B O   1 
HETATM 10333 O O   . HOH G 2 .   ? 15.356  23.342  16.969  1.00 61.72  ? 375 HOH B O   1 
HETATM 10334 O O   . HOH G 2 .   ? -0.341  -0.335  9.161   1.00 66.56  ? 376 HOH B O   1 
HETATM 10335 O O   . HOH G 2 .   ? 2.044   -6.901  23.436  1.00 102.52 ? 377 HOH B O   1 
HETATM 10336 O O   . HOH G 2 .   ? 2.431   38.777  -9.402  1.00 39.59  ? 378 HOH B O   1 
HETATM 10337 O O   . HOH G 2 .   ? 9.851   18.454  -17.652 1.00 78.94  ? 379 HOH B O   1 
HETATM 10338 O O   . HOH G 2 .   ? -3.222  19.441  -17.025 1.00 34.32  ? 380 HOH B O   1 
HETATM 10339 O O   . HOH G 2 .   ? -9.222  7.977   -4.077  1.00 95.71  ? 381 HOH B O   1 
HETATM 10340 O O   . HOH G 2 .   ? -13.160 22.229  -4.673  1.00 94.76  ? 382 HOH B O   1 
HETATM 10341 O O   . HOH G 2 .   ? 12.507  31.566  28.146  1.00 64.66  ? 383 HOH B O   1 
HETATM 10342 O O   . HOH G 2 .   ? 16.016  -2.922  23.997  1.00 107.45 ? 384 HOH B O   1 
HETATM 10343 O O   . HOH G 2 .   ? 2.362   2.343   31.815  1.00 158.70 ? 385 HOH B O   1 
HETATM 10344 O O   . HOH G 2 .   ? -12.954 34.476  -7.766  1.00 52.34  ? 386 HOH B O   1 
HETATM 10345 O O   . HOH G 2 .   ? 25.250  18.644  22.458  1.00 67.35  ? 387 HOH B O   1 
HETATM 10346 O O   . HOH G 2 .   ? -8.496  24.211  4.629   1.00 62.85  ? 388 HOH B O   1 
HETATM 10347 O O   . HOH G 2 .   ? 11.677  33.957  -5.360  1.00 102.23 ? 389 HOH B O   1 
HETATM 10348 O O   . HOH G 2 .   ? -15.827 26.270  -2.648  1.00 77.96  ? 390 HOH B O   1 
HETATM 10349 O O   . HOH G 2 .   ? 3.504   38.777  -6.436  1.00 43.06  ? 391 HOH B O   1 
HETATM 10350 O O   . HOH G 2 .   ? -2.585  15.842  -17.344 1.00 61.58  ? 392 HOH B O   1 
HETATM 10351 O O   . HOH G 2 .   ? 21.309  6.205   31.461  1.00 58.55  ? 393 HOH B O   1 
HETATM 10352 O O   . HOH G 2 .   ? 16.012  14.137  15.632  1.00 67.00  ? 394 HOH B O   1 
HETATM 10353 O O   . HOH G 2 .   ? 20.571  -5.223  6.587   1.00 55.28  ? 395 HOH B O   1 
HETATM 10354 O O   . HOH G 2 .   ? 24.374  21.367  21.239  1.00 63.70  ? 396 HOH B O   1 
HETATM 10355 O O   . HOH G 2 .   ? -3.422  -10.064 22.841  1.00 84.41  ? 397 HOH B O   1 
HETATM 10356 O O   . HOH G 2 .   ? 0.764   15.230  14.226  1.00 38.01  ? 398 HOH B O   1 
HETATM 10357 O O   . HOH G 2 .   ? -0.704  -0.118  12.021  1.00 84.91  ? 399 HOH B O   1 
HETATM 10358 O O   . HOH G 2 .   ? -0.345  31.631  -14.466 1.00 64.97  ? 400 HOH B O   1 
HETATM 10359 O O   . HOH G 2 .   ? 6.251   5.145   2.689   1.00 63.20  ? 401 HOH B O   1 
HETATM 10360 O O   . HOH G 2 .   ? 16.484  22.451  26.292  1.00 92.06  ? 402 HOH B O   1 
HETATM 10361 O O   . HOH G 2 .   ? 14.662  5.943   -6.313  1.00 67.74  ? 403 HOH B O   1 
HETATM 10362 O O   . HOH G 2 .   ? 9.205   5.705   1.968   1.00 56.60  ? 404 HOH B O   1 
HETATM 10363 O O   . HOH G 2 .   ? 18.368  11.913  27.746  1.00 94.13  ? 405 HOH B O   1 
HETATM 10364 O O   . HOH G 2 .   ? 4.383   17.202  20.027  1.00 55.96  ? 406 HOH B O   1 
HETATM 10365 O O   . HOH G 2 .   ? 13.078  -8.692  20.482  1.00 89.49  ? 407 HOH B O   1 
HETATM 10366 O O   . HOH G 2 .   ? -10.900 24.482  7.103   1.00 141.33 ? 408 HOH B O   1 
HETATM 10367 O O   . HOH G 2 .   ? 10.551  -2.745  11.028  1.00 74.54  ? 409 HOH B O   1 
HETATM 10368 O O   . HOH G 2 .   ? 0.311   18.604  13.507  1.00 85.34  ? 410 HOH B O   1 
HETATM 10369 O O   . HOH G 2 .   ? 27.099  20.551  19.531  1.00 105.22 ? 411 HOH B O   1 
HETATM 10370 O O   . HOH G 2 .   ? 17.059  18.996  -15.641 1.00 59.83  ? 412 HOH B O   1 
HETATM 10371 O O   . HOH G 2 .   ? 19.782  4.108   11.910  1.00 88.37  ? 413 HOH B O   1 
HETATM 10372 O O   . HOH G 2 .   ? 6.451   -0.543  52.535  1.00 67.92  ? 414 HOH B O   1 
HETATM 10373 O O   . HOH G 2 .   ? 21.548  21.012  22.335  1.00 75.39  ? 415 HOH B O   1 
HETATM 10374 O O   . HOH G 2 .   ? 3.691   21.259  -13.392 1.00 158.37 ? 416 HOH B O   1 
HETATM 10375 O O   . HOH G 2 .   ? 20.400  13.539  29.983  1.00 73.24  ? 417 HOH B O   1 
HETATM 10376 O O   . HOH G 2 .   ? 2.249   28.598  8.702   1.00 91.17  ? 418 HOH B O   1 
HETATM 10377 O O   . HOH G 2 .   ? 12.993  4.039   38.956  1.00 148.84 ? 419 HOH B O   1 
HETATM 10378 O O   . HOH G 2 .   ? 6.797   0.987   7.125   1.00 72.30  ? 420 HOH B O   1 
HETATM 10379 O O   . HOH G 2 .   ? 22.550  9.967   12.862  1.00 55.81  ? 421 HOH B O   1 
HETATM 10380 O O   . HOH G 2 .   ? 18.851  7.524   31.849  1.00 108.08 ? 422 HOH B O   1 
HETATM 10381 O O   . HOH G 2 .   ? 18.521  21.328  24.369  1.00 64.72  ? 423 HOH B O   1 
HETATM 10382 O O   . HOH G 2 .   ? 18.780  19.235  22.386  1.00 62.30  ? 424 HOH B O   1 
HETATM 10383 O O   . HOH G 2 .   ? 6.957   1.858   2.506   1.00 59.58  ? 425 HOH B O   1 
HETATM 10384 O O   . HOH G 2 .   ? 13.115  -1.625  10.947  1.00 62.97  ? 426 HOH B O   1 
HETATM 10385 O O   . HOH G 2 .   ? 17.737  21.482  -17.103 1.00 64.74  ? 427 HOH B O   1 
HETATM 10386 O O   . HOH G 2 .   ? -0.653  18.078  -16.507 1.00 67.37  ? 428 HOH B O   1 
HETATM 10387 O O   . HOH G 2 .   ? 7.637   3.824   0.472   1.00 71.33  ? 429 HOH B O   1 
HETATM 10388 O O   . HOH G 2 .   ? 15.576  19.295  22.643  1.00 99.76  ? 430 HOH B O   1 
HETATM 10389 O O   . HOH G 2 .   ? 14.830  -8.273  17.992  1.00 65.24  ? 431 HOH B O   1 
HETATM 10390 O O   . HOH G 2 .   ? 14.671  4.664   5.747   1.00 71.69  ? 432 HOH B O   1 
HETATM 10391 O O   . HOH G 2 .   ? -7.767  -7.794  19.799  1.00 82.47  ? 433 HOH B O   1 
HETATM 10392 O O   . HOH G 2 .   ? 0.037   17.970  -21.902 1.00 67.14  ? 434 HOH B O   1 
HETATM 10393 O O   . HOH G 2 .   ? 8.413   4.231   4.766   1.00 55.08  ? 435 HOH B O   1 
HETATM 10394 O O   . HOH G 2 .   ? 5.418   28.727  -5.751  1.00 107.89 ? 436 HOH B O   1 
HETATM 10395 O O   . HOH G 2 .   ? 12.065  18.089  -19.482 1.00 62.81  ? 437 HOH B O   1 
HETATM 10396 O O   . HOH H 2 .   ? 0.413   55.105  26.741  1.00 59.21  ? 320 HOH C O   1 
HETATM 10397 O O   . HOH H 2 .   ? -4.408  50.220  8.999   1.00 26.40  ? 321 HOH C O   1 
HETATM 10398 O O   . HOH H 2 .   ? 6.560   63.891  32.843  1.00 57.28  ? 322 HOH C O   1 
HETATM 10399 O O   . HOH H 2 .   ? 2.144   62.314  26.780  1.00 119.49 ? 323 HOH C O   1 
HETATM 10400 O O   . HOH H 2 .   ? 0.416   94.474  25.388  1.00 77.91  ? 324 HOH C O   1 
HETATM 10401 O O   . HOH H 2 .   ? -18.444 49.960  7.093   1.00 50.80  ? 325 HOH C O   1 
HETATM 10402 O O   . HOH H 2 .   ? -25.304 56.035  -1.353  1.00 57.14  ? 326 HOH C O   1 
HETATM 10403 O O   . HOH H 2 .   ? -16.720 84.777  32.559  1.00 62.84  ? 327 HOH C O   1 
HETATM 10404 O O   . HOH H 2 .   ? -30.484 55.895  6.823   1.00 113.54 ? 328 HOH C O   1 
HETATM 10405 O O   . HOH H 2 .   ? -7.020  60.087  40.122  1.00 65.16  ? 329 HOH C O   1 
HETATM 10406 O O   . HOH H 2 .   ? -11.477 51.698  6.397   1.00 57.58  ? 330 HOH C O   1 
HETATM 10407 O O   . HOH H 2 .   ? -14.154 80.478  -3.496  1.00 76.65  ? 331 HOH C O   1 
HETATM 10408 O O   . HOH H 2 .   ? 8.514   78.882  31.497  1.00 122.11 ? 332 HOH C O   1 
HETATM 10409 O O   . HOH H 2 .   ? -18.540 82.279  30.414  1.00 73.49  ? 333 HOH C O   1 
HETATM 10410 O O   . HOH H 2 .   ? -10.992 77.813  19.673  1.00 85.97  ? 334 HOH C O   1 
HETATM 10411 O O   . HOH H 2 .   ? -18.757 79.290  29.982  1.00 62.63  ? 335 HOH C O   1 
HETATM 10412 O O   . HOH H 2 .   ? -30.278 63.011  9.475   1.00 52.05  ? 336 HOH C O   1 
HETATM 10413 O O   . HOH H 2 .   ? -14.695 75.944  -3.362  1.00 56.88  ? 337 HOH C O   1 
HETATM 10414 O O   . HOH H 2 .   ? 9.844   90.526  22.169  1.00 97.32  ? 338 HOH C O   1 
HETATM 10415 O O   . HOH H 2 .   ? 2.555   65.845  27.723  1.00 60.64  ? 339 HOH C O   1 
HETATM 10416 O O   . HOH H 2 .   ? -10.010 50.229  8.665   1.00 74.34  ? 340 HOH C O   1 
HETATM 10417 O O   . HOH H 2 .   ? -9.365  53.017  -2.025  1.00 41.12  ? 341 HOH C O   1 
HETATM 10418 O O   . HOH H 2 .   ? -27.755 57.185  16.445  1.00 83.04  ? 342 HOH C O   1 
HETATM 10419 O O   . HOH H 2 .   ? -2.406  93.837  24.454  1.00 83.02  ? 343 HOH C O   1 
HETATM 10420 O O   . HOH H 2 .   ? -8.412  67.307  -12.470 1.00 93.21  ? 344 HOH C O   1 
HETATM 10421 O O   . HOH H 2 .   ? -8.646  74.992  -10.969 1.00 44.65  ? 345 HOH C O   1 
HETATM 10422 O O   . HOH H 2 .   ? -20.316 53.015  10.902  1.00 58.04  ? 346 HOH C O   1 
HETATM 10423 O O   . HOH H 2 .   ? -1.479  100.534 24.366  1.00 90.81  ? 347 HOH C O   1 
HETATM 10424 O O   . HOH H 2 .   ? 0.408   73.873  40.633  1.00 87.09  ? 348 HOH C O   1 
HETATM 10425 O O   . HOH H 2 .   ? -5.332  70.986  -7.517  1.00 55.37  ? 349 HOH C O   1 
HETATM 10426 O O   . HOH H 2 .   ? -7.403  72.797  45.154  1.00 62.99  ? 350 HOH C O   1 
HETATM 10427 O O   . HOH H 2 .   ? 1.246   71.169  29.269  1.00 67.69  ? 351 HOH C O   1 
HETATM 10428 O O   . HOH H 2 .   ? 0.606   85.813  41.782  1.00 102.18 ? 352 HOH C O   1 
HETATM 10429 O O   . HOH H 2 .   ? -13.026 49.527  -3.050  1.00 29.18  ? 353 HOH C O   1 
HETATM 10430 O O   . HOH H 2 .   ? -17.377 76.462  2.212   1.00 97.93  ? 354 HOH C O   1 
HETATM 10431 O O   . HOH H 2 .   ? -1.083  99.333  27.435  1.00 77.48  ? 355 HOH C O   1 
HETATM 10432 O O   . HOH H 2 .   ? -2.443  55.172  26.750  1.00 54.77  ? 356 HOH C O   1 
HETATM 10433 O O   . HOH H 2 .   ? -21.509 53.287  13.717  1.00 112.32 ? 357 HOH C O   1 
HETATM 10434 O O   . HOH H 2 .   ? -17.848 83.023  27.805  1.00 67.88  ? 358 HOH C O   1 
HETATM 10435 O O   . HOH H 2 .   ? -4.041  48.894  6.331   1.00 40.44  ? 359 HOH C O   1 
HETATM 10436 O O   . HOH H 2 .   ? -0.890  63.507  21.038  1.00 152.18 ? 360 HOH C O   1 
HETATM 10437 O O   . HOH H 2 .   ? 3.121   56.274  25.312  1.00 76.98  ? 361 HOH C O   1 
HETATM 10438 O O   . HOH H 2 .   ? -9.393  61.273  41.525  1.00 52.77  ? 362 HOH C O   1 
HETATM 10439 O O   . HOH H 2 .   ? -5.818  83.426  37.836  1.00 118.63 ? 363 HOH C O   1 
HETATM 10440 O O   . HOH H 2 .   ? -7.464  67.827  40.711  1.00 64.23  ? 364 HOH C O   1 
HETATM 10441 O O   . HOH H 2 .   ? -6.199  75.621  -12.693 1.00 53.51  ? 365 HOH C O   1 
HETATM 10442 O O   . HOH H 2 .   ? 3.257   69.032  41.424  1.00 59.50  ? 366 HOH C O   1 
HETATM 10443 O O   . HOH H 2 .   ? -18.833 52.764  6.046   1.00 39.10  ? 367 HOH C O   1 
HETATM 10444 O O   . HOH H 2 .   ? -25.152 89.594  33.786  1.00 102.42 ? 368 HOH C O   1 
HETATM 10445 O O   . HOH H 2 .   ? -27.758 63.191  7.877   1.00 72.27  ? 369 HOH C O   1 
HETATM 10446 O O   . HOH H 2 .   ? 0.215   72.652  23.310  1.00 80.56  ? 370 HOH C O   1 
HETATM 10447 O O   . HOH H 2 .   ? -11.938 71.502  -8.253  1.00 169.43 ? 371 HOH C O   1 
HETATM 10448 O O   . HOH H 2 .   ? 10.633  88.978  24.971  1.00 85.07  ? 372 HOH C O   1 
HETATM 10449 O O   . HOH H 2 .   ? -15.541 79.560  2.470   1.00 94.01  ? 373 HOH C O   1 
HETATM 10450 O O   . HOH H 2 .   ? -18.542 69.413  31.723  1.00 78.80  ? 374 HOH C O   1 
HETATM 10451 O O   . HOH H 2 .   ? -9.473  78.680  -0.944  1.00 57.95  ? 375 HOH C O   1 
HETATM 10452 O O   . HOH H 2 .   ? 6.632   66.642  31.184  1.00 134.02 ? 376 HOH C O   1 
HETATM 10453 O O   . HOH H 2 .   ? 4.996   75.439  40.439  1.00 150.78 ? 377 HOH C O   1 
HETATM 10454 O O   . HOH H 2 .   ? -8.439  77.997  -7.811  1.00 65.59  ? 378 HOH C O   1 
HETATM 10455 O O   . HOH H 2 .   ? 3.627   74.705  45.819  1.00 83.57  ? 379 HOH C O   1 
HETATM 10456 O O   . HOH H 2 .   ? 10.075  83.762  26.122  1.00 137.02 ? 380 HOH C O   1 
HETATM 10457 O O   . HOH H 2 .   ? -3.316  58.879  25.660  1.00 64.66  ? 381 HOH C O   1 
HETATM 10458 O O   . HOH H 2 .   ? 4.448   74.950  14.507  1.00 43.64  ? 382 HOH C O   1 
HETATM 10459 O O   . HOH H 2 .   ? 12.328  69.256  39.978  1.00 72.74  ? 383 HOH C O   1 
HETATM 10460 O O   . HOH H 2 .   ? -30.141 52.134  14.012  1.00 40.10  ? 384 HOH C O   1 
HETATM 10461 O O   . HOH H 2 .   ? -5.368  77.369  44.586  1.00 84.67  ? 385 HOH C O   1 
HETATM 10462 O O   . HOH H 2 .   ? -9.762  70.367  40.950  1.00 75.18  ? 386 HOH C O   1 
HETATM 10463 O O   . HOH H 2 .   ? -4.695  67.263  40.270  1.00 75.96  ? 387 HOH C O   1 
HETATM 10464 O O   . HOH H 2 .   ? -14.092 94.925  26.610  1.00 59.90  ? 388 HOH C O   1 
HETATM 10465 O O   . HOH H 2 .   ? -7.578  78.203  -3.019  1.00 91.77  ? 389 HOH C O   1 
HETATM 10466 O O   . HOH H 2 .   ? 4.212   71.887  44.080  1.00 69.58  ? 390 HOH C O   1 
HETATM 10467 O O   . HOH H 2 .   ? -5.573  95.717  19.713  1.00 111.89 ? 391 HOH C O   1 
HETATM 10468 O O   . HOH H 2 .   ? -18.315 75.448  29.931  1.00 60.06  ? 392 HOH C O   1 
HETATM 10469 O O   . HOH H 2 .   ? -11.621 83.694  1.312   1.00 51.18  ? 393 HOH C O   1 
HETATM 10470 O O   . HOH H 2 .   ? -4.129  51.111  2.973   1.00 32.53  ? 394 HOH C O   1 
HETATM 10471 O O   . HOH H 2 .   ? -0.112  56.557  24.328  1.00 116.98 ? 395 HOH C O   1 
HETATM 10472 O O   . HOH H 2 .   ? -8.118  58.325  42.553  1.00 64.47  ? 396 HOH C O   1 
HETATM 10473 O O   . HOH H 2 .   ? -6.518  84.499  41.250  1.00 69.12  ? 397 HOH C O   1 
HETATM 10474 O O   . HOH H 2 .   ? -15.388 66.975  33.400  1.00 88.94  ? 398 HOH C O   1 
HETATM 10475 O O   . HOH H 2 .   ? -15.988 81.223  -0.442  1.00 62.23  ? 399 HOH C O   1 
HETATM 10476 O O   . HOH H 2 .   ? -32.818 62.207  10.565  1.00 63.09  ? 400 HOH C O   1 
HETATM 10477 O O   . HOH H 2 .   ? -4.852  67.549  24.633  1.00 114.50 ? 401 HOH C O   1 
HETATM 10478 O O   . HOH H 2 .   ? -0.849  87.301  32.745  1.00 166.54 ? 402 HOH C O   1 
HETATM 10479 O O   . HOH H 2 .   ? 12.897  89.253  23.239  1.00 80.54  ? 403 HOH C O   1 
HETATM 10480 O O   . HOH H 2 .   ? -19.655 56.021  10.865  1.00 143.83 ? 404 HOH C O   1 
HETATM 10481 O O   . HOH H 2 .   ? -10.756 67.344  41.321  1.00 75.44  ? 405 HOH C O   1 
HETATM 10482 O O   . HOH H 2 .   ? -17.315 78.671  0.015   1.00 39.66  ? 406 HOH C O   1 
HETATM 10483 O O   . HOH H 2 .   ? 9.835   68.989  38.161  1.00 114.11 ? 407 HOH C O   1 
HETATM 10484 O O   . HOH H 2 .   ? 8.686   65.046  18.328  1.00 74.85  ? 408 HOH C O   1 
HETATM 10485 O O   . HOH H 2 .   ? 14.087  67.334  38.848  1.00 83.92  ? 409 HOH C O   1 
HETATM 10486 O O   . HOH H 2 .   ? -2.307  55.793  30.011  1.00 69.92  ? 410 HOH C O   1 
HETATM 10487 O O   . HOH H 2 .   ? -9.617  65.977  11.466  1.00 58.66  ? 411 HOH C O   1 
HETATM 10488 O O   . HOH H 2 .   ? -0.386  77.531  25.540  1.00 77.69  ? 412 HOH C O   1 
HETATM 10489 O O   . HOH H 2 .   ? -7.495  50.589  -2.494  1.00 31.43  ? 413 HOH C O   1 
HETATM 10490 O O   . HOH H 2 .   ? 12.488  85.822  25.988  1.00 112.12 ? 414 HOH C O   1 
HETATM 10491 O O   . HOH H 2 .   ? -7.630  67.909  30.918  1.00 120.40 ? 415 HOH C O   1 
HETATM 10492 O O   . HOH H 2 .   ? 0.384   63.971  31.655  1.00 86.24  ? 416 HOH C O   1 
HETATM 10493 O O   . HOH H 2 .   ? -9.886  79.387  13.708  1.00 145.31 ? 417 HOH C O   1 
HETATM 10494 O O   . HOH H 2 .   ? -8.083  84.136  17.147  1.00 116.47 ? 418 HOH C O   1 
HETATM 10495 O O   . HOH H 2 .   ? -3.471  91.608  13.983  1.00 80.46  ? 419 HOH C O   1 
HETATM 10496 O O   . HOH H 2 .   ? -1.028  82.017  33.747  1.00 75.99  ? 420 HOH C O   1 
HETATM 10497 O O   . HOH H 2 .   ? -17.268 66.421  30.679  1.00 99.58  ? 421 HOH C O   1 
HETATM 10498 O O   . HOH H 2 .   ? -1.347  65.368  29.810  1.00 101.34 ? 422 HOH C O   1 
HETATM 10499 O O   . HOH H 2 .   ? 1.641   66.431  21.064  1.00 97.41  ? 423 HOH C O   1 
HETATM 10500 O O   . HOH H 2 .   ? -18.654 79.326  2.256   1.00 47.79  ? 424 HOH C O   1 
HETATM 10501 O O   . HOH H 2 .   ? -4.342  89.984  11.791  1.00 89.28  ? 425 HOH C O   1 
HETATM 10502 O O   . HOH H 2 .   ? 2.049   62.985  33.760  1.00 83.31  ? 426 HOH C O   1 
HETATM 10503 O O   . HOH H 2 .   ? -31.348 55.056  3.907   1.00 54.39  ? 427 HOH C O   1 
HETATM 10504 O O   . HOH H 2 .   ? -0.558  59.811  30.572  1.00 61.45  ? 428 HOH C O   1 
HETATM 10505 O O   . HOH H 2 .   ? -4.145  53.528  28.470  1.00 64.29  ? 429 HOH C O   1 
HETATM 10506 O O   . HOH H 2 .   ? 2.895   65.464  30.927  1.00 80.19  ? 430 HOH C O   1 
HETATM 10507 O O   . HOH H 2 .   ? -8.838  77.670  1.468   1.00 114.24 ? 431 HOH C O   1 
HETATM 10508 O O   . HOH H 2 .   ? -16.562 78.402  -2.939  1.00 68.23  ? 432 HOH C O   1 
HETATM 10509 O O   . HOH H 2 .   ? -0.719  79.919  22.475  1.00 74.38  ? 433 HOH C O   1 
HETATM 10510 O O   . HOH H 2 .   ? -11.413 70.368  0.320   1.00 52.21  ? 434 HOH C O   1 
HETATM 10511 O O   . HOH H 2 .   ? 15.804  89.649  24.007  1.00 96.44  ? 435 HOH C O   1 
HETATM 10512 O O   . HOH H 2 .   ? -4.576  57.649  29.163  1.00 81.58  ? 436 HOH C O   1 
HETATM 10513 O O   . HOH H 2 .   ? -9.424  65.584  21.236  1.00 144.35 ? 437 HOH C O   1 
HETATM 10514 O O   . HOH H 2 .   ? -8.324  86.528  39.637  1.00 86.65  ? 438 HOH C O   1 
HETATM 10515 O O   . HOH I 2 .   ? -22.956 36.255  24.151  1.00 51.17  ? 320 HOH D O   1 
HETATM 10516 O O   . HOH I 2 .   ? -6.227  48.840  27.212  1.00 78.84  ? 321 HOH D O   1 
HETATM 10517 O O   . HOH I 2 .   ? -5.507  35.378  -2.213  1.00 55.20  ? 322 HOH D O   1 
HETATM 10518 O O   . HOH I 2 .   ? -19.164 24.786  13.404  1.00 84.20  ? 323 HOH D O   1 
HETATM 10519 O O   . HOH I 2 .   ? -6.402  34.491  34.461  1.00 43.62  ? 324 HOH D O   1 
HETATM 10520 O O   . HOH I 2 .   ? -11.855 38.796  37.089  1.00 54.58  ? 325 HOH D O   1 
HETATM 10521 O O   . HOH I 2 .   ? -17.471 40.812  26.970  1.00 76.53  ? 326 HOH D O   1 
HETATM 10522 O O   . HOH I 2 .   ? -11.598 33.624  47.455  1.00 76.43  ? 327 HOH D O   1 
HETATM 10523 O O   . HOH I 2 .   ? -24.171 28.536  -3.653  1.00 52.27  ? 328 HOH D O   1 
HETATM 10524 O O   . HOH I 2 .   ? -8.048  45.232  48.585  1.00 79.14  ? 329 HOH D O   1 
HETATM 10525 O O   . HOH I 2 .   ? -12.632 30.804  5.420   1.00 102.76 ? 330 HOH D O   1 
HETATM 10526 O O   . HOH I 2 .   ? -16.585 30.535  -5.809  1.00 76.45  ? 331 HOH D O   1 
HETATM 10527 O O   . HOH I 2 .   ? -28.808 49.303  51.878  1.00 59.08  ? 332 HOH D O   1 
HETATM 10528 O O   . HOH I 2 .   ? -17.825 48.499  -7.191  1.00 49.38  ? 333 HOH D O   1 
HETATM 10529 O O   . HOH I 2 .   ? -26.049 48.965  9.994   1.00 54.86  ? 334 HOH D O   1 
HETATM 10530 O O   . HOH I 2 .   ? -17.413 42.625  37.153  1.00 57.05  ? 335 HOH D O   1 
HETATM 10531 O O   . HOH I 2 .   ? -7.045  38.362  32.204  1.00 75.13  ? 336 HOH D O   1 
HETATM 10532 O O   . HOH I 2 .   ? -4.867  32.907  45.580  1.00 73.81  ? 337 HOH D O   1 
HETATM 10533 O O   . HOH I 2 .   ? -19.300 26.009  1.386   1.00 46.92  ? 338 HOH D O   1 
HETATM 10534 O O   . HOH I 2 .   ? -18.367 46.470  59.658  1.00 68.49  ? 339 HOH D O   1 
HETATM 10535 O O   . HOH I 2 .   ? -28.673 28.458  29.452  1.00 46.27  ? 340 HOH D O   1 
HETATM 10536 O O   . HOH I 2 .   ? -13.161 27.291  38.270  1.00 63.51  ? 341 HOH D O   1 
HETATM 10537 O O   . HOH I 2 .   ? -2.100  38.551  43.505  1.00 64.88  ? 342 HOH D O   1 
HETATM 10538 O O   . HOH I 2 .   ? -36.368 38.701  13.557  1.00 46.32  ? 343 HOH D O   1 
HETATM 10539 O O   . HOH I 2 .   ? -19.656 46.036  40.790  1.00 68.19  ? 344 HOH D O   1 
HETATM 10540 O O   . HOH I 2 .   ? -20.681 21.991  14.316  1.00 78.65  ? 345 HOH D O   1 
HETATM 10541 O O   . HOH I 2 .   ? -13.814 51.991  54.955  1.00 81.54  ? 346 HOH D O   1 
HETATM 10542 O O   . HOH I 2 .   ? -13.407 31.396  46.892  1.00 112.28 ? 347 HOH D O   1 
HETATM 10543 O O   . HOH I 2 .   ? -26.913 21.898  6.785   1.00 62.18  ? 348 HOH D O   1 
HETATM 10544 O O   . HOH I 2 .   ? -22.416 22.210  48.402  1.00 132.16 ? 349 HOH D O   1 
HETATM 10545 O O   . HOH I 2 .   ? -27.113 43.918  4.100   1.00 121.95 ? 350 HOH D O   1 
HETATM 10546 O O   . HOH I 2 .   ? -23.180 42.637  14.786  1.00 143.13 ? 351 HOH D O   1 
HETATM 10547 O O   . HOH I 2 .   ? -35.598 29.130  18.053  1.00 41.35  ? 352 HOH D O   1 
HETATM 10548 O O   . HOH I 2 .   ? -16.416 51.940  44.785  1.00 97.42  ? 353 HOH D O   1 
HETATM 10549 O O   . HOH I 2 .   ? -10.705 39.016  33.627  1.00 77.32  ? 354 HOH D O   1 
HETATM 10550 O O   . HOH I 2 .   ? -15.371 23.692  4.091   1.00 44.05  ? 355 HOH D O   1 
HETATM 10551 O O   . HOH I 2 .   ? -4.649  42.374  10.684  1.00 37.27  ? 356 HOH D O   1 
HETATM 10552 O O   . HOH I 2 .   ? -24.719 29.974  1.004   1.00 106.53 ? 357 HOH D O   1 
HETATM 10553 O O   . HOH I 2 .   ? -29.202 45.973  53.685  1.00 61.22  ? 358 HOH D O   1 
HETATM 10554 O O   . HOH I 2 .   ? -26.395 30.198  -3.876  1.00 38.52  ? 359 HOH D O   1 
HETATM 10555 O O   . HOH I 2 .   ? -27.860 34.568  50.432  1.00 33.44  ? 360 HOH D O   1 
HETATM 10556 O O   . HOH I 2 .   ? -19.569 42.226  25.736  1.00 70.36  ? 361 HOH D O   1 
HETATM 10557 O O   . HOH I 2 .   ? -12.733 41.426  38.028  1.00 108.75 ? 362 HOH D O   1 
HETATM 10558 O O   . HOH I 2 .   ? -14.601 29.639  3.723   1.00 60.35  ? 363 HOH D O   1 
HETATM 10559 O O   . HOH I 2 .   ? -8.630  38.044  25.945  1.00 155.10 ? 364 HOH D O   1 
HETATM 10560 O O   . HOH I 2 .   ? -30.284 47.303  33.906  1.00 93.22  ? 365 HOH D O   1 
HETATM 10561 O O   . HOH I 2 .   ? -29.123 29.976  26.740  1.00 51.77  ? 366 HOH D O   1 
HETATM 10562 O O   . HOH I 2 .   ? -34.679 43.897  14.964  1.00 94.89  ? 367 HOH D O   1 
HETATM 10563 O O   . HOH I 2 .   ? -30.343 49.402  12.751  1.00 44.91  ? 368 HOH D O   1 
HETATM 10564 O O   . HOH I 2 .   ? -3.321  39.918  16.833  1.00 24.03  ? 369 HOH D O   1 
HETATM 10565 O O   . HOH I 2 .   ? -25.945 42.954  55.101  1.00 110.66 ? 370 HOH D O   1 
HETATM 10566 O O   . HOH I 2 .   ? -20.167 44.511  61.508  1.00 60.74  ? 371 HOH D O   1 
HETATM 10567 O O   . HOH I 2 .   ? -1.856  51.904  27.334  1.00 80.40  ? 372 HOH D O   1 
HETATM 10568 O O   . HOH I 2 .   ? -32.890 47.191  12.433  1.00 70.35  ? 373 HOH D O   1 
HETATM 10569 O O   . HOH I 2 .   ? -33.860 46.891  39.224  1.00 113.27 ? 374 HOH D O   1 
HETATM 10570 O O   . HOH I 2 .   ? -19.284 22.912  49.939  1.00 67.52  ? 375 HOH D O   1 
HETATM 10571 O O   . HOH I 2 .   ? -12.409 36.636  30.715  1.00 120.91 ? 376 HOH D O   1 
HETATM 10572 O O   . HOH I 2 .   ? -5.646  38.359  29.412  1.00 68.43  ? 377 HOH D O   1 
HETATM 10573 O O   . HOH I 2 .   ? -15.840 35.572  -7.213  1.00 60.24  ? 378 HOH D O   1 
HETATM 10574 O O   . HOH I 2 .   ? -31.463 62.940  40.274  1.00 53.23  ? 379 HOH D O   1 
HETATM 10575 O O   . HOH I 2 .   ? -21.528 38.031  58.242  1.00 71.49  ? 380 HOH D O   1 
HETATM 10576 O O   . HOH I 2 .   ? -35.913 36.728  16.399  1.00 62.73  ? 381 HOH D O   1 
HETATM 10577 O O   . HOH I 2 .   ? -3.240  36.749  -2.585  1.00 47.18  ? 382 HOH D O   1 
HETATM 10578 O O   . HOH I 2 .   ? -34.852 40.719  11.346  1.00 36.07  ? 383 HOH D O   1 
HETATM 10579 O O   . HOH I 2 .   ? -19.692 30.300  33.417  1.00 86.95  ? 384 HOH D O   1 
HETATM 10580 O O   . HOH I 2 .   ? -28.797 30.910  -2.543  1.00 68.62  ? 385 HOH D O   1 
HETATM 10581 O O   . HOH I 2 .   ? -31.131 30.204  28.674  1.00 34.02  ? 386 HOH D O   1 
HETATM 10582 O O   . HOH I 2 .   ? -1.384  45.369  25.718  1.00 71.89  ? 387 HOH D O   1 
HETATM 10583 O O   . HOH I 2 .   ? -26.729 43.635  9.405   1.00 53.44  ? 388 HOH D O   1 
HETATM 10584 O O   . HOH I 2 .   ? -35.102 60.647  41.315  1.00 55.84  ? 389 HOH D O   1 
HETATM 10585 O O   . HOH I 2 .   ? -4.397  23.721  33.569  1.00 63.47  ? 390 HOH D O   1 
HETATM 10586 O O   . HOH I 2 .   ? -29.375 45.006  45.910  1.00 94.98  ? 391 HOH D O   1 
HETATM 10587 O O   . HOH I 2 .   ? -32.479 46.336  15.159  1.00 72.17  ? 392 HOH D O   1 
HETATM 10588 O O   . HOH I 2 .   ? -10.005 31.148  28.107  1.00 97.17  ? 393 HOH D O   1 
HETATM 10589 O O   . HOH I 2 .   ? -37.351 31.268  17.938  1.00 66.22  ? 394 HOH D O   1 
HETATM 10590 O O   . HOH I 2 .   ? 4.828   45.595  32.302  1.00 60.48  ? 395 HOH D O   1 
HETATM 10591 O O   . HOH I 2 .   ? -29.655 35.266  37.411  1.00 199.80 ? 396 HOH D O   1 
HETATM 10592 O O   . HOH I 2 .   ? -9.512  36.951  31.782  1.00 157.35 ? 397 HOH D O   1 
HETATM 10593 O O   . HOH I 2 .   ? -11.825 51.918  47.373  1.00 189.30 ? 398 HOH D O   1 
HETATM 10594 O O   . HOH I 2 .   ? 1.556   47.875  43.809  1.00 62.99  ? 399 HOH D O   1 
HETATM 10595 O O   . HOH I 2 .   ? 2.110   39.757  36.074  1.00 75.53  ? 400 HOH D O   1 
HETATM 10596 O O   . HOH I 2 .   ? -26.755 27.505  27.576  1.00 91.38  ? 401 HOH D O   1 
HETATM 10597 O O   . HOH I 2 .   ? -18.618 43.217  58.582  1.00 77.69  ? 402 HOH D O   1 
HETATM 10598 O O   . HOH I 2 .   ? -5.149  38.808  -1.374  1.00 37.39  ? 403 HOH D O   1 
HETATM 10599 O O   . HOH I 2 .   ? -36.829 42.107  12.639  1.00 67.02  ? 404 HOH D O   1 
HETATM 10600 O O   . HOH I 2 .   ? -37.719 59.150  40.043  1.00 49.02  ? 405 HOH D O   1 
HETATM 10601 O O   . HOH I 2 .   ? -34.622 46.795  17.141  1.00 60.77  ? 406 HOH D O   1 
HETATM 10602 O O   . HOH I 2 .   ? -28.823 27.864  -5.868  1.00 48.89  ? 407 HOH D O   1 
HETATM 10603 O O   . HOH I 2 .   ? -3.690  41.870  7.859   1.00 36.08  ? 408 HOH D O   1 
HETATM 10604 O O   . HOH I 2 .   ? -1.350  24.032  33.394  1.00 63.23  ? 409 HOH D O   1 
HETATM 10605 O O   . HOH I 2 .   ? -0.496  45.326  43.853  1.00 58.71  ? 410 HOH D O   1 
HETATM 10606 O O   . HOH I 2 .   ? -22.913 54.914  28.868  1.00 56.25  ? 411 HOH D O   1 
HETATM 10607 O O   . HOH I 2 .   ? -22.477 20.184  50.463  1.00 71.97  ? 412 HOH D O   1 
HETATM 10608 O O   . HOH I 2 .   ? -28.843 51.512  32.696  1.00 128.73 ? 413 HOH D O   1 
HETATM 10609 O O   . HOH I 2 .   ? -15.773 42.112  58.387  1.00 90.14  ? 414 HOH D O   1 
HETATM 10610 O O   . HOH I 2 .   ? -18.548 46.184  16.312  1.00 172.48 ? 415 HOH D O   1 
HETATM 10611 O O   . HOH I 2 .   ? -18.578 37.205  22.631  1.00 63.13  ? 416 HOH D O   1 
HETATM 10612 O O   . HOH I 2 .   ? -3.809  33.239  32.173  1.00 70.21  ? 417 HOH D O   1 
HETATM 10613 O O   . HOH I 2 .   ? -39.653 42.586  39.558  1.00 97.07  ? 418 HOH D O   1 
HETATM 10614 O O   . HOH I 2 .   ? -20.634 24.664  10.454  1.00 77.63  ? 419 HOH D O   1 
HETATM 10615 O O   . HOH I 2 .   ? -19.526 40.103  45.929  1.00 72.67  ? 420 HOH D O   1 
HETATM 10616 O O   . HOH I 2 .   ? -26.820 30.595  -6.557  1.00 53.63  ? 421 HOH D O   1 
HETATM 10617 O O   . HOH I 2 .   ? -18.072 41.247  39.682  1.00 101.21 ? 422 HOH D O   1 
HETATM 10618 O O   . HOH I 2 .   ? -4.846  33.154  28.704  1.00 56.34  ? 423 HOH D O   1 
HETATM 10619 O O   . HOH I 2 .   ? -3.198  42.129  4.991   1.00 43.25  ? 424 HOH D O   1 
HETATM 10620 O O   . HOH I 2 .   ? -20.802 44.800  27.619  1.00 81.39  ? 425 HOH D O   1 
HETATM 10621 O O   . HOH I 2 .   ? -35.618 56.932  39.983  1.00 89.40  ? 426 HOH D O   1 
HETATM 10622 O O   . HOH I 2 .   ? -33.303 47.486  43.218  1.00 98.69  ? 427 HOH D O   1 
HETATM 10623 O O   . HOH I 2 .   ? -19.392 24.240  35.206  1.00 78.34  ? 428 HOH D O   1 
HETATM 10624 O O   . HOH I 2 .   ? 2.263   44.872  43.826  1.00 70.29  ? 429 HOH D O   1 
HETATM 10625 O O   . HOH I 2 .   ? -1.840  38.246  34.136  1.00 71.12  ? 430 HOH D O   1 
HETATM 10626 O O   . HOH I 2 .   ? -2.381  44.836  8.614   1.00 60.16  ? 431 HOH D O   1 
HETATM 10627 O O   . HOH I 2 .   ? -40.893 45.382  38.629  1.00 63.45  ? 432 HOH D O   1 
HETATM 10628 O O   . HOH I 2 .   ? -38.374 62.212  41.003  1.00 62.25  ? 433 HOH D O   1 
HETATM 10629 O O   . HOH I 2 .   ? -14.072 26.140  6.656   1.00 51.50  ? 434 HOH D O   1 
HETATM 10630 O O   . HOH I 2 .   ? -20.312 31.028  -5.064  1.00 94.56  ? 435 HOH D O   1 
HETATM 10631 O O   . HOH I 2 .   ? -29.304 27.905  -2.962  1.00 94.06  ? 436 HOH D O   1 
HETATM 10632 O O   . HOH I 2 .   ? -20.191 54.341  27.537  1.00 85.95  ? 437 HOH D O   1 
HETATM 10633 O O   . HOH I 2 .   ? -37.054 42.036  38.126  1.00 119.11 ? 438 HOH D O   1 
HETATM 10634 O O   . HOH I 2 .   ? -4.962  37.284  34.419  1.00 54.02  ? 439 HOH D O   1 
HETATM 10635 O O   . HOH I 2 .   ? -39.968 45.249  41.993  1.00 82.67  ? 440 HOH D O   1 
HETATM 10636 O O   . HOH I 2 .   ? -39.114 43.383  14.294  1.00 62.40  ? 441 HOH D O   1 
HETATM 10637 O O   . HOH I 2 .   ? -18.184 23.188  -0.434  1.00 56.09  ? 442 HOH D O   1 
HETATM 10638 O O   . HOH I 2 .   ? -15.599 45.291  35.308  1.00 62.70  ? 443 HOH D O   1 
HETATM 10639 O O   . HOH I 2 .   ? -21.286 19.247  1.511   1.00 51.08  ? 444 HOH D O   1 
HETATM 10640 O O   . HOH I 2 .   ? -17.297 50.545  -5.230  1.00 63.58  ? 445 HOH D O   1 
HETATM 10641 O O   . HOH J 2 .   ? 12.887  47.418  -26.340 1.00 26.93  ? 320 HOH E O   1 
HETATM 10642 O O   . HOH J 2 .   ? 57.445  21.042  -11.090 1.00 98.35  ? 321 HOH E O   1 
HETATM 10643 O O   . HOH J 2 .   ? 38.817  21.801  5.607   1.00 64.30  ? 322 HOH E O   1 
HETATM 10644 O O   . HOH J 2 .   ? 53.512  26.785  11.522  1.00 84.16  ? 323 HOH E O   1 
HETATM 10645 O O   . HOH J 2 .   ? 30.567  22.508  -5.008  1.00 78.60  ? 324 HOH E O   1 
HETATM 10646 O O   . HOH J 2 .   ? 32.304  29.831  -7.606  1.00 124.52 ? 325 HOH E O   1 
HETATM 10647 O O   . HOH J 2 .   ? 33.741  30.715  22.900  1.00 62.70  ? 326 HOH E O   1 
HETATM 10648 O O   . HOH J 2 .   ? 44.134  23.423  18.398  1.00 100.56 ? 327 HOH E O   1 
HETATM 10649 O O   . HOH J 2 .   ? 31.982  34.644  -3.370  1.00 58.14  ? 328 HOH E O   1 
HETATM 10650 O O   . HOH J 2 .   ? 23.197  23.840  -21.410 1.00 83.55  ? 329 HOH E O   1 
HETATM 10651 O O   . HOH J 2 .   ? 47.268  41.443  7.027   1.00 61.89  ? 330 HOH E O   1 
HETATM 10652 O O   . HOH J 2 .   ? 65.206  31.491  -7.372  1.00 64.92  ? 331 HOH E O   1 
HETATM 10653 O O   . HOH J 2 .   ? 38.175  32.052  -7.775  1.00 48.69  ? 332 HOH E O   1 
HETATM 10654 O O   . HOH J 2 .   ? 19.368  29.912  -4.073  1.00 73.33  ? 333 HOH E O   1 
HETATM 10655 O O   . HOH J 2 .   ? 19.276  37.133  8.490   1.00 50.61  ? 334 HOH E O   1 
HETATM 10656 O O   . HOH J 2 .   ? 27.227  39.271  3.469   1.00 117.24 ? 335 HOH E O   1 
HETATM 10657 O O   . HOH J 2 .   ? 43.617  25.931  21.536  1.00 63.50  ? 336 HOH E O   1 
HETATM 10658 O O   . HOH J 2 .   ? 13.291  45.747  3.537   1.00 60.15  ? 337 HOH E O   1 
HETATM 10659 O O   . HOH J 2 .   ? -2.277  33.340  -15.421 1.00 54.60  ? 338 HOH E O   1 
HETATM 10660 O O   . HOH J 2 .   ? 16.290  43.332  -23.998 1.00 123.04 ? 339 HOH E O   1 
HETATM 10661 O O   . HOH J 2 .   ? 34.831  39.911  7.975   1.00 58.67  ? 340 HOH E O   1 
HETATM 10662 O O   . HOH J 2 .   ? 12.105  46.596  -8.167  1.00 52.34  ? 341 HOH E O   1 
HETATM 10663 O O   . HOH J 2 .   ? 57.022  27.319  14.927  1.00 69.47  ? 342 HOH E O   1 
HETATM 10664 O O   . HOH J 2 .   ? 28.096  29.335  -3.907  1.00 58.66  ? 343 HOH E O   1 
HETATM 10665 O O   . HOH J 2 .   ? 12.786  49.595  -8.032  1.00 70.00  ? 344 HOH E O   1 
HETATM 10666 O O   . HOH J 2 .   ? 26.206  36.355  3.951   1.00 113.89 ? 345 HOH E O   1 
HETATM 10667 O O   . HOH J 2 .   ? 32.242  36.177  7.277   1.00 84.42  ? 346 HOH E O   1 
HETATM 10668 O O   . HOH J 2 .   ? 24.334  43.127  11.213  1.00 72.91  ? 347 HOH E O   1 
HETATM 10669 O O   . HOH J 2 .   ? 10.401  44.500  -0.523  1.00 38.88  ? 348 HOH E O   1 
HETATM 10670 O O   . HOH J 2 .   ? 36.686  32.955  8.064   1.00 48.88  ? 349 HOH E O   1 
HETATM 10671 O O   . HOH J 2 .   ? 33.989  7.804   -6.614  1.00 124.22 ? 350 HOH E O   1 
HETATM 10672 O O   . HOH J 2 .   ? 33.628  33.818  15.046  1.00 84.35  ? 351 HOH E O   1 
HETATM 10673 O O   . HOH J 2 .   ? 55.518  33.992  -2.931  1.00 87.42  ? 352 HOH E O   1 
HETATM 10674 O O   . HOH J 2 .   ? 42.671  42.360  7.288   1.00 75.61  ? 353 HOH E O   1 
HETATM 10675 O O   . HOH J 2 .   ? 12.609  44.778  -27.386 1.00 33.14  ? 354 HOH E O   1 
HETATM 10676 O O   . HOH J 2 .   ? 53.105  16.124  0.713   1.00 71.41  ? 355 HOH E O   1 
HETATM 10677 O O   . HOH J 2 .   ? 7.511   52.977  -24.661 1.00 46.96  ? 356 HOH E O   1 
HETATM 10678 O O   . HOH J 2 .   ? 15.144  46.579  -27.920 1.00 61.33  ? 357 HOH E O   1 
HETATM 10679 O O   . HOH J 2 .   ? 42.075  25.737  5.782   1.00 68.97  ? 358 HOH E O   1 
HETATM 10680 O O   . HOH J 2 .   ? 33.151  41.796  9.124   1.00 69.69  ? 359 HOH E O   1 
HETATM 10681 O O   . HOH J 2 .   ? 24.661  26.923  -24.304 1.00 61.52  ? 360 HOH E O   1 
HETATM 10682 O O   . HOH J 2 .   ? 18.140  35.842  11.678  1.00 56.00  ? 361 HOH E O   1 
HETATM 10683 O O   . HOH J 2 .   ? 36.430  27.013  6.884   1.00 101.73 ? 362 HOH E O   1 
HETATM 10684 O O   . HOH J 2 .   ? 3.505   27.327  -20.223 1.00 44.71  ? 363 HOH E O   1 
HETATM 10685 O O   . HOH J 2 .   ? 11.772  48.128  -24.119 1.00 28.80  ? 364 HOH E O   1 
HETATM 10686 O O   . HOH J 2 .   ? 7.422   44.353  -0.347  1.00 41.64  ? 365 HOH E O   1 
HETATM 10687 O O   . HOH J 2 .   ? 53.331  14.002  4.072   1.00 67.13  ? 366 HOH E O   1 
HETATM 10688 O O   . HOH J 2 .   ? -5.125  31.731  -16.221 1.00 83.41  ? 367 HOH E O   1 
HETATM 10689 O O   . HOH J 2 .   ? 35.353  39.640  10.993  1.00 55.62  ? 368 HOH E O   1 
HETATM 10690 O O   . HOH J 2 .   ? 12.976  48.312  -5.481  1.00 48.14  ? 369 HOH E O   1 
HETATM 10691 O O   . HOH J 2 .   ? 35.998  31.561  21.265  1.00 54.77  ? 370 HOH E O   1 
HETATM 10692 O O   . HOH J 2 .   ? 34.443  51.195  -20.673 1.00 56.55  ? 371 HOH E O   1 
HETATM 10693 O O   . HOH J 2 .   ? 16.833  34.055  -7.951  1.00 85.67  ? 372 HOH E O   1 
HETATM 10694 O O   . HOH J 2 .   ? 29.781  37.982  16.538  1.00 96.26  ? 373 HOH E O   1 
HETATM 10695 O O   . HOH J 2 .   ? 17.870  44.928  -27.568 1.00 52.26  ? 374 HOH E O   1 
HETATM 10696 O O   . HOH J 2 .   ? 13.083  24.500  -14.264 1.00 47.84  ? 375 HOH E O   1 
HETATM 10697 O O   . HOH J 2 .   ? 34.926  24.988  -7.007  1.00 84.31  ? 376 HOH E O   1 
HETATM 10698 O O   . HOH J 2 .   ? 37.030  30.552  6.850   1.00 90.42  ? 377 HOH E O   1 
HETATM 10699 O O   . HOH J 2 .   ? 48.424  8.489   3.428   1.00 32.79  ? 378 HOH E O   1 
HETATM 10700 O O   . HOH J 2 .   ? 21.738  55.150  -21.594 1.00 120.20 ? 379 HOH E O   1 
HETATM 10701 O O   . HOH J 2 .   ? 30.381  11.520  -4.248  1.00 74.73  ? 380 HOH E O   1 
HETATM 10702 O O   . HOH J 2 .   ? 18.215  32.337  -5.108  1.00 62.63  ? 381 HOH E O   1 
HETATM 10703 O O   . HOH J 2 .   ? 36.662  8.108   2.985   1.00 65.71  ? 382 HOH E O   1 
HETATM 10704 O O   . HOH J 2 .   ? 49.968  13.132  15.735  1.00 37.96  ? 383 HOH E O   1 
HETATM 10705 O O   . HOH J 2 .   ? 16.174  45.661  5.979   1.00 64.70  ? 384 HOH E O   1 
HETATM 10706 O O   . HOH J 2 .   ? 16.304  52.841  -21.922 1.00 62.03  ? 385 HOH E O   1 
HETATM 10707 O O   . HOH J 2 .   ? 52.503  23.290  17.754  1.00 90.68  ? 386 HOH E O   1 
HETATM 10708 O O   . HOH J 2 .   ? 18.426  39.165  11.397  1.00 37.01  ? 387 HOH E O   1 
HETATM 10709 O O   . HOH J 2 .   ? 30.437  42.242  9.222   1.00 66.61  ? 388 HOH E O   1 
HETATM 10710 O O   . HOH J 2 .   ? 14.982  48.239  4.972   1.00 48.07  ? 389 HOH E O   1 
HETATM 10711 O O   . HOH J 2 .   ? -5.091  33.716  -13.788 1.00 57.56  ? 390 HOH E O   1 
HETATM 10712 O O   . HOH J 2 .   ? 22.751  34.972  -7.752  1.00 77.23  ? 391 HOH E O   1 
HETATM 10713 O O   . HOH J 2 .   ? 4.684   43.681  -1.447  1.00 61.11  ? 392 HOH E O   1 
HETATM 10714 O O   . HOH J 2 .   ? 53.536  20.653  17.929  1.00 78.26  ? 393 HOH E O   1 
HETATM 10715 O O   . HOH J 2 .   ? 50.840  8.767   -1.332  1.00 55.93  ? 394 HOH E O   1 
HETATM 10716 O O   . HOH J 2 .   ? 11.563  23.671  -11.498 1.00 96.69  ? 395 HOH E O   1 
HETATM 10717 O O   . HOH J 2 .   ? 52.182  28.777  8.642   1.00 103.29 ? 396 HOH E O   1 
HETATM 10718 O O   . HOH J 2 .   ? 37.479  34.568  -14.226 1.00 49.66  ? 397 HOH E O   1 
HETATM 10719 O O   . HOH J 2 .   ? 14.335  42.450  -27.883 1.00 76.94  ? 398 HOH E O   1 
HETATM 10720 O O   . HOH J 2 .   ? 39.947  9.495   14.102  1.00 67.90  ? 399 HOH E O   1 
HETATM 10721 O O   . HOH J 2 .   ? 33.675  36.837  10.787  1.00 63.39  ? 400 HOH E O   1 
HETATM 10722 O O   . HOH J 2 .   ? 33.060  15.926  5.718   1.00 67.18  ? 401 HOH E O   1 
HETATM 10723 O O   . HOH J 2 .   ? 12.982  34.164  -13.425 1.00 131.82 ? 402 HOH E O   1 
HETATM 10724 O O   . HOH J 2 .   ? 18.257  19.885  -23.107 1.00 70.45  ? 403 HOH E O   1 
HETATM 10725 O O   . HOH J 2 .   ? 25.567  34.522  -8.145  1.00 151.02 ? 404 HOH E O   1 
HETATM 10726 O O   . HOH J 2 .   ? 33.810  29.577  0.525   1.00 99.50  ? 405 HOH E O   1 
HETATM 10727 O O   . HOH J 2 .   ? 27.095  17.710  -6.421  1.00 68.70  ? 406 HOH E O   1 
HETATM 10728 O O   . HOH J 2 .   ? 44.128  10.629  -7.572  1.00 80.32  ? 407 HOH E O   1 
HETATM 10729 O O   . HOH J 2 .   ? 20.332  30.415  -24.272 1.00 185.20 ? 408 HOH E O   1 
HETATM 10730 O O   . HOH J 2 .   ? 22.631  42.391  13.220  1.00 43.87  ? 409 HOH E O   1 
HETATM 10731 O O   . HOH J 2 .   ? 20.336  57.622  -19.799 1.00 78.49  ? 410 HOH E O   1 
HETATM 10732 O O   . HOH J 2 .   ? 25.471  30.878  -3.829  1.00 158.72 ? 411 HOH E O   1 
HETATM 10733 O O   . HOH J 2 .   ? 35.359  18.603  -7.605  1.00 71.36  ? 412 HOH E O   1 
HETATM 10734 O O   . HOH J 2 .   ? 54.393  17.944  -2.153  1.00 58.01  ? 413 HOH E O   1 
HETATM 10735 O O   . HOH J 2 .   ? 4.634   46.244  1.163   1.00 61.17  ? 414 HOH E O   1 
HETATM 10736 O O   . HOH J 2 .   ? 26.565  31.288  0.829   1.00 77.65  ? 415 HOH E O   1 
HETATM 10737 O O   . HOH J 2 .   ? 3.144   44.567  -21.491 1.00 40.28  ? 416 HOH E O   1 
HETATM 10738 O O   . HOH J 2 .   ? 29.578  42.380  6.114   1.00 97.35  ? 417 HOH E O   1 
HETATM 10739 O O   . HOH J 2 .   ? 2.155   43.973  -0.648  1.00 56.99  ? 418 HOH E O   1 
HETATM 10740 O O   . HOH J 2 .   ? 5.878   42.811  -3.824  1.00 36.61  ? 419 HOH E O   1 
HETATM 10741 O O   . HOH J 2 .   ? 74.632  39.485  -6.436  1.00 55.15  ? 420 HOH E O   1 
HETATM 10742 O O   . HOH J 2 .   ? 48.636  9.795   0.597   1.00 93.56  ? 421 HOH E O   1 
HETATM 10743 O O   . HOH J 2 .   ? 13.252  24.173  -17.504 1.00 82.81  ? 422 HOH E O   1 
HETATM 10744 O O   . HOH J 2 .   ? 46.378  16.820  2.445   1.00 170.33 ? 423 HOH E O   1 
HETATM 10745 O O   . HOH J 2 .   ? 54.438  20.064  14.890  1.00 61.98  ? 424 HOH E O   1 
HETATM 10746 O O   . HOH J 2 .   ? 48.636  35.045  9.638   1.00 137.53 ? 425 HOH E O   1 
HETATM 10747 O O   . HOH J 2 .   ? 51.413  34.961  -16.398 1.00 67.70  ? 426 HOH E O   1 
HETATM 10748 O O   . HOH J 2 .   ? 21.175  40.113  14.230  1.00 45.16  ? 427 HOH E O   1 
HETATM 10749 O O   . HOH J 2 .   ? 10.467  41.717  1.007   1.00 80.64  ? 428 HOH E O   1 
HETATM 10750 O O   . HOH J 2 .   ? 16.684  37.219  9.619   1.00 113.16 ? 429 HOH E O   1 
HETATM 10751 O O   . HOH J 2 .   ? 14.413  51.696  -12.729 1.00 69.11  ? 430 HOH E O   1 
HETATM 10752 O O   . HOH J 2 .   ? 49.325  6.775   0.479   1.00 96.33  ? 431 HOH E O   1 
HETATM 10753 O O   . HOH J 2 .   ? 10.421  45.790  -29.559 1.00 45.23  ? 432 HOH E O   1 
HETATM 10754 O O   . HOH J 2 .   ? 31.138  19.154  8.379   1.00 65.79  ? 433 HOH E O   1 
HETATM 10755 O O   . HOH J 2 .   ? 54.756  18.716  0.750   1.00 77.97  ? 434 HOH E O   1 
HETATM 10756 O O   . HOH J 2 .   ? 2.483   46.944  -18.939 1.00 51.45  ? 435 HOH E O   1 
HETATM 10757 O O   . HOH J 2 .   ? 34.575  24.856  7.899   1.00 54.34  ? 436 HOH E O   1 
HETATM 10758 O O   . HOH J 2 .   ? 19.479  52.741  -16.850 1.00 87.79  ? 437 HOH E O   1 
HETATM 10759 O O   . HOH J 2 .   ? 3.328   40.642  -1.706  1.00 40.04  ? 438 HOH E O   1 
HETATM 10760 O O   . HOH J 2 .   ? 64.293  32.949  -11.342 1.00 53.85  ? 439 HOH E O   1 
HETATM 10761 O O   . HOH J 2 .   ? 57.779  21.714  8.136   1.00 50.89  ? 440 HOH E O   1 
HETATM 10762 O O   . HOH J 2 .   ? 10.301  45.363  2.640   1.00 64.35  ? 441 HOH E O   1 
HETATM 10763 O O   . HOH J 2 .   ? 24.791  50.500  -22.395 1.00 188.47 ? 442 HOH E O   1 
HETATM 10764 O O   . HOH J 2 .   ? 50.582  27.805  10.771  1.00 170.60 ? 443 HOH E O   1 
HETATM 10765 O O   . HOH J 2 .   ? 32.788  19.214  5.615   1.00 53.51  ? 444 HOH E O   1 
HETATM 10766 O O   . HOH J 2 .   ? 41.125  31.099  6.276   1.00 68.92  ? 445 HOH E O   1 
HETATM 10767 O O   . HOH J 2 .   ? 48.574  34.763  16.786  1.00 77.31  ? 446 HOH E O   1 
HETATM 10768 O O   . HOH J 2 .   ? 31.653  28.879  4.493   1.00 82.94  ? 447 HOH E O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ARG 1   -1  -1  ARG ARG A . n 
A 1 2   ALA 2   0   0   ALA ALA A . n 
A 1 3   MET 3   1   1   MET MET A . n 
A 1 4   SER 4   2   2   SER SER A . n 
A 1 5   VAL 5   3   3   VAL VAL A . n 
A 1 6   GLY 6   4   4   GLY GLY A . n 
A 1 7   PHE 7   5   5   PHE PHE A . n 
A 1 8   ILE 8   6   6   ILE ILE A . n 
A 1 9   GLY 9   7   7   GLY GLY A . n 
A 1 10  ALA 10  8   8   ALA ALA A . n 
A 1 11  GLY 11  9   9   GLY GLY A . n 
A 1 12  GLN 12  10  10  GLN GLN A . n 
A 1 13  LEU 13  11  11  LEU LEU A . n 
A 1 14  ALA 14  12  12  ALA ALA A . n 
A 1 15  PHE 15  13  13  PHE PHE A . n 
A 1 16  ALA 16  14  14  ALA ALA A . n 
A 1 17  LEU 17  15  15  LEU LEU A . n 
A 1 18  ALA 18  16  16  ALA ALA A . n 
A 1 19  LYS 19  17  17  LYS LYS A . n 
A 1 20  GLY 20  18  18  GLY GLY A . n 
A 1 21  PHE 21  19  19  PHE PHE A . n 
A 1 22  THR 22  20  20  THR THR A . n 
A 1 23  ALA 23  21  21  ALA ALA A . n 
A 1 24  ALA 24  22  22  ALA ALA A . n 
A 1 25  GLY 25  23  23  GLY GLY A . n 
A 1 26  VAL 26  24  24  VAL VAL A . n 
A 1 27  LEU 27  25  25  LEU LEU A . n 
A 1 28  ALA 28  26  26  ALA ALA A . n 
A 1 29  ALA 29  27  27  ALA ALA A . n 
A 1 30  HIS 30  28  28  HIS HIS A . n 
A 1 31  LYS 31  29  29  LYS LYS A . n 
A 1 32  ILE 32  30  30  ILE ILE A . n 
A 1 33  MET 33  31  31  MET MET A . n 
A 1 34  ALA 34  32  32  ALA ALA A . n 
A 1 35  SER 35  33  33  SER SER A . n 
A 1 36  SER 36  34  34  SER SER A . n 
A 1 37  PRO 37  35  35  PRO PRO A . n 
A 1 38  ASP 38  36  36  ASP ASP A . n 
A 1 39  MET 39  37  37  MET MET A . n 
A 1 40  ASP 40  38  38  ASP ASP A . n 
A 1 41  LEU 41  39  39  LEU LEU A . n 
A 1 42  ALA 42  40  40  ALA ALA A . n 
A 1 43  THR 43  41  41  THR THR A . n 
A 1 44  VAL 44  42  42  VAL VAL A . n 
A 1 45  SER 45  43  43  SER SER A . n 
A 1 46  ALA 46  44  44  ALA ALA A . n 
A 1 47  LEU 47  45  45  LEU LEU A . n 
A 1 48  ARG 48  46  46  ARG ARG A . n 
A 1 49  LYS 49  47  47  LYS LYS A . n 
A 1 50  MET 50  48  48  MET MET A . n 
A 1 51  GLY 51  49  49  GLY GLY A . n 
A 1 52  VAL 52  50  50  VAL VAL A . n 
A 1 53  LYS 53  51  51  LYS LYS A . n 
A 1 54  LEU 54  52  52  LEU LEU A . n 
A 1 55  THR 55  53  53  THR THR A . n 
A 1 56  PRO 56  54  54  PRO PRO A . n 
A 1 57  HIS 57  55  55  HIS HIS A . n 
A 1 58  ASN 58  56  56  ASN ASN A . n 
A 1 59  LYS 59  57  57  LYS LYS A . n 
A 1 60  GLU 60  58  58  GLU GLU A . n 
A 1 61  THR 61  59  59  THR THR A . n 
A 1 62  VAL 62  60  60  VAL VAL A . n 
A 1 63  GLN 63  61  61  GLN GLN A . n 
A 1 64  HIS 64  62  62  HIS HIS A . n 
A 1 65  SER 65  63  63  SER SER A . n 
A 1 66  ASP 66  64  64  ASP ASP A . n 
A 1 67  VAL 67  65  65  VAL VAL A . n 
A 1 68  LEU 68  66  66  LEU LEU A . n 
A 1 69  PHE 69  67  67  PHE PHE A . n 
A 1 70  LEU 70  68  68  LEU LEU A . n 
A 1 71  ALA 71  69  69  ALA ALA A . n 
A 1 72  VAL 72  70  70  VAL VAL A . n 
A 1 73  LYS 73  71  71  LYS LYS A . n 
A 1 74  PRO 74  72  72  PRO PRO A . n 
A 1 75  HIS 75  73  73  HIS HIS A . n 
A 1 76  ILE 76  74  74  ILE ILE A . n 
A 1 77  ILE 77  75  75  ILE ILE A . n 
A 1 78  PRO 78  76  76  PRO PRO A . n 
A 1 79  PHE 79  77  77  PHE PHE A . n 
A 1 80  ILE 80  78  78  ILE ILE A . n 
A 1 81  LEU 81  79  79  LEU LEU A . n 
A 1 82  ASP 82  80  80  ASP ASP A . n 
A 1 83  GLU 83  81  81  GLU GLU A . n 
A 1 84  ILE 84  82  82  ILE ILE A . n 
A 1 85  GLY 85  83  83  GLY GLY A . n 
A 1 86  ALA 86  84  84  ALA ALA A . n 
A 1 87  ASP 87  85  85  ASP ASP A . n 
A 1 88  ILE 88  86  86  ILE ILE A . n 
A 1 89  GLU 89  87  87  GLU GLU A . n 
A 1 90  ASP 90  88  88  ASP ASP A . n 
A 1 91  ARG 91  89  89  ARG ARG A . n 
A 1 92  HIS 92  90  90  HIS HIS A . n 
A 1 93  ILE 93  91  91  ILE ILE A . n 
A 1 94  VAL 94  92  92  VAL VAL A . n 
A 1 95  VAL 95  93  93  VAL VAL A . n 
A 1 96  SER 96  94  94  SER SER A . n 
A 1 97  CYS 97  95  95  CYS CYS A . n 
A 1 98  ALA 98  96  96  ALA ALA A . n 
A 1 99  ALA 99  97  97  ALA ALA A . n 
A 1 100 GLY 100 98  98  GLY GLY A . n 
A 1 101 VAL 101 99  99  VAL VAL A . n 
A 1 102 THR 102 100 100 THR THR A . n 
A 1 103 ILE 103 101 101 ILE ILE A . n 
A 1 104 SER 104 102 102 SER SER A . n 
A 1 105 SER 105 103 103 SER SER A . n 
A 1 106 ILE 106 104 104 ILE ILE A . n 
A 1 107 GLU 107 105 105 GLU GLU A . n 
A 1 108 LYS 108 106 106 LYS LYS A . n 
A 1 109 LYS 109 107 107 LYS LYS A . n 
A 1 110 LEU 110 108 108 LEU LEU A . n 
A 1 111 SER 111 109 109 SER SER A . n 
A 1 112 ALA 112 110 110 ALA ALA A . n 
A 1 113 PHE 113 111 111 PHE PHE A . n 
A 1 114 ARG 114 112 112 ARG ARG A . n 
A 1 115 PRO 115 113 113 PRO PRO A . n 
A 1 116 ALA 116 114 114 ALA ALA A . n 
A 1 117 PRO 117 115 115 PRO PRO A . n 
A 1 118 ARG 118 116 116 ARG ARG A . n 
A 1 119 VAL 119 117 117 VAL VAL A . n 
A 1 120 ILE 120 118 118 ILE ILE A . n 
A 1 121 ARG 121 119 119 ARG ARG A . n 
A 1 122 CYS 122 120 120 CYS CYS A . n 
A 1 123 MET 123 121 121 MET MET A . n 
A 1 124 THR 124 122 122 THR THR A . n 
A 1 125 ASN 125 123 123 ASN ASN A . n 
A 1 126 THR 126 124 124 THR THR A . n 
A 1 127 PRO 127 125 125 PRO PRO A . n 
A 1 128 VAL 128 126 126 VAL VAL A . n 
A 1 129 VAL 129 127 127 VAL VAL A . n 
A 1 130 VAL 130 128 128 VAL VAL A . n 
A 1 131 ARG 131 129 129 ARG ARG A . n 
A 1 132 GLU 132 130 130 GLU GLU A . n 
A 1 133 GLY 133 131 131 GLY GLY A . n 
A 1 134 ALA 134 132 132 ALA ALA A . n 
A 1 135 THR 135 133 133 THR THR A . n 
A 1 136 VAL 136 134 134 VAL VAL A . n 
A 1 137 TYR 137 135 135 TYR TYR A . n 
A 1 138 ALA 138 136 136 ALA ALA A . n 
A 1 139 THR 139 137 137 THR THR A . n 
A 1 140 GLY 140 138 138 GLY GLY A . n 
A 1 141 THR 141 139 139 THR THR A . n 
A 1 142 HIS 142 140 140 HIS HIS A . n 
A 1 143 ALA 143 141 141 ALA ALA A . n 
A 1 144 GLN 144 142 142 GLN GLN A . n 
A 1 145 VAL 145 143 143 VAL VAL A . n 
A 1 146 GLU 146 144 144 GLU GLU A . n 
A 1 147 ASP 147 145 145 ASP ASP A . n 
A 1 148 GLY 148 146 146 GLY GLY A . n 
A 1 149 ARG 149 147 147 ARG ARG A . n 
A 1 150 LEU 150 148 148 LEU LEU A . n 
A 1 151 MET 151 149 149 MET MET A . n 
A 1 152 GLU 152 150 150 GLU GLU A . n 
A 1 153 GLN 153 151 151 GLN GLN A . n 
A 1 154 LEU 154 152 152 LEU LEU A . n 
A 1 155 LEU 155 153 153 LEU LEU A . n 
A 1 156 SER 156 154 154 SER SER A . n 
A 1 157 SER 157 155 155 SER SER A . n 
A 1 158 VAL 158 156 156 VAL VAL A . n 
A 1 159 GLY 159 157 157 GLY GLY A . n 
A 1 160 PHE 160 158 158 PHE PHE A . n 
A 1 161 CYS 161 159 159 CYS CYS A . n 
A 1 162 THR 162 160 160 THR THR A . n 
A 1 163 GLU 163 161 161 GLU GLU A . n 
A 1 164 VAL 164 162 162 VAL VAL A . n 
A 1 165 GLU 165 163 163 GLU GLU A . n 
A 1 166 GLU 166 164 164 GLU GLU A . n 
A 1 167 ASP 167 165 165 ASP ASP A . n 
A 1 168 LEU 168 166 166 LEU LEU A . n 
A 1 169 ILE 169 167 167 ILE ILE A . n 
A 1 170 ASP 170 168 168 ASP ASP A . n 
A 1 171 ALA 171 169 169 ALA ALA A . n 
A 1 172 VAL 172 170 170 VAL VAL A . n 
A 1 173 THR 173 171 171 THR THR A . n 
A 1 174 GLY 174 172 172 GLY GLY A . n 
A 1 175 LEU 175 173 173 LEU LEU A . n 
A 1 176 SER 176 174 174 SER SER A . n 
A 1 177 GLY 177 175 175 GLY GLY A . n 
A 1 178 SER 178 176 176 SER SER A . n 
A 1 179 GLY 179 177 177 GLY GLY A . n 
A 1 180 PRO 180 178 178 PRO PRO A . n 
A 1 181 ALA 181 179 179 ALA ALA A . n 
A 1 182 TYR 182 180 180 TYR TYR A . n 
A 1 183 ALA 183 181 181 ALA ALA A . n 
A 1 184 PHE 184 182 182 PHE PHE A . n 
A 1 185 THR 185 183 183 THR THR A . n 
A 1 186 ALA 186 184 184 ALA ALA A . n 
A 1 187 LEU 187 185 185 LEU LEU A . n 
A 1 188 ASP 188 186 186 ASP ASP A . n 
A 1 189 ALA 189 187 187 ALA ALA A . n 
A 1 190 LEU 190 188 188 LEU LEU A . n 
A 1 191 ALA 191 189 189 ALA ALA A . n 
A 1 192 ASP 192 190 190 ASP ASP A . n 
A 1 193 GLY 193 191 191 GLY GLY A . n 
A 1 194 GLY 194 192 192 GLY GLY A . n 
A 1 195 VAL 195 193 193 VAL VAL A . n 
A 1 196 LYS 196 194 194 LYS LYS A . n 
A 1 197 MET 197 195 195 MET MET A . n 
A 1 198 GLY 198 196 196 GLY GLY A . n 
A 1 199 LEU 199 197 197 LEU LEU A . n 
A 1 200 PRO 200 198 198 PRO PRO A . n 
A 1 201 ARG 201 199 199 ARG ARG A . n 
A 1 202 ARG 202 200 200 ARG ARG A . n 
A 1 203 LEU 203 201 201 LEU LEU A . n 
A 1 204 ALA 204 202 202 ALA ALA A . n 
A 1 205 VAL 205 203 203 VAL VAL A . n 
A 1 206 ARG 206 204 204 ARG ARG A . n 
A 1 207 LEU 207 205 205 LEU LEU A . n 
A 1 208 GLY 208 206 206 GLY GLY A . n 
A 1 209 ALA 209 207 207 ALA ALA A . n 
A 1 210 GLN 210 208 208 GLN GLN A . n 
A 1 211 ALA 211 209 209 ALA ALA A . n 
A 1 212 LEU 212 210 210 LEU LEU A . n 
A 1 213 LEU 213 211 211 LEU LEU A . n 
A 1 214 GLY 214 212 212 GLY GLY A . n 
A 1 215 ALA 215 213 213 ALA ALA A . n 
A 1 216 ALA 216 214 214 ALA ALA A . n 
A 1 217 LYS 217 215 215 LYS LYS A . n 
A 1 218 MET 218 216 216 MET MET A . n 
A 1 219 LEU 219 217 217 LEU LEU A . n 
A 1 220 LEU 220 218 218 LEU LEU A . n 
A 1 221 HIS 221 219 219 HIS HIS A . n 
A 1 222 SER 222 220 220 SER SER A . n 
A 1 223 GLU 223 221 221 GLU GLU A . n 
A 1 224 GLN 224 222 222 GLN GLN A . n 
A 1 225 HIS 225 223 223 HIS HIS A . n 
A 1 226 PRO 226 224 224 PRO PRO A . n 
A 1 227 GLY 227 225 225 GLY GLY A . n 
A 1 228 GLN 228 226 226 GLN GLN A . n 
A 1 229 LEU 229 227 227 LEU LEU A . n 
A 1 230 LYS 230 228 228 LYS LYS A . n 
A 1 231 ASP 231 229 229 ASP ASP A . n 
A 1 232 ASN 232 230 230 ASN ASN A . n 
A 1 233 VAL 233 231 231 VAL VAL A . n 
A 1 234 SER 234 232 232 SER SER A . n 
A 1 235 SER 235 233 233 SER SER A . n 
A 1 236 PRO 236 234 234 PRO PRO A . n 
A 1 237 GLY 237 235 235 GLY GLY A . n 
A 1 238 GLY 238 236 236 GLY GLY A . n 
A 1 239 ALA 239 237 237 ALA ALA A . n 
A 1 240 THR 240 238 238 THR THR A . n 
A 1 241 ILE 241 239 239 ILE ILE A . n 
A 1 242 HIS 242 240 240 HIS HIS A . n 
A 1 243 ALA 243 241 241 ALA ALA A . n 
A 1 244 LEU 244 242 242 LEU LEU A . n 
A 1 245 HIS 245 243 243 HIS HIS A . n 
A 1 246 VAL 246 244 244 VAL VAL A . n 
A 1 247 LEU 247 245 245 LEU LEU A . n 
A 1 248 GLU 248 246 246 GLU GLU A . n 
A 1 249 SER 249 247 247 SER SER A . n 
A 1 250 GLY 250 248 248 GLY GLY A . n 
A 1 251 GLY 251 249 249 GLY GLY A . n 
A 1 252 PHE 252 250 250 PHE PHE A . n 
A 1 253 ARG 253 251 251 ARG ARG A . n 
A 1 254 SER 254 252 252 SER SER A . n 
A 1 255 LEU 255 253 253 LEU LEU A . n 
A 1 256 LEU 256 254 254 LEU LEU A . n 
A 1 257 ILE 257 255 255 ILE ILE A . n 
A 1 258 ASN 258 256 256 ASN ASN A . n 
A 1 259 ALA 259 257 257 ALA ALA A . n 
A 1 260 VAL 260 258 258 VAL VAL A . n 
A 1 261 GLU 261 259 259 GLU GLU A . n 
A 1 262 ALA 262 260 260 ALA ALA A . n 
A 1 263 SER 263 261 261 SER SER A . n 
A 1 264 CYS 264 262 262 CYS CYS A . n 
A 1 265 ILE 265 263 263 ILE ILE A . n 
A 1 266 ARG 266 264 264 ARG ARG A . n 
A 1 267 THR 267 265 265 THR THR A . n 
A 1 268 ARG 268 266 266 ARG ARG A . n 
A 1 269 GLU 269 267 267 GLU GLU A . n 
A 1 270 LEU 270 268 268 LEU LEU A . n 
A 1 271 GLN 271 269 269 GLN GLN A . n 
A 1 272 SER 272 270 270 SER SER A . n 
A 1 273 MET 273 271 271 MET MET A . n 
A 1 274 ALA 274 272 272 ALA ALA A . n 
A 1 275 ASP 275 273 273 ASP ASP A . n 
A 1 276 GLN 276 274 274 GLN GLN A . n 
A 1 277 GLU 277 275 275 GLU GLU A . n 
A 1 278 GLN 278 276 ?   ?   ?   A . n 
A 1 279 VAL 279 277 ?   ?   ?   A . n 
A 1 280 SER 280 278 ?   ?   ?   A . n 
A 1 281 PRO 281 279 ?   ?   ?   A . n 
A 1 282 ALA 282 280 ?   ?   ?   A . n 
A 1 283 ALA 283 281 ?   ?   ?   A . n 
A 1 284 ILE 284 282 ?   ?   ?   A . n 
A 1 285 LYS 285 283 ?   ?   ?   A . n 
A 1 286 LYS 286 284 ?   ?   ?   A . n 
A 1 287 THR 287 285 ?   ?   ?   A . n 
A 1 288 ILE 288 286 ?   ?   ?   A . n 
A 1 289 LEU 289 287 ?   ?   ?   A . n 
A 1 290 ASP 290 288 ?   ?   ?   A . n 
A 1 291 LYS 291 289 ?   ?   ?   A . n 
A 1 292 VAL 292 290 ?   ?   ?   A . n 
A 1 293 LYS 293 291 ?   ?   ?   A . n 
A 1 294 LEU 294 292 ?   ?   ?   A . n 
A 1 295 ASP 295 293 ?   ?   ?   A . n 
A 1 296 SER 296 294 ?   ?   ?   A . n 
A 1 297 PRO 297 295 ?   ?   ?   A . n 
A 1 298 ALA 298 296 ?   ?   ?   A . n 
A 1 299 GLY 299 297 ?   ?   ?   A . n 
A 1 300 THR 300 298 ?   ?   ?   A . n 
A 1 301 ALA 301 299 ?   ?   ?   A . n 
A 1 302 LEU 302 300 ?   ?   ?   A . n 
A 1 303 SER 303 301 ?   ?   ?   A . n 
A 1 304 PRO 304 302 ?   ?   ?   A . n 
A 1 305 SER 305 303 ?   ?   ?   A . n 
A 1 306 GLY 306 304 ?   ?   ?   A . n 
A 1 307 HIS 307 305 ?   ?   ?   A . n 
A 1 308 THR 308 306 ?   ?   ?   A . n 
A 1 309 LYS 309 307 ?   ?   ?   A . n 
A 1 310 LEU 310 308 ?   ?   ?   A . n 
A 1 311 LEU 311 309 ?   ?   ?   A . n 
A 1 312 PRO 312 310 ?   ?   ?   A . n 
A 1 313 ARG 313 311 ?   ?   ?   A . n 
A 1 314 SER 314 312 ?   ?   ?   A . n 
A 1 315 LEU 315 313 ?   ?   ?   A . n 
A 1 316 ALA 316 314 ?   ?   ?   A . n 
A 1 317 PRO 317 315 ?   ?   ?   A . n 
A 1 318 ALA 318 316 ?   ?   ?   A . n 
A 1 319 GLY 319 317 ?   ?   ?   A . n 
A 1 320 LYS 320 318 ?   ?   ?   A . n 
A 1 321 ASP 321 319 ?   ?   ?   A . n 
B 1 1   ARG 1   -1  -1  ARG ARG B . n 
B 1 2   ALA 2   0   0   ALA ALA B . n 
B 1 3   MET 3   1   1   MET MET B . n 
B 1 4   SER 4   2   2   SER SER B . n 
B 1 5   VAL 5   3   3   VAL VAL B . n 
B 1 6   GLY 6   4   4   GLY GLY B . n 
B 1 7   PHE 7   5   5   PHE PHE B . n 
B 1 8   ILE 8   6   6   ILE ILE B . n 
B 1 9   GLY 9   7   7   GLY GLY B . n 
B 1 10  ALA 10  8   8   ALA ALA B . n 
B 1 11  GLY 11  9   9   GLY GLY B . n 
B 1 12  GLN 12  10  10  GLN GLN B . n 
B 1 13  LEU 13  11  11  LEU LEU B . n 
B 1 14  ALA 14  12  12  ALA ALA B . n 
B 1 15  PHE 15  13  13  PHE PHE B . n 
B 1 16  ALA 16  14  14  ALA ALA B . n 
B 1 17  LEU 17  15  15  LEU LEU B . n 
B 1 18  ALA 18  16  16  ALA ALA B . n 
B 1 19  LYS 19  17  17  LYS LYS B . n 
B 1 20  GLY 20  18  18  GLY GLY B . n 
B 1 21  PHE 21  19  19  PHE PHE B . n 
B 1 22  THR 22  20  20  THR THR B . n 
B 1 23  ALA 23  21  21  ALA ALA B . n 
B 1 24  ALA 24  22  22  ALA ALA B . n 
B 1 25  GLY 25  23  23  GLY GLY B . n 
B 1 26  VAL 26  24  24  VAL VAL B . n 
B 1 27  LEU 27  25  25  LEU LEU B . n 
B 1 28  ALA 28  26  26  ALA ALA B . n 
B 1 29  ALA 29  27  27  ALA ALA B . n 
B 1 30  HIS 30  28  28  HIS HIS B . n 
B 1 31  LYS 31  29  29  LYS LYS B . n 
B 1 32  ILE 32  30  30  ILE ILE B . n 
B 1 33  MET 33  31  31  MET MET B . n 
B 1 34  ALA 34  32  32  ALA ALA B . n 
B 1 35  SER 35  33  33  SER SER B . n 
B 1 36  SER 36  34  34  SER SER B . n 
B 1 37  PRO 37  35  35  PRO PRO B . n 
B 1 38  ASP 38  36  36  ASP ASP B . n 
B 1 39  MET 39  37  37  MET MET B . n 
B 1 40  ASP 40  38  38  ASP ASP B . n 
B 1 41  LEU 41  39  39  LEU LEU B . n 
B 1 42  ALA 42  40  40  ALA ALA B . n 
B 1 43  THR 43  41  41  THR THR B . n 
B 1 44  VAL 44  42  42  VAL VAL B . n 
B 1 45  SER 45  43  43  SER SER B . n 
B 1 46  ALA 46  44  44  ALA ALA B . n 
B 1 47  LEU 47  45  45  LEU LEU B . n 
B 1 48  ARG 48  46  46  ARG ARG B . n 
B 1 49  LYS 49  47  47  LYS LYS B . n 
B 1 50  MET 50  48  48  MET MET B . n 
B 1 51  GLY 51  49  49  GLY GLY B . n 
B 1 52  VAL 52  50  50  VAL VAL B . n 
B 1 53  LYS 53  51  51  LYS LYS B . n 
B 1 54  LEU 54  52  ?   ?   ?   B . n 
B 1 55  THR 55  53  53  THR THR B . n 
B 1 56  PRO 56  54  54  PRO PRO B . n 
B 1 57  HIS 57  55  55  HIS HIS B . n 
B 1 58  ASN 58  56  56  ASN ASN B . n 
B 1 59  LYS 59  57  57  LYS LYS B . n 
B 1 60  GLU 60  58  58  GLU GLU B . n 
B 1 61  THR 61  59  59  THR THR B . n 
B 1 62  VAL 62  60  60  VAL VAL B . n 
B 1 63  GLN 63  61  61  GLN GLN B . n 
B 1 64  HIS 64  62  62  HIS HIS B . n 
B 1 65  SER 65  63  63  SER SER B . n 
B 1 66  ASP 66  64  64  ASP ASP B . n 
B 1 67  VAL 67  65  65  VAL VAL B . n 
B 1 68  LEU 68  66  66  LEU LEU B . n 
B 1 69  PHE 69  67  67  PHE PHE B . n 
B 1 70  LEU 70  68  68  LEU LEU B . n 
B 1 71  ALA 71  69  69  ALA ALA B . n 
B 1 72  VAL 72  70  70  VAL VAL B . n 
B 1 73  LYS 73  71  71  LYS LYS B . n 
B 1 74  PRO 74  72  72  PRO PRO B . n 
B 1 75  HIS 75  73  73  HIS HIS B . n 
B 1 76  ILE 76  74  74  ILE ILE B . n 
B 1 77  ILE 77  75  75  ILE ILE B . n 
B 1 78  PRO 78  76  76  PRO PRO B . n 
B 1 79  PHE 79  77  77  PHE PHE B . n 
B 1 80  ILE 80  78  78  ILE ILE B . n 
B 1 81  LEU 81  79  79  LEU LEU B . n 
B 1 82  ASP 82  80  80  ASP ASP B . n 
B 1 83  GLU 83  81  81  GLU GLU B . n 
B 1 84  ILE 84  82  82  ILE ILE B . n 
B 1 85  GLY 85  83  83  GLY GLY B . n 
B 1 86  ALA 86  84  84  ALA ALA B . n 
B 1 87  ASP 87  85  85  ASP ASP B . n 
B 1 88  ILE 88  86  86  ILE ILE B . n 
B 1 89  GLU 89  87  87  GLU GLU B . n 
B 1 90  ASP 90  88  88  ASP ASP B . n 
B 1 91  ARG 91  89  89  ARG ARG B . n 
B 1 92  HIS 92  90  90  HIS HIS B . n 
B 1 93  ILE 93  91  91  ILE ILE B . n 
B 1 94  VAL 94  92  92  VAL VAL B . n 
B 1 95  VAL 95  93  93  VAL VAL B . n 
B 1 96  SER 96  94  94  SER SER B . n 
B 1 97  CYS 97  95  95  CYS CYS B . n 
B 1 98  ALA 98  96  96  ALA ALA B . n 
B 1 99  ALA 99  97  97  ALA ALA B . n 
B 1 100 GLY 100 98  98  GLY GLY B . n 
B 1 101 VAL 101 99  99  VAL VAL B . n 
B 1 102 THR 102 100 100 THR THR B . n 
B 1 103 ILE 103 101 101 ILE ILE B . n 
B 1 104 SER 104 102 102 SER SER B . n 
B 1 105 SER 105 103 103 SER SER B . n 
B 1 106 ILE 106 104 104 ILE ILE B . n 
B 1 107 GLU 107 105 105 GLU GLU B . n 
B 1 108 LYS 108 106 106 LYS LYS B . n 
B 1 109 LYS 109 107 107 LYS LYS B . n 
B 1 110 LEU 110 108 108 LEU LEU B . n 
B 1 111 SER 111 109 109 SER SER B . n 
B 1 112 ALA 112 110 110 ALA ALA B . n 
B 1 113 PHE 113 111 111 PHE PHE B . n 
B 1 114 ARG 114 112 112 ARG ARG B . n 
B 1 115 PRO 115 113 113 PRO PRO B . n 
B 1 116 ALA 116 114 114 ALA ALA B . n 
B 1 117 PRO 117 115 115 PRO PRO B . n 
B 1 118 ARG 118 116 116 ARG ARG B . n 
B 1 119 VAL 119 117 117 VAL VAL B . n 
B 1 120 ILE 120 118 118 ILE ILE B . n 
B 1 121 ARG 121 119 119 ARG ARG B . n 
B 1 122 CYS 122 120 120 CYS CYS B . n 
B 1 123 MET 123 121 121 MET MET B . n 
B 1 124 THR 124 122 122 THR THR B . n 
B 1 125 ASN 125 123 123 ASN ASN B . n 
B 1 126 THR 126 124 124 THR THR B . n 
B 1 127 PRO 127 125 125 PRO PRO B . n 
B 1 128 VAL 128 126 126 VAL VAL B . n 
B 1 129 VAL 129 127 127 VAL VAL B . n 
B 1 130 VAL 130 128 128 VAL VAL B . n 
B 1 131 ARG 131 129 129 ARG ARG B . n 
B 1 132 GLU 132 130 130 GLU GLU B . n 
B 1 133 GLY 133 131 131 GLY GLY B . n 
B 1 134 ALA 134 132 132 ALA ALA B . n 
B 1 135 THR 135 133 133 THR THR B . n 
B 1 136 VAL 136 134 134 VAL VAL B . n 
B 1 137 TYR 137 135 135 TYR TYR B . n 
B 1 138 ALA 138 136 136 ALA ALA B . n 
B 1 139 THR 139 137 137 THR THR B . n 
B 1 140 GLY 140 138 138 GLY GLY B . n 
B 1 141 THR 141 139 139 THR THR B . n 
B 1 142 HIS 142 140 140 HIS HIS B . n 
B 1 143 ALA 143 141 141 ALA ALA B . n 
B 1 144 GLN 144 142 142 GLN GLN B . n 
B 1 145 VAL 145 143 143 VAL VAL B . n 
B 1 146 GLU 146 144 144 GLU GLU B . n 
B 1 147 ASP 147 145 145 ASP ASP B . n 
B 1 148 GLY 148 146 146 GLY GLY B . n 
B 1 149 ARG 149 147 147 ARG ARG B . n 
B 1 150 LEU 150 148 148 LEU LEU B . n 
B 1 151 MET 151 149 149 MET MET B . n 
B 1 152 GLU 152 150 150 GLU GLU B . n 
B 1 153 GLN 153 151 151 GLN GLN B . n 
B 1 154 LEU 154 152 152 LEU LEU B . n 
B 1 155 LEU 155 153 153 LEU LEU B . n 
B 1 156 SER 156 154 154 SER SER B . n 
B 1 157 SER 157 155 155 SER SER B . n 
B 1 158 VAL 158 156 156 VAL VAL B . n 
B 1 159 GLY 159 157 157 GLY GLY B . n 
B 1 160 PHE 160 158 158 PHE PHE B . n 
B 1 161 CYS 161 159 159 CYS CYS B . n 
B 1 162 THR 162 160 160 THR THR B . n 
B 1 163 GLU 163 161 161 GLU GLU B . n 
B 1 164 VAL 164 162 162 VAL VAL B . n 
B 1 165 GLU 165 163 163 GLU GLU B . n 
B 1 166 GLU 166 164 164 GLU GLU B . n 
B 1 167 ASP 167 165 165 ASP ASP B . n 
B 1 168 LEU 168 166 166 LEU LEU B . n 
B 1 169 ILE 169 167 167 ILE ILE B . n 
B 1 170 ASP 170 168 168 ASP ASP B . n 
B 1 171 ALA 171 169 169 ALA ALA B . n 
B 1 172 VAL 172 170 170 VAL VAL B . n 
B 1 173 THR 173 171 171 THR THR B . n 
B 1 174 GLY 174 172 172 GLY GLY B . n 
B 1 175 LEU 175 173 173 LEU LEU B . n 
B 1 176 SER 176 174 174 SER SER B . n 
B 1 177 GLY 177 175 175 GLY GLY B . n 
B 1 178 SER 178 176 176 SER SER B . n 
B 1 179 GLY 179 177 177 GLY GLY B . n 
B 1 180 PRO 180 178 178 PRO PRO B . n 
B 1 181 ALA 181 179 179 ALA ALA B . n 
B 1 182 TYR 182 180 180 TYR TYR B . n 
B 1 183 ALA 183 181 181 ALA ALA B . n 
B 1 184 PHE 184 182 182 PHE PHE B . n 
B 1 185 THR 185 183 183 THR THR B . n 
B 1 186 ALA 186 184 184 ALA ALA B . n 
B 1 187 LEU 187 185 185 LEU LEU B . n 
B 1 188 ASP 188 186 186 ASP ASP B . n 
B 1 189 ALA 189 187 187 ALA ALA B . n 
B 1 190 LEU 190 188 188 LEU LEU B . n 
B 1 191 ALA 191 189 189 ALA ALA B . n 
B 1 192 ASP 192 190 190 ASP ASP B . n 
B 1 193 GLY 193 191 191 GLY GLY B . n 
B 1 194 GLY 194 192 192 GLY GLY B . n 
B 1 195 VAL 195 193 193 VAL VAL B . n 
B 1 196 LYS 196 194 194 LYS LYS B . n 
B 1 197 MET 197 195 195 MET MET B . n 
B 1 198 GLY 198 196 196 GLY GLY B . n 
B 1 199 LEU 199 197 197 LEU LEU B . n 
B 1 200 PRO 200 198 198 PRO PRO B . n 
B 1 201 ARG 201 199 199 ARG ARG B . n 
B 1 202 ARG 202 200 200 ARG ARG B . n 
B 1 203 LEU 203 201 201 LEU LEU B . n 
B 1 204 ALA 204 202 202 ALA ALA B . n 
B 1 205 VAL 205 203 203 VAL VAL B . n 
B 1 206 ARG 206 204 204 ARG ARG B . n 
B 1 207 LEU 207 205 205 LEU LEU B . n 
B 1 208 GLY 208 206 206 GLY GLY B . n 
B 1 209 ALA 209 207 207 ALA ALA B . n 
B 1 210 GLN 210 208 208 GLN GLN B . n 
B 1 211 ALA 211 209 209 ALA ALA B . n 
B 1 212 LEU 212 210 210 LEU LEU B . n 
B 1 213 LEU 213 211 211 LEU LEU B . n 
B 1 214 GLY 214 212 212 GLY GLY B . n 
B 1 215 ALA 215 213 213 ALA ALA B . n 
B 1 216 ALA 216 214 214 ALA ALA B . n 
B 1 217 LYS 217 215 215 LYS LYS B . n 
B 1 218 MET 218 216 216 MET MET B . n 
B 1 219 LEU 219 217 217 LEU LEU B . n 
B 1 220 LEU 220 218 218 LEU LEU B . n 
B 1 221 HIS 221 219 219 HIS HIS B . n 
B 1 222 SER 222 220 220 SER SER B . n 
B 1 223 GLU 223 221 221 GLU GLU B . n 
B 1 224 GLN 224 222 222 GLN GLN B . n 
B 1 225 HIS 225 223 223 HIS HIS B . n 
B 1 226 PRO 226 224 224 PRO PRO B . n 
B 1 227 GLY 227 225 225 GLY GLY B . n 
B 1 228 GLN 228 226 226 GLN GLN B . n 
B 1 229 LEU 229 227 227 LEU LEU B . n 
B 1 230 LYS 230 228 228 LYS LYS B . n 
B 1 231 ASP 231 229 229 ASP ASP B . n 
B 1 232 ASN 232 230 230 ASN ASN B . n 
B 1 233 VAL 233 231 231 VAL VAL B . n 
B 1 234 SER 234 232 232 SER SER B . n 
B 1 235 SER 235 233 233 SER SER B . n 
B 1 236 PRO 236 234 234 PRO PRO B . n 
B 1 237 GLY 237 235 235 GLY GLY B . n 
B 1 238 GLY 238 236 236 GLY GLY B . n 
B 1 239 ALA 239 237 237 ALA ALA B . n 
B 1 240 THR 240 238 238 THR THR B . n 
B 1 241 ILE 241 239 239 ILE ILE B . n 
B 1 242 HIS 242 240 240 HIS HIS B . n 
B 1 243 ALA 243 241 241 ALA ALA B . n 
B 1 244 LEU 244 242 242 LEU LEU B . n 
B 1 245 HIS 245 243 243 HIS HIS B . n 
B 1 246 VAL 246 244 244 VAL VAL B . n 
B 1 247 LEU 247 245 245 LEU LEU B . n 
B 1 248 GLU 248 246 246 GLU GLU B . n 
B 1 249 SER 249 247 247 SER SER B . n 
B 1 250 GLY 250 248 248 GLY GLY B . n 
B 1 251 GLY 251 249 249 GLY GLY B . n 
B 1 252 PHE 252 250 250 PHE PHE B . n 
B 1 253 ARG 253 251 251 ARG ARG B . n 
B 1 254 SER 254 252 252 SER SER B . n 
B 1 255 LEU 255 253 253 LEU LEU B . n 
B 1 256 LEU 256 254 254 LEU LEU B . n 
B 1 257 ILE 257 255 255 ILE ILE B . n 
B 1 258 ASN 258 256 256 ASN ASN B . n 
B 1 259 ALA 259 257 257 ALA ALA B . n 
B 1 260 VAL 260 258 258 VAL VAL B . n 
B 1 261 GLU 261 259 259 GLU GLU B . n 
B 1 262 ALA 262 260 260 ALA ALA B . n 
B 1 263 SER 263 261 261 SER SER B . n 
B 1 264 CYS 264 262 262 CYS CYS B . n 
B 1 265 ILE 265 263 263 ILE ILE B . n 
B 1 266 ARG 266 264 264 ARG ARG B . n 
B 1 267 THR 267 265 265 THR THR B . n 
B 1 268 ARG 268 266 266 ARG ARG B . n 
B 1 269 GLU 269 267 267 GLU GLU B . n 
B 1 270 LEU 270 268 268 LEU LEU B . n 
B 1 271 GLN 271 269 269 GLN GLN B . n 
B 1 272 SER 272 270 270 SER SER B . n 
B 1 273 MET 273 271 271 MET MET B . n 
B 1 274 ALA 274 272 272 ALA ALA B . n 
B 1 275 ASP 275 273 273 ASP ASP B . n 
B 1 276 GLN 276 274 274 GLN GLN B . n 
B 1 277 GLU 277 275 275 GLU GLU B . n 
B 1 278 GLN 278 276 ?   ?   ?   B . n 
B 1 279 VAL 279 277 ?   ?   ?   B . n 
B 1 280 SER 280 278 ?   ?   ?   B . n 
B 1 281 PRO 281 279 ?   ?   ?   B . n 
B 1 282 ALA 282 280 ?   ?   ?   B . n 
B 1 283 ALA 283 281 ?   ?   ?   B . n 
B 1 284 ILE 284 282 ?   ?   ?   B . n 
B 1 285 LYS 285 283 ?   ?   ?   B . n 
B 1 286 LYS 286 284 ?   ?   ?   B . n 
B 1 287 THR 287 285 ?   ?   ?   B . n 
B 1 288 ILE 288 286 ?   ?   ?   B . n 
B 1 289 LEU 289 287 ?   ?   ?   B . n 
B 1 290 ASP 290 288 ?   ?   ?   B . n 
B 1 291 LYS 291 289 ?   ?   ?   B . n 
B 1 292 VAL 292 290 ?   ?   ?   B . n 
B 1 293 LYS 293 291 ?   ?   ?   B . n 
B 1 294 LEU 294 292 ?   ?   ?   B . n 
B 1 295 ASP 295 293 ?   ?   ?   B . n 
B 1 296 SER 296 294 ?   ?   ?   B . n 
B 1 297 PRO 297 295 ?   ?   ?   B . n 
B 1 298 ALA 298 296 ?   ?   ?   B . n 
B 1 299 GLY 299 297 ?   ?   ?   B . n 
B 1 300 THR 300 298 ?   ?   ?   B . n 
B 1 301 ALA 301 299 ?   ?   ?   B . n 
B 1 302 LEU 302 300 ?   ?   ?   B . n 
B 1 303 SER 303 301 ?   ?   ?   B . n 
B 1 304 PRO 304 302 ?   ?   ?   B . n 
B 1 305 SER 305 303 ?   ?   ?   B . n 
B 1 306 GLY 306 304 ?   ?   ?   B . n 
B 1 307 HIS 307 305 ?   ?   ?   B . n 
B 1 308 THR 308 306 ?   ?   ?   B . n 
B 1 309 LYS 309 307 ?   ?   ?   B . n 
B 1 310 LEU 310 308 ?   ?   ?   B . n 
B 1 311 LEU 311 309 ?   ?   ?   B . n 
B 1 312 PRO 312 310 ?   ?   ?   B . n 
B 1 313 ARG 313 311 ?   ?   ?   B . n 
B 1 314 SER 314 312 ?   ?   ?   B . n 
B 1 315 LEU 315 313 ?   ?   ?   B . n 
B 1 316 ALA 316 314 ?   ?   ?   B . n 
B 1 317 PRO 317 315 ?   ?   ?   B . n 
B 1 318 ALA 318 316 ?   ?   ?   B . n 
B 1 319 GLY 319 317 ?   ?   ?   B . n 
B 1 320 LYS 320 318 ?   ?   ?   B . n 
B 1 321 ASP 321 319 ?   ?   ?   B . n 
C 1 1   ARG 1   -1  -1  ARG ARG C . n 
C 1 2   ALA 2   0   0   ALA ALA C . n 
C 1 3   MET 3   1   1   MET MET C . n 
C 1 4   SER 4   2   2   SER SER C . n 
C 1 5   VAL 5   3   3   VAL VAL C . n 
C 1 6   GLY 6   4   4   GLY GLY C . n 
C 1 7   PHE 7   5   5   PHE PHE C . n 
C 1 8   ILE 8   6   6   ILE ILE C . n 
C 1 9   GLY 9   7   7   GLY GLY C . n 
C 1 10  ALA 10  8   8   ALA ALA C . n 
C 1 11  GLY 11  9   9   GLY GLY C . n 
C 1 12  GLN 12  10  10  GLN GLN C . n 
C 1 13  LEU 13  11  11  LEU LEU C . n 
C 1 14  ALA 14  12  12  ALA ALA C . n 
C 1 15  PHE 15  13  13  PHE PHE C . n 
C 1 16  ALA 16  14  14  ALA ALA C . n 
C 1 17  LEU 17  15  15  LEU LEU C . n 
C 1 18  ALA 18  16  16  ALA ALA C . n 
C 1 19  LYS 19  17  17  LYS LYS C . n 
C 1 20  GLY 20  18  18  GLY GLY C . n 
C 1 21  PHE 21  19  19  PHE PHE C . n 
C 1 22  THR 22  20  20  THR THR C . n 
C 1 23  ALA 23  21  21  ALA ALA C . n 
C 1 24  ALA 24  22  22  ALA ALA C . n 
C 1 25  GLY 25  23  23  GLY GLY C . n 
C 1 26  VAL 26  24  24  VAL VAL C . n 
C 1 27  LEU 27  25  25  LEU LEU C . n 
C 1 28  ALA 28  26  26  ALA ALA C . n 
C 1 29  ALA 29  27  27  ALA ALA C . n 
C 1 30  HIS 30  28  28  HIS HIS C . n 
C 1 31  LYS 31  29  29  LYS LYS C . n 
C 1 32  ILE 32  30  30  ILE ILE C . n 
C 1 33  MET 33  31  31  MET MET C . n 
C 1 34  ALA 34  32  32  ALA ALA C . n 
C 1 35  SER 35  33  33  SER SER C . n 
C 1 36  SER 36  34  34  SER SER C . n 
C 1 37  PRO 37  35  35  PRO PRO C . n 
C 1 38  ASP 38  36  36  ASP ASP C . n 
C 1 39  MET 39  37  37  MET MET C . n 
C 1 40  ASP 40  38  38  ASP ASP C . n 
C 1 41  LEU 41  39  39  LEU LEU C . n 
C 1 42  ALA 42  40  40  ALA ALA C . n 
C 1 43  THR 43  41  41  THR THR C . n 
C 1 44  VAL 44  42  42  VAL VAL C . n 
C 1 45  SER 45  43  43  SER SER C . n 
C 1 46  ALA 46  44  44  ALA ALA C . n 
C 1 47  LEU 47  45  45  LEU LEU C . n 
C 1 48  ARG 48  46  46  ARG ARG C . n 
C 1 49  LYS 49  47  47  LYS LYS C . n 
C 1 50  MET 50  48  48  MET MET C . n 
C 1 51  GLY 51  49  49  GLY GLY C . n 
C 1 52  VAL 52  50  50  VAL VAL C . n 
C 1 53  LYS 53  51  51  LYS LYS C . n 
C 1 54  LEU 54  52  52  LEU LEU C . n 
C 1 55  THR 55  53  53  THR THR C . n 
C 1 56  PRO 56  54  54  PRO PRO C . n 
C 1 57  HIS 57  55  55  HIS HIS C . n 
C 1 58  ASN 58  56  56  ASN ASN C . n 
C 1 59  LYS 59  57  57  LYS LYS C . n 
C 1 60  GLU 60  58  58  GLU GLU C . n 
C 1 61  THR 61  59  59  THR THR C . n 
C 1 62  VAL 62  60  60  VAL VAL C . n 
C 1 63  GLN 63  61  61  GLN GLN C . n 
C 1 64  HIS 64  62  62  HIS HIS C . n 
C 1 65  SER 65  63  63  SER SER C . n 
C 1 66  ASP 66  64  64  ASP ASP C . n 
C 1 67  VAL 67  65  65  VAL VAL C . n 
C 1 68  LEU 68  66  66  LEU LEU C . n 
C 1 69  PHE 69  67  67  PHE PHE C . n 
C 1 70  LEU 70  68  68  LEU LEU C . n 
C 1 71  ALA 71  69  69  ALA ALA C . n 
C 1 72  VAL 72  70  70  VAL VAL C . n 
C 1 73  LYS 73  71  71  LYS LYS C . n 
C 1 74  PRO 74  72  72  PRO PRO C . n 
C 1 75  HIS 75  73  73  HIS HIS C . n 
C 1 76  ILE 76  74  74  ILE ILE C . n 
C 1 77  ILE 77  75  75  ILE ILE C . n 
C 1 78  PRO 78  76  76  PRO PRO C . n 
C 1 79  PHE 79  77  77  PHE PHE C . n 
C 1 80  ILE 80  78  78  ILE ILE C . n 
C 1 81  LEU 81  79  79  LEU LEU C . n 
C 1 82  ASP 82  80  80  ASP ASP C . n 
C 1 83  GLU 83  81  81  GLU GLU C . n 
C 1 84  ILE 84  82  82  ILE ILE C . n 
C 1 85  GLY 85  83  83  GLY GLY C . n 
C 1 86  ALA 86  84  84  ALA ALA C . n 
C 1 87  ASP 87  85  85  ASP ASP C . n 
C 1 88  ILE 88  86  86  ILE ILE C . n 
C 1 89  GLU 89  87  87  GLU GLU C . n 
C 1 90  ASP 90  88  88  ASP ASP C . n 
C 1 91  ARG 91  89  89  ARG ARG C . n 
C 1 92  HIS 92  90  90  HIS HIS C . n 
C 1 93  ILE 93  91  91  ILE ILE C . n 
C 1 94  VAL 94  92  92  VAL VAL C . n 
C 1 95  VAL 95  93  93  VAL VAL C . n 
C 1 96  SER 96  94  94  SER SER C . n 
C 1 97  CYS 97  95  95  CYS CYS C . n 
C 1 98  ALA 98  96  96  ALA ALA C . n 
C 1 99  ALA 99  97  97  ALA ALA C . n 
C 1 100 GLY 100 98  98  GLY GLY C . n 
C 1 101 VAL 101 99  99  VAL VAL C . n 
C 1 102 THR 102 100 100 THR THR C . n 
C 1 103 ILE 103 101 101 ILE ILE C . n 
C 1 104 SER 104 102 102 SER SER C . n 
C 1 105 SER 105 103 103 SER SER C . n 
C 1 106 ILE 106 104 104 ILE ILE C . n 
C 1 107 GLU 107 105 105 GLU GLU C . n 
C 1 108 LYS 108 106 106 LYS LYS C . n 
C 1 109 LYS 109 107 107 LYS LYS C . n 
C 1 110 LEU 110 108 108 LEU LEU C . n 
C 1 111 SER 111 109 109 SER SER C . n 
C 1 112 ALA 112 110 110 ALA ALA C . n 
C 1 113 PHE 113 111 111 PHE PHE C . n 
C 1 114 ARG 114 112 112 ARG ARG C . n 
C 1 115 PRO 115 113 113 PRO PRO C . n 
C 1 116 ALA 116 114 114 ALA ALA C . n 
C 1 117 PRO 117 115 115 PRO PRO C . n 
C 1 118 ARG 118 116 116 ARG ARG C . n 
C 1 119 VAL 119 117 117 VAL VAL C . n 
C 1 120 ILE 120 118 118 ILE ILE C . n 
C 1 121 ARG 121 119 119 ARG ARG C . n 
C 1 122 CYS 122 120 120 CYS CYS C . n 
C 1 123 MET 123 121 121 MET MET C . n 
C 1 124 THR 124 122 122 THR THR C . n 
C 1 125 ASN 125 123 123 ASN ASN C . n 
C 1 126 THR 126 124 124 THR THR C . n 
C 1 127 PRO 127 125 125 PRO PRO C . n 
C 1 128 VAL 128 126 126 VAL VAL C . n 
C 1 129 VAL 129 127 127 VAL VAL C . n 
C 1 130 VAL 130 128 128 VAL VAL C . n 
C 1 131 ARG 131 129 129 ARG ARG C . n 
C 1 132 GLU 132 130 130 GLU GLU C . n 
C 1 133 GLY 133 131 131 GLY GLY C . n 
C 1 134 ALA 134 132 132 ALA ALA C . n 
C 1 135 THR 135 133 133 THR THR C . n 
C 1 136 VAL 136 134 134 VAL VAL C . n 
C 1 137 TYR 137 135 135 TYR TYR C . n 
C 1 138 ALA 138 136 136 ALA ALA C . n 
C 1 139 THR 139 137 137 THR THR C . n 
C 1 140 GLY 140 138 138 GLY GLY C . n 
C 1 141 THR 141 139 139 THR THR C . n 
C 1 142 HIS 142 140 140 HIS HIS C . n 
C 1 143 ALA 143 141 141 ALA ALA C . n 
C 1 144 GLN 144 142 142 GLN GLN C . n 
C 1 145 VAL 145 143 143 VAL VAL C . n 
C 1 146 GLU 146 144 144 GLU GLU C . n 
C 1 147 ASP 147 145 145 ASP ASP C . n 
C 1 148 GLY 148 146 146 GLY GLY C . n 
C 1 149 ARG 149 147 147 ARG ARG C . n 
C 1 150 LEU 150 148 148 LEU LEU C . n 
C 1 151 MET 151 149 149 MET MET C . n 
C 1 152 GLU 152 150 150 GLU GLU C . n 
C 1 153 GLN 153 151 151 GLN GLN C . n 
C 1 154 LEU 154 152 152 LEU LEU C . n 
C 1 155 LEU 155 153 153 LEU LEU C . n 
C 1 156 SER 156 154 154 SER SER C . n 
C 1 157 SER 157 155 155 SER SER C . n 
C 1 158 VAL 158 156 156 VAL VAL C . n 
C 1 159 GLY 159 157 157 GLY GLY C . n 
C 1 160 PHE 160 158 158 PHE PHE C . n 
C 1 161 CYS 161 159 159 CYS CYS C . n 
C 1 162 THR 162 160 160 THR THR C . n 
C 1 163 GLU 163 161 161 GLU GLU C . n 
C 1 164 VAL 164 162 162 VAL VAL C . n 
C 1 165 GLU 165 163 163 GLU GLU C . n 
C 1 166 GLU 166 164 164 GLU GLU C . n 
C 1 167 ASP 167 165 165 ASP ASP C . n 
C 1 168 LEU 168 166 166 LEU LEU C . n 
C 1 169 ILE 169 167 167 ILE ILE C . n 
C 1 170 ASP 170 168 168 ASP ASP C . n 
C 1 171 ALA 171 169 169 ALA ALA C . n 
C 1 172 VAL 172 170 170 VAL VAL C . n 
C 1 173 THR 173 171 171 THR THR C . n 
C 1 174 GLY 174 172 172 GLY GLY C . n 
C 1 175 LEU 175 173 173 LEU LEU C . n 
C 1 176 SER 176 174 174 SER SER C . n 
C 1 177 GLY 177 175 175 GLY GLY C . n 
C 1 178 SER 178 176 176 SER SER C . n 
C 1 179 GLY 179 177 177 GLY GLY C . n 
C 1 180 PRO 180 178 178 PRO PRO C . n 
C 1 181 ALA 181 179 179 ALA ALA C . n 
C 1 182 TYR 182 180 180 TYR TYR C . n 
C 1 183 ALA 183 181 181 ALA ALA C . n 
C 1 184 PHE 184 182 182 PHE PHE C . n 
C 1 185 THR 185 183 183 THR THR C . n 
C 1 186 ALA 186 184 184 ALA ALA C . n 
C 1 187 LEU 187 185 185 LEU LEU C . n 
C 1 188 ASP 188 186 186 ASP ASP C . n 
C 1 189 ALA 189 187 187 ALA ALA C . n 
C 1 190 LEU 190 188 188 LEU LEU C . n 
C 1 191 ALA 191 189 189 ALA ALA C . n 
C 1 192 ASP 192 190 190 ASP ASP C . n 
C 1 193 GLY 193 191 191 GLY GLY C . n 
C 1 194 GLY 194 192 192 GLY GLY C . n 
C 1 195 VAL 195 193 193 VAL VAL C . n 
C 1 196 LYS 196 194 194 LYS LYS C . n 
C 1 197 MET 197 195 195 MET MET C . n 
C 1 198 GLY 198 196 196 GLY GLY C . n 
C 1 199 LEU 199 197 197 LEU LEU C . n 
C 1 200 PRO 200 198 198 PRO PRO C . n 
C 1 201 ARG 201 199 199 ARG ARG C . n 
C 1 202 ARG 202 200 200 ARG ARG C . n 
C 1 203 LEU 203 201 201 LEU LEU C . n 
C 1 204 ALA 204 202 202 ALA ALA C . n 
C 1 205 VAL 205 203 203 VAL VAL C . n 
C 1 206 ARG 206 204 204 ARG ARG C . n 
C 1 207 LEU 207 205 205 LEU LEU C . n 
C 1 208 GLY 208 206 206 GLY GLY C . n 
C 1 209 ALA 209 207 207 ALA ALA C . n 
C 1 210 GLN 210 208 208 GLN GLN C . n 
C 1 211 ALA 211 209 209 ALA ALA C . n 
C 1 212 LEU 212 210 210 LEU LEU C . n 
C 1 213 LEU 213 211 211 LEU LEU C . n 
C 1 214 GLY 214 212 212 GLY GLY C . n 
C 1 215 ALA 215 213 213 ALA ALA C . n 
C 1 216 ALA 216 214 214 ALA ALA C . n 
C 1 217 LYS 217 215 215 LYS LYS C . n 
C 1 218 MET 218 216 216 MET MET C . n 
C 1 219 LEU 219 217 217 LEU LEU C . n 
C 1 220 LEU 220 218 218 LEU LEU C . n 
C 1 221 HIS 221 219 219 HIS HIS C . n 
C 1 222 SER 222 220 220 SER SER C . n 
C 1 223 GLU 223 221 221 GLU GLU C . n 
C 1 224 GLN 224 222 222 GLN GLN C . n 
C 1 225 HIS 225 223 223 HIS HIS C . n 
C 1 226 PRO 226 224 224 PRO PRO C . n 
C 1 227 GLY 227 225 225 GLY GLY C . n 
C 1 228 GLN 228 226 226 GLN GLN C . n 
C 1 229 LEU 229 227 227 LEU LEU C . n 
C 1 230 LYS 230 228 228 LYS LYS C . n 
C 1 231 ASP 231 229 229 ASP ASP C . n 
C 1 232 ASN 232 230 230 ASN ASN C . n 
C 1 233 VAL 233 231 231 VAL VAL C . n 
C 1 234 SER 234 232 232 SER SER C . n 
C 1 235 SER 235 233 233 SER SER C . n 
C 1 236 PRO 236 234 234 PRO PRO C . n 
C 1 237 GLY 237 235 235 GLY GLY C . n 
C 1 238 GLY 238 236 236 GLY GLY C . n 
C 1 239 ALA 239 237 237 ALA ALA C . n 
C 1 240 THR 240 238 238 THR THR C . n 
C 1 241 ILE 241 239 239 ILE ILE C . n 
C 1 242 HIS 242 240 240 HIS HIS C . n 
C 1 243 ALA 243 241 241 ALA ALA C . n 
C 1 244 LEU 244 242 242 LEU LEU C . n 
C 1 245 HIS 245 243 243 HIS HIS C . n 
C 1 246 VAL 246 244 244 VAL VAL C . n 
C 1 247 LEU 247 245 245 LEU LEU C . n 
C 1 248 GLU 248 246 246 GLU GLU C . n 
C 1 249 SER 249 247 247 SER SER C . n 
C 1 250 GLY 250 248 248 GLY GLY C . n 
C 1 251 GLY 251 249 249 GLY GLY C . n 
C 1 252 PHE 252 250 250 PHE PHE C . n 
C 1 253 ARG 253 251 251 ARG ARG C . n 
C 1 254 SER 254 252 252 SER SER C . n 
C 1 255 LEU 255 253 253 LEU LEU C . n 
C 1 256 LEU 256 254 254 LEU LEU C . n 
C 1 257 ILE 257 255 255 ILE ILE C . n 
C 1 258 ASN 258 256 256 ASN ASN C . n 
C 1 259 ALA 259 257 257 ALA ALA C . n 
C 1 260 VAL 260 258 258 VAL VAL C . n 
C 1 261 GLU 261 259 259 GLU GLU C . n 
C 1 262 ALA 262 260 260 ALA ALA C . n 
C 1 263 SER 263 261 261 SER SER C . n 
C 1 264 CYS 264 262 262 CYS CYS C . n 
C 1 265 ILE 265 263 263 ILE ILE C . n 
C 1 266 ARG 266 264 264 ARG ARG C . n 
C 1 267 THR 267 265 265 THR THR C . n 
C 1 268 ARG 268 266 266 ARG ARG C . n 
C 1 269 GLU 269 267 267 GLU GLU C . n 
C 1 270 LEU 270 268 268 LEU LEU C . n 
C 1 271 GLN 271 269 269 GLN GLN C . n 
C 1 272 SER 272 270 270 SER SER C . n 
C 1 273 MET 273 271 271 MET MET C . n 
C 1 274 ALA 274 272 272 ALA ALA C . n 
C 1 275 ASP 275 273 273 ASP ASP C . n 
C 1 276 GLN 276 274 274 GLN GLN C . n 
C 1 277 GLU 277 275 275 GLU GLU C . n 
C 1 278 GLN 278 276 ?   ?   ?   C . n 
C 1 279 VAL 279 277 ?   ?   ?   C . n 
C 1 280 SER 280 278 ?   ?   ?   C . n 
C 1 281 PRO 281 279 ?   ?   ?   C . n 
C 1 282 ALA 282 280 ?   ?   ?   C . n 
C 1 283 ALA 283 281 ?   ?   ?   C . n 
C 1 284 ILE 284 282 ?   ?   ?   C . n 
C 1 285 LYS 285 283 ?   ?   ?   C . n 
C 1 286 LYS 286 284 ?   ?   ?   C . n 
C 1 287 THR 287 285 ?   ?   ?   C . n 
C 1 288 ILE 288 286 ?   ?   ?   C . n 
C 1 289 LEU 289 287 ?   ?   ?   C . n 
C 1 290 ASP 290 288 ?   ?   ?   C . n 
C 1 291 LYS 291 289 ?   ?   ?   C . n 
C 1 292 VAL 292 290 ?   ?   ?   C . n 
C 1 293 LYS 293 291 ?   ?   ?   C . n 
C 1 294 LEU 294 292 ?   ?   ?   C . n 
C 1 295 ASP 295 293 ?   ?   ?   C . n 
C 1 296 SER 296 294 ?   ?   ?   C . n 
C 1 297 PRO 297 295 ?   ?   ?   C . n 
C 1 298 ALA 298 296 ?   ?   ?   C . n 
C 1 299 GLY 299 297 ?   ?   ?   C . n 
C 1 300 THR 300 298 ?   ?   ?   C . n 
C 1 301 ALA 301 299 ?   ?   ?   C . n 
C 1 302 LEU 302 300 ?   ?   ?   C . n 
C 1 303 SER 303 301 ?   ?   ?   C . n 
C 1 304 PRO 304 302 ?   ?   ?   C . n 
C 1 305 SER 305 303 ?   ?   ?   C . n 
C 1 306 GLY 306 304 ?   ?   ?   C . n 
C 1 307 HIS 307 305 ?   ?   ?   C . n 
C 1 308 THR 308 306 ?   ?   ?   C . n 
C 1 309 LYS 309 307 ?   ?   ?   C . n 
C 1 310 LEU 310 308 ?   ?   ?   C . n 
C 1 311 LEU 311 309 ?   ?   ?   C . n 
C 1 312 PRO 312 310 ?   ?   ?   C . n 
C 1 313 ARG 313 311 ?   ?   ?   C . n 
C 1 314 SER 314 312 ?   ?   ?   C . n 
C 1 315 LEU 315 313 ?   ?   ?   C . n 
C 1 316 ALA 316 314 ?   ?   ?   C . n 
C 1 317 PRO 317 315 ?   ?   ?   C . n 
C 1 318 ALA 318 316 ?   ?   ?   C . n 
C 1 319 GLY 319 317 ?   ?   ?   C . n 
C 1 320 LYS 320 318 ?   ?   ?   C . n 
C 1 321 ASP 321 319 ?   ?   ?   C . n 
D 1 1   ARG 1   -1  -1  ARG ARG D . n 
D 1 2   ALA 2   0   0   ALA ALA D . n 
D 1 3   MET 3   1   1   MET MET D . n 
D 1 4   SER 4   2   2   SER SER D . n 
D 1 5   VAL 5   3   3   VAL VAL D . n 
D 1 6   GLY 6   4   4   GLY GLY D . n 
D 1 7   PHE 7   5   5   PHE PHE D . n 
D 1 8   ILE 8   6   6   ILE ILE D . n 
D 1 9   GLY 9   7   7   GLY GLY D . n 
D 1 10  ALA 10  8   8   ALA ALA D . n 
D 1 11  GLY 11  9   9   GLY GLY D . n 
D 1 12  GLN 12  10  10  GLN GLN D . n 
D 1 13  LEU 13  11  11  LEU LEU D . n 
D 1 14  ALA 14  12  12  ALA ALA D . n 
D 1 15  PHE 15  13  13  PHE PHE D . n 
D 1 16  ALA 16  14  14  ALA ALA D . n 
D 1 17  LEU 17  15  15  LEU LEU D . n 
D 1 18  ALA 18  16  16  ALA ALA D . n 
D 1 19  LYS 19  17  17  LYS LYS D . n 
D 1 20  GLY 20  18  18  GLY GLY D . n 
D 1 21  PHE 21  19  19  PHE PHE D . n 
D 1 22  THR 22  20  20  THR THR D . n 
D 1 23  ALA 23  21  21  ALA ALA D . n 
D 1 24  ALA 24  22  22  ALA ALA D . n 
D 1 25  GLY 25  23  23  GLY GLY D . n 
D 1 26  VAL 26  24  24  VAL VAL D . n 
D 1 27  LEU 27  25  25  LEU LEU D . n 
D 1 28  ALA 28  26  26  ALA ALA D . n 
D 1 29  ALA 29  27  27  ALA ALA D . n 
D 1 30  HIS 30  28  28  HIS HIS D . n 
D 1 31  LYS 31  29  29  LYS LYS D . n 
D 1 32  ILE 32  30  30  ILE ILE D . n 
D 1 33  MET 33  31  31  MET MET D . n 
D 1 34  ALA 34  32  32  ALA ALA D . n 
D 1 35  SER 35  33  33  SER SER D . n 
D 1 36  SER 36  34  34  SER SER D . n 
D 1 37  PRO 37  35  35  PRO PRO D . n 
D 1 38  ASP 38  36  36  ASP ASP D . n 
D 1 39  MET 39  37  37  MET MET D . n 
D 1 40  ASP 40  38  38  ASP ASP D . n 
D 1 41  LEU 41  39  39  LEU LEU D . n 
D 1 42  ALA 42  40  40  ALA ALA D . n 
D 1 43  THR 43  41  41  THR THR D . n 
D 1 44  VAL 44  42  42  VAL VAL D . n 
D 1 45  SER 45  43  43  SER SER D . n 
D 1 46  ALA 46  44  44  ALA ALA D . n 
D 1 47  LEU 47  45  45  LEU LEU D . n 
D 1 48  ARG 48  46  46  ARG ARG D . n 
D 1 49  LYS 49  47  47  LYS LYS D . n 
D 1 50  MET 50  48  48  MET MET D . n 
D 1 51  GLY 51  49  49  GLY GLY D . n 
D 1 52  VAL 52  50  50  VAL VAL D . n 
D 1 53  LYS 53  51  51  LYS LYS D . n 
D 1 54  LEU 54  52  52  LEU LEU D . n 
D 1 55  THR 55  53  53  THR THR D . n 
D 1 56  PRO 56  54  54  PRO PRO D . n 
D 1 57  HIS 57  55  55  HIS HIS D . n 
D 1 58  ASN 58  56  56  ASN ASN D . n 
D 1 5