data_2GPV
# 
_entry.id   2GPV 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.321 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2GPV         
RCSB  RCSB037407   
WWPDB D_1000037407 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 2GP7 . unspecified 
PDB 2GPO . unspecified 
PDB 2GPP . unspecified 
PDB 2GPU . unspecified 
# 
_pdbx_database_status.entry_id                        2GPV 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2006-04-18 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Wang, L.'            1 
'Zuercher, W.J.'      2 
'Consler, T.G.'       3 
'Lambert, M.H.'       4 
'Miller, A.B.'        5 
'Osband-miller, L.A.' 6 
'McKee, D.D.'         7 
'Willson, T.M.'       8 
'Nolte, R.T.'         9 
# 
_citation.id                        primary 
_citation.title                     
;X-ray crystal structures of the estrogen-related receptor-gamma ligand binding domain in three functional states reveal the molecular basis of small molecule regulation.
;
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_volume            281 
_citation.page_first                37773 
_citation.page_last                 37781 
_citation.year                      2006 
_citation.journal_id_ASTM           JBCHA3 
_citation.country                   US 
_citation.journal_id_ISSN           0021-9258 
_citation.journal_id_CSD            0071 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   16990259 
_citation.pdbx_database_id_DOI      10.1074/jbc.M608410200 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Wang, L.'            1 ? 
primary 'Zuercher, W.J.'      2 ? 
primary 'Consler, T.G.'       3 ? 
primary 'Lambert, M.H.'       4 ? 
primary 'Miller, A.B.'        5 ? 
primary 'Orband-Miller, L.A.' 6 ? 
primary 'McKee, D.D.'         7 ? 
primary 'Willson, T.M.'       8 ? 
primary 'Nolte, R.T.'         9 ? 
# 
_cell.length_a           200.22 
_cell.length_b           117.17 
_cell.length_c           90.47 
_cell.angle_alpha        90 
_cell.angle_beta         102.36 
_cell.angle_gamma        90 
_cell.entry_id           2GPV 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              24 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.entry_id                         2GPV 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.Int_Tables_number                5 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Estrogen-related receptor gamma' 26084.373 6  ? ? 'Ligand Binding Domain (residues 229-458)' ? 
2 polymer     syn 'Nuclear receptor corepressor 2'  2599.999  3  ? ? 'LXXLL Motif (residues 2338-2359)'         ? 
3 non-polymer syn 4-HYDROXYTAMOXIFEN                387.514   6  ? ? ?                                          ? 
4 water       nat water                             18.015    61 ? ? ?                                          ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'Estrogen receptor-related protein 3, ERR gamma-2' 
2 
;N-CoR2, Silencing mediator of retinoic acid and thyroid hormone receptor, SMRT, SMRTe, Thyroid-, retinoic-acid-receptor-associated corepressor, T3 receptor- associating factor, TRAC, CTG repeat protein 26, SMAP270,
;
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;PAKKPYNKIVSHLLVAEPEKIYAMPDPTVPDSDIKALTTLCDLADRELVVIIGWAKHIPGFSTLSLADQMSLLQSAWMEI
LILGVVYRSLSFEDELVYADDYIMDEDQSKLAGLLDLNNAILQLVKKYKSMKLEKEEFVTLKAIALANSDSMHIEDVEAV
QKLQDVLHEALQDYEAGQHMEDPRRAGKMLMTLPLLRQTSTKAVQHFYNIKLEGKVPMHKLFLEMLEAKV
;
;PAKKPYNKIVSHLLVAEPEKIYAMPDPTVPDSDIKALTTLCDLADRELVVIIGWAKHIPGFSTLSLADQMSLLQSAWMEI
LILGVVYRSLSFEDELVYADDYIMDEDQSKLAGLLDLNNAILQLVKKYKSMKLEKEEFVTLKAIALANSDSMHIEDVEAV
QKLQDVLHEALQDYEAGQHMEDPRRAGKMLMTLPLLRQTSTKAVQHFYNIKLEGKVPMHKLFLEMLEAKV
;
A,B,C,D,E,F ? 
2 'polypeptide(L)' no no TNMGLEAIIRKALMGKYDQWEE TNMGLEAIIRKALMGKYDQWEE G,H,I       ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   PRO n 
1 2   ALA n 
1 3   LYS n 
1 4   LYS n 
1 5   PRO n 
1 6   TYR n 
1 7   ASN n 
1 8   LYS n 
1 9   ILE n 
1 10  VAL n 
1 11  SER n 
1 12  HIS n 
1 13  LEU n 
1 14  LEU n 
1 15  VAL n 
1 16  ALA n 
1 17  GLU n 
1 18  PRO n 
1 19  GLU n 
1 20  LYS n 
1 21  ILE n 
1 22  TYR n 
1 23  ALA n 
1 24  MET n 
1 25  PRO n 
1 26  ASP n 
1 27  PRO n 
1 28  THR n 
1 29  VAL n 
1 30  PRO n 
1 31  ASP n 
1 32  SER n 
1 33  ASP n 
1 34  ILE n 
1 35  LYS n 
1 36  ALA n 
1 37  LEU n 
1 38  THR n 
1 39  THR n 
1 40  LEU n 
1 41  CYS n 
1 42  ASP n 
1 43  LEU n 
1 44  ALA n 
1 45  ASP n 
1 46  ARG n 
1 47  GLU n 
1 48  LEU n 
1 49  VAL n 
1 50  VAL n 
1 51  ILE n 
1 52  ILE n 
1 53  GLY n 
1 54  TRP n 
1 55  ALA n 
1 56  LYS n 
1 57  HIS n 
1 58  ILE n 
1 59  PRO n 
1 60  GLY n 
1 61  PHE n 
1 62  SER n 
1 63  THR n 
1 64  LEU n 
1 65  SER n 
1 66  LEU n 
1 67  ALA n 
1 68  ASP n 
1 69  GLN n 
1 70  MET n 
1 71  SER n 
1 72  LEU n 
1 73  LEU n 
1 74  GLN n 
1 75  SER n 
1 76  ALA n 
1 77  TRP n 
1 78  MET n 
1 79  GLU n 
1 80  ILE n 
1 81  LEU n 
1 82  ILE n 
1 83  LEU n 
1 84  GLY n 
1 85  VAL n 
1 86  VAL n 
1 87  TYR n 
1 88  ARG n 
1 89  SER n 
1 90  LEU n 
1 91  SER n 
1 92  PHE n 
1 93  GLU n 
1 94  ASP n 
1 95  GLU n 
1 96  LEU n 
1 97  VAL n 
1 98  TYR n 
1 99  ALA n 
1 100 ASP n 
1 101 ASP n 
1 102 TYR n 
1 103 ILE n 
1 104 MET n 
1 105 ASP n 
1 106 GLU n 
1 107 ASP n 
1 108 GLN n 
1 109 SER n 
1 110 LYS n 
1 111 LEU n 
1 112 ALA n 
1 113 GLY n 
1 114 LEU n 
1 115 LEU n 
1 116 ASP n 
1 117 LEU n 
1 118 ASN n 
1 119 ASN n 
1 120 ALA n 
1 121 ILE n 
1 122 LEU n 
1 123 GLN n 
1 124 LEU n 
1 125 VAL n 
1 126 LYS n 
1 127 LYS n 
1 128 TYR n 
1 129 LYS n 
1 130 SER n 
1 131 MET n 
1 132 LYS n 
1 133 LEU n 
1 134 GLU n 
1 135 LYS n 
1 136 GLU n 
1 137 GLU n 
1 138 PHE n 
1 139 VAL n 
1 140 THR n 
1 141 LEU n 
1 142 LYS n 
1 143 ALA n 
1 144 ILE n 
1 145 ALA n 
1 146 LEU n 
1 147 ALA n 
1 148 ASN n 
1 149 SER n 
1 150 ASP n 
1 151 SER n 
1 152 MET n 
1 153 HIS n 
1 154 ILE n 
1 155 GLU n 
1 156 ASP n 
1 157 VAL n 
1 158 GLU n 
1 159 ALA n 
1 160 VAL n 
1 161 GLN n 
1 162 LYS n 
1 163 LEU n 
1 164 GLN n 
1 165 ASP n 
1 166 VAL n 
1 167 LEU n 
1 168 HIS n 
1 169 GLU n 
1 170 ALA n 
1 171 LEU n 
1 172 GLN n 
1 173 ASP n 
1 174 TYR n 
1 175 GLU n 
1 176 ALA n 
1 177 GLY n 
1 178 GLN n 
1 179 HIS n 
1 180 MET n 
1 181 GLU n 
1 182 ASP n 
1 183 PRO n 
1 184 ARG n 
1 185 ARG n 
1 186 ALA n 
1 187 GLY n 
1 188 LYS n 
1 189 MET n 
1 190 LEU n 
1 191 MET n 
1 192 THR n 
1 193 LEU n 
1 194 PRO n 
1 195 LEU n 
1 196 LEU n 
1 197 ARG n 
1 198 GLN n 
1 199 THR n 
1 200 SER n 
1 201 THR n 
1 202 LYS n 
1 203 ALA n 
1 204 VAL n 
1 205 GLN n 
1 206 HIS n 
1 207 PHE n 
1 208 TYR n 
1 209 ASN n 
1 210 ILE n 
1 211 LYS n 
1 212 LEU n 
1 213 GLU n 
1 214 GLY n 
1 215 LYS n 
1 216 VAL n 
1 217 PRO n 
1 218 MET n 
1 219 HIS n 
1 220 LYS n 
1 221 LEU n 
1 222 PHE n 
1 223 LEU n 
1 224 GLU n 
1 225 MET n 
1 226 LEU n 
1 227 GLU n 
1 228 ALA n 
1 229 LYS n 
1 230 VAL n 
2 1   THR n 
2 2   ASN n 
2 3   MET n 
2 4   GLY n 
2 5   LEU n 
2 6   GLU n 
2 7   ALA n 
2 8   ILE n 
2 9   ILE n 
2 10  ARG n 
2 11  LYS n 
2 12  ALA n 
2 13  LEU n 
2 14  MET n 
2 15  GLY n 
2 16  LYS n 
2 17  TYR n 
2 18  ASP n 
2 19  GLN n 
2 20  TRP n 
2 21  GLU n 
2 22  GLU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 ESRRG 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pRSET 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_pdbx_entity_src_syn.entity_id              2 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    ? 
_pdbx_entity_src_syn.organism_common_name   ? 
_pdbx_entity_src_syn.ncbi_taxonomy_id       ? 
_pdbx_entity_src_syn.details                'Chemically synthesized' 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP ERR3_HUMAN  P62508 1 
;PAKKPYNKIVSHLLVAEPEKIYAMPDPTVPDSDIKALTTLCDLADRELVVIIGWAKHIPGFSTLSLADQMSLLQSAWMEI
LILGVVYRSLSFEDELVYADDYIMDEDQSKLAGLLDLNNAILQLVKKYKSMKLEKEEFVTLKAIALANSDSMHIEDVEAV
QKLQDVLHEALQDYEAGQHMEDPRRAGKMLMTLPLLRQTSTKAVQHFYNIKLEGKVPMHKLFLEMLEAKV
;
229  ? 
2 UNP NCOR2_HUMAN Q9Y618 2 TNMGLEAIIRKALMGKYDQWEE 2338 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2GPV A 1 ? 230 ? P62508 229  ? 458  ? 229  458  
2 1 2GPV B 1 ? 230 ? P62508 229  ? 458  ? 229  458  
3 1 2GPV C 1 ? 230 ? P62508 229  ? 458  ? 229  458  
4 1 2GPV D 1 ? 230 ? P62508 229  ? 458  ? 229  458  
5 1 2GPV E 1 ? 230 ? P62508 229  ? 458  ? 229  458  
6 1 2GPV F 1 ? 230 ? P62508 229  ? 458  ? 229  458  
7 2 2GPV G 1 ? 22  ? Q9Y618 2338 ? 2359 ? 1316 1337 
8 2 2GPV H 1 ? 22  ? Q9Y618 2338 ? 2359 ? 1316 1337 
9 2 2GPV I 1 ? 22  ? Q9Y618 2338 ? 2359 ? 1316 1337 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE            ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE           ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE         ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'    ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE           ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE          ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'    ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE            ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE          ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER              ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE         ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE            ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE             ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE         ? 'C5 H11 N O2 S'  149.211 
OHT non-polymer         . 4-HYDROXYTAMOXIFEN ? 'C26 H29 N O2'   387.514 
PHE 'L-peptide linking' y PHENYLALANINE      ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE            ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE             ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE          ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN         ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE           ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE             ? 'C5 H11 N O2'    117.146 
# 
_exptl.crystals_number   1 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.entry_id          2GPV 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_percent_sol   60.99 
_exptl_crystal.density_Matthews      3.15 
_exptl_crystal.density_meas          ? 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.pH              7.8 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.pdbx_details    
;7% PEG3350  
0.2M Lithium Acetate, pH 7.8, VAPOR DIFFUSION, HANGING DROP, temperature 293K
;
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MAR CCD 165 mm' 
_diffrn_detector.pdbx_collection_date   ? 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.monochromator                    'Si 111' 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 17-ID' 
_diffrn_source.pdbx_wavelength_list        1.0 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   17-ID 
# 
_reflns.entry_id                     2GPV 
_reflns.d_resolution_low             50.00 
_reflns.d_resolution_high            2.85 
_reflns.number_obs                   43368 
_reflns.percent_possible_obs         90.200 
_reflns.pdbx_Rmerge_I_obs            0.093 
_reflns.pdbx_chi_squared             1.018 
_reflns.pdbx_redundancy              3.400 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.observed_criterion_sigma_F   -3 
_reflns.observed_criterion_sigma_I   -3 
_reflns.number_all                   48079 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_low              2.95 
_reflns_shell.d_res_high             2.85 
_reflns_shell.number_measured_obs    1891 
_reflns_shell.percent_possible_obs   39.900 
_reflns_shell.Rmerge_I_obs           0.298 
_reflns_shell.pdbx_chi_squared       0.860 
_reflns_shell.pdbx_redundancy        1.400 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.percent_possible_all   38.21 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.ls_d_res_high                            2.850 
_refine.ls_d_res_low                             19.910 
_refine.pdbx_ls_sigma_F                          0.00 
_refine.ls_percent_reflns_obs                    90.870 
_refine.ls_number_reflns_obs                     43251 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.ls_R_factor_all                          0.221 
_refine.ls_R_factor_R_work                       0.219 
_refine.ls_R_factor_R_free                       0.279 
_refine.ls_percent_reflns_R_free                 3.100 
_refine.ls_number_reflns_R_free                  1359 
_refine.B_iso_mean                               13.974 
_refine.aniso_B[1][1]                            1.930 
_refine.aniso_B[2][2]                            0.140 
_refine.aniso_B[3][3]                            -2.310 
_refine.aniso_B[1][2]                            0.000 
_refine.aniso_B[1][3]                            -0.550 
_refine.aniso_B[2][3]                            0.000 
_refine.correlation_coeff_Fo_to_Fc               0.900 
_refine.correlation_coeff_Fo_to_Fc_free          0.819 
_refine.pdbx_overall_ESU_R_Free                  0.423 
_refine.overall_SU_ML                            0.319 
_refine.overall_SU_B                             34.341 
_refine.solvent_model_details                    MASK 
_refine.pdbx_solvent_vdw_probe_radii             1.400 
_refine.pdbx_solvent_ion_probe_radii             0.800 
_refine.pdbx_solvent_shrinkage_radii             0.800 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.entry_id                                 2GPV 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_number_reflns_all                     47597 
_refine.ls_R_factor_obs                          0.221 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      2GP7 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        10545 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         174 
_refine_hist.number_atoms_solvent             61 
_refine_hist.number_atoms_total               10780 
_refine_hist.d_res_high                       2.850 
_refine_hist.d_res_low                        19.910 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d         10995 0.010  0.022  ? 'X-RAY DIFFRACTION' ? 
r_bond_other_d           7335  0.001  0.020  ? 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg      14878 1.164  2.006  ? 'X-RAY DIFFRACTION' ? 
r_angle_other_deg        18121 0.863  3.000  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg   1340  5.155  5.000  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg   460   36.385 25.804 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg   2066  17.053 15.000 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg   33    14.966 15.000 ? 'X-RAY DIFFRACTION' ? 
r_chiral_restr           1716  0.056  0.200  ? 'X-RAY DIFFRACTION' ? 
r_gen_planes_refined     12144 0.003  0.020  ? 'X-RAY DIFFRACTION' ? 
r_gen_planes_other       2049  0.001  0.020  ? 'X-RAY DIFFRACTION' ? 
r_nbd_refined            2846  0.231  0.200  ? 'X-RAY DIFFRACTION' ? 
r_nbd_other              7227  0.180  0.200  ? 'X-RAY DIFFRACTION' ? 
r_nbtor_refined          5449  0.183  0.200  ? 'X-RAY DIFFRACTION' ? 
r_nbtor_other            5602  0.086  0.200  ? 'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined    257   0.147  0.200  ? 'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other      2     0.027  0.200  ? 'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined   33    0.170  0.200  ? 'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other     47    0.252  0.200  ? 'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined 2     0.157  0.200  ? 'X-RAY DIFFRACTION' ? 
r_mcbond_it              7033  0.335  1.500  ? 'X-RAY DIFFRACTION' ? 
r_mcbond_other           2678  0.068  1.500  ? 'X-RAY DIFFRACTION' ? 
r_mcangle_it             10833 0.536  2.000  ? 'X-RAY DIFFRACTION' ? 
r_scbond_it              4638  0.830  3.000  ? 'X-RAY DIFFRACTION' ? 
r_scangle_it             4045  1.297  4.500  ? 'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_restr_ncs.dom_id 
_refine_ls_restr_ncs.pdbx_type 
_refine_ls_restr_ncs.pdbx_auth_asym_id 
_refine_ls_restr_ncs.pdbx_number 
_refine_ls_restr_ncs.pdbx_rms 
_refine_ls_restr_ncs.pdbx_weight 
_refine_ls_restr_ncs.pdbx_ens_id 
_refine_ls_restr_ncs.pdbx_refine_id 
_refine_ls_restr_ncs.pdbx_ordinal 
_refine_ls_restr_ncs.ncs_model_details 
_refine_ls_restr_ncs.rms_dev_position 
_refine_ls_restr_ncs.weight_position 
_refine_ls_restr_ncs.rms_dev_B_iso 
_refine_ls_restr_ncs.weight_B_iso 
1 'MEDIUM POSITIONAL' A 1192 0.190 0.500  1 'X-RAY DIFFRACTION' 1  ? ? ? ? ? 
2 'MEDIUM POSITIONAL' B 1192 0.190 0.500  1 'X-RAY DIFFRACTION' 2  ? ? ? ? ? 
3 'MEDIUM POSITIONAL' C 1192 0.180 0.500  1 'X-RAY DIFFRACTION' 3  ? ? ? ? ? 
4 'MEDIUM POSITIONAL' D 1192 0.200 0.500  1 'X-RAY DIFFRACTION' 4  ? ? ? ? ? 
5 'MEDIUM POSITIONAL' E 1192 0.200 0.500  1 'X-RAY DIFFRACTION' 5  ? ? ? ? ? 
6 'MEDIUM POSITIONAL' F 1192 0.200 0.500  1 'X-RAY DIFFRACTION' 6  ? ? ? ? ? 
1 'LOOSE POSITIONAL'  A 1463 0.570 5.000  1 'X-RAY DIFFRACTION' 7  ? ? ? ? ? 
2 'LOOSE POSITIONAL'  B 1463 0.590 5.000  1 'X-RAY DIFFRACTION' 8  ? ? ? ? ? 
3 'LOOSE POSITIONAL'  C 1463 0.530 5.000  1 'X-RAY DIFFRACTION' 9  ? ? ? ? ? 
4 'LOOSE POSITIONAL'  D 1463 0.780 5.000  1 'X-RAY DIFFRACTION' 10 ? ? ? ? ? 
5 'LOOSE POSITIONAL'  E 1463 0.550 5.000  1 'X-RAY DIFFRACTION' 11 ? ? ? ? ? 
6 'LOOSE POSITIONAL'  F 1463 0.560 5.000  1 'X-RAY DIFFRACTION' 12 ? ? ? ? ? 
1 'MEDIUM THERMAL'    A 1192 0.320 2.000  1 'X-RAY DIFFRACTION' 13 ? ? ? ? ? 
2 'MEDIUM THERMAL'    B 1192 0.270 2.000  1 'X-RAY DIFFRACTION' 14 ? ? ? ? ? 
3 'MEDIUM THERMAL'    C 1192 0.270 2.000  1 'X-RAY DIFFRACTION' 15 ? ? ? ? ? 
4 'MEDIUM THERMAL'    D 1192 0.270 2.000  1 'X-RAY DIFFRACTION' 16 ? ? ? ? ? 
5 'MEDIUM THERMAL'    E 1192 0.300 2.000  1 'X-RAY DIFFRACTION' 17 ? ? ? ? ? 
6 'MEDIUM THERMAL'    F 1192 0.320 2.000  1 'X-RAY DIFFRACTION' 18 ? ? ? ? ? 
1 'LOOSE THERMAL'     A 1463 0.890 10.000 1 'X-RAY DIFFRACTION' 19 ? ? ? ? ? 
2 'LOOSE THERMAL'     B 1463 0.850 10.000 1 'X-RAY DIFFRACTION' 20 ? ? ? ? ? 
3 'LOOSE THERMAL'     C 1463 0.880 10.000 1 'X-RAY DIFFRACTION' 21 ? ? ? ? ? 
4 'LOOSE THERMAL'     D 1463 0.800 10.000 1 'X-RAY DIFFRACTION' 22 ? ? ? ? ? 
5 'LOOSE THERMAL'     E 1463 0.780 10.000 1 'X-RAY DIFFRACTION' 23 ? ? ? ? ? 
6 'LOOSE THERMAL'     F 1463 0.930 10.000 1 'X-RAY DIFFRACTION' 24 ? ? ? ? ? 
1 'MEDIUM POSITIONAL' A 94   0.350 0.500  2 'X-RAY DIFFRACTION' 25 ? ? ? ? ? 
2 'MEDIUM POSITIONAL' B 94   0.320 0.500  2 'X-RAY DIFFRACTION' 26 ? ? ? ? ? 
3 'MEDIUM POSITIONAL' C 94   0.320 0.500  2 'X-RAY DIFFRACTION' 27 ? ? ? ? ? 
1 'LOOSE POSITIONAL'  A 130  0.900 5.000  2 'X-RAY DIFFRACTION' 28 ? ? ? ? ? 
2 'LOOSE POSITIONAL'  B 130  0.860 5.000  2 'X-RAY DIFFRACTION' 29 ? ? ? ? ? 
3 'LOOSE POSITIONAL'  C 130  0.730 5.000  2 'X-RAY DIFFRACTION' 30 ? ? ? ? ? 
1 'MEDIUM THERMAL'    A 94   0.250 2.000  2 'X-RAY DIFFRACTION' 31 ? ? ? ? ? 
2 'MEDIUM THERMAL'    B 94   0.200 2.000  2 'X-RAY DIFFRACTION' 32 ? ? ? ? ? 
3 'MEDIUM THERMAL'    C 94   0.200 2.000  2 'X-RAY DIFFRACTION' 33 ? ? ? ? ? 
1 'LOOSE THERMAL'     A 130  0.580 10.000 2 'X-RAY DIFFRACTION' 34 ? ? ? ? ? 
2 'LOOSE THERMAL'     B 130  0.470 10.000 2 'X-RAY DIFFRACTION' 35 ? ? ? ? ? 
3 'LOOSE THERMAL'     C 130  0.490 10.000 2 'X-RAY DIFFRACTION' 36 ? ? ? ? ? 
1 'MEDIUM POSITIONAL' G 63   0.510 0.500  3 'X-RAY DIFFRACTION' 37 ? ? ? ? ? 
2 'MEDIUM POSITIONAL' H 63   0.310 0.500  3 'X-RAY DIFFRACTION' 38 ? ? ? ? ? 
3 'MEDIUM POSITIONAL' I 63   0.370 0.500  3 'X-RAY DIFFRACTION' 39 ? ? ? ? ? 
1 'LOOSE POSITIONAL'  G 66   0.990 5.000  3 'X-RAY DIFFRACTION' 40 ? ? ? ? ? 
2 'LOOSE POSITIONAL'  H 66   0.910 5.000  3 'X-RAY DIFFRACTION' 41 ? ? ? ? ? 
3 'LOOSE POSITIONAL'  I 66   0.810 5.000  3 'X-RAY DIFFRACTION' 42 ? ? ? ? ? 
1 'MEDIUM THERMAL'    G 63   0.170 2.000  3 'X-RAY DIFFRACTION' 43 ? ? ? ? ? 
2 'MEDIUM THERMAL'    H 63   0.250 2.000  3 'X-RAY DIFFRACTION' 44 ? ? ? ? ? 
3 'MEDIUM THERMAL'    I 63   0.250 2.000  3 'X-RAY DIFFRACTION' 45 ? ? ? ? ? 
1 'LOOSE THERMAL'     G 66   0.960 10.000 3 'X-RAY DIFFRACTION' 46 ? ? ? ? ? 
2 'LOOSE THERMAL'     H 66   0.990 10.000 3 'X-RAY DIFFRACTION' 47 ? ? ? ? ? 
3 'LOOSE THERMAL'     I 66   0.600 10.000 3 'X-RAY DIFFRACTION' 48 ? ? ? ? ? 
# 
_refine_ls_shell.d_res_high                       2.850 
_refine_ls_shell.d_res_low                        2.922 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.percent_reflns_obs               38.210 
_refine_ls_shell.number_reflns_R_work             1272 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_R_work                  0.299 
_refine_ls_shell.R_factor_R_free                  0.444 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             40 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.number_reflns_all                1312 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
loop_
_struct_ncs_dom.pdbx_ens_id 
_struct_ncs_dom.id 
_struct_ncs_dom.details 
1 1 A 
1 2 B 
1 3 C 
1 4 D 
1 5 E 
1 6 F 
2 1 A 
2 2 B 
2 3 C 
3 1 G 
3 2 H 
3 3 I 
# 
loop_
_struct_ncs_dom_lim.dom_id 
_struct_ncs_dom_lim.pdbx_component_id 
_struct_ncs_dom_lim.beg_label_asym_id 
_struct_ncs_dom_lim.beg_label_seq_id 
_struct_ncs_dom_lim.end_label_asym_id 
_struct_ncs_dom_lim.end_label_seq_id 
_struct_ncs_dom_lim.pdbx_refine_code 
_struct_ncs_dom_lim.beg_label_alt_id 
_struct_ncs_dom_lim.end_label_alt_id 
_struct_ncs_dom_lim.beg_label_comp_id 
_struct_ncs_dom_lim.end_label_comp_id 
_struct_ncs_dom_lim.beg_auth_asym_id 
_struct_ncs_dom_lim.beg_auth_seq_id 
_struct_ncs_dom_lim.end_auth_asym_id 
_struct_ncs_dom_lim.end_auth_seq_id 
_struct_ncs_dom_lim.pdbx_ens_id 
_struct_ncs_dom_lim.selection_details 
1 1 A 4   A 210 5 . . LYS ILE A 232  A 438  1 ? 
2 1 B 5   B 210 5 . . PRO ILE B 233  B 438  1 ? 
3 1 C 5   C 210 5 . . PRO ILE C 233  C 438  1 ? 
4 1 D 5   D 210 5 . . PRO ILE D 233  D 438  1 ? 
5 1 E 6   E 210 5 . . TYR ILE E 234  E 438  1 ? 
6 1 F 5   F 210 5 . . PRO ILE F 233  F 438  1 ? 
1 1 A 211 A 227 5 . . LYS GLU A 439  A 455  2 ? 
2 1 B 211 B 227 5 . . LYS GLU B 439  B 455  2 ? 
3 1 C 211 C 227 5 . . LYS GLU C 439  C 455  2 ? 
1 1 G 4   G 15  5 . . GLY GLY G 1319 G 1330 3 ? 
2 1 H 4   H 15  5 . . GLY GLY H 1319 H 1330 3 ? 
3 1 I 4   I 15  5 . . GLY GLY I 1319 I 1330 3 ? 
# 
loop_
_struct_ncs_ens.id 
_struct_ncs_ens.details 
1 ? 
2 ? 
3 ? 
# 
_struct.entry_id                  2GPV 
_struct.title                     
'Estrogen Related Receptor-gamma ligand binding domain complexed with 4-hydroxy-tamoxifen and a SMRT peptide' 
_struct.pdbx_descriptor           'Estrogen-related receptor gamma, Nuclear receptor corepressor 2' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.text            
'Estrogen related receptor, ERR, ERRg, ESRRG, Nuclear Receptor, Steroid Receptor, SMRT, Tamoxifen, TRANSCRIPTION' 
_struct_keywords.entry_id        2GPV 
_struct_keywords.pdbx_keywords   TRANSCRIPTION 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 1 ? 
F N N 1 ? 
G N N 2 ? 
H N N 2 ? 
I N N 2 ? 
J N N 3 ? 
K N N 3 ? 
L N N 3 ? 
M N N 3 ? 
N N N 3 ? 
O N N 3 ? 
P N N 4 ? 
Q N N 4 ? 
R N N 4 ? 
S N N 4 ? 
T N N 4 ? 
U N N 4 ? 
V N N 4 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASN A 7   ? ALA A 16  ? ASN A 235  ALA A 244  1 ? 10 
HELX_P HELX_P2  2  SER A 32  ? HIS A 57  ? SER A 260  HIS A 285  1 ? 26 
HELX_P HELX_P3  3  GLY A 60  ? LEU A 64  ? GLY A 288  LEU A 292  5 ? 5  
HELX_P HELX_P4  4  SER A 65  ? SER A 89  ? SER A 293  SER A 317  1 ? 25 
HELX_P HELX_P5  5  ASP A 105 ? GLY A 113 ? ASP A 333  GLY A 341  1 ? 9  
HELX_P HELX_P6  6  LEU A 114 ? LYS A 132 ? LEU A 342  LYS A 360  1 ? 19 
HELX_P HELX_P7  7  GLU A 134 ? ASN A 148 ? GLU A 362  ASN A 376  1 ? 15 
HELX_P HELX_P8  8  ASP A 156 ? HIS A 179 ? ASP A 384  HIS A 407  1 ? 24 
HELX_P HELX_P9  9  ARG A 184 ? MET A 191 ? ARG A 412  MET A 419  1 ? 8  
HELX_P HELX_P10 10 THR A 192 ? LEU A 212 ? THR A 420  LEU A 440  1 ? 21 
HELX_P HELX_P11 11 LYS A 215 ? GLU A 227 ? LYS A 443  GLU A 455  1 ? 13 
HELX_P HELX_P12 12 ASN B 7   ? GLU B 17  ? ASN B 235  GLU B 245  1 ? 11 
HELX_P HELX_P13 13 SER B 32  ? ILE B 58  ? SER B 260  ILE B 286  1 ? 27 
HELX_P HELX_P14 14 GLY B 60  ? LEU B 64  ? GLY B 288  LEU B 292  5 ? 5  
HELX_P HELX_P15 15 SER B 65  ? SER B 89  ? SER B 293  SER B 317  1 ? 25 
HELX_P HELX_P16 16 ASP B 105 ? GLY B 113 ? ASP B 333  GLY B 341  1 ? 9  
HELX_P HELX_P17 17 LEU B 114 ? MET B 131 ? LEU B 342  MET B 359  1 ? 18 
HELX_P HELX_P18 18 GLU B 134 ? ASN B 148 ? GLU B 362  ASN B 376  1 ? 15 
HELX_P HELX_P19 19 ASP B 156 ? HIS B 179 ? ASP B 384  HIS B 407  1 ? 24 
HELX_P HELX_P20 20 ARG B 184 ? MET B 191 ? ARG B 412  MET B 419  1 ? 8  
HELX_P HELX_P21 21 THR B 192 ? GLU B 213 ? THR B 420  GLU B 441  1 ? 22 
HELX_P HELX_P22 22 LYS B 215 ? GLU B 227 ? LYS B 443  GLU B 455  1 ? 13 
HELX_P HELX_P23 23 ASN C 7   ? ALA C 16  ? ASN C 235  ALA C 244  1 ? 10 
HELX_P HELX_P24 24 SER C 32  ? LYS C 56  ? SER C 260  LYS C 284  1 ? 25 
HELX_P HELX_P25 25 SER C 65  ? LEU C 90  ? SER C 293  LEU C 318  1 ? 26 
HELX_P HELX_P26 26 ASP C 105 ? GLY C 113 ? ASP C 333  GLY C 341  1 ? 9  
HELX_P HELX_P27 27 LEU C 114 ? LYS C 132 ? LEU C 342  LYS C 360  1 ? 19 
HELX_P HELX_P28 28 GLU C 134 ? ASN C 148 ? GLU C 362  ASN C 376  1 ? 15 
HELX_P HELX_P29 29 ASP C 156 ? HIS C 179 ? ASP C 384  HIS C 407  1 ? 24 
HELX_P HELX_P30 30 ARG C 184 ? MET C 191 ? ARG C 412  MET C 419  1 ? 8  
HELX_P HELX_P31 31 THR C 192 ? LEU C 212 ? THR C 420  LEU C 440  1 ? 21 
HELX_P HELX_P32 32 GLY C 214 ? LEU C 226 ? GLY C 442  LEU C 454  1 ? 13 
HELX_P HELX_P33 33 ASN D 7   ? GLU D 17  ? ASN D 235  GLU D 245  1 ? 11 
HELX_P HELX_P34 34 SER D 32  ? HIS D 57  ? SER D 260  HIS D 285  1 ? 26 
HELX_P HELX_P35 35 GLY D 60  ? LEU D 64  ? GLY D 288  LEU D 292  5 ? 5  
HELX_P HELX_P36 36 SER D 65  ? SER D 89  ? SER D 293  SER D 317  1 ? 25 
HELX_P HELX_P37 37 GLU D 106 ? ALA D 112 ? GLU D 334  ALA D 340  1 ? 7  
HELX_P HELX_P38 38 LEU D 114 ? LYS D 132 ? LEU D 342  LYS D 360  1 ? 19 
HELX_P HELX_P39 39 GLU D 134 ? ASN D 148 ? GLU D 362  ASN D 376  1 ? 15 
HELX_P HELX_P40 40 ASP D 156 ? HIS D 179 ? ASP D 384  HIS D 407  1 ? 24 
HELX_P HELX_P41 41 ARG D 184 ? MET D 191 ? ARG D 412  MET D 419  1 ? 8  
HELX_P HELX_P42 42 THR D 192 ? LYS D 211 ? THR D 420  LYS D 439  1 ? 20 
HELX_P HELX_P43 43 ASN E 7   ? GLU E 17  ? ASN E 235  GLU E 245  1 ? 11 
HELX_P HELX_P44 44 SER E 32  ? HIS E 57  ? SER E 260  HIS E 285  1 ? 26 
HELX_P HELX_P45 45 GLY E 60  ? LEU E 64  ? GLY E 288  LEU E 292  5 ? 5  
HELX_P HELX_P46 46 SER E 65  ? SER E 89  ? SER E 293  SER E 317  1 ? 25 
HELX_P HELX_P47 47 GLU E 106 ? ALA E 112 ? GLU E 334  ALA E 340  1 ? 7  
HELX_P HELX_P48 48 LEU E 114 ? LYS E 132 ? LEU E 342  LYS E 360  1 ? 19 
HELX_P HELX_P49 49 GLU E 134 ? ASN E 148 ? GLU E 362  ASN E 376  1 ? 15 
HELX_P HELX_P50 50 ASP E 156 ? HIS E 179 ? ASP E 384  HIS E 407  1 ? 24 
HELX_P HELX_P51 51 ARG E 184 ? MET E 191 ? ARG E 412  MET E 419  1 ? 8  
HELX_P HELX_P52 52 THR E 192 ? GLU E 213 ? THR E 420  GLU E 441  1 ? 22 
HELX_P HELX_P53 53 ASN F 7   ? ALA F 16  ? ASN F 235  ALA F 244  1 ? 10 
HELX_P HELX_P54 54 SER F 32  ? LYS F 56  ? SER F 260  LYS F 284  1 ? 25 
HELX_P HELX_P55 55 GLY F 60  ? LEU F 64  ? GLY F 288  LEU F 292  5 ? 5  
HELX_P HELX_P56 56 SER F 65  ? LEU F 90  ? SER F 293  LEU F 318  1 ? 26 
HELX_P HELX_P57 57 GLU F 106 ? ALA F 112 ? GLU F 334  ALA F 340  1 ? 7  
HELX_P HELX_P58 58 LEU F 114 ? MET F 131 ? LEU F 342  MET F 359  1 ? 18 
HELX_P HELX_P59 59 GLU F 134 ? ASN F 148 ? GLU F 362  ASN F 376  1 ? 15 
HELX_P HELX_P60 60 ASP F 156 ? HIS F 179 ? ASP F 384  HIS F 407  1 ? 24 
HELX_P HELX_P61 61 ARG F 184 ? MET F 191 ? ARG F 412  MET F 419  1 ? 8  
HELX_P HELX_P62 62 THR F 192 ? LYS F 211 ? THR F 420  LYS F 439  1 ? 20 
HELX_P HELX_P63 63 LEU G 5   ? GLY G 15  ? LEU G 1320 GLY G 1330 1 ? 11 
HELX_P HELX_P64 64 GLY H 4   ? GLY H 15  ? GLY H 1319 GLY H 1330 1 ? 12 
HELX_P HELX_P65 65 GLY I 4   ? GLY I 15  ? GLY I 1319 GLY I 1330 1 ? 12 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 2 ? 
C ? 2 ? 
D ? 2 ? 
E ? 2 ? 
F ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? anti-parallel 
C 1 2 ? anti-parallel 
D 1 2 ? anti-parallel 
E 1 2 ? anti-parallel 
F 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LEU A 96  ? ALA A 99  ? LEU A 324 ALA A 327 
A 2 TYR A 102 ? MET A 104 ? TYR A 330 MET A 332 
B 1 LEU B 96  ? ALA B 99  ? LEU B 324 ALA B 327 
B 2 TYR B 102 ? MET B 104 ? TYR B 330 MET B 332 
C 1 LEU C 96  ? ALA C 99  ? LEU C 324 ALA C 327 
C 2 TYR C 102 ? MET C 104 ? TYR C 330 MET C 332 
D 1 GLU D 95  ? ALA D 99  ? GLU D 323 ALA D 327 
D 2 TYR D 102 ? ASP D 105 ? TYR D 330 ASP D 333 
E 1 GLU E 95  ? ALA E 99  ? GLU E 323 ALA E 327 
E 2 TYR E 102 ? ASP E 105 ? TYR E 330 ASP E 333 
F 1 GLU F 95  ? ALA F 99  ? GLU F 323 ALA F 327 
F 2 TYR F 102 ? ASP F 105 ? TYR F 330 ASP F 333 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N LEU A 96 ? N LEU A 324 O MET A 104 ? O MET A 332 
B 1 2 N ALA B 99 ? N ALA B 327 O TYR B 102 ? O TYR B 330 
C 1 2 N ALA C 99 ? N ALA C 327 O TYR C 102 ? O TYR C 330 
D 1 2 N LEU D 96 ? N LEU D 324 O MET D 104 ? O MET D 332 
E 1 2 N ALA E 99 ? N ALA E 327 O TYR E 102 ? O TYR E 330 
F 1 2 N ALA F 99 ? N ALA F 327 O TYR F 102 ? O TYR F 330 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE OHT A 500' 
AC2 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE OHT B 501' 
AC3 Software ? ? ? ? 13 'BINDING SITE FOR RESIDUE OHT C 502' 
AC4 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE OHT D 503' 
AC5 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE OHT E 504' 
AC6 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE OHT F 505' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 12 LEU A 40  ? LEU A 268  . ? 1_555 ? 
2  AC1 12 ALA A 44  ? ALA A 272  . ? 1_555 ? 
3  AC1 12 ASP A 45  ? ASP A 273  . ? 1_555 ? 
4  AC1 12 GLU A 47  ? GLU A 275  . ? 1_555 ? 
5  AC1 12 LEU A 48  ? LEU A 276  . ? 1_555 ? 
6  AC1 12 MET A 78  ? MET A 306  . ? 1_555 ? 
7  AC1 12 ARG A 88  ? ARG A 316  . ? 1_555 ? 
8  AC1 12 TYR A 98  ? TYR A 326  . ? 1_555 ? 
9  AC1 12 LEU A 117 ? LEU A 345  . ? 1_555 ? 
10 AC1 12 ALA A 203 ? ALA A 431  . ? 1_555 ? 
11 AC1 12 PHE A 207 ? PHE A 435  . ? 1_555 ? 
12 AC1 12 GLY G 4   ? GLY G 1319 . ? 1_555 ? 
13 AC2 10 LEU B 40  ? LEU B 268  . ? 1_555 ? 
14 AC2 10 ALA B 44  ? ALA B 272  . ? 1_555 ? 
15 AC2 10 ASP B 45  ? ASP B 273  . ? 1_555 ? 
16 AC2 10 GLU B 47  ? GLU B 275  . ? 1_555 ? 
17 AC2 10 MET B 78  ? MET B 306  . ? 1_555 ? 
18 AC2 10 LEU B 81  ? LEU B 309  . ? 1_555 ? 
19 AC2 10 ARG B 88  ? ARG B 316  . ? 1_555 ? 
20 AC2 10 TYR B 98  ? TYR B 326  . ? 1_555 ? 
21 AC2 10 ALA B 203 ? ALA B 431  . ? 1_555 ? 
22 AC2 10 PHE B 207 ? PHE B 435  . ? 1_555 ? 
23 AC3 13 CYS C 41  ? CYS C 269  . ? 1_555 ? 
24 AC3 13 ALA C 44  ? ALA C 272  . ? 1_555 ? 
25 AC3 13 ASP C 45  ? ASP C 273  . ? 1_555 ? 
26 AC3 13 GLU C 47  ? GLU C 275  . ? 1_555 ? 
27 AC3 13 LEU C 48  ? LEU C 276  . ? 1_555 ? 
28 AC3 13 LEU C 81  ? LEU C 309  . ? 1_555 ? 
29 AC3 13 ARG C 88  ? ARG C 316  . ? 1_555 ? 
30 AC3 13 TYR C 98  ? TYR C 326  . ? 1_555 ? 
31 AC3 13 LEU C 114 ? LEU C 342  . ? 1_555 ? 
32 AC3 13 LEU C 117 ? LEU C 345  . ? 1_555 ? 
33 AC3 13 ILE C 121 ? ILE C 349  . ? 1_555 ? 
34 AC3 13 ALA C 203 ? ALA C 431  . ? 1_555 ? 
35 AC3 13 PHE C 207 ? PHE C 435  . ? 1_555 ? 
36 AC4 11 MET B 218 ? MET B 446  . ? 1_555 ? 
37 AC4 11 LEU D 40  ? LEU D 268  . ? 1_555 ? 
38 AC4 11 ALA D 44  ? ALA D 272  . ? 1_555 ? 
39 AC4 11 ASP D 45  ? ASP D 273  . ? 1_555 ? 
40 AC4 11 GLU D 47  ? GLU D 275  . ? 1_555 ? 
41 AC4 11 ARG D 88  ? ARG D 316  . ? 1_555 ? 
42 AC4 11 TYR D 98  ? TYR D 326  . ? 1_555 ? 
43 AC4 11 LEU D 114 ? LEU D 342  . ? 1_555 ? 
44 AC4 11 LEU D 117 ? LEU D 345  . ? 1_555 ? 
45 AC4 11 ALA D 203 ? ALA D 431  . ? 1_555 ? 
46 AC4 11 PHE D 207 ? PHE D 435  . ? 1_555 ? 
47 AC5 10 LEU E 40  ? LEU E 268  . ? 1_555 ? 
48 AC5 10 ALA E 44  ? ALA E 272  . ? 1_555 ? 
49 AC5 10 ASP E 45  ? ASP E 273  . ? 1_555 ? 
50 AC5 10 GLU E 47  ? GLU E 275  . ? 1_555 ? 
51 AC5 10 LEU E 81  ? LEU E 309  . ? 1_555 ? 
52 AC5 10 ARG E 88  ? ARG E 316  . ? 1_555 ? 
53 AC5 10 TYR E 98  ? TYR E 326  . ? 1_555 ? 
54 AC5 10 LEU E 114 ? LEU E 342  . ? 1_555 ? 
55 AC5 10 ILE E 121 ? ILE E 349  . ? 1_555 ? 
56 AC5 10 PHE E 207 ? PHE E 435  . ? 1_555 ? 
57 AC6 10 ALA F 44  ? ALA F 272  . ? 1_555 ? 
58 AC6 10 ASP F 45  ? ASP F 273  . ? 1_555 ? 
59 AC6 10 GLU F 47  ? GLU F 275  . ? 1_555 ? 
60 AC6 10 MET F 78  ? MET F 306  . ? 1_555 ? 
61 AC6 10 LEU F 81  ? LEU F 309  . ? 1_555 ? 
62 AC6 10 ARG F 88  ? ARG F 316  . ? 1_555 ? 
63 AC6 10 TYR F 98  ? TYR F 326  . ? 1_555 ? 
64 AC6 10 ALA F 203 ? ALA F 431  . ? 1_555 ? 
65 AC6 10 HIS F 206 ? HIS F 434  . ? 1_555 ? 
66 AC6 10 PHE F 207 ? PHE F 435  . ? 1_555 ? 
# 
_atom_sites.entry_id                    2GPV 
_atom_sites.fract_transf_matrix[1][1]   0.00500 
_atom_sites.fract_transf_matrix[1][2]   0.00000 
_atom_sites.fract_transf_matrix[1][3]   0.00109 
_atom_sites.fract_transf_matrix[2][1]   0.00000 
_atom_sites.fract_transf_matrix[2][2]   0.00853 
_atom_sites.fract_transf_matrix[2][3]   0.00000 
_atom_sites.fract_transf_matrix[3][1]   0.00000 
_atom_sites.fract_transf_matrix[3][2]   0.00000 
_atom_sites.fract_transf_matrix[3][3]   0.01132 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N N   . LYS A 1 4   ? 58.712  -4.195  25.395  1.00 27.42 ? 232  LYS A N   1 
ATOM   2     C CA  . LYS A 1 4   ? 59.472  -2.934  25.670  1.00 27.51 ? 232  LYS A CA  1 
ATOM   3     C C   . LYS A 1 4   ? 58.564  -1.691  25.683  1.00 27.68 ? 232  LYS A C   1 
ATOM   4     O O   . LYS A 1 4   ? 58.724  -0.829  26.562  1.00 27.90 ? 232  LYS A O   1 
ATOM   5     C CB  . LYS A 1 4   ? 60.624  -2.769  24.663  1.00 27.31 ? 232  LYS A CB  1 
ATOM   6     C CG  . LYS A 1 4   ? 61.955  -3.382  25.108  1.00 26.55 ? 232  LYS A CG  1 
ATOM   7     C CD  . LYS A 1 4   ? 62.667  -4.054  23.942  1.00 25.85 ? 232  LYS A CD  1 
ATOM   8     C CE  . LYS A 1 4   ? 64.151  -4.241  24.192  1.00 25.42 ? 232  LYS A CE  1 
ATOM   9     N NZ  . LYS A 1 4   ? 64.942  -3.075  23.727  1.00 24.42 ? 232  LYS A NZ  1 
ATOM   10    N N   . PRO A 1 5   ? 57.634  -1.578  24.702  1.00 27.60 ? 233  PRO A N   1 
ATOM   11    C CA  . PRO A 1 5   ? 56.565  -0.587  24.803  1.00 27.29 ? 233  PRO A CA  1 
ATOM   12    C C   . PRO A 1 5   ? 55.406  -1.220  25.540  1.00 26.91 ? 233  PRO A C   1 
ATOM   13    O O   . PRO A 1 5   ? 55.184  -2.418  25.390  1.00 26.89 ? 233  PRO A O   1 
ATOM   14    C CB  . PRO A 1 5   ? 56.196  -0.311  23.344  1.00 27.22 ? 233  PRO A CB  1 
ATOM   15    C CG  . PRO A 1 5   ? 56.490  -1.596  22.631  1.00 27.56 ? 233  PRO A CG  1 
ATOM   16    C CD  . PRO A 1 5   ? 57.526  -2.353  23.450  1.00 27.75 ? 233  PRO A CD  1 
ATOM   17    N N   . TYR A 1 6   ? 54.704  -0.433  26.347  1.00 26.54 ? 234  TYR A N   1 
ATOM   18    C CA  . TYR A 1 6   ? 53.524  -0.901  27.066  1.00 26.21 ? 234  TYR A CA  1 
ATOM   19    C C   . TYR A 1 6   ? 52.288  -0.816  26.198  1.00 25.27 ? 234  TYR A C   1 
ATOM   20    O O   . TYR A 1 6   ? 52.314  -0.294  25.094  1.00 25.49 ? 234  TYR A O   1 
ATOM   21    C CB  . TYR A 1 6   ? 53.251  -0.027  28.299  1.00 26.84 ? 234  TYR A CB  1 
ATOM   22    C CG  . TYR A 1 6   ? 53.804  -0.477  29.636  1.00 27.33 ? 234  TYR A CG  1 
ATOM   23    C CD1 . TYR A 1 6   ? 54.823  -1.426  29.738  1.00 28.34 ? 234  TYR A CD1 1 
ATOM   24    C CD2 . TYR A 1 6   ? 53.336  0.111   30.810  1.00 27.13 ? 234  TYR A CD2 1 
ATOM   25    C CE1 . TYR A 1 6   ? 55.333  -1.800  30.984  1.00 28.56 ? 234  TYR A CE1 1 
ATOM   26    C CE2 . TYR A 1 6   ? 53.838  -0.244  32.045  1.00 27.88 ? 234  TYR A CE2 1 
ATOM   27    C CZ  . TYR A 1 6   ? 54.838  -1.200  32.133  1.00 28.35 ? 234  TYR A CZ  1 
ATOM   28    O OH  . TYR A 1 6   ? 55.335  -1.561  33.370  1.00 28.20 ? 234  TYR A OH  1 
ATOM   29    N N   . ASN A 1 7   ? 51.201  -1.325  26.757  1.00 24.06 ? 235  ASN A N   1 
ATOM   30    C CA  . ASN A 1 7   ? 49.851  -1.166  26.249  1.00 22.85 ? 235  ASN A CA  1 
ATOM   31    C C   . ASN A 1 7   ? 49.388  0.297   26.279  1.00 21.96 ? 235  ASN A C   1 
ATOM   32    O O   . ASN A 1 7   ? 49.524  0.979   27.295  1.00 21.92 ? 235  ASN A O   1 
ATOM   33    C CB  . ASN A 1 7   ? 48.939  -2.000  27.142  1.00 22.58 ? 235  ASN A CB  1 
ATOM   34    C CG  . ASN A 1 7   ? 47.571  -2.159  26.587  1.00 22.14 ? 235  ASN A CG  1 
ATOM   35    O OD1 . ASN A 1 7   ? 46.754  -1.240  26.651  1.00 21.56 ? 235  ASN A OD1 1 
ATOM   36    N ND2 . ASN A 1 7   ? 47.289  -3.340  26.049  1.00 20.90 ? 235  ASN A ND2 1 
ATOM   37    N N   . LYS A 1 8   ? 48.811  0.766   25.180  1.00 20.66 ? 236  LYS A N   1 
ATOM   38    C CA  . LYS A 1 8   ? 48.329  2.145   25.090  1.00 19.56 ? 236  LYS A CA  1 
ATOM   39    C C   . LYS A 1 8   ? 47.228  2.487   26.092  1.00 18.89 ? 236  LYS A C   1 
ATOM   40    O O   . LYS A 1 8   ? 47.196  3.594   26.602  1.00 19.03 ? 236  LYS A O   1 
ATOM   41    C CB  . LYS A 1 8   ? 47.835  2.447   23.678  1.00 19.28 ? 236  LYS A CB  1 
ATOM   42    C CG  . LYS A 1 8   ? 48.923  2.800   22.713  1.00 18.99 ? 236  LYS A CG  1 
ATOM   43    C CD  . LYS A 1 8   ? 48.497  2.528   21.297  1.00 19.75 ? 236  LYS A CD  1 
ATOM   44    C CE  . LYS A 1 8   ? 49.524  3.027   20.301  1.00 20.91 ? 236  LYS A CE  1 
ATOM   45    N NZ  . LYS A 1 8   ? 49.249  2.498   18.937  1.00 21.48 ? 236  LYS A NZ  1 
ATOM   46    N N   . ILE A 1 9   ? 46.318  1.560   26.367  1.00 18.08 ? 237  ILE A N   1 
ATOM   47    C CA  . ILE A 1 9   ? 45.252  1.816   27.356  1.00 17.49 ? 237  ILE A CA  1 
ATOM   48    C C   . ILE A 1 9   ? 45.759  1.799   28.795  1.00 17.21 ? 237  ILE A C   1 
ATOM   49    O O   . ILE A 1 9   ? 45.359  2.614   29.608  1.00 17.31 ? 237  ILE A O   1 
ATOM   50    C CB  . ILE A 1 9   ? 44.113  0.786   27.269  1.00 17.32 ? 237  ILE A CB  1 
ATOM   51    C CG1 . ILE A 1 9   ? 43.220  1.112   26.069  1.00 16.99 ? 237  ILE A CG1 1 
ATOM   52    C CG2 . ILE A 1 9   ? 43.322  0.767   28.576  1.00 16.18 ? 237  ILE A CG2 1 
ATOM   53    C CD1 . ILE A 1 9   ? 42.211  0.056   25.745  1.00 15.83 ? 237  ILE A CD1 1 
ATOM   54    N N   . VAL A 1 10  ? 46.613  0.839   29.111  1.00 16.90 ? 238  VAL A N   1 
ATOM   55    C CA  . VAL A 1 10  ? 47.207  0.771   30.423  1.00 16.26 ? 238  VAL A CA  1 
ATOM   56    C C   . VAL A 1 10  ? 47.962  2.054   30.645  1.00 16.19 ? 238  VAL A C   1 
ATOM   57    O O   . VAL A 1 10  ? 47.774  2.696   31.664  1.00 16.34 ? 238  VAL A O   1 
ATOM   58    C CB  . VAL A 1 10  ? 48.159  -0.416  30.572  1.00 16.15 ? 238  VAL A CB  1 
ATOM   59    C CG1 . VAL A 1 10  ? 48.844  -0.358  31.905  1.00 15.23 ? 238  VAL A CG1 1 
ATOM   60    C CG2 . VAL A 1 10  ? 47.397  -1.732  30.406  1.00 15.78 ? 238  VAL A CG2 1 
ATOM   61    N N   . SER A 1 11  ? 48.790  2.447   29.679  1.00 16.16 ? 239  SER A N   1 
ATOM   62    C CA  . SER A 1 11  ? 49.551  3.704   29.785  1.00 16.07 ? 239  SER A CA  1 
ATOM   63    C C   . SER A 1 11  ? 48.664  4.914   29.967  1.00 15.71 ? 239  SER A C   1 
ATOM   64    O O   . SER A 1 11  ? 49.004  5.829   30.699  1.00 15.59 ? 239  SER A O   1 
ATOM   65    C CB  . SER A 1 11  ? 50.402  3.929   28.553  1.00 16.06 ? 239  SER A CB  1 
ATOM   66    O OG  . SER A 1 11  ? 51.512  3.067   28.582  1.00 17.38 ? 239  SER A OG  1 
ATOM   67    N N   . HIS A 1 12  ? 47.531  4.916   29.286  1.00 15.40 ? 240  HIS A N   1 
ATOM   68    C CA  . HIS A 1 12  ? 46.591  5.985   29.426  1.00 15.20 ? 240  HIS A CA  1 
ATOM   69    C C   . HIS A 1 12  ? 46.064  6.014   30.850  1.00 15.30 ? 240  HIS A C   1 
ATOM   70    O O   . HIS A 1 12  ? 46.086  7.051   31.499  1.00 15.58 ? 240  HIS A O   1 
ATOM   71    C CB  . HIS A 1 12  ? 45.472  5.801   28.437  1.00 15.08 ? 240  HIS A CB  1 
ATOM   72    C CG  . HIS A 1 12  ? 44.482  6.909   28.458  1.00 15.53 ? 240  HIS A CG  1 
ATOM   73    N ND1 . HIS A 1 12  ? 44.704  8.111   27.828  1.00 16.77 ? 240  HIS A ND1 1 
ATOM   74    C CD2 . HIS A 1 12  ? 43.268  7.004   29.042  1.00 15.76 ? 240  HIS A CD2 1 
ATOM   75    C CE1 . HIS A 1 12  ? 43.662  8.898   28.015  1.00 17.00 ? 240  HIS A CE1 1 
ATOM   76    N NE2 . HIS A 1 12  ? 42.776  8.249   28.749  1.00 16.22 ? 240  HIS A NE2 1 
ATOM   77    N N   . LEU A 1 13  ? 45.630  4.860   31.342  1.00 15.26 ? 241  LEU A N   1 
ATOM   78    C CA  . LEU A 1 13  ? 45.140  4.723   32.708  1.00 15.27 ? 241  LEU A CA  1 
ATOM   79    C C   . LEU A 1 13  ? 46.120  5.207   33.788  1.00 15.31 ? 241  LEU A C   1 
ATOM   80    O O   . LEU A 1 13  ? 45.715  5.784   34.781  1.00 15.18 ? 241  LEU A O   1 
ATOM   81    C CB  . LEU A 1 13  ? 44.748  3.262   32.976  1.00 15.34 ? 241  LEU A CB  1 
ATOM   82    C CG  . LEU A 1 13  ? 43.449  2.778   32.310  1.00 15.11 ? 241  LEU A CG  1 
ATOM   83    C CD1 . LEU A 1 13  ? 43.125  1.356   32.744  1.00 13.79 ? 241  LEU A CD1 1 
ATOM   84    C CD2 . LEU A 1 13  ? 42.275  3.714   32.616  1.00 14.30 ? 241  LEU A CD2 1 
ATOM   85    N N   . LEU A 1 14  ? 47.403  4.970   33.592  1.00 15.56 ? 242  LEU A N   1 
ATOM   86    C CA  . LEU A 1 14  ? 48.421  5.449   34.524  1.00 15.84 ? 242  LEU A CA  1 
ATOM   87    C C   . LEU A 1 14  ? 48.515  6.979   34.615  1.00 16.01 ? 242  LEU A C   1 
ATOM   88    O O   . LEU A 1 14  ? 48.709  7.513   35.713  1.00 16.32 ? 242  LEU A O   1 
ATOM   89    C CB  . LEU A 1 14  ? 49.794  4.887   34.149  1.00 16.03 ? 242  LEU A CB  1 
ATOM   90    C CG  . LEU A 1 14  ? 50.103  3.469   34.646  1.00 16.83 ? 242  LEU A CG  1 
ATOM   91    C CD1 . LEU A 1 14  ? 51.420  2.942   34.015  1.00 16.59 ? 242  LEU A CD1 1 
ATOM   92    C CD2 . LEU A 1 14  ? 50.160  3.438   36.180  1.00 16.07 ? 242  LEU A CD2 1 
ATOM   93    N N   . VAL A 1 15  ? 48.400  7.678   33.482  1.00 15.93 ? 243  VAL A N   1 
ATOM   94    C CA  . VAL A 1 15  ? 48.461  9.148   33.478  1.00 15.79 ? 243  VAL A CA  1 
ATOM   95    C C   . VAL A 1 15  ? 47.176  9.739   34.049  1.00 15.99 ? 243  VAL A C   1 
ATOM   96    O O   . VAL A 1 15  ? 47.195  10.800  34.661  1.00 15.85 ? 243  VAL A O   1 
ATOM   97    C CB  . VAL A 1 15  ? 48.705  9.750   32.063  1.00 15.84 ? 243  VAL A CB  1 
ATOM   98    C CG1 . VAL A 1 15  ? 49.937  9.130   31.408  1.00 14.75 ? 243  VAL A CG1 1 
ATOM   99    C CG2 . VAL A 1 15  ? 47.453  9.616   31.172  1.00 15.58 ? 243  VAL A CG2 1 
ATOM   100   N N   . ALA A 1 16  ? 46.064  9.040   33.859  1.00 16.22 ? 244  ALA A N   1 
ATOM   101   C CA  . ALA A 1 16  ? 44.792  9.476   34.413  1.00 16.48 ? 244  ALA A CA  1 
ATOM   102   C C   . ALA A 1 16  ? 44.684  9.203   35.922  1.00 17.07 ? 244  ALA A C   1 
ATOM   103   O O   . ALA A 1 16  ? 43.736  9.664   36.550  1.00 17.08 ? 244  ALA A O   1 
ATOM   104   C CB  . ALA A 1 16  ? 43.649  8.815   33.675  1.00 16.02 ? 244  ALA A CB  1 
ATOM   105   N N   . GLU A 1 17  ? 45.635  8.467   36.510  1.00 17.87 ? 245  GLU A N   1 
ATOM   106   C CA  . GLU A 1 17  ? 45.546  8.108   37.935  1.00 18.14 ? 245  GLU A CA  1 
ATOM   107   C C   . GLU A 1 17  ? 45.607  9.368   38.789  1.00 18.36 ? 245  GLU A C   1 
ATOM   108   O O   . GLU A 1 17  ? 46.619  10.073  38.758  1.00 18.25 ? 245  GLU A O   1 
ATOM   109   C CB  . GLU A 1 17  ? 46.666  7.148   38.345  1.00 18.40 ? 245  GLU A CB  1 
ATOM   110   C CG  . GLU A 1 17  ? 46.793  6.869   39.868  1.00 19.09 ? 245  GLU A CG  1 
ATOM   111   C CD  . GLU A 1 17  ? 45.529  6.292   40.521  1.00 21.99 ? 245  GLU A CD  1 
ATOM   112   O OE1 . GLU A 1 17  ? 44.629  5.757   39.819  1.00 21.58 ? 245  GLU A OE1 1 
ATOM   113   O OE2 . GLU A 1 17  ? 45.451  6.371   41.767  1.00 23.74 ? 245  GLU A OE2 1 
ATOM   114   N N   . PRO A 1 18  ? 44.521  9.661   39.540  1.00 18.66 ? 246  PRO A N   1 
ATOM   115   C CA  . PRO A 1 18  ? 44.462  10.856  40.387  1.00 19.01 ? 246  PRO A CA  1 
ATOM   116   C C   . PRO A 1 18  ? 45.549  10.961  41.453  1.00 19.27 ? 246  PRO A C   1 
ATOM   117   O O   . PRO A 1 18  ? 46.053  9.955   41.955  1.00 19.58 ? 246  PRO A O   1 
ATOM   118   C CB  . PRO A 1 18  ? 43.084  10.754  41.056  1.00 18.84 ? 246  PRO A CB  1 
ATOM   119   C CG  . PRO A 1 18  ? 42.294  9.930   40.136  1.00 18.83 ? 246  PRO A CG  1 
ATOM   120   C CD  . PRO A 1 18  ? 43.256  8.912   39.613  1.00 18.76 ? 246  PRO A CD  1 
ATOM   121   N N   . GLU A 1 19  ? 45.888  12.197  41.783  1.00 19.56 ? 247  GLU A N   1 
ATOM   122   C CA  . GLU A 1 19  ? 46.873  12.485  42.801  1.00 19.84 ? 247  GLU A CA  1 
ATOM   123   C C   . GLU A 1 19  ? 46.316  12.078  44.150  1.00 19.51 ? 247  GLU A C   1 
ATOM   124   O O   . GLU A 1 19  ? 45.098  11.899  44.295  1.00 19.41 ? 247  GLU A O   1 
ATOM   125   C CB  . GLU A 1 19  ? 47.184  13.981  42.825  1.00 20.27 ? 247  GLU A CB  1 
ATOM   126   C CG  . GLU A 1 19  ? 47.577  14.552  41.480  1.00 21.97 ? 247  GLU A CG  1 
ATOM   127   C CD  . GLU A 1 19  ? 48.343  15.850  41.621  1.00 24.68 ? 247  GLU A CD  1 
ATOM   128   O OE1 . GLU A 1 19  ? 47.824  16.805  42.264  1.00 26.45 ? 247  GLU A OE1 1 
ATOM   129   O OE2 . GLU A 1 19  ? 49.471  15.903  41.089  1.00 25.51 ? 247  GLU A OE2 1 
ATOM   130   N N   . LYS A 1 20  ? 47.214  11.967  45.133  1.00 19.11 ? 248  LYS A N   1 
ATOM   131   C CA  . LYS A 1 20  ? 46.845  11.626  46.510  1.00 18.81 ? 248  LYS A CA  1 
ATOM   132   C C   . LYS A 1 20  ? 45.783  12.580  47.021  1.00 18.23 ? 248  LYS A C   1 
ATOM   133   O O   . LYS A 1 20  ? 45.818  13.780  46.702  1.00 18.24 ? 248  LYS A O   1 
ATOM   134   C CB  . LYS A 1 20  ? 48.064  11.699  47.443  1.00 18.88 ? 248  LYS A CB  1 
ATOM   135   C CG  . LYS A 1 20  ? 49.105  10.593  47.261  1.00 19.16 ? 248  LYS A CG  1 
ATOM   136   C CD  . LYS A 1 20  ? 50.296  10.810  48.202  1.00 19.36 ? 248  LYS A CD  1 
ATOM   137   C CE  . LYS A 1 20  ? 51.492  9.896   47.869  1.00 19.97 ? 248  LYS A CE  1 
ATOM   138   N NZ  . LYS A 1 20  ? 51.228  8.422   48.063  1.00 20.19 ? 248  LYS A NZ  1 
ATOM   139   N N   . ILE A 1 21  ? 44.844  12.044  47.800  1.00 17.60 ? 249  ILE A N   1 
ATOM   140   C CA  . ILE A 1 21  ? 43.858  12.864  48.507  1.00 17.18 ? 249  ILE A CA  1 
ATOM   141   C C   . ILE A 1 21  ? 44.072  12.687  50.006  1.00 17.36 ? 249  ILE A C   1 
ATOM   142   O O   . ILE A 1 21  ? 44.309  11.569  50.473  1.00 17.67 ? 249  ILE A O   1 
ATOM   143   C CB  . ILE A 1 21  ? 42.420  12.488  48.122  1.00 16.84 ? 249  ILE A CB  1 
ATOM   144   C CG1 . ILE A 1 21  ? 42.174  12.754  46.632  1.00 16.34 ? 249  ILE A CG1 1 
ATOM   145   C CG2 . ILE A 1 21  ? 41.446  13.282  48.919  1.00 16.06 ? 249  ILE A CG2 1 
ATOM   146   C CD1 . ILE A 1 21  ? 41.033  11.951  46.012  1.00 14.66 ? 249  ILE A CD1 1 
ATOM   147   N N   . TYR A 1 22  ? 44.011  13.787  50.753  1.00 17.31 ? 250  TYR A N   1 
ATOM   148   C CA  . TYR A 1 22  ? 44.251  13.748  52.197  1.00 17.36 ? 250  TYR A CA  1 
ATOM   149   C C   . TYR A 1 22  ? 42.962  13.673  52.997  1.00 16.98 ? 250  TYR A C   1 
ATOM   150   O O   . TYR A 1 22  ? 41.974  14.316  52.653  1.00 16.60 ? 250  TYR A O   1 
ATOM   151   C CB  . TYR A 1 22  ? 45.073  14.956  52.630  1.00 17.82 ? 250  TYR A CB  1 
ATOM   152   C CG  . TYR A 1 22  ? 46.500  14.856  52.167  1.00 18.41 ? 250  TYR A CG  1 
ATOM   153   C CD1 . TYR A 1 22  ? 47.418  14.106  52.887  1.00 19.01 ? 250  TYR A CD1 1 
ATOM   154   C CD2 . TYR A 1 22  ? 46.927  15.476  51.006  1.00 18.46 ? 250  TYR A CD2 1 
ATOM   155   C CE1 . TYR A 1 22  ? 48.720  13.976  52.477  1.00 18.92 ? 250  TYR A CE1 1 
ATOM   156   C CE2 . TYR A 1 22  ? 48.242  15.354  50.587  1.00 19.47 ? 250  TYR A CE2 1 
ATOM   157   C CZ  . TYR A 1 22  ? 49.129  14.594  51.335  1.00 18.97 ? 250  TYR A CZ  1 
ATOM   158   O OH  . TYR A 1 22  ? 50.437  14.444  50.960  1.00 19.64 ? 250  TYR A OH  1 
ATOM   159   N N   . ALA A 1 23  ? 42.985  12.873  54.063  1.00 16.63 ? 251  ALA A N   1 
ATOM   160   C CA  . ALA A 1 23  ? 41.820  12.688  54.926  1.00 16.27 ? 251  ALA A CA  1 
ATOM   161   C C   . ALA A 1 23  ? 41.539  13.978  55.662  1.00 16.06 ? 251  ALA A C   1 
ATOM   162   O O   . ALA A 1 23  ? 40.415  14.480  55.667  1.00 15.97 ? 251  ALA A O   1 
ATOM   163   C CB  . ALA A 1 23  ? 42.069  11.581  55.919  1.00 16.04 ? 251  ALA A CB  1 
ATOM   164   N N   . MET A 1 24  ? 42.580  14.491  56.298  1.00 15.87 ? 252  MET A N   1 
ATOM   165   C CA  . MET A 1 24  ? 42.542  15.785  56.951  1.00 15.96 ? 252  MET A CA  1 
ATOM   166   C C   . MET A 1 24  ? 41.603  15.810  58.147  1.00 15.86 ? 252  MET A C   1 
ATOM   167   O O   . MET A 1 24  ? 40.672  16.624  58.202  1.00 15.79 ? 252  MET A O   1 
ATOM   168   C CB  . MET A 1 24  ? 42.194  16.875  55.944  1.00 15.95 ? 252  MET A CB  1 
ATOM   169   C CG  . MET A 1 24  ? 43.079  16.801  54.736  1.00 16.14 ? 252  MET A CG  1 
ATOM   170   S SD  . MET A 1 24  ? 43.887  18.350  54.426  1.00 16.65 ? 252  MET A SD  1 
ATOM   171   C CE  . MET A 1 24  ? 42.513  19.263  53.703  1.00 17.85 ? 252  MET A CE  1 
ATOM   172   N N   . PRO A 1 25  ? 41.875  14.931  59.125  1.00 15.66 ? 253  PRO A N   1 
ATOM   173   C CA  . PRO A 1 25  ? 41.090  14.866  60.342  1.00 15.59 ? 253  PRO A CA  1 
ATOM   174   C C   . PRO A 1 25  ? 41.141  16.178  61.113  1.00 15.60 ? 253  PRO A C   1 
ATOM   175   O O   . PRO A 1 25  ? 42.152  16.881  61.078  1.00 15.45 ? 253  PRO A O   1 
ATOM   176   C CB  . PRO A 1 25  ? 41.772  13.749  61.138  1.00 15.63 ? 253  PRO A CB  1 
ATOM   177   C CG  . PRO A 1 25  ? 43.149  13.659  60.577  1.00 15.54 ? 253  PRO A CG  1 
ATOM   178   C CD  . PRO A 1 25  ? 42.982  13.955  59.139  1.00 15.60 ? 253  PRO A CD  1 
ATOM   179   N N   . ASP A 1 26  ? 40.041  16.490  61.788  1.00 15.67 ? 254  ASP A N   1 
ATOM   180   C CA  . ASP A 1 26  ? 39.930  17.678  62.618  1.00 15.73 ? 254  ASP A CA  1 
ATOM   181   C C   . ASP A 1 26  ? 40.674  17.414  63.925  1.00 15.78 ? 254  ASP A C   1 
ATOM   182   O O   . ASP A 1 26  ? 40.276  16.540  64.684  1.00 16.03 ? 254  ASP A O   1 
ATOM   183   C CB  . ASP A 1 26  ? 38.451  17.945  62.892  1.00 15.72 ? 254  ASP A CB  1 
ATOM   184   C CG  . ASP A 1 26  ? 38.189  19.331  63.430  1.00 16.18 ? 254  ASP A CG  1 
ATOM   185   O OD1 . ASP A 1 26  ? 39.020  19.864  64.203  1.00 16.32 ? 254  ASP A OD1 1 
ATOM   186   O OD2 . ASP A 1 26  ? 37.125  19.883  63.083  1.00 16.90 ? 254  ASP A OD2 1 
ATOM   187   N N   . PRO A 1 27  ? 41.762  18.157  64.197  1.00 15.85 ? 255  PRO A N   1 
ATOM   188   C CA  . PRO A 1 27  ? 42.510  17.897  65.439  1.00 15.88 ? 255  PRO A CA  1 
ATOM   189   C C   . PRO A 1 27  ? 41.768  18.288  66.708  1.00 16.04 ? 255  PRO A C   1 
ATOM   190   O O   . PRO A 1 27  ? 42.089  17.773  67.782  1.00 16.09 ? 255  PRO A O   1 
ATOM   191   C CB  . PRO A 1 27  ? 43.761  18.763  65.289  1.00 15.85 ? 255  PRO A CB  1 
ATOM   192   C CG  . PRO A 1 27  ? 43.347  19.867  64.369  1.00 16.06 ? 255  PRO A CG  1 
ATOM   193   C CD  . PRO A 1 27  ? 42.361  19.252  63.411  1.00 15.88 ? 255  PRO A CD  1 
ATOM   194   N N   . THR A 1 28  ? 40.793  19.191  66.581  1.00 16.28 ? 256  THR A N   1 
ATOM   195   C CA  . THR A 1 28  ? 40.035  19.719  67.729  1.00 16.32 ? 256  THR A CA  1 
ATOM   196   C C   . THR A 1 28  ? 39.030  18.694  68.271  1.00 16.38 ? 256  THR A C   1 
ATOM   197   O O   . THR A 1 28  ? 38.804  18.616  69.482  1.00 16.66 ? 256  THR A O   1 
ATOM   198   C CB  . THR A 1 28  ? 39.286  21.031  67.355  1.00 16.30 ? 256  THR A CB  1 
ATOM   199   O OG1 . THR A 1 28  ? 38.237  20.757  66.416  1.00 16.05 ? 256  THR A OG1 1 
ATOM   200   C CG2 . THR A 1 28  ? 40.246  22.038  66.733  1.00 16.47 ? 256  THR A CG2 1 
ATOM   201   N N   . VAL A 1 29  ? 38.434  17.919  67.366  1.00 16.29 ? 257  VAL A N   1 
ATOM   202   C CA  . VAL A 1 29  ? 37.459  16.895  67.729  1.00 16.32 ? 257  VAL A CA  1 
ATOM   203   C C   . VAL A 1 29  ? 38.168  15.745  68.429  1.00 16.35 ? 257  VAL A C   1 
ATOM   204   O O   . VAL A 1 29  ? 39.090  15.168  67.855  1.00 16.39 ? 257  VAL A O   1 
ATOM   205   C CB  . VAL A 1 29  ? 36.732  16.335  66.476  1.00 16.42 ? 257  VAL A CB  1 
ATOM   206   C CG1 . VAL A 1 29  ? 35.943  15.061  66.816  1.00 16.25 ? 257  VAL A CG1 1 
ATOM   207   C CG2 . VAL A 1 29  ? 35.818  17.404  65.858  1.00 16.49 ? 257  VAL A CG2 1 
ATOM   208   N N   . PRO A 1 30  ? 37.738  15.398  69.659  1.00 16.34 ? 258  PRO A N   1 
ATOM   209   C CA  . PRO A 1 30  ? 38.350  14.273  70.378  1.00 16.41 ? 258  PRO A CA  1 
ATOM   210   C C   . PRO A 1 30  ? 38.154  12.939  69.665  1.00 16.42 ? 258  PRO A C   1 
ATOM   211   O O   . PRO A 1 30  ? 37.123  12.730  69.028  1.00 16.33 ? 258  PRO A O   1 
ATOM   212   C CB  . PRO A 1 30  ? 37.611  14.259  71.729  1.00 16.57 ? 258  PRO A CB  1 
ATOM   213   C CG  . PRO A 1 30  ? 36.958  15.580  71.848  1.00 16.48 ? 258  PRO A CG  1 
ATOM   214   C CD  . PRO A 1 30  ? 36.663  16.023  70.447  1.00 16.34 ? 258  PRO A CD  1 
ATOM   215   N N   . ASP A 1 31  ? 39.143  12.056  69.779  1.00 16.61 ? 259  ASP A N   1 
ATOM   216   C CA  . ASP A 1 31  ? 39.097  10.725  69.149  1.00 16.83 ? 259  ASP A CA  1 
ATOM   217   C C   . ASP A 1 31  ? 37.869  9.931   69.593  1.00 16.76 ? 259  ASP A C   1 
ATOM   218   O O   . ASP A 1 31  ? 37.630  9.788   70.791  1.00 17.20 ? 259  ASP A O   1 
ATOM   219   C CB  . ASP A 1 31  ? 40.357  9.914   69.492  1.00 16.87 ? 259  ASP A CB  1 
ATOM   220   C CG  . ASP A 1 31  ? 41.493  10.155  68.519  1.00 17.91 ? 259  ASP A CG  1 
ATOM   221   O OD1 . ASP A 1 31  ? 42.030  11.284  68.492  1.00 19.50 ? 259  ASP A OD1 1 
ATOM   222   O OD2 . ASP A 1 31  ? 41.851  9.208   67.779  1.00 19.07 ? 259  ASP A OD2 1 
ATOM   223   N N   . SER A 1 32  ? 37.101  9.422   68.634  1.00 16.59 ? 260  SER A N   1 
ATOM   224   C CA  . SER A 1 32  ? 35.922  8.612   68.937  1.00 16.68 ? 260  SER A CA  1 
ATOM   225   C C   . SER A 1 32  ? 35.435  7.873   67.705  1.00 16.83 ? 260  SER A C   1 
ATOM   226   O O   . SER A 1 32  ? 35.951  8.070   66.596  1.00 16.96 ? 260  SER A O   1 
ATOM   227   C CB  . SER A 1 32  ? 34.784  9.475   69.488  1.00 16.78 ? 260  SER A CB  1 
ATOM   228   O OG  . SER A 1 32  ? 34.336  10.408  68.525  1.00 16.86 ? 260  SER A OG  1 
ATOM   229   N N   . ASP A 1 33  ? 34.435  7.021   67.895  1.00 16.91 ? 261  ASP A N   1 
ATOM   230   C CA  . ASP A 1 33  ? 33.869  6.282   66.776  1.00 17.10 ? 261  ASP A CA  1 
ATOM   231   C C   . ASP A 1 33  ? 33.393  7.234   65.693  1.00 16.74 ? 261  ASP A C   1 
ATOM   232   O O   . ASP A 1 33  ? 33.719  7.060   64.513  1.00 16.58 ? 261  ASP A O   1 
ATOM   233   C CB  . ASP A 1 33  ? 32.722  5.359   67.223  1.00 17.53 ? 261  ASP A CB  1 
ATOM   234   C CG  . ASP A 1 33  ? 31.544  6.115   67.822  1.00 18.60 ? 261  ASP A CG  1 
ATOM   235   O OD1 . ASP A 1 33  ? 31.743  6.860   68.818  1.00 19.98 ? 261  ASP A OD1 1 
ATOM   236   O OD2 . ASP A 1 33  ? 30.420  5.941   67.296  1.00 19.76 ? 261  ASP A OD2 1 
ATOM   237   N N   . ILE A 1 34  ? 32.658  8.264   66.108  1.00 16.36 ? 262  ILE A N   1 
ATOM   238   C CA  . ILE A 1 34  ? 32.020  9.172   65.165  1.00 16.01 ? 262  ILE A CA  1 
ATOM   239   C C   . ILE A 1 34  ? 33.048  9.972   64.377  1.00 15.63 ? 262  ILE A C   1 
ATOM   240   O O   . ILE A 1 34  ? 32.898  10.124  63.166  1.00 15.60 ? 262  ILE A O   1 
ATOM   241   C CB  . ILE A 1 34  ? 30.980  10.067  65.865  1.00 15.90 ? 262  ILE A CB  1 
ATOM   242   C CG1 . ILE A 1 34  ? 29.863  9.191   66.445  1.00 15.70 ? 262  ILE A CG1 1 
ATOM   243   C CG2 . ILE A 1 34  ? 30.380  11.067  64.900  1.00 16.17 ? 262  ILE A CG2 1 
ATOM   244   C CD1 . ILE A 1 34  ? 29.397  8.079   65.520  1.00 14.79 ? 262  ILE A CD1 1 
ATOM   245   N N   . LYS A 1 35  ? 34.101  10.443  65.040  1.00 15.14 ? 263  LYS A N   1 
ATOM   246   C CA  . LYS A 1 35  ? 35.194  11.100  64.325  1.00 14.93 ? 263  LYS A CA  1 
ATOM   247   C C   . LYS A 1 35  ? 35.682  10.229  63.172  1.00 14.79 ? 263  LYS A C   1 
ATOM   248   O O   . LYS A 1 35  ? 35.725  10.667  62.025  1.00 14.64 ? 263  LYS A O   1 
ATOM   249   C CB  . LYS A 1 35  ? 36.369  11.407  65.248  1.00 14.83 ? 263  LYS A CB  1 
ATOM   250   C CG  . LYS A 1 35  ? 37.590  11.927  64.497  1.00 14.82 ? 263  LYS A CG  1 
ATOM   251   C CD  . LYS A 1 35  ? 38.512  12.767  65.360  1.00 14.87 ? 263  LYS A CD  1 
ATOM   252   C CE  . LYS A 1 35  ? 39.558  13.468  64.508  1.00 14.63 ? 263  LYS A CE  1 
ATOM   253   N NZ  . LYS A 1 35  ? 40.604  14.139  65.334  1.00 14.99 ? 263  LYS A NZ  1 
ATOM   254   N N   . ALA A 1 36  ? 36.047  8.992   63.491  1.00 14.76 ? 264  ALA A N   1 
ATOM   255   C CA  . ALA A 1 36  ? 36.563  8.055   62.487  1.00 14.51 ? 264  ALA A CA  1 
ATOM   256   C C   . ALA A 1 36  ? 35.598  7.915   61.328  1.00 14.29 ? 264  ALA A C   1 
ATOM   257   O O   . ALA A 1 36  ? 36.004  7.917   60.175  1.00 14.57 ? 264  ALA A O   1 
ATOM   258   C CB  . ALA A 1 36  ? 36.840  6.691   63.109  1.00 14.18 ? 264  ALA A CB  1 
ATOM   259   N N   . LEU A 1 37  ? 34.316  7.818   61.638  1.00 14.07 ? 265  LEU A N   1 
ATOM   260   C CA  . LEU A 1 37  ? 33.310  7.687   60.604  1.00 13.94 ? 265  LEU A CA  1 
ATOM   261   C C   . LEU A 1 37  ? 33.242  9.001   59.850  1.00 13.93 ? 265  LEU A C   1 
ATOM   262   O O   . LEU A 1 37  ? 33.616  9.061   58.678  1.00 14.25 ? 265  LEU A O   1 
ATOM   263   C CB  . LEU A 1 37  ? 31.965  7.280   61.218  1.00 13.89 ? 265  LEU A CB  1 
ATOM   264   C CG  . LEU A 1 37  ? 32.041  5.837   61.752  1.00 13.34 ? 265  LEU A CG  1 
ATOM   265   C CD1 . LEU A 1 37  ? 31.085  5.574   62.884  1.00 12.90 ? 265  LEU A CD1 1 
ATOM   266   C CD2 . LEU A 1 37  ? 31.819  4.857   60.624  1.00 12.60 ? 265  LEU A CD2 1 
ATOM   267   N N   . THR A 1 38  ? 32.830  10.059  60.542  1.00 13.71 ? 266  THR A N   1 
ATOM   268   C CA  . THR A 1 38  ? 32.827  11.412  59.991  1.00 13.38 ? 266  THR A CA  1 
ATOM   269   C C   . THR A 1 38  ? 34.009  11.652  59.047  1.00 13.25 ? 266  THR A C   1 
ATOM   270   O O   . THR A 1 38  ? 33.832  12.163  57.946  1.00 13.71 ? 266  THR A O   1 
ATOM   271   C CB  . THR A 1 38  ? 32.871  12.457  61.122  1.00 13.42 ? 266  THR A CB  1 
ATOM   272   O OG1 . THR A 1 38  ? 31.639  12.428  61.861  1.00 13.08 ? 266  THR A OG1 1 
ATOM   273   C CG2 . THR A 1 38  ? 33.112  13.863  60.563  1.00 13.62 ? 266  THR A CG2 1 
ATOM   274   N N   . THR A 1 39  ? 35.209  11.268  59.468  1.00 12.91 ? 267  THR A N   1 
ATOM   275   C CA  . THR A 1 39  ? 36.419  11.498  58.670  1.00 12.66 ? 267  THR A CA  1 
ATOM   276   C C   . THR A 1 39  ? 36.484  10.677  57.386  1.00 12.50 ? 267  THR A C   1 
ATOM   277   O O   . THR A 1 39  ? 37.007  11.143  56.381  1.00 12.44 ? 267  THR A O   1 
ATOM   278   C CB  . THR A 1 39  ? 37.668  11.218  59.496  1.00 12.64 ? 267  THR A CB  1 
ATOM   279   O OG1 . THR A 1 39  ? 37.675  12.101  60.623  1.00 12.65 ? 267  THR A OG1 1 
ATOM   280   C CG2 . THR A 1 39  ? 38.929  11.436  58.675  1.00 12.03 ? 267  THR A CG2 1 
ATOM   281   N N   . LEU A 1 40  ? 35.957  9.460   57.424  1.00 12.21 ? 268  LEU A N   1 
ATOM   282   C CA  . LEU A 1 40  ? 35.893  8.615   56.234  1.00 11.95 ? 268  LEU A CA  1 
ATOM   283   C C   . LEU A 1 40  ? 34.793  9.058   55.275  1.00 12.24 ? 268  LEU A C   1 
ATOM   284   O O   . LEU A 1 40  ? 34.947  8.976   54.048  1.00 12.03 ? 268  LEU A O   1 
ATOM   285   C CB  . LEU A 1 40  ? 35.689  7.158   56.637  1.00 11.57 ? 268  LEU A CB  1 
ATOM   286   C CG  . LEU A 1 40  ? 36.954  6.612   57.282  1.00 10.49 ? 268  LEU A CG  1 
ATOM   287   C CD1 . LEU A 1 40  ? 36.679  5.317   58.022  1.00 9.63  ? 268  LEU A CD1 1 
ATOM   288   C CD2 . LEU A 1 40  ? 38.025  6.446   56.225  1.00 8.75  ? 268  LEU A CD2 1 
ATOM   289   N N   A CYS A 1 41  ? 33.685  9.540   55.821  0.60 12.44 ? 269  CYS A N   1 
ATOM   290   N N   B CYS A 1 41  ? 33.688  9.521   55.856  0.40 12.41 ? 269  CYS A N   1 
ATOM   291   C CA  A CYS A 1 41  ? 32.585  9.995   54.987  0.60 12.66 ? 269  CYS A CA  1 
ATOM   292   C CA  B CYS A 1 41  ? 32.544  10.017  55.103  0.40 12.55 ? 269  CYS A CA  1 
ATOM   293   C C   A CYS A 1 41  ? 33.013  11.144  54.120  0.60 12.76 ? 269  CYS A C   1 
ATOM   294   C C   B CYS A 1 41  ? 32.965  11.141  54.170  0.40 12.75 ? 269  CYS A C   1 
ATOM   295   O O   A CYS A 1 41  ? 32.805  11.108  52.912  0.60 12.72 ? 269  CYS A O   1 
ATOM   296   O O   B CYS A 1 41  ? 32.707  11.079  52.972  0.40 12.71 ? 269  CYS A O   1 
ATOM   297   C CB  A CYS A 1 41  ? 31.408  10.415  55.837  0.60 12.66 ? 269  CYS A CB  1 
ATOM   298   C CB  B CYS A 1 41  ? 31.458  10.510  56.062  0.40 12.54 ? 269  CYS A CB  1 
ATOM   299   S SG  A CYS A 1 41  ? 30.928  9.103   56.908  0.60 13.38 ? 269  CYS A SG  1 
ATOM   300   S SG  B CYS A 1 41  ? 29.887  10.948  55.289  0.40 12.53 ? 269  CYS A SG  1 
ATOM   301   N N   . ASP A 1 42  ? 33.627  12.157  54.718  1.00 13.01 ? 270  ASP A N   1 
ATOM   302   C CA  . ASP A 1 42  ? 34.045  13.306  53.919  1.00 13.80 ? 270  ASP A CA  1 
ATOM   303   C C   . ASP A 1 42  ? 35.147  12.933  52.946  1.00 13.74 ? 270  ASP A C   1 
ATOM   304   O O   . ASP A 1 42  ? 35.184  13.477  51.845  1.00 13.87 ? 270  ASP A O   1 
ATOM   305   C CB  . ASP A 1 42  ? 34.478  14.511  54.753  1.00 14.25 ? 270  ASP A CB  1 
ATOM   306   C CG  . ASP A 1 42  ? 34.843  15.717  53.876  1.00 15.87 ? 270  ASP A CG  1 
ATOM   307   O OD1 . ASP A 1 42  ? 34.651  15.643  52.630  1.00 17.30 ? 270  ASP A OD1 1 
ATOM   308   O OD2 . ASP A 1 42  ? 35.322  16.736  54.422  1.00 17.70 ? 270  ASP A OD2 1 
ATOM   309   N N   . LEU A 1 43  ? 36.032  12.016  53.346  1.00 13.69 ? 271  LEU A N   1 
ATOM   310   C CA  . LEU A 1 43  ? 37.062  11.496  52.447  1.00 13.17 ? 271  LEU A CA  1 
ATOM   311   C C   . LEU A 1 43  ? 36.382  10.817  51.268  1.00 13.81 ? 271  LEU A C   1 
ATOM   312   O O   . LEU A 1 43  ? 36.583  11.207  50.122  1.00 14.14 ? 271  LEU A O   1 
ATOM   313   C CB  . LEU A 1 43  ? 37.985  10.518  53.168  1.00 12.81 ? 271  LEU A CB  1 
ATOM   314   C CG  . LEU A 1 43  ? 39.067  9.877   52.301  1.00 12.27 ? 271  LEU A CG  1 
ATOM   315   C CD1 . LEU A 1 43  ? 39.800  10.953  51.538  1.00 12.60 ? 271  LEU A CD1 1 
ATOM   316   C CD2 . LEU A 1 43  ? 40.061  9.023   53.075  1.00 11.91 ? 271  LEU A CD2 1 
ATOM   317   N N   . ALA A 1 44  ? 35.554  9.814   51.543  1.00 14.19 ? 272  ALA A N   1 
ATOM   318   C CA  . ALA A 1 44  ? 34.811  9.145   50.482  1.00 14.19 ? 272  ALA A CA  1 
ATOM   319   C C   . ALA A 1 44  ? 34.233  10.175  49.515  1.00 14.53 ? 272  ALA A C   1 
ATOM   320   O O   . ALA A 1 44  ? 34.405  10.049  48.308  1.00 15.00 ? 272  ALA A O   1 
ATOM   321   C CB  . ALA A 1 44  ? 33.704  8.278   51.062  1.00 13.80 ? 272  ALA A CB  1 
ATOM   322   N N   . ASP A 1 45  ? 33.581  11.209  50.035  1.00 14.71 ? 273  ASP A N   1 
ATOM   323   C CA  . ASP A 1 45  ? 32.837  12.134  49.171  1.00 15.34 ? 273  ASP A CA  1 
ATOM   324   C C   . ASP A 1 45  ? 33.735  12.910  48.209  1.00 15.64 ? 273  ASP A C   1 
ATOM   325   O O   . ASP A 1 45  ? 33.358  13.142  47.058  1.00 16.17 ? 273  ASP A O   1 
ATOM   326   C CB  . ASP A 1 45  ? 31.972  13.106  49.992  1.00 15.50 ? 273  ASP A CB  1 
ATOM   327   C CG  . ASP A 1 45  ? 30.907  12.388  50.820  1.00 15.90 ? 273  ASP A CG  1 
ATOM   328   O OD1 . ASP A 1 45  ? 30.712  11.175  50.610  1.00 13.77 ? 273  ASP A OD1 1 
ATOM   329   O OD2 . ASP A 1 45  ? 30.280  13.030  51.695  1.00 17.49 ? 273  ASP A OD2 1 
ATOM   330   N N   . ARG A 1 46  ? 34.913  13.315  48.668  1.00 15.57 ? 274  ARG A N   1 
ATOM   331   C CA  . ARG A 1 46  ? 35.873  13.958  47.785  1.00 15.54 ? 274  ARG A CA  1 
ATOM   332   C C   . ARG A 1 46  ? 36.505  12.947  46.820  1.00 15.97 ? 274  ARG A C   1 
ATOM   333   O O   . ARG A 1 46  ? 36.724  13.259  45.639  1.00 16.36 ? 274  ARG A O   1 
ATOM   334   C CB  . ARG A 1 46  ? 36.946  14.677  48.589  1.00 15.53 ? 274  ARG A CB  1 
ATOM   335   C CG  . ARG A 1 46  ? 36.504  16.029  49.068  1.00 15.36 ? 274  ARG A CG  1 
ATOM   336   C CD  . ARG A 1 46  ? 37.588  16.730  49.805  1.00 15.34 ? 274  ARG A CD  1 
ATOM   337   N NE  . ARG A 1 46  ? 37.657  16.218  51.166  1.00 16.01 ? 274  ARG A NE  1 
ATOM   338   C CZ  . ARG A 1 46  ? 38.716  15.636  51.719  1.00 16.46 ? 274  ARG A CZ  1 
ATOM   339   N NH1 . ARG A 1 46  ? 39.850  15.499  51.039  1.00 16.23 ? 274  ARG A NH1 1 
ATOM   340   N NH2 . ARG A 1 46  ? 38.643  15.207  52.981  1.00 16.81 ? 274  ARG A NH2 1 
ATOM   341   N N   . GLU A 1 47  ? 36.792  11.742  47.311  1.00 15.97 ? 275  GLU A N   1 
ATOM   342   C CA  . GLU A 1 47  ? 37.293  10.674  46.442  1.00 16.14 ? 275  GLU A CA  1 
ATOM   343   C C   . GLU A 1 47  ? 36.305  10.341  45.311  1.00 16.12 ? 275  GLU A C   1 
ATOM   344   O O   . GLU A 1 47  ? 36.708  10.196  44.159  1.00 15.93 ? 275  GLU A O   1 
ATOM   345   C CB  . GLU A 1 47  ? 37.651  9.415   47.249  1.00 16.26 ? 275  GLU A CB  1 
ATOM   346   C CG  . GLU A 1 47  ? 39.159  9.233   47.526  1.00 16.22 ? 275  GLU A CG  1 
ATOM   347   C CD  . GLU A 1 47  ? 39.437  8.115   48.520  1.00 16.56 ? 275  GLU A CD  1 
ATOM   348   O OE1 . GLU A 1 47  ? 39.605  6.940   48.113  1.00 18.05 ? 275  GLU A OE1 1 
ATOM   349   O OE2 . GLU A 1 47  ? 39.485  8.410   49.727  1.00 16.58 ? 275  GLU A OE2 1 
ATOM   350   N N   . LEU A 1 48  ? 35.018  10.227  45.631  1.00 16.18 ? 276  LEU A N   1 
ATOM   351   C CA  . LEU A 1 48  ? 34.001  9.996   44.597  1.00 16.55 ? 276  LEU A CA  1 
ATOM   352   C C   . LEU A 1 48  ? 34.104  11.030  43.467  1.00 16.63 ? 276  LEU A C   1 
ATOM   353   O O   . LEU A 1 48  ? 34.077  10.675  42.275  1.00 16.73 ? 276  LEU A O   1 
ATOM   354   C CB  . LEU A 1 48  ? 32.584  10.049  45.188  1.00 16.81 ? 276  LEU A CB  1 
ATOM   355   C CG  . LEU A 1 48  ? 32.098  8.840   45.993  1.00 17.55 ? 276  LEU A CG  1 
ATOM   356   C CD1 . LEU A 1 48  ? 30.628  9.035   46.427  1.00 17.80 ? 276  LEU A CD1 1 
ATOM   357   C CD2 . LEU A 1 48  ? 32.265  7.556   45.180  1.00 17.94 ? 276  LEU A CD2 1 
ATOM   358   N N   . VAL A 1 49  ? 34.215  12.304  43.844  1.00 16.30 ? 277  VAL A N   1 
ATOM   359   C CA  . VAL A 1 49  ? 34.249  13.368  42.857  1.00 16.27 ? 277  VAL A CA  1 
ATOM   360   C C   . VAL A 1 49  ? 35.407  13.148  41.894  1.00 16.15 ? 277  VAL A C   1 
ATOM   361   O O   . VAL A 1 49  ? 35.220  13.292  40.697  1.00 16.72 ? 277  VAL A O   1 
ATOM   362   C CB  . VAL A 1 49  ? 34.287  14.796  43.501  1.00 16.63 ? 277  VAL A CB  1 
ATOM   363   C CG1 . VAL A 1 49  ? 34.875  15.829  42.536  1.00 15.89 ? 277  VAL A CG1 1 
ATOM   364   C CG2 . VAL A 1 49  ? 32.878  15.220  43.938  1.00 16.40 ? 277  VAL A CG2 1 
ATOM   365   N N   . VAL A 1 50  ? 36.583  12.777  42.391  1.00 15.82 ? 278  VAL A N   1 
ATOM   366   C CA  . VAL A 1 50  ? 37.698  12.483  41.483  1.00 15.62 ? 278  VAL A CA  1 
ATOM   367   C C   . VAL A 1 50  ? 37.532  11.123  40.820  1.00 15.20 ? 278  VAL A C   1 
ATOM   368   O O   . VAL A 1 50  ? 37.911  10.963  39.685  1.00 15.91 ? 278  VAL A O   1 
ATOM   369   C CB  . VAL A 1 50  ? 39.109  12.605  42.150  1.00 15.63 ? 278  VAL A CB  1 
ATOM   370   C CG1 . VAL A 1 50  ? 39.320  14.009  42.734  1.00 15.30 ? 278  VAL A CG1 1 
ATOM   371   C CG2 . VAL A 1 50  ? 39.314  11.551  43.213  1.00 16.29 ? 278  VAL A CG2 1 
ATOM   372   N N   . ILE A 1 51  ? 36.961  10.147  41.513  1.00 14.90 ? 279  ILE A N   1 
ATOM   373   C CA  . ILE A 1 51  ? 36.724  8.823   40.912  1.00 14.63 ? 279  ILE A CA  1 
ATOM   374   C C   . ILE A 1 51  ? 35.904  8.970   39.632  1.00 14.75 ? 279  ILE A C   1 
ATOM   375   O O   . ILE A 1 51  ? 36.175  8.317   38.617  1.00 14.28 ? 279  ILE A O   1 
ATOM   376   C CB  . ILE A 1 51  ? 35.981  7.862   41.891  1.00 14.43 ? 279  ILE A CB  1 
ATOM   377   C CG1 . ILE A 1 51  ? 36.964  7.250   42.887  1.00 14.05 ? 279  ILE A CG1 1 
ATOM   378   C CG2 . ILE A 1 51  ? 35.286  6.744   41.131  1.00 13.78 ? 279  ILE A CG2 1 
ATOM   379   C CD1 . ILE A 1 51  ? 36.307  6.385   43.927  1.00 14.26 ? 279  ILE A CD1 1 
ATOM   380   N N   . ILE A 1 52  ? 34.906  9.854   39.709  1.00 14.88 ? 280  ILE A N   1 
ATOM   381   C CA  . ILE A 1 52  ? 34.011  10.153  38.588  1.00 14.95 ? 280  ILE A CA  1 
ATOM   382   C C   . ILE A 1 52  ? 34.797  10.849  37.486  1.00 14.78 ? 280  ILE A C   1 
ATOM   383   O O   . ILE A 1 52  ? 34.773  10.427  36.336  1.00 14.70 ? 280  ILE A O   1 
ATOM   384   C CB  . ILE A 1 52  ? 32.803  11.034  39.051  1.00 15.07 ? 280  ILE A CB  1 
ATOM   385   C CG1 . ILE A 1 52  ? 31.876  10.210  39.972  1.00 15.77 ? 280  ILE A CG1 1 
ATOM   386   C CG2 . ILE A 1 52  ? 32.044  11.575  37.861  1.00 13.85 ? 280  ILE A CG2 1 
ATOM   387   C CD1 . ILE A 1 52  ? 30.873  11.033  40.802  1.00 15.03 ? 280  ILE A CD1 1 
ATOM   388   N N   . GLY A 1 53  ? 35.512  11.904  37.857  1.00 14.60 ? 281  GLY A N   1 
ATOM   389   C CA  . GLY A 1 53  ? 36.397  12.587  36.934  1.00 14.62 ? 281  GLY A CA  1 
ATOM   390   C C   . GLY A 1 53  ? 37.298  11.602  36.233  1.00 14.63 ? 281  GLY A C   1 
ATOM   391   O O   . GLY A 1 53  ? 37.499  11.683  35.029  1.00 14.99 ? 281  GLY A O   1 
ATOM   392   N N   . TRP A 1 54  ? 37.823  10.658  36.999  1.00 14.58 ? 282  TRP A N   1 
ATOM   393   C CA  . TRP A 1 54  ? 38.637  9.591   36.465  1.00 14.64 ? 282  TRP A CA  1 
ATOM   394   C C   . TRP A 1 54  ? 37.872  8.741   35.457  1.00 14.92 ? 282  TRP A C   1 
ATOM   395   O O   . TRP A 1 54  ? 38.369  8.504   34.359  1.00 15.18 ? 282  TRP A O   1 
ATOM   396   C CB  . TRP A 1 54  ? 39.148  8.731   37.609  1.00 14.36 ? 282  TRP A CB  1 
ATOM   397   C CG  . TRP A 1 54  ? 39.756  7.419   37.201  1.00 14.74 ? 282  TRP A CG  1 
ATOM   398   C CD1 . TRP A 1 54  ? 41.028  7.201   36.759  1.00 14.12 ? 282  TRP A CD1 1 
ATOM   399   C CD2 . TRP A 1 54  ? 39.121  6.130   37.245  1.00 14.35 ? 282  TRP A CD2 1 
ATOM   400   N NE1 . TRP A 1 54  ? 41.222  5.858   36.522  1.00 13.85 ? 282  TRP A NE1 1 
ATOM   401   C CE2 . TRP A 1 54  ? 40.067  5.183   36.807  1.00 13.96 ? 282  TRP A CE2 1 
ATOM   402   C CE3 . TRP A 1 54  ? 37.847  5.692   37.610  1.00 13.54 ? 282  TRP A CE3 1 
ATOM   403   C CZ2 . TRP A 1 54  ? 39.777  3.825   36.722  1.00 14.42 ? 282  TRP A CZ2 1 
ATOM   404   C CZ3 . TRP A 1 54  ? 37.561  4.355   37.520  1.00 13.94 ? 282  TRP A CZ3 1 
ATOM   405   C CH2 . TRP A 1 54  ? 38.520  3.433   37.085  1.00 14.12 ? 282  TRP A CH2 1 
ATOM   406   N N   . ALA A 1 55  ? 36.670  8.293   35.815  1.00 14.99 ? 283  ALA A N   1 
ATOM   407   C CA  . ALA A 1 55  ? 35.871  7.445   34.928  1.00 15.03 ? 283  ALA A CA  1 
ATOM   408   C C   . ALA A 1 55  ? 35.854  7.943   33.469  1.00 15.57 ? 283  ALA A C   1 
ATOM   409   O O   . ALA A 1 55  ? 36.041  7.162   32.530  1.00 15.49 ? 283  ALA A O   1 
ATOM   410   C CB  . ALA A 1 55  ? 34.477  7.332   35.449  1.00 14.55 ? 283  ALA A CB  1 
ATOM   411   N N   . LYS A 1 56  ? 35.650  9.248   33.289  1.00 16.24 ? 284  LYS A N   1 
ATOM   412   C CA  . LYS A 1 56  ? 35.562  9.864   31.952  1.00 16.66 ? 284  LYS A CA  1 
ATOM   413   C C   . LYS A 1 56  ? 36.779  9.561   31.102  1.00 16.82 ? 284  LYS A C   1 
ATOM   414   O O   . LYS A 1 56  ? 36.682  9.408   29.888  1.00 16.94 ? 284  LYS A O   1 
ATOM   415   C CB  . LYS A 1 56  ? 35.405  11.371  32.066  1.00 16.71 ? 284  LYS A CB  1 
ATOM   416   C CG  . LYS A 1 56  ? 34.056  11.828  32.635  1.00 17.22 ? 284  LYS A CG  1 
ATOM   417   C CD  . LYS A 1 56  ? 33.925  13.363  32.577  1.00 17.55 ? 284  LYS A CD  1 
ATOM   418   C CE  . LYS A 1 56  ? 32.620  13.879  33.201  1.00 18.43 ? 284  LYS A CE  1 
ATOM   419   N NZ  . LYS A 1 56  ? 32.081  15.106  32.486  1.00 19.38 ? 284  LYS A NZ  1 
ATOM   420   N N   . HIS A 1 57  ? 37.927  9.449   31.751  1.00 17.13 ? 285  HIS A N   1 
ATOM   421   C CA  . HIS A 1 57  ? 39.170  9.156   31.048  1.00 17.16 ? 285  HIS A CA  1 
ATOM   422   C C   . HIS A 1 57  ? 39.300  7.712   30.579  1.00 17.06 ? 285  HIS A C   1 
ATOM   423   O O   . HIS A 1 57  ? 40.192  7.418   29.791  1.00 17.36 ? 285  HIS A O   1 
ATOM   424   C CB  . HIS A 1 57  ? 40.366  9.522   31.925  1.00 17.29 ? 285  HIS A CB  1 
ATOM   425   C CG  . HIS A 1 57  ? 40.513  10.997  32.154  1.00 17.40 ? 285  HIS A CG  1 
ATOM   426   N ND1 . HIS A 1 57  ? 40.836  11.877  31.142  1.00 17.71 ? 285  HIS A ND1 1 
ATOM   427   C CD2 . HIS A 1 57  ? 40.400  11.741  33.278  1.00 17.04 ? 285  HIS A CD2 1 
ATOM   428   C CE1 . HIS A 1 57  ? 40.905  13.101  31.631  1.00 17.87 ? 285  HIS A CE1 1 
ATOM   429   N NE2 . HIS A 1 57  ? 40.645  13.046  32.925  1.00 17.93 ? 285  HIS A NE2 1 
ATOM   430   N N   . ILE A 1 58  ? 38.435  6.815   31.050  1.00 16.85 ? 286  ILE A N   1 
ATOM   431   C CA  . ILE A 1 58  ? 38.481  5.401   30.631  1.00 16.57 ? 286  ILE A CA  1 
ATOM   432   C C   . ILE A 1 58  ? 37.922  5.326   29.229  1.00 16.42 ? 286  ILE A C   1 
ATOM   433   O O   . ILE A 1 58  ? 36.844  5.863   28.984  1.00 16.63 ? 286  ILE A O   1 
ATOM   434   C CB  . ILE A 1 58  ? 37.598  4.503   31.525  1.00 16.44 ? 286  ILE A CB  1 
ATOM   435   C CG1 . ILE A 1 58  ? 38.112  4.496   32.959  1.00 16.29 ? 286  ILE A CG1 1 
ATOM   436   C CG2 . ILE A 1 58  ? 37.549  3.096   30.982  1.00 15.71 ? 286  ILE A CG2 1 
ATOM   437   C CD1 . ILE A 1 58  ? 37.157  3.870   33.926  1.00 16.36 ? 286  ILE A CD1 1 
ATOM   438   N N   . PRO A 1 59  ? 38.633  4.668   28.301  1.00 16.32 ? 287  PRO A N   1 
ATOM   439   C CA  . PRO A 1 59  ? 38.200  4.698   26.905  1.00 16.33 ? 287  PRO A CA  1 
ATOM   440   C C   . PRO A 1 59  ? 36.962  3.848   26.682  1.00 16.17 ? 287  PRO A C   1 
ATOM   441   O O   . PRO A 1 59  ? 36.924  2.699   27.078  1.00 15.92 ? 287  PRO A O   1 
ATOM   442   C CB  . PRO A 1 59  ? 39.405  4.144   26.150  1.00 16.24 ? 287  PRO A CB  1 
ATOM   443   C CG  . PRO A 1 59  ? 40.037  3.253   27.100  1.00 16.47 ? 287  PRO A CG  1 
ATOM   444   C CD  . PRO A 1 59  ? 39.850  3.867   28.461  1.00 16.51 ? 287  PRO A CD  1 
ATOM   445   N N   . GLY A 1 60  ? 35.957  4.438   26.048  1.00 16.35 ? 288  GLY A N   1 
ATOM   446   C CA  . GLY A 1 60  ? 34.659  3.805   25.873  1.00 16.54 ? 288  GLY A CA  1 
ATOM   447   C C   . GLY A 1 60  ? 33.634  4.533   26.707  1.00 16.78 ? 288  GLY A C   1 
ATOM   448   O O   . GLY A 1 60  ? 32.588  4.925   26.207  1.00 16.88 ? 288  GLY A O   1 
ATOM   449   N N   . PHE A 1 61  ? 33.976  4.745   27.977  1.00 17.00 ? 289  PHE A N   1 
ATOM   450   C CA  . PHE A 1 61  ? 33.058  5.270   28.990  1.00 16.87 ? 289  PHE A CA  1 
ATOM   451   C C   . PHE A 1 61  ? 32.258  6.470   28.520  1.00 16.74 ? 289  PHE A C   1 
ATOM   452   O O   . PHE A 1 61  ? 31.049  6.393   28.430  1.00 16.82 ? 289  PHE A O   1 
ATOM   453   C CB  . PHE A 1 61  ? 33.828  5.628   30.273  1.00 17.01 ? 289  PHE A CB  1 
ATOM   454   C CG  . PHE A 1 61  ? 32.947  5.799   31.472  1.00 17.02 ? 289  PHE A CG  1 
ATOM   455   C CD1 . PHE A 1 61  ? 32.503  4.698   32.182  1.00 16.88 ? 289  PHE A CD1 1 
ATOM   456   C CD2 . PHE A 1 61  ? 32.550  7.053   31.882  1.00 17.05 ? 289  PHE A CD2 1 
ATOM   457   C CE1 . PHE A 1 61  ? 31.681  4.854   33.273  1.00 16.94 ? 289  PHE A CE1 1 
ATOM   458   C CE2 . PHE A 1 61  ? 31.728  7.207   32.978  1.00 16.42 ? 289  PHE A CE2 1 
ATOM   459   C CZ  . PHE A 1 61  ? 31.298  6.112   33.670  1.00 16.27 ? 289  PHE A CZ  1 
ATOM   460   N N   . SER A 1 62  ? 32.934  7.571   28.206  1.00 16.79 ? 290  SER A N   1 
ATOM   461   C CA  . SER A 1 62  ? 32.244  8.813   27.807  1.00 16.86 ? 290  SER A CA  1 
ATOM   462   C C   . SER A 1 62  ? 31.386  8.677   26.548  1.00 16.44 ? 290  SER A C   1 
ATOM   463   O O   . SER A 1 62  ? 30.527  9.519   26.291  1.00 16.33 ? 290  SER A O   1 
ATOM   464   C CB  . SER A 1 62  ? 33.246  9.953   27.578  1.00 17.04 ? 290  SER A CB  1 
ATOM   465   O OG  . SER A 1 62  ? 33.744  10.453  28.807  1.00 18.18 ? 290  SER A OG  1 
ATOM   466   N N   . THR A 1 63  ? 31.640  7.648   25.749  1.00 15.93 ? 291  THR A N   1 
ATOM   467   C CA  . THR A 1 63  ? 30.824  7.405   24.580  1.00 15.64 ? 291  THR A CA  1 
ATOM   468   C C   . THR A 1 63  ? 29.464  6.857   24.999  1.00 15.21 ? 291  THR A C   1 
ATOM   469   O O   . THR A 1 63  ? 28.493  7.033   24.264  1.00 15.40 ? 291  THR A O   1 
ATOM   470   C CB  . THR A 1 63  ? 31.485  6.404   23.626  1.00 15.77 ? 291  THR A CB  1 
ATOM   471   O OG1 . THR A 1 63  ? 32.901  6.380   23.856  1.00 16.92 ? 291  THR A OG1 1 
ATOM   472   C CG2 . THR A 1 63  ? 31.177  6.746   22.168  1.00 15.52 ? 291  THR A CG2 1 
ATOM   473   N N   . LEU A 1 64  ? 29.399  6.191   26.160  1.00 14.52 ? 292  LEU A N   1 
ATOM   474   C CA  . LEU A 1 64  ? 28.145  5.624   26.677  1.00 14.14 ? 292  LEU A CA  1 
ATOM   475   C C   . LEU A 1 64  ? 27.149  6.716   27.090  1.00 14.16 ? 292  LEU A C   1 
ATOM   476   O O   . LEU A 1 64  ? 27.554  7.835   27.439  1.00 14.09 ? 292  LEU A O   1 
ATOM   477   C CB  . LEU A 1 64  ? 28.398  4.726   27.891  1.00 14.02 ? 292  LEU A CB  1 
ATOM   478   C CG  . LEU A 1 64  ? 29.244  3.451   27.772  1.00 13.70 ? 292  LEU A CG  1 
ATOM   479   C CD1 . LEU A 1 64  ? 29.626  2.993   29.168  1.00 13.39 ? 292  LEU A CD1 1 
ATOM   480   C CD2 . LEU A 1 64  ? 28.527  2.331   27.044  1.00 12.29 ? 292  LEU A CD2 1 
ATOM   481   N N   . SER A 1 65  ? 25.853  6.377   27.071  1.00 13.86 ? 293  SER A N   1 
ATOM   482   C CA  . SER A 1 65  ? 24.793  7.304   27.495  1.00 13.69 ? 293  SER A CA  1 
ATOM   483   C C   . SER A 1 65  ? 24.994  7.735   28.947  1.00 13.76 ? 293  SER A C   1 
ATOM   484   O O   . SER A 1 65  ? 25.543  6.982   29.755  1.00 14.18 ? 293  SER A O   1 
ATOM   485   C CB  . SER A 1 65  ? 23.406  6.668   27.332  1.00 13.60 ? 293  SER A CB  1 
ATOM   486   O OG  . SER A 1 65  ? 23.271  5.495   28.117  1.00 13.43 ? 293  SER A OG  1 
ATOM   487   N N   . LEU A 1 66  ? 24.552  8.940   29.284  1.00 13.56 ? 294  LEU A N   1 
ATOM   488   C CA  . LEU A 1 66  ? 24.715  9.444   30.642  1.00 13.51 ? 294  LEU A CA  1 
ATOM   489   C C   . LEU A 1 66  ? 24.059  8.552   31.689  1.00 13.45 ? 294  LEU A C   1 
ATOM   490   O O   . LEU A 1 66  ? 24.550  8.457   32.812  1.00 13.65 ? 294  LEU A O   1 
ATOM   491   C CB  . LEU A 1 66  ? 24.171  10.868  30.760  1.00 13.61 ? 294  LEU A CB  1 
ATOM   492   C CG  . LEU A 1 66  ? 25.079  11.921  30.133  1.00 13.82 ? 294  LEU A CG  1 
ATOM   493   C CD1 . LEU A 1 66  ? 24.399  13.301  30.060  1.00 13.38 ? 294  LEU A CD1 1 
ATOM   494   C CD2 . LEU A 1 66  ? 26.394  11.972  30.923  1.00 14.08 ? 294  LEU A CD2 1 
ATOM   495   N N   . ALA A 1 67  ? 22.956  7.900   31.324  1.00 13.30 ? 295  ALA A N   1 
ATOM   496   C CA  . ALA A 1 67  ? 22.280  6.968   32.225  1.00 13.05 ? 295  ALA A CA  1 
ATOM   497   C C   . ALA A 1 67  ? 23.155  5.751   32.516  1.00 12.93 ? 295  ALA A C   1 
ATOM   498   O O   . ALA A 1 67  ? 23.261  5.337   33.658  1.00 12.81 ? 295  ALA A O   1 
ATOM   499   C CB  . ALA A 1 67  ? 20.928  6.544   31.653  1.00 12.84 ? 295  ALA A CB  1 
ATOM   500   N N   . ASP A 1 68  ? 23.797  5.190   31.494  1.00 13.29 ? 296  ASP A N   1 
ATOM   501   C CA  . ASP A 1 68  ? 24.684  4.019   31.689  1.00 13.60 ? 296  ASP A CA  1 
ATOM   502   C C   . ASP A 1 68  ? 25.950  4.387   32.493  1.00 13.43 ? 296  ASP A C   1 
ATOM   503   O O   . ASP A 1 68  ? 26.325  3.671   33.417  1.00 13.35 ? 296  ASP A O   1 
ATOM   504   C CB  . ASP A 1 68  ? 25.030  3.324   30.349  1.00 13.77 ? 296  ASP A CB  1 
ATOM   505   C CG  . ASP A 1 68  ? 23.871  2.421   29.807  1.00 14.29 ? 296  ASP A CG  1 
ATOM   506   O OD1 . ASP A 1 68  ? 22.804  2.332   30.473  1.00 13.93 ? 296  ASP A OD1 1 
ATOM   507   O OD2 . ASP A 1 68  ? 24.032  1.796   28.715  1.00 12.65 ? 296  ASP A OD2 1 
ATOM   508   N N   . GLN A 1 69  ? 26.577  5.518   32.174  1.00 13.46 ? 297  GLN A N   1 
ATOM   509   C CA  . GLN A 1 69  ? 27.701  6.017   32.975  1.00 13.30 ? 297  GLN A CA  1 
ATOM   510   C C   . GLN A 1 69  ? 27.287  6.092   34.441  1.00 13.62 ? 297  GLN A C   1 
ATOM   511   O O   . GLN A 1 69  ? 27.984  5.589   35.324  1.00 13.43 ? 297  GLN A O   1 
ATOM   512   C CB  . GLN A 1 69  ? 28.143  7.399   32.498  1.00 13.26 ? 297  GLN A CB  1 
ATOM   513   C CG  . GLN A 1 69  ? 28.744  7.430   31.098  1.00 13.42 ? 297  GLN A CG  1 
ATOM   514   C CD  . GLN A 1 69  ? 29.063  8.843   30.606  1.00 12.88 ? 297  GLN A CD  1 
ATOM   515   O OE1 . GLN A 1 69  ? 29.244  9.772   31.391  1.00 11.76 ? 297  GLN A OE1 1 
ATOM   516   N NE2 . GLN A 1 69  ? 29.131  8.998   29.299  1.00 11.95 ? 297  GLN A NE2 1 
ATOM   517   N N   . MET A 1 70  ? 26.143  6.725   34.688  1.00 14.01 ? 298  MET A N   1 
ATOM   518   C CA  . MET A 1 70  ? 25.597  6.829   36.036  1.00 14.84 ? 298  MET A CA  1 
ATOM   519   C C   . MET A 1 70  ? 25.494  5.460   36.671  1.00 14.24 ? 298  MET A C   1 
ATOM   520   O O   . MET A 1 70  ? 25.973  5.259   37.791  1.00 14.33 ? 298  MET A O   1 
ATOM   521   C CB  . MET A 1 70  ? 24.200  7.473   36.039  1.00 14.85 ? 298  MET A CB  1 
ATOM   522   C CG  . MET A 1 70  ? 24.205  8.950   36.371  1.00 16.32 ? 298  MET A CG  1 
ATOM   523   S SD  . MET A 1 70  ? 22.561  9.629   36.700  1.00 18.23 ? 298  MET A SD  1 
ATOM   524   C CE  . MET A 1 70  ? 22.100  8.720   38.195  1.00 20.01 ? 298  MET A CE  1 
ATOM   525   N N   . SER A 1 71  ? 24.865  4.538   35.942  1.00 13.76 ? 299  SER A N   1 
ATOM   526   C CA  . SER A 1 71  ? 24.572  3.195   36.442  1.00 13.51 ? 299  SER A CA  1 
ATOM   527   C C   . SER A 1 71  ? 25.810  2.351   36.751  1.00 13.48 ? 299  SER A C   1 
ATOM   528   O O   . SER A 1 71  ? 25.768  1.498   37.639  1.00 13.40 ? 299  SER A O   1 
ATOM   529   C CB  . SER A 1 71  ? 23.703  2.445   35.444  1.00 13.33 ? 299  SER A CB  1 
ATOM   530   O OG  . SER A 1 71  ? 22.467  3.098   35.299  1.00 12.98 ? 299  SER A OG  1 
ATOM   531   N N   . LEU A 1 72  ? 26.901  2.566   36.026  1.00 13.38 ? 300  LEU A N   1 
ATOM   532   C CA  . LEU A 1 72  ? 28.118  1.813   36.318  1.00 13.72 ? 300  LEU A CA  1 
ATOM   533   C C   . LEU A 1 72  ? 28.768  2.347   37.586  1.00 13.44 ? 300  LEU A C   1 
ATOM   534   O O   . LEU A 1 72  ? 29.190  1.570   38.439  1.00 13.47 ? 300  LEU A O   1 
ATOM   535   C CB  . LEU A 1 72  ? 29.108  1.835   35.145  1.00 13.86 ? 300  LEU A CB  1 
ATOM   536   C CG  . LEU A 1 72  ? 28.569  1.387   33.778  1.00 14.09 ? 300  LEU A CG  1 
ATOM   537   C CD1 . LEU A 1 72  ? 29.737  1.190   32.816  1.00 15.08 ? 300  LEU A CD1 1 
ATOM   538   C CD2 . LEU A 1 72  ? 27.673  0.131   33.846  1.00 12.36 ? 300  LEU A CD2 1 
ATOM   539   N N   . LEU A 1 73  ? 28.844  3.670   37.695  1.00 13.21 ? 301  LEU A N   1 
ATOM   540   C CA  . LEU A 1 73  ? 29.391  4.323   38.884  1.00 13.10 ? 301  LEU A CA  1 
ATOM   541   C C   . LEU A 1 73  ? 28.542  3.991   40.114  1.00 13.46 ? 301  LEU A C   1 
ATOM   542   O O   . LEU A 1 73  ? 29.054  3.829   41.232  1.00 13.15 ? 301  LEU A O   1 
ATOM   543   C CB  . LEU A 1 73  ? 29.451  5.840   38.678  1.00 12.77 ? 301  LEU A CB  1 
ATOM   544   C CG  . LEU A 1 73  ? 30.628  6.359   37.853  1.00 12.05 ? 301  LEU A CG  1 
ATOM   545   C CD1 . LEU A 1 73  ? 30.371  7.768   37.286  1.00 10.53 ? 301  LEU A CD1 1 
ATOM   546   C CD2 . LEU A 1 73  ? 31.873  6.335   38.718  1.00 10.59 ? 301  LEU A CD2 1 
ATOM   547   N N   . GLN A 1 74  ? 27.237  3.883   39.889  1.00 13.86 ? 302  GLN A N   1 
ATOM   548   C CA  . GLN A 1 74  ? 26.279  3.654   40.961  1.00 14.35 ? 302  GLN A CA  1 
ATOM   549   C C   . GLN A 1 74  ? 26.508  2.278   41.587  1.00 13.92 ? 302  GLN A C   1 
ATOM   550   O O   . GLN A 1 74  ? 26.278  2.094   42.779  1.00 13.65 ? 302  GLN A O   1 
ATOM   551   C CB  . GLN A 1 74  ? 24.851  3.771   40.409  1.00 14.34 ? 302  GLN A CB  1 
ATOM   552   C CG  . GLN A 1 74  ? 23.844  4.340   41.369  1.00 15.49 ? 302  GLN A CG  1 
ATOM   553   C CD  . GLN A 1 74  ? 22.463  4.470   40.743  1.00 16.34 ? 302  GLN A CD  1 
ATOM   554   O OE1 . GLN A 1 74  ? 22.173  5.433   40.005  1.00 19.02 ? 302  GLN A OE1 1 
ATOM   555   N NE2 . GLN A 1 74  ? 21.591  3.500   41.043  1.00 18.24 ? 302  GLN A NE2 1 
ATOM   556   N N   . SER A 1 75  ? 26.982  1.333   40.767  1.00 13.89 ? 303  SER A N   1 
ATOM   557   C CA  . SER A 1 75  ? 27.219  -0.059  41.167  1.00 13.62 ? 303  SER A CA  1 
ATOM   558   C C   . SER A 1 75  ? 28.620  -0.323  41.719  1.00 13.77 ? 303  SER A C   1 
ATOM   559   O O   . SER A 1 75  ? 28.773  -1.120  42.629  1.00 14.21 ? 303  SER A O   1 
ATOM   560   C CB  . SER A 1 75  ? 26.984  -0.993  39.975  1.00 13.49 ? 303  SER A CB  1 
ATOM   561   O OG  . SER A 1 75  ? 25.640  -1.436  39.900  1.00 13.72 ? 303  SER A OG  1 
ATOM   562   N N   . ALA A 1 76  ? 29.635  0.341   41.173  1.00 13.89 ? 304  ALA A N   1 
ATOM   563   C CA  . ALA A 1 76  ? 31.032  0.027   41.470  1.00 13.97 ? 304  ALA A CA  1 
ATOM   564   C C   . ALA A 1 76  ? 31.775  1.060   42.341  1.00 14.30 ? 304  ALA A C   1 
ATOM   565   O O   . ALA A 1 76  ? 32.933  0.858   42.710  1.00 14.39 ? 304  ALA A O   1 
ATOM   566   C CB  . ALA A 1 76  ? 31.770  -0.159  40.173  1.00 13.96 ? 304  ALA A CB  1 
ATOM   567   N N   . TRP A 1 77  ? 31.137  2.171   42.670  1.00 14.47 ? 305  TRP A N   1 
ATOM   568   C CA  . TRP A 1 77  ? 31.829  3.201   43.431  1.00 14.42 ? 305  TRP A CA  1 
ATOM   569   C C   . TRP A 1 77  ? 32.570  2.599   44.623  1.00 14.32 ? 305  TRP A C   1 
ATOM   570   O O   . TRP A 1 77  ? 33.760  2.811   44.778  1.00 14.21 ? 305  TRP A O   1 
ATOM   571   C CB  . TRP A 1 77  ? 30.868  4.322   43.873  1.00 14.55 ? 305  TRP A CB  1 
ATOM   572   C CG  . TRP A 1 77  ? 29.749  3.892   44.762  1.00 14.10 ? 305  TRP A CG  1 
ATOM   573   C CD1 . TRP A 1 77  ? 28.680  3.135   44.412  1.00 14.61 ? 305  TRP A CD1 1 
ATOM   574   C CD2 . TRP A 1 77  ? 29.595  4.196   46.149  1.00 13.47 ? 305  TRP A CD2 1 
ATOM   575   N NE1 . TRP A 1 77  ? 27.861  2.935   45.499  1.00 15.10 ? 305  TRP A NE1 1 
ATOM   576   C CE2 . TRP A 1 77  ? 28.398  3.580   46.581  1.00 14.73 ? 305  TRP A CE2 1 
ATOM   577   C CE3 . TRP A 1 77  ? 30.353  4.924   47.070  1.00 14.06 ? 305  TRP A CE3 1 
ATOM   578   C CZ2 . TRP A 1 77  ? 27.930  3.675   47.906  1.00 14.35 ? 305  TRP A CZ2 1 
ATOM   579   C CZ3 . TRP A 1 77  ? 29.898  5.016   48.386  1.00 14.78 ? 305  TRP A CZ3 1 
ATOM   580   C CH2 . TRP A 1 77  ? 28.689  4.394   48.792  1.00 14.57 ? 305  TRP A CH2 1 
ATOM   581   N N   . MET A 1 78  ? 31.872  1.808   45.433  1.00 14.67 ? 306  MET A N   1 
ATOM   582   C CA  . MET A 1 78  ? 32.426  1.321   46.695  1.00 14.65 ? 306  MET A CA  1 
ATOM   583   C C   . MET A 1 78  ? 33.531  0.296   46.457  1.00 15.17 ? 306  MET A C   1 
ATOM   584   O O   . MET A 1 78  ? 34.484  0.221   47.245  1.00 15.43 ? 306  MET A O   1 
ATOM   585   C CB  . MET A 1 78  ? 31.333  0.741   47.574  1.00 14.36 ? 306  MET A CB  1 
ATOM   586   C CG  . MET A 1 78  ? 31.811  0.280   48.920  1.00 14.03 ? 306  MET A CG  1 
ATOM   587   S SD  . MET A 1 78  ? 32.396  1.621   49.937  1.00 12.01 ? 306  MET A SD  1 
ATOM   588   C CE  . MET A 1 78  ? 30.902  2.179   50.761  1.00 11.46 ? 306  MET A CE  1 
ATOM   589   N N   . GLU A 1 79  ? 33.422  -0.471  45.370  1.00 15.40 ? 307  GLU A N   1 
ATOM   590   C CA  . GLU A 1 79  ? 34.518  -1.349  44.953  1.00 15.65 ? 307  GLU A CA  1 
ATOM   591   C C   . GLU A 1 79  ? 35.736  -0.568  44.548  1.00 15.58 ? 307  GLU A C   1 
ATOM   592   O O   . GLU A 1 79  ? 36.834  -0.994  44.848  1.00 15.87 ? 307  GLU A O   1 
ATOM   593   C CB  . GLU A 1 79  ? 34.122  -2.241  43.791  1.00 15.88 ? 307  GLU A CB  1 
ATOM   594   C CG  . GLU A 1 79  ? 33.236  -3.394  44.202  1.00 17.19 ? 307  GLU A CG  1 
ATOM   595   C CD  . GLU A 1 79  ? 32.659  -4.123  43.022  1.00 17.78 ? 307  GLU A CD  1 
ATOM   596   O OE1 . GLU A 1 79  ? 33.416  -4.386  42.065  1.00 18.32 ? 307  GLU A OE1 1 
ATOM   597   O OE2 . GLU A 1 79  ? 31.443  -4.412  43.059  1.00 18.48 ? 307  GLU A OE2 1 
ATOM   598   N N   . ILE A 1 80  ? 35.549  0.565   43.870  1.00 15.75 ? 308  ILE A N   1 
ATOM   599   C CA  . ILE A 1 80  ? 36.681  1.408   43.457  1.00 15.87 ? 308  ILE A CA  1 
ATOM   600   C C   . ILE A 1 80  ? 37.294  2.121   44.662  1.00 16.08 ? 308  ILE A C   1 
ATOM   601   O O   . ILE A 1 80  ? 38.530  2.179   44.769  1.00 16.39 ? 308  ILE A O   1 
ATOM   602   C CB  . ILE A 1 80  ? 36.307  2.450   42.372  1.00 16.02 ? 308  ILE A CB  1 
ATOM   603   C CG1 . ILE A 1 80  ? 35.718  1.756   41.133  1.00 16.37 ? 308  ILE A CG1 1 
ATOM   604   C CG2 . ILE A 1 80  ? 37.526  3.275   41.972  1.00 14.91 ? 308  ILE A CG2 1 
ATOM   605   C CD1 . ILE A 1 80  ? 34.837  2.674   40.283  1.00 15.98 ? 308  ILE A CD1 1 
ATOM   606   N N   . LEU A 1 81  ? 36.463  2.649   45.569  1.00 15.88 ? 309  LEU A N   1 
ATOM   607   C CA  . LEU A 1 81  ? 37.003  3.250   46.811  1.00 16.11 ? 309  LEU A CA  1 
ATOM   608   C C   . LEU A 1 81  ? 37.824  2.211   47.567  1.00 16.48 ? 309  LEU A C   1 
ATOM   609   O O   . LEU A 1 81  ? 39.018  2.394   47.835  1.00 16.35 ? 309  LEU A O   1 
ATOM   610   C CB  . LEU A 1 81  ? 35.905  3.789   47.737  1.00 15.84 ? 309  LEU A CB  1 
ATOM   611   C CG  . LEU A 1 81  ? 35.366  5.209   47.478  1.00 14.89 ? 309  LEU A CG  1 
ATOM   612   C CD1 . LEU A 1 81  ? 34.104  5.442   48.305  1.00 12.84 ? 309  LEU A CD1 1 
ATOM   613   C CD2 . LEU A 1 81  ? 36.399  6.259   47.757  1.00 11.45 ? 309  LEU A CD2 1 
ATOM   614   N N   . ILE A 1 82  ? 37.167  1.102   47.882  1.00 16.81 ? 310  ILE A N   1 
ATOM   615   C CA  . ILE A 1 82  ? 37.797  0.035   48.660  1.00 16.77 ? 310  ILE A CA  1 
ATOM   616   C C   . ILE A 1 82  ? 39.055  -0.527  48.006  1.00 16.75 ? 310  ILE A C   1 
ATOM   617   O O   . ILE A 1 82  ? 40.007  -0.913  48.702  1.00 16.78 ? 310  ILE A O   1 
ATOM   618   C CB  . ILE A 1 82  ? 36.801  -1.096  48.949  1.00 16.61 ? 310  ILE A CB  1 
ATOM   619   C CG1 . ILE A 1 82  ? 35.917  -0.677  50.126  1.00 16.23 ? 310  ILE A CG1 1 
ATOM   620   C CG2 . ILE A 1 82  ? 37.543  -2.421  49.210  1.00 16.48 ? 310  ILE A CG2 1 
ATOM   621   C CD1 . ILE A 1 82  ? 34.744  -1.586  50.355  1.00 17.50 ? 310  ILE A CD1 1 
ATOM   622   N N   . LEU A 1 83  ? 39.068  -0.578  46.679  1.00 16.50 ? 311  LEU A N   1 
ATOM   623   C CA  . LEU A 1 83  ? 40.224  -1.135  45.992  1.00 16.56 ? 311  LEU A CA  1 
ATOM   624   C C   . LEU A 1 83  ? 41.371  -0.100  46.035  1.00 16.69 ? 311  LEU A C   1 
ATOM   625   O O   . LEU A 1 83  ? 42.552  -0.461  45.958  1.00 16.95 ? 311  LEU A O   1 
ATOM   626   C CB  . LEU A 1 83  ? 39.849  -1.541  44.575  1.00 16.39 ? 311  LEU A CB  1 
ATOM   627   C CG  . LEU A 1 83  ? 40.918  -2.139  43.683  1.00 16.24 ? 311  LEU A CG  1 
ATOM   628   C CD1 . LEU A 1 83  ? 41.438  -3.447  44.212  1.00 16.68 ? 311  LEU A CD1 1 
ATOM   629   C CD2 . LEU A 1 83  ? 40.306  -2.329  42.332  1.00 16.93 ? 311  LEU A CD2 1 
ATOM   630   N N   . GLY A 1 84  ? 41.011  1.176   46.188  1.00 16.17 ? 312  GLY A N   1 
ATOM   631   C CA  . GLY A 1 84  ? 41.990  2.238   46.377  1.00 15.73 ? 312  GLY A CA  1 
ATOM   632   C C   . GLY A 1 84  ? 42.730  2.103   47.694  1.00 15.47 ? 312  GLY A C   1 
ATOM   633   O O   . GLY A 1 84  ? 43.946  2.083   47.711  1.00 15.55 ? 312  GLY A O   1 
ATOM   634   N N   . VAL A 1 85  ? 42.014  2.010   48.808  1.00 15.27 ? 313  VAL A N   1 
ATOM   635   C CA  . VAL A 1 85  ? 42.695  1.863   50.097  1.00 15.03 ? 313  VAL A CA  1 
ATOM   636   C C   . VAL A 1 85  ? 43.569  0.606   50.071  1.00 15.34 ? 313  VAL A C   1 
ATOM   637   O O   . VAL A 1 85  ? 44.733  0.631   50.512  1.00 15.65 ? 313  VAL A O   1 
ATOM   638   C CB  . VAL A 1 85  ? 41.733  1.875   51.337  1.00 14.74 ? 313  VAL A CB  1 
ATOM   639   C CG1 . VAL A 1 85  ? 40.486  1.059   51.093  1.00 14.91 ? 313  VAL A CG1 1 
ATOM   640   C CG2 . VAL A 1 85  ? 42.459  1.408   52.582  1.00 13.42 ? 313  VAL A CG2 1 
ATOM   641   N N   . VAL A 1 86  ? 43.038  -0.472  49.500  1.00 15.27 ? 314  VAL A N   1 
ATOM   642   C CA  . VAL A 1 86  ? 43.781  -1.736  49.452  1.00 15.13 ? 314  VAL A CA  1 
ATOM   643   C C   . VAL A 1 86  ? 45.145  -1.543  48.793  1.00 14.48 ? 314  VAL A C   1 
ATOM   644   O O   . VAL A 1 86  ? 46.154  -2.016  49.309  1.00 14.66 ? 314  VAL A O   1 
ATOM   645   C CB  . VAL A 1 86  ? 42.997  -2.854  48.711  1.00 15.34 ? 314  VAL A CB  1 
ATOM   646   C CG1 . VAL A 1 86  ? 43.902  -4.025  48.410  1.00 15.82 ? 314  VAL A CG1 1 
ATOM   647   C CG2 . VAL A 1 86  ? 41.801  -3.322  49.539  1.00 15.80 ? 314  VAL A CG2 1 
ATOM   648   N N   . TYR A 1 87  ? 45.186  -0.840  47.667  1.00 13.87 ? 315  TYR A N   1 
ATOM   649   C CA  . TYR A 1 87  ? 46.453  -0.695  46.953  1.00 13.62 ? 315  TYR A CA  1 
ATOM   650   C C   . TYR A 1 87  ? 47.424  0.083   47.820  1.00 13.35 ? 315  TYR A C   1 
ATOM   651   O O   . TYR A 1 87  ? 48.517  -0.404  48.127  1.00 13.29 ? 315  TYR A O   1 
ATOM   652   C CB  . TYR A 1 87  ? 46.291  -0.016  45.584  1.00 13.57 ? 315  TYR A CB  1 
ATOM   653   C CG  . TYR A 1 87  ? 47.620  0.104   44.856  1.00 13.69 ? 315  TYR A CG  1 
ATOM   654   C CD1 . TYR A 1 87  ? 48.191  -1.000  44.233  1.00 13.12 ? 315  TYR A CD1 1 
ATOM   655   C CD2 . TYR A 1 87  ? 48.328  1.312   44.837  1.00 12.57 ? 315  TYR A CD2 1 
ATOM   656   C CE1 . TYR A 1 87  ? 49.416  -0.896  43.590  1.00 13.61 ? 315  TYR A CE1 1 
ATOM   657   C CE2 . TYR A 1 87  ? 49.548  1.419   44.202  1.00 12.04 ? 315  TYR A CE2 1 
ATOM   658   C CZ  . TYR A 1 87  ? 50.091  0.317   43.579  1.00 12.98 ? 315  TYR A CZ  1 
ATOM   659   O OH  . TYR A 1 87  ? 51.309  0.412   42.938  1.00 12.51 ? 315  TYR A OH  1 
ATOM   660   N N   . ARG A 1 88  ? 46.985  1.275   48.226  1.00 13.10 ? 316  ARG A N   1 
ATOM   661   C CA  . ARG A 1 88  ? 47.729  2.156   49.132  1.00 12.87 ? 316  ARG A CA  1 
ATOM   662   C C   . ARG A 1 88  ? 48.229  1.412   50.375  1.00 12.78 ? 316  ARG A C   1 
ATOM   663   O O   . ARG A 1 88  ? 49.209  1.834   50.979  1.00 12.60 ? 316  ARG A O   1 
ATOM   664   C CB  . ARG A 1 88  ? 46.855  3.355   49.570  1.00 13.05 ? 316  ARG A CB  1 
ATOM   665   C CG  . ARG A 1 88  ? 46.300  4.220   48.410  1.00 13.29 ? 316  ARG A CG  1 
ATOM   666   C CD  . ARG A 1 88  ? 45.682  5.551   48.834  1.00 12.62 ? 316  ARG A CD  1 
ATOM   667   N NE  . ARG A 1 88  ? 44.518  5.411   49.711  1.00 13.17 ? 316  ARG A NE  1 
ATOM   668   C CZ  . ARG A 1 88  ? 43.235  5.337   49.323  1.00 13.45 ? 316  ARG A CZ  1 
ATOM   669   N NH1 . ARG A 1 88  ? 42.862  5.367   48.048  1.00 13.38 ? 316  ARG A NH1 1 
ATOM   670   N NH2 . ARG A 1 88  ? 42.295  5.227   50.242  1.00 13.21 ? 316  ARG A NH2 1 
ATOM   671   N N   . SER A 1 89  ? 47.559  0.316   50.752  1.00 12.68 ? 317  SER A N   1 
ATOM   672   C CA  . SER A 1 89  ? 47.928  -0.456  51.941  1.00 12.62 ? 317  SER A CA  1 
ATOM   673   C C   . SER A 1 89  ? 48.963  -1.564  51.716  1.00 12.93 ? 317  SER A C   1 
ATOM   674   O O   . SER A 1 89  ? 49.448  -2.140  52.691  1.00 13.05 ? 317  SER A O   1 
ATOM   675   C CB  . SER A 1 89  ? 46.684  -1.075  52.568  1.00 12.46 ? 317  SER A CB  1 
ATOM   676   O OG  . SER A 1 89  ? 45.695  -0.102  52.840  1.00 12.52 ? 317  SER A OG  1 
ATOM   677   N N   . LEU A 1 90  ? 49.307  -1.858  50.457  1.00 13.28 ? 318  LEU A N   1 
ATOM   678   C CA  . LEU A 1 90  ? 50.123  -3.056  50.111  1.00 13.49 ? 318  LEU A CA  1 
ATOM   679   C C   . LEU A 1 90  ? 51.412  -3.238  50.923  1.00 13.48 ? 318  LEU A C   1 
ATOM   680   O O   . LEU A 1 90  ? 51.701  -4.336  51.386  1.00 13.95 ? 318  LEU A O   1 
ATOM   681   C CB  . LEU A 1 90  ? 50.492  -3.076  48.620  1.00 13.49 ? 318  LEU A CB  1 
ATOM   682   C CG  . LEU A 1 90  ? 49.569  -3.774  47.625  1.00 14.02 ? 318  LEU A CG  1 
ATOM   683   C CD1 . LEU A 1 90  ? 50.075  -3.526  46.216  1.00 13.75 ? 318  LEU A CD1 1 
ATOM   684   C CD2 . LEU A 1 90  ? 49.479  -5.269  47.907  1.00 14.35 ? 318  LEU A CD2 1 
ATOM   685   N N   . SER A 1 91  ? 52.198  -2.185  51.089  1.00 13.36 ? 319  SER A N   1 
ATOM   686   C CA  . SER A 1 91  ? 53.487  -2.326  51.762  1.00 13.30 ? 319  SER A CA  1 
ATOM   687   C C   . SER A 1 91  ? 53.392  -1.940  53.237  1.00 13.29 ? 319  SER A C   1 
ATOM   688   O O   . SER A 1 91  ? 54.309  -1.335  53.783  1.00 13.27 ? 319  SER A O   1 
ATOM   689   C CB  . SER A 1 91  ? 54.541  -1.490  51.042  1.00 13.18 ? 319  SER A CB  1 
ATOM   690   O OG  . SER A 1 91  ? 54.194  -0.128  51.089  1.00 13.02 ? 319  SER A OG  1 
ATOM   691   N N   . PHE A 1 92  ? 52.269  -2.286  53.865  1.00 13.37 ? 320  PHE A N   1 
ATOM   692   C CA  . PHE A 1 92  ? 52.049  -2.063  55.293  1.00 13.37 ? 320  PHE A CA  1 
ATOM   693   C C   . PHE A 1 92  ? 51.616  -3.370  55.931  1.00 13.72 ? 320  PHE A C   1 
ATOM   694   O O   . PHE A 1 92  ? 51.167  -4.281  55.250  1.00 13.73 ? 320  PHE A O   1 
ATOM   695   C CB  . PHE A 1 92  ? 50.975  -0.997  55.524  1.00 13.18 ? 320  PHE A CB  1 
ATOM   696   C CG  . PHE A 1 92  ? 51.435  0.399   55.230  1.00 12.73 ? 320  PHE A CG  1 
ATOM   697   C CD1 . PHE A 1 92  ? 51.601  0.829   53.917  1.00 12.36 ? 320  PHE A CD1 1 
ATOM   698   C CD2 . PHE A 1 92  ? 51.712  1.284   56.261  1.00 12.50 ? 320  PHE A CD2 1 
ATOM   699   C CE1 . PHE A 1 92  ? 52.035  2.118   53.635  1.00 12.42 ? 320  PHE A CE1 1 
ATOM   700   C CE2 . PHE A 1 92  ? 52.157  2.582   55.986  1.00 12.64 ? 320  PHE A CE2 1 
ATOM   701   C CZ  . PHE A 1 92  ? 52.314  2.999   54.672  1.00 12.29 ? 320  PHE A CZ  1 
ATOM   702   N N   . GLU A 1 93  ? 51.751  -3.457  57.246  1.00 14.21 ? 321  GLU A N   1 
ATOM   703   C CA  . GLU A 1 93  ? 51.375  -4.660  57.963  1.00 14.80 ? 321  GLU A CA  1 
ATOM   704   C C   . GLU A 1 93  ? 50.232  -4.355  58.950  1.00 14.56 ? 321  GLU A C   1 
ATOM   705   O O   . GLU A 1 93  ? 50.392  -3.581  59.900  1.00 14.25 ? 321  GLU A O   1 
ATOM   706   C CB  . GLU A 1 93  ? 52.603  -5.283  58.655  1.00 15.40 ? 321  GLU A CB  1 
ATOM   707   C CG  . GLU A 1 93  ? 53.657  -5.928  57.683  1.00 17.34 ? 321  GLU A CG  1 
ATOM   708   C CD  . GLU A 1 93  ? 53.283  -7.350  57.163  1.00 20.28 ? 321  GLU A CD  1 
ATOM   709   O OE1 . GLU A 1 93  ? 52.456  -8.045  57.806  1.00 22.57 ? 321  GLU A OE1 1 
ATOM   710   O OE2 . GLU A 1 93  ? 53.838  -7.788  56.117  1.00 20.71 ? 321  GLU A OE2 1 
ATOM   711   N N   . ASP A 1 94  ? 49.069  -4.951  58.668  1.00 14.48 ? 322  ASP A N   1 
ATOM   712   C CA  . ASP A 1 94  ? 47.866  -4.858  59.506  1.00 14.33 ? 322  ASP A CA  1 
ATOM   713   C C   . ASP A 1 94  ? 47.369  -3.414  59.710  1.00 14.41 ? 322  ASP A C   1 
ATOM   714   O O   . ASP A 1 94  ? 46.678  -3.100  60.690  1.00 14.15 ? 322  ASP A O   1 
ATOM   715   C CB  . ASP A 1 94  ? 48.086  -5.568  60.853  1.00 14.27 ? 322  ASP A CB  1 
ATOM   716   C CG  . ASP A 1 94  ? 48.371  -7.061  60.702  1.00 13.89 ? 322  ASP A CG  1 
ATOM   717   O OD1 . ASP A 1 94  ? 48.407  -7.588  59.572  1.00 12.67 ? 322  ASP A OD1 1 
ATOM   718   O OD2 . ASP A 1 94  ? 48.564  -7.721  61.738  1.00 14.95 ? 322  ASP A OD2 1 
ATOM   719   N N   . GLU A 1 95  ? 47.708  -2.541  58.768  1.00 14.46 ? 323  GLU A N   1 
ATOM   720   C CA  . GLU A 1 95  ? 47.254  -1.160  58.812  1.00 14.66 ? 323  GLU A CA  1 
ATOM   721   C C   . GLU A 1 95  ? 46.625  -0.829  57.477  1.00 14.19 ? 323  GLU A C   1 
ATOM   722   O O   . GLU A 1 95  ? 46.970  -1.435  56.456  1.00 14.30 ? 323  GLU A O   1 
ATOM   723   C CB  . GLU A 1 95  ? 48.415  -0.211  59.116  1.00 14.81 ? 323  GLU A CB  1 
ATOM   724   C CG  . GLU A 1 95  ? 48.688  -0.009  60.615  1.00 15.40 ? 323  GLU A CG  1 
ATOM   725   C CD  . GLU A 1 95  ? 50.089  0.541   60.901  1.00 16.00 ? 323  GLU A CD  1 
ATOM   726   O OE1 . GLU A 1 95  ? 50.882  0.675   59.932  1.00 18.48 ? 323  GLU A OE1 1 
ATOM   727   O OE2 . GLU A 1 95  ? 50.396  0.836   62.088  1.00 15.98 ? 323  GLU A OE2 1 
ATOM   728   N N   . LEU A 1 96  ? 45.693  0.120   57.502  1.00 13.74 ? 324  LEU A N   1 
ATOM   729   C CA  . LEU A 1 96  ? 44.950  0.525   56.324  1.00 13.44 ? 324  LEU A CA  1 
ATOM   730   C C   . LEU A 1 96  ? 45.178  2.005   56.071  1.00 13.17 ? 324  LEU A C   1 
ATOM   731   O O   . LEU A 1 96  ? 44.808  2.834   56.894  1.00 12.87 ? 324  LEU A O   1 
ATOM   732   C CB  . LEU A 1 96  ? 43.457  0.247   56.520  1.00 13.44 ? 324  LEU A CB  1 
ATOM   733   C CG  . LEU A 1 96  ? 43.006  -1.219  56.415  1.00 13.79 ? 324  LEU A CG  1 
ATOM   734   C CD1 . LEU A 1 96  ? 41.542  -1.326  56.780  1.00 13.60 ? 324  LEU A CD1 1 
ATOM   735   C CD2 . LEU A 1 96  ? 43.243  -1.807  55.022  1.00 12.87 ? 324  LEU A CD2 1 
ATOM   736   N N   . VAL A 1 97  ? 45.784  2.319   54.925  1.00 13.08 ? 325  VAL A N   1 
ATOM   737   C CA  . VAL A 1 97  ? 46.070  3.693   54.537  1.00 12.93 ? 325  VAL A CA  1 
ATOM   738   C C   . VAL A 1 97  ? 44.875  4.259   53.825  1.00 12.88 ? 325  VAL A C   1 
ATOM   739   O O   . VAL A 1 97  ? 44.746  4.092   52.639  1.00 13.23 ? 325  VAL A O   1 
ATOM   740   C CB  . VAL A 1 97  ? 47.258  3.784   53.556  1.00 12.87 ? 325  VAL A CB  1 
ATOM   741   C CG1 . VAL A 1 97  ? 47.536  5.254   53.205  1.00 12.15 ? 325  VAL A CG1 1 
ATOM   742   C CG2 . VAL A 1 97  ? 48.493  3.113   54.142  1.00 12.69 ? 325  VAL A CG2 1 
ATOM   743   N N   . TYR A 1 98  ? 43.980  4.911   54.541  1.00 12.89 ? 326  TYR A N   1 
ATOM   744   C CA  . TYR A 1 98  ? 42.866  5.565   53.882  1.00 12.90 ? 326  TYR A CA  1 
ATOM   745   C C   . TYR A 1 98  ? 43.374  6.816   53.187  1.00 13.02 ? 326  TYR A C   1 
ATOM   746   O O   . TYR A 1 98  ? 42.878  7.208   52.130  1.00 12.96 ? 326  TYR A O   1 
ATOM   747   C CB  . TYR A 1 98  ? 41.749  5.852   54.881  1.00 12.98 ? 326  TYR A CB  1 
ATOM   748   C CG  . TYR A 1 98  ? 40.938  4.614   55.111  1.00 13.06 ? 326  TYR A CG  1 
ATOM   749   C CD1 . TYR A 1 98  ? 39.951  4.246   54.223  1.00 13.27 ? 326  TYR A CD1 1 
ATOM   750   C CD2 . TYR A 1 98  ? 41.202  3.774   56.167  1.00 13.31 ? 326  TYR A CD2 1 
ATOM   751   C CE1 . TYR A 1 98  ? 39.230  3.101   54.404  1.00 13.09 ? 326  TYR A CE1 1 
ATOM   752   C CE2 . TYR A 1 98  ? 40.485  2.618   56.349  1.00 12.99 ? 326  TYR A CE2 1 
ATOM   753   C CZ  . TYR A 1 98  ? 39.502  2.284   55.464  1.00 13.01 ? 326  TYR A CZ  1 
ATOM   754   O OH  . TYR A 1 98  ? 38.765  1.128   55.650  1.00 14.23 ? 326  TYR A OH  1 
ATOM   755   N N   . ALA A 1 99  ? 44.391  7.413   53.793  1.00 13.11 ? 327  ALA A N   1 
ATOM   756   C CA  . ALA A 1 99  ? 45.116  8.526   53.227  1.00 13.16 ? 327  ALA A CA  1 
ATOM   757   C C   . ALA A 1 99  ? 46.452  8.555   53.942  1.00 13.42 ? 327  ALA A C   1 
ATOM   758   O O   . ALA A 1 99  ? 46.595  7.941   54.989  1.00 13.76 ? 327  ALA A O   1 
ATOM   759   C CB  . ALA A 1 99  ? 44.361  9.810   53.464  1.00 13.05 ? 327  ALA A CB  1 
ATOM   760   N N   . ASP A 1 100 ? 47.432  9.267   53.400  1.00 13.81 ? 328  ASP A N   1 
ATOM   761   C CA  . ASP A 1 100 ? 48.748  9.359   54.045  1.00 13.94 ? 328  ASP A CA  1 
ATOM   762   C C   . ASP A 1 100 ? 48.687  9.896   55.483  1.00 13.78 ? 328  ASP A C   1 
ATOM   763   O O   . ASP A 1 100 ? 49.537  9.565   56.315  1.00 13.53 ? 328  ASP A O   1 
ATOM   764   C CB  . ASP A 1 100 ? 49.698  10.207  53.197  1.00 14.16 ? 328  ASP A CB  1 
ATOM   765   C CG  . ASP A 1 100 ? 50.342  9.415   52.056  1.00 15.16 ? 328  ASP A CG  1 
ATOM   766   O OD1 . ASP A 1 100 ? 50.277  8.165   52.052  1.00 14.99 ? 328  ASP A OD1 1 
ATOM   767   O OD2 . ASP A 1 100 ? 50.944  10.059  51.168  1.00 17.96 ? 328  ASP A OD2 1 
ATOM   768   N N   . ASP A 1 101 ? 47.677  10.718  55.758  1.00 13.79 ? 329  ASP A N   1 
ATOM   769   C CA  . ASP A 1 101 ? 47.445  11.271  57.093  1.00 13.80 ? 329  ASP A CA  1 
ATOM   770   C C   . ASP A 1 101 ? 46.365  10.511  57.843  1.00 13.80 ? 329  ASP A C   1 
ATOM   771   O O   . ASP A 1 101 ? 45.912  10.946  58.898  1.00 14.20 ? 329  ASP A O   1 
ATOM   772   C CB  . ASP A 1 101 ? 47.078  12.767  57.017  1.00 13.79 ? 329  ASP A CB  1 
ATOM   773   C CG  . ASP A 1 101 ? 45.837  13.044  56.167  1.00 14.21 ? 329  ASP A CG  1 
ATOM   774   O OD1 . ASP A 1 101 ? 45.377  12.155  55.417  1.00 15.06 ? 329  ASP A OD1 1 
ATOM   775   O OD2 . ASP A 1 101 ? 45.319  14.175  56.242  1.00 15.46 ? 329  ASP A OD2 1 
ATOM   776   N N   . TYR A 1 102 ? 45.942  9.372   57.314  1.00 13.82 ? 330  TYR A N   1 
ATOM   777   C CA  . TYR A 1 102 ? 44.917  8.601   57.988  1.00 13.61 ? 330  TYR A CA  1 
ATOM   778   C C   . TYR A 1 102 ? 45.113  7.120   57.819  1.00 13.52 ? 330  TYR A C   1 
ATOM   779   O O   . TYR A 1 102 ? 44.552  6.527   56.908  1.00 13.52 ? 330  TYR A O   1 
ATOM   780   C CB  . TYR A 1 102 ? 43.533  9.020   57.500  1.00 13.42 ? 330  TYR A CB  1 
ATOM   781   C CG  . TYR A 1 102 ? 42.486  8.792   58.541  1.00 13.18 ? 330  TYR A CG  1 
ATOM   782   C CD1 . TYR A 1 102 ? 42.639  9.333   59.806  1.00 13.56 ? 330  TYR A CD1 1 
ATOM   783   C CD2 . TYR A 1 102 ? 41.355  8.043   58.283  1.00 12.42 ? 330  TYR A CD2 1 
ATOM   784   C CE1 . TYR A 1 102 ? 41.708  9.135   60.786  1.00 13.51 ? 330  TYR A CE1 1 
ATOM   785   C CE2 . TYR A 1 102 ? 40.405  7.842   59.273  1.00 12.86 ? 330  TYR A CE2 1 
ATOM   786   C CZ  . TYR A 1 102 ? 40.598  8.396   60.523  1.00 12.92 ? 330  TYR A CZ  1 
ATOM   787   O OH  . TYR A 1 102 ? 39.698  8.247   61.542  1.00 13.56 ? 330  TYR A OH  1 
ATOM   788   N N   . ILE A 1 103 ? 45.901  6.535   58.717  1.00 13.66 ? 331  ILE A N   1 
ATOM   789   C CA  . ILE A 1 103 ? 46.187  5.110   58.683  1.00 14.09 ? 331  ILE A CA  1 
ATOM   790   C C   . ILE A 1 103 ? 45.544  4.421   59.880  1.00 14.57 ? 331  ILE A C   1 
ATOM   791   O O   . ILE A 1 103 ? 45.873  4.745   61.017  1.00 14.94 ? 331  ILE A O   1 
ATOM   792   C CB  . ILE A 1 103 ? 47.715  4.822   58.693  1.00 14.35 ? 331  ILE A CB  1 
ATOM   793   C CG1 . ILE A 1 103 ? 48.470  5.667   57.641  1.00 13.86 ? 331  ILE A CG1 1 
ATOM   794   C CG2 . ILE A 1 103 ? 47.965  3.328   58.449  1.00 14.55 ? 331  ILE A CG2 1 
ATOM   795   C CD1 . ILE A 1 103 ? 49.972  5.757   57.891  1.00 12.75 ? 331  ILE A CD1 1 
ATOM   796   N N   . MET A 1 104 ? 44.639  3.470   59.637  1.00 15.04 ? 332  MET A N   1 
ATOM   797   C CA  . MET A 1 104 ? 43.938  2.782   60.740  1.00 15.58 ? 332  MET A CA  1 
ATOM   798   C C   . MET A 1 104 ? 44.510  1.415   61.065  1.00 15.52 ? 332  MET A C   1 
ATOM   799   O O   . MET A 1 104 ? 44.376  0.487   60.294  1.00 15.36 ? 332  MET A O   1 
ATOM   800   C CB  . MET A 1 104 ? 42.449  2.617   60.434  1.00 15.70 ? 332  MET A CB  1 
ATOM   801   C CG  . MET A 1 104 ? 41.681  3.917   60.356  1.00 15.82 ? 332  MET A CG  1 
ATOM   802   S SD  . MET A 1 104 ? 39.947  3.617   60.013  1.00 16.17 ? 332  MET A SD  1 
ATOM   803   C CE  . MET A 1 104 ? 39.365  3.049   61.614  1.00 14.02 ? 332  MET A CE  1 
ATOM   804   N N   . ASP A 1 105 ? 45.131  1.309   62.231  1.00 16.04 ? 333  ASP A N   1 
ATOM   805   C CA  . ASP A 1 105 ? 45.587  0.040   62.766  1.00 16.28 ? 333  ASP A CA  1 
ATOM   806   C C   . ASP A 1 105 ? 44.445  -0.589  63.531  1.00 16.69 ? 333  ASP A C   1 
ATOM   807   O O   . ASP A 1 105 ? 43.389  0.017   63.689  1.00 16.62 ? 333  ASP A O   1 
ATOM   808   C CB  . ASP A 1 105 ? 46.790  0.247   63.688  1.00 16.26 ? 333  ASP A CB  1 
ATOM   809   C CG  . ASP A 1 105 ? 46.402  0.779   65.055  1.00 16.32 ? 333  ASP A CG  1 
ATOM   810   O OD1 . ASP A 1 105 ? 45.826  1.883   65.151  1.00 15.84 ? 333  ASP A OD1 1 
ATOM   811   O OD2 . ASP A 1 105 ? 46.687  0.081   66.045  1.00 17.40 ? 333  ASP A OD2 1 
ATOM   812   N N   . GLU A 1 106 ? 44.659  -1.805  64.016  1.00 17.38 ? 334  GLU A N   1 
ATOM   813   C CA  . GLU A 1 106 ? 43.622  -2.515  64.767  1.00 18.06 ? 334  GLU A CA  1 
ATOM   814   C C   . GLU A 1 106 ? 42.941  -1.649  65.842  1.00 18.19 ? 334  GLU A C   1 
ATOM   815   O O   . GLU A 1 106 ? 41.716  -1.514  65.837  1.00 18.52 ? 334  GLU A O   1 
ATOM   816   C CB  . GLU A 1 106 ? 44.188  -3.783  65.417  1.00 18.19 ? 334  GLU A CB  1 
ATOM   817   C CG  . GLU A 1 106 ? 43.159  -4.895  65.567  1.00 18.72 ? 334  GLU A CG  1 
ATOM   818   C CD  . GLU A 1 106 ? 43.663  -6.066  66.386  1.00 18.83 ? 334  GLU A CD  1 
ATOM   819   O OE1 . GLU A 1 106 ? 44.343  -5.826  67.409  1.00 20.16 ? 334  GLU A OE1 1 
ATOM   820   O OE2 . GLU A 1 106 ? 43.360  -7.223  66.011  1.00 19.33 ? 334  GLU A OE2 1 
ATOM   821   N N   . ASP A 1 107 ? 43.728  -1.063  66.749  1.00 18.19 ? 335  ASP A N   1 
ATOM   822   C CA  . ASP A 1 107 ? 43.170  -0.291  67.870  1.00 18.29 ? 335  ASP A CA  1 
ATOM   823   C C   . ASP A 1 107 ? 42.178  0.790   67.383  1.00 18.42 ? 335  ASP A C   1 
ATOM   824   O O   . ASP A 1 107 ? 41.058  0.888   67.895  1.00 18.48 ? 335  ASP A O   1 
ATOM   825   C CB  . ASP A 1 107 ? 44.285  0.342   68.734  1.00 18.27 ? 335  ASP A CB  1 
ATOM   826   C CG  . ASP A 1 107 ? 44.995  -0.673  69.643  1.00 18.51 ? 335  ASP A CG  1 
ATOM   827   O OD1 . ASP A 1 107 ? 45.755  -1.522  69.135  1.00 19.55 ? 335  ASP A OD1 1 
ATOM   828   O OD2 . ASP A 1 107 ? 44.820  -0.610  70.876  1.00 18.19 ? 335  ASP A OD2 1 
ATOM   829   N N   . GLN A 1 108 ? 42.580  1.578   66.384  1.00 18.45 ? 336  GLN A N   1 
ATOM   830   C CA  . GLN A 1 108 ? 41.731  2.661   65.871  1.00 18.64 ? 336  GLN A CA  1 
ATOM   831   C C   . GLN A 1 108 ? 40.435  2.118   65.234  1.00 18.51 ? 336  GLN A C   1 
ATOM   832   O O   . GLN A 1 108 ? 39.391  2.783   65.226  1.00 18.34 ? 336  GLN A O   1 
ATOM   833   C CB  . GLN A 1 108 ? 42.509  3.528   64.877  1.00 18.50 ? 336  GLN A CB  1 
ATOM   834   C CG  . GLN A 1 108 ? 43.624  4.358   65.508  1.00 18.99 ? 336  GLN A CG  1 
ATOM   835   C CD  . GLN A 1 108 ? 44.583  4.946   64.475  1.00 19.81 ? 336  GLN A CD  1 
ATOM   836   O OE1 . GLN A 1 108 ? 44.544  6.146   64.188  1.00 21.86 ? 336  GLN A OE1 1 
ATOM   837   N NE2 . GLN A 1 108 ? 45.439  4.100   63.899  1.00 20.21 ? 336  GLN A NE2 1 
ATOM   838   N N   . SER A 1 109 ? 40.510  0.901   64.710  1.00 18.46 ? 337  SER A N   1 
ATOM   839   C CA  . SER A 1 109 ? 39.350  0.247   64.134  1.00 18.44 ? 337  SER A CA  1 
ATOM   840   C C   . SER A 1 109 ? 38.409  -0.228  65.230  1.00 18.71 ? 337  SER A C   1 
ATOM   841   O O   . SER A 1 109 ? 37.192  -0.157  65.071  1.00 18.78 ? 337  SER A O   1 
ATOM   842   C CB  . SER A 1 109 ? 39.792  -0.920  63.270  1.00 18.22 ? 337  SER A CB  1 
ATOM   843   O OG  . SER A 1 109 ? 41.004  -0.588  62.623  1.00 18.07 ? 337  SER A OG  1 
ATOM   844   N N   . LYS A 1 110 ? 38.972  -0.712  66.338  1.00 18.99 ? 338  LYS A N   1 
ATOM   845   C CA  . LYS A 1 110 ? 38.161  -1.121  67.486  1.00 19.25 ? 338  LYS A CA  1 
ATOM   846   C C   . LYS A 1 110 ? 37.404  0.087   68.038  1.00 19.47 ? 338  LYS A C   1 
ATOM   847   O O   . LYS A 1 110 ? 36.255  -0.037  68.479  1.00 19.73 ? 338  LYS A O   1 
ATOM   848   C CB  . LYS A 1 110 ? 39.015  -1.787  68.579  1.00 19.23 ? 338  LYS A CB  1 
ATOM   849   C CG  . LYS A 1 110 ? 39.295  -3.278  68.337  1.00 19.43 ? 338  LYS A CG  1 
ATOM   850   C CD  . LYS A 1 110 ? 40.287  -3.862  69.356  1.00 19.51 ? 338  LYS A CD  1 
ATOM   851   C CE  . LYS A 1 110 ? 41.032  -5.103  68.819  1.00 19.92 ? 338  LYS A CE  1 
ATOM   852   N NZ  . LYS A 1 110 ? 40.276  -6.396  68.925  1.00 19.82 ? 338  LYS A NZ  1 
ATOM   853   N N   . LEU A 1 111 ? 38.040  1.259   67.986  1.00 19.49 ? 339  LEU A N   1 
ATOM   854   C CA  . LEU A 1 111 ? 37.417  2.480   68.478  1.00 19.39 ? 339  LEU A CA  1 
ATOM   855   C C   . LEU A 1 111 ? 36.281  2.953   67.560  1.00 19.37 ? 339  LEU A C   1 
ATOM   856   O O   . LEU A 1 111 ? 35.355  3.623   68.023  1.00 19.56 ? 339  LEU A O   1 
ATOM   857   C CB  . LEU A 1 111 ? 38.463  3.585   68.665  1.00 19.35 ? 339  LEU A CB  1 
ATOM   858   C CG  . LEU A 1 111 ? 38.000  4.873   69.383  1.00 19.59 ? 339  LEU A CG  1 
ATOM   859   C CD1 . LEU A 1 111 ? 37.605  4.607   70.829  1.00 19.28 ? 339  LEU A CD1 1 
ATOM   860   C CD2 . LEU A 1 111 ? 39.065  5.977   69.329  1.00 19.35 ? 339  LEU A CD2 1 
ATOM   861   N N   . ALA A 1 112 ? 36.343  2.599   66.275  1.00 19.17 ? 340  ALA A N   1 
ATOM   862   C CA  . ALA A 1 112 ? 35.353  3.055   65.289  1.00 19.02 ? 340  ALA A CA  1 
ATOM   863   C C   . ALA A 1 112 ? 34.309  1.992   64.894  1.00 19.21 ? 340  ALA A C   1 
ATOM   864   O O   . ALA A 1 112 ? 33.433  2.262   64.064  1.00 19.53 ? 340  ALA A O   1 
ATOM   865   C CB  . ALA A 1 112 ? 36.060  3.571   64.061  1.00 18.52 ? 340  ALA A CB  1 
ATOM   866   N N   . GLY A 1 113 ? 34.389  0.794   65.475  1.00 19.12 ? 341  GLY A N   1 
ATOM   867   C CA  . GLY A 1 113 ? 33.441  -0.279  65.152  1.00 19.04 ? 341  GLY A CA  1 
ATOM   868   C C   . GLY A 1 113 ? 33.505  -0.742  63.706  1.00 18.94 ? 341  GLY A C   1 
ATOM   869   O O   . GLY A 1 113 ? 32.510  -1.211  63.150  1.00 18.84 ? 341  GLY A O   1 
ATOM   870   N N   . LEU A 1 114 ? 34.686  -0.608  63.105  1.00 18.95 ? 342  LEU A N   1 
ATOM   871   C CA  . LEU A 1 114 ? 34.951  -1.114  61.764  1.00 18.92 ? 342  LEU A CA  1 
ATOM   872   C C   . LEU A 1 114 ? 35.922  -2.296  61.821  1.00 18.86 ? 342  LEU A C   1 
ATOM   873   O O   . LEU A 1 114 ? 36.699  -2.516  60.894  1.00 18.99 ? 342  LEU A O   1 
ATOM   874   C CB  . LEU A 1 114 ? 35.529  -0.002  60.882  1.00 18.93 ? 342  LEU A CB  1 
ATOM   875   C CG  . LEU A 1 114 ? 34.706  1.276   60.758  1.00 18.77 ? 342  LEU A CG  1 
ATOM   876   C CD1 . LEU A 1 114 ? 35.404  2.246   59.839  1.00 18.51 ? 342  LEU A CD1 1 
ATOM   877   C CD2 . LEU A 1 114 ? 33.298  0.972   60.260  1.00 19.45 ? 342  LEU A CD2 1 
ATOM   878   N N   . LEU A 1 115 ? 35.871  -3.062  62.905  1.00 18.82 ? 343  LEU A N   1 
ATOM   879   C CA  . LEU A 1 115 ? 36.780  -4.184  63.073  1.00 18.78 ? 343  LEU A CA  1 
ATOM   880   C C   . LEU A 1 115 ? 36.463  -5.270  62.046  1.00 18.49 ? 343  LEU A C   1 
ATOM   881   O O   . LEU A 1 115 ? 37.362  -5.747  61.367  1.00 18.53 ? 343  LEU A O   1 
ATOM   882   C CB  . LEU A 1 115 ? 36.714  -4.723  64.507  1.00 18.98 ? 343  LEU A CB  1 
ATOM   883   C CG  . LEU A 1 115 ? 37.534  -5.982  64.826  1.00 19.53 ? 343  LEU A CG  1 
ATOM   884   C CD1 . LEU A 1 115 ? 39.004  -5.767  64.475  1.00 19.66 ? 343  LEU A CD1 1 
ATOM   885   C CD2 . LEU A 1 115 ? 37.359  -6.408  66.303  1.00 18.89 ? 343  LEU A CD2 1 
ATOM   886   N N   . ASP A 1 116 ? 35.193  -5.650  61.914  1.00 18.30 ? 344  ASP A N   1 
ATOM   887   C CA  . ASP A 1 116 ? 34.804  -6.615  60.877  1.00 18.27 ? 344  ASP A CA  1 
ATOM   888   C C   . ASP A 1 116 ? 35.119  -6.031  59.511  1.00 17.65 ? 344  ASP A C   1 
ATOM   889   O O   . ASP A 1 116 ? 35.800  -6.645  58.705  1.00 17.96 ? 344  ASP A O   1 
ATOM   890   C CB  . ASP A 1 116 ? 33.310  -6.937  60.917  1.00 18.45 ? 344  ASP A CB  1 
ATOM   891   C CG  . ASP A 1 116 ? 32.944  -7.912  62.000  1.00 19.70 ? 344  ASP A CG  1 
ATOM   892   O OD1 . ASP A 1 116 ? 33.648  -7.982  63.032  1.00 21.50 ? 344  ASP A OD1 1 
ATOM   893   O OD2 . ASP A 1 116 ? 31.919  -8.607  61.817  1.00 22.30 ? 344  ASP A OD2 1 
ATOM   894   N N   . LEU A 1 117 ? 34.619  -4.832  59.260  1.00 16.88 ? 345  LEU A N   1 
ATOM   895   C CA  . LEU A 1 117 ? 34.768  -4.220  57.947  1.00 16.33 ? 345  LEU A CA  1 
ATOM   896   C C   . LEU A 1 117 ? 36.232  -4.150  57.516  1.00 15.72 ? 345  LEU A C   1 
ATOM   897   O O   . LEU A 1 117 ? 36.581  -4.667  56.467  1.00 15.92 ? 345  LEU A O   1 
ATOM   898   C CB  . LEU A 1 117 ? 34.102  -2.836  57.901  1.00 16.26 ? 345  LEU A CB  1 
ATOM   899   C CG  . LEU A 1 117 ? 33.728  -2.280  56.524  1.00 16.23 ? 345  LEU A CG  1 
ATOM   900   C CD1 . LEU A 1 117 ? 32.878  -3.254  55.714  1.00 15.91 ? 345  LEU A CD1 1 
ATOM   901   C CD2 . LEU A 1 117 ? 32.996  -0.954  56.681  1.00 16.34 ? 345  LEU A CD2 1 
ATOM   902   N N   . ASN A 1 118 ? 37.089  -3.539  58.319  1.00 15.10 ? 346  ASN A N   1 
ATOM   903   C CA  . ASN A 1 118 ? 38.496  -3.454  57.953  1.00 14.87 ? 346  ASN A CA  1 
ATOM   904   C C   . ASN A 1 118 ? 39.209  -4.818  57.844  1.00 14.85 ? 346  ASN A C   1 
ATOM   905   O O   . ASN A 1 118 ? 40.078  -4.959  56.992  1.00 14.90 ? 346  ASN A O   1 
ATOM   906   C CB  . ASN A 1 118 ? 39.254  -2.512  58.899  1.00 14.90 ? 346  ASN A CB  1 
ATOM   907   C CG  . ASN A 1 118 ? 39.004  -1.036  58.594  1.00 14.69 ? 346  ASN A CG  1 
ATOM   908   O OD1 . ASN A 1 118 ? 38.378  -0.690  57.598  1.00 15.44 ? 346  ASN A OD1 1 
ATOM   909   N ND2 . ASN A 1 118 ? 39.516  -0.163  59.447  1.00 13.80 ? 346  ASN A ND2 1 
ATOM   910   N N   . ASN A 1 119 ? 38.852  -5.804  58.684  1.00 14.69 ? 347  ASN A N   1 
ATOM   911   C CA  . ASN A 1 119 ? 39.418  -7.182  58.595  1.00 14.72 ? 347  ASN A CA  1 
ATOM   912   C C   . ASN A 1 119 ? 39.177  -7.816  57.238  1.00 14.66 ? 347  ASN A C   1 
ATOM   913   O O   . ASN A 1 119 ? 40.030  -8.524  56.693  1.00 14.68 ? 347  ASN A O   1 
ATOM   914   C CB  . ASN A 1 119 ? 38.788  -8.127  59.625  1.00 14.69 ? 347  ASN A CB  1 
ATOM   915   C CG  . ASN A 1 119 ? 39.503  -8.116  60.963  1.00 15.29 ? 347  ASN A CG  1 
ATOM   916   O OD1 . ASN A 1 119 ? 40.308  -7.234  61.258  1.00 14.85 ? 347  ASN A OD1 1 
ATOM   917   N ND2 . ASN A 1 119 ? 39.193  -9.109  61.793  1.00 16.76 ? 347  ASN A ND2 1 
ATOM   918   N N   . ALA A 1 120 ? 37.977  -7.578  56.729  1.00 14.60 ? 348  ALA A N   1 
ATOM   919   C CA  . ALA A 1 120 ? 37.588  -7.995  55.400  1.00 14.70 ? 348  ALA A CA  1 
ATOM   920   C C   . ALA A 1 120 ? 38.431  -7.277  54.335  1.00 14.93 ? 348  ALA A C   1 
ATOM   921   O O   . ALA A 1 120 ? 38.841  -7.901  53.342  1.00 14.68 ? 348  ALA A O   1 
ATOM   922   C CB  . ALA A 1 120 ? 36.088  -7.724  55.191  1.00 14.45 ? 348  ALA A CB  1 
ATOM   923   N N   . ILE A 1 121 ? 38.692  -5.978  54.553  1.00 14.92 ? 349  ILE A N   1 
ATOM   924   C CA  . ILE A 1 121 ? 39.511  -5.195  53.634  1.00 14.98 ? 349  ILE A CA  1 
ATOM   925   C C   . ILE A 1 121 ? 40.965  -5.651  53.707  1.00 15.13 ? 349  ILE A C   1 
ATOM   926   O O   . ILE A 1 121 ? 41.679  -5.619  52.706  1.00 14.90 ? 349  ILE A O   1 
ATOM   927   C CB  . ILE A 1 121 ? 39.438  -3.690  53.909  1.00 15.02 ? 349  ILE A CB  1 
ATOM   928   C CG1 . ILE A 1 121 ? 38.025  -3.166  53.677  1.00 15.20 ? 349  ILE A CG1 1 
ATOM   929   C CG2 . ILE A 1 121 ? 40.413  -2.910  52.997  1.00 14.32 ? 349  ILE A CG2 1 
ATOM   930   C CD1 . ILE A 1 121 ? 37.826  -1.736  54.213  1.00 15.27 ? 349  ILE A CD1 1 
ATOM   931   N N   . LEU A 1 122 ? 41.394  -6.084  54.888  1.00 15.31 ? 350  LEU A N   1 
ATOM   932   C CA  . LEU A 1 122 ? 42.745  -6.596  55.051  1.00 15.78 ? 350  LEU A CA  1 
ATOM   933   C C   . LEU A 1 122 ? 42.892  -7.935  54.341  1.00 16.18 ? 350  LEU A C   1 
ATOM   934   O O   . LEU A 1 122 ? 44.009  -8.311  53.962  1.00 16.11 ? 350  LEU A O   1 
ATOM   935   C CB  . LEU A 1 122 ? 43.105  -6.736  56.526  1.00 15.95 ? 350  LEU A CB  1 
ATOM   936   C CG  . LEU A 1 122 ? 43.442  -5.430  57.257  1.00 16.44 ? 350  LEU A CG  1 
ATOM   937   C CD1 . LEU A 1 122 ? 43.365  -5.630  58.775  1.00 16.54 ? 350  LEU A CD1 1 
ATOM   938   C CD2 . LEU A 1 122 ? 44.814  -4.919  56.847  1.00 15.93 ? 350  LEU A CD2 1 
ATOM   939   N N   . GLN A 1 123 ? 41.769  -8.641  54.160  1.00 16.41 ? 351  GLN A N   1 
ATOM   940   C CA  . GLN A 1 123 ? 41.761  -9.917  53.437  1.00 16.68 ? 351  GLN A CA  1 
ATOM   941   C C   . GLN A 1 123 ? 42.120  -9.690  51.979  1.00 16.44 ? 351  GLN A C   1 
ATOM   942   O O   . GLN A 1 123 ? 42.916  -10.436 51.421  1.00 16.64 ? 351  GLN A O   1 
ATOM   943   C CB  . GLN A 1 123 ? 40.406  -10.636 53.551  1.00 16.93 ? 351  GLN A CB  1 
ATOM   944   C CG  . GLN A 1 123 ? 40.507  -12.175 53.404  1.00 17.69 ? 351  GLN A CG  1 
ATOM   945   C CD  . GLN A 1 123 ? 39.154  -12.895 53.432  1.00 17.37 ? 351  GLN A CD  1 
ATOM   946   O OE1 . GLN A 1 123 ? 38.182  -12.385 53.972  1.00 19.03 ? 351  GLN A OE1 1 
ATOM   947   N NE2 . GLN A 1 123 ? 39.100  -14.089 52.845  1.00 18.13 ? 351  GLN A NE2 1 
ATOM   948   N N   . LEU A 1 124 ? 41.547  -8.646  51.380  1.00 16.43 ? 352  LEU A N   1 
ATOM   949   C CA  . LEU A 1 124 ? 41.931  -8.194  50.022  1.00 16.34 ? 352  LEU A CA  1 
ATOM   950   C C   . LEU A 1 124 ? 43.375  -7.746  49.929  1.00 15.91 ? 352  LEU A C   1 
ATOM   951   O O   . LEU A 1 124 ? 44.029  -7.968  48.916  1.00 15.55 ? 352  LEU A O   1 
ATOM   952   C CB  . LEU A 1 124 ? 41.072  -7.011  49.580  1.00 16.60 ? 352  LEU A CB  1 
ATOM   953   C CG  . LEU A 1 124 ? 39.668  -7.379  49.140  1.00 16.95 ? 352  LEU A CG  1 
ATOM   954   C CD1 . LEU A 1 124 ? 38.734  -6.193  49.308  1.00 17.24 ? 352  LEU A CD1 1 
ATOM   955   C CD2 . LEU A 1 124 ? 39.727  -7.872  47.703  1.00 17.43 ? 352  LEU A CD2 1 
ATOM   956   N N   . VAL A 1 125 ? 43.849  -7.076  50.975  1.00 15.86 ? 353  VAL A N   1 
ATOM   957   C CA  . VAL A 1 125 ? 45.235  -6.634  51.026  1.00 15.95 ? 353  VAL A CA  1 
ATOM   958   C C   . VAL A 1 125 ? 46.180  -7.836  51.079  1.00 16.25 ? 353  VAL A C   1 
ATOM   959   O O   . VAL A 1 125 ? 47.198  -7.849  50.397  1.00 16.20 ? 353  VAL A O   1 
ATOM   960   C CB  . VAL A 1 125 ? 45.511  -5.684  52.221  1.00 15.83 ? 353  VAL A CB  1 
ATOM   961   C CG1 . VAL A 1 125 ? 47.000  -5.636  52.523  1.00 15.97 ? 353  VAL A CG1 1 
ATOM   962   C CG2 . VAL A 1 125 ? 44.992  -4.275  51.927  1.00 14.50 ? 353  VAL A CG2 1 
ATOM   963   N N   . LYS A 1 126 ? 45.827  -8.856  51.859  1.00 16.57 ? 354  LYS A N   1 
ATOM   964   C CA  . LYS A 1 126 ? 46.709  -9.999  52.039  1.00 16.68 ? 354  LYS A CA  1 
ATOM   965   C C   . LYS A 1 126 ? 46.898  -10.697 50.732  1.00 16.61 ? 354  LYS A C   1 
ATOM   966   O O   . LYS A 1 126 ? 48.016  -11.066 50.393  1.00 16.70 ? 354  LYS A O   1 
ATOM   967   C CB  . LYS A 1 126 ? 46.152  -10.975 53.069  1.00 16.92 ? 354  LYS A CB  1 
ATOM   968   C CG  . LYS A 1 126 ? 47.048  -12.191 53.352  1.00 17.41 ? 354  LYS A CG  1 
ATOM   969   C CD  . LYS A 1 126 ? 46.354  -13.149 54.320  1.00 17.38 ? 354  LYS A CD  1 
ATOM   970   C CE  . LYS A 1 126 ? 46.827  -14.602 54.180  1.00 18.40 ? 354  LYS A CE  1 
ATOM   971   N NZ  . LYS A 1 126 ? 47.638  -15.092 55.334  1.00 18.23 ? 354  LYS A NZ  1 
ATOM   972   N N   . LYS A 1 127 ? 45.808  -10.874 49.992  1.00 16.77 ? 355  LYS A N   1 
ATOM   973   C CA  . LYS A 1 127 ? 45.862  -11.628 48.736  1.00 17.34 ? 355  LYS A CA  1 
ATOM   974   C C   . LYS A 1 127 ? 46.726  -10.898 47.695  1.00 16.84 ? 355  LYS A C   1 
ATOM   975   O O   . LYS A 1 127 ? 47.717  -11.456 47.214  1.00 16.82 ? 355  LYS A O   1 
ATOM   976   C CB  . LYS A 1 127 ? 44.451  -11.947 48.195  1.00 17.30 ? 355  LYS A CB  1 
ATOM   977   C CG  . LYS A 1 127 ? 44.350  -13.350 47.565  1.00 19.05 ? 355  LYS A CG  1 
ATOM   978   C CD  . LYS A 1 127 ? 43.180  -13.516 46.573  1.00 19.63 ? 355  LYS A CD  1 
ATOM   979   C CE  . LYS A 1 127 ? 41.853  -13.991 47.234  1.00 21.98 ? 355  LYS A CE  1 
ATOM   980   N NZ  . LYS A 1 127 ? 40.626  -13.788 46.343  1.00 21.74 ? 355  LYS A NZ  1 
ATOM   981   N N   . TYR A 1 128 ? 46.380  -9.650  47.371  1.00 16.53 ? 356  TYR A N   1 
ATOM   982   C CA  . TYR A 1 128 ? 47.190  -8.875  46.429  1.00 16.41 ? 356  TYR A CA  1 
ATOM   983   C C   . TYR A 1 128 ? 48.659  -8.734  46.880  1.00 16.66 ? 356  TYR A C   1 
ATOM   984   O O   . TYR A 1 128 ? 49.570  -8.718  46.046  1.00 16.99 ? 356  TYR A O   1 
ATOM   985   C CB  . TYR A 1 128 ? 46.597  -7.496  46.161  1.00 16.10 ? 356  TYR A CB  1 
ATOM   986   C CG  . TYR A 1 128 ? 45.290  -7.499  45.403  1.00 15.86 ? 356  TYR A CG  1 
ATOM   987   C CD1 . TYR A 1 128 ? 45.148  -8.170  44.183  1.00 15.95 ? 356  TYR A CD1 1 
ATOM   988   C CD2 . TYR A 1 128 ? 44.196  -6.787  45.884  1.00 16.01 ? 356  TYR A CD2 1 
ATOM   989   C CE1 . TYR A 1 128 ? 43.919  -8.160  43.489  1.00 14.94 ? 356  TYR A CE1 1 
ATOM   990   C CE2 . TYR A 1 128 ? 42.986  -6.759  45.201  1.00 15.67 ? 356  TYR A CE2 1 
ATOM   991   C CZ  . TYR A 1 128 ? 42.852  -7.447  44.018  1.00 15.52 ? 356  TYR A CZ  1 
ATOM   992   O OH  . TYR A 1 128 ? 41.645  -7.384  43.382  1.00 16.11 ? 356  TYR A OH  1 
ATOM   993   N N   . LYS A 1 129 ? 48.904  -8.642  48.182  1.00 16.79 ? 357  LYS A N   1 
ATOM   994   C CA  . LYS A 1 129 ? 50.281  -8.687  48.675  1.00 16.90 ? 357  LYS A CA  1 
ATOM   995   C C   . LYS A 1 129 ? 50.968  -9.944  48.123  1.00 17.18 ? 357  LYS A C   1 
ATOM   996   O O   . LYS A 1 129 ? 52.080  -9.858  47.606  1.00 17.09 ? 357  LYS A O   1 
ATOM   997   C CB  . LYS A 1 129 ? 50.339  -8.730  50.205  1.00 16.87 ? 357  LYS A CB  1 
ATOM   998   C CG  . LYS A 1 129 ? 50.355  -7.409  50.950  1.00 16.57 ? 357  LYS A CG  1 
ATOM   999   C CD  . LYS A 1 129 ? 50.652  -7.717  52.422  1.00 16.82 ? 357  LYS A CD  1 
ATOM   1000  C CE  . LYS A 1 129 ? 50.343  -6.572  53.359  1.00 17.42 ? 357  LYS A CE  1 
ATOM   1001  N NZ  . LYS A 1 129 ? 50.450  -6.970  54.811  1.00 17.90 ? 357  LYS A NZ  1 
ATOM   1002  N N   . SER A 1 130 ? 50.299  -11.098 48.230  1.00 17.32 ? 358  SER A N   1 
ATOM   1003  C CA  . SER A 1 130 ? 50.862  -12.375 47.765  1.00 17.57 ? 358  SER A CA  1 
ATOM   1004  C C   . SER A 1 130 ? 51.295  -12.289 46.321  1.00 17.74 ? 358  SER A C   1 
ATOM   1005  O O   . SER A 1 130 ? 52.400  -12.692 45.979  1.00 17.59 ? 358  SER A O   1 
ATOM   1006  C CB  . SER A 1 130 ? 49.851  -13.507 47.878  1.00 17.44 ? 358  SER A CB  1 
ATOM   1007  O OG  . SER A 1 130 ? 48.957  -13.259 48.936  1.00 18.49 ? 358  SER A OG  1 
ATOM   1008  N N   . MET A 1 131 ? 50.423  -11.745 45.481  1.00 17.92 ? 359  MET A N   1 
ATOM   1009  C CA  . MET A 1 131 ? 50.688  -11.678 44.050  1.00 18.54 ? 359  MET A CA  1 
ATOM   1010  C C   . MET A 1 131 ? 51.663  -10.569 43.673  1.00 17.90 ? 359  MET A C   1 
ATOM   1011  O O   . MET A 1 131 ? 52.174  -10.540 42.556  1.00 17.48 ? 359  MET A O   1 
ATOM   1012  C CB  . MET A 1 131 ? 49.388  -11.464 43.297  1.00 18.68 ? 359  MET A CB  1 
ATOM   1013  C CG  . MET A 1 131 ? 48.382  -12.574 43.506  1.00 19.65 ? 359  MET A CG  1 
ATOM   1014  S SD  . MET A 1 131 ? 46.725  -11.970 43.198  1.00 21.21 ? 359  MET A SD  1 
ATOM   1015  C CE  . MET A 1 131 ? 46.898  -11.446 41.488  1.00 21.43 ? 359  MET A CE  1 
ATOM   1016  N N   . LYS A 1 132 ? 51.920  -9.665  44.613  1.00 17.60 ? 360  LYS A N   1 
ATOM   1017  C CA  . LYS A 1 132 ? 52.786  -8.519  44.386  1.00 17.36 ? 360  LYS A CA  1 
ATOM   1018  C C   . LYS A 1 132 ? 52.111  -7.659  43.348  1.00 16.89 ? 360  LYS A C   1 
ATOM   1019  O O   . LYS A 1 132 ? 52.703  -7.356  42.314  1.00 17.30 ? 360  LYS A O   1 
ATOM   1020  C CB  . LYS A 1 132 ? 54.206  -8.918  43.920  1.00 17.32 ? 360  LYS A CB  1 
ATOM   1021  C CG  . LYS A 1 132 ? 55.071  -9.693  44.929  1.00 17.20 ? 360  LYS A CG  1 
ATOM   1022  C CD  . LYS A 1 132 ? 56.532  -9.766  44.428  1.00 17.77 ? 360  LYS A CD  1 
ATOM   1023  C CE  . LYS A 1 132 ? 57.382  -10.869 45.100  1.00 18.26 ? 360  LYS A CE  1 
ATOM   1024  N NZ  . LYS A 1 132 ? 57.808  -10.533 46.503  1.00 18.40 ? 360  LYS A NZ  1 
ATOM   1025  N N   . LEU A 1 133 ? 50.863  -7.291  43.615  1.00 16.21 ? 361  LEU A N   1 
ATOM   1026  C CA  . LEU A 1 133 ? 50.104  -6.466  42.692  1.00 16.06 ? 361  LEU A CA  1 
ATOM   1027  C C   . LEU A 1 133 ? 50.898  -5.196  42.347  1.00 16.23 ? 361  LEU A C   1 
ATOM   1028  O O   . LEU A 1 133 ? 51.538  -4.591  43.214  1.00 16.39 ? 361  LEU A O   1 
ATOM   1029  C CB  . LEU A 1 133 ? 48.729  -6.120  43.269  1.00 16.15 ? 361  LEU A CB  1 
ATOM   1030  C CG  . LEU A 1 133 ? 47.775  -5.239  42.458  1.00 15.85 ? 361  LEU A CG  1 
ATOM   1031  C CD1 . LEU A 1 133 ? 47.365  -5.951  41.199  1.00 15.38 ? 361  LEU A CD1 1 
ATOM   1032  C CD2 . LEU A 1 133 ? 46.543  -4.854  43.282  1.00 15.14 ? 361  LEU A CD2 1 
ATOM   1033  N N   . GLU A 1 134 ? 50.854  -4.836  41.064  1.00 16.14 ? 362  GLU A N   1 
ATOM   1034  C CA  . GLU A 1 134 ? 51.638  -3.764  40.471  1.00 16.09 ? 362  GLU A CA  1 
ATOM   1035  C C   . GLU A 1 134 ? 50.702  -2.664  40.010  1.00 15.99 ? 362  GLU A C   1 
ATOM   1036  O O   . GLU A 1 134 ? 49.579  -2.950  39.628  1.00 16.14 ? 362  GLU A O   1 
ATOM   1037  C CB  . GLU A 1 134 ? 52.369  -4.319  39.258  1.00 16.31 ? 362  GLU A CB  1 
ATOM   1038  C CG  . GLU A 1 134 ? 53.383  -5.400  39.605  1.00 17.02 ? 362  GLU A CG  1 
ATOM   1039  C CD  . GLU A 1 134 ? 53.907  -6.164  38.404  1.00 16.51 ? 362  GLU A CD  1 
ATOM   1040  O OE1 . GLU A 1 134 ? 53.402  -5.957  37.281  1.00 16.13 ? 362  GLU A OE1 1 
ATOM   1041  O OE2 . GLU A 1 134 ? 54.821  -6.993  38.603  1.00 16.98 ? 362  GLU A OE2 1 
ATOM   1042  N N   . LYS A 1 135 ? 51.154  -1.412  40.016  1.00 15.99 ? 363  LYS A N   1 
ATOM   1043  C CA  . LYS A 1 135 ? 50.245  -0.282  39.767  1.00 16.30 ? 363  LYS A CA  1 
ATOM   1044  C C   . LYS A 1 135 ? 49.442  -0.494  38.499  1.00 16.01 ? 363  LYS A C   1 
ATOM   1045  O O   . LYS A 1 135 ? 48.213  -0.413  38.502  1.00 15.95 ? 363  LYS A O   1 
ATOM   1046  C CB  . LYS A 1 135 ? 51.012  1.029   39.649  1.00 16.36 ? 363  LYS A CB  1 
ATOM   1047  C CG  . LYS A 1 135 ? 50.124  2.265   39.680  1.00 16.67 ? 363  LYS A CG  1 
ATOM   1048  C CD  . LYS A 1 135 ? 50.957  3.536   39.930  1.00 17.78 ? 363  LYS A CD  1 
ATOM   1049  C CE  . LYS A 1 135 ? 50.115  4.715   40.451  1.00 19.70 ? 363  LYS A CE  1 
ATOM   1050  N NZ  . LYS A 1 135 ? 50.717  5.375   41.673  1.00 20.07 ? 363  LYS A NZ  1 
ATOM   1051  N N   . GLU A 1 136 ? 50.163  -0.787  37.424  1.00 15.77 ? 364  GLU A N   1 
ATOM   1052  C CA  . GLU A 1 136 ? 49.583  -1.085  36.120  1.00 15.56 ? 364  GLU A CA  1 
ATOM   1053  C C   . GLU A 1 136 ? 48.347  -1.985  36.256  1.00 15.78 ? 364  GLU A C   1 
ATOM   1054  O O   . GLU A 1 136 ? 47.342  -1.811  35.558  1.00 15.78 ? 364  GLU A O   1 
ATOM   1055  C CB  . GLU A 1 136 ? 50.630  -1.786  35.240  1.00 15.51 ? 364  GLU A CB  1 
ATOM   1056  C CG  . GLU A 1 136 ? 51.814  -0.924  34.788  1.00 14.98 ? 364  GLU A CG  1 
ATOM   1057  C CD  . GLU A 1 136 ? 52.938  -0.822  35.810  1.00 15.10 ? 364  GLU A CD  1 
ATOM   1058  O OE1 . GLU A 1 136 ? 52.706  -1.076  37.009  1.00 15.55 ? 364  GLU A OE1 1 
ATOM   1059  O OE2 . GLU A 1 136 ? 54.068  -0.467  35.418  1.00 16.21 ? 364  GLU A OE2 1 
ATOM   1060  N N   . GLU A 1 137 ? 48.438  -2.944  37.172  1.00 15.99 ? 365  GLU A N   1 
ATOM   1061  C CA  . GLU A 1 137 ? 47.397  -3.942  37.387  1.00 16.07 ? 365  GLU A CA  1 
ATOM   1062  C C   . GLU A 1 137 ? 46.236  -3.366  38.204  1.00 16.09 ? 365  GLU A C   1 
ATOM   1063  O O   . GLU A 1 137 ? 45.061  -3.584  37.864  1.00 16.19 ? 365  GLU A O   1 
ATOM   1064  C CB  . GLU A 1 137 ? 48.004  -5.159  38.079  1.00 16.07 ? 365  GLU A CB  1 
ATOM   1065  C CG  . GLU A 1 137 ? 49.202  -5.732  37.326  1.00 16.54 ? 365  GLU A CG  1 
ATOM   1066  C CD  . GLU A 1 137 ? 49.883  -6.868  38.060  1.00 16.63 ? 365  GLU A CD  1 
ATOM   1067  O OE1 . GLU A 1 137 ? 50.054  -6.788  39.294  1.00 15.76 ? 365  GLU A OE1 1 
ATOM   1068  O OE2 . GLU A 1 137 ? 50.272  -7.838  37.387  1.00 18.60 ? 365  GLU A OE2 1 
ATOM   1069  N N   . PHE A 1 138 ? 46.572  -2.626  39.268  1.00 15.87 ? 366  PHE A N   1 
ATOM   1070  C CA  . PHE A 1 138 ? 45.577  -1.917  40.103  1.00 15.72 ? 366  PHE A CA  1 
ATOM   1071  C C   . PHE A 1 138 ? 44.614  -1.033  39.297  1.00 15.39 ? 366  PHE A C   1 
ATOM   1072  O O   . PHE A 1 138 ? 43.379  -1.155  39.461  1.00 15.16 ? 366  PHE A O   1 
ATOM   1073  C CB  . PHE A 1 138 ? 46.293  -1.059  41.157  1.00 16.13 ? 366  PHE A CB  1 
ATOM   1074  C CG  . PHE A 1 138 ? 45.421  0.014   41.794  1.00 16.63 ? 366  PHE A CG  1 
ATOM   1075  C CD1 . PHE A 1 138 ? 44.355  -0.326  42.629  1.00 17.31 ? 366  PHE A CD1 1 
ATOM   1076  C CD2 . PHE A 1 138 ? 45.701  1.364   41.592  1.00 16.52 ? 366  PHE A CD2 1 
ATOM   1077  C CE1 . PHE A 1 138 ? 43.575  0.661   43.237  1.00 16.93 ? 366  PHE A CE1 1 
ATOM   1078  C CE2 . PHE A 1 138 ? 44.925  2.352   42.190  1.00 17.11 ? 366  PHE A CE2 1 
ATOM   1079  C CZ  . PHE A 1 138 ? 43.860  1.998   43.011  1.00 17.29 ? 366  PHE A CZ  1 
ATOM   1080  N N   . VAL A 1 139 ? 45.197  -0.157  38.449  1.00 14.68 ? 367  VAL A N   1 
ATOM   1081  C CA  . VAL A 1 139 ? 44.460  0.856   37.679  1.00 13.80 ? 367  VAL A CA  1 
ATOM   1082  C C   . VAL A 1 139 ? 43.612  0.189   36.615  1.00 13.65 ? 367  VAL A C   1 
ATOM   1083  O O   . VAL A 1 139 ? 42.487  0.621   36.344  1.00 13.88 ? 367  VAL A O   1 
ATOM   1084  C CB  . VAL A 1 139 ? 45.386  1.922   37.020  1.00 13.62 ? 367  VAL A CB  1 
ATOM   1085  C CG1 . VAL A 1 139 ? 46.104  2.742   38.059  1.00 12.52 ? 367  VAL A CG1 1 
ATOM   1086  C CG2 . VAL A 1 139 ? 46.390  1.285   36.077  1.00 14.00 ? 367  VAL A CG2 1 
ATOM   1087  N N   . THR A 1 140 ? 44.146  -0.877  36.028  1.00 13.55 ? 368  THR A N   1 
ATOM   1088  C CA  . THR A 1 140 ? 43.408  -1.656  35.037  1.00 13.54 ? 368  THR A CA  1 
ATOM   1089  C C   . THR A 1 140 ? 42.277  -2.403  35.750  1.00 13.96 ? 368  THR A C   1 
ATOM   1090  O O   . THR A 1 140 ? 41.156  -2.447  35.244  1.00 14.24 ? 368  THR A O   1 
ATOM   1091  C CB  . THR A 1 140 ? 44.331  -2.651  34.251  1.00 13.40 ? 368  THR A CB  1 
ATOM   1092  O OG1 . THR A 1 140 ? 45.463  -1.949  33.726  1.00 12.82 ? 368  THR A OG1 1 
ATOM   1093  C CG2 . THR A 1 140 ? 43.592  -3.311  33.099  1.00 12.22 ? 368  THR A CG2 1 
ATOM   1094  N N   . LEU A 1 141 ? 42.559  -2.958  36.934  1.00 14.23 ? 369  LEU A N   1 
ATOM   1095  C CA  . LEU A 1 141 ? 41.523  -3.664  37.720  1.00 14.42 ? 369  LEU A CA  1 
ATOM   1096  C C   . LEU A 1 141 ? 40.375  -2.734  38.159  1.00 14.22 ? 369  LEU A C   1 
ATOM   1097  O O   . LEU A 1 141 ? 39.208  -3.130  38.098  1.00 13.96 ? 369  LEU A O   1 
ATOM   1098  C CB  . LEU A 1 141 ? 42.126  -4.412  38.929  1.00 14.49 ? 369  LEU A CB  1 
ATOM   1099  C CG  . LEU A 1 141 ? 42.573  -5.851  38.620  1.00 15.34 ? 369  LEU A CG  1 
ATOM   1100  C CD1 . LEU A 1 141 ? 43.539  -6.414  39.671  1.00 16.73 ? 369  LEU A CD1 1 
ATOM   1101  C CD2 . LEU A 1 141 ? 41.371  -6.774  38.479  1.00 15.33 ? 369  LEU A CD2 1 
ATOM   1102  N N   . LYS A 1 142 ? 40.714  -1.514  38.591  1.00 13.82 ? 370  LYS A N   1 
ATOM   1103  C CA  . LYS A 1 142 ? 39.715  -0.492  38.882  1.00 13.84 ? 370  LYS A CA  1 
ATOM   1104  C C   . LYS A 1 142 ? 38.774  -0.260  37.690  1.00 13.59 ? 370  LYS A C   1 
ATOM   1105  O O   . LYS A 1 142 ? 37.530  -0.170  37.843  1.00 12.97 ? 370  LYS A O   1 
ATOM   1106  C CB  . LYS A 1 142 ? 40.394  0.831   39.233  1.00 14.08 ? 370  LYS A CB  1 
ATOM   1107  C CG  . LYS A 1 142 ? 40.831  0.957   40.698  1.00 14.65 ? 370  LYS A CG  1 
ATOM   1108  C CD  . LYS A 1 142 ? 40.990  2.423   41.109  1.00 14.33 ? 370  LYS A CD  1 
ATOM   1109  C CE  . LYS A 1 142 ? 41.990  3.170   40.230  1.00 14.38 ? 370  LYS A CE  1 
ATOM   1110  N NZ  . LYS A 1 142 ? 41.876  4.641   40.403  1.00 15.13 ? 370  LYS A NZ  1 
ATOM   1111  N N   . ALA A 1 143 ? 39.377  -0.149  36.505  1.00 13.21 ? 371  ALA A N   1 
ATOM   1112  C CA  . ALA A 1 143 ? 38.607  0.083   35.285  1.00 13.22 ? 371  ALA A CA  1 
ATOM   1113  C C   . ALA A 1 143 ? 37.647  -1.073  35.063  1.00 13.05 ? 371  ALA A C   1 
ATOM   1114  O O   . ALA A 1 143 ? 36.468  -0.874  34.809  1.00 12.90 ? 371  ALA A O   1 
ATOM   1115  C CB  . ALA A 1 143 ? 39.526  0.251   34.092  1.00 13.27 ? 371  ALA A CB  1 
ATOM   1116  N N   . ILE A 1 144 ? 38.158  -2.290  35.204  1.00 13.16 ? 372  ILE A N   1 
ATOM   1117  C CA  . ILE A 1 144 ? 37.337  -3.489  35.010  1.00 12.86 ? 372  ILE A CA  1 
ATOM   1118  C C   . ILE A 1 144 ? 36.256  -3.610  36.095  1.00 12.53 ? 372  ILE A C   1 
ATOM   1119  O O   . ILE A 1 144 ? 35.131  -3.972  35.794  1.00 12.67 ? 372  ILE A O   1 
ATOM   1120  C CB  . ILE A 1 144 ? 38.182  -4.785  34.953  1.00 12.76 ? 372  ILE A CB  1 
ATOM   1121  C CG1 . ILE A 1 144 ? 39.220  -4.718  33.814  1.00 12.92 ? 372  ILE A CG1 1 
ATOM   1122  C CG2 . ILE A 1 144 ? 37.265  -5.972  34.750  1.00 12.38 ? 372  ILE A CG2 1 
ATOM   1123  C CD1 . ILE A 1 144 ? 40.451  -5.630  34.019  1.00 12.49 ? 372  ILE A CD1 1 
ATOM   1124  N N   . ALA A 1 145 ? 36.576  -3.303  37.344  1.00 12.26 ? 373  ALA A N   1 
ATOM   1125  C CA  . ALA A 1 145 ? 35.552  -3.345  38.380  1.00 12.48 ? 373  ALA A CA  1 
ATOM   1126  C C   . ALA A 1 145 ? 34.362  -2.475  37.932  1.00 12.81 ? 373  ALA A C   1 
ATOM   1127  O O   . ALA A 1 145 ? 33.194  -2.895  37.993  1.00 13.14 ? 373  ALA A O   1 
ATOM   1128  C CB  . ALA A 1 145 ? 36.108  -2.873  39.711  1.00 12.07 ? 373  ALA A CB  1 
ATOM   1129  N N   . LEU A 1 146 ? 34.669  -1.273  37.449  1.00 12.80 ? 374  LEU A N   1 
ATOM   1130  C CA  . LEU A 1 146 ? 33.648  -0.380  36.930  1.00 12.49 ? 374  LEU A CA  1 
ATOM   1131  C C   . LEU A 1 146 ? 32.917  -1.036  35.771  1.00 12.76 ? 374  LEU A C   1 
ATOM   1132  O O   . LEU A 1 146 ? 31.731  -1.299  35.883  1.00 13.38 ? 374  LEU A O   1 
ATOM   1133  C CB  . LEU A 1 146 ? 34.269  0.939   36.503  1.00 12.40 ? 374  LEU A CB  1 
ATOM   1134  C CG  . LEU A 1 146 ? 33.379  2.012   35.892  1.00 12.10 ? 374  LEU A CG  1 
ATOM   1135  C CD1 . LEU A 1 146 ? 32.350  2.511   36.866  1.00 11.23 ? 374  LEU A CD1 1 
ATOM   1136  C CD2 . LEU A 1 146 ? 34.265  3.160   35.404  1.00 12.36 ? 374  LEU A CD2 1 
ATOM   1137  N N   . ALA A 1 147 ? 33.614  -1.335  34.675  1.00 12.75 ? 375  ALA A N   1 
ATOM   1138  C CA  . ALA A 1 147 ? 32.968  -1.948  33.508  1.00 12.84 ? 375  ALA A CA  1 
ATOM   1139  C C   . ALA A 1 147 ? 32.118  -3.147  33.911  1.00 13.48 ? 375  ALA A C   1 
ATOM   1140  O O   . ALA A 1 147 ? 30.936  -3.244  33.553  1.00 13.94 ? 375  ALA A O   1 
ATOM   1141  C CB  . ALA A 1 147 ? 33.985  -2.361  32.501  1.00 12.39 ? 375  ALA A CB  1 
ATOM   1142  N N   . ASN A 1 148 ? 32.710  -4.025  34.717  1.00 14.14 ? 376  ASN A N   1 
ATOM   1143  C CA  . ASN A 1 148 ? 32.111  -5.321  35.093  1.00 14.51 ? 376  ASN A CA  1 
ATOM   1144  C C   . ASN A 1 148 ? 31.098  -5.267  36.278  1.00 14.66 ? 376  ASN A C   1 
ATOM   1145  O O   . ASN A 1 148 ? 30.860  -6.292  36.924  1.00 14.34 ? 376  ASN A O   1 
ATOM   1146  C CB  . ASN A 1 148 ? 33.259  -6.299  35.407  1.00 14.25 ? 376  ASN A CB  1 
ATOM   1147  C CG  . ASN A 1 148 ? 32.809  -7.733  35.489  1.00 14.77 ? 376  ASN A CG  1 
ATOM   1148  O OD1 . ASN A 1 148 ? 31.897  -8.142  34.777  1.00 18.62 ? 376  ASN A OD1 1 
ATOM   1149  N ND2 . ASN A 1 148 ? 33.449  -8.514  36.359  1.00 12.56 ? 376  ASN A ND2 1 
ATOM   1150  N N   . SER A 1 149 ? 30.471  -4.103  36.516  1.00 14.82 ? 377  SER A N   1 
ATOM   1151  C CA  . SER A 1 149 ? 29.717  -3.836  37.774  1.00 14.98 ? 377  SER A CA  1 
ATOM   1152  C C   . SER A 1 149 ? 28.269  -4.392  37.892  1.00 14.89 ? 377  SER A C   1 
ATOM   1153  O O   . SER A 1 149 ? 27.604  -4.180  38.889  1.00 14.13 ? 377  SER A O   1 
ATOM   1154  C CB  . SER A 1 149 ? 29.738  -2.323  38.091  1.00 15.09 ? 377  SER A CB  1 
ATOM   1155  O OG  . SER A 1 149 ? 28.942  -1.546  37.189  1.00 15.42 ? 377  SER A OG  1 
ATOM   1156  N N   . ASP A 1 150 ? 27.806  -5.104  36.876  1.00 15.59 ? 378  ASP A N   1 
ATOM   1157  C CA  . ASP A 1 150 ? 26.557  -5.881  36.931  1.00 16.39 ? 378  ASP A CA  1 
ATOM   1158  C C   . ASP A 1 150 ? 25.289  -5.112  37.362  1.00 17.16 ? 378  ASP A C   1 
ATOM   1159  O O   . ASP A 1 150 ? 24.385  -5.662  38.032  1.00 17.28 ? 378  ASP A O   1 
ATOM   1160  C CB  . ASP A 1 150 ? 26.753  -7.128  37.804  1.00 16.41 ? 378  ASP A CB  1 
ATOM   1161  C CG  . ASP A 1 150 ? 27.627  -8.174  37.149  1.00 16.38 ? 378  ASP A CG  1 
ATOM   1162  O OD1 . ASP A 1 150 ? 27.537  -8.378  35.920  1.00 16.81 ? 378  ASP A OD1 1 
ATOM   1163  O OD2 . ASP A 1 150 ? 28.403  -8.816  37.873  1.00 17.59 ? 378  ASP A OD2 1 
ATOM   1164  N N   . SER A 1 151 ? 25.221  -3.848  36.954  1.00 17.71 ? 379  SER A N   1 
ATOM   1165  C CA  . SER A 1 151 ? 24.044  -3.030  37.164  1.00 17.91 ? 379  SER A CA  1 
ATOM   1166  C C   . SER A 1 151 ? 22.854  -3.667  36.475  1.00 18.37 ? 379  SER A C   1 
ATOM   1167  O O   . SER A 1 151 ? 22.948  -4.045  35.319  1.00 18.74 ? 379  SER A O   1 
ATOM   1168  C CB  . SER A 1 151 ? 24.287  -1.638  36.589  1.00 17.96 ? 379  SER A CB  1 
ATOM   1169  O OG  . SER A 1 151 ? 23.094  -0.880  36.542  1.00 18.32 ? 379  SER A OG  1 
ATOM   1170  N N   . MET A 1 152 ? 21.723  -3.743  37.167  1.00 18.97 ? 380  MET A N   1 
ATOM   1171  C CA  . MET A 1 152 ? 20.521  -4.378  36.619  1.00 19.70 ? 380  MET A CA  1 
ATOM   1172  C C   . MET A 1 152 ? 19.801  -3.437  35.657  1.00 19.15 ? 380  MET A C   1 
ATOM   1173  O O   . MET A 1 152 ? 18.745  -3.781  35.134  1.00 19.12 ? 380  MET A O   1 
ATOM   1174  C CB  . MET A 1 152 ? 19.527  -4.783  37.724  1.00 19.78 ? 380  MET A CB  1 
ATOM   1175  C CG  . MET A 1 152 ? 20.054  -4.774  39.164  1.00 20.93 ? 380  MET A CG  1 
ATOM   1176  S SD  . MET A 1 152 ? 18.716  -4.679  40.380  1.00 22.78 ? 380  MET A SD  1 
ATOM   1177  C CE  . MET A 1 152 ? 19.273  -3.331  41.460  1.00 21.70 ? 380  MET A CE  1 
ATOM   1178  N N   . HIS A 1 153 ? 20.372  -2.258  35.420  1.00 18.84 ? 381  HIS A N   1 
ATOM   1179  C CA  . HIS A 1 153 ? 19.661  -1.159  34.767  1.00 18.46 ? 381  HIS A CA  1 
ATOM   1180  C C   . HIS A 1 153 ? 20.341  -0.620  33.502  1.00 18.10 ? 381  HIS A C   1 
ATOM   1181  O O   . HIS A 1 153 ? 20.129  0.532   33.142  1.00 17.88 ? 381  HIS A O   1 
ATOM   1182  C CB  . HIS A 1 153 ? 19.495  -0.025  35.780  1.00 18.31 ? 381  HIS A CB  1 
ATOM   1183  C CG  . HIS A 1 153 ? 18.870  -0.459  37.070  1.00 18.35 ? 381  HIS A CG  1 
ATOM   1184  N ND1 . HIS A 1 153 ? 17.583  -0.951  37.146  1.00 17.25 ? 381  HIS A ND1 1 
ATOM   1185  C CD2 . HIS A 1 153 ? 19.354  -0.475  38.336  1.00 18.06 ? 381  HIS A CD2 1 
ATOM   1186  C CE1 . HIS A 1 153 ? 17.304  -1.249  38.403  1.00 17.52 ? 381  HIS A CE1 1 
ATOM   1187  N NE2 . HIS A 1 153 ? 18.359  -0.966  39.146  1.00 17.15 ? 381  HIS A NE2 1 
ATOM   1188  N N   . ILE A 1 154 ? 21.132  -1.451  32.824  1.00 17.90 ? 382  ILE A N   1 
ATOM   1189  C CA  . ILE A 1 154 ? 21.899  -1.014  31.651  1.00 17.64 ? 382  ILE A CA  1 
ATOM   1190  C C   . ILE A 1 154 ? 21.009  -0.869  30.417  1.00 17.53 ? 382  ILE A C   1 
ATOM   1191  O O   . ILE A 1 154 ? 20.136  -1.705  30.173  1.00 17.61 ? 382  ILE A O   1 
ATOM   1192  C CB  . ILE A 1 154 ? 23.048  -2.000  31.333  1.00 17.64 ? 382  ILE A CB  1 
ATOM   1193  C CG1 . ILE A 1 154 ? 24.032  -2.074  32.506  1.00 18.22 ? 382  ILE A CG1 1 
ATOM   1194  C CG2 . ILE A 1 154 ? 23.792  -1.600  30.073  1.00 16.96 ? 382  ILE A CG2 1 
ATOM   1195  C CD1 . ILE A 1 154 ? 24.629  -0.723  32.920  1.00 18.81 ? 382  ILE A CD1 1 
ATOM   1196  N N   . GLU A 1 155 ? 21.230  0.208   29.661  1.00 17.30 ? 383  GLU A N   1 
ATOM   1197  C CA  . GLU A 1 155 ? 20.569  0.433   28.369  1.00 17.10 ? 383  GLU A CA  1 
ATOM   1198  C C   . GLU A 1 155 ? 21.256  -0.367  27.264  1.00 16.95 ? 383  GLU A C   1 
ATOM   1199  O O   . GLU A 1 155 ? 20.683  -1.283  26.698  1.00 17.03 ? 383  GLU A O   1 
ATOM   1200  C CB  . GLU A 1 155 ? 20.597  1.925   27.979  1.00 17.22 ? 383  GLU A CB  1 
ATOM   1201  C CG  . GLU A 1 155 ? 19.505  2.813   28.608  1.00 17.11 ? 383  GLU A CG  1 
ATOM   1202  C CD  . GLU A 1 155 ? 19.627  4.299   28.225  1.00 16.78 ? 383  GLU A CD  1 
ATOM   1203  O OE1 . GLU A 1 155 ? 20.737  4.756   27.868  1.00 16.79 ? 383  GLU A OE1 1 
ATOM   1204  O OE2 . GLU A 1 155 ? 18.607  5.012   28.294  1.00 15.70 ? 383  GLU A OE2 1 
ATOM   1205  N N   . ASP A 1 156 ? 22.497  -0.011  26.969  1.00 16.85 ? 384  ASP A N   1 
ATOM   1206  C CA  . ASP A 1 156 ? 23.233  -0.607  25.867  1.00 16.71 ? 384  ASP A CA  1 
ATOM   1207  C C   . ASP A 1 156 ? 24.099  -1.750  26.379  1.00 16.72 ? 384  ASP A C   1 
ATOM   1208  O O   . ASP A 1 156 ? 25.267  -1.549  26.692  1.00 16.72 ? 384  ASP A O   1 
ATOM   1209  C CB  . ASP A 1 156 ? 24.103  0.473   25.236  1.00 16.66 ? 384  ASP A CB  1 
ATOM   1210  C CG  . ASP A 1 156 ? 24.602  0.106   23.866  1.00 16.69 ? 384  ASP A CG  1 
ATOM   1211  O OD1 . ASP A 1 156 ? 24.598  -1.088  23.490  1.00 16.60 ? 384  ASP A OD1 1 
ATOM   1212  O OD2 . ASP A 1 156 ? 25.009  1.046   23.159  1.00 16.93 ? 384  ASP A OD2 1 
ATOM   1213  N N   . VAL A 1 157 ? 23.542  -2.954  26.471  1.00 16.66 ? 385  VAL A N   1 
ATOM   1214  C CA  . VAL A 1 157 ? 24.290  -4.064  27.064  1.00 16.56 ? 385  VAL A CA  1 
ATOM   1215  C C   . VAL A 1 157 ? 25.532  -4.414  26.257  1.00 16.65 ? 385  VAL A C   1 
ATOM   1216  O O   . VAL A 1 157 ? 26.577  -4.701  26.846  1.00 16.52 ? 385  VAL A O   1 
ATOM   1217  C CB  . VAL A 1 157 ? 23.431  -5.330  27.244  1.00 16.56 ? 385  VAL A CB  1 
ATOM   1218  C CG1 . VAL A 1 157 ? 24.307  -6.523  27.606  1.00 16.09 ? 385  VAL A CG1 1 
ATOM   1219  C CG2 . VAL A 1 157 ? 22.382  -5.105  28.312  1.00 16.32 ? 385  VAL A CG2 1 
ATOM   1220  N N   . GLU A 1 158 ? 25.411  -4.391  24.927  1.00 16.75 ? 386  GLU A N   1 
ATOM   1221  C CA  . GLU A 1 158 ? 26.531  -4.728  24.035  1.00 17.02 ? 386  GLU A CA  1 
ATOM   1222  C C   . GLU A 1 158 ? 27.713  -3.765  24.176  1.00 16.81 ? 386  GLU A C   1 
ATOM   1223  O O   . GLU A 1 158 ? 28.863  -4.190  24.115  1.00 16.40 ? 386  GLU A O   1 
ATOM   1224  C CB  . GLU A 1 158 ? 26.091  -4.791  22.559  1.00 17.29 ? 386  GLU A CB  1 
ATOM   1225  C CG  . GLU A 1 158 ? 25.458  -6.129  22.107  1.00 18.31 ? 386  GLU A CG  1 
ATOM   1226  C CD  . GLU A 1 158 ? 23.921  -6.185  22.224  1.00 19.77 ? 386  GLU A CD  1 
ATOM   1227  O OE1 . GLU A 1 158 ? 23.296  -5.241  22.773  1.00 21.16 ? 386  GLU A OE1 1 
ATOM   1228  O OE2 . GLU A 1 158 ? 23.337  -7.190  21.757  1.00 19.64 ? 386  GLU A OE2 1 
ATOM   1229  N N   . ALA A 1 159 ? 27.423  -2.476  24.362  1.00 16.91 ? 387  ALA A N   1 
ATOM   1230  C CA  . ALA A 1 159 ? 28.459  -1.448  24.529  1.00 16.98 ? 387  ALA A CA  1 
ATOM   1231  C C   . ALA A 1 159 ? 29.248  -1.628  25.828  1.00 17.25 ? 387  ALA A C   1 
ATOM   1232  O O   . ALA A 1 159 ? 30.466  -1.424  25.846  1.00 17.46 ? 387  ALA A O   1 
ATOM   1233  C CB  . ALA A 1 159 ? 27.851  -0.066  24.480  1.00 16.56 ? 387  ALA A CB  1 
ATOM   1234  N N   . VAL A 1 160 ? 28.551  -2.002  26.906  1.00 17.48 ? 388  VAL A N   1 
ATOM   1235  C CA  . VAL A 1 160 ? 29.175  -2.243  28.215  1.00 17.41 ? 388  VAL A CA  1 
ATOM   1236  C C   . VAL A 1 160 ? 30.065  -3.466  28.152  1.00 17.67 ? 388  VAL A C   1 
ATOM   1237  O O   . VAL A 1 160 ? 31.177  -3.455  28.671  1.00 17.80 ? 388  VAL A O   1 
ATOM   1238  C CB  . VAL A 1 160 ? 28.136  -2.468  29.332  1.00 17.34 ? 388  VAL A CB  1 
ATOM   1239  C CG1 . VAL A 1 160 ? 28.822  -2.954  30.599  1.00 17.03 ? 388  VAL A CG1 1 
ATOM   1240  C CG2 . VAL A 1 160 ? 27.365  -1.191  29.612  1.00 17.27 ? 388  VAL A CG2 1 
ATOM   1241  N N   . GLN A 1 161 ? 29.565  -4.524  27.520  1.00 17.94 ? 389  GLN A N   1 
ATOM   1242  C CA  . GLN A 1 161 ? 30.365  -5.719  27.238  1.00 17.96 ? 389  GLN A CA  1 
ATOM   1243  C C   . GLN A 1 161 ? 31.624  -5.380  26.449  1.00 17.69 ? 389  GLN A C   1 
ATOM   1244  O O   . GLN A 1 161 ? 32.695  -5.916  26.713  1.00 17.71 ? 389  GLN A O   1 
ATOM   1245  C CB  . GLN A 1 161 ? 29.532  -6.721  26.449  1.00 18.09 ? 389  GLN A CB  1 
ATOM   1246  C CG  . GLN A 1 161 ? 30.283  -7.955  26.022  1.00 19.00 ? 389  GLN A CG  1 
ATOM   1247  C CD  . GLN A 1 161 ? 30.701  -8.818  27.190  1.00 20.03 ? 389  GLN A CD  1 
ATOM   1248  O OE1 . GLN A 1 161 ? 29.896  -9.095  28.082  1.00 20.13 ? 389  GLN A OE1 1 
ATOM   1249  N NE2 . GLN A 1 161 ? 31.956  -9.271  27.182  1.00 20.23 ? 389  GLN A NE2 1 
ATOM   1250  N N   . LYS A 1 162 ? 31.477  -4.493  25.473  1.00 17.62 ? 390  LYS A N   1 
ATOM   1251  C CA  . LYS A 1 162 ? 32.592  -4.066  24.625  1.00 17.66 ? 390  LYS A CA  1 
ATOM   1252  C C   . LYS A 1 162 ? 33.630  -3.291  25.423  1.00 17.38 ? 390  LYS A C   1 
ATOM   1253  O O   . LYS A 1 162 ? 34.822  -3.364  25.135  1.00 17.49 ? 390  LYS A O   1 
ATOM   1254  C CB  . LYS A 1 162 ? 32.063  -3.214  23.471  1.00 17.85 ? 390  LYS A CB  1 
ATOM   1255  C CG  . LYS A 1 162 ? 33.057  -2.953  22.367  1.00 18.78 ? 390  LYS A CG  1 
ATOM   1256  C CD  . LYS A 1 162 ? 32.380  -2.924  21.011  1.00 19.94 ? 390  LYS A CD  1 
ATOM   1257  C CE  . LYS A 1 162 ? 32.119  -4.341  20.483  1.00 20.80 ? 390  LYS A CE  1 
ATOM   1258  N NZ  . LYS A 1 162 ? 31.386  -4.346  19.155  1.00 20.95 ? 390  LYS A NZ  1 
ATOM   1259  N N   . LEU A 1 163 ? 33.156  -2.548  26.422  1.00 17.15 ? 391  LEU A N   1 
ATOM   1260  C CA  . LEU A 1 163 ? 34.006  -1.877  27.400  1.00 16.86 ? 391  LEU A CA  1 
ATOM   1261  C C   . LEU A 1 163 ? 34.760  -2.879  28.278  1.00 16.66 ? 391  LEU A C   1 
ATOM   1262  O O   . LEU A 1 163 ? 35.928  -2.678  28.584  1.00 16.87 ? 391  LEU A O   1 
ATOM   1263  C CB  . LEU A 1 163 ? 33.151  -0.978  28.293  1.00 16.89 ? 391  LEU A CB  1 
ATOM   1264  C CG  . LEU A 1 163 ? 33.911  0.006   29.175  1.00 17.27 ? 391  LEU A CG  1 
ATOM   1265  C CD1 . LEU A 1 163 ? 34.431  1.154   28.311  1.00 17.30 ? 391  LEU A CD1 1 
ATOM   1266  C CD2 . LEU A 1 163 ? 33.016  0.517   30.275  1.00 16.81 ? 391  LEU A CD2 1 
ATOM   1267  N N   . GLN A 1 164 ? 34.093  -3.950  28.698  1.00 16.48 ? 392  GLN A N   1 
ATOM   1268  C CA  . GLN A 1 164 ? 34.746  -4.984  29.511  1.00 16.30 ? 392  GLN A CA  1 
ATOM   1269  C C   . GLN A 1 164 ? 35.776  -5.723  28.690  1.00 16.41 ? 392  GLN A C   1 
ATOM   1270  O O   . GLN A 1 164 ? 36.837  -6.074  29.187  1.00 16.34 ? 392  GLN A O   1 
ATOM   1271  C CB  . GLN A 1 164 ? 33.735  -5.993  30.021  1.00 16.09 ? 392  GLN A CB  1 
ATOM   1272  C CG  . GLN A 1 164 ? 32.688  -5.413  30.917  1.00 17.03 ? 392  GLN A CG  1 
ATOM   1273  C CD  . GLN A 1 164 ? 31.596  -6.404  31.230  1.00 18.45 ? 392  GLN A CD  1 
ATOM   1274  O OE1 . GLN A 1 164 ? 31.800  -7.620  31.140  1.00 20.22 ? 392  GLN A OE1 1 
ATOM   1275  N NE2 . GLN A 1 164 ? 30.428  -5.894  31.609  1.00 17.73 ? 392  GLN A NE2 1 
ATOM   1276  N N   . ASP A 1 165 ? 35.450  -5.959  27.424  1.00 16.65 ? 393  ASP A N   1 
ATOM   1277  C CA  . ASP A 1 165 ? 36.338  -6.689  26.530  1.00 17.19 ? 393  ASP A CA  1 
ATOM   1278  C C   . ASP A 1 165 ? 37.636  -5.943  26.219  1.00 16.39 ? 393  ASP A C   1 
ATOM   1279  O O   . ASP A 1 165 ? 38.690  -6.569  26.082  1.00 16.40 ? 393  ASP A O   1 
ATOM   1280  C CB  . ASP A 1 165 ? 35.595  -7.071  25.240  1.00 17.66 ? 393  ASP A CB  1 
ATOM   1281  C CG  . ASP A 1 165 ? 34.533  -8.145  25.482  1.00 20.57 ? 393  ASP A CG  1 
ATOM   1282  O OD1 . ASP A 1 165 ? 34.762  -9.040  26.337  1.00 24.40 ? 393  ASP A OD1 1 
ATOM   1283  O OD2 . ASP A 1 165 ? 33.462  -8.098  24.830  1.00 24.00 ? 393  ASP A OD2 1 
ATOM   1284  N N   . VAL A 1 166 ? 37.551  -4.620  26.108  1.00 15.53 ? 394  VAL A N   1 
ATOM   1285  C CA  . VAL A 1 166 ? 38.715  -3.800  25.805  1.00 15.04 ? 394  VAL A CA  1 
ATOM   1286  C C   . VAL A 1 166 ? 39.681  -3.790  26.977  1.00 14.68 ? 394  VAL A C   1 
ATOM   1287  O O   . VAL A 1 166 ? 40.859  -4.107  26.837  1.00 14.63 ? 394  VAL A O   1 
ATOM   1288  C CB  . VAL A 1 166 ? 38.308  -2.364  25.488  1.00 14.94 ? 394  VAL A CB  1 
ATOM   1289  C CG1 . VAL A 1 166 ? 39.521  -1.467  25.502  1.00 14.68 ? 394  VAL A CG1 1 
ATOM   1290  C CG2 . VAL A 1 166 ? 37.612  -2.313  24.137  1.00 15.16 ? 394  VAL A CG2 1 
ATOM   1291  N N   . LEU A 1 167 ? 39.155  -3.417  28.134  1.00 14.31 ? 395  LEU A N   1 
ATOM   1292  C CA  . LEU A 1 167 ? 39.919  -3.358  29.370  1.00 13.99 ? 395  LEU A CA  1 
ATOM   1293  C C   . LEU A 1 167 ? 40.526  -4.727  29.745  1.00 14.12 ? 395  LEU A C   1 
ATOM   1294  O O   . LEU A 1 167 ? 41.687  -4.822  30.164  1.00 14.26 ? 395  LEU A O   1 
ATOM   1295  C CB  . LEU A 1 167 ? 38.994  -2.909  30.485  1.00 13.80 ? 395  LEU A CB  1 
ATOM   1296  C CG  . LEU A 1 167 ? 38.390  -1.520  30.393  1.00 13.27 ? 395  LEU A CG  1 
ATOM   1297  C CD1 . LEU A 1 167 ? 37.388  -1.371  31.516  1.00 13.93 ? 395  LEU A CD1 1 
ATOM   1298  C CD2 . LEU A 1 167 ? 39.465  -0.466  30.489  1.00 12.90 ? 395  LEU A CD2 1 
ATOM   1299  N N   . HIS A 1 168 ? 39.724  -5.778  29.606  1.00 13.86 ? 396  HIS A N   1 
ATOM   1300  C CA  . HIS A 1 168 ? 40.186  -7.142  29.828  1.00 13.85 ? 396  HIS A CA  1 
ATOM   1301  C C   . HIS A 1 168 ? 41.393  -7.463  28.952  1.00 13.54 ? 396  HIS A C   1 
ATOM   1302  O O   . HIS A 1 168 ? 42.378  -8.033  29.419  1.00 13.29 ? 396  HIS A O   1 
ATOM   1303  C CB  . HIS A 1 168 ? 39.048  -8.114  29.521  1.00 14.15 ? 396  HIS A CB  1 
ATOM   1304  C CG  . HIS A 1 168 ? 39.414  -9.554  29.676  1.00 14.43 ? 396  HIS A CG  1 
ATOM   1305  N ND1 . HIS A 1 168 ? 38.659  -10.568 29.130  1.00 14.67 ? 396  HIS A ND1 1 
ATOM   1306  C CD2 . HIS A 1 168 ? 40.448  -10.152 30.315  1.00 15.17 ? 396  HIS A CD2 1 
ATOM   1307  C CE1 . HIS A 1 168 ? 39.205  -11.730 29.436  1.00 15.55 ? 396  HIS A CE1 1 
ATOM   1308  N NE2 . HIS A 1 168 ? 40.295  -11.507 30.150  1.00 16.27 ? 396  HIS A NE2 1 
ATOM   1309  N N   . GLU A 1 169 ? 41.289  -7.080  27.683  1.00 13.10 ? 397  GLU A N   1 
ATOM   1310  C CA  . GLU A 1 169 ? 42.344  -7.267  26.704  1.00 13.05 ? 397  GLU A CA  1 
ATOM   1311  C C   . GLU A 1 169 ? 43.626  -6.514  27.054  1.00 12.87 ? 397  GLU A C   1 
ATOM   1312  O O   . GLU A 1 169 ? 44.712  -6.970  26.718  1.00 12.47 ? 397  GLU A O   1 
ATOM   1313  C CB  . GLU A 1 169 ? 41.836  -6.825  25.337  1.00 12.97 ? 397  GLU A CB  1 
ATOM   1314  C CG  . GLU A 1 169 ? 42.861  -6.882  24.226  1.00 13.47 ? 397  GLU A CG  1 
ATOM   1315  C CD  . GLU A 1 169 ? 42.295  -6.437  22.886  1.00 14.15 ? 397  GLU A CD  1 
ATOM   1316  O OE1 . GLU A 1 169 ? 41.094  -6.067  22.809  1.00 15.84 ? 397  GLU A OE1 1 
ATOM   1317  O OE2 . GLU A 1 169 ? 43.070  -6.449  21.910  1.00 14.73 ? 397  GLU A OE2 1 
ATOM   1318  N N   . ALA A 1 170 ? 43.498  -5.361  27.716  1.00 12.91 ? 398  ALA A N   1 
ATOM   1319  C CA  . ALA A 1 170 ? 44.664  -4.581  28.112  1.00 12.62 ? 398  ALA A CA  1 
ATOM   1320  C C   . ALA A 1 170 ? 45.373  -5.285  29.251  1.00 12.69 ? 398  ALA A C   1 
ATOM   1321  O O   . ALA A 1 170 ? 46.601  -5.368  29.267  1.00 13.07 ? 398  ALA A O   1 
ATOM   1322  C CB  . ALA A 1 170 ? 44.271  -3.202  28.502  1.00 12.42 ? 398  ALA A CB  1 
ATOM   1323  N N   . LEU A 1 171 ? 44.598  -5.815  30.194  1.00 12.73 ? 399  LEU A N   1 
ATOM   1324  C CA  . LEU A 1 171 ? 45.161  -6.612  31.296  1.00 12.72 ? 399  LEU A CA  1 
ATOM   1325  C C   . LEU A 1 171 ? 45.881  -7.802  30.715  1.00 12.79 ? 399  LEU A C   1 
ATOM   1326  O O   . LEU A 1 171 ? 47.054  -8.013  30.988  1.00 12.88 ? 399  LEU A O   1 
ATOM   1327  C CB  . LEU A 1 171 ? 44.075  -7.091  32.280  1.00 12.53 ? 399  LEU A CB  1 
ATOM   1328  C CG  . LEU A 1 171 ? 44.480  -7.916  33.520  1.00 11.83 ? 399  LEU A CG  1 
ATOM   1329  C CD1 . LEU A 1 171 ? 45.340  -7.132  34.475  1.00 9.00  ? 399  LEU A CD1 1 
ATOM   1330  C CD2 . LEU A 1 171 ? 43.227  -8.433  34.257  1.00 11.98 ? 399  LEU A CD2 1 
ATOM   1331  N N   A GLN A 1 172 ? 45.182  -8.573  29.891  0.60 12.97 ? 400  GLN A N   1 
ATOM   1332  N N   B GLN A 1 172 ? 45.159  -8.561  29.895  0.40 12.84 ? 400  GLN A N   1 
ATOM   1333  C CA  A GLN A 1 172 ? 45.744  -9.810  29.367  0.60 13.20 ? 400  GLN A CA  1 
ATOM   1334  C CA  B GLN A 1 172 ? 45.670  -9.784  29.285  0.40 12.87 ? 400  GLN A CA  1 
ATOM   1335  C C   A GLN A 1 172 ? 46.999  -9.554  28.517  0.60 13.40 ? 400  GLN A C   1 
ATOM   1336  C C   B GLN A 1 172 ? 46.985  -9.541  28.533  0.40 13.25 ? 400  GLN A C   1 
ATOM   1337  O O   A GLN A 1 172 ? 47.865  -10.418 28.422  0.60 13.45 ? 400  GLN A O   1 
ATOM   1338  O O   B GLN A 1 172 ? 47.868  -10.396 28.519  0.40 13.26 ? 400  GLN A O   1 
ATOM   1339  C CB  A GLN A 1 172 ? 44.683  -10.596 28.587  0.60 13.19 ? 400  GLN A CB  1 
ATOM   1340  C CB  B GLN A 1 172 ? 44.618  -10.363 28.336  0.40 12.86 ? 400  GLN A CB  1 
ATOM   1341  C CG  A GLN A 1 172 ? 45.115  -12.014 28.155  0.60 13.63 ? 400  GLN A CG  1 
ATOM   1342  C CG  B GLN A 1 172 ? 44.803  -11.841 28.019  0.40 12.81 ? 400  GLN A CG  1 
ATOM   1343  C CD  A GLN A 1 172 ? 45.546  -12.903 29.322  0.60 13.14 ? 400  GLN A CD  1 
ATOM   1344  C CD  B GLN A 1 172 ? 43.865  -12.327 26.934  0.40 12.11 ? 400  GLN A CD  1 
ATOM   1345  O OE1 A GLN A 1 172 ? 44.722  -13.321 30.139  0.60 12.10 ? 400  GLN A OE1 1 
ATOM   1346  O OE1 B GLN A 1 172 ? 43.723  -11.689 25.895  0.40 9.99  ? 400  GLN A OE1 1 
ATOM   1347  N NE2 A GLN A 1 172 ? 46.843  -13.196 29.395  0.60 11.91 ? 400  GLN A NE2 1 
ATOM   1348  N NE2 B GLN A 1 172 ? 43.218  -13.463 27.174  0.40 11.03 ? 400  GLN A NE2 1 
ATOM   1349  N N   . ASP A 1 173 ? 47.103  -8.364  27.928  1.00 13.61 ? 401  ASP A N   1 
ATOM   1350  C CA  . ASP A 1 173 ? 48.285  -7.974  27.153  1.00 14.12 ? 401  ASP A CA  1 
ATOM   1351  C C   . ASP A 1 173 ? 49.465  -7.509  28.016  1.00 14.15 ? 401  ASP A C   1 
ATOM   1352  O O   . ASP A 1 173 ? 50.615  -7.882  27.771  1.00 13.96 ? 401  ASP A O   1 
ATOM   1353  C CB  . ASP A 1 173 ? 47.906  -6.844  26.190  1.00 14.50 ? 401  ASP A CB  1 
ATOM   1354  C CG  . ASP A 1 173 ? 49.106  -6.230  25.518  1.00 15.58 ? 401  ASP A CG  1 
ATOM   1355  O OD1 . ASP A 1 173 ? 49.612  -6.824  24.543  1.00 16.75 ? 401  ASP A OD1 1 
ATOM   1356  O OD2 . ASP A 1 173 ? 49.541  -5.147  25.967  1.00 18.76 ? 401  ASP A OD2 1 
ATOM   1357  N N   . TYR A 1 174 ? 49.189  -6.646  28.990  1.00 14.37 ? 402  TYR A N   1 
ATOM   1358  C CA  . TYR A 1 174 ? 50.215  -6.262  29.967  1.00 14.34 ? 402  TYR A CA  1 
ATOM   1359  C C   . TYR A 1 174 ? 50.774  -7.519  30.645  1.00 14.20 ? 402  TYR A C   1 
ATOM   1360  O O   . TYR A 1 174 ? 51.988  -7.704  30.734  1.00 14.37 ? 402  TYR A O   1 
ATOM   1361  C CB  . TYR A 1 174 ? 49.645  -5.311  31.027  1.00 14.37 ? 402  TYR A CB  1 
ATOM   1362  C CG  . TYR A 1 174 ? 50.589  -5.057  32.190  1.00 14.14 ? 402  TYR A CG  1 
ATOM   1363  C CD1 . TYR A 1 174 ? 51.615  -4.145  32.084  1.00 14.41 ? 402  TYR A CD1 1 
ATOM   1364  C CD2 . TYR A 1 174 ? 50.450  -5.745  33.390  1.00 14.22 ? 402  TYR A CD2 1 
ATOM   1365  C CE1 . TYR A 1 174 ? 52.476  -3.918  33.139  1.00 15.27 ? 402  TYR A CE1 1 
ATOM   1366  C CE2 . TYR A 1 174 ? 51.301  -5.526  34.449  1.00 14.05 ? 402  TYR A CE2 1 
ATOM   1367  C CZ  . TYR A 1 174 ? 52.313  -4.611  34.320  1.00 14.71 ? 402  TYR A CZ  1 
ATOM   1368  O OH  . TYR A 1 174 ? 53.174  -4.375  35.365  1.00 14.86 ? 402  TYR A OH  1 
ATOM   1369  N N   . GLU A 1 175 ? 49.866  -8.379  31.097  1.00 13.88 ? 403  GLU A N   1 
ATOM   1370  C CA  . GLU A 1 175 ? 50.218  -9.597  31.801  1.00 13.79 ? 403  GLU A CA  1 
ATOM   1371  C C   . GLU A 1 175 ? 50.925  -10.608 30.904  1.00 13.96 ? 403  GLU A C   1 
ATOM   1372  O O   . GLU A 1 175 ? 51.627  -11.492 31.408  1.00 14.40 ? 403  GLU A O   1 
ATOM   1373  C CB  . GLU A 1 175 ? 48.961  -10.241 32.395  1.00 13.94 ? 403  GLU A CB  1 
ATOM   1374  C CG  . GLU A 1 175 ? 48.245  -9.414  33.471  1.00 13.24 ? 403  GLU A CG  1 
ATOM   1375  C CD  . GLU A 1 175 ? 49.045  -9.244  34.755  1.00 13.06 ? 403  GLU A CD  1 
ATOM   1376  O OE1 . GLU A 1 175 ? 50.102  -9.880  34.933  1.00 11.92 ? 403  GLU A OE1 1 
ATOM   1377  O OE2 . GLU A 1 175 ? 48.605  -8.447  35.601  1.00 15.20 ? 403  GLU A OE2 1 
ATOM   1378  N N   . ALA A 1 176 ? 50.724  -10.489 29.589  1.00 13.82 ? 404  ALA A N   1 
ATOM   1379  C CA  . ALA A 1 176 ? 51.422  -11.316 28.598  1.00 13.45 ? 404  ALA A CA  1 
ATOM   1380  C C   . ALA A 1 176 ? 52.845  -10.835 28.358  1.00 13.54 ? 404  ALA A C   1 
ATOM   1381  O O   . ALA A 1 176 ? 53.738  -11.639 28.159  1.00 13.81 ? 404  ALA A O   1 
ATOM   1382  C CB  . ALA A 1 176 ? 50.659  -11.331 27.294  1.00 13.01 ? 404  ALA A CB  1 
ATOM   1383  N N   . GLY A 1 177 ? 53.059  -9.526  28.374  1.00 13.97 ? 405  GLY A N   1 
ATOM   1384  C CA  . GLY A 1 177 ? 54.391  -8.961  28.121  1.00 14.27 ? 405  GLY A CA  1 
ATOM   1385  C C   . GLY A 1 177 ? 55.265  -8.841  29.355  1.00 14.48 ? 405  GLY A C   1 
ATOM   1386  O O   . GLY A 1 177 ? 56.466  -9.090  29.297  1.00 14.12 ? 405  GLY A O   1 
ATOM   1387  N N   . GLN A 1 178 ? 54.640  -8.466  30.472  1.00 14.93 ? 406  GLN A N   1 
ATOM   1388  C CA  . GLN A 1 178 ? 55.336  -8.195  31.727  1.00 15.12 ? 406  GLN A CA  1 
ATOM   1389  C C   . GLN A 1 178 ? 55.393  -9.395  32.676  1.00 15.11 ? 406  GLN A C   1 
ATOM   1390  O O   . GLN A 1 178 ? 56.149  -9.371  33.653  1.00 14.89 ? 406  GLN A O   1 
ATOM   1391  C CB  . GLN A 1 178 ? 54.653  -7.018  32.436  1.00 15.46 ? 406  GLN A CB  1 
ATOM   1392  C CG  . GLN A 1 178 ? 55.498  -6.326  33.506  1.00 16.43 ? 406  GLN A CG  1 
ATOM   1393  C CD  . GLN A 1 178 ? 56.870  -5.931  32.980  1.00 17.64 ? 406  GLN A CD  1 
ATOM   1394  O OE1 . GLN A 1 178 ? 56.997  -5.468  31.838  1.00 19.25 ? 406  GLN A OE1 1 
ATOM   1395  N NE2 . GLN A 1 178 ? 57.906  -6.129  33.797  1.00 16.87 ? 406  GLN A NE2 1 
ATOM   1396  N N   . HIS A 1 179 ? 54.603  -10.437 32.407  1.00 15.26 ? 407  HIS A N   1 
ATOM   1397  C CA  . HIS A 1 179 ? 54.602  -11.633 33.270  1.00 15.40 ? 407  HIS A CA  1 
ATOM   1398  C C   . HIS A 1 179 ? 54.521  -12.947 32.491  1.00 15.92 ? 407  HIS A C   1 
ATOM   1399  O O   . HIS A 1 179 ? 53.556  -13.708 32.591  1.00 15.97 ? 407  HIS A O   1 
ATOM   1400  C CB  . HIS A 1 179 ? 53.503  -11.538 34.333  1.00 14.90 ? 407  HIS A CB  1 
ATOM   1401  C CG  . HIS A 1 179 ? 53.771  -10.496 35.374  1.00 13.73 ? 407  HIS A CG  1 
ATOM   1402  N ND1 . HIS A 1 179 ? 54.408  -10.781 36.560  1.00 13.04 ? 407  HIS A ND1 1 
ATOM   1403  C CD2 . HIS A 1 179 ? 53.496  -9.172  35.404  1.00 12.09 ? 407  HIS A CD2 1 
ATOM   1404  C CE1 . HIS A 1 179 ? 54.506  -9.676  37.277  1.00 12.13 ? 407  HIS A CE1 1 
ATOM   1405  N NE2 . HIS A 1 179 ? 53.960  -8.687  36.599  1.00 10.79 ? 407  HIS A NE2 1 
ATOM   1406  N N   . MET A 1 180 ? 55.583  -13.219 31.747  1.00 16.51 ? 408  MET A N   1 
ATOM   1407  C CA  . MET A 1 180 ? 55.661  -14.411 30.911  1.00 17.15 ? 408  MET A CA  1 
ATOM   1408  C C   . MET A 1 180 ? 55.831  -15.652 31.766  1.00 16.78 ? 408  MET A C   1 
ATOM   1409  O O   . MET A 1 180 ? 55.461  -16.752 31.349  1.00 16.86 ? 408  MET A O   1 
ATOM   1410  C CB  . MET A 1 180 ? 56.841  -14.300 29.961  1.00 17.08 ? 408  MET A CB  1 
ATOM   1411  C CG  . MET A 1 180 ? 56.852  -13.021 29.141  1.00 18.15 ? 408  MET A CG  1 
ATOM   1412  S SD  . MET A 1 180 ? 58.244  -12.976 27.995  1.00 19.96 ? 408  MET A SD  1 
ATOM   1413  C CE  . MET A 1 180 ? 59.592  -13.587 29.030  1.00 19.64 ? 408  MET A CE  1 
ATOM   1414  N N   . GLU A 1 181 ? 56.408  -15.453 32.955  1.00 16.69 ? 409  GLU A N   1 
ATOM   1415  C CA  . GLU A 1 181 ? 56.620  -16.510 33.959  1.00 16.42 ? 409  GLU A CA  1 
ATOM   1416  C C   . GLU A 1 181 ? 55.310  -17.025 34.575  1.00 16.11 ? 409  GLU A C   1 
ATOM   1417  O O   . GLU A 1 181 ? 55.274  -18.090 35.174  1.00 15.96 ? 409  GLU A O   1 
ATOM   1418  C CB  . GLU A 1 181 ? 57.573  -16.011 35.073  1.00 16.49 ? 409  GLU A CB  1 
ATOM   1419  C CG  . GLU A 1 181 ? 56.930  -15.232 36.260  1.00 16.84 ? 409  GLU A CG  1 
ATOM   1420  C CD  . GLU A 1 181 ? 56.324  -13.883 35.882  1.00 17.77 ? 409  GLU A CD  1 
ATOM   1421  O OE1 . GLU A 1 181 ? 56.792  -13.284 34.875  1.00 19.36 ? 409  GLU A OE1 1 
ATOM   1422  O OE2 . GLU A 1 181 ? 55.392  -13.422 36.599  1.00 15.40 ? 409  GLU A OE2 1 
ATOM   1423  N N   . ASP A 1 182 ? 54.239  -16.255 34.439  1.00 15.97 ? 410  ASP A N   1 
ATOM   1424  C CA  . ASP A 1 182 ? 52.923  -16.688 34.875  1.00 15.82 ? 410  ASP A CA  1 
ATOM   1425  C C   . ASP A 1 182 ? 51.923  -16.525 33.726  1.00 15.57 ? 410  ASP A C   1 
ATOM   1426  O O   . ASP A 1 182 ? 51.318  -15.458 33.565  1.00 15.72 ? 410  ASP A O   1 
ATOM   1427  C CB  . ASP A 1 182 ? 52.484  -15.872 36.094  1.00 15.92 ? 410  ASP A CB  1 
ATOM   1428  C CG  . ASP A 1 182 ? 51.279  -16.454 36.785  1.00 16.01 ? 410  ASP A CG  1 
ATOM   1429  O OD1 . ASP A 1 182 ? 50.714  -17.450 36.288  1.00 16.73 ? 410  ASP A OD1 1 
ATOM   1430  O OD2 . ASP A 1 182 ? 50.908  -15.923 37.848  1.00 17.04 ? 410  ASP A OD2 1 
ATOM   1431  N N   . PRO A 1 183 ? 51.742  -17.578 32.919  1.00 15.04 ? 411  PRO A N   1 
ATOM   1432  C CA  . PRO A 1 183 ? 50.701  -17.524 31.913  1.00 14.97 ? 411  PRO A CA  1 
ATOM   1433  C C   . PRO A 1 183 ? 49.278  -17.373 32.453  1.00 14.96 ? 411  PRO A C   1 
ATOM   1434  O O   . PRO A 1 183 ? 48.374  -17.163 31.661  1.00 15.36 ? 411  PRO A O   1 
ATOM   1435  C CB  . PRO A 1 183 ? 50.839  -18.868 31.196  1.00 14.84 ? 411  PRO A CB  1 
ATOM   1436  C CG  . PRO A 1 183 ? 51.545  -19.727 32.122  1.00 14.97 ? 411  PRO A CG  1 
ATOM   1437  C CD  . PRO A 1 183 ? 52.478  -18.844 32.854  1.00 15.09 ? 411  PRO A CD  1 
ATOM   1438  N N   . ARG A 1 184 ? 49.068  -17.494 33.761  1.00 14.90 ? 412  ARG A N   1 
ATOM   1439  C CA  . ARG A 1 184 ? 47.716  -17.420 34.330  1.00 15.07 ? 412  ARG A CA  1 
ATOM   1440  C C   . ARG A 1 184 ? 47.552  -16.251 35.320  1.00 14.90 ? 412  ARG A C   1 
ATOM   1441  O O   . ARG A 1 184 ? 46.646  -16.248 36.150  1.00 14.85 ? 412  ARG A O   1 
ATOM   1442  C CB  . ARG A 1 184 ? 47.352  -18.760 34.995  1.00 15.05 ? 412  ARG A CB  1 
ATOM   1443  C CG  . ARG A 1 184 ? 47.512  -19.966 34.064  1.00 15.81 ? 412  ARG A CG  1 
ATOM   1444  C CD  . ARG A 1 184 ? 46.952  -21.254 34.647  1.00 15.64 ? 412  ARG A CD  1 
ATOM   1445  N NE  . ARG A 1 184 ? 47.900  -21.950 35.516  1.00 16.55 ? 412  ARG A NE  1 
ATOM   1446  C CZ  . ARG A 1 184 ? 48.946  -22.653 35.086  1.00 17.09 ? 412  ARG A CZ  1 
ATOM   1447  N NH1 . ARG A 1 184 ? 49.205  -22.736 33.790  1.00 18.81 ? 412  ARG A NH1 1 
ATOM   1448  N NH2 . ARG A 1 184 ? 49.753  -23.262 35.949  1.00 15.94 ? 412  ARG A NH2 1 
ATOM   1449  N N   . ARG A 1 185 ? 48.409  -15.244 35.209  1.00 14.81 ? 413  ARG A N   1 
ATOM   1450  C CA  . ARG A 1 185 ? 48.347  -14.100 36.111  1.00 14.59 ? 413  ARG A CA  1 
ATOM   1451  C C   . ARG A 1 185 ? 47.104  -13.254 35.939  1.00 14.48 ? 413  ARG A C   1 
ATOM   1452  O O   . ARG A 1 185 ? 46.590  -12.752 36.938  1.00 15.11 ? 413  ARG A O   1 
ATOM   1453  C CB  . ARG A 1 185 ? 49.566  -13.199 35.960  1.00 14.65 ? 413  ARG A CB  1 
ATOM   1454  C CG  . ARG A 1 185 ? 49.652  -12.123 37.028  1.00 14.35 ? 413  ARG A CG  1 
ATOM   1455  C CD  . ARG A 1 185 ? 51.073  -11.650 37.180  1.00 14.28 ? 413  ARG A CD  1 
ATOM   1456  N NE  . ARG A 1 185 ? 51.167  -10.484 38.044  1.00 13.97 ? 413  ARG A NE  1 
ATOM   1457  C CZ  . ARG A 1 185 ? 51.468  -10.525 39.341  1.00 15.26 ? 413  ARG A CZ  1 
ATOM   1458  N NH1 . ARG A 1 185 ? 51.738  -11.676 39.951  1.00 16.06 ? 413  ARG A NH1 1 
ATOM   1459  N NH2 . ARG A 1 185 ? 51.519  -9.395  40.035  1.00 15.76 ? 413  ARG A NH2 1 
ATOM   1460  N N   . ALA A 1 186 ? 46.627  -13.079 34.701  1.00 14.21 ? 414  ALA A N   1 
ATOM   1461  C CA  . ALA A 1 186 ? 45.451  -12.222 34.431  1.00 13.88 ? 414  ALA A CA  1 
ATOM   1462  C C   . ALA A 1 186 ? 44.229  -12.816 35.096  1.00 13.86 ? 414  ALA A C   1 
ATOM   1463  O O   . ALA A 1 186 ? 43.545  -12.145 35.868  1.00 13.83 ? 414  ALA A O   1 
ATOM   1464  C CB  . ALA A 1 186 ? 45.211  -12.060 32.944  1.00 13.58 ? 414  ALA A CB  1 
ATOM   1465  N N   . GLY A 1 187 ? 43.976  -14.091 34.819  1.00 13.90 ? 415  GLY A N   1 
ATOM   1466  C CA  . GLY A 1 187 ? 42.904  -14.827 35.502  1.00 13.95 ? 415  GLY A CA  1 
ATOM   1467  C C   . GLY A 1 187 ? 43.017  -14.840 37.025  1.00 13.67 ? 415  GLY A C   1 
ATOM   1468  O O   . GLY A 1 187 ? 42.013  -14.736 37.736  1.00 13.37 ? 415  GLY A O   1 
ATOM   1469  N N   . LYS A 1 188 ? 44.237  -14.980 37.532  1.00 13.49 ? 416  LYS A N   1 
ATOM   1470  C CA  . LYS A 1 188 ? 44.451  -14.895 38.965  1.00 13.63 ? 416  LYS A CA  1 
ATOM   1471  C C   . LYS A 1 188 ? 43.927  -13.548 39.468  1.00 14.09 ? 416  LYS A C   1 
ATOM   1472  O O   . LYS A 1 188 ? 43.281  -13.465 40.531  1.00 13.90 ? 416  LYS A O   1 
ATOM   1473  C CB  . LYS A 1 188 ? 45.935  -15.070 39.319  1.00 13.51 ? 416  LYS A CB  1 
ATOM   1474  C CG  . LYS A 1 188 ? 46.394  -16.530 39.479  1.00 13.29 ? 416  LYS A CG  1 
ATOM   1475  C CD  . LYS A 1 188 ? 47.928  -16.654 39.690  1.00 13.12 ? 416  LYS A CD  1 
ATOM   1476  C CE  . LYS A 1 188 ? 48.440  -18.036 39.285  1.00 12.97 ? 416  LYS A CE  1 
ATOM   1477  N NZ  . LYS A 1 188 ? 49.907  -18.097 39.054  1.00 12.23 ? 416  LYS A NZ  1 
ATOM   1478  N N   . MET A 1 189 ? 44.210  -12.504 38.687  1.00 14.46 ? 417  MET A N   1 
ATOM   1479  C CA  . MET A 1 189 ? 43.822  -11.147 39.037  1.00 14.76 ? 417  MET A CA  1 
ATOM   1480  C C   . MET A 1 189 ? 42.321  -11.011 39.025  1.00 14.66 ? 417  MET A C   1 
ATOM   1481  O O   . MET A 1 189 ? 41.726  -10.500 39.976  1.00 14.77 ? 417  MET A O   1 
ATOM   1482  C CB  . MET A 1 189 ? 44.420  -10.151 38.057  1.00 15.50 ? 417  MET A CB  1 
ATOM   1483  C CG  . MET A 1 189 ? 45.867  -9.846  38.295  1.00 16.67 ? 417  MET A CG  1 
ATOM   1484  S SD  . MET A 1 189 ? 46.127  -9.147  39.932  1.00 20.09 ? 417  MET A SD  1 
ATOM   1485  C CE  . MET A 1 189 ? 47.908  -8.946  39.852  1.00 20.19 ? 417  MET A CE  1 
ATOM   1486  N N   . LEU A 1 190 ? 41.717  -11.469 37.933  1.00 14.48 ? 418  LEU A N   1 
ATOM   1487  C CA  . LEU A 1 190 ? 40.263  -11.492 37.784  1.00 14.04 ? 418  LEU A CA  1 
ATOM   1488  C C   . LEU A 1 190 ? 39.557  -12.314 38.879  1.00 14.14 ? 418  LEU A C   1 
ATOM   1489  O O   . LEU A 1 190 ? 38.417  -12.014 39.244  1.00 14.25 ? 418  LEU A O   1 
ATOM   1490  C CB  . LEU A 1 190 ? 39.900  -12.063 36.413  1.00 13.95 ? 418  LEU A CB  1 
ATOM   1491  C CG  . LEU A 1 190 ? 40.234  -11.276 35.144  1.00 13.37 ? 418  LEU A CG  1 
ATOM   1492  C CD1 . LEU A 1 190 ? 39.890  -12.108 33.894  1.00 11.36 ? 418  LEU A CD1 1 
ATOM   1493  C CD2 . LEU A 1 190 ? 39.488  -9.951  35.125  1.00 12.75 ? 418  LEU A CD2 1 
ATOM   1494  N N   . MET A 1 191 ? 40.230  -13.345 39.393  1.00 14.15 ? 419  MET A N   1 
ATOM   1495  C CA  . MET A 1 191 ? 39.652  -14.223 40.422  1.00 14.37 ? 419  MET A CA  1 
ATOM   1496  C C   . MET A 1 191 ? 39.571  -13.546 41.796  1.00 13.77 ? 419  MET A C   1 
ATOM   1497  O O   . MET A 1 191 ? 39.092  -14.148 42.752  1.00 13.90 ? 419  MET A O   1 
ATOM   1498  C CB  . MET A 1 191 ? 40.458  -15.538 40.534  1.00 14.56 ? 419  MET A CB  1 
ATOM   1499  C CG  . MET A 1 191 ? 39.983  -16.683 39.626  1.00 15.01 ? 419  MET A CG  1 
ATOM   1500  S SD  . MET A 1 191 ? 41.153  -18.081 39.510  1.00 16.21 ? 419  MET A SD  1 
ATOM   1501  C CE  . MET A 1 191 ? 41.105  -18.789 41.169  1.00 16.27 ? 419  MET A CE  1 
ATOM   1502  N N   . THR A 1 192 ? 40.074  -12.319 41.902  1.00 13.37 ? 420  THR A N   1 
ATOM   1503  C CA  . THR A 1 192 ? 39.983  -11.542 43.137  1.00 13.01 ? 420  THR A CA  1 
ATOM   1504  C C   . THR A 1 192 ? 38.736  -10.668 43.122  1.00 12.91 ? 420  THR A C   1 
ATOM   1505  O O   . THR A 1 192 ? 38.343  -10.122 44.140  1.00 13.28 ? 420  THR A O   1 
ATOM   1506  C CB  . THR A 1 192 ? 41.199  -10.618 43.329  1.00 12.69 ? 420  THR A CB  1 
ATOM   1507  O OG1 . THR A 1 192 ? 41.123  -9.533  42.403  1.00 13.45 ? 420  THR A OG1 1 
ATOM   1508  C CG2 . THR A 1 192 ? 42.499  -11.365 43.106  1.00 12.19 ? 420  THR A CG2 1 
ATOM   1509  N N   . LEU A 1 193 ? 38.115  -10.522 41.962  1.00 12.88 ? 421  LEU A N   1 
ATOM   1510  C CA  . LEU A 1 193 ? 36.977  -9.622  41.829  1.00 12.55 ? 421  LEU A CA  1 
ATOM   1511  C C   . LEU A 1 193 ? 35.837  -9.950  42.817  1.00 12.72 ? 421  LEU A C   1 
ATOM   1512  O O   . LEU A 1 193 ? 35.352  -9.064  43.506  1.00 12.55 ? 421  LEU A O   1 
ATOM   1513  C CB  . LEU A 1 193 ? 36.497  -9.593  40.366  1.00 12.28 ? 421  LEU A CB  1 
ATOM   1514  C CG  . LEU A 1 193 ? 37.367  -8.795  39.373  1.00 11.11 ? 421  LEU A CG  1 
ATOM   1515  C CD1 . LEU A 1 193 ? 36.730  -8.701  37.994  1.00 8.36  ? 421  LEU A CD1 1 
ATOM   1516  C CD2 . LEU A 1 193 ? 37.631  -7.401  39.893  1.00 9.87  ? 421  LEU A CD2 1 
ATOM   1517  N N   . PRO A 1 194 ? 35.437  -11.232 42.923  1.00 13.10 ? 422  PRO A N   1 
ATOM   1518  C CA  . PRO A 1 194 ? 34.345  -11.600 43.827  1.00 13.10 ? 422  PRO A CA  1 
ATOM   1519  C C   . PRO A 1 194 ? 34.537  -11.169 45.276  1.00 13.13 ? 422  PRO A C   1 
ATOM   1520  O O   . PRO A 1 194 ? 33.544  -10.828 45.929  1.00 13.30 ? 422  PRO A O   1 
ATOM   1521  C CB  . PRO A 1 194 ? 34.325  -13.132 43.759  1.00 12.98 ? 422  PRO A CB  1 
ATOM   1522  C CG  . PRO A 1 194 ? 34.904  -13.449 42.444  1.00 13.23 ? 422  PRO A CG  1 
ATOM   1523  C CD  . PRO A 1 194 ? 35.967  -12.417 42.223  1.00 13.46 ? 422  PRO A CD  1 
ATOM   1524  N N   . LEU A 1 195 ? 35.771  -11.214 45.792  1.00 12.81 ? 423  LEU A N   1 
ATOM   1525  C CA  . LEU A 1 195 ? 35.990  -10.813 47.180  1.00 12.63 ? 423  LEU A CA  1 
ATOM   1526  C C   . LEU A 1 195 ? 35.766  -9.321  47.282  1.00 13.01 ? 423  LEU A C   1 
ATOM   1527  O O   . LEU A 1 195 ? 35.200  -8.838  48.275  1.00 13.39 ? 423  LEU A O   1 
ATOM   1528  C CB  . LEU A 1 195 ? 37.382  -11.181 47.703  1.00 12.61 ? 423  LEU A CB  1 
ATOM   1529  C CG  . LEU A 1 195 ? 37.632  -10.899 49.208  1.00 12.42 ? 423  LEU A CG  1 
ATOM   1530  C CD1 . LEU A 1 195 ? 36.481  -11.322 50.128  1.00 10.86 ? 423  LEU A CD1 1 
ATOM   1531  C CD2 . LEU A 1 195 ? 38.911  -11.543 49.675  1.00 11.87 ? 423  LEU A CD2 1 
ATOM   1532  N N   . LEU A 1 196 ? 36.196  -8.596  46.245  1.00 12.93 ? 424  LEU A N   1 
ATOM   1533  C CA  . LEU A 1 196 ? 35.993  -7.153  46.173  1.00 12.73 ? 424  LEU A CA  1 
ATOM   1534  C C   . LEU A 1 196 ? 34.510  -6.840  46.176  1.00 12.55 ? 424  LEU A C   1 
ATOM   1535  O O   . LEU A 1 196 ? 34.076  -5.925  46.869  1.00 12.92 ? 424  LEU A O   1 
ATOM   1536  C CB  . LEU A 1 196 ? 36.656  -6.583  44.925  1.00 12.76 ? 424  LEU A CB  1 
ATOM   1537  C CG  . LEU A 1 196 ? 36.622  -5.062  44.756  1.00 13.67 ? 424  LEU A CG  1 
ATOM   1538  C CD1 . LEU A 1 196 ? 37.284  -4.355  45.954  1.00 12.39 ? 424  LEU A CD1 1 
ATOM   1539  C CD2 . LEU A 1 196 ? 37.277  -4.656  43.396  1.00 12.91 ? 424  LEU A CD2 1 
ATOM   1540  N N   . ARG A 1 197 ? 33.737  -7.622  45.420  1.00 12.44 ? 425  ARG A N   1 
ATOM   1541  C CA  . ARG A 1 197 ? 32.282  -7.470  45.355  1.00 12.33 ? 425  ARG A CA  1 
ATOM   1542  C C   . ARG A 1 197 ? 31.645  -7.737  46.706  1.00 12.34 ? 425  ARG A C   1 
ATOM   1543  O O   . ARG A 1 197 ? 30.835  -6.950  47.189  1.00 12.83 ? 425  ARG A O   1 
ATOM   1544  C CB  . ARG A 1 197 ? 31.688  -8.435  44.329  1.00 12.49 ? 425  ARG A CB  1 
ATOM   1545  C CG  . ARG A 1 197 ? 30.158  -8.337  44.141  1.00 12.96 ? 425  ARG A CG  1 
ATOM   1546  C CD  . ARG A 1 197 ? 29.758  -7.057  43.430  1.00 13.45 ? 425  ARG A CD  1 
ATOM   1547  N NE  . ARG A 1 197 ? 30.445  -6.901  42.141  1.00 14.16 ? 425  ARG A NE  1 
ATOM   1548  C CZ  . ARG A 1 197 ? 30.002  -7.380  40.981  1.00 13.57 ? 425  ARG A CZ  1 
ATOM   1549  N NH1 . ARG A 1 197 ? 28.858  -8.047  40.925  1.00 14.04 ? 425  ARG A NH1 1 
ATOM   1550  N NH2 . ARG A 1 197 ? 30.697  -7.178  39.870  1.00 12.82 ? 425  ARG A NH2 1 
ATOM   1551  N N   . GLN A 1 198 ? 31.999  -8.868  47.300  1.00 12.33 ? 426  GLN A N   1 
ATOM   1552  C CA  . GLN A 1 198 ? 31.467  -9.266  48.596  1.00 12.14 ? 426  GLN A CA  1 
ATOM   1553  C C   . GLN A 1 198 ? 31.744  -8.172  49.605  1.00 12.59 ? 426  GLN A C   1 
ATOM   1554  O O   . GLN A 1 198 ? 30.852  -7.734  50.344  1.00 12.75 ? 426  GLN A O   1 
ATOM   1555  C CB  . GLN A 1 198 ? 32.131  -10.565 49.040  1.00 12.17 ? 426  GLN A CB  1 
ATOM   1556  C CG  . GLN A 1 198 ? 31.999  -10.888 50.522  1.00 12.04 ? 426  GLN A CG  1 
ATOM   1557  C CD  . GLN A 1 198 ? 32.542  -12.255 50.865  1.00 10.89 ? 426  GLN A CD  1 
ATOM   1558  O OE1 . GLN A 1 198 ? 32.803  -13.062 49.987  1.00 8.50  ? 426  GLN A OE1 1 
ATOM   1559  N NE2 . GLN A 1 198 ? 32.711  -12.519 52.150  1.00 9.67  ? 426  GLN A NE2 1 
ATOM   1560  N N   . THR A 1 199 ? 32.994  -7.732  49.613  1.00 12.94 ? 427  THR A N   1 
ATOM   1561  C CA  . THR A 1 199 ? 33.456  -6.735  50.562  1.00 13.17 ? 427  THR A CA  1 
ATOM   1562  C C   . THR A 1 199 ? 32.726  -5.419  50.354  1.00 13.33 ? 427  THR A C   1 
ATOM   1563  O O   . THR A 1 199 ? 32.286  -4.816  51.331  1.00 13.60 ? 427  THR A O   1 
ATOM   1564  C CB  . THR A 1 199 ? 34.993  -6.530  50.471  1.00 13.16 ? 427  THR A CB  1 
ATOM   1565  O OG1 . THR A 1 199 ? 35.660  -7.770  50.745  1.00 13.77 ? 427  THR A OG1 1 
ATOM   1566  C CG2 . THR A 1 199 ? 35.456  -5.499  51.473  1.00 13.02 ? 427  THR A CG2 1 
ATOM   1567  N N   . SER A 1 200 ? 32.593  -4.975  49.101  1.00 13.42 ? 428  SER A N   1 
ATOM   1568  C CA  . SER A 1 200 ? 31.877  -3.735  48.819  1.00 13.73 ? 428  SER A CA  1 
ATOM   1569  C C   . SER A 1 200 ? 30.478  -3.763  49.444  1.00 14.00 ? 428  SER A C   1 
ATOM   1570  O O   . SER A 1 200 ? 30.105  -2.880  50.237  1.00 14.18 ? 428  SER A O   1 
ATOM   1571  C CB  . SER A 1 200 ? 31.742  -3.508  47.320  1.00 13.86 ? 428  SER A CB  1 
ATOM   1572  O OG  . SER A 1 200 ? 30.519  -2.826  47.022  1.00 14.88 ? 428  SER A OG  1 
ATOM   1573  N N   . THR A 1 201 ? 29.713  -4.790  49.083  1.00 13.94 ? 429  THR A N   1 
ATOM   1574  C CA  . THR A 1 201 ? 28.362  -4.962  49.594  1.00 13.82 ? 429  THR A CA  1 
ATOM   1575  C C   . THR A 1 201 ? 28.346  -4.905  51.126  1.00 14.22 ? 429  THR A C   1 
ATOM   1576  O O   . THR A 1 201 ? 27.447  -4.301  51.699  1.00 14.32 ? 429  THR A O   1 
ATOM   1577  C CB  . THR A 1 201 ? 27.745  -6.286  49.079  1.00 13.68 ? 429  THR A CB  1 
ATOM   1578  O OG1 . THR A 1 201 ? 27.925  -6.381  47.663  1.00 13.62 ? 429  THR A OG1 1 
ATOM   1579  C CG2 . THR A 1 201 ? 26.287  -6.347  49.359  1.00 12.81 ? 429  THR A CG2 1 
ATOM   1580  N N   . LYS A 1 202 ? 29.326  -5.534  51.784  1.00 14.56 ? 430  LYS A N   1 
ATOM   1581  C CA  . LYS A 1 202 ? 29.463  -5.456  53.250  1.00 14.69 ? 430  LYS A CA  1 
ATOM   1582  C C   . LYS A 1 202 ? 29.498  -3.995  53.640  1.00 14.81 ? 430  LYS A C   1 
ATOM   1583  O O   . LYS A 1 202 ? 28.758  -3.541  54.513  1.00 14.70 ? 430  LYS A O   1 
ATOM   1584  C CB  . LYS A 1 202 ? 30.772  -6.112  53.759  1.00 14.71 ? 430  LYS A CB  1 
ATOM   1585  C CG  . LYS A 1 202 ? 30.632  -7.420  54.532  1.00 14.72 ? 430  LYS A CG  1 
ATOM   1586  C CD  . LYS A 1 202 ? 30.684  -8.633  53.597  1.00 15.75 ? 430  LYS A CD  1 
ATOM   1587  C CE  . LYS A 1 202 ? 29.906  -9.846  54.132  1.00 16.04 ? 430  LYS A CE  1 
ATOM   1588  N NZ  . LYS A 1 202 ? 29.657  -10.860 53.046  1.00 15.21 ? 430  LYS A NZ  1 
ATOM   1589  N N   . ALA A 1 203 ? 30.389  -3.270  52.983  1.00 14.96 ? 431  ALA A N   1 
ATOM   1590  C CA  . ALA A 1 203 ? 30.640  -1.890  53.330  1.00 15.40 ? 431  ALA A CA  1 
ATOM   1591  C C   . ALA A 1 203 ? 29.351  -1.120  53.190  1.00 15.48 ? 431  ALA A C   1 
ATOM   1592  O O   . ALA A 1 203 ? 28.873  -0.542  54.145  1.00 15.58 ? 431  ALA A O   1 
ATOM   1593  C CB  . ALA A 1 203 ? 31.745  -1.292  52.433  1.00 15.30 ? 431  ALA A CB  1 
ATOM   1594  N N   . VAL A 1 204 ? 28.774  -1.160  51.997  1.00 15.90 ? 432  VAL A N   1 
ATOM   1595  C CA  . VAL A 1 204 ? 27.534  -0.443  51.708  1.00 16.17 ? 432  VAL A CA  1 
ATOM   1596  C C   . VAL A 1 204 ? 26.444  -0.793  52.722  1.00 16.75 ? 432  VAL A C   1 
ATOM   1597  O O   . VAL A 1 204 ? 25.629  0.044   53.079  1.00 16.81 ? 432  VAL A O   1 
ATOM   1598  C CB  . VAL A 1 204 ? 27.025  -0.748  50.289  1.00 16.00 ? 432  VAL A CB  1 
ATOM   1599  C CG1 . VAL A 1 204 ? 25.745  -0.014  50.033  1.00 15.72 ? 432  VAL A CG1 1 
ATOM   1600  C CG2 . VAL A 1 204 ? 28.077  -0.373  49.245  1.00 15.76 ? 432  VAL A CG2 1 
ATOM   1601  N N   . GLN A 1 205 ? 26.437  -2.037  53.182  1.00 17.70 ? 433  GLN A N   1 
ATOM   1602  C CA  . GLN A 1 205 ? 25.517  -2.467  54.222  1.00 18.46 ? 433  GLN A CA  1 
ATOM   1603  C C   . GLN A 1 205 ? 25.833  -1.654  55.465  1.00 18.85 ? 433  GLN A C   1 
ATOM   1604  O O   . GLN A 1 205 ? 25.023  -0.835  55.909  1.00 19.03 ? 433  GLN A O   1 
ATOM   1605  C CB  . GLN A 1 205 ? 25.696  -3.964  54.515  1.00 18.92 ? 433  GLN A CB  1 
ATOM   1606  C CG  . GLN A 1 205 ? 24.421  -4.824  54.457  1.00 19.83 ? 433  GLN A CG  1 
ATOM   1607  C CD  . GLN A 1 205 ? 24.637  -6.124  53.664  1.00 20.55 ? 433  GLN A CD  1 
ATOM   1608  O OE1 . GLN A 1 205 ? 25.766  -6.628  53.549  1.00 21.59 ? 433  GLN A OE1 1 
ATOM   1609  N NE2 . GLN A 1 205 ? 23.557  -6.655  53.100  1.00 19.88 ? 433  GLN A NE2 1 
ATOM   1610  N N   . HIS A 1 206 ? 27.036  -1.859  56.000  1.00 19.25 ? 434  HIS A N   1 
ATOM   1611  C CA  . HIS A 1 206 ? 27.434  -1.251  57.267  1.00 19.35 ? 434  HIS A CA  1 
ATOM   1612  C C   . HIS A 1 206 ? 27.005  0.196   57.286  1.00 20.21 ? 434  HIS A C   1 
ATOM   1613  O O   . HIS A 1 206 ? 26.423  0.659   58.261  1.00 20.50 ? 434  HIS A O   1 
ATOM   1614  C CB  . HIS A 1 206 ? 28.945  -1.347  57.475  1.00 18.96 ? 434  HIS A CB  1 
ATOM   1615  C CG  . HIS A 1 206 ? 29.384  -1.031  58.867  1.00 18.35 ? 434  HIS A CG  1 
ATOM   1616  N ND1 . HIS A 1 206 ? 29.369  -1.964  59.881  1.00 18.02 ? 434  HIS A ND1 1 
ATOM   1617  C CD2 . HIS A 1 206 ? 29.863  0.111   59.415  1.00 18.13 ? 434  HIS A CD2 1 
ATOM   1618  C CE1 . HIS A 1 206 ? 29.811  -1.407  60.994  1.00 17.90 ? 434  HIS A CE1 1 
ATOM   1619  N NE2 . HIS A 1 206 ? 30.120  -0.148  60.738  1.00 17.89 ? 434  HIS A NE2 1 
ATOM   1620  N N   . PHE A 1 207 ? 27.262  0.899   56.187  1.00 21.37 ? 435  PHE A N   1 
ATOM   1621  C CA  . PHE A 1 207 ? 27.035  2.338   56.135  1.00 22.28 ? 435  PHE A CA  1 
ATOM   1622  C C   . PHE A 1 207 ? 25.563  2.701   56.329  1.00 23.17 ? 435  PHE A C   1 
ATOM   1623  O O   . PHE A 1 207 ? 25.248  3.555   57.162  1.00 23.32 ? 435  PHE A O   1 
ATOM   1624  C CB  . PHE A 1 207 ? 27.554  2.940   54.832  1.00 22.35 ? 435  PHE A CB  1 
ATOM   1625  C CG  . PHE A 1 207 ? 27.211  4.386   54.672  1.00 22.23 ? 435  PHE A CG  1 
ATOM   1626  C CD1 . PHE A 1 207 ? 25.988  4.765   54.127  1.00 22.94 ? 435  PHE A CD1 1 
ATOM   1627  C CD2 . PHE A 1 207 ? 28.088  5.366   55.092  1.00 22.06 ? 435  PHE A CD2 1 
ATOM   1628  C CE1 . PHE A 1 207 ? 25.650  6.105   53.988  1.00 22.94 ? 435  PHE A CE1 1 
ATOM   1629  C CE2 . PHE A 1 207 ? 27.765  6.707   54.954  1.00 22.74 ? 435  PHE A CE2 1 
ATOM   1630  C CZ  . PHE A 1 207 ? 26.538  7.076   54.403  1.00 22.99 ? 435  PHE A CZ  1 
ATOM   1631  N N   . TYR A 1 208 ? 24.674  2.078   55.558  1.00 24.15 ? 436  TYR A N   1 
ATOM   1632  C CA  . TYR A 1 208 ? 23.241  2.333   55.716  1.00 25.24 ? 436  TYR A CA  1 
ATOM   1633  C C   . TYR A 1 208 ? 22.760  1.826   57.086  1.00 25.46 ? 436  TYR A C   1 
ATOM   1634  O O   . TYR A 1 208 ? 21.858  2.416   57.705  1.00 25.40 ? 436  TYR A O   1 
ATOM   1635  C CB  . TYR A 1 208 ? 22.422  1.713   54.567  1.00 26.05 ? 436  TYR A CB  1 
ATOM   1636  C CG  . TYR A 1 208 ? 22.359  2.564   53.293  1.00 27.37 ? 436  TYR A CG  1 
ATOM   1637  C CD1 . TYR A 1 208 ? 21.900  3.901   53.332  1.00 28.30 ? 436  TYR A CD1 1 
ATOM   1638  C CD2 . TYR A 1 208 ? 22.733  2.032   52.043  1.00 27.99 ? 436  TYR A CD2 1 
ATOM   1639  C CE1 . TYR A 1 208 ? 21.836  4.694   52.160  1.00 28.09 ? 436  TYR A CE1 1 
ATOM   1640  C CE2 . TYR A 1 208 ? 22.672  2.815   50.864  1.00 28.16 ? 436  TYR A CE2 1 
ATOM   1641  C CZ  . TYR A 1 208 ? 22.218  4.143   50.932  1.00 28.16 ? 436  TYR A CZ  1 
ATOM   1642  O OH  . TYR A 1 208 ? 22.154  4.916   49.785  1.00 28.09 ? 436  TYR A OH  1 
ATOM   1643  N N   . ASN A 1 209 ? 23.398  0.756   57.560  1.00 25.74 ? 437  ASN A N   1 
ATOM   1644  C CA  . ASN A 1 209 ? 23.097  0.163   58.868  1.00 26.15 ? 437  ASN A CA  1 
ATOM   1645  C C   . ASN A 1 209 ? 23.363  1.067   60.080  1.00 26.45 ? 437  ASN A C   1 
ATOM   1646  O O   . ASN A 1 209 ? 22.865  0.793   61.170  1.00 26.49 ? 437  ASN A O   1 
ATOM   1647  C CB  . ASN A 1 209 ? 23.870  -1.157  59.047  1.00 26.11 ? 437  ASN A CB  1 
ATOM   1648  C CG  . ASN A 1 209 ? 23.144  -2.346  58.453  1.00 26.11 ? 437  ASN A CG  1 
ATOM   1649  O OD1 . ASN A 1 209 ? 22.170  -2.832  59.028  1.00 25.84 ? 437  ASN A OD1 1 
ATOM   1650  N ND2 . ASN A 1 209 ? 23.623  -2.833  57.305  1.00 26.05 ? 437  ASN A ND2 1 
ATOM   1651  N N   . ILE A 1 210 ? 24.153  2.122   59.905  1.00 26.91 ? 438  ILE A N   1 
ATOM   1652  C CA  . ILE A 1 210 ? 24.446  3.038   61.012  1.00 27.23 ? 438  ILE A CA  1 
ATOM   1653  C C   . ILE A 1 210 ? 23.788  4.410   60.864  1.00 27.57 ? 438  ILE A C   1 
ATOM   1654  O O   . ILE A 1 210 ? 23.826  5.216   61.793  1.00 27.52 ? 438  ILE A O   1 
ATOM   1655  C CB  . ILE A 1 210 ? 25.970  3.192   61.243  1.00 27.31 ? 438  ILE A CB  1 
ATOM   1656  C CG1 . ILE A 1 210 ? 26.625  4.041   60.148  1.00 26.77 ? 438  ILE A CG1 1 
ATOM   1657  C CG2 . ILE A 1 210 ? 26.633  1.805   61.331  1.00 27.67 ? 438  ILE A CG2 1 
ATOM   1658  C CD1 . ILE A 1 210 ? 28.066  4.375   60.442  1.00 26.76 ? 438  ILE A CD1 1 
ATOM   1659  N N   . LYS A 1 211 ? 23.198  4.686   59.704  1.00 27.93 ? 439  LYS A N   1 
ATOM   1660  C CA  . LYS A 1 211 ? 22.346  5.865   59.566  1.00 28.45 ? 439  LYS A CA  1 
ATOM   1661  C C   . LYS A 1 211 ? 21.074  5.661   60.393  1.00 28.72 ? 439  LYS A C   1 
ATOM   1662  O O   . LYS A 1 211 ? 20.704  6.504   61.212  1.00 28.95 ? 439  LYS A O   1 
ATOM   1663  C CB  . LYS A 1 211 ? 21.996  6.123   58.097  1.00 28.58 ? 439  LYS A CB  1 
ATOM   1664  C CG  . LYS A 1 211 ? 23.189  6.520   57.240  1.00 29.31 ? 439  LYS A CG  1 
ATOM   1665  C CD  . LYS A 1 211 ? 23.788  7.893   57.639  1.00 30.44 ? 439  LYS A CD  1 
ATOM   1666  C CE  . LYS A 1 211 ? 23.418  9.020   56.659  1.00 30.68 ? 439  LYS A CE  1 
ATOM   1667  N NZ  . LYS A 1 211 ? 24.168  8.911   55.366  1.00 30.71 ? 439  LYS A NZ  1 
ATOM   1668  N N   . LEU A 1 212 ? 20.432  4.514   60.192  1.00 29.05 ? 440  LEU A N   1 
ATOM   1669  C CA  . LEU A 1 212 ? 19.211  4.159   60.917  1.00 29.20 ? 440  LEU A CA  1 
ATOM   1670  C C   . LEU A 1 212 ? 19.530  3.873   62.385  1.00 29.18 ? 440  LEU A C   1 
ATOM   1671  O O   . LEU A 1 212 ? 18.698  4.117   63.264  1.00 29.19 ? 440  LEU A O   1 
ATOM   1672  C CB  . LEU A 1 212 ? 18.519  2.963   60.247  1.00 29.38 ? 440  LEU A CB  1 
ATOM   1673  C CG  . LEU A 1 212 ? 17.857  3.240   58.880  1.00 29.70 ? 440  LEU A CG  1 
ATOM   1674  C CD1 . LEU A 1 212 ? 18.501  4.417   58.120  1.00 29.80 ? 440  LEU A CD1 1 
ATOM   1675  C CD2 . LEU A 1 212 ? 17.849  1.979   58.001  1.00 29.47 ? 440  LEU A CD2 1 
ATOM   1676  N N   . GLU A 1 213 ? 20.737  3.368   62.643  1.00 29.17 ? 441  GLU A N   1 
ATOM   1677  C CA  . GLU A 1 213 ? 21.306  3.390   63.990  1.00 29.33 ? 441  GLU A CA  1 
ATOM   1678  C C   . GLU A 1 213 ? 21.986  4.752   64.187  1.00 29.23 ? 441  GLU A C   1 
ATOM   1679  O O   . GLU A 1 213 ? 23.202  4.823   64.350  1.00 29.43 ? 441  GLU A O   1 
ATOM   1680  C CB  . GLU A 1 213 ? 22.314  2.247   64.179  1.00 29.33 ? 441  GLU A CB  1 
ATOM   1681  C CG  . GLU A 1 213 ? 22.710  2.000   65.642  1.00 29.71 ? 441  GLU A CG  1 
ATOM   1682  C CD  . GLU A 1 213 ? 23.933  1.106   65.808  1.00 29.71 ? 441  GLU A CD  1 
ATOM   1683  O OE1 . GLU A 1 213 ? 24.534  0.687   64.788  1.00 30.51 ? 441  GLU A OE1 1 
ATOM   1684  O OE2 . GLU A 1 213 ? 24.291  0.822   66.975  1.00 29.78 ? 441  GLU A OE2 1 
ATOM   1685  N N   . GLY A 1 214 ? 21.200  5.827   64.167  1.00 29.08 ? 442  GLY A N   1 
ATOM   1686  C CA  . GLY A 1 214 ? 21.730  7.196   64.134  1.00 29.00 ? 442  GLY A CA  1 
ATOM   1687  C C   . GLY A 1 214 ? 22.401  7.682   65.409  1.00 28.98 ? 442  GLY A C   1 
ATOM   1688  O O   . GLY A 1 214 ? 21.912  8.604   66.069  1.00 28.93 ? 442  GLY A O   1 
ATOM   1689  N N   . LYS A 1 215 ? 23.532  7.063   65.742  1.00 28.97 ? 443  LYS A N   1 
ATOM   1690  C CA  . LYS A 1 215 ? 24.395  7.513   66.835  1.00 29.00 ? 443  LYS A CA  1 
ATOM   1691  C C   . LYS A 1 215 ? 25.070  8.840   66.451  1.00 28.94 ? 443  LYS A C   1 
ATOM   1692  O O   . LYS A 1 215 ? 25.332  9.688   67.309  1.00 29.13 ? 443  LYS A O   1 
ATOM   1693  C CB  . LYS A 1 215 ? 25.489  6.468   67.128  1.00 29.06 ? 443  LYS A CB  1 
ATOM   1694  C CG  . LYS A 1 215 ? 25.011  5.033   67.482  1.00 29.13 ? 443  LYS A CG  1 
ATOM   1695  C CD  . LYS A 1 215 ? 25.072  4.741   68.988  1.00 29.04 ? 443  LYS A CD  1 
ATOM   1696  C CE  . LYS A 1 215 ? 25.074  3.242   69.285  1.00 28.71 ? 443  LYS A CE  1 
ATOM   1697  N NZ  . LYS A 1 215 ? 26.407  2.617   69.079  1.00 28.25 ? 443  LYS A NZ  1 
ATOM   1698  N N   . VAL A 1 216 ? 25.321  9.002   65.150  1.00 28.81 ? 444  VAL A N   1 
ATOM   1699  C CA  . VAL A 1 216 ? 26.185  10.058  64.596  1.00 28.73 ? 444  VAL A CA  1 
ATOM   1700  C C   . VAL A 1 216 ? 25.869  11.490  65.032  1.00 28.60 ? 444  VAL A C   1 
ATOM   1701  O O   . VAL A 1 216 ? 26.737  12.161  65.590  1.00 28.63 ? 444  VAL A O   1 
ATOM   1702  C CB  . VAL A 1 216 ? 26.203  10.003  63.041  1.00 28.90 ? 444  VAL A CB  1 
ATOM   1703  C CG1 . VAL A 1 216 ? 26.859  11.268  62.453  1.00 28.74 ? 444  VAL A CG1 1 
ATOM   1704  C CG2 . VAL A 1 216 ? 26.900  8.721   62.556  1.00 28.65 ? 444  VAL A CG2 1 
ATOM   1705  N N   . PRO A 1 217 ? 24.642  11.975  64.764  1.00 28.50 ? 445  PRO A N   1 
ATOM   1706  C CA  . PRO A 1 217 ? 24.339  13.348  65.178  1.00 28.41 ? 445  PRO A CA  1 
ATOM   1707  C C   . PRO A 1 217 ? 24.300  13.522  66.695  1.00 28.27 ? 445  PRO A C   1 
ATOM   1708  O O   . PRO A 1 217 ? 24.539  14.627  67.187  1.00 28.32 ? 445  PRO A O   1 
ATOM   1709  C CB  . PRO A 1 217 ? 22.957  13.611  64.568  1.00 28.45 ? 445  PRO A CB  1 
ATOM   1710  C CG  . PRO A 1 217 ? 22.353  12.273  64.396  1.00 28.61 ? 445  PRO A CG  1 
ATOM   1711  C CD  . PRO A 1 217 ? 23.489  11.336  64.104  1.00 28.54 ? 445  PRO A CD  1 
ATOM   1712  N N   . MET A 1 218 ? 24.002  12.444  67.423  1.00 28.12 ? 446  MET A N   1 
ATOM   1713  C CA  . MET A 1 218 ? 23.994  12.496  68.884  1.00 27.92 ? 446  MET A CA  1 
ATOM   1714  C C   . MET A 1 218 ? 25.380  12.887  69.396  1.00 27.92 ? 446  MET A C   1 
ATOM   1715  O O   . MET A 1 218 ? 25.502  13.798  70.233  1.00 27.87 ? 446  MET A O   1 
ATOM   1716  C CB  . MET A 1 218 ? 23.509  11.169  69.514  1.00 27.99 ? 446  MET A CB  1 
ATOM   1717  C CG  . MET A 1 218 ? 22.037  11.204  69.987  1.00 27.86 ? 446  MET A CG  1 
ATOM   1718  S SD  . MET A 1 218 ? 21.612  10.041  71.303  1.00 27.19 ? 446  MET A SD  1 
ATOM   1719  C CE  . MET A 1 218 ? 21.812  8.471   70.430  1.00 27.26 ? 446  MET A CE  1 
ATOM   1720  N N   . HIS A 1 219 ? 26.411  12.223  68.871  1.00 27.63 ? 447  HIS A N   1 
ATOM   1721  C CA  . HIS A 1 219 ? 27.800  12.523  69.239  1.00 27.63 ? 447  HIS A CA  1 
ATOM   1722  C C   . HIS A 1 219 ? 28.161  13.991  69.018  1.00 27.26 ? 447  HIS A C   1 
ATOM   1723  O O   . HIS A 1 219 ? 28.688  14.654  69.914  1.00 27.17 ? 447  HIS A O   1 
ATOM   1724  C CB  . HIS A 1 219 ? 28.765  11.643  68.443  1.00 27.87 ? 447  HIS A CB  1 
ATOM   1725  C CG  . HIS A 1 219 ? 30.183  12.136  68.446  1.00 28.53 ? 447  HIS A CG  1 
ATOM   1726  N ND1 . HIS A 1 219 ? 30.635  13.110  67.579  1.00 28.72 ? 447  HIS A ND1 1 
ATOM   1727  C CD2 . HIS A 1 219 ? 31.252  11.779  69.199  1.00 28.85 ? 447  HIS A CD2 1 
ATOM   1728  C CE1 . HIS A 1 219 ? 31.916  13.340  67.805  1.00 28.72 ? 447  HIS A CE1 1 
ATOM   1729  N NE2 . HIS A 1 219 ? 32.316  12.544  68.782  1.00 29.05 ? 447  HIS A NE2 1 
ATOM   1730  N N   . LYS A 1 220 ? 27.878  14.487  67.820  1.00 26.92 ? 448  LYS A N   1 
ATOM   1731  C CA  . LYS A 1 220 ? 28.182  15.877  67.476  1.00 26.74 ? 448  LYS A CA  1 
ATOM   1732  C C   . LYS A 1 220 ? 27.484  16.861  68.420  1.00 26.46 ? 448  LYS A C   1 
ATOM   1733  O O   . LYS A 1 220 ? 28.026  17.922  68.717  1.00 26.44 ? 448  LYS A O   1 
ATOM   1734  C CB  . LYS A 1 220 ? 27.806  16.168  66.017  1.00 26.78 ? 448  LYS A CB  1 
ATOM   1735  C CG  . LYS A 1 220 ? 28.514  15.265  65.003  1.00 26.81 ? 448  LYS A CG  1 
ATOM   1736  C CD  . LYS A 1 220 ? 28.352  15.767  63.573  1.00 27.09 ? 448  LYS A CD  1 
ATOM   1737  C CE  . LYS A 1 220 ? 29.172  14.928  62.589  1.00 27.33 ? 448  LYS A CE  1 
ATOM   1738  N NZ  . LYS A 1 220 ? 29.237  15.543  61.231  1.00 27.39 ? 448  LYS A NZ  1 
ATOM   1739  N N   A LEU A 1 221 ? 26.295  16.493  68.891  0.70 26.38 ? 449  LEU A N   1 
ATOM   1740  N N   B LEU A 1 221 ? 26.288  16.499  68.886  0.30 26.32 ? 449  LEU A N   1 
ATOM   1741  C CA  A LEU A 1 221 ? 25.526  17.327  69.814  0.70 26.35 ? 449  LEU A CA  1 
ATOM   1742  C CA  B LEU A 1 221 ? 25.528  17.336  69.819  0.30 26.21 ? 449  LEU A CA  1 
ATOM   1743  C C   A LEU A 1 221 ? 26.079  17.315  71.245  0.70 26.17 ? 449  LEU A C   1 
ATOM   1744  C C   B LEU A 1 221 ? 26.117  17.327  71.232  0.30 26.12 ? 449  LEU A C   1 
ATOM   1745  O O   A LEU A 1 221 ? 25.981  18.317  71.958  0.70 25.99 ? 449  LEU A O   1 
ATOM   1746  O O   B LEU A 1 221 ? 26.082  18.349  71.922  0.30 26.04 ? 449  LEU A O   1 
ATOM   1747  C CB  A LEU A 1 221 ? 24.062  16.883  69.816  0.70 26.46 ? 449  LEU A CB  1 
ATOM   1748  C CB  B LEU A 1 221 ? 24.059  16.894  69.868  0.30 26.23 ? 449  LEU A CB  1 
ATOM   1749  C CG  A LEU A 1 221 ? 23.311  17.147  68.504  0.70 26.73 ? 449  LEU A CG  1 
ATOM   1750  C CG  B LEU A 1 221 ? 23.138  17.700  70.795  0.30 26.16 ? 449  LEU A CG  1 
ATOM   1751  C CD1 A LEU A 1 221 ? 22.216  16.103  68.271  0.70 26.70 ? 449  LEU A CD1 1 
ATOM   1752  C CD1 B LEU A 1 221 ? 23.059  19.154  70.349  0.30 26.09 ? 449  LEU A CD1 1 
ATOM   1753  C CD2 A LEU A 1 221 ? 22.736  18.576  68.478  0.70 26.95 ? 449  LEU A CD2 1 
ATOM   1754  C CD2 B LEU A 1 221 ? 21.747  17.088  70.861  0.30 26.15 ? 449  LEU A CD2 1 
ATOM   1755  N N   . PHE A 1 222 ? 26.638  16.179  71.665  1.00 26.04 ? 450  PHE A N   1 
ATOM   1756  C CA  . PHE A 1 222 ? 27.277  16.076  72.984  1.00 25.89 ? 450  PHE A CA  1 
ATOM   1757  C C   . PHE A 1 222 ? 28.457  17.033  73.013  1.00 25.76 ? 450  PHE A C   1 
ATOM   1758  O O   . PHE A 1 222 ? 28.534  17.920  73.863  1.00 25.65 ? 450  PHE A O   1 
ATOM   1759  C CB  . PHE A 1 222 ? 27.778  14.652  73.287  1.00 25.86 ? 450  PHE A CB  1 
ATOM   1760  C CG  . PHE A 1 222 ? 26.689  13.608  73.407  1.00 25.95 ? 450  PHE A CG  1 
ATOM   1761  C CD1 . PHE A 1 222 ? 25.340  13.949  73.432  1.00 26.09 ? 450  PHE A CD1 1 
ATOM   1762  C CD2 . PHE A 1 222 ? 27.028  12.267  73.526  1.00 25.99 ? 450  PHE A CD2 1 
ATOM   1763  C CE1 . PHE A 1 222 ? 24.357  12.969  73.544  1.00 25.95 ? 450  PHE A CE1 1 
ATOM   1764  C CE2 . PHE A 1 222 ? 26.043  11.290  73.644  1.00 25.97 ? 450  PHE A CE2 1 
ATOM   1765  C CZ  . PHE A 1 222 ? 24.711  11.644  73.652  1.00 25.66 ? 450  PHE A CZ  1 
ATOM   1766  N N   . LEU A 1 223 ? 29.359  16.848  72.053  1.00 25.71 ? 451  LEU A N   1 
ATOM   1767  C CA  . LEU A 1 223 ? 30.548  17.684  71.917  1.00 25.65 ? 451  LEU A CA  1 
ATOM   1768  C C   . LEU A 1 223 ? 30.177  19.156  71.862  1.00 25.50 ? 451  LEU A C   1 
ATOM   1769  O O   . LEU A 1 223 ? 30.853  19.994  72.456  1.00 25.46 ? 451  LEU A O   1 
ATOM   1770  C CB  . LEU A 1 223 ? 31.330  17.295  70.655  1.00 25.77 ? 451  LEU A CB  1 
ATOM   1771  C CG  . LEU A 1 223 ? 32.658  18.012  70.358  1.00 25.83 ? 451  LEU A CG  1 
ATOM   1772  C CD1 . LEU A 1 223 ? 33.707  17.693  71.420  1.00 25.84 ? 451  LEU A CD1 1 
ATOM   1773  C CD2 . LEU A 1 223 ? 33.174  17.642  68.956  1.00 25.75 ? 451  LEU A CD2 1 
ATOM   1774  N N   . GLU A 1 224 ? 29.098  19.462  71.149  1.00 25.41 ? 452  GLU A N   1 
ATOM   1775  C CA  . GLU A 1 224 ? 28.650  20.841  70.991  1.00 25.39 ? 452  GLU A CA  1 
ATOM   1776  C C   . GLU A 1 224 ? 28.309  21.458  72.344  1.00 25.09 ? 452  GLU A C   1 
ATOM   1777  O O   . GLU A 1 224 ? 28.795  22.540  72.669  1.00 25.03 ? 452  GLU A O   1 
ATOM   1778  C CB  . GLU A 1 224 ? 27.452  20.908  70.041  1.00 25.44 ? 452  GLU A CB  1 
ATOM   1779  C CG  . GLU A 1 224 ? 27.221  22.284  69.419  1.00 25.65 ? 452  GLU A CG  1 
ATOM   1780  C CD  . GLU A 1 224 ? 26.309  22.242  68.195  1.00 25.64 ? 452  GLU A CD  1 
ATOM   1781  O OE1 . GLU A 1 224 ? 25.949  21.128  67.743  1.00 25.44 ? 452  GLU A OE1 1 
ATOM   1782  O OE2 . GLU A 1 224 ? 25.954  23.331  67.687  1.00 25.68 ? 452  GLU A OE2 1 
ATOM   1783  N N   . MET A 1 225 ? 27.500  20.754  73.136  1.00 24.90 ? 453  MET A N   1 
ATOM   1784  C CA  . MET A 1 225 ? 27.152  21.204  74.495  1.00 24.78 ? 453  MET A CA  1 
ATOM   1785  C C   . MET A 1 225 ? 28.352  21.208  75.438  1.00 24.55 ? 453  MET A C   1 
ATOM   1786  O O   . MET A 1 225 ? 28.548  22.156  76.198  1.00 24.42 ? 453  MET A O   1 
ATOM   1787  C CB  . MET A 1 225 ? 26.058  20.325  75.121  1.00 24.83 ? 453  MET A CB  1 
ATOM   1788  C CG  . MET A 1 225 ? 24.641  20.879  75.033  1.00 25.04 ? 453  MET A CG  1 
ATOM   1789  S SD  . MET A 1 225 ? 23.802  20.365  73.521  1.00 25.77 ? 453  MET A SD  1 
ATOM   1790  C CE  . MET A 1 225 ? 23.149  18.771  73.985  1.00 25.55 ? 453  MET A CE  1 
ATOM   1791  N N   . LEU A 1 226 ? 29.141  20.138  75.387  1.00 24.39 ? 454  LEU A N   1 
ATOM   1792  C CA  . LEU A 1 226 ? 30.243  19.935  76.334  1.00 24.21 ? 454  LEU A CA  1 
ATOM   1793  C C   . LEU A 1 226 ? 31.448  20.847  76.101  1.00 24.21 ? 454  LEU A C   1 
ATOM   1794  O O   . LEU A 1 226 ? 32.309  20.971  76.969  1.00 24.16 ? 454  LEU A O   1 
ATOM   1795  C CB  . LEU A 1 226 ? 30.700  18.468  76.314  1.00 24.07 ? 454  LEU A CB  1 
ATOM   1796  C CG  . LEU A 1 226 ? 29.829  17.475  77.086  1.00 23.61 ? 454  LEU A CG  1 
ATOM   1797  C CD1 . LEU A 1 226 ? 30.337  16.061  76.887  1.00 22.93 ? 454  LEU A CD1 1 
ATOM   1798  C CD2 . LEU A 1 226 ? 29.796  17.829  78.565  1.00 23.16 ? 454  LEU A CD2 1 
ATOM   1799  N N   . GLU A 1 227 ? 31.504  21.485  74.937  1.00 24.32 ? 455  GLU A N   1 
ATOM   1800  C CA  . GLU A 1 227 ? 32.657  22.289  74.551  1.00 24.29 ? 455  GLU A CA  1 
ATOM   1801  C C   . GLU A 1 227 ? 32.237  23.727  74.240  1.00 24.08 ? 455  GLU A C   1 
ATOM   1802  O O   . GLU A 1 227 ? 32.719  24.672  74.875  1.00 23.66 ? 455  GLU A O   1 
ATOM   1803  C CB  . GLU A 1 227 ? 33.338  21.644  73.337  1.00 24.21 ? 455  GLU A CB  1 
ATOM   1804  C CG  . GLU A 1 227 ? 34.777  22.085  73.119  1.00 24.30 ? 455  GLU A CG  1 
ATOM   1805  C CD  . GLU A 1 227 ? 35.326  21.683  71.759  1.00 24.35 ? 455  GLU A CD  1 
ATOM   1806  O OE1 . GLU A 1 227 ? 34.601  21.038  70.971  1.00 24.47 ? 455  GLU A OE1 1 
ATOM   1807  O OE2 . GLU A 1 227 ? 36.494  22.020  71.475  1.00 24.62 ? 455  GLU A OE2 1 
ATOM   1808  N N   . PRO B 1 5   ? 38.520  -14.875 112.203 1.00 28.03 ? 233  PRO B N   1 
ATOM   1809  C CA  . PRO B 1 5   ? 37.496  -15.873 111.895 1.00 28.01 ? 233  PRO B CA  1 
ATOM   1810  C C   . PRO B 1 5   ? 36.677  -15.474 110.679 1.00 27.87 ? 233  PRO B C   1 
ATOM   1811  O O   . PRO B 1 5   ? 36.879  -14.390 110.130 1.00 28.04 ? 233  PRO B O   1 
ATOM   1812  C CB  . PRO B 1 5   ? 36.627  -15.895 113.161 1.00 27.98 ? 233  PRO B CB  1 
ATOM   1813  C CG  . PRO B 1 5   ? 37.539  -15.444 114.244 1.00 28.02 ? 233  PRO B CG  1 
ATOM   1814  C CD  . PRO B 1 5   ? 38.434  -14.418 113.597 1.00 28.15 ? 233  PRO B CD  1 
ATOM   1815  N N   . TYR B 1 6   ? 35.765  -16.344 110.261 1.00 27.72 ? 234  TYR B N   1 
ATOM   1816  C CA  . TYR B 1 6   ? 34.968  -16.093 109.058 1.00 27.60 ? 234  TYR B CA  1 
ATOM   1817  C C   . TYR B 1 6   ? 33.468  -16.063 109.282 1.00 26.42 ? 234  TYR B C   1 
ATOM   1818  O O   . TYR B 1 6   ? 32.958  -16.541 110.298 1.00 26.61 ? 234  TYR B O   1 
ATOM   1819  C CB  . TYR B 1 6   ? 35.295  -17.132 107.988 1.00 28.46 ? 234  TYR B CB  1 
ATOM   1820  C CG  . TYR B 1 6   ? 36.346  -16.665 107.008 1.00 29.76 ? 234  TYR B CG  1 
ATOM   1821  C CD1 . TYR B 1 6   ? 37.485  -15.970 107.447 1.00 30.52 ? 234  TYR B CD1 1 
ATOM   1822  C CD2 . TYR B 1 6   ? 36.214  -16.923 105.651 1.00 30.04 ? 234  TYR B CD2 1 
ATOM   1823  C CE1 . TYR B 1 6   ? 38.450  -15.543 106.563 1.00 30.33 ? 234  TYR B CE1 1 
ATOM   1824  C CE2 . TYR B 1 6   ? 37.178  -16.504 104.759 1.00 30.57 ? 234  TYR B CE2 1 
ATOM   1825  C CZ  . TYR B 1 6   ? 38.296  -15.813 105.218 1.00 30.42 ? 234  TYR B CZ  1 
ATOM   1826  O OH  . TYR B 1 6   ? 39.264  -15.393 104.328 1.00 30.86 ? 234  TYR B OH  1 
ATOM   1827  N N   . ASN B 1 7   ? 32.783  -15.486 108.300 1.00 24.96 ? 235  ASN B N   1 
ATOM   1828  C CA  . ASN B 1 7   ? 31.326  -15.441 108.248 1.00 23.72 ? 235  ASN B CA  1 
ATOM   1829  C C   . ASN B 1 7   ? 30.786  -16.835 107.913 1.00 22.34 ? 235  ASN B C   1 
ATOM   1830  O O   . ASN B 1 7   ? 31.365  -17.542 107.100 1.00 21.85 ? 235  ASN B O   1 
ATOM   1831  C CB  . ASN B 1 7   ? 30.887  -14.397 107.208 1.00 23.57 ? 235  ASN B CB  1 
ATOM   1832  C CG  . ASN B 1 7   ? 29.409  -14.444 106.919 1.00 23.85 ? 235  ASN B CG  1 
ATOM   1833  O OD1 . ASN B 1 7   ? 28.893  -15.442 106.421 1.00 24.74 ? 235  ASN B OD1 1 
ATOM   1834  N ND2 . ASN B 1 7   ? 28.715  -13.360 107.221 1.00 24.69 ? 235  ASN B ND2 1 
ATOM   1835  N N   . LYS B 1 8   ? 29.679  -17.219 108.538 1.00 20.98 ? 236  LYS B N   1 
ATOM   1836  C CA  . LYS B 1 8   ? 29.175  -18.585 108.412 1.00 20.08 ? 236  LYS B CA  1 
ATOM   1837  C C   . LYS B 1 8   ? 28.672  -18.891 107.016 1.00 19.13 ? 236  LYS B C   1 
ATOM   1838  O O   . LYS B 1 8   ? 28.993  -19.930 106.456 1.00 19.37 ? 236  LYS B O   1 
ATOM   1839  C CB  . LYS B 1 8   ? 28.083  -18.873 109.442 1.00 20.00 ? 236  LYS B CB  1 
ATOM   1840  C CG  . LYS B 1 8   ? 28.627  -19.168 110.829 1.00 19.97 ? 236  LYS B CG  1 
ATOM   1841  C CD  . LYS B 1 8   ? 27.507  -19.420 111.828 1.00 20.33 ? 236  LYS B CD  1 
ATOM   1842  C CE  . LYS B 1 8   ? 28.026  -19.446 113.267 1.00 20.57 ? 236  LYS B CE  1 
ATOM   1843  N NZ  . LYS B 1 8   ? 26.928  -19.489 114.273 1.00 20.38 ? 236  LYS B NZ  1 
ATOM   1844  N N   . ILE B 1 9   ? 27.889  -17.987 106.455 1.00 18.17 ? 237  ILE B N   1 
ATOM   1845  C CA  . ILE B 1 9   ? 27.360  -18.161 105.101 1.00 17.39 ? 237  ILE B CA  1 
ATOM   1846  C C   . ILE B 1 9   ? 28.476  -18.278 104.062 1.00 17.02 ? 237  ILE B C   1 
ATOM   1847  O O   . ILE B 1 9   ? 28.486  -19.195 103.246 1.00 16.66 ? 237  ILE B O   1 
ATOM   1848  C CB  . ILE B 1 9   ? 26.419  -16.994 104.737 1.00 17.19 ? 237  ILE B CB  1 
ATOM   1849  C CG1 . ILE B 1 9   ? 25.087  -17.165 105.482 1.00 16.63 ? 237  ILE B CG1 1 
ATOM   1850  C CG2 . ILE B 1 9   ? 26.207  -16.925 103.244 1.00 16.48 ? 237  ILE B CG2 1 
ATOM   1851  C CD1 . ILE B 1 9   ? 24.302  -15.912 105.669 1.00 15.05 ? 237  ILE B CD1 1 
ATOM   1852  N N   . VAL B 1 10  ? 29.413  -17.340 104.111 1.00 16.69 ? 238  VAL B N   1 
ATOM   1853  C CA  . VAL B 1 10  ? 30.567  -17.341 103.220 1.00 16.32 ? 238  VAL B CA  1 
ATOM   1854  C C   . VAL B 1 10  ? 31.285  -18.679 103.275 1.00 16.17 ? 238  VAL B C   1 
ATOM   1855  O O   . VAL B 1 10  ? 31.563  -19.278 102.236 1.00 16.22 ? 238  VAL B O   1 
ATOM   1856  C CB  . VAL B 1 10  ? 31.554  -16.226 103.595 1.00 16.21 ? 238  VAL B CB  1 
ATOM   1857  C CG1 . VAL B 1 10  ? 32.813  -16.286 102.733 1.00 16.00 ? 238  VAL B CG1 1 
ATOM   1858  C CG2 . VAL B 1 10  ? 30.884  -14.898 103.457 1.00 16.30 ? 238  VAL B CG2 1 
ATOM   1859  N N   . SER B 1 11  ? 31.589  -19.134 104.489 1.00 16.03 ? 239  SER B N   1 
ATOM   1860  C CA  . SER B 1 11  ? 32.168  -20.458 104.705 1.00 15.84 ? 239  SER B CA  1 
ATOM   1861  C C   . SER B 1 11  ? 31.325  -21.510 104.030 1.00 15.61 ? 239  SER B C   1 
ATOM   1862  O O   . SER B 1 11  ? 31.830  -22.291 103.244 1.00 15.64 ? 239  SER B O   1 
ATOM   1863  C CB  . SER B 1 11  ? 32.267  -20.780 106.191 1.00 15.79 ? 239  SER B CB  1 
ATOM   1864  O OG  . SER B 1 11  ? 33.333  -20.064 106.776 1.00 16.43 ? 239  SER B OG  1 
ATOM   1865  N N   . HIS B 1 12  ? 30.032  -21.510 104.320 1.00 15.52 ? 240  HIS B N   1 
ATOM   1866  C CA  . HIS B 1 12  ? 29.120  -22.463 103.708 1.00 15.72 ? 240  HIS B CA  1 
ATOM   1867  C C   . HIS B 1 12  ? 29.259  -22.493 102.182 1.00 15.85 ? 240  HIS B C   1 
ATOM   1868  O O   . HIS B 1 12  ? 29.261  -23.565 101.577 1.00 15.81 ? 240  HIS B O   1 
ATOM   1869  C CB  . HIS B 1 12  ? 27.674  -22.159 104.100 1.00 15.80 ? 240  HIS B CB  1 
ATOM   1870  C CG  . HIS B 1 12  ? 26.697  -23.188 103.628 1.00 16.51 ? 240  HIS B CG  1 
ATOM   1871  N ND1 . HIS B 1 12  ? 26.457  -24.358 104.316 1.00 18.10 ? 240  HIS B ND1 1 
ATOM   1872  C CD2 . HIS B 1 12  ? 25.910  -23.230 102.528 1.00 17.39 ? 240  HIS B CD2 1 
ATOM   1873  C CE1 . HIS B 1 12  ? 25.560  -25.076 103.662 1.00 18.18 ? 240  HIS B CE1 1 
ATOM   1874  N NE2 . HIS B 1 12  ? 25.212  -24.414 102.574 1.00 18.02 ? 240  HIS B NE2 1 
ATOM   1875  N N   . LEU B 1 13  ? 29.390  -21.316 101.567 1.00 15.97 ? 241  LEU B N   1 
ATOM   1876  C CA  . LEU B 1 13  ? 29.473  -21.209 100.107 1.00 15.66 ? 241  LEU B CA  1 
ATOM   1877  C C   . LEU B 1 13  ? 30.782  -21.772 99.550  1.00 15.52 ? 241  LEU B C   1 
ATOM   1878  O O   . LEU B 1 13  ? 30.779  -22.422 98.503  1.00 15.45 ? 241  LEU B O   1 
ATOM   1879  C CB  . LEU B 1 13  ? 29.276  -19.758 99.653  1.00 15.56 ? 241  LEU B CB  1 
ATOM   1880  C CG  . LEU B 1 13  ? 27.888  -19.161 99.916  1.00 16.05 ? 241  LEU B CG  1 
ATOM   1881  C CD1 . LEU B 1 13  ? 27.717  -17.773 99.252  1.00 15.69 ? 241  LEU B CD1 1 
ATOM   1882  C CD2 . LEU B 1 13  ? 26.792  -20.111 99.450  1.00 16.11 ? 241  LEU B CD2 1 
ATOM   1883  N N   . LEU B 1 14  ? 31.893  -21.526 100.236 1.00 15.45 ? 242  LEU B N   1 
ATOM   1884  C CA  . LEU B 1 14  ? 33.180  -22.098 99.812  1.00 15.45 ? 242  LEU B CA  1 
ATOM   1885  C C   . LEU B 1 14  ? 33.121  -23.637 99.753  1.00 15.68 ? 242  LEU B C   1 
ATOM   1886  O O   . LEU B 1 14  ? 33.614  -24.223 98.793  1.00 15.63 ? 242  LEU B O   1 
ATOM   1887  C CB  . LEU B 1 14  ? 34.332  -21.642 100.721 1.00 15.32 ? 242  LEU B CB  1 
ATOM   1888  C CG  . LEU B 1 14  ? 34.761  -20.169 100.669 1.00 14.30 ? 242  LEU B CG  1 
ATOM   1889  C CD1 . LEU B 1 14  ? 35.721  -19.861 101.795 1.00 13.23 ? 242  LEU B CD1 1 
ATOM   1890  C CD2 . LEU B 1 14  ? 35.389  -19.815 99.339  1.00 12.74 ? 242  LEU B CD2 1 
ATOM   1891  N N   . VAL B 1 15  ? 32.500  -24.281 100.749 1.00 15.81 ? 243  VAL B N   1 
ATOM   1892  C CA  . VAL B 1 15  ? 32.311  -25.742 100.711 1.00 16.00 ? 243  VAL B CA  1 
ATOM   1893  C C   . VAL B 1 15  ? 31.221  -26.141 99.686  1.00 16.39 ? 243  VAL B C   1 
ATOM   1894  O O   . VAL B 1 15  ? 31.344  -27.158 99.008  1.00 16.53 ? 243  VAL B O   1 
ATOM   1895  C CB  . VAL B 1 15  ? 32.050  -26.383 102.123 1.00 15.89 ? 243  VAL B CB  1 
ATOM   1896  C CG1 . VAL B 1 15  ? 32.773  -25.600 103.218 1.00 15.45 ? 243  VAL B CG1 1 
ATOM   1897  C CG2 . VAL B 1 15  ? 30.563  -26.505 102.432 1.00 15.84 ? 243  VAL B CG2 1 
ATOM   1898  N N   . ALA B 1 16  ? 30.178  -25.326 99.548  1.00 16.85 ? 244  ALA B N   1 
ATOM   1899  C CA  . ALA B 1 16  ? 29.182  -25.517 98.478  1.00 17.19 ? 244  ALA B CA  1 
ATOM   1900  C C   . ALA B 1 16  ? 29.797  -25.472 97.075  1.00 17.49 ? 244  ALA B C   1 
ATOM   1901  O O   . ALA B 1 16  ? 29.253  -26.059 96.146  1.00 17.58 ? 244  ALA B O   1 
ATOM   1902  C CB  . ALA B 1 16  ? 28.075  -24.468 98.580  1.00 17.08 ? 244  ALA B CB  1 
ATOM   1903  N N   . GLU B 1 17  ? 30.923  -24.778 96.928  1.00 17.88 ? 245  GLU B N   1 
ATOM   1904  C CA  . GLU B 1 17  ? 31.567  -24.594 95.623  1.00 18.10 ? 245  GLU B CA  1 
ATOM   1905  C C   . GLU B 1 17  ? 31.846  -25.921 94.918  1.00 18.57 ? 245  GLU B C   1 
ATOM   1906  O O   . GLU B 1 17  ? 32.670  -26.719 95.403  1.00 18.78 ? 245  GLU B O   1 
ATOM   1907  C CB  . GLU B 1 17  ? 32.880  -23.833 95.784  1.00 17.93 ? 245  GLU B CB  1 
ATOM   1908  C CG  . GLU B 1 17  ? 33.617  -23.610 94.509  1.00 17.83 ? 245  GLU B CG  1 
ATOM   1909  C CD  . GLU B 1 17  ? 32.848  -22.760 93.525  1.00 18.74 ? 245  GLU B CD  1 
ATOM   1910  O OE1 . GLU B 1 17  ? 31.897  -22.056 93.945  1.00 17.22 ? 245  GLU B OE1 1 
ATOM   1911  O OE2 . GLU B 1 17  ? 33.217  -22.785 92.321  1.00 19.89 ? 245  GLU B OE2 1 
ATOM   1912  N N   . PRO B 1 18  ? 31.159  -26.164 93.776  1.00 18.93 ? 246  PRO B N   1 
ATOM   1913  C CA  . PRO B 1 18  ? 31.369  -27.350 92.929  1.00 18.91 ? 246  PRO B CA  1 
ATOM   1914  C C   . PRO B 1 18  ? 32.801  -27.576 92.474  1.00 18.85 ? 246  PRO B C   1 
ATOM   1915  O O   . PRO B 1 18  ? 33.608  -26.652 92.471  1.00 18.68 ? 246  PRO B O   1 
ATOM   1916  C CB  . PRO B 1 18  ? 30.494  -27.067 91.707  1.00 18.90 ? 246  PRO B CB  1 
ATOM   1917  C CG  . PRO B 1 18  ? 29.427  -26.190 92.210  1.00 19.26 ? 246  PRO B CG  1 
ATOM   1918  C CD  . PRO B 1 18  ? 30.082  -25.313 93.238  1.00 19.02 ? 246  PRO B CD  1 
ATOM   1919  N N   . GLU B 1 19  ? 33.089  -28.813 92.084  1.00 19.13 ? 247  GLU B N   1 
ATOM   1920  C CA  . GLU B 1 19  ? 34.398  -29.189 91.566  1.00 19.24 ? 247  GLU B CA  1 
ATOM   1921  C C   . GLU B 1 19  ? 34.532  -28.681 90.144  1.00 18.81 ? 247  GLU B C   1 
ATOM   1922  O O   . GLU B 1 19  ? 33.536  -28.414 89.479  1.00 18.65 ? 247  GLU B O   1 
ATOM   1923  C CB  . GLU B 1 19  ? 34.562  -30.714 91.575  1.00 19.52 ? 247  GLU B CB  1 
ATOM   1924  C CG  . GLU B 1 19  ? 34.368  -31.377 92.953  1.00 20.49 ? 247  GLU B CG  1 
ATOM   1925  C CD  . GLU B 1 19  ? 35.674  -31.890 93.561  1.00 22.31 ? 247  GLU B CD  1 
ATOM   1926  O OE1 . GLU B 1 19  ? 36.288  -32.843 93.007  1.00 23.33 ? 247  GLU B OE1 1 
ATOM   1927  O OE2 . GLU B 1 19  ? 36.084  -31.345 94.606  1.00 23.34 ? 247  GLU B OE2 1 
ATOM   1928  N N   . LYS B 1 20  ? 35.772  -28.561 89.688  1.00 18.65 ? 248  LYS B N   1 
ATOM   1929  C CA  . LYS B 1 20  ? 36.081  -28.204 88.301  1.00 18.54 ? 248  LYS B CA  1 
ATOM   1930  C C   . LYS B 1 20  ? 35.289  -29.039 87.307  1.00 18.00 ? 248  LYS B C   1 
ATOM   1931  O O   . LYS B 1 20  ? 34.993  -30.209 87.554  1.00 17.96 ? 248  LYS B O   1 
ATOM   1932  C CB  . LYS B 1 20  ? 37.574  -28.416 88.012  1.00 18.66 ? 248  LYS B CB  1 
ATOM   1933  C CG  . LYS B 1 20  ? 38.504  -27.421 88.687  1.00 19.05 ? 248  LYS B CG  1 
ATOM   1934  C CD  . LYS B 1 20  ? 39.954  -27.616 88.252  1.00 19.30 ? 248  LYS B CD  1 
ATOM   1935  C CE  . LYS B 1 20  ? 40.893  -26.606 88.923  1.00 20.23 ? 248  LYS B CE  1 
ATOM   1936  N NZ  . LYS B 1 20  ? 42.033  -26.180 88.032  1.00 21.72 ? 248  LYS B NZ  1 
ATOM   1937  N N   . ILE B 1 21  ? 34.964  -28.429 86.174  1.00 17.58 ? 249  ILE B N   1 
ATOM   1938  C CA  . ILE B 1 21  ? 34.296  -29.130 85.088  1.00 17.22 ? 249  ILE B CA  1 
ATOM   1939  C C   . ILE B 1 21  ? 35.048  -28.890 83.780  1.00 17.03 ? 249  ILE B C   1 
ATOM   1940  O O   . ILE B 1 21  ? 35.339  -27.744 83.406  1.00 16.95 ? 249  ILE B O   1 
ATOM   1941  C CB  . ILE B 1 21  ? 32.818  -28.717 84.993  1.00 17.10 ? 249  ILE B CB  1 
ATOM   1942  C CG1 . ILE B 1 21  ? 32.070  -29.266 86.203  1.00 17.34 ? 249  ILE B CG1 1 
ATOM   1943  C CG2 . ILE B 1 21  ? 32.170  -29.239 83.727  1.00 16.59 ? 249  ILE B CG2 1 
ATOM   1944  C CD1 . ILE B 1 21  ? 30.586  -29.012 86.171  1.00 18.23 ? 249  ILE B CD1 1 
ATOM   1945  N N   . TYR B 1 22  ? 35.357  -29.989 83.097  1.00 16.69 ? 250  TYR B N   1 
ATOM   1946  C CA  . TYR B 1 22  ? 36.188  -29.956 81.908  1.00 16.38 ? 250  TYR B CA  1 
ATOM   1947  C C   . TYR B 1 22  ? 35.326  -29.919 80.673  1.00 16.31 ? 250  TYR B C   1 
ATOM   1948  O O   . TYR B 1 22  ? 34.237  -30.479 80.666  1.00 16.08 ? 250  TYR B O   1 
ATOM   1949  C CB  . TYR B 1 22  ? 37.091  -31.176 81.884  1.00 16.17 ? 250  TYR B CB  1 
ATOM   1950  C CG  . TYR B 1 22  ? 38.032  -31.200 83.055  1.00 15.95 ? 250  TYR B CG  1 
ATOM   1951  C CD1 . TYR B 1 22  ? 37.619  -31.689 84.294  1.00 15.50 ? 250  TYR B CD1 1 
ATOM   1952  C CD2 . TYR B 1 22  ? 39.331  -30.712 82.935  1.00 15.48 ? 250  TYR B CD2 1 
ATOM   1953  C CE1 . TYR B 1 22  ? 38.480  -31.702 85.376  1.00 15.52 ? 250  TYR B CE1 1 
ATOM   1954  C CE2 . TYR B 1 22  ? 40.196  -30.717 84.012  1.00 15.43 ? 250  TYR B CE2 1 
ATOM   1955  C CZ  . TYR B 1 22  ? 39.763  -31.211 85.227  1.00 15.58 ? 250  TYR B CZ  1 
ATOM   1956  O OH  . TYR B 1 22  ? 40.621  -31.216 86.288  1.00 16.09 ? 250  TYR B OH  1 
ATOM   1957  N N   . ALA B 1 23  ? 35.819  -29.247 79.632  1.00 16.44 ? 251  ALA B N   1 
ATOM   1958  C CA  . ALA B 1 23  ? 35.076  -29.089 78.370  1.00 16.27 ? 251  ALA B CA  1 
ATOM   1959  C C   . ALA B 1 23  ? 35.055  -30.394 77.570  1.00 16.07 ? 251  ALA B C   1 
ATOM   1960  O O   . ALA B 1 23  ? 34.058  -30.713 76.921  1.00 15.93 ? 251  ALA B O   1 
ATOM   1961  C CB  . ALA B 1 23  ? 35.663  -27.944 77.533  1.00 15.91 ? 251  ALA B CB  1 
ATOM   1962  N N   . MET B 1 24  ? 36.154  -31.140 77.647  1.00 15.90 ? 252  MET B N   1 
ATOM   1963  C CA  . MET B 1 24  ? 36.329  -32.391 76.921  1.00 15.96 ? 252  MET B CA  1 
ATOM   1964  C C   . MET B 1 24  ? 36.063  -32.231 75.420  1.00 15.96 ? 252  MET B C   1 
ATOM   1965  O O   . MET B 1 24  ? 35.212  -32.919 74.843  1.00 16.08 ? 252  MET B O   1 
ATOM   1966  C CB  . MET B 1 24  ? 35.482  -33.496 77.549  1.00 15.89 ? 252  MET B CB  1 
ATOM   1967  C CG  . MET B 1 24  ? 36.008  -33.910 78.910  1.00 15.94 ? 252  MET B CG  1 
ATOM   1968  S SD  . MET B 1 24  ? 34.966  -35.084 79.779  1.00 16.15 ? 252  MET B SD  1 
ATOM   1969  C CE  . MET B 1 24  ? 33.522  -34.082 80.103  1.00 14.80 ? 252  MET B CE  1 
ATOM   1970  N N   . PRO B 1 25  ? 36.814  -31.324 74.779  1.00 15.89 ? 253  PRO B N   1 
ATOM   1971  C CA  . PRO B 1 25  ? 36.732  -31.170 73.335  1.00 16.01 ? 253  PRO B CA  1 
ATOM   1972  C C   . PRO B 1 25  ? 37.049  -32.469 72.601  1.00 15.96 ? 253  PRO B C   1 
ATOM   1973  O O   . PRO B 1 25  ? 38.034  -33.134 72.924  1.00 15.87 ? 253  PRO B O   1 
ATOM   1974  C CB  . PRO B 1 25  ? 37.816  -30.123 73.024  1.00 16.15 ? 253  PRO B CB  1 
ATOM   1975  C CG  . PRO B 1 25  ? 38.689  -30.069 74.233  1.00 16.08 ? 253  PRO B CG  1 
ATOM   1976  C CD  . PRO B 1 25  ? 37.803  -30.407 75.374  1.00 15.93 ? 253  PRO B CD  1 
ATOM   1977  N N   . ASP B 1 26  ? 36.215  -32.821 71.629  1.00 15.91 ? 254  ASP B N   1 
ATOM   1978  C CA  . ASP B 1 26  ? 36.491  -33.961 70.770  1.00 15.85 ? 254  ASP B CA  1 
ATOM   1979  C C   . ASP B 1 26  ? 37.748  -33.658 69.946  1.00 15.86 ? 254  ASP B C   1 
ATOM   1980  O O   . ASP B 1 26  ? 37.777  -32.677 69.198  1.00 15.71 ? 254  ASP B O   1 
ATOM   1981  C CB  . ASP B 1 26  ? 35.298  -34.253 69.855  1.00 15.85 ? 254  ASP B CB  1 
ATOM   1982  C CG  . ASP B 1 26  ? 35.389  -35.615 69.191  1.00 16.50 ? 254  ASP B CG  1 
ATOM   1983  O OD1 . ASP B 1 26  ? 36.325  -35.832 68.389  1.00 17.59 ? 254  ASP B OD1 1 
ATOM   1984  O OD2 . ASP B 1 26  ? 34.522  -36.472 69.462  1.00 17.06 ? 254  ASP B OD2 1 
ATOM   1985  N N   . PRO B 1 27  ? 38.803  -34.483 70.102  1.00 15.96 ? 255  PRO B N   1 
ATOM   1986  C CA  . PRO B 1 27  ? 40.009  -34.336 69.274  1.00 15.90 ? 255  PRO B CA  1 
ATOM   1987  C C   . PRO B 1 27  ? 39.868  -34.802 67.819  1.00 15.81 ? 255  PRO B C   1 
ATOM   1988  O O   . PRO B 1 27  ? 40.631  -34.346 66.971  1.00 15.67 ? 255  PRO B O   1 
ATOM   1989  C CB  . PRO B 1 27  ? 41.052  -35.202 69.996  1.00 15.92 ? 255  PRO B CB  1 
ATOM   1990  C CG  . PRO B 1 27  ? 40.408  -35.647 71.292  1.00 16.02 ? 255  PRO B CG  1 
ATOM   1991  C CD  . PRO B 1 27  ? 38.944  -35.586 71.072  1.00 15.96 ? 255  PRO B CD  1 
ATOM   1992  N N   . THR B 1 28  ? 38.926  -35.703 67.536  1.00 15.89 ? 256  THR B N   1 
ATOM   1993  C CA  . THR B 1 28  ? 38.727  -36.196 66.164  1.00 16.04 ? 256  THR B CA  1 
ATOM   1994  C C   . THR B 1 28  ? 38.090  -35.121 65.286  1.00 16.21 ? 256  THR B C   1 
ATOM   1995  O O   . THR B 1 28  ? 38.406  -35.019 64.102  1.00 16.45 ? 256  THR B O   1 
ATOM   1996  C CB  . THR B 1 28  ? 37.864  -37.489 66.098  1.00 16.01 ? 256  THR B CB  1 
ATOM   1997  O OG1 . THR B 1 28  ? 36.535  -37.219 66.560  1.00 15.93 ? 256  THR B OG1 1 
ATOM   1998  C CG2 . THR B 1 28  ? 38.479  -38.610 66.934  1.00 15.82 ? 256  THR B CG2 1 
ATOM   1999  N N   . VAL B 1 29  ? 37.202  -34.321 65.873  1.00 16.23 ? 257  VAL B N   1 
ATOM   2000  C CA  . VAL B 1 29  ? 36.565  -33.204 65.174  1.00 16.31 ? 257  VAL B CA  1 
ATOM   2001  C C   . VAL B 1 29  ? 37.613  -32.137 64.799  1.00 16.37 ? 257  VAL B C   1 
ATOM   2002  O O   . VAL B 1 29  ? 38.467  -31.800 65.620  1.00 16.47 ? 257  VAL B O   1 
ATOM   2003  C CB  . VAL B 1 29  ? 35.462  -32.554 66.067  1.00 16.40 ? 257  VAL B CB  1 
ATOM   2004  C CG1 . VAL B 1 29  ? 34.866  -31.319 65.406  1.00 16.63 ? 257  VAL B CG1 1 
ATOM   2005  C CG2 . VAL B 1 29  ? 34.362  -33.558 66.394  1.00 16.38 ? 257  VAL B CG2 1 
ATOM   2006  N N   . PRO B 1 30  ? 37.558  -31.609 63.557  1.00 16.40 ? 258  PRO B N   1 
ATOM   2007  C CA  . PRO B 1 30  ? 38.465  -30.540 63.135  1.00 16.41 ? 258  PRO B CA  1 
ATOM   2008  C C   . PRO B 1 30  ? 38.040  -29.160 63.649  1.00 16.56 ? 258  PRO B C   1 
ATOM   2009  O O   . PRO B 1 30  ? 36.844  -28.864 63.738  1.00 16.45 ? 258  PRO B O   1 
ATOM   2010  C CB  . PRO B 1 30  ? 38.360  -30.587 61.617  1.00 16.40 ? 258  PRO B CB  1 
ATOM   2011  C CG  . PRO B 1 30  ? 36.970  -31.020 61.369  1.00 16.39 ? 258  PRO B CG  1 
ATOM   2012  C CD  . PRO B 1 30  ? 36.638  -31.991 62.470  1.00 16.41 ? 258  PRO B CD  1 
ATOM   2013  N N   . ASP B 1 31  ? 39.028  -28.318 63.942  1.00 16.75 ? 259  ASP B N   1 
ATOM   2014  C CA  . ASP B 1 31  ? 38.809  -27.057 64.657  1.00 16.88 ? 259  ASP B CA  1 
ATOM   2015  C C   . ASP B 1 31  ? 38.138  -26.030 63.751  1.00 16.80 ? 259  ASP B C   1 
ATOM   2016  O O   . ASP B 1 31  ? 38.622  -25.755 62.650  1.00 16.98 ? 259  ASP B O   1 
ATOM   2017  C CB  . ASP B 1 31  ? 40.132  -26.495 65.211  1.00 17.05 ? 259  ASP B CB  1 
ATOM   2018  C CG  . ASP B 1 31  ? 41.049  -27.585 65.782  1.00 17.38 ? 259  ASP B CG  1 
ATOM   2019  O OD1 . ASP B 1 31  ? 41.870  -28.128 65.010  1.00 17.26 ? 259  ASP B OD1 1 
ATOM   2020  O OD2 . ASP B 1 31  ? 40.954  -27.892 66.995  1.00 17.99 ? 259  ASP B OD2 1 
ATOM   2021  N N   . SER B 1 32  ? 37.035  -25.464 64.235  1.00 16.71 ? 260  SER B N   1 
ATOM   2022  C CA  . SER B 1 32  ? 36.168  -24.606 63.433  1.00 16.67 ? 260  SER B CA  1 
ATOM   2023  C C   . SER B 1 32  ? 35.216  -23.806 64.319  1.00 16.82 ? 260  SER B C   1 
ATOM   2024  O O   . SER B 1 32  ? 35.196  -23.980 65.545  1.00 16.89 ? 260  SER B O   1 
ATOM   2025  C CB  . SER B 1 32  ? 35.367  -25.460 62.441  1.00 16.78 ? 260  SER B CB  1 
ATOM   2026  O OG  . SER B 1 32  ? 34.846  -26.635 63.054  1.00 16.57 ? 260  SER B OG  1 
ATOM   2027  N N   . ASP B 1 33  ? 34.433  -22.925 63.696  1.00 16.85 ? 261  ASP B N   1 
ATOM   2028  C CA  . ASP B 1 33  ? 33.410  -22.151 64.416  1.00 16.79 ? 261  ASP B CA  1 
ATOM   2029  C C   . ASP B 1 33  ? 32.475  -23.053 65.215  1.00 16.43 ? 261  ASP B C   1 
ATOM   2030  O O   . ASP B 1 33  ? 32.277  -22.860 66.418  1.00 16.36 ? 261  ASP B O   1 
ATOM   2031  C CB  . ASP B 1 33  ? 32.585  -21.197 63.499  1.00 16.99 ? 261  ASP B CB  1 
ATOM   2032  C CG  . ASP B 1 33  ? 32.626  -21.565 61.993  1.00 18.07 ? 261  ASP B CG  1 
ATOM   2033  O OD1 . ASP B 1 33  ? 33.219  -22.607 61.605  1.00 19.29 ? 261  ASP B OD1 1 
ATOM   2034  O OD2 . ASP B 1 33  ? 32.059  -20.778 61.188  1.00 18.31 ? 261  ASP B OD2 1 
ATOM   2035  N N   . ILE B 1 34  ? 31.934  -24.059 64.545  1.00 16.10 ? 262  ILE B N   1 
ATOM   2036  C CA  . ILE B 1 34  ? 30.894  -24.885 65.130  1.00 15.86 ? 262  ILE B CA  1 
ATOM   2037  C C   . ILE B 1 34  ? 31.431  -25.813 66.210  1.00 15.67 ? 262  ILE B C   1 
ATOM   2038  O O   . ILE B 1 34  ? 30.720  -26.087 67.174  1.00 15.82 ? 262  ILE B O   1 
ATOM   2039  C CB  . ILE B 1 34  ? 30.152  -25.689 64.058  1.00 15.85 ? 262  ILE B CB  1 
ATOM   2040  C CG1 . ILE B 1 34  ? 29.588  -24.746 62.980  1.00 15.95 ? 262  ILE B CG1 1 
ATOM   2041  C CG2 . ILE B 1 34  ? 29.039  -26.518 64.683  1.00 15.91 ? 262  ILE B CG2 1 
ATOM   2042  C CD1 . ILE B 1 34  ? 28.935  -23.470 63.507  1.00 15.43 ? 262  ILE B CD1 1 
ATOM   2043  N N   . LYS B 1 35  ? 32.670  -26.290 66.069  1.00 15.31 ? 263  LYS B N   1 
ATOM   2044  C CA  . LYS B 1 35  ? 33.303  -27.055 67.150  1.00 14.92 ? 263  LYS B CA  1 
ATOM   2045  C C   . LYS B 1 35  ? 33.270  -26.238 68.434  1.00 14.72 ? 263  LYS B C   1 
ATOM   2046  O O   . LYS B 1 35  ? 32.614  -26.617 69.394  1.00 14.69 ? 263  LYS B O   1 
ATOM   2047  C CB  . LYS B 1 35  ? 34.743  -27.446 66.817  1.00 14.80 ? 263  LYS B CB  1 
ATOM   2048  C CG  . LYS B 1 35  ? 35.492  -28.063 68.002  1.00 14.69 ? 263  LYS B CG  1 
ATOM   2049  C CD  . LYS B 1 35  ? 36.546  -29.064 67.559  1.00 14.64 ? 263  LYS B CD  1 
ATOM   2050  C CE  . LYS B 1 35  ? 37.546  -29.351 68.664  1.00 14.59 ? 263  LYS B CE  1 
ATOM   2051  N NZ  . LYS B 1 35  ? 38.556  -30.353 68.222  1.00 14.57 ? 263  LYS B NZ  1 
ATOM   2052  N N   . ALA B 1 36  ? 33.961  -25.103 68.433  1.00 14.55 ? 264  ALA B N   1 
ATOM   2053  C CA  . ALA B 1 36  ? 33.936  -24.187 69.564  1.00 14.20 ? 264  ALA B CA  1 
ATOM   2054  C C   . ALA B 1 36  ? 32.552  -24.155 70.171  1.00 14.03 ? 264  ALA B C   1 
ATOM   2055  O O   . ALA B 1 36  ? 32.366  -24.525 71.321  1.00 14.13 ? 264  ALA B O   1 
ATOM   2056  C CB  . ALA B 1 36  ? 34.349  -22.786 69.128  1.00 14.06 ? 264  ALA B CB  1 
ATOM   2057  N N   . LEU B 1 37  ? 31.579  -23.751 69.368  1.00 14.00 ? 265  LEU B N   1 
ATOM   2058  C CA  . LEU B 1 37  ? 30.211  -23.552 69.842  1.00 13.87 ? 265  LEU B CA  1 
ATOM   2059  C C   . LEU B 1 37  ? 29.600  -24.861 70.338  1.00 13.68 ? 265  LEU B C   1 
ATOM   2060  O O   . LEU B 1 37  ? 28.962  -24.885 71.384  1.00 13.86 ? 265  LEU B O   1 
ATOM   2061  C CB  . LEU B 1 37  ? 29.338  -22.930 68.738  1.00 13.93 ? 265  LEU B CB  1 
ATOM   2062  C CG  . LEU B 1 37  ? 29.762  -21.555 68.192  1.00 13.67 ? 265  LEU B CG  1 
ATOM   2063  C CD1 . LEU B 1 37  ? 28.990  -21.191 66.939  1.00 13.20 ? 265  LEU B CD1 1 
ATOM   2064  C CD2 . LEU B 1 37  ? 29.585  -20.480 69.243  1.00 13.84 ? 265  LEU B CD2 1 
ATOM   2065  N N   . THR B 1 38  ? 29.799  -25.945 69.596  1.00 13.35 ? 266  THR B N   1 
ATOM   2066  C CA  . THR B 1 38  ? 29.388  -27.265 70.054  1.00 13.28 ? 266  THR B CA  1 
ATOM   2067  C C   . THR B 1 38  ? 29.940  -27.500 71.457  1.00 13.32 ? 266  THR B C   1 
ATOM   2068  O O   . THR B 1 38  ? 29.191  -27.826 72.377  1.00 13.67 ? 266  THR B O   1 
ATOM   2069  C CB  . THR B 1 38  ? 29.902  -28.400 69.119  1.00 13.36 ? 266  THR B CB  1 
ATOM   2070  O OG1 . THR B 1 38  ? 29.302  -28.285 67.823  1.00 12.99 ? 266  THR B OG1 1 
ATOM   2071  C CG2 . THR B 1 38  ? 29.596  -29.790 69.700  1.00 13.42 ? 266  THR B CG2 1 
ATOM   2072  N N   . THR B 1 39  ? 31.249  -27.311 71.617  1.00 13.10 ? 267  THR B N   1 
ATOM   2073  C CA  . THR B 1 39  ? 31.925  -27.595 72.884  1.00 12.87 ? 267  THR B CA  1 
ATOM   2074  C C   . THR B 1 39  ? 31.384  -26.756 74.053  1.00 12.72 ? 267  THR B C   1 
ATOM   2075  O O   . THR B 1 39  ? 31.229  -27.261 75.162  1.00 12.64 ? 267  THR B O   1 
ATOM   2076  C CB  . THR B 1 39  ? 33.446  -27.377 72.776  1.00 12.70 ? 267  THR B CB  1 
ATOM   2077  O OG1 . THR B 1 39  ? 33.917  -27.879 71.530  1.00 12.59 ? 267  THR B OG1 1 
ATOM   2078  C CG2 . THR B 1 39  ? 34.165  -28.112 73.876  1.00 12.86 ? 267  THR B CG2 1 
ATOM   2079  N N   . LEU B 1 40  ? 31.087  -25.490 73.798  1.00 12.44 ? 268  LEU B N   1 
ATOM   2080  C CA  . LEU B 1 40  ? 30.619  -24.590 74.847  1.00 12.41 ? 268  LEU B CA  1 
ATOM   2081  C C   . LEU B 1 40  ? 29.158  -24.857 75.255  1.00 12.86 ? 268  LEU B C   1 
ATOM   2082  O O   . LEU B 1 40  ? 28.805  -24.722 76.420  1.00 12.82 ? 268  LEU B O   1 
ATOM   2083  C CB  . LEU B 1 40  ? 30.842  -23.138 74.425  1.00 12.04 ? 268  LEU B CB  1 
ATOM   2084  C CG  . LEU B 1 40  ? 32.333  -22.850 74.204  1.00 11.13 ? 268  LEU B CG  1 
ATOM   2085  C CD1 . LEU B 1 40  ? 32.575  -21.573 73.421  1.00 9.30  ? 268  LEU B CD1 1 
ATOM   2086  C CD2 . LEU B 1 40  ? 33.060  -22.827 75.535  1.00 10.29 ? 268  LEU B CD2 1 
ATOM   2087  N N   A CYS B 1 41  ? 28.322  -25.250 74.303  0.60 13.27 ? 269  CYS B N   1 
ATOM   2088  N N   B CYS B 1 41  ? 28.326  -25.253 74.297  0.40 13.08 ? 269  CYS B N   1 
ATOM   2089  C CA  A CYS B 1 41  ? 26.938  -25.599 74.611  0.60 13.51 ? 269  CYS B CA  1 
ATOM   2090  C CA  B CYS B 1 41  ? 26.937  -25.608 74.590  0.40 13.27 ? 269  CYS B CA  1 
ATOM   2091  C C   A CYS B 1 41  ? 26.849  -26.849 75.492  0.60 13.81 ? 269  CYS B C   1 
ATOM   2092  C C   B CYS B 1 41  ? 26.846  -26.849 75.484  0.40 13.66 ? 269  CYS B C   1 
ATOM   2093  O O   A CYS B 1 41  ? 26.049  -26.890 76.429  0.60 14.08 ? 269  CYS B O   1 
ATOM   2094  O O   B CYS B 1 41  ? 26.040  -26.884 76.415  0.40 13.85 ? 269  CYS B O   1 
ATOM   2095  C CB  A CYS B 1 41  ? 26.136  -25.800 73.325  0.60 13.58 ? 269  CYS B CB  1 
ATOM   2096  C CB  B CYS B 1 41  ? 26.148  -25.845 73.300  0.40 13.29 ? 269  CYS B CB  1 
ATOM   2097  S SG  A CYS B 1 41  ? 24.524  -26.588 73.545  0.60 13.67 ? 269  CYS B SG  1 
ATOM   2098  S SG  B CYS B 1 41  ? 25.908  -24.377 72.268  0.40 12.66 ? 269  CYS B SG  1 
ATOM   2099  N N   . ASP B 1 42  ? 27.663  -27.862 75.198  1.00 14.01 ? 270  ASP B N   1 
ATOM   2100  C CA  . ASP B 1 42  ? 27.713  -29.083 76.037  1.00 14.37 ? 270  ASP B CA  1 
ATOM   2101  C C   . ASP B 1 42  ? 28.181  -28.746 77.457  1.00 14.24 ? 270  ASP B C   1 
ATOM   2102  O O   . ASP B 1 42  ? 27.544  -29.112 78.442  1.00 14.18 ? 270  ASP B O   1 
ATOM   2103  C CB  . ASP B 1 42  ? 28.651  -30.131 75.433  1.00 14.70 ? 270  ASP B CB  1 
ATOM   2104  C CG  . ASP B 1 42  ? 28.703  -31.437 76.254  1.00 16.35 ? 270  ASP B CG  1 
ATOM   2105  O OD1 . ASP B 1 42  ? 27.733  -31.737 76.994  1.00 18.48 ? 270  ASP B OD1 1 
ATOM   2106  O OD2 . ASP B 1 42  ? 29.712  -32.175 76.152  1.00 17.56 ? 270  ASP B OD2 1 
ATOM   2107  N N   . LEU B 1 43  ? 29.301  -28.037 77.534  1.00 14.27 ? 271  LEU B N   1 
ATOM   2108  C CA  . LEU B 1 43  ? 29.842  -27.515 78.788  1.00 13.90 ? 271  LEU B CA  1 
ATOM   2109  C C   . LEU B 1 43  ? 28.755  -26.795 79.570  1.00 14.32 ? 271  LEU B C   1 
ATOM   2110  O O   . LEU B 1 43  ? 28.445  -27.170 80.698  1.00 14.42 ? 271  LEU B O   1 
ATOM   2111  C CB  . LEU B 1 43  ? 31.010  -26.565 78.487  1.00 13.57 ? 271  LEU B CB  1 
ATOM   2112  C CG  . LEU B 1 43  ? 31.708  -25.865 79.640  1.00 13.29 ? 271  LEU B CG  1 
ATOM   2113  C CD1 . LEU B 1 43  ? 31.901  -26.819 80.786  1.00 14.16 ? 271  LEU B CD1 1 
ATOM   2114  C CD2 . LEU B 1 43  ? 33.049  -25.280 79.204  1.00 13.28 ? 271  LEU B CD2 1 
ATOM   2115  N N   . ALA B 1 44  ? 28.153  -25.774 78.961  1.00 14.64 ? 272  ALA B N   1 
ATOM   2116  C CA  . ALA B 1 44  ? 27.124  -24.993 79.642  1.00 14.59 ? 272  ALA B CA  1 
ATOM   2117  C C   . ALA B 1 44  ? 26.053  -25.923 80.191  1.00 14.70 ? 272  ALA B C   1 
ATOM   2118  O O   . ALA B 1 44  ? 25.712  -25.855 81.368  1.00 14.90 ? 272  ALA B O   1 
ATOM   2119  C CB  . ALA B 1 44  ? 26.518  -23.981 78.710  1.00 14.61 ? 272  ALA B CB  1 
ATOM   2120  N N   . ASP B 1 45  ? 25.549  -26.812 79.348  1.00 14.82 ? 273  ASP B N   1 
ATOM   2121  C CA  . ASP B 1 45  ? 24.493  -27.722 79.768  1.00 15.35 ? 273  ASP B CA  1 
ATOM   2122  C C   . ASP B 1 45  ? 24.853  -28.519 81.032  1.00 15.61 ? 273  ASP B C   1 
ATOM   2123  O O   . ASP B 1 45  ? 24.007  -28.724 81.908  1.00 15.63 ? 273  ASP B O   1 
ATOM   2124  C CB  . ASP B 1 45  ? 24.109  -28.662 78.620  1.00 15.43 ? 273  ASP B CB  1 
ATOM   2125  C CG  . ASP B 1 45  ? 23.262  -27.974 77.567  1.00 15.72 ? 273  ASP B CG  1 
ATOM   2126  O OD1 . ASP B 1 45  ? 22.863  -26.818 77.796  1.00 16.50 ? 273  ASP B OD1 1 
ATOM   2127  O OD2 . ASP B 1 45  ? 22.990  -28.581 76.510  1.00 16.74 ? 273  ASP B OD2 1 
ATOM   2128  N N   . ARG B 1 46  ? 26.106  -28.952 81.122  1.00 15.78 ? 274  ARG B N   1 
ATOM   2129  C CA  . ARG B 1 46  ? 26.583  -29.667 82.299  1.00 15.88 ? 274  ARG B CA  1 
ATOM   2130  C C   . ARG B 1 46  ? 26.786  -28.747 83.485  1.00 15.88 ? 274  ARG B C   1 
ATOM   2131  O O   . ARG B 1 46  ? 26.509  -29.140 84.605  1.00 16.48 ? 274  ARG B O   1 
ATOM   2132  C CB  . ARG B 1 46  ? 27.868  -30.446 81.990  1.00 15.86 ? 274  ARG B CB  1 
ATOM   2133  C CG  . ARG B 1 46  ? 27.606  -31.659 81.093  1.00 16.27 ? 274  ARG B CG  1 
ATOM   2134  C CD  . ARG B 1 46  ? 28.769  -32.624 81.013  1.00 16.27 ? 274  ARG B CD  1 
ATOM   2135  N NE  . ARG B 1 46  ? 29.738  -32.211 80.004  1.00 16.81 ? 274  ARG B NE  1 
ATOM   2136  C CZ  . ARG B 1 46  ? 30.975  -31.782 80.254  1.00 17.67 ? 274  ARG B CZ  1 
ATOM   2137  N NH1 . ARG B 1 46  ? 31.441  -31.722 81.508  1.00 17.65 ? 274  ARG B NH1 1 
ATOM   2138  N NH2 . ARG B 1 46  ? 31.753  -31.417 79.228  1.00 17.41 ? 274  ARG B NH2 1 
ATOM   2139  N N   . GLU B 1 47  ? 27.257  -27.526 83.257  1.00 15.95 ? 275  GLU B N   1 
ATOM   2140  C CA  . GLU B 1 47  ? 27.464  -26.582 84.361  1.00 16.14 ? 275  GLU B CA  1 
ATOM   2141  C C   . GLU B 1 47  ? 26.134  -26.118 84.924  1.00 15.87 ? 275  GLU B C   1 
ATOM   2142  O O   . GLU B 1 47  ? 25.984  -25.993 86.142  1.00 15.85 ? 275  GLU B O   1 
ATOM   2143  C CB  . GLU B 1 47  ? 28.289  -25.374 83.922  1.00 16.13 ? 275  GLU B CB  1 
ATOM   2144  C CG  . GLU B 1 47  ? 29.725  -25.714 83.559  1.00 16.72 ? 275  GLU B CG  1 
ATOM   2145  C CD  . GLU B 1 47  ? 30.612  -24.483 83.431  1.00 17.42 ? 275  GLU B CD  1 
ATOM   2146  O OE1 . GLU B 1 47  ? 30.876  -23.831 84.464  1.00 19.61 ? 275  GLU B OE1 1 
ATOM   2147  O OE2 . GLU B 1 47  ? 31.059  -24.173 82.302  1.00 18.27 ? 275  GLU B OE2 1 
ATOM   2148  N N   . LEU B 1 48  ? 25.177  -25.857 84.036  1.00 15.75 ? 276  LEU B N   1 
ATOM   2149  C CA  . LEU B 1 48  ? 23.798  -25.580 84.454  1.00 15.84 ? 276  LEU B CA  1 
ATOM   2150  C C   . LEU B 1 48  ? 23.362  -26.542 85.547  1.00 15.56 ? 276  LEU B C   1 
ATOM   2151  O O   . LEU B 1 48  ? 22.987  -26.127 86.633  1.00 15.73 ? 276  LEU B O   1 
ATOM   2152  C CB  . LEU B 1 48  ? 22.811  -25.671 83.279  1.00 15.94 ? 276  LEU B CB  1 
ATOM   2153  C CG  . LEU B 1 48  ? 22.149  -24.350 82.871  1.00 16.24 ? 276  LEU B CG  1 
ATOM   2154  C CD1 . LEU B 1 48  ? 21.347  -24.495 81.578  1.00 16.25 ? 276  LEU B CD1 1 
ATOM   2155  C CD2 . LEU B 1 48  ? 21.265  -23.837 84.006  1.00 16.18 ? 276  LEU B CD2 1 
ATOM   2156  N N   . VAL B 1 49  ? 23.453  -27.829 85.254  1.00 15.27 ? 277  VAL B N   1 
ATOM   2157  C CA  . VAL B 1 49  ? 23.063  -28.856 86.194  1.00 15.02 ? 277  VAL B CA  1 
ATOM   2158  C C   . VAL B 1 49  ? 23.736  -28.685 87.552  1.00 15.22 ? 277  VAL B C   1 
ATOM   2159  O O   . VAL B 1 49  ? 23.044  -28.670 88.567  1.00 15.52 ? 277  VAL B O   1 
ATOM   2160  C CB  . VAL B 1 49  ? 23.343  -30.258 85.636  1.00 14.82 ? 277  VAL B CB  1 
ATOM   2161  C CG1 . VAL B 1 49  ? 23.247  -31.303 86.741  1.00 14.42 ? 277  VAL B CG1 1 
ATOM   2162  C CG2 . VAL B 1 49  ? 22.370  -30.555 84.514  1.00 14.01 ? 277  VAL B CG2 1 
ATOM   2163  N N   . VAL B 1 50  ? 25.061  -28.542 87.596  1.00 15.16 ? 278  VAL B N   1 
ATOM   2164  C CA  . VAL B 1 50  ? 25.721  -28.345 88.897  1.00 15.07 ? 278  VAL B CA  1 
ATOM   2165  C C   . VAL B 1 50  ? 25.457  -26.960 89.470  1.00 14.87 ? 278  VAL B C   1 
ATOM   2166  O O   . VAL B 1 50  ? 25.463  -26.813 90.683  1.00 14.83 ? 278  VAL B O   1 
ATOM   2167  C CB  . VAL B 1 50  ? 27.246  -28.620 88.886  1.00 15.11 ? 278  VAL B CB  1 
ATOM   2168  C CG1 . VAL B 1 50  ? 27.527  -30.031 88.361  1.00 14.78 ? 278  VAL B CG1 1 
ATOM   2169  C CG2 . VAL B 1 50  ? 27.994  -27.553 88.091  1.00 15.13 ? 278  VAL B CG2 1 
ATOM   2170  N N   . ILE B 1 51  ? 25.229  -25.951 88.621  1.00 14.69 ? 279  ILE B N   1 
ATOM   2171  C CA  . ILE B 1 51  ? 24.785  -24.644 89.125  1.00 14.65 ? 279  ILE B CA  1 
ATOM   2172  C C   . ILE B 1 51  ? 23.419  -24.760 89.837  1.00 14.78 ? 279  ILE B C   1 
ATOM   2173  O O   . ILE B 1 51  ? 23.178  -24.084 90.849  1.00 14.65 ? 279  ILE B O   1 
ATOM   2174  C CB  . ILE B 1 51  ? 24.705  -23.556 88.024  1.00 14.71 ? 279  ILE B CB  1 
ATOM   2175  C CG1 . ILE B 1 51  ? 26.102  -23.121 87.594  1.00 14.03 ? 279  ILE B CG1 1 
ATOM   2176  C CG2 . ILE B 1 51  ? 23.916  -22.314 88.534  1.00 13.66 ? 279  ILE B CG2 1 
ATOM   2177  C CD1 . ILE B 1 51  ? 26.088  -22.268 86.343  1.00 13.54 ? 279  ILE B CD1 1 
ATOM   2178  N N   . ILE B 1 52  ? 22.548  -25.626 89.317  1.00 14.67 ? 280  ILE B N   1 
ATOM   2179  C CA  . ILE B 1 52  ? 21.218  -25.819 89.896  1.00 14.83 ? 280  ILE B CA  1 
ATOM   2180  C C   . ILE B 1 52  ? 21.298  -26.523 91.235  1.00 14.97 ? 280  ILE B C   1 
ATOM   2181  O O   . ILE B 1 52  ? 20.620  -26.133 92.177  1.00 15.70 ? 280  ILE B O   1 
ATOM   2182  C CB  . ILE B 1 52  ? 20.272  -26.626 88.979  1.00 14.88 ? 280  ILE B CB  1 
ATOM   2183  C CG1 . ILE B 1 52  ? 20.005  -25.871 87.663  1.00 14.92 ? 280  ILE B CG1 1 
ATOM   2184  C CG2 . ILE B 1 52  ? 18.946  -26.898 89.705  1.00 14.30 ? 280  ILE B CG2 1 
ATOM   2185  C CD1 . ILE B 1 52  ? 19.766  -26.780 86.454  1.00 13.87 ? 280  ILE B CD1 1 
ATOM   2186  N N   . GLY B 1 53  ? 22.115  -27.561 91.323  1.00 14.93 ? 281  GLY B N   1 
ATOM   2187  C CA  . GLY B 1 53  ? 22.387  -28.201 92.605  1.00 14.97 ? 281  GLY B CA  1 
ATOM   2188  C C   . GLY B 1 53  ? 23.075  -27.240 93.559  1.00 15.02 ? 281  GLY B C   1 
ATOM   2189  O O   . GLY B 1 53  ? 22.855  -27.260 94.764  1.00 15.09 ? 281  GLY B O   1 
ATOM   2190  N N   . TRP B 1 54  ? 23.909  -26.376 93.017  1.00 15.23 ? 282  TRP B N   1 
ATOM   2191  C CA  . TRP B 1 54  ? 24.663  -25.481 93.857  1.00 15.43 ? 282  TRP B CA  1 
ATOM   2192  C C   . TRP B 1 54  ? 23.738  -24.528 94.553  1.00 15.81 ? 282  TRP B C   1 
ATOM   2193  O O   . TRP B 1 54  ? 23.908  -24.254 95.735  1.00 16.44 ? 282  TRP B O   1 
ATOM   2194  C CB  . TRP B 1 54  ? 25.690  -24.720 93.046  1.00 15.32 ? 282  TRP B CB  1 
ATOM   2195  C CG  . TRP B 1 54  ? 26.163  -23.529 93.714  1.00 15.10 ? 282  TRP B CG  1 
ATOM   2196  C CD1 . TRP B 1 54  ? 27.088  -23.459 94.700  1.00 15.18 ? 282  TRP B CD1 1 
ATOM   2197  C CD2 . TRP B 1 54  ? 25.753  -22.195 93.442  1.00 15.67 ? 282  TRP B CD2 1 
ATOM   2198  N NE1 . TRP B 1 54  ? 27.292  -22.151 95.063  1.00 15.31 ? 282  TRP B NE1 1 
ATOM   2199  C CE2 . TRP B 1 54  ? 26.476  -21.353 94.306  1.00 15.93 ? 282  TRP B CE2 1 
ATOM   2200  C CE3 . TRP B 1 54  ? 24.833  -21.627 92.553  1.00 15.70 ? 282  TRP B CE3 1 
ATOM   2201  C CZ2 . TRP B 1 54  ? 26.307  -19.963 94.314  1.00 16.10 ? 282  TRP B CZ2 1 
ATOM   2202  C CZ3 . TRP B 1 54  ? 24.670  -20.256 92.555  1.00 15.63 ? 282  TRP B CZ3 1 
ATOM   2203  C CH2 . TRP B 1 54  ? 25.405  -19.435 93.432  1.00 15.65 ? 282  TRP B CH2 1 
ATOM   2204  N N   . ALA B 1 55  ? 22.743  -24.026 93.837  1.00 16.08 ? 283  ALA B N   1 
ATOM   2205  C CA  . ALA B 1 55  ? 21.873  -23.013 94.418  1.00 15.99 ? 283  ALA B CA  1 
ATOM   2206  C C   . ALA B 1 55  ? 21.135  -23.537 95.652  1.00 15.92 ? 283  ALA B C   1 
ATOM   2207  O O   . ALA B 1 55  ? 20.874  -22.775 96.579  1.00 15.63 ? 283  ALA B O   1 
ATOM   2208  C CB  . ALA B 1 55  ? 20.906  -22.490 93.386  1.00 16.07 ? 283  ALA B CB  1 
ATOM   2209  N N   . LYS B 1 56  ? 20.820  -24.832 95.671  1.00 16.11 ? 284  LYS B N   1 
ATOM   2210  C CA  . LYS B 1 56  ? 20.098  -25.446 96.812  1.00 16.62 ? 284  LYS B CA  1 
ATOM   2211  C C   . LYS B 1 56  ? 20.796  -25.180 98.144  1.00 16.45 ? 284  LYS B C   1 
ATOM   2212  O O   . LYS B 1 56  ? 20.148  -24.954 99.160  1.00 16.29 ? 284  LYS B O   1 
ATOM   2213  C CB  . LYS B 1 56  ? 19.933  -26.966 96.621  1.00 16.82 ? 284  LYS B CB  1 
ATOM   2214  C CG  . LYS B 1 56  ? 18.835  -27.377 95.637  1.00 17.26 ? 284  LYS B CG  1 
ATOM   2215  C CD  . LYS B 1 56  ? 18.743  -28.897 95.493  1.00 17.34 ? 284  LYS B CD  1 
ATOM   2216  C CE  . LYS B 1 56  ? 17.452  -29.335 94.765  1.00 18.20 ? 284  LYS B CE  1 
ATOM   2217  N NZ  . LYS B 1 56  ? 17.236  -30.821 94.783  1.00 18.46 ? 284  LYS B NZ  1 
ATOM   2218  N N   . HIS B 1 57  ? 22.121  -25.201 98.119  1.00 16.61 ? 285  HIS B N   1 
ATOM   2219  C CA  . HIS B 1 57  ? 22.926  -24.944 99.304  1.00 16.80 ? 285  HIS B CA  1 
ATOM   2220  C C   . HIS B 1 57  ? 22.869  -23.479 99.773  1.00 16.72 ? 285  HIS B C   1 
ATOM   2221  O O   . HIS B 1 57  ? 23.159  -23.186 100.932 1.00 16.78 ? 285  HIS B O   1 
ATOM   2222  C CB  . HIS B 1 57  ? 24.376  -25.376 99.061  1.00 16.77 ? 285  HIS B CB  1 
ATOM   2223  C CG  . HIS B 1 57  ? 24.574  -26.866 99.065  1.00 17.48 ? 285  HIS B CG  1 
ATOM   2224  N ND1 . HIS B 1 57  ? 24.923  -27.571 100.200 1.00 17.99 ? 285  HIS B ND1 1 
ATOM   2225  C CD2 . HIS B 1 57  ? 24.478  -27.784 98.071  1.00 17.45 ? 285  HIS B CD2 1 
ATOM   2226  C CE1 . HIS B 1 57  ? 25.037  -28.854 99.903  1.00 16.88 ? 285  HIS B CE1 1 
ATOM   2227  N NE2 . HIS B 1 57  ? 24.770  -29.010 98.620  1.00 16.45 ? 285  HIS B NE2 1 
ATOM   2228  N N   . ILE B 1 58  ? 22.486  -22.557 98.892  1.00 16.67 ? 286  ILE B N   1 
ATOM   2229  C CA  . ILE B 1 58  ? 22.383  -21.146 99.285  1.00 16.37 ? 286  ILE B CA  1 
ATOM   2230  C C   . ILE B 1 58  ? 21.312  -21.038 100.365 1.00 16.54 ? 286  ILE B C   1 
ATOM   2231  O O   . ILE B 1 58  ? 20.194  -21.520 100.177 1.00 16.89 ? 286  ILE B O   1 
ATOM   2232  C CB  . ILE B 1 58  ? 22.084  -20.219 98.091  1.00 16.03 ? 286  ILE B CB  1 
ATOM   2233  C CG1 . ILE B 1 58  ? 23.287  -20.194 97.147  1.00 16.05 ? 286  ILE B CG1 1 
ATOM   2234  C CG2 . ILE B 1 58  ? 21.825  -18.824 98.553  1.00 15.48 ? 286  ILE B CG2 1 
ATOM   2235  C CD1 . ILE B 1 58  ? 22.992  -19.646 95.783  1.00 15.71 ? 286  ILE B CD1 1 
ATOM   2236  N N   . PRO B 1 59  ? 21.659  -20.439 101.516 1.00 16.46 ? 287  PRO B N   1 
ATOM   2237  C CA  . PRO B 1 59  ? 20.750  -20.399 102.635 1.00 16.48 ? 287  PRO B CA  1 
ATOM   2238  C C   . PRO B 1 59  ? 19.547  -19.551 102.314 1.00 16.50 ? 287  PRO B C   1 
ATOM   2239  O O   . PRO B 1 59  ? 19.704  -18.404 101.928 1.00 16.69 ? 287  PRO B O   1 
ATOM   2240  C CB  . PRO B 1 59  ? 21.583  -19.732 103.721 1.00 16.49 ? 287  PRO B CB  1 
ATOM   2241  C CG  . PRO B 1 59  ? 22.492  -18.884 102.986 1.00 16.37 ? 287  PRO B CG  1 
ATOM   2242  C CD  . PRO B 1 59  ? 22.902  -19.736 101.842 1.00 16.54 ? 287  PRO B CD  1 
ATOM   2243  N N   . GLY B 1 60  ? 18.359  -20.124 102.469 1.00 16.62 ? 288  GLY B N   1 
ATOM   2244  C CA  . GLY B 1 60  ? 17.110  -19.445 102.145 1.00 16.70 ? 288  GLY B CA  1 
ATOM   2245  C C   . GLY B 1 60  ? 16.484  -20.022 100.891 1.00 16.96 ? 288  GLY B C   1 
ATOM   2246  O O   . GLY B 1 60  ? 15.277  -20.286 100.863 1.00 16.78 ? 288  GLY B O   1 
ATOM   2247  N N   . PHE B 1 61  ? 17.316  -20.248 99.867  1.00 17.20 ? 289  PHE B N   1 
ATOM   2248  C CA  . PHE B 1 61  ? 16.841  -20.578 98.509  1.00 17.39 ? 289  PHE B CA  1 
ATOM   2249  C C   . PHE B 1 61  ? 15.945  -21.821 98.426  1.00 17.00 ? 289  PHE B C   1 
ATOM   2250  O O   . PHE B 1 61  ? 15.010  -21.843 97.638  1.00 17.14 ? 289  PHE B O   1 
ATOM   2251  C CB  . PHE B 1 61  ? 18.028  -20.697 97.533  1.00 17.79 ? 289  PHE B CB  1 
ATOM   2252  C CG  . PHE B 1 61  ? 17.630  -21.045 96.113  1.00 18.37 ? 289  PHE B CG  1 
ATOM   2253  C CD1 . PHE B 1 61  ? 17.485  -22.374 95.721  1.00 18.08 ? 289  PHE B CD1 1 
ATOM   2254  C CD2 . PHE B 1 61  ? 17.416  -20.044 95.169  1.00 19.05 ? 289  PHE B CD2 1 
ATOM   2255  C CE1 . PHE B 1 61  ? 17.129  -22.700 94.420  1.00 18.20 ? 289  PHE B CE1 1 
ATOM   2256  C CE2 . PHE B 1 61  ? 17.056  -20.368 93.857  1.00 19.19 ? 289  PHE B CE2 1 
ATOM   2257  C CZ  . PHE B 1 61  ? 16.911  -21.699 93.488  1.00 18.53 ? 289  PHE B CZ  1 
ATOM   2258  N N   . SER B 1 62  ? 16.217  -22.848 99.216  1.00 16.68 ? 290  SER B N   1 
ATOM   2259  C CA  . SER B 1 62  ? 15.305  -23.998 99.250  1.00 16.84 ? 290  SER B CA  1 
ATOM   2260  C C   . SER B 1 62  ? 13.929  -23.654 99.826  1.00 16.60 ? 290  SER B C   1 
ATOM   2261  O O   . SER B 1 62  ? 12.942  -24.262 99.416  1.00 16.51 ? 290  SER B O   1 
ATOM   2262  C CB  . SER B 1 62  ? 15.898  -25.155 100.044 1.00 16.83 ? 290  SER B CB  1 
ATOM   2263  O OG  . SER B 1 62  ? 17.119  -25.564 99.460  1.00 17.98 ? 290  SER B OG  1 
ATOM   2264  N N   . THR B 1 63  ? 13.862  -22.689 100.759 1.00 16.25 ? 291  THR B N   1 
ATOM   2265  C CA  . THR B 1 63  ? 12.587  -22.346 101.435 1.00 15.93 ? 291  THR B CA  1 
ATOM   2266  C C   . THR B 1 63  ? 11.601  -21.563 100.547 1.00 15.44 ? 291  THR B C   1 
ATOM   2267  O O   . THR B 1 63  ? 10.455  -21.359 100.943 1.00 15.40 ? 291  THR B O   1 
ATOM   2268  C CB  . THR B 1 63  ? 12.786  -21.567 102.785 1.00 15.94 ? 291  THR B CB  1 
ATOM   2269  O OG1 . THR B 1 63  ? 13.227  -20.221 102.533 1.00 16.86 ? 291  THR B OG1 1 
ATOM   2270  C CG2 . THR B 1 63  ? 13.777  -22.276 103.704 1.00 16.01 ? 291  THR B CG2 1 
ATOM   2271  N N   . LEU B 1 64  ? 12.042  -21.126 99.363  1.00 14.87 ? 292  LEU B N   1 
ATOM   2272  C CA  . LEU B 1 64  ? 11.158  -20.467 98.396  1.00 14.46 ? 292  LEU B CA  1 
ATOM   2273  C C   . LEU B 1 64  ? 10.292  -21.499 97.696  1.00 14.39 ? 292  LEU B C   1 
ATOM   2274  O O   . LEU B 1 64  ? 10.619  -22.692 97.679  1.00 14.54 ? 292  LEU B O   1 
ATOM   2275  C CB  . LEU B 1 64  ? 11.974  -19.733 97.326  1.00 14.40 ? 292  LEU B CB  1 
ATOM   2276  C CG  . LEU B 1 64  ? 12.838  -18.536 97.743  1.00 14.04 ? 292  LEU B CG  1 
ATOM   2277  C CD1 . LEU B 1 64  ? 13.757  -18.091 96.596  1.00 13.11 ? 292  LEU B CD1 1 
ATOM   2278  C CD2 . LEU B 1 64  ? 11.966  -17.382 98.208  1.00 12.94 ? 292  LEU B CD2 1 
ATOM   2279  N N   . SER B 1 65  ? 9.204   -21.044 97.085  1.00 14.09 ? 293  SER B N   1 
ATOM   2280  C CA  . SER B 1 65  ? 8.417   -21.917 96.217  1.00 14.04 ? 293  SER B CA  1 
ATOM   2281  C C   . SER B 1 65  ? 9.278   -22.477 95.074  1.00 14.08 ? 293  SER B C   1 
ATOM   2282  O O   . SER B 1 65  ? 10.329  -21.913 94.725  1.00 14.38 ? 293  SER B O   1 
ATOM   2283  C CB  . SER B 1 65  ? 7.224   -21.161 95.636  1.00 13.93 ? 293  SER B CB  1 
ATOM   2284  O OG  . SER B 1 65  ? 7.654   -20.022 94.914  1.00 13.89 ? 293  SER B OG  1 
ATOM   2285  N N   . LEU B 1 66  ? 8.835   -23.585 94.491  1.00 13.89 ? 294  LEU B N   1 
ATOM   2286  C CA  . LEU B 1 66  ? 9.521   -24.145 93.331  1.00 13.86 ? 294  LEU B CA  1 
ATOM   2287  C C   . LEU B 1 66  ? 9.425   -23.198 92.149  1.00 13.63 ? 294  LEU B C   1 
ATOM   2288  O O   . LEU B 1 66  ? 10.324  -23.145 91.339  1.00 13.87 ? 294  LEU B O   1 
ATOM   2289  C CB  . LEU B 1 66  ? 8.959   -25.521 92.962  1.00 13.86 ? 294  LEU B CB  1 
ATOM   2290  C CG  . LEU B 1 66  ? 9.339   -26.607 93.968  1.00 14.20 ? 294  LEU B CG  1 
ATOM   2291  C CD1 . LEU B 1 66  ? 8.473   -27.867 93.814  1.00 13.72 ? 294  LEU B CD1 1 
ATOM   2292  C CD2 . LEU B 1 66  ? 10.840  -26.919 93.832  1.00 14.55 ? 294  LEU B CD2 1 
ATOM   2293  N N   . ALA B 1 67  ? 8.339   -22.444 92.064  1.00 13.54 ? 295  ALA B N   1 
ATOM   2294  C CA  . ALA B 1 67  ? 8.162   -21.472 90.990  1.00 13.44 ? 295  ALA B CA  1 
ATOM   2295  C C   . ALA B 1 67  ? 9.195   -20.352 91.089  1.00 13.32 ? 295  ALA B C   1 
ATOM   2296  O O   . ALA B 1 67  ? 9.769   -19.937 90.080  1.00 13.20 ? 295  ALA B O   1 
ATOM   2297  C CB  . ALA B 1 67  ? 6.745   -20.893 91.026  1.00 13.39 ? 295  ALA B CB  1 
ATOM   2298  N N   . ASP B 1 68  ? 9.425   -19.869 92.307  1.00 13.28 ? 296  ASP B N   1 
ATOM   2299  C CA  . ASP B 1 68  ? 10.401  -18.809 92.539  1.00 13.36 ? 296  ASP B CA  1 
ATOM   2300  C C   . ASP B 1 68  ? 11.840  -19.287 92.314  1.00 13.29 ? 296  ASP B C   1 
ATOM   2301  O O   . ASP B 1 68  ? 12.633  -18.576 91.708  1.00 13.07 ? 296  ASP B O   1 
ATOM   2302  C CB  . ASP B 1 68  ? 10.239  -18.220 93.945  1.00 13.48 ? 296  ASP B CB  1 
ATOM   2303  C CG  . ASP B 1 68  ? 9.062   -17.259 94.051  1.00 13.61 ? 296  ASP B CG  1 
ATOM   2304  O OD1 . ASP B 1 68  ? 8.726   -16.606 93.042  1.00 13.35 ? 296  ASP B OD1 1 
ATOM   2305  O OD2 . ASP B 1 68  ? 8.474   -17.153 95.150  1.00 14.38 ? 296  ASP B OD2 1 
ATOM   2306  N N   . GLN B 1 69  ? 12.171  -20.488 92.785  1.00 13.39 ? 297  GLN B N   1 
ATOM   2307  C CA  . GLN B 1 69  ? 13.501  -21.070 92.531  1.00 13.34 ? 297  GLN B CA  1 
ATOM   2308  C C   . GLN B 1 69  ? 13.790  -21.116 91.046  1.00 13.35 ? 297  GLN B C   1 
ATOM   2309  O O   . GLN B 1 69  ? 14.901  -20.813 90.604  1.00 13.37 ? 297  GLN B O   1 
ATOM   2310  C CB  . GLN B 1 69  ? 13.598  -22.483 93.095  1.00 13.23 ? 297  GLN B CB  1 
ATOM   2311  C CG  . GLN B 1 69  ? 13.662  -22.519 94.595  1.00 13.38 ? 297  GLN B CG  1 
ATOM   2312  C CD  . GLN B 1 69  ? 13.651  -23.926 95.143  1.00 13.23 ? 297  GLN B CD  1 
ATOM   2313  O OE1 . GLN B 1 69  ? 14.389  -24.799 94.670  1.00 12.80 ? 297  GLN B OE1 1 
ATOM   2314  N NE2 . GLN B 1 69  ? 12.826  -24.154 96.164  1.00 12.79 ? 297  GLN B NE2 1 
ATOM   2315  N N   . MET B 1 70  ? 12.777  -21.501 90.282  1.00 13.43 ? 298  MET B N   1 
ATOM   2316  C CA  . MET B 1 70  ? 12.900  -21.588 88.838  1.00 13.83 ? 298  MET B CA  1 
ATOM   2317  C C   . MET B 1 70  ? 13.078  -20.225 88.194  1.00 13.67 ? 298  MET B C   1 
ATOM   2318  O O   . MET B 1 70  ? 13.852  -20.092 87.248  1.00 13.79 ? 298  MET B O   1 
ATOM   2319  C CB  . MET B 1 70  ? 11.674  -22.270 88.234  1.00 13.78 ? 298  MET B CB  1 
ATOM   2320  C CG  . MET B 1 70  ? 11.648  -23.773 88.406  1.00 13.83 ? 298  MET B CG  1 
ATOM   2321  S SD  . MET B 1 70  ? 10.991  -24.538 86.920  1.00 15.14 ? 298  MET B SD  1 
ATOM   2322  C CE  . MET B 1 70  ? 9.212   -24.439 87.251  1.00 14.91 ? 298  MET B CE  1 
ATOM   2323  N N   . SER B 1 71  ? 12.350  -19.226 88.694  1.00 13.51 ? 299  SER B N   1 
ATOM   2324  C CA  . SER B 1 71  ? 12.404  -17.877 88.127  1.00 13.41 ? 299  SER B CA  1 
ATOM   2325  C C   . SER B 1 71  ? 13.799  -17.266 88.294  1.00 13.51 ? 299  SER B C   1 
ATOM   2326  O O   . SER B 1 71  ? 14.375  -16.741 87.332  1.00 13.72 ? 299  SER B O   1 
ATOM   2327  C CB  . SER B 1 71  ? 11.343  -16.958 88.755  1.00 13.37 ? 299  SER B CB  1 
ATOM   2328  O OG  . SER B 1 71  ? 10.039  -17.201 88.233  1.00 12.70 ? 299  SER B OG  1 
ATOM   2329  N N   . LEU B 1 72  ? 14.347  -17.353 89.504  1.00 13.35 ? 300  LEU B N   1 
ATOM   2330  C CA  . LEU B 1 72  ? 15.657  -16.775 89.784  1.00 13.15 ? 300  LEU B CA  1 
ATOM   2331  C C   . LEU B 1 72  ? 16.705  -17.415 88.902  1.00 13.07 ? 300  LEU B C   1 
ATOM   2332  O O   . LEU B 1 72  ? 17.539  -16.726 88.337  1.00 13.31 ? 300  LEU B O   1 
ATOM   2333  C CB  . LEU B 1 72  ? 16.043  -16.938 91.255  1.00 13.11 ? 300  LEU B CB  1 
ATOM   2334  C CG  . LEU B 1 72  ? 15.083  -16.412 92.340  1.00 13.28 ? 300  LEU B CG  1 
ATOM   2335  C CD1 . LEU B 1 72  ? 15.830  -16.304 93.665  1.00 13.31 ? 300  LEU B CD1 1 
ATOM   2336  C CD2 . LEU B 1 72  ? 14.421  -15.074 91.990  1.00 12.09 ? 300  LEU B CD2 1 
ATOM   2337  N N   . LEU B 1 73  ? 16.638  -18.732 88.762  1.00 13.15 ? 301  LEU B N   1 
ATOM   2338  C CA  . LEU B 1 73  ? 17.572  -19.464 87.908  1.00 13.17 ? 301  LEU B CA  1 
ATOM   2339  C C   . LEU B 1 73  ? 17.467  -19.054 86.439  1.00 13.32 ? 301  LEU B C   1 
ATOM   2340  O O   . LEU B 1 73  ? 18.473  -18.782 85.792  1.00 13.12 ? 301  LEU B O   1 
ATOM   2341  C CB  . LEU B 1 73  ? 17.356  -20.973 88.061  1.00 13.04 ? 301  LEU B CB  1 
ATOM   2342  C CG  . LEU B 1 73  ? 17.930  -21.519 89.369  1.00 12.75 ? 301  LEU B CG  1 
ATOM   2343  C CD1 . LEU B 1 73  ? 17.385  -22.916 89.661  1.00 11.69 ? 301  LEU B CD1 1 
ATOM   2344  C CD2 . LEU B 1 73  ? 19.485  -21.490 89.331  1.00 11.02 ? 301  LEU B CD2 1 
ATOM   2345  N N   . GLN B 1 74  ? 16.245  -18.990 85.923  1.00 13.67 ? 302  GLN B N   1 
ATOM   2346  C CA  . GLN B 1 74  ? 16.016  -18.607 84.526  1.00 14.03 ? 302  GLN B CA  1 
ATOM   2347  C C   . GLN B 1 74  ? 16.553  -17.232 84.205  1.00 13.91 ? 302  GLN B C   1 
ATOM   2348  O O   . GLN B 1 74  ? 16.877  -16.955 83.055  1.00 13.85 ? 302  GLN B O   1 
ATOM   2349  C CB  . GLN B 1 74  ? 14.531  -18.640 84.186  1.00 14.14 ? 302  GLN B CB  1 
ATOM   2350  C CG  . GLN B 1 74  ? 13.989  -20.037 83.987  1.00 15.58 ? 302  GLN B CG  1 
ATOM   2351  C CD  . GLN B 1 74  ? 12.502  -20.091 84.188  1.00 17.65 ? 302  GLN B CD  1 
ATOM   2352  O OE1 . GLN B 1 74  ? 11.904  -19.112 84.634  1.00 19.56 ? 302  GLN B OE1 1 
ATOM   2353  N NE2 . GLN B 1 74  ? 11.888  -21.231 83.869  1.00 17.92 ? 302  GLN B NE2 1 
ATOM   2354  N N   . SER B 1 75  ? 16.625  -16.373 85.217  1.00 14.03 ? 303  SER B N   1 
ATOM   2355  C CA  . SER B 1 75  ? 17.136  -15.023 85.043  1.00 14.01 ? 303  SER B CA  1 
ATOM   2356  C C   . SER B 1 75  ? 18.655  -14.924 85.236  1.00 14.07 ? 303  SER B C   1 
ATOM   2357  O O   . SER B 1 75  ? 19.318  -14.204 84.499  1.00 13.80 ? 303  SER B O   1 
ATOM   2358  C CB  . SER B 1 75  ? 16.385  -14.062 85.968  1.00 14.11 ? 303  SER B CB  1 
ATOM   2359  O OG  . SER B 1 75  ? 15.099  -13.748 85.430  1.00 13.92 ? 303  SER B OG  1 
ATOM   2360  N N   . ALA B 1 76  ? 19.206  -15.678 86.186  1.00 14.38 ? 304  ALA B N   1 
ATOM   2361  C CA  . ALA B 1 76  ? 20.624  -15.547 86.563  1.00 14.58 ? 304  ALA B CA  1 
ATOM   2362  C C   . ALA B 1 76  ? 21.594  -16.590 85.994  1.00 14.89 ? 304  ALA B C   1 
ATOM   2363  O O   . ALA B 1 76  ? 22.801  -16.497 86.217  1.00 15.37 ? 304  ALA B O   1 
ATOM   2364  C CB  . ALA B 1 76  ? 20.738  -15.544 88.056  1.00 14.63 ? 304  ALA B CB  1 
ATOM   2365  N N   . TRP B 1 77  ? 21.094  -17.584 85.274  1.00 15.17 ? 305  TRP B N   1 
ATOM   2366  C CA  . TRP B 1 77  ? 21.955  -18.679 84.811  1.00 15.07 ? 305  TRP B CA  1 
ATOM   2367  C C   . TRP B 1 77  ? 23.151  -18.180 83.987  1.00 14.97 ? 305  TRP B C   1 
ATOM   2368  O O   . TRP B 1 77  ? 24.291  -18.519 84.296  1.00 14.82 ? 305  TRP B O   1 
ATOM   2369  C CB  . TRP B 1 77  ? 21.143  -19.749 84.054  1.00 15.32 ? 305  TRP B CB  1 
ATOM   2370  C CG  . TRP B 1 77  ? 20.545  -19.284 82.771  1.00 15.44 ? 305  TRP B CG  1 
ATOM   2371  C CD1 . TRP B 1 77  ? 19.516  -18.419 82.621  1.00 15.87 ? 305  TRP B CD1 1 
ATOM   2372  C CD2 . TRP B 1 77  ? 20.953  -19.658 81.455  1.00 16.02 ? 305  TRP B CD2 1 
ATOM   2373  N NE1 . TRP B 1 77  ? 19.243  -18.225 81.292  1.00 16.01 ? 305  TRP B NE1 1 
ATOM   2374  C CE2 . TRP B 1 77  ? 20.115  -18.976 80.550  1.00 15.97 ? 305  TRP B CE2 1 
ATOM   2375  C CE3 . TRP B 1 77  ? 21.947  -20.503 80.948  1.00 16.25 ? 305  TRP B CE3 1 
ATOM   2376  C CZ2 . TRP B 1 77  ? 20.239  -19.109 79.160  1.00 15.86 ? 305  TRP B CZ2 1 
ATOM   2377  C CZ3 . TRP B 1 77  ? 22.071  -20.633 79.566  1.00 16.08 ? 305  TRP B CZ3 1 
ATOM   2378  C CH2 . TRP B 1 77  ? 21.220  -19.936 78.688  1.00 15.69 ? 305  TRP B CH2 1 
ATOM   2379  N N   . MET B 1 78  ? 22.912  -17.354 82.972  1.00 15.05 ? 306  MET B N   1 
ATOM   2380  C CA  . MET B 1 78  ? 24.019  -16.905 82.121  1.00 15.24 ? 306  MET B CA  1 
ATOM   2381  C C   . MET B 1 78  ? 24.973  -16.003 82.899  1.00 15.61 ? 306  MET B C   1 
ATOM   2382  O O   . MET B 1 78  ? 26.168  -16.024 82.636  1.00 15.80 ? 306  MET B O   1 
ATOM   2383  C CB  . MET B 1 78  ? 23.523  -16.201 80.863  1.00 15.27 ? 306  MET B CB  1 
ATOM   2384  C CG  . MET B 1 78  ? 24.601  -15.928 79.821  1.00 15.23 ? 306  MET B CG  1 
ATOM   2385  S SD  . MET B 1 78  ? 25.242  -17.440 79.098  1.00 16.63 ? 306  MET B SD  1 
ATOM   2386  C CE  . MET B 1 78  ? 24.232  -17.651 77.633  1.00 14.16 ? 306  MET B CE  1 
ATOM   2387  N N   . GLU B 1 79  ? 24.446  -15.231 83.857  1.00 15.91 ? 307  GLU B N   1 
ATOM   2388  C CA  . GLU B 1 79  ? 25.278  -14.412 84.765  1.00 16.28 ? 307  GLU B CA  1 
ATOM   2389  C C   . GLU B 1 79  ? 26.230  -15.229 85.643  1.00 16.12 ? 307  GLU B C   1 
ATOM   2390  O O   . GLU B 1 79  ? 27.357  -14.791 85.925  1.00 15.84 ? 307  GLU B O   1 
ATOM   2391  C CB  . GLU B 1 79  ? 24.411  -13.546 85.681  1.00 16.10 ? 307  GLU B CB  1 
ATOM   2392  C CG  . GLU B 1 79  ? 24.003  -12.259 85.046  1.00 17.23 ? 307  GLU B CG  1 
ATOM   2393  C CD  . GLU B 1 79  ? 23.132  -11.390 85.934  1.00 17.84 ? 307  GLU B CD  1 
ATOM   2394  O OE1 . GLU B 1 79  ? 23.391  -11.269 87.160  1.00 19.45 ? 307  GLU B OE1 1 
ATOM   2395  O OE2 . GLU B 1 79  ? 22.181  -10.810 85.375  1.00 19.70 ? 307  GLU B OE2 1 
ATOM   2396  N N   . ILE B 1 80  ? 25.769  -16.395 86.098  1.00 16.13 ? 308  ILE B N   1 
ATOM   2397  C CA  . ILE B 1 80  ? 26.616  -17.284 86.908  1.00 16.02 ? 308  ILE B CA  1 
ATOM   2398  C C   . ILE B 1 80  ? 27.677  -17.930 86.021  1.00 16.27 ? 308  ILE B C   1 
ATOM   2399  O O   . ILE B 1 80  ? 28.868  -17.922 86.353  1.00 16.36 ? 308  ILE B O   1 
ATOM   2400  C CB  . ILE B 1 80  ? 25.802  -18.360 87.622  1.00 15.72 ? 308  ILE B CB  1 
ATOM   2401  C CG1 . ILE B 1 80  ? 24.864  -17.707 88.645  1.00 15.54 ? 308  ILE B CG1 1 
ATOM   2402  C CG2 . ILE B 1 80  ? 26.729  -19.319 88.306  1.00 15.54 ? 308  ILE B CG2 1 
ATOM   2403  C CD1 . ILE B 1 80  ? 23.675  -18.535 89.042  1.00 13.56 ? 308  ILE B CD1 1 
ATOM   2404  N N   . LEU B 1 81  ? 27.245  -18.450 84.873  1.00 16.36 ? 309  LEU B N   1 
ATOM   2405  C CA  . LEU B 1 81  ? 28.165  -19.082 83.941  1.00 16.48 ? 309  LEU B CA  1 
ATOM   2406  C C   . LEU B 1 81  ? 29.322  -18.151 83.617  1.00 16.64 ? 309  LEU B C   1 
ATOM   2407  O O   . LEU B 1 81  ? 30.486  -18.570 83.611  1.00 17.06 ? 309  LEU B O   1 
ATOM   2408  C CB  . LEU B 1 81  ? 27.456  -19.484 82.645  1.00 16.51 ? 309  LEU B CB  1 
ATOM   2409  C CG  . LEU B 1 81  ? 26.637  -20.771 82.667  1.00 16.38 ? 309  LEU B CG  1 
ATOM   2410  C CD1 . LEU B 1 81  ? 26.057  -21.015 81.277  1.00 15.73 ? 309  LEU B CD1 1 
ATOM   2411  C CD2 . LEU B 1 81  ? 27.485  -21.959 83.124  1.00 15.95 ? 309  LEU B CD2 1 
ATOM   2412  N N   . ILE B 1 82  ? 29.002  -16.890 83.353  1.00 16.65 ? 310  ILE B N   1 
ATOM   2413  C CA  . ILE B 1 82  ? 30.019  -15.910 82.973  1.00 16.72 ? 310  ILE B CA  1 
ATOM   2414  C C   . ILE B 1 82  ? 30.902  -15.519 84.169  1.00 16.79 ? 310  ILE B C   1 
ATOM   2415  O O   . ILE B 1 82  ? 32.134  -15.450 84.060  1.00 16.89 ? 310  ILE B O   1 
ATOM   2416  C CB  . ILE B 1 82  ? 29.377  -14.678 82.343  1.00 16.63 ? 310  ILE B CB  1 
ATOM   2417  C CG1 . ILE B 1 82  ? 28.892  -15.025 80.939  1.00 17.28 ? 310  ILE B CG1 1 
ATOM   2418  C CG2 . ILE B 1 82  ? 30.353  -13.519 82.304  1.00 16.97 ? 310  ILE B CG2 1 
ATOM   2419  C CD1 . ILE B 1 82  ? 27.954  -13.981 80.343  1.00 18.28 ? 310  ILE B CD1 1 
ATOM   2420  N N   . LEU B 1 83  ? 30.288  -15.289 85.320  1.00 16.79 ? 311  LEU B N   1 
ATOM   2421  C CA  . LEU B 1 83  ? 31.074  -14.939 86.494  1.00 16.71 ? 311  LEU B CA  1 
ATOM   2422  C C   . LEU B 1 83  ? 32.054  -16.104 86.758  1.00 16.66 ? 311  LEU B C   1 
ATOM   2423  O O   . LEU B 1 83  ? 33.193  -15.887 87.193  1.00 16.87 ? 311  LEU B O   1 
ATOM   2424  C CB  . LEU B 1 83  ? 30.153  -14.636 87.685  1.00 16.93 ? 311  LEU B CB  1 
ATOM   2425  C CG  . LEU B 1 83  ? 30.679  -13.920 88.931  1.00 16.60 ? 311  LEU B CG  1 
ATOM   2426  C CD1 . LEU B 1 83  ? 31.239  -12.558 88.604  1.00 16.72 ? 311  LEU B CD1 1 
ATOM   2427  C CD2 . LEU B 1 83  ? 29.547  -13.793 89.931  1.00 16.38 ? 311  LEU B CD2 1 
ATOM   2428  N N   . GLY B 1 84  ? 31.624  -17.330 86.447  1.00 16.20 ? 312  GLY B N   1 
ATOM   2429  C CA  . GLY B 1 84  ? 32.518  -18.500 86.479  1.00 15.85 ? 312  GLY B CA  1 
ATOM   2430  C C   . GLY B 1 84  ? 33.765  -18.342 85.610  1.00 15.45 ? 312  GLY B C   1 
ATOM   2431  O O   . GLY B 1 84  ? 34.876  -18.192 86.123  1.00 15.11 ? 312  GLY B O   1 
ATOM   2432  N N   . VAL B 1 85  ? 33.590  -18.366 84.290  1.00 15.03 ? 313  VAL B N   1 
ATOM   2433  C CA  . VAL B 1 85  ? 34.724  -18.175 83.373  1.00 14.76 ? 313  VAL B CA  1 
ATOM   2434  C C   . VAL B 1 85  ? 35.547  -16.915 83.711  1.00 14.74 ? 313  VAL B C   1 
ATOM   2435  O O   . VAL B 1 85  ? 36.754  -16.863 83.450  1.00 14.75 ? 313  VAL B O   1 
ATOM   2436  C CB  . VAL B 1 85  ? 34.292  -18.146 81.866  1.00 14.56 ? 313  VAL B CB  1 
ATOM   2437  C CG1 . VAL B 1 85  ? 33.103  -17.264 81.651  1.00 13.75 ? 313  VAL B CG1 1 
ATOM   2438  C CG2 . VAL B 1 85  ? 35.435  -17.684 80.990  1.00 14.00 ? 313  VAL B CG2 1 
ATOM   2439  N N   . VAL B 1 86  ? 34.907  -15.905 84.296  1.00 14.36 ? 314  VAL B N   1 
ATOM   2440  C CA  . VAL B 1 86  ? 35.623  -14.681 84.620  1.00 14.07 ? 314  VAL B CA  1 
ATOM   2441  C C   . VAL B 1 86  ? 36.575  -14.914 85.796  1.00 13.88 ? 314  VAL B C   1 
ATOM   2442  O O   . VAL B 1 86  ? 37.756  -14.587 85.712  1.00 14.01 ? 314  VAL B O   1 
ATOM   2443  C CB  . VAL B 1 86  ? 34.663  -13.499 84.835  1.00 14.16 ? 314  VAL B CB  1 
ATOM   2444  C CG1 . VAL B 1 86  ? 35.332  -12.389 85.603  1.00 14.65 ? 314  VAL B CG1 1 
ATOM   2445  C CG2 . VAL B 1 86  ? 34.176  -12.971 83.478  1.00 13.37 ? 314  VAL B CG2 1 
ATOM   2446  N N   . TYR B 1 87  ? 36.087  -15.530 86.867  1.00 13.70 ? 315  TYR B N   1 
ATOM   2447  C CA  . TYR B 1 87  ? 36.968  -15.886 87.991  1.00 13.18 ? 315  TYR B CA  1 
ATOM   2448  C C   . TYR B 1 87  ? 38.087  -16.834 87.586  1.00 12.95 ? 315  TYR B C   1 
ATOM   2449  O O   . TYR B 1 87  ? 39.233  -16.664 87.989  1.00 13.05 ? 315  TYR B O   1 
ATOM   2450  C CB  . TYR B 1 87  ? 36.190  -16.514 89.143  1.00 12.85 ? 315  TYR B CB  1 
ATOM   2451  C CG  . TYR B 1 87  ? 37.079  -16.780 90.332  1.00 12.51 ? 315  TYR B CG  1 
ATOM   2452  C CD1 . TYR B 1 87  ? 37.451  -15.750 91.184  1.00 11.98 ? 315  TYR B CD1 1 
ATOM   2453  C CD2 . TYR B 1 87  ? 37.585  -18.052 90.576  1.00 11.66 ? 315  TYR B CD2 1 
ATOM   2454  C CE1 . TYR B 1 87  ? 38.286  -15.985 92.258  1.00 12.14 ? 315  TYR B CE1 1 
ATOM   2455  C CE2 . TYR B 1 87  ? 38.408  -18.293 91.653  1.00 11.61 ? 315  TYR B CE2 1 
ATOM   2456  C CZ  . TYR B 1 87  ? 38.756  -17.260 92.485  1.00 11.76 ? 315  TYR B CZ  1 
ATOM   2457  O OH  . TYR B 1 87  ? 39.579  -17.501 93.543  1.00 11.93 ? 315  TYR B OH  1 
ATOM   2458  N N   . ARG B 1 88  ? 37.752  -17.835 86.790  1.00 12.84 ? 316  ARG B N   1 
ATOM   2459  C CA  . ARG B 1 88  ? 38.748  -18.807 86.356  1.00 12.89 ? 316  ARG B CA  1 
ATOM   2460  C C   . ARG B 1 88  ? 39.857  -18.145 85.540  1.00 12.80 ? 316  ARG B C   1 
ATOM   2461  O O   . ARG B 1 88  ? 40.971  -18.646 85.508  1.00 12.53 ? 316  ARG B O   1 
ATOM   2462  C CB  . ARG B 1 88  ? 38.087  -19.949 85.566  1.00 12.98 ? 316  ARG B CB  1 
ATOM   2463  C CG  . ARG B 1 88  ? 37.038  -20.709 86.370  1.00 12.48 ? 316  ARG B CG  1 
ATOM   2464  C CD  . ARG B 1 88  ? 36.677  -22.012 85.730  1.00 12.69 ? 316  ARG B CD  1 
ATOM   2465  N NE  . ARG B 1 88  ? 35.975  -21.840 84.463  1.00 12.67 ? 316  ARG B NE  1 
ATOM   2466  C CZ  . ARG B 1 88  ? 34.667  -21.613 84.339  1.00 13.46 ? 316  ARG B CZ  1 
ATOM   2467  N NH1 . ARG B 1 88  ? 33.867  -21.513 85.404  1.00 13.49 ? 316  ARG B NH1 1 
ATOM   2468  N NH2 . ARG B 1 88  ? 34.148  -21.476 83.125  1.00 13.41 ? 316  ARG B NH2 1 
ATOM   2469  N N   . SER B 1 89  ? 39.547  -17.000 84.922  1.00 13.02 ? 317  SER B N   1 
ATOM   2470  C CA  . SER B 1 89  ? 40.474  -16.295 84.015  1.00 13.12 ? 317  SER B CA  1 
ATOM   2471  C C   . SER B 1 89  ? 41.354  -15.204 84.644  1.00 12.82 ? 317  SER B C   1 
ATOM   2472  O O   . SER B 1 89  ? 42.214  -14.655 83.956  1.00 12.66 ? 317  SER B O   1 
ATOM   2473  C CB  . SER B 1 89  ? 39.674  -15.667 82.868  1.00 13.27 ? 317  SER B CB  1 
ATOM   2474  O OG  . SER B 1 89  ? 38.866  -16.631 82.201  1.00 14.83 ? 317  SER B OG  1 
ATOM   2475  N N   . LEU B 1 90  ? 41.137  -14.896 85.927  1.00 12.94 ? 318  LEU B N   1 
ATOM   2476  C CA  . LEU B 1 90  ? 41.800  -13.767 86.618  1.00 13.06 ? 318  LEU B CA  1 
ATOM   2477  C C   . LEU B 1 90  ? 43.322  -13.801 86.544  1.00 13.23 ? 318  LEU B C   1 
ATOM   2478  O O   . LEU B 1 90  ? 43.967  -12.784 86.325  1.00 13.52 ? 318  LEU B O   1 
ATOM   2479  C CB  . LEU B 1 90  ? 41.406  -13.728 88.099  1.00 13.03 ? 318  LEU B CB  1 
ATOM   2480  C CG  . LEU B 1 90  ? 40.009  -13.267 88.512  1.00 12.96 ? 318  LEU B CG  1 
ATOM   2481  C CD1 . LEU B 1 90  ? 39.925  -13.213 90.032  1.00 11.33 ? 318  LEU B CD1 1 
ATOM   2482  C CD2 . LEU B 1 90  ? 39.661  -11.903 87.898  1.00 12.68 ? 318  LEU B CD2 1 
ATOM   2483  N N   . SER B 1 91  ? 43.883  -14.986 86.736  1.00 13.39 ? 319  SER B N   1 
ATOM   2484  C CA  . SER B 1 91  ? 45.327  -15.202 86.696  1.00 13.18 ? 319  SER B CA  1 
ATOM   2485  C C   . SER B 1 91  ? 45.942  -15.189 85.290  1.00 13.07 ? 319  SER B C   1 
ATOM   2486  O O   . SER B 1 91  ? 47.153  -15.266 85.172  1.00 13.03 ? 319  SER B O   1 
ATOM   2487  C CB  . SER B 1 91  ? 45.635  -16.536 87.384  1.00 13.21 ? 319  SER B CB  1 
ATOM   2488  O OG  . SER B 1 91  ? 44.485  -17.381 87.369  1.00 13.01 ? 319  SER B OG  1 
ATOM   2489  N N   . PHE B 1 92  ? 45.125  -15.078 84.241  1.00 13.15 ? 320  PHE B N   1 
ATOM   2490  C CA  . PHE B 1 92  ? 45.598  -15.158 82.852  1.00 13.28 ? 320  PHE B CA  1 
ATOM   2491  C C   . PHE B 1 92  ? 45.560  -13.820 82.139  1.00 13.63 ? 320  PHE B C   1 
ATOM   2492  O O   . PHE B 1 92  ? 44.811  -12.928 82.541  1.00 13.82 ? 320  PHE B O   1 
ATOM   2493  C CB  . PHE B 1 92  ? 44.735  -16.132 82.065  1.00 13.31 ? 320  PHE B CB  1 
ATOM   2494  C CG  . PHE B 1 92  ? 44.928  -17.561 82.458  1.00 13.28 ? 320  PHE B CG  1 
ATOM   2495  C CD1 . PHE B 1 92  ? 44.427  -18.038 83.660  1.00 13.45 ? 320  PHE B CD1 1 
ATOM   2496  C CD2 . PHE B 1 92  ? 45.604  -18.436 81.625  1.00 13.62 ? 320  PHE B CD2 1 
ATOM   2497  C CE1 . PHE B 1 92  ? 44.607  -19.355 84.035  1.00 13.69 ? 320  PHE B CE1 1 
ATOM   2498  C CE2 . PHE B 1 92  ? 45.789  -19.766 81.992  1.00 14.06 ? 320  PHE B CE2 1 
ATOM   2499  C CZ  . PHE B 1 92  ? 45.286  -20.225 83.201  1.00 13.94 ? 320  PHE B CZ  1 
ATOM   2500  N N   . GLU B 1 93  ? 46.345  -13.708 81.062  1.00 13.89 ? 321  GLU B N   1 
ATOM   2501  C CA  . GLU B 1 93  ? 46.405  -12.501 80.223  1.00 14.15 ? 321  GLU B CA  1 
ATOM   2502  C C   . GLU B 1 93  ? 45.716  -12.721 78.879  1.00 13.95 ? 321  GLU B C   1 
ATOM   2503  O O   . GLU B 1 93  ? 46.177  -13.519 78.074  1.00 13.94 ? 321  GLU B O   1 
ATOM   2504  C CB  . GLU B 1 93  ? 47.864  -12.079 79.959  1.00 14.40 ? 321  GLU B CB  1 
ATOM   2505  C CG  . GLU B 1 93  ? 48.676  -11.640 81.195  1.00 15.57 ? 321  GLU B CG  1 
ATOM   2506  C CD  . GLU B 1 93  ? 48.031  -10.484 81.972  1.00 17.43 ? 321  GLU B CD  1 
ATOM   2507  O OE1 . GLU B 1 93  ? 47.615  -9.479  81.346  1.00 18.74 ? 321  GLU B OE1 1 
ATOM   2508  O OE2 . GLU B 1 93  ? 47.937  -10.580 83.219  1.00 17.70 ? 321  GLU B OE2 1 
ATOM   2509  N N   . ASP B 1 94  ? 44.620  -11.999 78.644  1.00 13.90 ? 322  ASP B N   1 
ATOM   2510  C CA  . ASP B 1 94  ? 43.898  -12.002 77.351  1.00 13.83 ? 322  ASP B CA  1 
ATOM   2511  C C   . ASP B 1 94  ? 43.369  -13.377 76.945  1.00 13.85 ? 322  ASP B C   1 
ATOM   2512  O O   . ASP B 1 94  ? 43.132  -13.649 75.762  1.00 13.87 ? 322  ASP B O   1 
ATOM   2513  C CB  . ASP B 1 94  ? 44.768  -11.411 76.224  1.00 13.58 ? 322  ASP B CB  1 
ATOM   2514  C CG  . ASP B 1 94  ? 45.069  -9.935  76.423  1.00 13.18 ? 322  ASP B CG  1 
ATOM   2515  O OD1 . ASP B 1 94  ? 44.460  -9.289  77.300  1.00 12.90 ? 322  ASP B OD1 1 
ATOM   2516  O OD2 . ASP B 1 94  ? 45.930  -9.409  75.699  1.00 14.01 ? 322  ASP B OD2 1 
ATOM   2517  N N   . GLU B 1 95  ? 43.170  -14.232 77.938  1.00 13.85 ? 323  GLU B N   1 
ATOM   2518  C CA  . GLU B 1 95  ? 42.713  -15.588 77.706  1.00 13.90 ? 323  GLU B CA  1 
ATOM   2519  C C   . GLU B 1 95  ? 41.590  -15.903 78.660  1.00 13.70 ? 323  GLU B C   1 
ATOM   2520  O O   . GLU B 1 95  ? 41.590  -15.431 79.806  1.00 13.80 ? 323  GLU B O   1 
ATOM   2521  C CB  . GLU B 1 95  ? 43.844  -16.581 77.939  1.00 14.08 ? 323  GLU B CB  1 
ATOM   2522  C CG  . GLU B 1 95  ? 44.903  -16.635 76.848  1.00 14.00 ? 323  GLU B CG  1 
ATOM   2523  C CD  . GLU B 1 95  ? 45.776  -17.868 76.977  1.00 14.36 ? 323  GLU B CD  1 
ATOM   2524  O OE1 . GLU B 1 95  ? 45.625  -18.584 77.995  1.00 15.36 ? 323  GLU B OE1 1 
ATOM   2525  O OE2 . GLU B 1 95  ? 46.603  -18.132 76.071  1.00 14.83 ? 323  GLU B OE2 1 
ATOM   2526  N N   . LEU B 1 96  ? 40.642  -16.704 78.185  1.00 13.50 ? 324  LEU B N   1 
ATOM   2527  C CA  . LEU B 1 96  ? 39.465  -17.074 78.961  1.00 13.35 ? 324  LEU B CA  1 
ATOM   2528  C C   . LEU B 1 96  ? 39.503  -18.561 79.275  1.00 13.39 ? 324  LEU B C   1 
ATOM   2529  O O   . LEU B 1 96  ? 39.498  -19.388 78.359  1.00 13.54 ? 324  LEU B O   1 
ATOM   2530  C CB  . LEU B 1 96  ? 38.194  -16.735 78.181  1.00 13.03 ? 324  LEU B CB  1 
ATOM   2531  C CG  . LEU B 1 96  ? 37.948  -15.238 77.984  1.00 13.19 ? 324  LEU B CG  1 
ATOM   2532  C CD1 . LEU B 1 96  ? 36.553  -14.973 77.419  1.00 13.66 ? 324  LEU B CD1 1 
ATOM   2533  C CD2 . LEU B 1 96  ? 38.119  -14.486 79.279  1.00 12.54 ? 324  LEU B CD2 1 
ATOM   2534  N N   . VAL B 1 97  ? 39.544  -18.910 80.559  1.00 13.22 ? 325  VAL B N   1 
ATOM   2535  C CA  . VAL B 1 97  ? 39.550  -20.327 80.942  1.00 13.03 ? 325  VAL B CA  1 
ATOM   2536  C C   . VAL B 1 97  ? 38.128  -20.803 81.160  1.00 12.65 ? 325  VAL B C   1 
ATOM   2537  O O   . VAL B 1 97  ? 37.587  -20.708 82.254  1.00 12.49 ? 325  VAL B O   1 
ATOM   2538  C CB  . VAL B 1 97  ? 40.390  -20.600 82.199  1.00 13.10 ? 325  VAL B CB  1 
ATOM   2539  C CG1 . VAL B 1 97  ? 40.290  -22.062 82.582  1.00 12.77 ? 325  VAL B CG1 1 
ATOM   2540  C CG2 . VAL B 1 97  ? 41.843  -20.198 81.959  1.00 12.94 ? 325  VAL B CG2 1 
ATOM   2541  N N   . TYR B 1 98  ? 37.528  -21.286 80.084  1.00 12.42 ? 326  TYR B N   1 
ATOM   2542  C CA  . TYR B 1 98  ? 36.213  -21.889 80.137  1.00 12.47 ? 326  TYR B CA  1 
ATOM   2543  C C   . TYR B 1 98  ? 36.291  -23.197 80.937  1.00 12.75 ? 326  TYR B C   1 
ATOM   2544  O O   . TYR B 1 98  ? 35.363  -23.559 81.665  1.00 13.14 ? 326  TYR B O   1 
ATOM   2545  C CB  . TYR B 1 98  ? 35.668  -22.089 78.712  1.00 12.20 ? 326  TYR B CB  1 
ATOM   2546  C CG  . TYR B 1 98  ? 35.095  -20.805 78.114  1.00 11.76 ? 326  TYR B CG  1 
ATOM   2547  C CD1 . TYR B 1 98  ? 33.878  -20.318 78.532  1.00 11.07 ? 326  TYR B CD1 1 
ATOM   2548  C CD2 . TYR B 1 98  ? 35.779  -20.082 77.156  1.00 11.54 ? 326  TYR B CD2 1 
ATOM   2549  C CE1 . TYR B 1 98  ? 33.358  -19.172 78.024  1.00 10.80 ? 326  TYR B CE1 1 
ATOM   2550  C CE2 . TYR B 1 98  ? 35.255  -18.927 76.633  1.00 10.79 ? 326  TYR B CE2 1 
ATOM   2551  C CZ  . TYR B 1 98  ? 34.038  -18.474 77.076  1.00 11.02 ? 326  TYR B CZ  1 
ATOM   2552  O OH  . TYR B 1 98  ? 33.474  -17.309 76.577  1.00 11.10 ? 326  TYR B OH  1 
ATOM   2553  N N   . ALA B 1 99  ? 37.422  -23.879 80.796  1.00 12.94 ? 327  ALA B N   1 
ATOM   2554  C CA  . ALA B 1 99  ? 37.800  -25.012 81.631  1.00 13.12 ? 327  ALA B CA  1 
ATOM   2555  C C   . ALA B 1 99  ? 39.318  -25.222 81.460  1.00 13.36 ? 327  ALA B C   1 
ATOM   2556  O O   . ALA B 1 99  ? 39.915  -24.651 80.537  1.00 13.23 ? 327  ALA B O   1 
ATOM   2557  C CB  . ALA B 1 99  ? 37.035  -26.244 81.217  1.00 13.16 ? 327  ALA B CB  1 
ATOM   2558  N N   . ASP B 1 100 ? 39.940  -26.028 82.328  1.00 13.46 ? 328  ASP B N   1 
ATOM   2559  C CA  . ASP B 1 100 ? 41.400  -26.289 82.252  1.00 13.48 ? 328  ASP B CA  1 
ATOM   2560  C C   . ASP B 1 100 ? 41.820  -26.894 80.909  1.00 13.42 ? 328  ASP B C   1 
ATOM   2561  O O   . ASP B 1 100 ? 42.946  -26.672 80.447  1.00 13.49 ? 328  ASP B O   1 
ATOM   2562  C CB  . ASP B 1 100 ? 41.884  -27.218 83.383  1.00 13.55 ? 328  ASP B CB  1 
ATOM   2563  C CG  . ASP B 1 100 ? 41.775  -26.590 84.782  1.00 13.80 ? 328  ASP B CG  1 
ATOM   2564  O OD1 . ASP B 1 100 ? 41.501  -25.379 84.917  1.00 15.81 ? 328  ASP B OD1 1 
ATOM   2565  O OD2 . ASP B 1 100 ? 41.976  -27.322 85.762  1.00 12.98 ? 328  ASP B OD2 1 
ATOM   2566  N N   . ASP B 1 101 ? 40.912  -27.647 80.290  1.00 13.30 ? 329  ASP B N   1 
ATOM   2567  C CA  . ASP B 1 101 ? 41.166  -28.263 78.991  1.00 13.43 ? 329  ASP B CA  1 
ATOM   2568  C C   . ASP B 1 101 ? 40.532  -27.492 77.826  1.00 13.68 ? 329  ASP B C   1 
ATOM   2569  O O   . ASP B 1 101 ? 40.346  -28.047 76.733  1.00 13.83 ? 329  ASP B O   1 
ATOM   2570  C CB  . ASP B 1 101 ? 40.663  -29.710 78.996  1.00 13.31 ? 329  ASP B CB  1 
ATOM   2571  C CG  . ASP B 1 101 ? 39.159  -29.804 79.082  1.00 13.13 ? 329  ASP B CG  1 
ATOM   2572  O OD1 . ASP B 1 101 ? 38.521  -28.857 79.610  1.00 13.30 ? 329  ASP B OD1 1 
ATOM   2573  O OD2 . ASP B 1 101 ? 38.617  -30.825 78.611  1.00 11.95 ? 329  ASP B OD2 1 
ATOM   2574  N N   . TYR B 1 102 ? 40.205  -26.220 78.058  1.00 13.96 ? 330  TYR B N   1 
ATOM   2575  C CA  . TYR B 1 102 ? 39.620  -25.371 77.022  1.00 14.09 ? 330  TYR B CA  1 
ATOM   2576  C C   . TYR B 1 102 ? 39.809  -23.879 77.324  1.00 14.16 ? 330  TYR B C   1 
ATOM   2577  O O   . TYR B 1 102 ? 39.071  -23.302 78.120  1.00 14.20 ? 330  TYR B O   1 
ATOM   2578  C CB  . TYR B 1 102 ? 38.132  -25.697 76.851  1.00 14.23 ? 330  TYR B CB  1 
ATOM   2579  C CG  . TYR B 1 102 ? 37.633  -25.359 75.475  1.00 14.55 ? 330  TYR B CG  1 
ATOM   2580  C CD1 . TYR B 1 102 ? 38.161  -26.001 74.361  1.00 14.78 ? 330  TYR B CD1 1 
ATOM   2581  C CD2 . TYR B 1 102 ? 36.654  -24.391 75.274  1.00 14.48 ? 330  TYR B CD2 1 
ATOM   2582  C CE1 . TYR B 1 102 ? 37.724  -25.700 73.089  1.00 14.89 ? 330  TYR B CE1 1 
ATOM   2583  C CE2 . TYR B 1 102 ? 36.215  -24.080 73.992  1.00 13.86 ? 330  TYR B CE2 1 
ATOM   2584  C CZ  . TYR B 1 102 ? 36.755  -24.741 72.913  1.00 14.11 ? 330  TYR B CZ  1 
ATOM   2585  O OH  . TYR B 1 102 ? 36.342  -24.466 71.638  1.00 14.88 ? 330  TYR B OH  1 
ATOM   2586  N N   . ILE B 1 103 ? 40.785  -23.263 76.656  1.00 14.30 ? 331  ILE B N   1 
ATOM   2587  C CA  . ILE B 1 103 ? 41.229  -21.899 76.951  1.00 14.38 ? 331  ILE B CA  1 
ATOM   2588  C C   . ILE B 1 103 ? 41.334  -21.053 75.673  1.00 14.91 ? 331  ILE B C   1 
ATOM   2589  O O   . ILE B 1 103 ? 42.156  -21.341 74.800  1.00 15.21 ? 331  ILE B O   1 
ATOM   2590  C CB  . ILE B 1 103 ? 42.603  -21.947 77.653  1.00 14.27 ? 331  ILE B CB  1 
ATOM   2591  C CG1 . ILE B 1 103 ? 42.502  -22.736 78.968  1.00 14.22 ? 331  ILE B CG1 1 
ATOM   2592  C CG2 . ILE B 1 103 ? 43.136  -20.550 77.906  1.00 13.92 ? 331  ILE B CG2 1 
ATOM   2593  C CD1 . ILE B 1 103 ? 43.826  -23.023 79.628  1.00 14.18 ? 331  ILE B CD1 1 
ATOM   2594  N N   . MET B 1 104 ? 40.518  -20.001 75.566  1.00 15.50 ? 332  MET B N   1 
ATOM   2595  C CA  . MET B 1 104 ? 40.429  -19.201 74.327  1.00 15.83 ? 332  MET B CA  1 
ATOM   2596  C C   . MET B 1 104 ? 41.293  -17.937 74.354  1.00 15.99 ? 332  MET B C   1 
ATOM   2597  O O   . MET B 1 104 ? 41.147  -17.091 75.223  1.00 16.11 ? 332  MET B O   1 
ATOM   2598  C CB  . MET B 1 104 ? 38.964  -18.834 74.016  1.00 15.73 ? 332  MET B CB  1 
ATOM   2599  C CG  . MET B 1 104 ? 38.053  -20.055 73.744  1.00 15.98 ? 332  MET B CG  1 
ATOM   2600  S SD  . MET B 1 104 ? 36.431  -19.742 72.963  1.00 16.18 ? 332  MET B SD  1 
ATOM   2601  C CE  . MET B 1 104 ? 36.875  -19.550 71.232  1.00 15.08 ? 332  MET B CE  1 
ATOM   2602  N N   . ASP B 1 105 ? 42.193  -17.823 73.387  1.00 16.45 ? 333  ASP B N   1 
ATOM   2603  C CA  . ASP B 1 105 ? 42.942  -16.591 73.165  1.00 16.91 ? 333  ASP B CA  1 
ATOM   2604  C C   . ASP B 1 105 ? 42.319  -15.816 72.006  1.00 17.25 ? 333  ASP B C   1 
ATOM   2605  O O   . ASP B 1 105 ? 41.385  -16.305 71.357  1.00 17.07 ? 333  ASP B O   1 
ATOM   2606  C CB  . ASP B 1 105 ? 44.430  -16.888 72.886  1.00 17.15 ? 333  ASP B CB  1 
ATOM   2607  C CG  . ASP B 1 105 ? 44.656  -17.718 71.623  1.00 17.12 ? 333  ASP B CG  1 
ATOM   2608  O OD1 . ASP B 1 105 ? 43.718  -17.867 70.807  1.00 17.53 ? 333  ASP B OD1 1 
ATOM   2609  O OD2 . ASP B 1 105 ? 45.787  -18.224 71.452  1.00 16.51 ? 333  ASP B OD2 1 
ATOM   2610  N N   . GLU B 1 106 ? 42.845  -14.618 71.746  1.00 17.69 ? 334  GLU B N   1 
ATOM   2611  C CA  . GLU B 1 106 ? 42.346  -13.778 70.651  1.00 18.29 ? 334  GLU B CA  1 
ATOM   2612  C C   . GLU B 1 106 ? 42.180  -14.596 69.357  1.00 18.39 ? 334  GLU B C   1 
ATOM   2613  O O   . GLU B 1 106 ? 41.112  -14.561 68.746  1.00 18.64 ? 334  GLU B O   1 
ATOM   2614  C CB  . GLU B 1 106 ? 43.248  -12.540 70.403  1.00 18.41 ? 334  GLU B CB  1 
ATOM   2615  C CG  . GLU B 1 106 ? 42.453  -11.235 70.127  1.00 18.87 ? 334  GLU B CG  1 
ATOM   2616  C CD  . GLU B 1 106 ? 43.325  -10.038 69.726  1.00 19.08 ? 334  GLU B CD  1 
ATOM   2617  O OE1 . GLU B 1 106 ? 44.016  -10.107 68.685  1.00 20.40 ? 334  GLU B OE1 1 
ATOM   2618  O OE2 . GLU B 1 106 ? 43.292  -9.009  70.438  1.00 20.14 ? 334  GLU B OE2 1 
ATOM   2619  N N   . ASP B 1 107 ? 43.207  -15.353 68.966  1.00 18.33 ? 335  ASP B N   1 
ATOM   2620  C CA  . ASP B 1 107 ? 43.146  -16.138 67.722  1.00 18.45 ? 335  ASP B CA  1 
ATOM   2621  C C   . ASP B 1 107 ? 41.932  -17.091 67.651  1.00 18.55 ? 335  ASP B C   1 
ATOM   2622  O O   . ASP B 1 107 ? 41.251  -17.147 66.626  1.00 18.58 ? 335  ASP B O   1 
ATOM   2623  C CB  . ASP B 1 107 ? 44.457  -16.913 67.482  1.00 18.47 ? 335  ASP B CB  1 
ATOM   2624  C CG  . ASP B 1 107 ? 45.573  -16.039 66.893  1.00 18.53 ? 335  ASP B CG  1 
ATOM   2625  O OD1 . ASP B 1 107 ? 45.639  -14.831 67.201  1.00 17.92 ? 335  ASP B OD1 1 
ATOM   2626  O OD2 . ASP B 1 107 ? 46.401  -16.571 66.121  1.00 19.16 ? 335  ASP B OD2 1 
ATOM   2627  N N   . GLN B 1 108 ? 41.655  -17.825 68.730  1.00 18.76 ? 336  GLN B N   1 
ATOM   2628  C CA  . GLN B 1 108 ? 40.567  -18.827 68.726  1.00 19.03 ? 336  GLN B CA  1 
ATOM   2629  C C   . GLN B 1 108 ? 39.191  -18.208 68.884  1.00 18.83 ? 336  GLN B C   1 
ATOM   2630  O O   . GLN B 1 108 ? 38.209  -18.715 68.328  1.00 18.64 ? 336  GLN B O   1 
ATOM   2631  C CB  . GLN B 1 108 ? 40.749  -19.848 69.840  1.00 19.39 ? 336  GLN B CB  1 
ATOM   2632  C CG  . GLN B 1 108 ? 41.857  -20.862 69.627  1.00 20.39 ? 336  GLN B CG  1 
ATOM   2633  C CD  . GLN B 1 108 ? 42.364  -21.370 70.959  1.00 22.33 ? 336  GLN B CD  1 
ATOM   2634  O OE1 . GLN B 1 108 ? 41.927  -22.414 71.449  1.00 24.15 ? 336  GLN B OE1 1 
ATOM   2635  N NE2 . GLN B 1 108 ? 43.243  -20.597 71.588  1.00 23.20 ? 336  GLN B NE2 1 
ATOM   2636  N N   . SER B 1 109 ? 39.117  -17.135 69.670  1.00 18.77 ? 337  SER B N   1 
ATOM   2637  C CA  . SER B 1 109 ? 37.904  -16.330 69.743  1.00 18.90 ? 337  SER B CA  1 
ATOM   2638  C C   . SER B 1 109 ? 37.479  -15.889 68.339  1.00 18.97 ? 337  SER B C   1 
ATOM   2639  O O   . SER B 1 109 ? 36.291  -15.871 68.023  1.00 18.93 ? 337  SER B O   1 
ATOM   2640  C CB  . SER B 1 109 ? 38.116  -15.116 70.648  1.00 19.02 ? 337  SER B CB  1 
ATOM   2641  O OG  . SER B 1 109 ? 38.329  -15.509 71.998  1.00 19.42 ? 337  SER B OG  1 
ATOM   2642  N N   . LYS B 1 110 ? 38.454  -15.564 67.490  1.00 19.19 ? 338  LYS B N   1 
ATOM   2643  C CA  . LYS B 1 110 ? 38.164  -15.202 66.106  1.00 19.31 ? 338  LYS B CA  1 
ATOM   2644  C C   . LYS B 1 110 ? 37.589  -16.391 65.339  1.00 19.54 ? 338  LYS B C   1 
ATOM   2645  O O   . LYS B 1 110 ? 36.601  -16.238 64.615  1.00 19.79 ? 338  LYS B O   1 
ATOM   2646  C CB  . LYS B 1 110 ? 39.402  -14.684 65.367  1.00 19.32 ? 338  LYS B CB  1 
ATOM   2647  C CG  . LYS B 1 110 ? 40.219  -13.615 66.082  1.00 19.59 ? 338  LYS B CG  1 
ATOM   2648  C CD  . LYS B 1 110 ? 40.803  -12.589 65.096  1.00 20.33 ? 338  LYS B CD  1 
ATOM   2649  C CE  . LYS B 1 110 ? 42.145  -11.997 65.559  1.00 20.60 ? 338  LYS B CE  1 
ATOM   2650  N NZ  . LYS B 1 110 ? 43.323  -12.614 64.868  1.00 20.41 ? 338  LYS B NZ  1 
ATOM   2651  N N   . LEU B 1 111 ? 38.205  -17.567 65.473  1.00 19.59 ? 339  LEU B N   1 
ATOM   2652  C CA  . LEU B 1 111 ? 37.694  -18.755 64.785  1.00 19.60 ? 339  LEU B CA  1 
ATOM   2653  C C   . LEU B 1 111 ? 36.214  -18.957 65.114  1.00 19.46 ? 339  LEU B C   1 
ATOM   2654  O O   . LEU B 1 111 ? 35.407  -19.190 64.216  1.00 19.67 ? 339  LEU B O   1 
ATOM   2655  C CB  . LEU B 1 111 ? 38.475  -20.029 65.151  1.00 19.69 ? 339  LEU B CB  1 
ATOM   2656  C CG  . LEU B 1 111 ? 39.823  -20.352 64.488  1.00 20.21 ? 339  LEU B CG  1 
ATOM   2657  C CD1 . LEU B 1 111 ? 40.289  -21.753 64.929  1.00 20.38 ? 339  LEU B CD1 1 
ATOM   2658  C CD2 . LEU B 1 111 ? 39.740  -20.297 62.964  1.00 20.20 ? 339  LEU B CD2 1 
ATOM   2659  N N   . ALA B 1 112 ? 35.858  -18.835 66.392  1.00 19.01 ? 340  ALA B N   1 
ATOM   2660  C CA  . ALA B 1 112 ? 34.527  -19.222 66.849  1.00 18.94 ? 340  ALA B CA  1 
ATOM   2661  C C   . ALA B 1 112 ? 33.447  -18.173 66.594  1.00 18.96 ? 340  ALA B C   1 
ATOM   2662  O O   . ALA B 1 112 ? 32.263  -18.444 66.796  1.00 19.09 ? 340  ALA B O   1 
ATOM   2663  C CB  . ALA B 1 112 ? 34.568  -19.586 68.327  1.00 18.93 ? 340  ALA B CB  1 
ATOM   2664  N N   . GLY B 1 113 ? 33.843  -16.983 66.155  1.00 19.00 ? 341  GLY B N   1 
ATOM   2665  C CA  . GLY B 1 113 ? 32.895  -15.897 65.940  1.00 19.00 ? 341  GLY B CA  1 
ATOM   2666  C C   . GLY B 1 113 ? 32.443  -15.316 67.261  1.00 19.21 ? 341  GLY B C   1 
ATOM   2667  O O   . GLY B 1 113 ? 31.319  -14.818 67.381  1.00 19.67 ? 341  GLY B O   1 
ATOM   2668  N N   . LEU B 1 114 ? 33.334  -15.371 68.251  1.00 19.19 ? 342  LEU B N   1 
ATOM   2669  C CA  . LEU B 1 114 ? 33.047  -14.913 69.601  1.00 19.08 ? 342  LEU B CA  1 
ATOM   2670  C C   . LEU B 1 114 ? 33.865  -13.687 69.974  1.00 19.04 ? 342  LEU B C   1 
ATOM   2671  O O   . LEU B 1 114 ? 33.888  -13.288 71.132  1.00 19.63 ? 342  LEU B O   1 
ATOM   2672  C CB  . LEU B 1 114 ? 33.366  -16.028 70.595  1.00 19.11 ? 342  LEU B CB  1 
ATOM   2673  C CG  . LEU B 1 114 ? 32.501  -17.275 70.536  1.00 19.11 ? 342  LEU B CG  1 
ATOM   2674  C CD1 . LEU B 1 114 ? 32.972  -18.261 71.594  1.00 18.96 ? 342  LEU B CD1 1 
ATOM   2675  C CD2 . LEU B 1 114 ? 31.043  -16.899 70.748  1.00 19.71 ? 342  LEU B CD2 1 
ATOM   2676  N N   . LEU B 1 115 ? 34.533  -13.075 69.012  1.00 18.96 ? 343  LEU B N   1 
ATOM   2677  C CA  . LEU B 1 115 ? 35.457  -11.999 69.336  1.00 18.99 ? 343  LEU B CA  1 
ATOM   2678  C C   . LEU B 1 115 ? 34.778  -10.890 70.135  1.00 18.66 ? 343  LEU B C   1 
ATOM   2679  O O   . LEU B 1 115 ? 35.268  -10.504 71.188  1.00 18.96 ? 343  LEU B O   1 
ATOM   2680  C CB  . LEU B 1 115 ? 36.101  -11.434 68.072  1.00 18.98 ? 343  LEU B CB  1 
ATOM   2681  C CG  . LEU B 1 115 ? 37.125  -10.319 68.297  1.00 19.48 ? 343  LEU B CG  1 
ATOM   2682  C CD1 . LEU B 1 115 ? 37.990  -10.573 69.535  1.00 19.57 ? 343  LEU B CD1 1 
ATOM   2683  C CD2 . LEU B 1 115 ? 37.987  -10.156 67.039  1.00 19.57 ? 343  LEU B CD2 1 
ATOM   2684  N N   . ASP B 1 116 ? 33.646  -10.394 69.655  1.00 18.29 ? 344  ASP B N   1 
ATOM   2685  C CA  . ASP B 1 116 ? 32.962  -9.298  70.353  1.00 18.06 ? 344  ASP B CA  1 
ATOM   2686  C C   . ASP B 1 116 ? 32.488  -9.707  71.744  1.00 17.61 ? 344  ASP B C   1 
ATOM   2687  O O   . ASP B 1 116 ? 32.672  -8.962  72.711  1.00 17.84 ? 344  ASP B O   1 
ATOM   2688  C CB  . ASP B 1 116 ? 31.801  -8.733  69.520  1.00 18.06 ? 344  ASP B CB  1 
ATOM   2689  C CG  . ASP B 1 116 ? 32.172  -7.439  68.827  1.00 18.44 ? 344  ASP B CG  1 
ATOM   2690  O OD1 . ASP B 1 116 ? 32.209  -6.408  69.532  1.00 19.17 ? 344  ASP B OD1 1 
ATOM   2691  O OD2 . ASP B 1 116 ? 32.434  -7.451  67.600  1.00 18.45 ? 344  ASP B OD2 1 
ATOM   2692  N N   . LEU B 1 117 ? 31.901  -10.898 71.843  1.00 16.87 ? 345  LEU B N   1 
ATOM   2693  C CA  . LEU B 1 117 ? 31.355  -11.385 73.103  1.00 16.01 ? 345  LEU B CA  1 
ATOM   2694  C C   . LEU B 1 117 ? 32.450  -11.774 74.090  1.00 15.65 ? 345  LEU B C   1 
ATOM   2695  O O   . LEU B 1 117 ? 32.281  -11.583 75.301  1.00 16.00 ? 345  LEU B O   1 
ATOM   2696  C CB  . LEU B 1 117 ? 30.414  -12.562 72.853  1.00 15.97 ? 345  LEU B CB  1 
ATOM   2697  C CG  . LEU B 1 117 ? 29.722  -13.212 74.055  1.00 15.84 ? 345  LEU B CG  1 
ATOM   2698  C CD1 . LEU B 1 117 ? 29.107  -12.185 75.002  1.00 15.46 ? 345  LEU B CD1 1 
ATOM   2699  C CD2 . LEU B 1 117 ? 28.669  -14.195 73.556  1.00 15.63 ? 345  LEU B CD2 1 
ATOM   2700  N N   . ASN B 1 118 ? 33.565  -12.312 73.596  1.00 14.97 ? 346  ASN B N   1 
ATOM   2701  C CA  . ASN B 1 118 ? 34.659  -12.689 74.492  1.00 14.62 ? 346  ASN B CA  1 
ATOM   2702  C C   . ASN B 1 118 ? 35.352  -11.466 75.093  1.00 14.53 ? 346  ASN B C   1 
ATOM   2703  O O   . ASN B 1 118 ? 35.622  -11.458 76.286  1.00 14.59 ? 346  ASN B O   1 
ATOM   2704  C CB  . ASN B 1 118 ? 35.660  -13.649 73.823  1.00 14.69 ? 346  ASN B CB  1 
ATOM   2705  C CG  . ASN B 1 118 ? 35.307  -15.141 74.039  1.00 13.61 ? 346  ASN B CG  1 
ATOM   2706  O OD1 . ASN B 1 118 ? 34.561  -15.491 74.945  1.00 12.81 ? 346  ASN B OD1 1 
ATOM   2707  N ND2 . ASN B 1 118 ? 35.870  -16.011 73.209  1.00 11.56 ? 346  ASN B ND2 1 
ATOM   2708  N N   . ASN B 1 119 ? 35.586  -10.427 74.289  1.00 14.44 ? 347  ASN B N   1 
ATOM   2709  C CA  . ASN B 1 119 ? 36.161  -9.153  74.777  1.00 14.34 ? 347  ASN B CA  1 
ATOM   2710  C C   . ASN B 1 119 ? 35.330  -8.484  75.875  1.00 14.58 ? 347  ASN B C   1 
ATOM   2711  O O   . ASN B 1 119 ? 35.876  -7.827  76.761  1.00 14.80 ? 347  ASN B O   1 
ATOM   2712  C CB  . ASN B 1 119 ? 36.320  -8.135  73.643  1.00 14.17 ? 347  ASN B CB  1 
ATOM   2713  C CG  . ASN B 1 119 ? 37.334  -8.556  72.595  1.00 13.73 ? 347  ASN B CG  1 
ATOM   2714  O OD1 . ASN B 1 119 ? 38.233  -9.350  72.854  1.00 12.55 ? 347  ASN B OD1 1 
ATOM   2715  N ND2 . ASN B 1 119 ? 37.186  -8.015  71.391  1.00 13.72 ? 347  ASN B ND2 1 
ATOM   2716  N N   . ALA B 1 120 ? 34.011  -8.620  75.792  1.00 14.70 ? 348  ALA B N   1 
ATOM   2717  C CA  . ALA B 1 120 ? 33.116  -8.080  76.809  1.00 14.82 ? 348  ALA B CA  1 
ATOM   2718  C C   . ALA B 1 120 ? 33.348  -8.798  78.146  1.00 15.37 ? 348  ALA B C   1 
ATOM   2719  O O   . ALA B 1 120 ? 33.403  -8.153  79.210  1.00 15.47 ? 348  ALA B O   1 
ATOM   2720  C CB  . ALA B 1 120 ? 31.679  -8.228  76.368  1.00 14.57 ? 348  ALA B CB  1 
ATOM   2721  N N   . ILE B 1 121 ? 33.492  -10.129 78.077  1.00 15.51 ? 349  ILE B N   1 
ATOM   2722  C CA  . ILE B 1 121 ? 33.827  -10.951 79.246  1.00 15.38 ? 349  ILE B CA  1 
ATOM   2723  C C   . ILE B 1 121 ? 35.238  -10.602 79.745  1.00 15.12 ? 349  ILE B C   1 
ATOM   2724  O O   . ILE B 1 121 ? 35.479  -10.560 80.948  1.00 14.52 ? 349  ILE B O   1 
ATOM   2725  C CB  . ILE B 1 121 ? 33.750  -12.470 78.912  1.00 15.69 ? 349  ILE B CB  1 
ATOM   2726  C CG1 . ILE B 1 121 ? 32.352  -12.845 78.420  1.00 16.17 ? 349  ILE B CG1 1 
ATOM   2727  C CG2 . ILE B 1 121 ? 34.109  -13.334 80.129  1.00 14.83 ? 349  ILE B CG2 1 
ATOM   2728  C CD1 . ILE B 1 121 ? 32.272  -14.233 77.854  1.00 15.81 ? 349  ILE B CD1 1 
ATOM   2729  N N   . LEU B 1 122 ? 36.163  -10.349 78.816  1.00 15.13 ? 350  LEU B N   1 
ATOM   2730  C CA  . LEU B 1 122 ? 37.524  -9.938  79.182  1.00 15.37 ? 350  LEU B CA  1 
ATOM   2731  C C   . LEU B 1 122 ? 37.518  -8.552  79.813  1.00 15.75 ? 350  LEU B C   1 
ATOM   2732  O O   . LEU B 1 122 ? 38.411  -8.234  80.602  1.00 15.93 ? 350  LEU B O   1 
ATOM   2733  C CB  . LEU B 1 122 ? 38.484  -9.961  77.984  1.00 15.35 ? 350  LEU B CB  1 
ATOM   2734  C CG  . LEU B 1 122 ? 39.116  -11.305 77.572  1.00 15.29 ? 350  LEU B CG  1 
ATOM   2735  C CD1 . LEU B 1 122 ? 39.807  -11.183 76.206  1.00 14.27 ? 350  LEU B CD1 1 
ATOM   2736  C CD2 . LEU B 1 122 ? 40.098  -11.798 78.619  1.00 13.97 ? 350  LEU B CD2 1 
ATOM   2737  N N   . GLN B 1 123 ? 36.520  -7.735  79.469  1.00 15.96 ? 351  GLN B N   1 
ATOM   2738  C CA  . GLN B 1 123 ? 36.326  -6.454  80.133  1.00 16.25 ? 351  GLN B CA  1 
ATOM   2739  C C   . GLN B 1 123 ? 35.963  -6.670  81.597  1.00 16.37 ? 351  GLN B C   1 
ATOM   2740  O O   . GLN B 1 123 ? 36.398  -5.915  82.461  1.00 16.57 ? 351  GLN B O   1 
ATOM   2741  C CB  . GLN B 1 123 ? 35.243  -5.617  79.448  1.00 16.46 ? 351  GLN B CB  1 
ATOM   2742  C CG  . GLN B 1 123 ? 35.359  -4.120  79.737  1.00 16.65 ? 351  GLN B CG  1 
ATOM   2743  C CD  . GLN B 1 123 ? 34.095  -3.336  79.421  1.00 16.60 ? 351  GLN B CD  1 
ATOM   2744  O OE1 . GLN B 1 123 ? 33.421  -3.593  78.428  1.00 16.34 ? 351  GLN B OE1 1 
ATOM   2745  N NE2 . GLN B 1 123 ? 33.784  -2.356  80.262  1.00 17.76 ? 351  GLN B NE2 1 
ATOM   2746  N N   . LEU B 1 124 ? 35.167  -7.698  81.875  1.00 16.57 ? 352  LEU B N   1 
ATOM   2747  C CA  . LEU B 1 124 ? 34.861  -8.082  83.258  1.00 16.44 ? 352  LEU B CA  1 
ATOM   2748  C C   . LEU B 1 124 ? 36.071  -8.668  83.976  1.00 16.01 ? 352  LEU B C   1 
ATOM   2749  O O   . LEU B 1 124 ? 36.242  -8.457  85.178  1.00 15.68 ? 352  LEU B O   1 
ATOM   2750  C CB  . LEU B 1 124 ? 33.718  -9.087  83.297  1.00 16.74 ? 352  LEU B CB  1 
ATOM   2751  C CG  . LEU B 1 124 ? 32.337  -8.471  83.245  1.00 17.85 ? 352  LEU B CG  1 
ATOM   2752  C CD1 . LEU B 1 124 ? 31.285  -9.544  82.921  1.00 19.64 ? 352  LEU B CD1 1 
ATOM   2753  C CD2 . LEU B 1 124 ? 32.063  -7.805  84.595  1.00 20.15 ? 352  LEU B CD2 1 
ATOM   2754  N N   . VAL B 1 125 ? 36.900  -9.414  83.253  1.00 15.81 ? 353  VAL B N   1 
ATOM   2755  C CA  . VAL B 1 125 ? 38.108  -9.956  83.864  1.00 15.82 ? 353  VAL B CA  1 
ATOM   2756  C C   . VAL B 1 125 ? 38.981  -8.789  84.327  1.00 16.10 ? 353  VAL B C   1 
ATOM   2757  O O   . VAL B 1 125 ? 39.411  -8.757  85.485  1.00 16.11 ? 353  VAL B O   1 
ATOM   2758  C CB  . VAL B 1 125 ? 38.907  -10.905 82.921  1.00 15.50 ? 353  VAL B CB  1 
ATOM   2759  C CG1 . VAL B 1 125 ? 40.162  -11.408 83.612  1.00 15.40 ? 353  VAL B CG1 1 
ATOM   2760  C CG2 . VAL B 1 125 ? 38.079  -12.085 82.523  1.00 14.39 ? 353  VAL B CG2 1 
ATOM   2761  N N   . LYS B 1 126 ? 39.180  -7.815  83.439  1.00 16.27 ? 354  LYS B N   1 
ATOM   2762  C CA  . LYS B 1 126 ? 40.095  -6.692  83.691  1.00 16.78 ? 354  LYS B CA  1 
ATOM   2763  C C   . LYS B 1 126 ? 39.798  -5.955  84.995  1.00 16.62 ? 354  LYS B C   1 
ATOM   2764  O O   . LYS B 1 126 ? 40.712  -5.625  85.755  1.00 16.39 ? 354  LYS B O   1 
ATOM   2765  C CB  . LYS B 1 126 ? 40.091  -5.719  82.496  1.00 16.83 ? 354  LYS B CB  1 
ATOM   2766  C CG  . LYS B 1 126 ? 41.039  -4.521  82.639  1.00 17.38 ? 354  LYS B CG  1 
ATOM   2767  C CD  . LYS B 1 126 ? 41.528  -3.972  81.281  1.00 18.00 ? 354  LYS B CD  1 
ATOM   2768  C CE  . LYS B 1 126 ? 41.504  -2.397  81.189  1.00 18.73 ? 354  LYS B CE  1 
ATOM   2769  N NZ  . LYS B 1 126 ? 42.127  -1.656  82.331  1.00 17.72 ? 354  LYS B NZ  1 
ATOM   2770  N N   . LYS B 1 127 ? 38.513  -5.725  85.245  1.00 16.87 ? 355  LYS B N   1 
ATOM   2771  C CA  . LYS B 1 127 ? 38.045  -5.015  86.440  1.00 17.31 ? 355  LYS B CA  1 
ATOM   2772  C C   . LYS B 1 127 ? 38.369  -5.823  87.710  1.00 17.05 ? 355  LYS B C   1 
ATOM   2773  O O   . LYS B 1 127 ? 39.014  -5.321  88.640  1.00 17.33 ? 355  LYS B O   1 
ATOM   2774  C CB  . LYS B 1 127 ? 36.530  -4.747  86.340  1.00 17.09 ? 355  LYS B CB  1 
ATOM   2775  C CG  . LYS B 1 127 ? 36.083  -3.395  86.882  1.00 18.03 ? 355  LYS B CG  1 
ATOM   2776  C CD  . LYS B 1 127 ? 34.589  -3.368  87.311  1.00 19.17 ? 355  LYS B CD  1 
ATOM   2777  C CE  . LYS B 1 127 ? 33.619  -2.695  86.291  1.00 20.81 ? 355  LYS B CE  1 
ATOM   2778  N NZ  . LYS B 1 127 ? 32.296  -2.237  86.918  1.00 20.57 ? 355  LYS B NZ  1 
ATOM   2779  N N   . TYR B 1 128 ? 37.947  -7.081  87.741  1.00 16.56 ? 356  TYR B N   1 
ATOM   2780  C CA  . TYR B 1 128 ? 38.208  -7.929  88.903  1.00 16.27 ? 356  TYR B CA  1 
ATOM   2781  C C   . TYR B 1 128 ? 39.697  -8.233  89.129  1.00 16.37 ? 356  TYR B C   1 
ATOM   2782  O O   . TYR B 1 128 ? 40.145  -8.414  90.262  1.00 16.10 ? 356  TYR B O   1 
ATOM   2783  C CB  . TYR B 1 128 ? 37.445  -9.231  88.767  1.00 16.05 ? 356  TYR B CB  1 
ATOM   2784  C CG  . TYR B 1 128 ? 35.965  -9.079  88.870  1.00 14.94 ? 356  TYR B CG  1 
ATOM   2785  C CD1 . TYR B 1 128 ? 35.391  -8.471  89.969  1.00 14.45 ? 356  TYR B CD1 1 
ATOM   2786  C CD2 . TYR B 1 128 ? 35.132  -9.580  87.887  1.00 15.18 ? 356  TYR B CD2 1 
ATOM   2787  C CE1 . TYR B 1 128 ? 34.019  -8.344  90.086  1.00 14.24 ? 356  TYR B CE1 1 
ATOM   2788  C CE2 . TYR B 1 128 ? 33.757  -9.465  87.990  1.00 15.28 ? 356  TYR B CE2 1 
ATOM   2789  C CZ  . TYR B 1 128 ? 33.211  -8.847  89.098  1.00 15.24 ? 356  TYR B CZ  1 
ATOM   2790  O OH  . TYR B 1 128 ? 31.852  -8.726  89.209  1.00 15.82 ? 356  TYR B OH  1 
ATOM   2791  N N   . LYS B 1 129 ? 40.456  -8.310  88.045  1.00 16.77 ? 357  LYS B N   1 
ATOM   2792  C CA  . LYS B 1 129 ? 41.918  -8.345  88.147  1.00 17.02 ? 357  LYS B CA  1 
ATOM   2793  C C   . LYS B 1 129 ? 42.405  -7.134  88.931  1.00 17.06 ? 357  LYS B C   1 
ATOM   2794  O O   . LYS B 1 129 ? 43.247  -7.270  89.799  1.00 17.04 ? 357  LYS B O   1 
ATOM   2795  C CB  . LYS B 1 129 ? 42.577  -8.321  86.769  1.00 16.99 ? 357  LYS B CB  1 
ATOM   2796  C CG  . LYS B 1 129 ? 42.828  -9.659  86.105  1.00 16.96 ? 357  LYS B CG  1 
ATOM   2797  C CD  . LYS B 1 129 ? 43.743  -9.410  84.879  1.00 17.55 ? 357  LYS B CD  1 
ATOM   2798  C CE  . LYS B 1 129 ? 43.921  -10.628 83.978  1.00 17.87 ? 357  LYS B CE  1 
ATOM   2799  N NZ  . LYS B 1 129 ? 44.168  -10.227 82.552  1.00 16.83 ? 357  LYS B NZ  1 
ATOM   2800  N N   . SER B 1 130 ? 41.869  -5.954  88.618  1.00 17.32 ? 358  SER B N   1 
ATOM   2801  C CA  . SER B 1 130 ? 42.310  -4.704  89.255  1.00 17.66 ? 358  SER B CA  1 
ATOM   2802  C C   . SER B 1 130 ? 42.013  -4.636  90.746  1.00 17.79 ? 358  SER B C   1 
ATOM   2803  O O   . SER B 1 130 ? 42.763  -4.021  91.505  1.00 17.44 ? 358  SER B O   1 
ATOM   2804  C CB  . SER B 1 130 ? 41.677  -3.499  88.567  1.00 17.67 ? 358  SER B CB  1 
ATOM   2805  O OG  . SER B 1 130 ? 42.011  -3.499  87.194  1.00 18.62 ? 358  SER B OG  1 
ATOM   2806  N N   . MET B 1 131 ? 40.920  -5.278  91.156  1.00 18.13 ? 359  MET B N   1 
ATOM   2807  C CA  . MET B 1 131 ? 40.529  -5.319  92.560  1.00 18.49 ? 359  MET B CA  1 
ATOM   2808  C C   . MET B 1 131 ? 40.975  -6.610  93.225  1.00 17.75 ? 359  MET B C   1 
ATOM   2809  O O   . MET B 1 131 ? 40.425  -6.980  94.251  1.00 17.40 ? 359  MET B O   1 
ATOM   2810  C CB  . MET B 1 131 ? 39.018  -5.238  92.695  1.00 18.62 ? 359  MET B CB  1 
ATOM   2811  C CG  . MET B 1 131 ? 38.337  -4.216  91.820  1.00 19.77 ? 359  MET B CG  1 
ATOM   2812  S SD  . MET B 1 131 ? 36.566  -4.519  91.846  1.00 21.19 ? 359  MET B SD  1 
ATOM   2813  C CE  . MET B 1 131 ? 36.184  -4.125  93.550  1.00 21.03 ? 359  MET B CE  1 
ATOM   2814  N N   . LYS B 1 132 ? 41.939  -7.309  92.633  1.00 17.46 ? 360  LYS B N   1 
ATOM   2815  C CA  . LYS B 1 132 ? 42.478  -8.529  93.225  1.00 17.44 ? 360  LYS B CA  1 
ATOM   2816  C C   . LYS B 1 132 ? 41.365  -9.328  93.936  1.00 17.04 ? 360  LYS B C   1 
ATOM   2817  O O   . LYS B 1 132 ? 41.468  -9.642  95.131  1.00 16.91 ? 360  LYS B O   1 
ATOM   2818  C CB  . LYS B 1 132 ? 43.623  -8.183  94.187  1.00 17.49 ? 360  LYS B CB  1 
ATOM   2819  C CG  . LYS B 1 132 ? 44.881  -7.602  93.511  1.00 17.72 ? 360  LYS B CG  1 
ATOM   2820  C CD  . LYS B 1 132 ? 45.848  -6.995  94.546  1.00 18.12 ? 360  LYS B CD  1 
ATOM   2821  C CE  . LYS B 1 132 ? 47.088  -6.340  93.912  1.00 18.71 ? 360  LYS B CE  1 
ATOM   2822  N NZ  . LYS B 1 132 ? 48.259  -7.273  93.742  1.00 18.62 ? 360  LYS B NZ  1 
ATOM   2823  N N   . LEU B 1 133 ? 40.311  -9.628  93.167  1.00 16.45 ? 361  LEU B N   1 
ATOM   2824  C CA  . LEU B 1 133 ? 39.123  -10.354 93.619  1.00 15.95 ? 361  LEU B CA  1 
ATOM   2825  C C   . LEU B 1 133 ? 39.452  -11.742 94.140  1.00 15.92 ? 361  LEU B C   1 
ATOM   2826  O O   . LEU B 1 133 ? 40.276  -12.437 93.568  1.00 15.84 ? 361  LEU B O   1 
ATOM   2827  C CB  . LEU B 1 133 ? 38.139  -10.492 92.458  1.00 16.00 ? 361  LEU B CB  1 
ATOM   2828  C CG  . LEU B 1 133 ? 36.850  -11.279 92.692  1.00 15.41 ? 361  LEU B CG  1 
ATOM   2829  C CD1 . LEU B 1 133 ? 35.940  -10.474 93.579  1.00 14.45 ? 361  LEU B CD1 1 
ATOM   2830  C CD2 . LEU B 1 133 ? 36.180  -11.613 91.362  1.00 15.18 ? 361  LEU B CD2 1 
ATOM   2831  N N   . GLU B 1 134 ? 38.766  -12.143 95.207  1.00 15.88 ? 362  GLU B N   1 
ATOM   2832  C CA  . GLU B 1 134 ? 39.077  -13.369 95.934  1.00 15.86 ? 362  GLU B CA  1 
ATOM   2833  C C   . GLU B 1 134 ? 37.934  -14.372 95.868  1.00 15.88 ? 362  GLU B C   1 
ATOM   2834  O O   . GLU B 1 134 ? 36.785  -14.004 95.649  1.00 15.68 ? 362  GLU B O   1 
ATOM   2835  C CB  . GLU B 1 134 ? 39.355  -13.042 97.391  1.00 15.78 ? 362  GLU B CB  1 
ATOM   2836  C CG  . GLU B 1 134 ? 40.379  -11.953 97.587  1.00 16.22 ? 362  GLU B CG  1 
ATOM   2837  C CD  . GLU B 1 134 ? 40.292  -11.303 98.956  1.00 17.42 ? 362  GLU B CD  1 
ATOM   2838  O OE1 . GLU B 1 134 ? 39.289  -11.528 99.670  1.00 18.60 ? 362  GLU B OE1 1 
ATOM   2839  O OE2 . GLU B 1 134 ? 41.226  -10.554 99.318  1.00 17.71 ? 362  GLU B OE2 1 
ATOM   2840  N N   . LYS B 1 135 ? 38.257  -15.645 96.078  1.00 16.08 ? 363  LYS B N   1 
ATOM   2841  C CA  . LYS B 1 135 ? 37.274  -16.699 95.927  1.00 16.24 ? 363  LYS B CA  1 
ATOM   2842  C C   . LYS B 1 135 ? 36.088  -16.429 96.837  1.00 16.14 ? 363  LYS B C   1 
ATOM   2843  O O   . LYS B 1 135 ? 34.943  -16.689 96.465  1.00 16.35 ? 363  LYS B O   1 
ATOM   2844  C CB  . LYS B 1 135 ? 37.868  -18.076 96.236  1.00 16.55 ? 363  LYS B CB  1 
ATOM   2845  C CG  . LYS B 1 135 ? 36.853  -19.220 96.037  1.00 17.93 ? 363  LYS B CG  1 
ATOM   2846  C CD  . LYS B 1 135 ? 37.467  -20.542 95.591  1.00 19.96 ? 363  LYS B CD  1 
ATOM   2847  C CE  . LYS B 1 135 ? 36.599  -21.193 94.505  1.00 21.09 ? 363  LYS B CE  1 
ATOM   2848  N NZ  . LYS B 1 135 ? 37.194  -22.458 93.962  1.00 21.88 ? 363  LYS B NZ  1 
ATOM   2849  N N   . GLU B 1 136 ? 36.359  -15.900 98.023  1.00 15.89 ? 364  GLU B N   1 
ATOM   2850  C CA  . GLU B 1 136 ? 35.299  -15.617 98.988  1.00 15.93 ? 364  GLU B CA  1 
ATOM   2851  C C   . GLU B 1 136 ? 34.310  -14.639 98.386  1.00 15.89 ? 364  GLU B C   1 
ATOM   2852  O O   . GLU B 1 136 ? 33.097  -14.761 98.582  1.00 15.89 ? 364  GLU B O   1 
ATOM   2853  C CB  . GLU B 1 136 ? 35.884  -15.030 100.273 1.00 16.06 ? 364  GLU B CB  1 
ATOM   2854  C CG  . GLU B 1 136 ? 36.660  -16.041 101.146 1.00 16.60 ? 364  GLU B CG  1 
ATOM   2855  C CD  . GLU B 1 136 ? 38.083  -16.355 100.663 1.00 16.75 ? 364  GLU B CD  1 
ATOM   2856  O OE1 . GLU B 1 136 ? 38.446  -15.995 99.524  1.00 17.19 ? 364  GLU B OE1 1 
ATOM   2857  O OE2 . GLU B 1 136 ? 38.840  -16.980 101.434 1.00 17.23 ? 364  GLU B OE2 1 
ATOM   2858  N N   . GLU B 1 137 ? 34.851  -13.674 97.641  1.00 15.86 ? 365  GLU B N   1 
ATOM   2859  C CA  . GLU B 1 137 ? 34.062  -12.633 97.000  1.00 15.64 ? 365  GLU B CA  1 
ATOM   2860  C C   . GLU B 1 137 ? 33.402  -13.155 95.737  1.00 15.72 ? 365  GLU B C   1 
ATOM   2861  O O   . GLU B 1 137 ? 32.319  -12.690 95.376  1.00 16.59 ? 365  GLU B O   1 
ATOM   2862  C CB  . GLU B 1 137 ? 34.937  -11.429 96.668  1.00 15.42 ? 365  GLU B CB  1 
ATOM   2863  C CG  . GLU B 1 137 ? 35.527  -10.756 97.890  1.00 15.83 ? 365  GLU B CG  1 
ATOM   2864  C CD  . GLU B 1 137 ? 36.699  -9.848  97.550  1.00 17.27 ? 365  GLU B CD  1 
ATOM   2865  O OE1 . GLU B 1 137 ? 37.698  -10.352 96.980  1.00 16.77 ? 365  GLU B OE1 1 
ATOM   2866  O OE2 . GLU B 1 137 ? 36.619  -8.630  97.847  1.00 17.87 ? 365  GLU B OE2 1 
ATOM   2867  N N   . PHE B 1 138 ? 34.045  -14.101 95.057  1.00 15.32 ? 366  PHE B N   1 
ATOM   2868  C CA  . PHE B 1 138 ? 33.453  -14.718 93.867  1.00 15.24 ? 366  PHE B CA  1 
ATOM   2869  C C   . PHE B 1 138 ? 32.215  -15.528 94.226  1.00 14.88 ? 366  PHE B C   1 
ATOM   2870  O O   . PHE B 1 138 ? 31.127  -15.271 93.695  1.00 15.15 ? 366  PHE B O   1 
ATOM   2871  C CB  . PHE B 1 138 ? 34.483  -15.580 93.125  1.00 15.73 ? 366  PHE B CB  1 
ATOM   2872  C CG  . PHE B 1 138 ? 33.881  -16.613 92.211  1.00 16.16 ? 366  PHE B CG  1 
ATOM   2873  C CD1 . PHE B 1 138 ? 33.197  -16.245 91.072  1.00 17.38 ? 366  PHE B CD1 1 
ATOM   2874  C CD2 . PHE B 1 138 ? 34.012  -17.967 92.489  1.00 16.87 ? 366  PHE B CD2 1 
ATOM   2875  C CE1 . PHE B 1 138 ? 32.645  -17.224 90.227  1.00 17.48 ? 366  PHE B CE1 1 
ATOM   2876  C CE2 . PHE B 1 138 ? 33.456  -18.933 91.658  1.00 16.16 ? 366  PHE B CE2 1 
ATOM   2877  C CZ  . PHE B 1 138 ? 32.782  -18.564 90.534  1.00 16.17 ? 366  PHE B CZ  1 
ATOM   2878  N N   . VAL B 1 139 ? 32.370  -16.480 95.145  1.00 14.45 ? 367  VAL B N   1 
ATOM   2879  C CA  . VAL B 1 139 ? 31.250  -17.360 95.531  1.00 13.93 ? 367  VAL B CA  1 
ATOM   2880  C C   . VAL B 1 139 ? 30.063  -16.568 96.047  1.00 13.57 ? 367  VAL B C   1 
ATOM   2881  O O   . VAL B 1 139 ? 28.941  -16.838 95.652  1.00 13.77 ? 367  VAL B O   1 
ATOM   2882  C CB  . VAL B 1 139 ? 31.644  -18.456 96.570  1.00 13.75 ? 367  VAL B CB  1 
ATOM   2883  C CG1 . VAL B 1 139 ? 32.782  -19.269 96.049  1.00 13.19 ? 367  VAL B CG1 1 
ATOM   2884  C CG2 . VAL B 1 139 ? 31.998  -17.858 97.918  1.00 13.40 ? 367  VAL B CG2 1 
ATOM   2885  N N   . THR B 1 140 ? 30.307  -15.576 96.896  1.00 13.33 ? 368  THR B N   1 
ATOM   2886  C CA  . THR B 1 140 ? 29.210  -14.791 97.466  1.00 13.32 ? 368  THR B CA  1 
ATOM   2887  C C   . THR B 1 140 ? 28.550  -13.960 96.369  1.00 13.49 ? 368  THR B C   1 
ATOM   2888  O O   . THR B 1 140 ? 27.325  -13.886 96.306  1.00 13.09 ? 368  THR B O   1 
ATOM   2889  C CB  . THR B 1 140 ? 29.672  -13.925 98.659  1.00 13.24 ? 368  THR B CB  1 
ATOM   2890  O OG1 . THR B 1 140 ? 30.376  -14.754 99.595  1.00 13.13 ? 368  THR B OG1 1 
ATOM   2891  C CG2 . THR B 1 140 ? 28.494  -13.300 99.371  1.00 12.64 ? 368  THR B CG2 1 
ATOM   2892  N N   . LEU B 1 141 ? 29.360  -13.399 95.469  1.00 13.90 ? 369  LEU B N   1 
ATOM   2893  C CA  . LEU B 1 141 ? 28.828  -12.639 94.332  1.00 14.07 ? 369  LEU B CA  1 
ATOM   2894  C C   . LEU B 1 141 ? 27.944  -13.471 93.386  1.00 13.83 ? 369  LEU B C   1 
ATOM   2895  O O   . LEU B 1 141 ? 26.993  -12.931 92.809  1.00 13.64 ? 369  LEU B O   1 
ATOM   2896  C CB  . LEU B 1 141 ? 29.940  -11.928 93.549  1.00 14.25 ? 369  LEU B CB  1 
ATOM   2897  C CG  . LEU B 1 141 ? 30.279  -10.502 94.042  1.00 15.29 ? 369  LEU B CG  1 
ATOM   2898  C CD1 . LEU B 1 141 ? 31.534  -9.915  93.348  1.00 14.44 ? 369  LEU B CD1 1 
ATOM   2899  C CD2 . LEU B 1 141 ? 29.084  -9.549  93.864  1.00 14.13 ? 369  LEU B CD2 1 
ATOM   2900  N N   . LYS B 1 142 ? 28.238  -14.759 93.222  1.00 13.43 ? 370  LYS B N   1 
ATOM   2901  C CA  . LYS B 1 142 ? 27.362  -15.617 92.411  1.00 13.55 ? 370  LYS B CA  1 
ATOM   2902  C C   . LYS B 1 142 ? 26.010  -15.763 93.102  1.00 13.41 ? 370  LYS B C   1 
ATOM   2903  O O   . LYS B 1 142 ? 24.958  -15.784 92.447  1.00 13.11 ? 370  LYS B O   1 
ATOM   2904  C CB  . LYS B 1 142 ? 27.948  -17.014 92.193  1.00 13.63 ? 370  LYS B CB  1 
ATOM   2905  C CG  . LYS B 1 142 ? 29.118  -17.097 91.219  1.00 13.75 ? 370  LYS B CG  1 
ATOM   2906  C CD  . LYS B 1 142 ? 29.417  -18.559 90.852  1.00 14.31 ? 370  LYS B CD  1 
ATOM   2907  C CE  . LYS B 1 142 ? 29.887  -19.435 92.056  1.00 15.13 ? 370  LYS B CE  1 
ATOM   2908  N NZ  . LYS B 1 142 ? 29.810  -20.934 91.826  1.00 13.94 ? 370  LYS B NZ  1 
ATOM   2909  N N   . ALA B 1 143 ? 26.042  -15.876 94.428  1.00 13.25 ? 371  ALA B N   1 
ATOM   2910  C CA  . ALA B 1 143 ? 24.811  -16.033 95.204  1.00 13.19 ? 371  ALA B CA  1 
ATOM   2911  C C   . ALA B 1 143 ? 23.952  -14.779 95.064  1.00 12.96 ? 371  ALA B C   1 
ATOM   2912  O O   . ALA B 1 143 ? 22.729  -14.856 94.946  1.00 12.81 ? 371  ALA B O   1 
ATOM   2913  C CB  . ALA B 1 143 ? 25.129  -16.317 96.685  1.00 13.17 ? 371  ALA B CB  1 
ATOM   2914  N N   . ILE B 1 144 ? 24.613  -13.623 95.061  1.00 12.87 ? 372  ILE B N   1 
ATOM   2915  C CA  . ILE B 1 144 ? 23.925  -12.328 95.005  1.00 12.45 ? 372  ILE B CA  1 
ATOM   2916  C C   . ILE B 1 144 ? 23.370  -12.118 93.601  1.00 12.25 ? 372  ILE B C   1 
ATOM   2917  O O   . ILE B 1 144 ? 22.247  -11.676 93.429  1.00 11.88 ? 372  ILE B O   1 
ATOM   2918  C CB  . ILE B 1 144 ? 24.874  -11.159 95.416  1.00 12.32 ? 372  ILE B CB  1 
ATOM   2919  C CG1 . ILE B 1 144 ? 25.223  -11.271 96.907  1.00 11.87 ? 372  ILE B CG1 1 
ATOM   2920  C CG2 . ILE B 1 144 ? 24.235  -9.827  95.119  1.00 12.12 ? 372  ILE B CG2 1 
ATOM   2921  C CD1 . ILE B 1 144 ? 26.122  -10.170 97.451  1.00 11.49 ? 372  ILE B CD1 1 
ATOM   2922  N N   . ALA B 1 145 ? 24.165  -12.474 92.603  1.00 12.27 ? 373  ALA B N   1 
ATOM   2923  C CA  . ALA B 1 145 ? 23.739  -12.344 91.223  1.00 12.50 ? 373  ALA B CA  1 
ATOM   2924  C C   . ALA B 1 145 ? 22.484  -13.162 90.993  1.00 12.70 ? 373  ALA B C   1 
ATOM   2925  O O   . ALA B 1 145 ? 21.656  -12.788 90.178  1.00 13.49 ? 373  ALA B O   1 
ATOM   2926  C CB  . ALA B 1 145 ? 24.840  -12.774 90.271  1.00 12.08 ? 373  ALA B CB  1 
ATOM   2927  N N   . LEU B 1 146 ? 22.344  -14.272 91.716  1.00 12.70 ? 374  LEU B N   1 
ATOM   2928  C CA  . LEU B 1 146 ? 21.157  -15.131 91.606  1.00 12.41 ? 374  LEU B CA  1 
ATOM   2929  C C   . LEU B 1 146 ? 19.954  -14.555 92.360  1.00 12.51 ? 374  LEU B C   1 
ATOM   2930  O O   . LEU B 1 146 ? 18.859  -14.449 91.800  1.00 12.31 ? 374  LEU B O   1 
ATOM   2931  C CB  . LEU B 1 146 ? 21.473  -16.542 92.111  1.00 12.15 ? 374  LEU B CB  1 
ATOM   2932  C CG  . LEU B 1 146 ? 20.285  -17.479 92.266  1.00 11.46 ? 374  LEU B CG  1 
ATOM   2933  C CD1 . LEU B 1 146 ? 19.566  -17.671 90.940  1.00 10.76 ? 374  LEU B CD1 1 
ATOM   2934  C CD2 . LEU B 1 146 ? 20.752  -18.796 92.826  1.00 11.79 ? 374  LEU B CD2 1 
ATOM   2935  N N   . ALA B 1 147 ? 20.166  -14.200 93.625  1.00 12.50 ? 375  ALA B N   1 
ATOM   2936  C CA  . ALA B 1 147 ? 19.126  -13.564 94.443  1.00 13.00 ? 375  ALA B CA  1 
ATOM   2937  C C   . ALA B 1 147 ? 18.606  -12.218 93.884  1.00 13.31 ? 375  ALA B C   1 
ATOM   2938  O O   . ALA B 1 147 ? 17.417  -11.910 93.999  1.00 13.12 ? 375  ALA B O   1 
ATOM   2939  C CB  . ALA B 1 147 ? 19.633  -13.372 95.870  1.00 13.00 ? 375  ALA B CB  1 
ATOM   2940  N N   . ASN B 1 148 ? 19.502  -11.436 93.275  1.00 13.80 ? 376  ASN B N   1 
ATOM   2941  C CA  . ASN B 1 148 ? 19.190  -10.090 92.769  1.00 13.99 ? 376  ASN B CA  1 
ATOM   2942  C C   . ASN B 1 148 ? 19.013  -10.044 91.251  1.00 14.26 ? 376  ASN B C   1 
ATOM   2943  O O   . ASN B 1 148 ? 19.259  -9.015  90.639  1.00 14.23 ? 376  ASN B O   1 
ATOM   2944  C CB  . ASN B 1 148 ? 20.298  -9.124  93.215  1.00 14.05 ? 376  ASN B CB  1 
ATOM   2945  C CG  . ASN B 1 148 ? 20.043  -7.680  92.809  1.00 14.01 ? 376  ASN B CG  1 
ATOM   2946  O OD1 . ASN B 1 148 ? 19.106  -7.035  93.285  1.00 15.10 ? 376  ASN B OD1 1 
ATOM   2947  N ND2 . ASN B 1 148 ? 20.910  -7.155  91.954  1.00 13.41 ? 376  ASN B ND2 1 
ATOM   2948  N N   . SER B 1 149 ? 18.538  -11.141 90.657  1.00 14.82 ? 377  SER B N   1 
ATOM   2949  C CA  . SER B 1 149 ? 18.470  -11.270 89.193  1.00 15.34 ? 377  SER B CA  1 
ATOM   2950  C C   . SER B 1 149 ? 17.172  -10.734 88.584  1.00 15.57 ? 377  SER B C   1 
ATOM   2951  O O   . SER B 1 149 ? 16.923  -10.943 87.399  1.00 15.77 ? 377  SER B O   1 
ATOM   2952  C CB  . SER B 1 149 ? 18.743  -12.726 88.738  1.00 15.53 ? 377  SER B CB  1 
ATOM   2953  O OG  . SER B 1 149 ? 17.633  -13.593 88.889  1.00 15.95 ? 377  SER B OG  1 
ATOM   2954  N N   . ASP B 1 150 ? 16.357  -10.060 89.394  1.00 15.85 ? 378  ASP B N   1 
ATOM   2955  C CA  . ASP B 1 150 ? 15.293  -9.161  88.906  1.00 16.38 ? 378  ASP B CA  1 
ATOM   2956  C C   . ASP B 1 150 ? 14.288  -9.791  87.930  1.00 17.03 ? 378  ASP B C   1 
ATOM   2957  O O   . ASP B 1 150 ? 14.015  -9.225  86.872  1.00 17.30 ? 378  ASP B O   1 
ATOM   2958  C CB  . ASP B 1 150 ? 15.905  -7.892  88.273  1.00 16.24 ? 378  ASP B CB  1 
ATOM   2959  C CG  . ASP B 1 150 ? 16.519  -6.951  89.300  1.00 16.21 ? 378  ASP B CG  1 
ATOM   2960  O OD1 . ASP B 1 150 ? 15.757  -6.406  90.123  1.00 16.16 ? 378  ASP B OD1 1 
ATOM   2961  O OD2 . ASP B 1 150 ? 17.759  -6.745  89.282  1.00 15.68 ? 378  ASP B OD2 1 
ATOM   2962  N N   . SER B 1 151 ? 13.727  -10.943 88.294  1.00 17.75 ? 379  SER B N   1 
ATOM   2963  C CA  . SER B 1 151 ? 12.729  -11.628 87.464  1.00 18.24 ? 379  SER B CA  1 
ATOM   2964  C C   . SER B 1 151 ? 11.336  -11.024 87.668  1.00 18.72 ? 379  SER B C   1 
ATOM   2965  O O   . SER B 1 151 ? 11.002  -10.602 88.769  1.00 18.99 ? 379  SER B O   1 
ATOM   2966  C CB  . SER B 1 151 ? 12.706  -13.119 87.801  1.00 18.26 ? 379  SER B CB  1 
ATOM   2967  O OG  . SER B 1 151 ? 11.718  -13.801 87.044  1.00 18.97 ? 379  SER B OG  1 
ATOM   2968  N N   . MET B 1 152 ? 10.521  -10.996 86.616  1.00 19.24 ? 380  MET B N   1 
ATOM   2969  C CA  . MET B 1 152 ? 9.168   -10.405 86.697  1.00 19.74 ? 380  MET B CA  1 
ATOM   2970  C C   . MET B 1 152 ? 8.127   -11.350 87.300  1.00 19.39 ? 380  MET B C   1 
ATOM   2971  O O   . MET B 1 152 ? 7.033   -10.914 87.640  1.00 19.21 ? 380  MET B O   1 
ATOM   2972  C CB  . MET B 1 152 ? 8.646   -10.014 85.308  1.00 19.86 ? 380  MET B CB  1 
ATOM   2973  C CG  . MET B 1 152 ? 9.569   -9.151  84.452  1.00 20.31 ? 380  MET B CG  1 
ATOM   2974  S SD  . MET B 1 152 ? 9.415   -9.576  82.701  1.00 21.52 ? 380  MET B SD  1 
ATOM   2975  C CE  . MET B 1 152 ? 10.161  -11.229 82.650  1.00 21.10 ? 380  MET B CE  1 
ATOM   2976  N N   . HIS B 1 153 ? 8.457   -12.638 87.411  1.00 19.27 ? 381  HIS B N   1 
ATOM   2977  C CA  . HIS B 1 153 ? 7.459   -13.671 87.720  1.00 18.97 ? 381  HIS B CA  1 
ATOM   2978  C C   . HIS B 1 153 ? 7.469   -14.103 89.195  1.00 18.79 ? 381  HIS B C   1 
ATOM   2979  O O   . HIS B 1 153 ? 6.921   -15.153 89.537  1.00 19.07 ? 381  HIS B O   1 
ATOM   2980  C CB  . HIS B 1 153 ? 7.673   -14.897 86.813  1.00 18.85 ? 381  HIS B CB  1 
ATOM   2981  C CG  . HIS B 1 153 ? 7.856   -14.561 85.362  1.00 18.61 ? 381  HIS B CG  1 
ATOM   2982  N ND1 . HIS B 1 153 ? 6.881   -13.940 84.609  1.00 17.66 ? 381  HIS B ND1 1 
ATOM   2983  C CD2 . HIS B 1 153 ? 8.903   -14.766 84.525  1.00 18.00 ? 381  HIS B CD2 1 
ATOM   2984  C CE1 . HIS B 1 153 ? 7.320   -13.771 83.374  1.00 17.62 ? 381  HIS B CE1 1 
ATOM   2985  N NE2 . HIS B 1 153 ? 8.545   -14.263 83.297  1.00 17.85 ? 381  HIS B NE2 1 
ATOM   2986  N N   . ILE B 1 154 ? 8.059   -13.290 90.070  1.00 18.40 ? 382  ILE B N   1 
ATOM   2987  C CA  . ILE B 1 154 ? 8.243   -13.686 91.468  1.00 17.94 ? 382  ILE B CA  1 
ATOM   2988  C C   . ILE B 1 154 ? 6.912   -13.766 92.206  1.00 17.61 ? 382  ILE B C   1 
ATOM   2989  O O   . ILE B 1 154 ? 6.087   -12.869 92.100  1.00 17.57 ? 382  ILE B O   1 
ATOM   2990  C CB  . ILE B 1 154 ? 9.183   -12.726 92.240  1.00 17.87 ? 382  ILE B CB  1 
ATOM   2991  C CG1 . ILE B 1 154 ? 10.550  -12.622 91.557  1.00 17.11 ? 382  ILE B CG1 1 
ATOM   2992  C CG2 . ILE B 1 154 ? 9.367   -13.205 93.677  1.00 18.07 ? 382  ILE B CG2 1 
ATOM   2993  C CD1 . ILE B 1 154 ? 11.226  -13.935 91.348  1.00 16.18 ? 382  ILE B CD1 1 
ATOM   2994  N N   . GLU B 1 155 ? 6.717   -14.858 92.939  1.00 17.38 ? 383  GLU B N   1 
ATOM   2995  C CA  . GLU B 1 155 ? 5.551   -15.032 93.801  1.00 17.31 ? 383  GLU B CA  1 
ATOM   2996  C C   . GLU B 1 155 ? 5.696   -14.279 95.115  1.00 17.13 ? 383  GLU B C   1 
ATOM   2997  O O   . GLU B 1 155 ? 4.795   -13.561 95.516  1.00 17.04 ? 383  GLU B O   1 
ATOM   2998  C CB  . GLU B 1 155 ? 5.350   -16.504 94.146  1.00 17.40 ? 383  GLU B CB  1 
ATOM   2999  C CG  . GLU B 1 155 ? 5.125   -17.423 92.964  1.00 17.58 ? 383  GLU B CG  1 
ATOM   3000  C CD  . GLU B 1 155 ? 4.627   -18.789 93.386  1.00 17.37 ? 383  GLU B CD  1 
ATOM   3001  O OE1 . GLU B 1 155 ? 4.512   -19.038 94.605  1.00 17.37 ? 383  GLU B OE1 1 
ATOM   3002  O OE2 . GLU B 1 155 ? 4.344   -19.613 92.498  1.00 17.92 ? 383  GLU B OE2 1 
ATOM   3003  N N   . ASP B 1 156 ? 6.830   -14.482 95.785  1.00 17.07 ? 384  ASP B N   1 
ATOM   3004  C CA  . ASP B 1 156 ? 7.091   -13.930 97.115  1.00 16.83 ? 384  ASP B CA  1 
ATOM   3005  C C   . ASP B 1 156 ? 8.262   -12.957 97.037  1.00 16.64 ? 384  ASP B C   1 
ATOM   3006  O O   . ASP B 1 156 ? 9.427   -13.348 97.107  1.00 16.31 ? 384  ASP B O   1 
ATOM   3007  C CB  . ASP B 1 156 ? 7.387   -15.062 98.111  1.00 16.91 ? 384  ASP B CB  1 
ATOM   3008  C CG  . ASP B 1 156 ? 7.152   -14.655 99.557  1.00 16.75 ? 384  ASP B CG  1 
ATOM   3009  O OD1 . ASP B 1 156 ? 7.611   -13.564 99.965  1.00 15.38 ? 384  ASP B OD1 1 
ATOM   3010  O OD2 . ASP B 1 156 ? 6.507   -15.446 100.288 1.00 16.90 ? 384  ASP B OD2 1 
ATOM   3011  N N   . VAL B 1 157 ? 7.926   -11.682 96.887  1.00 16.67 ? 385  VAL B N   1 
ATOM   3012  C CA  . VAL B 1 157 ? 8.909   -10.612 96.775  1.00 16.69 ? 385  VAL B CA  1 
ATOM   3013  C C   . VAL B 1 157 ? 9.664   -10.403 98.079  1.00 16.82 ? 385  VAL B C   1 
ATOM   3014  O O   . VAL B 1 157 ? 10.896  -10.330 98.068  1.00 16.66 ? 385  VAL B O   1 
ATOM   3015  C CB  . VAL B 1 157 ? 8.246   -9.282  96.356  1.00 16.62 ? 385  VAL B CB  1 
ATOM   3016  C CG1 . VAL B 1 157 ? 9.241   -8.152  96.404  1.00 16.65 ? 385  VAL B CG1 1 
ATOM   3017  C CG2 . VAL B 1 157 ? 7.654   -9.398  94.963  1.00 16.40 ? 385  VAL B CG2 1 
ATOM   3018  N N   . GLU B 1 158 ? 8.928   -10.293 99.188  1.00 16.97 ? 386  GLU B N   1 
ATOM   3019  C CA  . GLU B 1 158 ? 9.547   -10.213 100.517 1.00 17.39 ? 386  GLU B CA  1 
ATOM   3020  C C   . GLU B 1 158 ? 10.591  -11.306 100.720 1.00 17.30 ? 386  GLU B C   1 
ATOM   3021  O O   . GLU B 1 158 ? 11.695  -11.030 101.179 1.00 17.36 ? 386  GLU B O   1 
ATOM   3022  C CB  . GLU B 1 158 ? 8.515   -10.333 101.641 1.00 17.59 ? 386  GLU B CB  1 
ATOM   3023  C CG  . GLU B 1 158 ? 7.918   -9.019  102.103 1.00 18.77 ? 386  GLU B CG  1 
ATOM   3024  C CD  . GLU B 1 158 ? 6.545   -8.746  101.511 1.00 20.17 ? 386  GLU B CD  1 
ATOM   3025  O OE1 . GLU B 1 158 ? 6.323   -9.076  100.322 1.00 20.89 ? 386  GLU B OE1 1 
ATOM   3026  O OE2 . GLU B 1 158 ? 5.689   -8.197  102.242 1.00 20.93 ? 386  GLU B OE2 1 
ATOM   3027  N N   . ALA B 1 159 ? 10.236  -12.543 100.392 1.00 17.26 ? 387  ALA B N   1 
ATOM   3028  C CA  . ALA B 1 159 ? 11.136  -13.670 100.602 1.00 17.32 ? 387  ALA B CA  1 
ATOM   3029  C C   . ALA B 1 159 ? 12.421  -13.530 99.767  1.00 17.43 ? 387  ALA B C   1 
ATOM   3030  O O   . ALA B 1 159 ? 13.511  -13.838 100.251 1.00 17.36 ? 387  ALA B O   1 
ATOM   3031  C CB  . ALA B 1 159 ? 10.423  -14.988 100.303 1.00 17.15 ? 387  ALA B CB  1 
ATOM   3032  N N   . VAL B 1 160 ? 12.298  -13.040 98.534  1.00 17.50 ? 388  VAL B N   1 
ATOM   3033  C CA  . VAL B 1 160 ? 13.468  -12.858 97.663  1.00 17.58 ? 388  VAL B CA  1 
ATOM   3034  C C   . VAL B 1 160 ? 14.348  -11.683 98.125  1.00 17.87 ? 388  VAL B C   1 
ATOM   3035  O O   . VAL B 1 160 ? 15.570  -11.733 97.998  1.00 17.85 ? 388  VAL B O   1 
ATOM   3036  C CB  . VAL B 1 160 ? 13.077  -12.651 96.169  1.00 17.49 ? 388  VAL B CB  1 
ATOM   3037  C CG1 . VAL B 1 160 ? 14.305  -12.678 95.293  1.00 16.82 ? 388  VAL B CG1 1 
ATOM   3038  C CG2 . VAL B 1 160 ? 12.099  -13.706 95.706  1.00 17.27 ? 388  VAL B CG2 1 
ATOM   3039  N N   . GLN B 1 161 ? 13.725  -10.626 98.646  1.00 18.22 ? 389  GLN B N   1 
ATOM   3040  C CA  . GLN B 1 161 ? 14.458  -9.486  99.212  1.00 18.42 ? 389  GLN B CA  1 
ATOM   3041  C C   . GLN B 1 161 ? 15.231  -9.931  100.460 1.00 17.93 ? 389  GLN B C   1 
ATOM   3042  O O   . GLN B 1 161 ? 16.393  -9.553  100.672 1.00 17.60 ? 389  GLN B O   1 
ATOM   3043  C CB  . GLN B 1 161 ? 13.481  -8.345  99.554  1.00 18.89 ? 389  GLN B CB  1 
ATOM   3044  C CG  . GLN B 1 161 ? 14.106  -7.093  100.191 1.00 20.20 ? 389  GLN B CG  1 
ATOM   3045  C CD  . GLN B 1 161 ? 15.058  -6.386  99.262  1.00 23.36 ? 389  GLN B CD  1 
ATOM   3046  O OE1 . GLN B 1 161 ? 14.874  -6.407  98.044  1.00 26.52 ? 389  GLN B OE1 1 
ATOM   3047  N NE2 . GLN B 1 161 ? 16.087  -5.758  99.823  1.00 25.22 ? 389  GLN B NE2 1 
ATOM   3048  N N   . LYS B 1 162 ? 14.580  -10.748 101.278 1.00 17.52 ? 390  LYS B N   1 
ATOM   3049  C CA  . LYS B 1 162 ? 15.200  -11.262 102.494 1.00 17.58 ? 390  LYS B CA  1 
ATOM   3050  C C   . LYS B 1 162 ? 16.471  -12.092 102.169 1.00 17.31 ? 390  LYS B C   1 
ATOM   3051  O O   . LYS B 1 162 ? 17.438  -12.089 102.943 1.00 17.22 ? 390  LYS B O   1 
ATOM   3052  C CB  . LYS B 1 162 ? 14.178  -12.072 103.300 1.00 17.50 ? 390  LYS B CB  1 
ATOM   3053  C CG  . LYS B 1 162 ? 14.522  -12.269 104.772 1.00 18.71 ? 390  LYS B CG  1 
ATOM   3054  C CD  . LYS B 1 162 ? 13.729  -11.353 105.732 1.00 20.95 ? 390  LYS B CD  1 
ATOM   3055  C CE  . LYS B 1 162 ? 14.375  -9.960  105.901 1.00 22.74 ? 390  LYS B CE  1 
ATOM   3056  N NZ  . LYS B 1 162 ? 15.836  -9.992  106.282 1.00 23.49 ? 390  LYS B NZ  1 
ATOM   3057  N N   . LEU B 1 163 ? 16.469  -12.770 101.017 1.00 16.87 ? 391  LEU B N   1 
ATOM   3058  C CA  . LEU B 1 163 ? 17.629  -13.537 100.564 1.00 16.53 ? 391  LEU B CA  1 
ATOM   3059  C C   . LEU B 1 163 ? 18.709  -12.627 100.022 1.00 16.35 ? 391  LEU B C   1 
ATOM   3060  O O   . LEU B 1 163 ? 19.883  -12.890 100.230 1.00 16.44 ? 391  LEU B O   1 
ATOM   3061  C CB  . LEU B 1 163 ? 17.233  -14.566 99.501  1.00 16.73 ? 391  LEU B CB  1 
ATOM   3062  C CG  . LEU B 1 163 ? 18.361  -15.312 98.769  1.00 17.08 ? 391  LEU B CG  1 
ATOM   3063  C CD1 . LEU B 1 163 ? 19.222  -16.133 99.733  1.00 16.79 ? 391  LEU B CD1 1 
ATOM   3064  C CD2 . LEU B 1 163 ? 17.766  -16.187 97.684  1.00 16.44 ? 391  LEU B CD2 1 
ATOM   3065  N N   . GLN B 1 164 ? 18.324  -11.575 99.305  1.00 16.27 ? 392  GLN B N   1 
ATOM   3066  C CA  . GLN B 1 164 ? 19.281  -10.547 98.896  1.00 16.17 ? 392  GLN B CA  1 
ATOM   3067  C C   . GLN B 1 164 ? 19.956  -9.964  100.126 1.00 16.42 ? 392  GLN B C   1 
ATOM   3068  O O   . GLN B 1 164 ? 21.180  -9.871  100.188 1.00 16.34 ? 392  GLN B O   1 
ATOM   3069  C CB  . GLN B 1 164 ? 18.589  -9.418  98.144  1.00 16.20 ? 392  GLN B CB  1 
ATOM   3070  C CG  . GLN B 1 164 ? 18.275  -9.702  96.696  1.00 16.38 ? 392  GLN B CG  1 
ATOM   3071  C CD  . GLN B 1 164 ? 17.380  -8.634  96.083  1.00 16.18 ? 392  GLN B CD  1 
ATOM   3072  O OE1 . GLN B 1 164 ? 17.263  -7.523  96.616  1.00 17.07 ? 392  GLN B OE1 1 
ATOM   3073  N NE2 . GLN B 1 164 ? 16.736  -8.967  94.967  1.00 14.40 ? 392  GLN B NE2 1 
ATOM   3074  N N   . ASP B 1 165 ? 19.138  -9.592  101.111 1.00 16.81 ? 393  ASP B N   1 
ATOM   3075  C CA  . ASP B 1 165 ? 19.620  -8.929  102.336 1.00 17.17 ? 393  ASP B CA  1 
ATOM   3076  C C   . ASP B 1 165 ? 20.634  -9.781  103.117 1.00 16.47 ? 393  ASP B C   1 
ATOM   3077  O O   . ASP B 1 165 ? 21.665  -9.270  103.552 1.00 16.43 ? 393  ASP B O   1 
ATOM   3078  C CB  . ASP B 1 165 ? 18.438  -8.554  103.253 1.00 17.50 ? 393  ASP B CB  1 
ATOM   3079  C CG  . ASP B 1 165 ? 17.499  -7.498  102.635 1.00 19.95 ? 393  ASP B CG  1 
ATOM   3080  O OD1 . ASP B 1 165 ? 17.855  -6.865  101.613 1.00 24.34 ? 393  ASP B OD1 1 
ATOM   3081  O OD2 . ASP B 1 165 ? 16.386  -7.287  103.177 1.00 23.33 ? 393  ASP B OD2 1 
ATOM   3082  N N   . VAL B 1 166 ? 20.333  -11.069 103.291 1.00 15.62 ? 394  VAL B N   1 
ATOM   3083  C CA  . VAL B 1 166 ? 21.211  -11.970 104.040 1.00 15.44 ? 394  VAL B CA  1 
ATOM   3084  C C   . VAL B 1 166 ? 22.536  -12.183 103.320 1.00 15.18 ? 394  VAL B C   1 
ATOM   3085  O O   . VAL B 1 166 ? 23.598  -12.216 103.948 1.00 15.31 ? 394  VAL B O   1 
ATOM   3086  C CB  . VAL B 1 166 ? 20.581  -13.371 104.259 1.00 15.60 ? 394  VAL B CB  1 
ATOM   3087  C CG1 . VAL B 1 166 ? 21.542  -14.266 105.026 1.00 14.77 ? 394  VAL B CG1 1 
ATOM   3088  C CG2 . VAL B 1 166 ? 19.240  -13.255 104.991 1.00 16.05 ? 394  VAL B CG2 1 
ATOM   3089  N N   . LEU B 1 167 ? 22.460  -12.353 102.002 1.00 14.67 ? 395  LEU B N   1 
ATOM   3090  C CA  . LEU B 1 167 ? 23.647  -12.530 101.183 1.00 14.10 ? 395  LEU B CA  1 
ATOM   3091  C C   . LEU B 1 167 ? 24.463  -11.238 101.176 1.00 13.71 ? 395  LEU B C   1 
ATOM   3092  O O   . LEU B 1 167 ? 25.687  -11.268 101.269 1.00 13.82 ? 395  LEU B O   1 
ATOM   3093  C CB  . LEU B 1 167 ? 23.255  -12.954 99.769  1.00 14.02 ? 395  LEU B CB  1 
ATOM   3094  C CG  . LEU B 1 167 ? 22.576  -14.326 99.664  1.00 13.80 ? 395  LEU B CG  1 
ATOM   3095  C CD1 . LEU B 1 167 ? 22.232  -14.612 98.219  1.00 14.13 ? 395  LEU B CD1 1 
ATOM   3096  C CD2 . LEU B 1 167 ? 23.425  -15.452 100.242 1.00 12.41 ? 395  LEU B CD2 1 
ATOM   3097  N N   . HIS B 1 168 ? 23.778  -10.104 101.092 1.00 13.17 ? 396  HIS B N   1 
ATOM   3098  C CA  . HIS B 1 168 ? 24.446  -8.814  101.170 1.00 12.75 ? 396  HIS B CA  1 
ATOM   3099  C C   . HIS B 1 168 ? 25.186  -8.676  102.495 1.00 12.93 ? 396  HIS B C   1 
ATOM   3100  O O   . HIS B 1 168 ? 26.365  -8.328  102.516 1.00 12.83 ? 396  HIS B O   1 
ATOM   3101  C CB  . HIS B 1 168 ? 23.438  -7.679  100.989 1.00 12.49 ? 396  HIS B CB  1 
ATOM   3102  C CG  . HIS B 1 168 ? 24.054  -6.315  100.961 1.00 10.98 ? 396  HIS B CG  1 
ATOM   3103  N ND1 . HIS B 1 168 ? 23.329  -5.172  101.200 1.00 10.44 ? 396  HIS B ND1 1 
ATOM   3104  C CD2 . HIS B 1 168 ? 25.325  -5.913  100.744 1.00 9.91  ? 396  HIS B CD2 1 
ATOM   3105  C CE1 . HIS B 1 168 ? 24.123  -4.122  101.117 1.00 9.72  ? 396  HIS B CE1 1 
ATOM   3106  N NE2 . HIS B 1 168 ? 25.341  -4.544  100.845 1.00 9.71  ? 396  HIS B NE2 1 
ATOM   3107  N N   . GLU B 1 169 ? 24.493  -8.967  103.596 1.00 13.04 ? 397  GLU B N   1 
ATOM   3108  C CA  . GLU B 1 169 ? 25.106  -8.938  104.918 1.00 13.11 ? 397  GLU B CA  1 
ATOM   3109  C C   . GLU B 1 169 ? 26.395  -9.751  104.970 1.00 12.67 ? 397  GLU B C   1 
ATOM   3110  O O   . GLU B 1 169 ? 27.400  -9.296  105.500 1.00 12.48 ? 397  GLU B O   1 
ATOM   3111  C CB  . GLU B 1 169 ? 24.140  -9.450  105.979 1.00 12.96 ? 397  GLU B CB  1 
ATOM   3112  C CG  . GLU B 1 169 ? 24.718  -9.327  107.381 1.00 13.95 ? 397  GLU B CG  1 
ATOM   3113  C CD  . GLU B 1 169 ? 23.730  -9.646  108.486 1.00 14.84 ? 397  GLU B CD  1 
ATOM   3114  O OE1 . GLU B 1 169 ? 22.630  -10.191 108.210 1.00 17.97 ? 397  GLU B OE1 1 
ATOM   3115  O OE2 . GLU B 1 169 ? 24.080  -9.358  109.649 1.00 16.54 ? 397  GLU B OE2 1 
ATOM   3116  N N   . ALA B 1 170 ? 26.362  -10.954 104.414 1.00 12.67 ? 398  ALA B N   1 
ATOM   3117  C CA  . ALA B 1 170 ? 27.524  -11.836 104.445 1.00 12.72 ? 398  ALA B CA  1 
ATOM   3118  C C   . ALA B 1 170 ? 28.708  -11.185 103.726 1.00 12.99 ? 398  ALA B C   1 
ATOM   3119  O O   . ALA B 1 170 ? 29.865  -11.334 104.145 1.00 12.87 ? 398  ALA B O   1 
ATOM   3120  C CB  . ALA B 1 170 ? 27.188  -13.183 103.815 1.00 12.51 ? 398  ALA B CB  1 
ATOM   3121  N N   . LEU B 1 171 ? 28.412  -10.456 102.647 1.00 13.00 ? 399  LEU B N   1 
ATOM   3122  C CA  . LEU B 1 171 ? 29.451  -9.787  101.883 1.00 12.82 ? 399  LEU B CA  1 
ATOM   3123  C C   . LEU B 1 171 ? 30.017  -8.650  102.711 1.00 12.87 ? 399  LEU B C   1 
ATOM   3124  O O   . LEU B 1 171 ? 31.229  -8.579  102.923 1.00 12.80 ? 399  LEU B O   1 
ATOM   3125  C CB  . LEU B 1 171 ? 28.924  -9.279  100.541 1.00 12.63 ? 399  LEU B CB  1 
ATOM   3126  C CG  . LEU B 1 171 ? 29.960  -8.565  99.668  1.00 12.13 ? 399  LEU B CG  1 
ATOM   3127  C CD1 . LEU B 1 171 ? 31.163  -9.446  99.412  1.00 10.06 ? 399  LEU B CD1 1 
ATOM   3128  C CD2 . LEU B 1 171 ? 29.333  -8.110  98.355  1.00 12.52 ? 399  LEU B CD2 1 
ATOM   3129  N N   A GLN B 1 172 ? 29.148  -7.760  103.183 0.50 12.89 ? 400  GLN B N   1 
ATOM   3130  N N   B GLN B 1 172 ? 29.126  -7.776  103.171 0.50 12.86 ? 400  GLN B N   1 
ATOM   3131  C CA  A GLN B 1 172 ? 29.603  -6.639  104.001 0.50 12.95 ? 400  GLN B CA  1 
ATOM   3132  C CA  B GLN B 1 172 ? 29.488  -6.648  104.023 0.50 12.85 ? 400  GLN B CA  1 
ATOM   3133  C C   A GLN B 1 172 ? 30.454  -7.126  105.167 0.50 13.28 ? 400  GLN B C   1 
ATOM   3134  C C   B GLN B 1 172 ? 30.410  -7.116  105.151 0.50 13.25 ? 400  GLN B C   1 
ATOM   3135  O O   A GLN B 1 172 ? 31.567  -6.642  105.383 0.50 13.25 ? 400  GLN B O   1 
ATOM   3136  O O   B GLN B 1 172 ? 31.524  -6.613  105.318 0.50 13.24 ? 400  GLN B O   1 
ATOM   3137  C CB  A GLN B 1 172 ? 28.434  -5.797  104.523 0.50 12.80 ? 400  GLN B CB  1 
ATOM   3138  C CB  B GLN B 1 172 ? 28.223  -6.011  104.610 0.50 12.82 ? 400  GLN B CB  1 
ATOM   3139  C CG  A GLN B 1 172 ? 28.226  -4.479  103.769 0.50 12.41 ? 400  GLN B CG  1 
ATOM   3140  C CG  B GLN B 1 172 ? 28.243  -4.492  104.647 0.50 12.78 ? 400  GLN B CG  1 
ATOM   3141  C CD  A GLN B 1 172 ? 29.401  -3.501  103.900 0.50 10.95 ? 400  GLN B CD  1 
ATOM   3142  C CD  B GLN B 1 172 ? 27.000  -3.907  105.285 0.50 11.93 ? 400  GLN B CD  1 
ATOM   3143  O OE1 A GLN B 1 172 ? 30.452  -3.822  104.469 0.50 8.96  ? 400  GLN B OE1 1 
ATOM   3144  O OE1 B GLN B 1 172 ? 26.365  -4.543  106.119 0.50 9.97  ? 400  GLN B OE1 1 
ATOM   3145  N NE2 A GLN B 1 172 ? 29.214  -2.298  103.371 0.50 9.12  ? 400  GLN B NE2 1 
ATOM   3146  N NE2 B GLN B 1 172 ? 26.649  -2.692  104.895 0.50 10.39 ? 400  GLN B NE2 1 
ATOM   3147  N N   . ASP B 1 173 ? 29.932  -8.102  105.901 1.00 13.57 ? 401  ASP B N   1 
ATOM   3148  C CA  . ASP B 1 173 ? 30.654  -8.679  107.027 1.00 13.99 ? 401  ASP B CA  1 
ATOM   3149  C C   . ASP B 1 173 ? 32.064  -9.180  106.664 1.00 14.13 ? 401  ASP B C   1 
ATOM   3150  O O   . ASP B 1 173 ? 33.025  -8.940  107.402 1.00 14.09 ? 401  ASP B O   1 
ATOM   3151  C CB  . ASP B 1 173 ? 29.824  -9.827  107.582 1.00 14.05 ? 401  ASP B CB  1 
ATOM   3152  C CG  . ASP B 1 173 ? 30.361  -10.352 108.871 1.00 15.17 ? 401  ASP B CG  1 
ATOM   3153  O OD1 . ASP B 1 173 ? 31.355  -11.112 108.835 1.00 16.40 ? 401  ASP B OD1 1 
ATOM   3154  O OD2 . ASP B 1 173 ? 29.777  -10.011 109.920 1.00 17.12 ? 401  ASP B OD2 1 
ATOM   3155  N N   . TYR B 1 174 ? 32.170  -9.875  105.529 1.00 14.32 ? 402  TYR B N   1 
ATOM   3156  C CA  . TYR B 1 174 ? 33.454  -10.370 105.025 1.00 14.25 ? 402  TYR B CA  1 
ATOM   3157  C C   . TYR B 1 174 ? 34.422  -9.243  104.665 1.00 13.88 ? 402  TYR B C   1 
ATOM   3158  O O   . TYR B 1 174 ? 35.616  -9.340  104.912 1.00 13.55 ? 402  TYR B O   1 
ATOM   3159  C CB  . TYR B 1 174 ? 33.248  -11.249 103.785 1.00 14.83 ? 402  TYR B CB  1 
ATOM   3160  C CG  . TYR B 1 174 ? 34.561  -11.685 103.152 1.00 15.15 ? 402  TYR B CG  1 
ATOM   3161  C CD1 . TYR B 1 174 ? 35.280  -12.748 103.681 1.00 15.61 ? 402  TYR B CD1 1 
ATOM   3162  C CD2 . TYR B 1 174 ? 35.095  -11.007 102.056 1.00 15.15 ? 402  TYR B CD2 1 
ATOM   3163  C CE1 . TYR B 1 174 ? 36.492  -13.142 103.132 1.00 16.72 ? 402  TYR B CE1 1 
ATOM   3164  C CE2 . TYR B 1 174 ? 36.307  -11.392 101.489 1.00 16.23 ? 402  TYR B CE2 1 
ATOM   3165  C CZ  . TYR B 1 174 ? 37.011  -12.463 102.033 1.00 16.71 ? 402  TYR B CZ  1 
ATOM   3166  O OH  . TYR B 1 174 ? 38.221  -12.880 101.493 1.00 15.68 ? 402  TYR B OH  1 
ATOM   3167  N N   . GLU B 1 175 ? 33.902  -8.190  104.049 1.00 13.80 ? 403  GLU B N   1 
ATOM   3168  C CA  . GLU B 1 175 ? 34.721  -7.038  103.690 1.00 13.70 ? 403  GLU B CA  1 
ATOM   3169  C C   . GLU B 1 175 ? 35.165  -6.254  104.920 1.00 13.70 ? 403  GLU B C   1 
ATOM   3170  O O   . GLU B 1 175 ? 36.263  -5.712  104.940 1.00 13.60 ? 403  GLU B O   1 
ATOM   3171  C CB  . GLU B 1 175 ? 33.960  -6.109  102.739 1.00 13.85 ? 403  GLU B CB  1 
ATOM   3172  C CG  . GLU B 1 175 ? 33.548  -6.716  101.393 1.00 13.27 ? 403  GLU B CG  1 
ATOM   3173  C CD  . GLU B 1 175 ? 34.689  -7.370  100.656 1.00 12.89 ? 403  GLU B CD  1 
ATOM   3174  O OE1 . GLU B 1 175 ? 35.860  -7.009  100.892 1.00 12.19 ? 403  GLU B OE1 1 
ATOM   3175  O OE2 . GLU B 1 175 ? 34.407  -8.258  99.831  1.00 13.93 ? 403  GLU B OE2 1 
ATOM   3176  N N   . ALA B 1 176 ? 34.298  -6.190  105.932 1.00 13.87 ? 404  ALA B N   1 
ATOM   3177  C CA  . ALA B 1 176 ? 34.611  -5.536  107.210 1.00 13.78 ? 404  ALA B CA  1 
ATOM   3178  C C   . ALA B 1 176 ? 35.769  -6.242  107.907 1.00 14.01 ? 404  ALA B C   1 
ATOM   3179  O O   . ALA B 1 176 ? 36.643  -5.600  108.486 1.00 14.05 ? 404  ALA B O   1 
ATOM   3180  C CB  . ALA B 1 176 ? 33.387  -5.530  108.116 1.00 13.25 ? 404  ALA B CB  1 
ATOM   3181  N N   . GLY B 1 177 ? 35.760  -7.571  107.850 1.00 14.44 ? 405  GLY B N   1 
ATOM   3182  C CA  . GLY B 1 177 ? 36.770  -8.385  108.520 1.00 14.65 ? 405  GLY B CA  1 
ATOM   3183  C C   . GLY B 1 177 ? 38.071  -8.476  107.749 1.00 14.79 ? 405  GLY B C   1 
ATOM   3184  O O   . GLY B 1 177 ? 39.143  -8.355  108.329 1.00 14.58 ? 405  GLY B O   1 
ATOM   3185  N N   . GLN B 1 178 ? 37.959  -8.666  106.435 1.00 15.23 ? 406  GLN B N   1 
ATOM   3186  C CA  . GLN B 1 178 ? 39.095  -9.000  105.570 1.00 15.66 ? 406  GLN B CA  1 
ATOM   3187  C C   . GLN B 1 178 ? 39.673  -7.822  104.792 1.00 15.72 ? 406  GLN B C   1 
ATOM   3188  O O   . GLN B 1 178 ? 40.798  -7.905  104.313 1.00 15.87 ? 406  GLN B O   1 
ATOM   3189  C CB  . GLN B 1 178 ? 38.679  -10.075 104.559 1.00 16.05 ? 406  GLN B CB  1 
ATOM   3190  C CG  . GLN B 1 178 ? 39.784  -11.062 104.222 1.00 16.88 ? 406  GLN B CG  1 
ATOM   3191  C CD  . GLN B 1 178 ? 40.087  -11.981 105.389 1.00 18.02 ? 406  GLN B CD  1 
ATOM   3192  O OE1 . GLN B 1 178 ? 39.181  -12.454 106.085 1.00 18.49 ? 406  GLN B OE1 1 
ATOM   3193  N NE2 . GLN B 1 178 ? 41.364  -12.228 105.621 1.00 19.82 ? 406  GLN B NE2 1 
ATOM   3194  N N   . HIS B 1 179 ? 38.906  -6.746  104.639 1.00 15.89 ? 407  HIS B N   1 
ATOM   3195  C CA  . HIS B 1 179 ? 39.370  -5.575  103.897 1.00 16.00 ? 407  HIS B CA  1 
ATOM   3196  C C   . HIS B 1 179 ? 39.013  -4.255  104.570 1.00 16.12 ? 407  HIS B C   1 
ATOM   3197  O O   . HIS B 1 179 ? 38.137  -3.513  104.113 1.00 16.09 ? 407  HIS B O   1 
ATOM   3198  C CB  . HIS B 1 179 ? 38.814  -5.627  102.490 1.00 15.99 ? 407  HIS B CB  1 
ATOM   3199  C CG  . HIS B 1 179 ? 39.435  -6.696  101.663 1.00 16.12 ? 407  HIS B CG  1 
ATOM   3200  N ND1 . HIS B 1 179 ? 40.509  -6.458  100.837 1.00 16.04 ? 407  HIS B ND1 1 
ATOM   3201  C CD2 . HIS B 1 179 ? 39.158  -8.016  101.557 1.00 16.23 ? 407  HIS B CD2 1 
ATOM   3202  C CE1 . HIS B 1 179 ? 40.854  -7.584  100.239 1.00 16.12 ? 407  HIS B CE1 1 
ATOM   3203  N NE2 . HIS B 1 179 ? 40.053  -8.545  100.662 1.00 16.13 ? 407  HIS B NE2 1 
ATOM   3204  N N   . MET B 1 180 ? 39.730  -3.961  105.643 1.00 16.21 ? 408  MET B N   1 
ATOM   3205  C CA  . MET B 1 180 ? 39.425  -2.807  106.471 1.00 16.84 ? 408  MET B CA  1 
ATOM   3206  C C   . MET B 1 180 ? 40.054  -1.563  105.860 1.00 16.69 ? 408  MET B C   1 
ATOM   3207  O O   . MET B 1 180 ? 39.610  -0.440  106.148 1.00 16.81 ? 408  MET B O   1 
ATOM   3208  C CB  . MET B 1 180 ? 39.933  -2.998  107.902 1.00 16.75 ? 408  MET B CB  1 
ATOM   3209  C CG  . MET B 1 180 ? 40.261  -4.425  108.255 1.00 17.45 ? 408  MET B CG  1 
ATOM   3210  S SD  . MET B 1 180 ? 40.514  -4.624  110.004 1.00 18.76 ? 408  MET B SD  1 
ATOM   3211  C CE  . MET B 1 180 ? 38.942  -5.339  110.487 1.00 19.71 ? 408  MET B CE  1 
ATOM   3212  N N   . GLU B 1 181 ? 41.088  -1.773  105.035 1.00 16.48 ? 409  GLU B N   1 
ATOM   3213  C CA  . GLU B 1 181 ? 41.753  -0.695  104.280 1.00 16.33 ? 409  GLU B CA  1 
ATOM   3214  C C   . GLU B 1 181 ? 40.786  0.012   103.331 1.00 16.01 ? 409  GLU B C   1 
ATOM   3215  O O   . GLU B 1 181 ? 40.875  1.214   103.125 1.00 15.86 ? 409  GLU B O   1 
ATOM   3216  C CB  . GLU B 1 181 ? 42.969  -1.236  103.489 1.00 16.46 ? 409  GLU B CB  1 
ATOM   3217  C CG  . GLU B 1 181 ? 42.675  -1.976  102.151 1.00 16.75 ? 409  GLU B CG  1 
ATOM   3218  C CD  . GLU B 1 181 ? 42.138  -3.404  102.319 1.00 17.35 ? 409  GLU B CD  1 
ATOM   3219  O OE1 . GLU B 1 181 ? 41.924  -3.848  103.467 1.00 17.81 ? 409  GLU B OE1 1 
ATOM   3220  O OE2 . GLU B 1 181 ? 41.928  -4.087  101.291 1.00 17.05 ? 409  GLU B OE2 1 
ATOM   3221  N N   . ASP B 1 182 ? 39.858  -0.753  102.772 1.00 15.75 ? 410  ASP B N   1 
ATOM   3222  C CA  . ASP B 1 182 ? 38.878  -0.247  101.828 1.00 15.61 ? 410  ASP B CA  1 
ATOM   3223  C C   . ASP B 1 182 ? 37.451  -0.475  102.377 1.00 15.23 ? 410  ASP B C   1 
ATOM   3224  O O   . ASP B 1 182 ? 36.878  -1.548  102.192 1.00 14.94 ? 410  ASP B O   1 
ATOM   3225  C CB  . ASP B 1 182 ? 39.099  -0.966  100.495 1.00 15.76 ? 410  ASP B CB  1 
ATOM   3226  C CG  . ASP B 1 182 ? 38.170  -0.498  99.398  1.00 15.90 ? 410  ASP B CG  1 
ATOM   3227  O OD1 . ASP B 1 182 ? 37.501  0.542   99.548  1.00 14.71 ? 410  ASP B OD1 1 
ATOM   3228  O OD2 . ASP B 1 182 ? 38.125  -1.202  98.366  1.00 17.69 ? 410  ASP B OD2 1 
ATOM   3229  N N   . PRO B 1 183 ? 36.878  0.537   103.066 1.00 14.89 ? 411  PRO B N   1 
ATOM   3230  C CA  . PRO B 1 183 ? 35.526  0.455   103.596 1.00 14.70 ? 411  PRO B CA  1 
ATOM   3231  C C   . PRO B 1 183 ? 34.464  0.632   102.526 1.00 14.65 ? 411  PRO B C   1 
ATOM   3232  O O   . PRO B 1 183 ? 33.280  0.636   102.835 1.00 14.49 ? 411  PRO B O   1 
ATOM   3233  C CB  . PRO B 1 183 ? 35.473  1.618   104.574 1.00 14.55 ? 411  PRO B CB  1 
ATOM   3234  C CG  . PRO B 1 183 ? 36.338  2.604   103.984 1.00 14.88 ? 411  PRO B CG  1 
ATOM   3235  C CD  . PRO B 1 183 ? 37.481  1.838   103.391 1.00 15.09 ? 411  PRO B CD  1 
ATOM   3236  N N   . ARG B 1 184 ? 34.896  0.780   101.278 1.00 14.82 ? 412  ARG B N   1 
ATOM   3237  C CA  . ARG B 1 184 ? 33.994  0.833   100.134 1.00 14.84 ? 412  ARG B CA  1 
ATOM   3238  C C   . ARG B 1 184 ? 34.089  -0.409  99.234  1.00 14.82 ? 412  ARG B C   1 
ATOM   3239  O O   . ARG B 1 184 ? 33.312  -0.551  98.295  1.00 14.88 ? 412  ARG B O   1 
ATOM   3240  C CB  . ARG B 1 184 ? 34.271  2.113   99.353  1.00 14.86 ? 412  ARG B CB  1 
ATOM   3241  C CG  . ARG B 1 184 ? 34.281  3.323   100.282 1.00 15.24 ? 412  ARG B CG  1 
ATOM   3242  C CD  . ARG B 1 184 ? 33.949  4.617   99.603  1.00 15.85 ? 412  ARG B CD  1 
ATOM   3243  N NE  . ARG B 1 184 ? 35.145  5.352   99.201  1.00 17.22 ? 412  ARG B NE  1 
ATOM   3244  C CZ  . ARG B 1 184 ? 35.959  6.005   100.034 1.00 16.85 ? 412  ARG B CZ  1 
ATOM   3245  N NH1 . ARG B 1 184 ? 35.741  5.997   101.343 1.00 16.77 ? 412  ARG B NH1 1 
ATOM   3246  N NH2 . ARG B 1 184 ? 37.016  6.653   99.558  1.00 16.40 ? 412  ARG B NH2 1 
ATOM   3247  N N   . ARG B 1 185 ? 35.000  -1.330  99.549  1.00 14.72 ? 413  ARG B N   1 
ATOM   3248  C CA  . ARG B 1 185 ? 35.176  -2.554  98.754  1.00 14.54 ? 413  ARG B CA  1 
ATOM   3249  C C   . ARG B 1 185 ? 33.881  -3.303  98.459  1.00 14.54 ? 413  ARG B C   1 
ATOM   3250  O O   . ARG B 1 185 ? 33.717  -3.794  97.356  1.00 14.99 ? 413  ARG B O   1 
ATOM   3251  C CB  . ARG B 1 185 ? 36.156  -3.513  99.432  1.00 14.51 ? 413  ARG B CB  1 
ATOM   3252  C CG  . ARG B 1 185 ? 36.612  -4.681  98.568  1.00 13.89 ? 413  ARG B CG  1 
ATOM   3253  C CD  . ARG B 1 185 ? 37.956  -5.218  99.069  1.00 13.12 ? 413  ARG B CD  1 
ATOM   3254  N NE  . ARG B 1 185 ? 38.382  -6.449  98.393  1.00 12.83 ? 413  ARG B NE  1 
ATOM   3255  C CZ  . ARG B 1 185 ? 39.154  -6.512  97.305  1.00 11.47 ? 413  ARG B CZ  1 
ATOM   3256  N NH1 . ARG B 1 185 ? 39.631  -5.416  96.725  1.00 9.74  ? 413  ARG B NH1 1 
ATOM   3257  N NH2 . ARG B 1 185 ? 39.453  -7.699  96.796  1.00 11.75 ? 413  ARG B NH2 1 
ATOM   3258  N N   . ALA B 1 186 ? 32.975  -3.404  99.429  1.00 14.67 ? 414  ALA B N   1 
ATOM   3259  C CA  . ALA B 1 186 ? 31.735  -4.195  99.253  1.00 14.57 ? 414  ALA B CA  1 
ATOM   3260  C C   . ALA B 1 186 ? 30.876  -3.580  98.179  1.00 14.28 ? 414  ALA B C   1 
ATOM   3261  O O   . ALA B 1 186 ? 30.405  -4.278  97.277  1.00 13.98 ? 414  ALA B O   1 
ATOM   3262  C CB  . ALA B 1 186 ? 30.935  -4.277  100.562 1.00 14.85 ? 414  ALA B CB  1 
ATOM   3263  N N   . GLY B 1 187 ? 30.677  -2.267  98.300  1.00 14.01 ? 415  GLY B N   1 
ATOM   3264  C CA  . GLY B 1 187 ? 29.966  -1.484  97.291  1.00 13.98 ? 415  GLY B CA  1 
ATOM   3265  C C   . GLY B 1 187 ? 30.636  -1.548  95.925  1.00 13.85 ? 415  GLY B C   1 
ATOM   3266  O O   . GLY B 1 187 ? 29.956  -1.702  94.908  1.00 14.09 ? 415  GLY B O   1 
ATOM   3267  N N   . LYS B 1 188 ? 31.967  -1.445  95.898  1.00 13.35 ? 416  LYS B N   1 
ATOM   3268  C CA  . LYS B 1 188 ? 32.717  -1.568  94.653  1.00 12.98 ? 416  LYS B CA  1 
ATOM   3269  C C   . LYS B 1 188 ? 32.353  -2.874  93.972  1.00 13.36 ? 416  LYS B C   1 
ATOM   3270  O O   . LYS B 1 188 ? 32.110  -2.914  92.767  1.00 13.44 ? 416  LYS B O   1 
ATOM   3271  C CB  . LYS B 1 188 ? 34.226  -1.537  94.903  1.00 12.58 ? 416  LYS B CB  1 
ATOM   3272  C CG  . LYS B 1 188 ? 34.801  -0.175  95.098  1.00 11.28 ? 416  LYS B CG  1 
ATOM   3273  C CD  . LYS B 1 188 ? 36.242  -0.231  95.546  1.00 10.34 ? 416  LYS B CD  1 
ATOM   3274  C CE  . LYS B 1 188 ? 36.754  1.170   95.791  1.00 10.56 ? 416  LYS B CE  1 
ATOM   3275  N NZ  . LYS B 1 188 ? 38.070  1.234   96.445  1.00 10.34 ? 416  LYS B NZ  1 
ATOM   3276  N N   . MET B 1 189 ? 32.333  -3.942  94.762  1.00 13.78 ? 417  MET B N   1 
ATOM   3277  C CA  . MET B 1 189 ? 31.967  -5.263  94.278  1.00 14.09 ? 417  MET B CA  1 
ATOM   3278  C C   . MET B 1 189 ? 30.572  -5.240  93.675  1.00 13.96 ? 417  MET B C   1 
ATOM   3279  O O   . MET B 1 189 ? 30.343  -5.741  92.573  1.00 13.39 ? 417  MET B O   1 
ATOM   3280  C CB  . MET B 1 189 ? 31.999  -6.275  95.432  1.00 14.51 ? 417  MET B CB  1 
ATOM   3281  C CG  . MET B 1 189 ? 33.375  -6.719  95.849  1.00 15.15 ? 417  MET B CG  1 
ATOM   3282  S SD  . MET B 1 189 ? 34.275  -7.421  94.466  1.00 17.74 ? 417  MET B SD  1 
ATOM   3283  C CE  . MET B 1 189 ? 35.964  -7.416  95.094  1.00 16.91 ? 417  MET B CE  1 
ATOM   3284  N N   . LEU B 1 190 ? 29.646  -4.651  94.428  1.00 13.97 ? 418  LEU B N   1 
ATOM   3285  C CA  . LEU B 1 190 ? 28.259  -4.566  94.025  1.00 13.95 ? 418  LEU B CA  1 
ATOM   3286  C C   . LEU B 1 190 ? 28.128  -3.772  92.730  1.00 14.08 ? 418  LEU B C   1 
ATOM   3287  O O   . LEU B 1 190 ? 27.254  -4.067  91.912  1.00 14.44 ? 418  LEU B O   1 
ATOM   3288  C CB  . LEU B 1 190 ? 27.424  -3.935  95.147  1.00 14.12 ? 418  LEU B CB  1 
ATOM   3289  C CG  . LEU B 1 190 ? 27.072  -4.799  96.378  1.00 14.42 ? 418  LEU B CG  1 
ATOM   3290  C CD1 . LEU B 1 190 ? 26.388  -3.982  97.484  1.00 12.48 ? 418  LEU B CD1 1 
ATOM   3291  C CD2 . LEU B 1 190 ? 26.186  -6.009  95.990  1.00 14.57 ? 418  LEU B CD2 1 
ATOM   3292  N N   . MET B 1 191 ? 29.019  -2.788  92.547  1.00 14.04 ? 419  MET B N   1 
ATOM   3293  C CA  . MET B 1 191 ? 29.053  -1.914  91.354  1.00 13.90 ? 419  MET B CA  1 
ATOM   3294  C C   . MET B 1 191 ? 29.580  -2.559  90.061  1.00 13.64 ? 419  MET B C   1 
ATOM   3295  O O   . MET B 1 191 ? 29.652  -1.893  89.019  1.00 13.79 ? 419  MET B O   1 
ATOM   3296  C CB  . MET B 1 191 ? 29.892  -0.671  91.645  1.00 13.68 ? 419  MET B CB  1 
ATOM   3297  C CG  . MET B 1 191 ? 29.230  0.307   92.589  1.00 14.14 ? 419  MET B CG  1 
ATOM   3298  S SD  . MET B 1 191 ? 30.144  1.854   92.762  1.00 14.83 ? 419  MET B SD  1 
ATOM   3299  C CE  . MET B 1 191 ? 30.342  2.285   91.027  1.00 14.23 ? 419  MET B CE  1 
ATOM   3300  N N   . THR B 1 192 ? 29.961  -3.832  90.129  1.00 13.39 ? 420  THR B N   1 
ATOM   3301  C CA  . THR B 1 192 ? 30.320  -4.595  88.942  1.00 13.28 ? 420  THR B CA  1 
ATOM   3302  C C   . THR B 1 192 ? 29.169  -5.428  88.370  1.00 13.64 ? 420  THR B C   1 
ATOM   3303  O O   . THR B 1 192 ? 29.330  -6.031  87.313  1.00 14.18 ? 420  THR B O   1 
ATOM   3304  C CB  . THR B 1 192 ? 31.474  -5.577  89.215  1.00 13.04 ? 420  THR B CB  1 
ATOM   3305  O OG1 . THR B 1 192 ? 31.020  -6.631  90.056  1.00 11.13 ? 420  THR B OG1 1 
ATOM   3306  C CG2 . THR B 1 192 ? 32.639  -4.877  89.871  1.00 13.72 ? 420  THR B CG2 1 
ATOM   3307  N N   . LEU B 1 193 ? 28.029  -5.508  89.050  1.00 13.61 ? 421  LEU B N   1 
ATOM   3308  C CA  . LEU B 1 193 ? 26.956  -6.352  88.545  1.00 13.66 ? 421  LEU B CA  1 
ATOM   3309  C C   . LEU B 1 193 ? 26.344  -5.770  87.275  1.00 13.74 ? 421  LEU B C   1 
ATOM   3310  O O   . LEU B 1 193 ? 26.084  -6.517  86.339  1.00 14.32 ? 421  LEU B O   1 
ATOM   3311  C CB  . LEU B 1 193 ? 25.889  -6.606  89.608  1.00 14.01 ? 421  LEU B CB  1 
ATOM   3312  C CG  . LEU B 1 193 ? 26.304  -7.530  90.771  1.00 14.52 ? 421  LEU B CG  1 
ATOM   3313  C CD1 . LEU B 1 193 ? 25.355  -7.360  91.980  1.00 12.96 ? 421  LEU B CD1 1 
ATOM   3314  C CD2 . LEU B 1 193 ? 26.382  -9.001  90.328  1.00 13.36 ? 421  LEU B CD2 1 
ATOM   3315  N N   . PRO B 1 194 ? 26.138  -4.438  87.207  1.00 13.62 ? 422  PRO B N   1 
ATOM   3316  C CA  . PRO B 1 194 ? 25.538  -3.904  85.984  1.00 13.38 ? 422  PRO B CA  1 
ATOM   3317  C C   . PRO B 1 194 ? 26.241  -4.376  84.715  1.00 13.08 ? 422  PRO B C   1 
ATOM   3318  O O   . PRO B 1 194 ? 25.573  -4.618  83.703  1.00 13.19 ? 422  PRO B O   1 
ATOM   3319  C CB  . PRO B 1 194 ? 25.671  -2.385  86.153  1.00 13.13 ? 422  PRO B CB  1 
ATOM   3320  C CG  . PRO B 1 194 ? 25.642  -2.177  87.583  1.00 13.32 ? 422  PRO B CG  1 
ATOM   3321  C CD  . PRO B 1 194 ? 26.400  -3.359  88.172  1.00 13.98 ? 422  PRO B CD  1 
ATOM   3322  N N   . LEU B 1 195 ? 27.562  -4.515  84.769  1.00 12.60 ? 423  LEU B N   1 
ATOM   3323  C CA  . LEU B 1 195 ? 28.285  -5.076  83.631  1.00 12.68 ? 423  LEU B CA  1 
ATOM   3324  C C   . LEU B 1 195 ? 27.987  -6.568  83.454  1.00 12.41 ? 423  LEU B C   1 
ATOM   3325  O O   . LEU B 1 195 ? 27.872  -7.039  82.320  1.00 12.62 ? 423  LEU B O   1 
ATOM   3326  C CB  . LEU B 1 195 ? 29.805  -4.845  83.731  1.00 12.74 ? 423  LEU B CB  1 
ATOM   3327  C CG  . LEU B 1 195 ? 30.603  -5.200  82.464  1.00 12.11 ? 423  LEU B CG  1 
ATOM   3328  C CD1 . LEU B 1 195 ? 30.011  -4.562  81.205  1.00 11.27 ? 423  LEU B CD1 1 
ATOM   3329  C CD2 . LEU B 1 195 ? 32.058  -4.801  82.606  1.00 12.55 ? 423  LEU B CD2 1 
ATOM   3330  N N   . LEU B 1 196 ? 27.862  -7.303  84.559  1.00 11.82 ? 424  LEU B N   1 
ATOM   3331  C CA  . LEU B 1 196 ? 27.567  -8.729  84.482  1.00 11.55 ? 424  LEU B CA  1 
ATOM   3332  C C   . LEU B 1 196 ? 26.220  -8.989  83.819  1.00 11.91 ? 424  LEU B C   1 
ATOM   3333  O O   . LEU B 1 196 ? 26.087  -9.946  83.051  1.00 12.25 ? 424  LEU B O   1 
ATOM   3334  C CB  . LEU B 1 196 ? 27.583  -9.377  85.854  1.00 11.02 ? 424  LEU B CB  1 
ATOM   3335  C CG  . LEU B 1 196 ? 27.642  -10.902 85.828  1.00 10.66 ? 424  LEU B CG  1 
ATOM   3336  C CD1 . LEU B 1 196 ? 28.864  -11.422 85.016  1.00 9.97  ? 424  LEU B CD1 1 
ATOM   3337  C CD2 . LEU B 1 196 ? 27.667  -11.431 87.263  1.00 9.33  ? 424  LEU B CD2 1 
ATOM   3338  N N   . ARG B 1 197 ? 25.233  -8.140  84.115  1.00 11.80 ? 425  ARG B N   1 
ATOM   3339  C CA  . ARG B 1 197 ? 23.908  -8.246  83.526  1.00 11.84 ? 425  ARG B CA  1 
ATOM   3340  C C   . ARG B 1 197 ? 23.945  -7.930  82.044  1.00 11.80 ? 425  ARG B C   1 
ATOM   3341  O O   . ARG B 1 197 ? 23.432  -8.677  81.230  1.00 11.90 ? 425  ARG B O   1 
ATOM   3342  C CB  . ARG B 1 197 ? 22.969  -7.253  84.203  1.00 12.33 ? 425  ARG B CB  1 
ATOM   3343  C CG  . ARG B 1 197 ? 21.495  -7.265  83.699  1.00 11.98 ? 425  ARG B CG  1 
ATOM   3344  C CD  . ARG B 1 197 ? 20.690  -8.357  84.345  1.00 11.85 ? 425  ARG B CD  1 
ATOM   3345  N NE  . ARG B 1 197 ? 20.881  -8.410  85.801  1.00 12.69 ? 425  ARG B NE  1 
ATOM   3346  C CZ  . ARG B 1 197 ? 20.048  -7.919  86.724  1.00 13.42 ? 425  ARG B CZ  1 
ATOM   3347  N NH1 . ARG B 1 197 ? 18.923  -7.304  86.389  1.00 14.57 ? 425  ARG B NH1 1 
ATOM   3348  N NH2 . ARG B 1 197 ? 20.342  -8.052  88.007  1.00 13.40 ? 425  ARG B NH2 1 
ATOM   3349  N N   . GLN B 1 198 ? 24.534  -6.792  81.716  1.00 11.93 ? 426  GLN B N   1 
ATOM   3350  C CA  . GLN B 1 198 ? 24.721  -6.362  80.337  1.00 11.96 ? 426  GLN B CA  1 
ATOM   3351  C C   . GLN B 1 198 ? 25.372  -7.472  79.531  1.00 12.21 ? 426  GLN B C   1 
ATOM   3352  O O   . GLN B 1 198 ? 24.872  -7.878  78.483  1.00 12.22 ? 426  GLN B O   1 
ATOM   3353  C CB  . GLN B 1 198 ? 25.613  -5.113  80.323  1.00 12.12 ? 426  GLN B CB  1 
ATOM   3354  C CG  . GLN B 1 198 ? 25.783  -4.419  78.973  1.00 11.76 ? 426  GLN B CG  1 
ATOM   3355  C CD  . GLN B 1 198 ? 26.766  -3.272  79.056  1.00 11.07 ? 426  GLN B CD  1 
ATOM   3356  O OE1 . GLN B 1 198 ? 27.545  -3.032  78.148  1.00 10.55 ? 426  GLN B OE1 1 
ATOM   3357  N NE2 . GLN B 1 198 ? 26.755  -2.585  80.163  1.00 10.32 ? 426  GLN B NE2 1 
ATOM   3358  N N   . THR B 1 199 ? 26.488  -7.970  80.045  1.00 12.42 ? 427  THR B N   1 
ATOM   3359  C CA  . THR B 1 199 ? 27.264  -8.966  79.342  1.00 12.58 ? 427  THR B CA  1 
ATOM   3360  C C   . THR B 1 199 ? 26.484  -10.244 79.241  1.00 12.66 ? 427  THR B C   1 
ATOM   3361  O O   . THR B 1 199 ? 26.410  -10.823 78.167  1.00 13.04 ? 427  THR B O   1 
ATOM   3362  C CB  . THR B 1 199 ? 28.626  -9.187  80.004  1.00 12.63 ? 427  THR B CB  1 
ATOM   3363  O OG1 . THR B 1 199 ? 29.457  -8.063  79.698  1.00 12.77 ? 427  THR B OG1 1 
ATOM   3364  C CG2 . THR B 1 199 ? 29.305  -10.455 79.483  1.00 13.33 ? 427  THR B CG2 1 
ATOM   3365  N N   . SER B 1 200 ? 25.881  -10.678 80.340  1.00 12.95 ? 428  SER B N   1 
ATOM   3366  C CA  . SER B 1 200 ? 24.994  -11.845 80.314  1.00 13.12 ? 428  SER B CA  1 
ATOM   3367  C C   . SER B 1 200 ? 23.961  -11.749 79.191  1.00 13.36 ? 428  SER B C   1 
ATOM   3368  O O   . SER B 1 200 ? 23.763  -12.685 78.422  1.00 13.36 ? 428  SER B O   1 
ATOM   3369  C CB  . SER B 1 200 ? 24.279  -11.993 81.649  1.00 13.01 ? 428  SER B CB  1 
ATOM   3370  O OG  . SER B 1 200 ? 23.115  -12.784 81.510  1.00 13.94 ? 428  SER B OG  1 
ATOM   3371  N N   . THR B 1 201 ? 23.311  -10.600 79.101  1.00 13.73 ? 429  THR B N   1 
ATOM   3372  C CA  . THR B 1 201 ? 22.295  -10.372 78.086  1.00 14.06 ? 429  THR B CA  1 
ATOM   3373  C C   . THR B 1 201 ? 22.827  -10.509 76.659  1.00 14.59 ? 429  THR B C   1 
ATOM   3374  O O   . THR B 1 201 ? 22.120  -11.012 75.781  1.00 14.82 ? 429  THR B O   1 
ATOM   3375  C CB  . THR B 1 201 ? 21.645  -9.001  78.296  1.00 14.06 ? 429  THR B CB  1 
ATOM   3376  O OG1 . THR B 1 201 ? 20.625  -9.139  79.286  1.00 13.84 ? 429  THR B OG1 1 
ATOM   3377  C CG2 . THR B 1 201 ? 21.047  -8.439  77.009  1.00 13.63 ? 429  THR B CG2 1 
ATOM   3378  N N   . LYS B 1 202 ? 24.052  -10.044 76.424  1.00 15.00 ? 430  LYS B N   1 
ATOM   3379  C CA  . LYS B 1 202 ? 24.712  -10.246 75.127  1.00 15.28 ? 430  LYS B CA  1 
ATOM   3380  C C   . LYS B 1 202 ? 24.867  -11.731 74.837  1.00 15.07 ? 430  LYS B C   1 
ATOM   3381  O O   . LYS B 1 202 ? 24.458  -12.204 73.781  1.00 14.89 ? 430  LYS B O   1 
ATOM   3382  C CB  . LYS B 1 202 ? 26.077  -9.541  75.075  1.00 15.36 ? 430  LYS B CB  1 
ATOM   3383  C CG  . LYS B 1 202 ? 26.004  -8.170  74.419  1.00 16.28 ? 430  LYS B CG  1 
ATOM   3384  C CD  . LYS B 1 202 ? 26.747  -7.080  75.199  1.00 17.45 ? 430  LYS B CD  1 
ATOM   3385  C CE  . LYS B 1 202 ? 26.482  -5.690  74.597  1.00 17.58 ? 430  LYS B CE  1 
ATOM   3386  N NZ  . LYS B 1 202 ? 26.742  -4.607  75.580  1.00 18.58 ? 430  LYS B NZ  1 
ATOM   3387  N N   . ALA B 1 203 ? 25.439  -12.453 75.795  1.00 14.88 ? 431  ALA B N   1 
ATOM   3388  C CA  . ALA B 1 203 ? 25.597  -13.891 75.688  1.00 14.96 ? 431  ALA B CA  1 
ATOM   3389  C C   . ALA B 1 203 ? 24.278  -14.518 75.304  1.00 15.12 ? 431  ALA B C   1 
ATOM   3390  O O   . ALA B 1 203 ? 24.214  -15.272 74.362  1.00 15.20 ? 431  ALA B O   1 
ATOM   3391  C CB  . ALA B 1 203 ? 26.100  -14.483 77.004  1.00 14.72 ? 431  ALA B CB  1 
ATOM   3392  N N   . VAL B 1 204 ? 23.215  -14.190 76.019  1.00 15.70 ? 432  VAL B N   1 
ATOM   3393  C CA  . VAL B 1 204 ? 21.923  -14.819 75.765  1.00 15.98 ? 432  VAL B CA  1 
ATOM   3394  C C   . VAL B 1 204 ? 21.457  -14.502 74.361  1.00 16.80 ? 432  VAL B C   1 
ATOM   3395  O O   . VAL B 1 204 ? 21.070  -15.405 73.629  1.00 17.15 ? 432  VAL B O   1 
ATOM   3396  C CB  . VAL B 1 204 ? 20.841  -14.385 76.770  1.00 15.91 ? 432  VAL B CB  1 
ATOM   3397  C CG1 . VAL B 1 204 ? 19.475  -14.876 76.321  1.00 15.06 ? 432  VAL B CG1 1 
ATOM   3398  C CG2 . VAL B 1 204 ? 21.169  -14.904 78.172  1.00 15.44 ? 432  VAL B CG2 1 
ATOM   3399  N N   . GLN B 1 205 ? 21.508  -13.227 73.979  1.00 17.72 ? 433  GLN B N   1 
ATOM   3400  C CA  . GLN B 1 205 ? 21.070  -12.811 72.641  1.00 18.45 ? 433  GLN B CA  1 
ATOM   3401  C C   . GLN B 1 205 ? 21.845  -13.578 71.573  1.00 18.61 ? 433  GLN B C   1 
ATOM   3402  O O   . GLN B 1 205 ? 21.276  -14.409 70.874  1.00 18.70 ? 433  GLN B O   1 
ATOM   3403  C CB  . GLN B 1 205 ? 21.215  -11.295 72.455  1.00 18.73 ? 433  GLN B CB  1 
ATOM   3404  C CG  . GLN B 1 205 ? 19.977  -10.493 72.912  1.00 19.54 ? 433  GLN B CG  1 
ATOM   3405  C CD  . GLN B 1 205 ? 20.256  -9.000  73.123  1.00 19.19 ? 433  GLN B CD  1 
ATOM   3406  O OE1 . GLN B 1 205 ? 21.233  -8.622  73.770  1.00 20.80 ? 433  GLN B OE1 1 
ATOM   3407  N NE2 . GLN B 1 205 ? 19.383  -8.155  72.594  1.00 19.24 ? 433  GLN B NE2 1 
ATOM   3408  N N   . HIS B 1 206 ? 23.151  -13.344 71.499  1.00 18.94 ? 434  HIS B N   1 
ATOM   3409  C CA  . HIS B 1 206 ? 24.024  -14.065 70.571  1.00 19.24 ? 434  HIS B CA  1 
ATOM   3410  C C   . HIS B 1 206 ? 23.637  -15.535 70.355  1.00 20.14 ? 434  HIS B C   1 
ATOM   3411  O O   . HIS B 1 206 ? 23.793  -16.070 69.253  1.00 20.15 ? 434  HIS B O   1 
ATOM   3412  C CB  . HIS B 1 206 ? 25.480  -14.008 71.042  1.00 18.76 ? 434  HIS B CB  1 
ATOM   3413  C CG  . HIS B 1 206 ? 26.458  -14.400 69.985  1.00 18.06 ? 434  HIS B CG  1 
ATOM   3414  N ND1 . HIS B 1 206 ? 27.032  -13.486 69.130  1.00 17.17 ? 434  HIS B ND1 1 
ATOM   3415  C CD2 . HIS B 1 206 ? 26.938  -15.611 69.619  1.00 18.00 ? 434  HIS B CD2 1 
ATOM   3416  C CE1 . HIS B 1 206 ? 27.839  -14.115 68.296  1.00 17.57 ? 434  HIS B CE1 1 
ATOM   3417  N NE2 . HIS B 1 206 ? 27.800  -15.406 68.570  1.00 17.94 ? 434  HIS B NE2 1 
ATOM   3418  N N   . PHE B 1 207 ? 23.151  -16.193 71.400  1.00 21.24 ? 435  PHE B N   1 
ATOM   3419  C CA  . PHE B 1 207 ? 22.845  -17.609 71.303  1.00 22.30 ? 435  PHE B CA  1 
ATOM   3420  C C   . PHE B 1 207 ? 21.562  -17.878 70.527  1.00 23.26 ? 435  PHE B C   1 
ATOM   3421  O O   . PHE B 1 207 ? 21.576  -18.642 69.556  1.00 23.42 ? 435  PHE B O   1 
ATOM   3422  C CB  . PHE B 1 207 ? 22.739  -18.227 72.681  1.00 22.59 ? 435  PHE B CB  1 
ATOM   3423  C CG  . PHE B 1 207 ? 22.541  -19.697 72.647  1.00 22.88 ? 435  PHE B CG  1 
ATOM   3424  C CD1 . PHE B 1 207 ? 23.609  -20.537 72.380  1.00 23.57 ? 435  PHE B CD1 1 
ATOM   3425  C CD2 . PHE B 1 207 ? 21.288  -20.248 72.866  1.00 23.00 ? 435  PHE B CD2 1 
ATOM   3426  C CE1 . PHE B 1 207 ? 23.437  -21.906 72.345  1.00 23.81 ? 435  PHE B CE1 1 
ATOM   3427  C CE2 . PHE B 1 207 ? 21.103  -21.616 72.831  1.00 23.27 ? 435  PHE B CE2 1 
ATOM   3428  C CZ  . PHE B 1 207 ? 22.182  -22.451 72.569  1.00 23.63 ? 435  PHE B CZ  1 
ATOM   3429  N N   . TYR B 1 208 ? 20.454  -17.267 70.956  1.00 24.40 ? 436  TYR B N   1 
ATOM   3430  C CA  . TYR B 1 208 ? 19.173  -17.403 70.241  1.00 25.24 ? 436  TYR B CA  1 
ATOM   3431  C C   . TYR B 1 208 ? 19.387  -16.899 68.823  1.00 25.43 ? 436  TYR B C   1 
ATOM   3432  O O   . TYR B 1 208 ? 18.764  -17.377 67.880  1.00 25.55 ? 436  TYR B O   1 
ATOM   3433  C CB  . TYR B 1 208 ? 18.038  -16.605 70.921  1.00 25.97 ? 436  TYR B CB  1 
ATOM   3434  C CG  . TYR B 1 208 ? 17.576  -17.163 72.265  1.00 27.03 ? 436  TYR B CG  1 
ATOM   3435  C CD1 . TYR B 1 208 ? 18.274  -16.865 73.432  1.00 27.79 ? 436  TYR B CD1 1 
ATOM   3436  C CD2 . TYR B 1 208 ? 16.442  -17.984 72.373  1.00 27.56 ? 436  TYR B CD2 1 
ATOM   3437  C CE1 . TYR B 1 208 ? 17.878  -17.366 74.675  1.00 28.20 ? 436  TYR B CE1 1 
ATOM   3438  C CE2 . TYR B 1 208 ? 16.029  -18.494 73.624  1.00 27.62 ? 436  TYR B CE2 1 
ATOM   3439  C CZ  . TYR B 1 208 ? 16.762  -18.173 74.775  1.00 27.98 ? 436  TYR B CZ  1 
ATOM   3440  O OH  . TYR B 1 208 ? 16.421  -18.633 76.040  1.00 27.79 ? 436  TYR B OH  1 
ATOM   3441  N N   . ASN B 1 209 ? 20.295  -15.934 68.700  1.00 25.80 ? 437  ASN B N   1 
ATOM   3442  C CA  . ASN B 1 209 ? 20.703  -15.346 67.424  1.00 26.13 ? 437  ASN B CA  1 
ATOM   3443  C C   . ASN B 1 209 ? 21.393  -16.327 66.452  1.00 26.46 ? 437  ASN B C   1 
ATOM   3444  O O   . ASN B 1 209 ? 21.246  -16.195 65.236  1.00 26.47 ? 437  ASN B O   1 
ATOM   3445  C CB  . ASN B 1 209 ? 21.628  -14.152 67.710  1.00 26.11 ? 437  ASN B CB  1 
ATOM   3446  C CG  . ASN B 1 209 ? 21.673  -13.162 66.583  1.00 26.39 ? 437  ASN B CG  1 
ATOM   3447  O OD1 . ASN B 1 209 ? 21.031  -12.112 66.654  1.00 26.74 ? 437  ASN B OD1 1 
ATOM   3448  N ND2 . ASN B 1 209 ? 22.434  -13.478 65.531  1.00 26.50 ? 437  ASN B ND2 1 
ATOM   3449  N N   . ILE B 1 210 ? 22.151  -17.292 66.974  1.00 26.89 ? 438  ILE B N   1 
ATOM   3450  C CA  . ILE B 1 210 ? 22.823  -18.281 66.112  1.00 27.15 ? 438  ILE B CA  1 
ATOM   3451  C C   . ILE B 1 210 ? 22.052  -19.592 65.989  1.00 27.43 ? 438  ILE B C   1 
ATOM   3452  O O   . ILE B 1 210 ? 22.397  -20.435 65.155  1.00 27.36 ? 438  ILE B O   1 
ATOM   3453  C CB  . ILE B 1 210 ? 24.296  -18.544 66.524  1.00 27.16 ? 438  ILE B CB  1 
ATOM   3454  C CG1 . ILE B 1 210 ? 24.407  -19.213 67.890  1.00 26.87 ? 438  ILE B CG1 1 
ATOM   3455  C CG2 . ILE B 1 210 ? 25.077  -17.235 66.523  1.00 27.58 ? 438  ILE B CG2 1 
ATOM   3456  C CD1 . ILE B 1 210 ? 25.829  -19.254 68.404  1.00 26.91 ? 438  ILE B CD1 1 
ATOM   3457  N N   . LYS B 1 211 ? 21.013  -19.763 66.808  1.00 27.68 ? 439  LYS B N   1 
ATOM   3458  C CA  . LYS B 1 211 ? 20.023  -20.817 66.567  1.00 27.89 ? 439  LYS B CA  1 
ATOM   3459  C C   . LYS B 1 211 ? 19.251  -20.543 65.272  1.00 28.03 ? 439  LYS B C   1 
ATOM   3460  O O   . LYS B 1 211 ? 18.917  -21.478 64.552  1.00 28.23 ? 439  LYS B O   1 
ATOM   3461  C CB  . LYS B 1 211 ? 19.049  -20.971 67.746  1.00 27.84 ? 439  LYS B CB  1 
ATOM   3462  C CG  . LYS B 1 211 ? 19.603  -21.748 68.949  1.00 28.00 ? 439  LYS B CG  1 
ATOM   3463  C CD  . LYS B 1 211 ? 19.976  -23.201 68.597  1.00 28.38 ? 439  LYS B CD  1 
ATOM   3464  C CE  . LYS B 1 211 ? 20.138  -24.083 69.837  1.00 27.99 ? 439  LYS B CE  1 
ATOM   3465  N NZ  . LYS B 1 211 ? 20.531  -25.476 69.480  1.00 27.94 ? 439  LYS B NZ  1 
ATOM   3466  N N   . LEU B 1 212 ? 18.977  -19.272 64.974  1.00 28.25 ? 440  LEU B N   1 
ATOM   3467  C CA  . LEU B 1 212 ? 18.337  -18.893 63.704  1.00 28.35 ? 440  LEU B CA  1 
ATOM   3468  C C   . LEU B 1 212 ? 19.272  -19.112 62.516  1.00 28.41 ? 440  LEU B C   1 
ATOM   3469  O O   . LEU B 1 212 ? 18.897  -19.753 61.538  1.00 28.38 ? 440  LEU B O   1 
ATOM   3470  C CB  . LEU B 1 212 ? 17.885  -17.430 63.724  1.00 28.32 ? 440  LEU B CB  1 
ATOM   3471  C CG  . LEU B 1 212 ? 16.846  -17.030 64.771  1.00 28.29 ? 440  LEU B CG  1 
ATOM   3472  C CD1 . LEU B 1 212 ? 16.437  -15.589 64.548  1.00 28.39 ? 440  LEU B CD1 1 
ATOM   3473  C CD2 . LEU B 1 212 ? 15.626  -17.951 64.743  1.00 28.31 ? 440  LEU B CD2 1 
ATOM   3474  N N   . GLU B 1 213 ? 20.488  -18.585 62.610  1.00 28.60 ? 441  GLU B N   1 
ATOM   3475  C CA  . GLU B 1 213 ? 21.502  -18.794 61.569  1.00 28.89 ? 441  GLU B CA  1 
ATOM   3476  C C   . GLU B 1 213 ? 21.819  -20.271 61.300  1.00 29.06 ? 441  GLU B C   1 
ATOM   3477  O O   . GLU B 1 213 ? 22.426  -20.599 60.275  1.00 29.16 ? 441  GLU B O   1 
ATOM   3478  C CB  . GLU B 1 213 ? 22.804  -18.067 61.918  1.00 28.86 ? 441  GLU B CB  1 
ATOM   3479  C CG  . GLU B 1 213 ? 22.768  -16.574 61.629  1.00 29.16 ? 441  GLU B CG  1 
ATOM   3480  C CD  . GLU B 1 213 ? 24.087  -16.038 61.101  1.00 29.47 ? 441  GLU B CD  1 
ATOM   3481  O OE1 . GLU B 1 213 ? 25.012  -16.839 60.850  1.00 29.97 ? 441  GLU B OE1 1 
ATOM   3482  O OE2 . GLU B 1 213 ? 24.198  -14.808 60.929  1.00 29.56 ? 441  GLU B OE2 1 
ATOM   3483  N N   . GLY B 1 214 ? 21.441  -21.147 62.233  1.00 29.15 ? 442  GLY B N   1 
ATOM   3484  C CA  . GLY B 1 214 ? 21.606  -22.593 62.084  1.00 29.07 ? 442  GLY B CA  1 
ATOM   3485  C C   . GLY B 1 214 ? 22.676  -23.021 61.098  1.00 28.95 ? 442  GLY B C   1 
ATOM   3486  O O   . GLY B 1 214 ? 22.376  -23.686 60.110  1.00 29.07 ? 442  GLY B O   1 
ATOM   3487  N N   . LYS B 1 215 ? 23.916  -22.610 61.348  1.00 28.87 ? 443  LYS B N   1 
ATOM   3488  C CA  . LYS B 1 215 ? 25.070  -23.140 60.614  1.00 28.89 ? 443  LYS B CA  1 
ATOM   3489  C C   . LYS B 1 215 ? 25.666  -24.354 61.335  1.00 28.81 ? 443  LYS B C   1 
ATOM   3490  O O   . LYS B 1 215 ? 26.509  -25.058 60.773  1.00 28.84 ? 443  LYS B O   1 
ATOM   3491  C CB  . LYS B 1 215 ? 26.169  -22.086 60.456  1.00 28.96 ? 443  LYS B CB  1 
ATOM   3492  C CG  . LYS B 1 215 ? 25.783  -20.816 59.708  1.00 28.92 ? 443  LYS B CG  1 
ATOM   3493  C CD  . LYS B 1 215 ? 27.044  -20.128 59.160  1.00 28.86 ? 443  LYS B CD  1 
ATOM   3494  C CE  . LYS B 1 215 ? 27.093  -18.651 59.486  1.00 28.61 ? 443  LYS B CE  1 
ATOM   3495  N NZ  . LYS B 1 215 ? 28.423  -18.082 59.164  1.00 28.36 ? 443  LYS B NZ  1 
ATOM   3496  N N   . VAL B 1 216 ? 25.256  -24.568 62.587  1.00 28.67 ? 444  VAL B N   1 
ATOM   3497  C CA  . VAL B 1 216 ? 25.676  -25.733 63.367  1.00 28.49 ? 444  VAL B CA  1 
ATOM   3498  C C   . VAL B 1 216 ? 25.067  -27.035 62.816  1.00 28.35 ? 444  VAL B C   1 
ATOM   3499  O O   . VAL B 1 216 ? 25.803  -27.980 62.526  1.00 28.27 ? 444  VAL B O   1 
ATOM   3500  C CB  . VAL B 1 216 ? 25.348  -25.553 64.874  1.00 28.56 ? 444  VAL B CB  1 
ATOM   3501  C CG1 . VAL B 1 216 ? 25.619  -26.830 65.648  1.00 28.57 ? 444  VAL B CG1 1 
ATOM   3502  C CG2 . VAL B 1 216 ? 26.154  -24.395 65.454  1.00 28.19 ? 444  VAL B CG2 1 
ATOM   3503  N N   . PRO B 1 217 ? 23.729  -27.091 62.659  1.00 28.17 ? 445  PRO B N   1 
ATOM   3504  C CA  . PRO B 1 217 ? 23.133  -28.271 62.013  1.00 28.18 ? 445  PRO B CA  1 
ATOM   3505  C C   . PRO B 1 217 ? 23.559  -28.479 60.554  1.00 28.15 ? 445  PRO B C   1 
ATOM   3506  O O   . PRO B 1 217 ? 23.486  -29.600 60.048  1.00 28.15 ? 445  PRO B O   1 
ATOM   3507  C CB  . PRO B 1 217 ? 21.624  -28.006 62.103  1.00 28.17 ? 445  PRO B CB  1 
ATOM   3508  C CG  . PRO B 1 217 ? 21.496  -26.549 62.302  1.00 28.24 ? 445  PRO B CG  1 
ATOM   3509  C CD  . PRO B 1 217 ? 22.698  -26.126 63.079  1.00 28.13 ? 445  PRO B CD  1 
ATOM   3510  N N   . MET B 1 218 ? 23.968  -27.403 59.883  1.00 28.10 ? 446  MET B N   1 
ATOM   3511  C CA  . MET B 1 218 ? 24.681  -27.517 58.613  1.00 28.11 ? 446  MET B CA  1 
ATOM   3512  C C   . MET B 1 218 ? 25.980  -28.288 58.875  1.00 28.00 ? 446  MET B C   1 
ATOM   3513  O O   . MET B 1 218 ? 26.091  -29.468 58.541  1.00 28.16 ? 446  MET B O   1 
ATOM   3514  C CB  . MET B 1 218 ? 24.996  -26.128 58.027  1.00 28.16 ? 446  MET B CB  1 
ATOM   3515  C CG  . MET B 1 218 ? 23.820  -25.414 57.360  1.00 28.49 ? 446  MET B CG  1 
ATOM   3516  S SD  . MET B 1 218 ? 23.940  -25.239 55.561  1.00 28.98 ? 446  MET B SD  1 
ATOM   3517  C CE  . MET B 1 218 ? 22.645  -24.033 55.284  1.00 28.45 ? 446  MET B CE  1 
ATOM   3518  N N   . HIS B 1 219 ? 26.937  -27.624 59.514  1.00 27.73 ? 447  HIS B N   1 
ATOM   3519  C CA  . HIS B 1 219 ? 28.261  -28.182 59.778  1.00 27.69 ? 447  HIS B CA  1 
ATOM   3520  C C   . HIS B 1 219 ? 28.250  -29.653 60.188  1.00 27.53 ? 447  HIS B C   1 
ATOM   3521  O O   . HIS B 1 219 ? 29.168  -30.397 59.837  1.00 27.71 ? 447  HIS B O   1 
ATOM   3522  C CB  . HIS B 1 219 ? 28.944  -27.335 60.851  1.00 27.91 ? 447  HIS B CB  1 
ATOM   3523  C CG  . HIS B 1 219 ? 30.052  -28.027 61.580  1.00 28.38 ? 447  HIS B CG  1 
ATOM   3524  N ND1 . HIS B 1 219 ? 31.376  -27.682 61.417  1.00 29.25 ? 447  HIS B ND1 1 
ATOM   3525  C CD2 . HIS B 1 219 ? 30.031  -29.014 62.508  1.00 28.92 ? 447  HIS B CD2 1 
ATOM   3526  C CE1 . HIS B 1 219 ? 32.125  -28.436 62.203  1.00 29.51 ? 447  HIS B CE1 1 
ATOM   3527  N NE2 . HIS B 1 219 ? 31.333  -29.256 62.871  1.00 29.59 ? 447  HIS B NE2 1 
ATOM   3528  N N   . LYS B 1 220 ? 27.232  -30.069 60.939  1.00 27.28 ? 448  LYS B N   1 
ATOM   3529  C CA  . LYS B 1 220 ? 27.117  -31.471 61.359  1.00 27.12 ? 448  LYS B CA  1 
ATOM   3530  C C   . LYS B 1 220 ? 26.886  -32.408 60.178  1.00 26.79 ? 448  LYS B C   1 
ATOM   3531  O O   . LYS B 1 220 ? 27.476  -33.487 60.111  1.00 26.59 ? 448  LYS B O   1 
ATOM   3532  C CB  . LYS B 1 220 ? 26.008  -31.645 62.403  1.00 27.19 ? 448  LYS B CB  1 
ATOM   3533  C CG  . LYS B 1 220 ? 26.446  -31.284 63.818  1.00 27.22 ? 448  LYS B CG  1 
ATOM   3534  C CD  . LYS B 1 220 ? 25.283  -31.334 64.792  1.00 27.30 ? 448  LYS B CD  1 
ATOM   3535  C CE  . LYS B 1 220 ? 25.715  -30.912 66.187  1.00 27.53 ? 448  LYS B CE  1 
ATOM   3536  N NZ  . LYS B 1 220 ? 24.556  -30.558 67.058  1.00 27.84 ? 448  LYS B NZ  1 
ATOM   3537  N N   . LEU B 1 221 ? 26.030  -31.994 59.251  1.00 26.67 ? 449  LEU B N   1 
ATOM   3538  C CA  . LEU B 1 221 ? 25.786  -32.778 58.044  1.00 26.71 ? 449  LEU B CA  1 
ATOM   3539  C C   . LEU B 1 221 ? 26.998  -32.742 57.114  1.00 26.61 ? 449  LEU B C   1 
ATOM   3540  O O   . LEU B 1 221 ? 27.266  -33.715 56.422  1.00 26.81 ? 449  LEU B O   1 
ATOM   3541  C CB  . LEU B 1 221 ? 24.515  -32.310 57.321  1.00 26.70 ? 449  LEU B CB  1 
ATOM   3542  C CG  . LEU B 1 221 ? 23.217  -32.493 58.124  1.00 27.04 ? 449  LEU B CG  1 
ATOM   3543  C CD1 . LEU B 1 221 ? 22.015  -31.910 57.388  1.00 27.08 ? 449  LEU B CD1 1 
ATOM   3544  C CD2 . LEU B 1 221 ? 22.965  -33.960 58.455  1.00 27.16 ? 449  LEU B CD2 1 
ATOM   3545  N N   . PHE B 1 222 ? 27.738  -31.635 57.106  1.00 26.41 ? 450  PHE B N   1 
ATOM   3546  C CA  . PHE B 1 222 ? 28.978  -31.567 56.335  1.00 26.35 ? 450  PHE B CA  1 
ATOM   3547  C C   . PHE B 1 222 ? 30.013  -32.537 56.899  1.00 26.17 ? 450  PHE B C   1 
ATOM   3548  O O   . PHE B 1 222 ? 30.662  -33.256 56.145  1.00 26.21 ? 450  PHE B O   1 
ATOM   3549  C CB  . PHE B 1 222 ? 29.525  -30.134 56.273  1.00 26.54 ? 450  PHE B CB  1 
ATOM   3550  C CG  . PHE B 1 222 ? 28.734  -29.240 55.361  1.00 26.82 ? 450  PHE B CG  1 
ATOM   3551  C CD1 . PHE B 1 222 ? 28.973  -29.230 54.000  1.00 27.18 ? 450  PHE B CD1 1 
ATOM   3552  C CD2 . PHE B 1 222 ? 27.722  -28.438 55.858  1.00 27.56 ? 450  PHE B CD2 1 
ATOM   3553  C CE1 . PHE B 1 222 ? 28.225  -28.418 53.150  1.00 27.39 ? 450  PHE B CE1 1 
ATOM   3554  C CE2 . PHE B 1 222 ? 26.966  -27.618 55.014  1.00 27.43 ? 450  PHE B CE2 1 
ATOM   3555  C CZ  . PHE B 1 222 ? 27.220  -27.609 53.663  1.00 27.21 ? 450  PHE B CZ  1 
ATOM   3556  N N   . LEU B 1 223 ? 30.147  -32.565 58.220  1.00 26.04 ? 451  LEU B N   1 
ATOM   3557  C CA  . LEU B 1 223 ? 31.024  -33.530 58.894  1.00 25.98 ? 451  LEU B CA  1 
ATOM   3558  C C   . LEU B 1 223 ? 30.712  -34.972 58.515  1.00 25.96 ? 451  LEU B C   1 
ATOM   3559  O O   . LEU B 1 223 ? 31.613  -35.738 58.165  1.00 25.99 ? 451  LEU B O   1 
ATOM   3560  C CB  . LEU B 1 223 ? 30.892  -33.415 60.411  1.00 25.97 ? 451  LEU B CB  1 
ATOM   3561  C CG  . LEU B 1 223 ? 31.864  -32.501 61.128  1.00 26.01 ? 451  LEU B CG  1 
ATOM   3562  C CD1 . LEU B 1 223 ? 31.492  -32.450 62.601  1.00 26.06 ? 451  LEU B CD1 1 
ATOM   3563  C CD2 . LEU B 1 223 ? 33.282  -33.010 60.935  1.00 26.15 ? 451  LEU B CD2 1 
ATOM   3564  N N   . GLU B 1 224 ? 29.439  -35.342 58.615  1.00 25.81 ? 452  GLU B N   1 
ATOM   3565  C CA  . GLU B 1 224 ? 29.032  -36.721 58.375  1.00 25.93 ? 452  GLU B CA  1 
ATOM   3566  C C   . GLU B 1 224 ? 29.268  -37.095 56.920  1.00 25.66 ? 452  GLU B C   1 
ATOM   3567  O O   . GLU B 1 224 ? 29.859  -38.133 56.630  1.00 25.75 ? 452  GLU B O   1 
ATOM   3568  C CB  . GLU B 1 224 ? 27.564  -36.941 58.762  1.00 25.98 ? 452  GLU B CB  1 
ATOM   3569  C CG  . GLU B 1 224 ? 27.324  -36.927 60.274  1.00 26.43 ? 452  GLU B CG  1 
ATOM   3570  C CD  . GLU B 1 224 ? 25.862  -37.162 60.670  1.00 26.64 ? 452  GLU B CD  1 
ATOM   3571  O OE1 . GLU B 1 224 ? 25.023  -37.519 59.803  1.00 26.16 ? 452  GLU B OE1 1 
ATOM   3572  O OE2 . GLU B 1 224 ? 25.561  -36.988 61.872  1.00 27.85 ? 452  GLU B OE2 1 
ATOM   3573  N N   . MET B 1 225 ? 28.826  -36.225 56.016  1.00 25.45 ? 453  MET B N   1 
ATOM   3574  C CA  . MET B 1 225 ? 28.941  -36.449 54.572  1.00 25.14 ? 453  MET B CA  1 
ATOM   3575  C C   . MET B 1 225 ? 30.395  -36.592 54.125  1.00 24.87 ? 453  MET B C   1 
ATOM   3576  O O   . MET B 1 225 ? 30.763  -37.592 53.506  1.00 24.77 ? 453  MET B O   1 
ATOM   3577  C CB  . MET B 1 225 ? 28.305  -35.284 53.822  1.00 25.16 ? 453  MET B CB  1 
ATOM   3578  C CG  . MET B 1 225 ? 26.810  -35.167 54.007  1.00 25.42 ? 453  MET B CG  1 
ATOM   3579  S SD  . MET B 1 225 ? 25.898  -36.351 53.031  1.00 27.32 ? 453  MET B SD  1 
ATOM   3580  C CE  . MET B 1 225 ? 26.596  -36.122 51.396  1.00 27.58 ? 453  MET B CE  1 
ATOM   3581  N N   . LEU B 1 226 ? 31.217  -35.601 54.465  1.00 24.58 ? 454  LEU B N   1 
ATOM   3582  C CA  . LEU B 1 226 ? 32.617  -35.555 54.021  1.00 24.53 ? 454  LEU B CA  1 
ATOM   3583  C C   . LEU B 1 226 ? 33.480  -36.718 54.530  1.00 24.60 ? 454  LEU B C   1 
ATOM   3584  O O   . LEU B 1 226 ? 34.623  -36.874 54.096  1.00 24.63 ? 454  LEU B O   1 
ATOM   3585  C CB  . LEU B 1 226 ? 33.274  -34.224 54.420  1.00 24.48 ? 454  LEU B CB  1 
ATOM   3586  C CG  . LEU B 1 226 ? 32.842  -32.942 53.694  1.00 24.34 ? 454  LEU B CG  1 
ATOM   3587  C CD1 . LEU B 1 226 ? 33.561  -31.741 54.293  1.00 24.12 ? 454  LEU B CD1 1 
ATOM   3588  C CD2 . LEU B 1 226 ? 33.098  -33.012 52.196  1.00 24.14 ? 454  LEU B CD2 1 
ATOM   3589  N N   . GLU B 1 227 ? 32.942  -37.514 55.451  1.00 24.69 ? 455  GLU B N   1 
ATOM   3590  C CA  . GLU B 1 227 ? 33.598  -38.726 55.924  1.00 24.74 ? 455  GLU B CA  1 
ATOM   3591  C C   . GLU B 1 227 ? 32.791  -39.946 55.497  1.00 24.61 ? 455  GLU B C   1 
ATOM   3592  O O   . GLU B 1 227 ? 33.076  -41.070 55.910  1.00 24.61 ? 455  GLU B O   1 
ATOM   3593  C CB  . GLU B 1 227 ? 33.722  -38.683 57.442  1.00 24.68 ? 455  GLU B CB  1 
ATOM   3594  C CG  . GLU B 1 227 ? 34.506  -37.483 57.956  1.00 25.09 ? 455  GLU B CG  1 
ATOM   3595  C CD  . GLU B 1 227 ? 34.434  -37.331 59.473  1.00 25.32 ? 455  GLU B CD  1 
ATOM   3596  O OE1 . GLU B 1 227 ? 33.300  -37.260 60.005  1.00 25.87 ? 455  GLU B OE1 1 
ATOM   3597  O OE2 . GLU B 1 227 ? 35.508  -37.271 60.126  1.00 25.15 ? 455  GLU B OE2 1 
ATOM   3598  N N   . PRO C 1 5   ? 72.557  -2.857  86.475  1.00 29.03 ? 233  PRO C N   1 
ATOM   3599  C CA  . PRO C 1 5   ? 73.619  -3.394  87.327  1.00 28.81 ? 233  PRO C CA  1 
ATOM   3600  C C   . PRO C 1 5   ? 73.064  -4.139  88.536  1.00 28.54 ? 233  PRO C C   1 
ATOM   3601  O O   . PRO C 1 5   ? 72.628  -3.491  89.492  1.00 28.77 ? 233  PRO C O   1 
ATOM   3602  C CB  . PRO C 1 5   ? 74.369  -2.135  87.776  1.00 28.89 ? 233  PRO C CB  1 
ATOM   3603  C CG  . PRO C 1 5   ? 73.312  -1.056  87.797  1.00 29.15 ? 233  PRO C CG  1 
ATOM   3604  C CD  . PRO C 1 5   ? 72.259  -1.442  86.773  1.00 29.14 ? 233  PRO C CD  1 
ATOM   3605  N N   . TYR C 1 6   ? 73.059  -5.477  88.473  1.00 27.94 ? 234  TYR C N   1 
ATOM   3606  C CA  . TYR C 1 6   ? 72.648  -6.345  89.602  1.00 27.50 ? 234  TYR C CA  1 
ATOM   3607  C C   . TYR C 1 6   ? 72.602  -7.825  89.237  1.00 26.32 ? 234  TYR C C   1 
ATOM   3608  O O   . TYR C 1 6   ? 72.202  -8.180  88.132  1.00 26.46 ? 234  TYR C O   1 
ATOM   3609  C CB  . TYR C 1 6   ? 71.272  -5.952  90.157  1.00 28.19 ? 234  TYR C CB  1 
ATOM   3610  C CG  . TYR C 1 6   ? 71.320  -5.476  91.587  1.00 29.01 ? 234  TYR C CG  1 
ATOM   3611  C CD1 . TYR C 1 6   ? 71.364  -6.395  92.638  1.00 29.33 ? 234  TYR C CD1 1 
ATOM   3612  C CD2 . TYR C 1 6   ? 71.323  -4.108  91.892  1.00 30.00 ? 234  TYR C CD2 1 
ATOM   3613  C CE1 . TYR C 1 6   ? 71.407  -5.969  93.958  1.00 29.88 ? 234  TYR C CE1 1 
ATOM   3614  C CE2 . TYR C 1 6   ? 71.373  -3.668  93.208  1.00 30.44 ? 234  TYR C CE2 1 
ATOM   3615  C CZ  . TYR C 1 6   ? 71.412  -4.600  94.238  1.00 29.90 ? 234  TYR C CZ  1 
ATOM   3616  O OH  . TYR C 1 6   ? 71.458  -4.148  95.534  1.00 29.65 ? 234  TYR C OH  1 
ATOM   3617  N N   . ASN C 1 7   ? 72.971  -8.680  90.187  1.00 24.70 ? 235  ASN C N   1 
ATOM   3618  C CA  . ASN C 1 7   ? 73.023  -10.117 89.955  1.00 23.41 ? 235  ASN C CA  1 
ATOM   3619  C C   . ASN C 1 7   ? 71.626  -10.719 89.916  1.00 22.46 ? 235  ASN C C   1 
ATOM   3620  O O   . ASN C 1 7   ? 70.805  -10.427 90.779  1.00 22.38 ? 235  ASN C O   1 
ATOM   3621  C CB  . ASN C 1 7   ? 73.863  -10.785 91.047  1.00 23.42 ? 235  ASN C CB  1 
ATOM   3622  C CG  . ASN C 1 7   ? 73.826  -12.306 90.986  1.00 22.38 ? 235  ASN C CG  1 
ATOM   3623  O OD1 . ASN C 1 7   ? 72.760  -12.918 90.977  1.00 21.25 ? 235  ASN C OD1 1 
ATOM   3624  N ND2 . ASN C 1 7   ? 74.999  -12.920 90.973  1.00 20.74 ? 235  ASN C ND2 1 
ATOM   3625  N N   . LYS C 1 8   ? 71.384  -11.584 88.929  1.00 21.32 ? 236  LYS C N   1 
ATOM   3626  C CA  . LYS C 1 8   ? 70.060  -12.170 88.686  1.00 20.31 ? 236  LYS C CA  1 
ATOM   3627  C C   . LYS C 1 8   ? 69.516  -12.937 89.883  1.00 19.51 ? 236  LYS C C   1 
ATOM   3628  O O   . LYS C 1 8   ? 68.389  -12.719 90.297  1.00 19.59 ? 236  LYS C O   1 
ATOM   3629  C CB  . LYS C 1 8   ? 70.076  -13.096 87.463  1.00 20.26 ? 236  LYS C CB  1 
ATOM   3630  C CG  . LYS C 1 8   ? 69.575  -12.469 86.160  1.00 20.33 ? 236  LYS C CG  1 
ATOM   3631  C CD  . LYS C 1 8   ? 70.702  -11.995 85.234  1.00 20.69 ? 236  LYS C CD  1 
ATOM   3632  C CE  . LYS C 1 8   ? 70.173  -11.805 83.803  1.00 20.88 ? 236  LYS C CE  1 
ATOM   3633  N NZ  . LYS C 1 8   ? 71.060  -10.982 82.914  1.00 21.00 ? 236  LYS C NZ  1 
ATOM   3634  N N   . ILE C 1 9   ? 70.307  -13.837 90.445  1.00 18.72 ? 237  ILE C N   1 
ATOM   3635  C CA  . ILE C 1 9   ? 69.837  -14.625 91.589  1.00 18.03 ? 237  ILE C CA  1 
ATOM   3636  C C   . ILE C 1 9   ? 69.599  -13.781 92.843  1.00 17.74 ? 237  ILE C C   1 
ATOM   3637  O O   . ILE C 1 9   ? 68.649  -14.033 93.581  1.00 17.73 ? 237  ILE C O   1 
ATOM   3638  C CB  . ILE C 1 9   ? 70.799  -15.769 91.941  1.00 17.91 ? 237  ILE C CB  1 
ATOM   3639  C CG1 . ILE C 1 9   ? 70.837  -16.787 90.799  1.00 17.18 ? 237  ILE C CG1 1 
ATOM   3640  C CG2 . ILE C 1 9   ? 70.369  -16.435 93.255  1.00 17.30 ? 237  ILE C CG2 1 
ATOM   3641  C CD1 . ILE C 1 9   ? 71.791  -17.912 91.028  1.00 16.36 ? 237  ILE C CD1 1 
ATOM   3642  N N   . VAL C 1 10  ? 70.455  -12.790 93.088  1.00 17.32 ? 238  VAL C N   1 
ATOM   3643  C CA  . VAL C 1 10  ? 70.253  -11.904 94.222  1.00 16.84 ? 238  VAL C CA  1 
ATOM   3644  C C   . VAL C 1 10  ? 68.883  -11.290 94.045  1.00 16.76 ? 238  VAL C C   1 
ATOM   3645  O O   . VAL C 1 10  ? 68.024  -11.412 94.916  1.00 16.78 ? 238  VAL C O   1 
ATOM   3646  C CB  . VAL C 1 10  ? 71.305  -10.780 94.326  1.00 16.75 ? 238  VAL C CB  1 
ATOM   3647  C CG1 . VAL C 1 10  ? 70.986  -9.892  95.511  1.00 16.79 ? 238  VAL C CG1 1 
ATOM   3648  C CG2 . VAL C 1 10  ? 72.700  -11.342 94.484  1.00 16.48 ? 238  VAL C CG2 1 
ATOM   3649  N N   . SER C 1 11  ? 68.668  -10.660 92.892  1.00 16.67 ? 239  SER C N   1 
ATOM   3650  C CA  . SER C 1 11  ? 67.375  -10.043 92.577  1.00 16.57 ? 239  SER C CA  1 
ATOM   3651  C C   . SER C 1 11  ? 66.204  -11.006 92.792  1.00 16.45 ? 239  SER C C   1 
ATOM   3652  O O   . SER C 1 11  ? 65.252  -10.676 93.494  1.00 16.35 ? 239  SER C O   1 
ATOM   3653  C CB  . SER C 1 11  ? 67.359  -9.535  91.140  1.00 16.39 ? 239  SER C CB  1 
ATOM   3654  O OG  . SER C 1 11  ? 68.402  -8.608  90.934  1.00 16.83 ? 239  SER C OG  1 
ATOM   3655  N N   . HIS C 1 12  ? 66.284  -12.193 92.195  1.00 16.42 ? 240  HIS C N   1 
ATOM   3656  C CA  . HIS C 1 12  ? 65.220  -13.183 92.319  1.00 16.51 ? 240  HIS C CA  1 
ATOM   3657  C C   . HIS C 1 12  ? 64.888  -13.448 93.780  1.00 16.37 ? 240  HIS C C   1 
ATOM   3658  O O   . HIS C 1 12  ? 63.711  -13.545 94.152  1.00 16.39 ? 240  HIS C O   1 
ATOM   3659  C CB  . HIS C 1 12  ? 65.606  -14.503 91.651  1.00 16.85 ? 240  HIS C CB  1 
ATOM   3660  C CG  . HIS C 1 12  ? 64.509  -15.524 91.676  1.00 17.80 ? 240  HIS C CG  1 
ATOM   3661  N ND1 . HIS C 1 12  ? 63.580  -15.644 90.663  1.00 18.97 ? 240  HIS C ND1 1 
ATOM   3662  C CD2 . HIS C 1 12  ? 64.171  -16.447 92.610  1.00 18.21 ? 240  HIS C CD2 1 
ATOM   3663  C CE1 . HIS C 1 12  ? 62.725  -16.606 90.966  1.00 19.25 ? 240  HIS C CE1 1 
ATOM   3664  N NE2 . HIS C 1 12  ? 63.061  -17.108 92.143  1.00 18.79 ? 240  HIS C NE2 1 
ATOM   3665  N N   . LEU C 1 13  ? 65.930  -13.570 94.602  1.00 16.09 ? 241  LEU C N   1 
ATOM   3666  C CA  . LEU C 1 13  ? 65.756  -13.795 96.034  1.00 15.66 ? 241  LEU C CA  1 
ATOM   3667  C C   . LEU C 1 13  ? 65.078  -12.602 96.711  1.00 15.58 ? 241  LEU C C   1 
ATOM   3668  O O   . LEU C 1 13  ? 64.235  -12.798 97.578  1.00 15.58 ? 241  LEU C O   1 
ATOM   3669  C CB  . LEU C 1 13  ? 67.103  -14.126 96.697  1.00 15.59 ? 241  LEU C CB  1 
ATOM   3670  C CG  . LEU C 1 13  ? 67.727  -15.483 96.336  1.00 14.74 ? 241  LEU C CG  1 
ATOM   3671  C CD1 . LEU C 1 13  ? 69.196  -15.492 96.692  1.00 14.42 ? 241  LEU C CD1 1 
ATOM   3672  C CD2 . LEU C 1 13  ? 67.010  -16.631 97.030  1.00 13.39 ? 241  LEU C CD2 1 
ATOM   3673  N N   . LEU C 1 14  ? 65.426  -11.377 96.296  1.00 15.62 ? 242  LEU C N   1 
ATOM   3674  C CA  . LEU C 1 14  ? 64.784  -10.146 96.829  1.00 15.48 ? 242  LEU C CA  1 
ATOM   3675  C C   . LEU C 1 14  ? 63.265  -10.116 96.651  1.00 15.58 ? 242  LEU C C   1 
ATOM   3676  O O   . LEU C 1 14  ? 62.549  -9.703  97.558  1.00 15.74 ? 242  LEU C O   1 
ATOM   3677  C CB  . LEU C 1 14  ? 65.371  -8.864  96.203  1.00 15.22 ? 242  LEU C CB  1 
ATOM   3678  C CG  . LEU C 1 14  ? 66.682  -8.278  96.733  1.00 14.43 ? 242  LEU C CG  1 
ATOM   3679  C CD1 . LEU C 1 14  ? 67.014  -6.998  95.991  1.00 13.25 ? 242  LEU C CD1 1 
ATOM   3680  C CD2 . LEU C 1 14  ? 66.625  -8.021  98.223  1.00 13.47 ? 242  LEU C CD2 1 
ATOM   3681  N N   . VAL C 1 15  ? 62.779  -10.533 95.483  1.00 15.80 ? 243  VAL C N   1 
ATOM   3682  C CA  . VAL C 1 15  ? 61.331  -10.551 95.216  1.00 15.93 ? 243  VAL C CA  1 
ATOM   3683  C C   . VAL C 1 15  ? 60.660  -11.769 95.890  1.00 16.38 ? 243  VAL C C   1 
ATOM   3684  O O   . VAL C 1 15  ? 59.522  -11.684 96.359  1.00 16.56 ? 243  VAL C O   1 
ATOM   3685  C CB  . VAL C 1 15  ? 60.999  -10.487 93.689  1.00 15.66 ? 243  VAL C CB  1 
ATOM   3686  C CG1 . VAL C 1 15  ? 61.947  -9.515  92.965  1.00 15.41 ? 243  VAL C CG1 1 
ATOM   3687  C CG2 . VAL C 1 15  ? 61.039  -11.859 93.047  1.00 15.22 ? 243  VAL C CG2 1 
ATOM   3688  N N   . ALA C 1 16  ? 61.382  -12.885 95.976  1.00 16.61 ? 244  ALA C N   1 
ATOM   3689  C CA  . ALA C 1 16  ? 60.836  -14.097 96.557  1.00 16.86 ? 244  ALA C CA  1 
ATOM   3690  C C   . ALA C 1 16  ? 60.708  -13.971 98.069  1.00 17.39 ? 244  ALA C C   1 
ATOM   3691  O O   . ALA C 1 16  ? 60.198  -14.887 98.727  1.00 17.58 ? 244  ALA C O   1 
ATOM   3692  C CB  . ALA C 1 16  ? 61.708  -15.287 96.203  1.00 16.87 ? 244  ALA C CB  1 
ATOM   3693  N N   . GLU C 1 17  ? 61.181  -12.844 98.609  1.00 17.74 ? 245  GLU C N   1 
ATOM   3694  C CA  . GLU C 1 17  ? 61.214  -12.588 100.053 1.00 17.98 ? 245  GLU C CA  1 
ATOM   3695  C C   . GLU C 1 17  ? 59.791  -12.479 100.617 1.00 18.41 ? 245  GLU C C   1 
ATOM   3696  O O   . GLU C 1 17  ? 59.035  -11.602 100.191 1.00 18.72 ? 245  GLU C O   1 
ATOM   3697  C CB  . GLU C 1 17  ? 62.003  -11.297 100.304 1.00 17.95 ? 245  GLU C CB  1 
ATOM   3698  C CG  . GLU C 1 17  ? 62.104  -10.831 101.729 1.00 17.82 ? 245  GLU C CG  1 
ATOM   3699  C CD  . GLU C 1 17  ? 62.533  -11.915 102.672 1.00 18.57 ? 245  GLU C CD  1 
ATOM   3700  O OE1 . GLU C 1 17  ? 63.534  -12.628 102.381 1.00 18.07 ? 245  GLU C OE1 1 
ATOM   3701  O OE2 . GLU C 1 17  ? 61.852  -12.049 103.715 1.00 19.49 ? 245  GLU C OE2 1 
ATOM   3702  N N   . PRO C 1 18  ? 59.406  -13.392 101.538 1.00 18.73 ? 246  PRO C N   1 
ATOM   3703  C CA  . PRO C 1 18  ? 58.086  -13.407 102.187 1.00 19.00 ? 246  PRO C CA  1 
ATOM   3704  C C   . PRO C 1 18  ? 57.636  -12.081 102.803 1.00 19.18 ? 246  PRO C C   1 
ATOM   3705  O O   . PRO C 1 18  ? 58.471  -11.342 103.340 1.00 19.22 ? 246  PRO C O   1 
ATOM   3706  C CB  . PRO C 1 18  ? 58.267  -14.433 103.310 1.00 19.19 ? 246  PRO C CB  1 
ATOM   3707  C CG  . PRO C 1 18  ? 59.301  -15.348 102.823 1.00 18.94 ? 246  PRO C CG  1 
ATOM   3708  C CD  . PRO C 1 18  ? 60.230  -14.531 101.985 1.00 18.96 ? 246  PRO C CD  1 
ATOM   3709  N N   . GLU C 1 19  ? 56.325  -11.815 102.747 1.00 19.21 ? 247  GLU C N   1 
ATOM   3710  C CA  . GLU C 1 19  ? 55.729  -10.611 103.338 1.00 19.24 ? 247  GLU C CA  1 
ATOM   3711  C C   . GLU C 1 19  ? 55.843  -10.759 104.855 1.00 19.02 ? 247  GLU C C   1 
ATOM   3712  O O   . GLU C 1 19  ? 55.943  -11.873 105.357 1.00 19.01 ? 247  GLU C O   1 
ATOM   3713  C CB  . GLU C 1 19  ? 54.242  -10.447 102.959 1.00 19.44 ? 247  GLU C CB  1 
ATOM   3714  C CG  . GLU C 1 19  ? 53.817  -10.837 101.525 1.00 20.81 ? 247  GLU C CG  1 
ATOM   3715  C CD  . GLU C 1 19  ? 54.040  -9.742  100.474 1.00 22.78 ? 247  GLU C CD  1 
ATOM   3716  O OE1 . GLU C 1 19  ? 53.602  -8.592  100.703 1.00 23.94 ? 247  GLU C OE1 1 
ATOM   3717  O OE2 . GLU C 1 19  ? 54.619  -10.041 99.398  1.00 23.35 ? 247  GLU C OE2 1 
ATOM   3718  N N   . LYS C 1 20  ? 55.818  -9.643  105.579 1.00 18.90 ? 248  LYS C N   1 
ATOM   3719  C CA  . LYS C 1 20  ? 55.889  -9.660  107.049 1.00 18.77 ? 248  LYS C CA  1 
ATOM   3720  C C   . LYS C 1 20  ? 54.800  -10.542 107.688 1.00 18.48 ? 248  LYS C C   1 
ATOM   3721  O O   . LYS C 1 20  ? 53.645  -10.550 107.234 1.00 18.26 ? 248  LYS C O   1 
ATOM   3722  C CB  . LYS C 1 20  ? 55.791  -8.226  107.625 1.00 18.94 ? 248  LYS C CB  1 
ATOM   3723  C CG  . LYS C 1 20  ? 57.116  -7.449  107.665 1.00 19.09 ? 248  LYS C CG  1 
ATOM   3724  C CD  . LYS C 1 20  ? 56.939  -5.987  108.141 1.00 18.86 ? 248  LYS C CD  1 
ATOM   3725  C CE  . LYS C 1 20  ? 58.188  -5.142  107.810 1.00 18.75 ? 248  LYS C CE  1 
ATOM   3726  N NZ  . LYS C 1 20  ? 58.309  -3.874  108.569 1.00 17.61 ? 248  LYS C NZ  1 
ATOM   3727  N N   . ILE C 1 21  ? 55.192  -11.278 108.736 1.00 18.16 ? 249  ILE C N   1 
ATOM   3728  C CA  . ILE C 1 21  ? 54.254  -12.012 109.601 1.00 17.92 ? 249  ILE C CA  1 
ATOM   3729  C C   . ILE C 1 21  ? 54.285  -11.444 111.016 1.00 17.77 ? 249  ILE C C   1 
ATOM   3730  O O   . ILE C 1 21  ? 55.345  -11.097 111.548 1.00 17.70 ? 249  ILE C O   1 
ATOM   3731  C CB  . ILE C 1 21  ? 54.561  -13.525 109.686 1.00 17.86 ? 249  ILE C CB  1 
ATOM   3732  C CG1 . ILE C 1 21  ? 54.564  -14.162 108.296 1.00 18.10 ? 249  ILE C CG1 1 
ATOM   3733  C CG2 . ILE C 1 21  ? 53.517  -14.230 110.543 1.00 17.24 ? 249  ILE C CG2 1 
ATOM   3734  C CD1 . ILE C 1 21  ? 55.332  -15.472 108.228 1.00 18.47 ? 249  ILE C CD1 1 
ATOM   3735  N N   . TYR C 1 22  ? 53.104  -11.379 111.617 1.00 17.77 ? 250  TYR C N   1 
ATOM   3736  C CA  . TYR C 1 22  ? 52.914  -10.812 112.947 1.00 17.88 ? 250  TYR C CA  1 
ATOM   3737  C C   . TYR C 1 22  ? 52.813  -11.921 113.997 1.00 17.33 ? 250  TYR C C   1 
ATOM   3738  O O   . TYR C 1 22  ? 52.439  -13.044 113.681 1.00 17.17 ? 250  TYR C O   1 
ATOM   3739  C CB  . TYR C 1 22  ? 51.683  -9.891  112.928 1.00 18.33 ? 250  TYR C CB  1 
ATOM   3740  C CG  . TYR C 1 22  ? 51.900  -8.753  111.952 1.00 19.30 ? 250  TYR C CG  1 
ATOM   3741  C CD1 . TYR C 1 22  ? 52.693  -7.654  112.300 1.00 20.07 ? 250  TYR C CD1 1 
ATOM   3742  C CD2 . TYR C 1 22  ? 51.381  -8.799  110.660 1.00 20.35 ? 250  TYR C CD2 1 
ATOM   3743  C CE1 . TYR C 1 22  ? 52.931  -6.612  111.405 1.00 19.81 ? 250  TYR C CE1 1 
ATOM   3744  C CE2 . TYR C 1 22  ? 51.615  -7.756  109.754 1.00 20.54 ? 250  TYR C CE2 1 
ATOM   3745  C CZ  . TYR C 1 22  ? 52.394  -6.672  110.138 1.00 20.14 ? 250  TYR C CZ  1 
ATOM   3746  O OH  . TYR C 1 22  ? 52.637  -5.644  109.260 1.00 20.56 ? 250  TYR C OH  1 
ATOM   3747  N N   . ALA C 1 23  ? 53.198  -11.611 115.231 1.00 16.92 ? 251  ALA C N   1 
ATOM   3748  C CA  . ALA C 1 23  ? 53.172  -12.588 116.326 1.00 16.70 ? 251  ALA C CA  1 
ATOM   3749  C C   . ALA C 1 23  ? 51.759  -12.747 116.881 1.00 16.62 ? 251  ALA C C   1 
ATOM   3750  O O   . ALA C 1 23  ? 51.363  -13.843 117.296 1.00 16.43 ? 251  ALA C O   1 
ATOM   3751  C CB  . ALA C 1 23  ? 54.124  -12.170 117.430 1.00 16.40 ? 251  ALA C CB  1 
ATOM   3752  N N   . MET C 1 24  ? 51.023  -11.636 116.891 1.00 16.54 ? 252  MET C N   1 
ATOM   3753  C CA  . MET C 1 24  ? 49.630  -11.590 117.324 1.00 16.73 ? 252  MET C CA  1 
ATOM   3754  C C   . MET C 1 24  ? 49.432  -12.206 118.700 1.00 16.40 ? 252  MET C C   1 
ATOM   3755  O O   . MET C 1 24  ? 48.651  -13.151 118.857 1.00 16.26 ? 252  MET C O   1 
ATOM   3756  C CB  . MET C 1 24  ? 48.734  -12.262 116.287 1.00 16.70 ? 252  MET C CB  1 
ATOM   3757  C CG  . MET C 1 24  ? 48.855  -11.624 114.922 1.00 17.18 ? 252  MET C CG  1 
ATOM   3758  S SD  . MET C 1 24  ? 47.521  -12.112 113.830 1.00 18.03 ? 252  MET C SD  1 
ATOM   3759  C CE  . MET C 1 24  ? 47.913  -13.861 113.609 1.00 17.83 ? 252  MET C CE  1 
ATOM   3760  N N   . PRO C 1 25  ? 50.133  -11.658 119.707 1.00 16.29 ? 253  PRO C N   1 
ATOM   3761  C CA  . PRO C 1 25  ? 50.032  -12.201 121.059 1.00 16.28 ? 253  PRO C CA  1 
ATOM   3762  C C   . PRO C 1 25  ? 48.626  -12.008 121.588 1.00 16.16 ? 253  PRO C C   1 
ATOM   3763  O O   . PRO C 1 25  ? 48.090  -10.910 121.470 1.00 16.23 ? 253  PRO C O   1 
ATOM   3764  C CB  . PRO C 1 25  ? 51.041  -11.362 121.853 1.00 16.34 ? 253  PRO C CB  1 
ATOM   3765  C CG  . PRO C 1 25  ? 51.191  -10.091 121.071 1.00 16.29 ? 253  PRO C CG  1 
ATOM   3766  C CD  . PRO C 1 25  ? 51.031  -10.488 119.642 1.00 16.25 ? 253  PRO C CD  1 
ATOM   3767  N N   . ASP C 1 26  ? 48.023  -13.064 122.131 1.00 16.24 ? 254  ASP C N   1 
ATOM   3768  C CA  . ASP C 1 26  ? 46.663  -12.964 122.667 1.00 16.36 ? 254  ASP C CA  1 
ATOM   3769  C C   . ASP C 1 26  ? 46.655  -12.032 123.896 1.00 16.34 ? 254  ASP C C   1 
ATOM   3770  O O   . ASP C 1 26  ? 47.200  -12.385 124.948 1.00 16.21 ? 254  ASP C O   1 
ATOM   3771  C CB  . ASP C 1 26  ? 46.106  -14.343 123.034 1.00 16.40 ? 254  ASP C CB  1 
ATOM   3772  C CG  . ASP C 1 26  ? 44.641  -14.286 123.484 1.00 17.48 ? 254  ASP C CG  1 
ATOM   3773  O OD1 . ASP C 1 26  ? 44.231  -13.305 124.154 1.00 17.52 ? 254  ASP C OD1 1 
ATOM   3774  O OD2 . ASP C 1 26  ? 43.887  -15.230 123.163 1.00 18.97 ? 254  ASP C OD2 1 
ATOM   3775  N N   . PRO C 1 27  ? 46.015  -10.849 123.769 1.00 16.35 ? 255  PRO C N   1 
ATOM   3776  C CA  . PRO C 1 27  ? 46.124  -9.819  124.808 1.00 16.33 ? 255  PRO C CA  1 
ATOM   3777  C C   . PRO C 1 27  ? 45.492  -10.235 126.133 1.00 16.42 ? 255  PRO C C   1 
ATOM   3778  O O   . PRO C 1 27  ? 46.025  -9.902  127.196 1.00 16.46 ? 255  PRO C O   1 
ATOM   3779  C CB  . PRO C 1 27  ? 45.384  -8.622  124.199 1.00 16.34 ? 255  PRO C CB  1 
ATOM   3780  C CG  . PRO C 1 27  ? 44.445  -9.213  123.219 1.00 16.38 ? 255  PRO C CG  1 
ATOM   3781  C CD  . PRO C 1 27  ? 45.120  -10.431 122.673 1.00 16.29 ? 255  PRO C CD  1 
ATOM   3782  N N   . THR C 1 28  ? 44.381  -10.968 126.056 1.00 16.41 ? 256  THR C N   1 
ATOM   3783  C CA  . THR C 1 28  ? 43.656  -11.438 127.241 1.00 16.41 ? 256  THR C CA  1 
ATOM   3784  C C   . THR C 1 28  ? 44.521  -12.312 128.172 1.00 16.39 ? 256  THR C C   1 
ATOM   3785  O O   . THR C 1 28  ? 44.460  -12.164 129.394 1.00 16.54 ? 256  THR C O   1 
ATOM   3786  C CB  . THR C 1 28  ? 42.389  -12.226 126.832 1.00 16.48 ? 256  THR C CB  1 
ATOM   3787  O OG1 . THR C 1 28  ? 42.758  -13.331 125.997 1.00 16.59 ? 256  THR C OG1 1 
ATOM   3788  C CG2 . THR C 1 28  ? 41.404  -11.322 126.075 1.00 16.24 ? 256  THR C CG2 1 
ATOM   3789  N N   . VAL C 1 29  ? 45.322  -13.208 127.592 1.00 16.35 ? 257  VAL C N   1 
ATOM   3790  C CA  . VAL C 1 29  ? 46.229  -14.083 128.355 1.00 16.34 ? 257  VAL C CA  1 
ATOM   3791  C C   . VAL C 1 29  ? 47.324  -13.263 129.056 1.00 16.27 ? 257  VAL C C   1 
ATOM   3792  O O   . VAL C 1 29  ? 48.136  -12.633 128.380 1.00 16.35 ? 257  VAL C O   1 
ATOM   3793  C CB  . VAL C 1 29  ? 46.904  -15.132 127.418 1.00 16.43 ? 257  VAL C CB  1 
ATOM   3794  C CG1 . VAL C 1 29  ? 48.083  -15.811 128.105 1.00 16.72 ? 257  VAL C CG1 1 
ATOM   3795  C CG2 . VAL C 1 29  ? 45.888  -16.170 126.942 1.00 16.31 ? 257  VAL C CG2 1 
ATOM   3796  N N   . PRO C 1 30  ? 47.367  -13.284 130.407 1.00 16.17 ? 258  PRO C N   1 
ATOM   3797  C CA  . PRO C 1 30  ? 48.318  -12.436 131.134 1.00 16.21 ? 258  PRO C CA  1 
ATOM   3798  C C   . PRO C 1 30  ? 49.777  -12.838 130.902 1.00 16.33 ? 258  PRO C C   1 
ATOM   3799  O O   . PRO C 1 30  ? 50.074  -14.016 130.678 1.00 16.17 ? 258  PRO C O   1 
ATOM   3800  C CB  . PRO C 1 30  ? 47.920  -12.637 132.596 1.00 16.15 ? 258  PRO C CB  1 
ATOM   3801  C CG  . PRO C 1 30  ? 47.288  -13.960 132.624 1.00 16.06 ? 258  PRO C CG  1 
ATOM   3802  C CD  . PRO C 1 30  ? 46.567  -14.104 131.329 1.00 16.07 ? 258  PRO C CD  1 
ATOM   3803  N N   . ASP C 1 31  ? 50.668  -11.852 130.956 1.00 16.58 ? 259  ASP C N   1 
ATOM   3804  C CA  . ASP C 1 31  ? 52.077  -12.041 130.582 1.00 16.87 ? 259  ASP C CA  1 
ATOM   3805  C C   . ASP C 1 31  ? 52.773  -13.052 131.484 1.00 16.80 ? 259  ASP C C   1 
ATOM   3806  O O   . ASP C 1 31  ? 52.490  -13.111 132.683 1.00 16.83 ? 259  ASP C O   1 
ATOM   3807  C CB  . ASP C 1 31  ? 52.829  -10.703 130.599 1.00 17.03 ? 259  ASP C CB  1 
ATOM   3808  C CG  . ASP C 1 31  ? 52.418  -9.790  129.450 1.00 17.63 ? 259  ASP C CG  1 
ATOM   3809  O OD1 . ASP C 1 31  ? 51.197  -9.592  129.249 1.00 18.88 ? 259  ASP C OD1 1 
ATOM   3810  O OD2 . ASP C 1 31  ? 53.311  -9.278  128.741 1.00 18.25 ? 259  ASP C OD2 1 
ATOM   3811  N N   . SER C 1 32  ? 53.674  -13.842 130.896 1.00 16.63 ? 260  SER C N   1 
ATOM   3812  C CA  . SER C 1 32  ? 54.253  -15.004 131.574 1.00 16.81 ? 260  SER C CA  1 
ATOM   3813  C C   . SER C 1 32  ? 55.222  -15.756 130.678 1.00 16.78 ? 260  SER C C   1 
ATOM   3814  O O   . SER C 1 32  ? 55.207  -15.579 129.454 1.00 16.97 ? 260  SER C O   1 
ATOM   3815  C CB  . SER C 1 32  ? 53.143  -15.967 132.029 1.00 17.02 ? 260  SER C CB  1 
ATOM   3816  O OG  . SER C 1 32  ? 52.078  -16.029 131.086 1.00 17.50 ? 260  SER C OG  1 
ATOM   3817  N N   . ASP C 1 33  ? 56.057  -16.606 131.283 1.00 16.75 ? 261  ASP C N   1 
ATOM   3818  C CA  . ASP C 1 33  ? 57.028  -17.402 130.510 1.00 16.52 ? 261  ASP C CA  1 
ATOM   3819  C C   . ASP C 1 33  ? 56.325  -18.196 129.423 1.00 16.24 ? 261  ASP C C   1 
ATOM   3820  O O   . ASP C 1 33  ? 56.707  -18.129 128.259 1.00 16.19 ? 261  ASP C O   1 
ATOM   3821  C CB  . ASP C 1 33  ? 57.905  -18.320 131.392 1.00 16.64 ? 261  ASP C CB  1 
ATOM   3822  C CG  . ASP C 1 33  ? 57.102  -19.223 132.338 1.00 17.10 ? 261  ASP C CG  1 
ATOM   3823  O OD1 . ASP C 1 33  ? 56.095  -18.761 132.930 1.00 17.28 ? 261  ASP C OD1 1 
ATOM   3824  O OD2 . ASP C 1 33  ? 57.514  -20.396 132.513 1.00 17.20 ? 261  ASP C OD2 1 
ATOM   3825  N N   . ILE C 1 34  ? 55.254  -18.887 129.803 1.00 16.03 ? 262  ILE C N   1 
ATOM   3826  C CA  . ILE C 1 34  ? 54.544  -19.786 128.891 1.00 15.81 ? 262  ILE C CA  1 
ATOM   3827  C C   . ILE C 1 34  ? 53.943  -19.043 127.694 1.00 15.61 ? 262  ILE C C   1 
ATOM   3828  O O   . ILE C 1 34  ? 53.917  -19.581 126.584 1.00 15.65 ? 262  ILE C O   1 
ATOM   3829  C CB  . ILE C 1 34  ? 53.451  -20.604 129.628 1.00 15.68 ? 262  ILE C CB  1 
ATOM   3830  C CG1 . ILE C 1 34  ? 54.063  -21.385 130.804 1.00 15.61 ? 262  ILE C CG1 1 
ATOM   3831  C CG2 . ILE C 1 34  ? 52.741  -21.558 128.664 1.00 15.38 ? 262  ILE C CG2 1 
ATOM   3832  C CD1 . ILE C 1 34  ? 55.274  -22.226 130.449 1.00 15.33 ? 262  ILE C CD1 1 
ATOM   3833  N N   . LYS C 1 35  ? 53.485  -17.811 127.912 1.00 15.27 ? 263  LYS C N   1 
ATOM   3834  C CA  . LYS C 1 35  ? 52.989  -16.967 126.819 1.00 14.86 ? 263  LYS C CA  1 
ATOM   3835  C C   . LYS C 1 35  ? 54.099  -16.744 125.789 1.00 14.81 ? 263  LYS C C   1 
ATOM   3836  O O   . LYS C 1 35  ? 54.041  -17.272 124.679 1.00 14.73 ? 263  LYS C O   1 
ATOM   3837  C CB  . LYS C 1 35  ? 52.461  -15.633 127.364 1.00 14.78 ? 263  LYS C CB  1 
ATOM   3838  C CG  . LYS C 1 35  ? 51.862  -14.711 126.325 1.00 14.31 ? 263  LYS C CG  1 
ATOM   3839  C CD  . LYS C 1 35  ? 51.102  -13.555 126.979 1.00 14.15 ? 263  LYS C CD  1 
ATOM   3840  C CE  . LYS C 1 35  ? 50.016  -13.003 126.067 1.00 12.68 ? 263  LYS C CE  1 
ATOM   3841  N NZ  . LYS C 1 35  ? 49.641  -11.618 126.420 1.00 11.05 ? 263  LYS C NZ  1 
ATOM   3842  N N   . ALA C 1 36  ? 55.136  -16.010 126.176 1.00 14.66 ? 264  ALA C N   1 
ATOM   3843  C CA  . ALA C 1 36  ? 56.252  -15.754 125.274 1.00 14.54 ? 264  ALA C CA  1 
ATOM   3844  C C   . ALA C 1 36  ? 56.579  -16.982 124.446 1.00 14.34 ? 264  ALA C C   1 
ATOM   3845  O O   . ALA C 1 36  ? 56.735  -16.903 123.236 1.00 14.49 ? 264  ALA C O   1 
ATOM   3846  C CB  . ALA C 1 36  ? 57.471  -15.326 126.059 1.00 14.65 ? 264  ALA C CB  1 
ATOM   3847  N N   . LEU C 1 37  ? 56.662  -18.118 125.122 1.00 14.10 ? 265  LEU C N   1 
ATOM   3848  C CA  . LEU C 1 37  ? 57.017  -19.374 124.497 1.00 13.87 ? 265  LEU C CA  1 
ATOM   3849  C C   . LEU C 1 37  ? 55.888  -19.854 123.594 1.00 13.72 ? 265  LEU C C   1 
ATOM   3850  O O   . LEU C 1 37  ? 56.100  -20.124 122.411 1.00 14.05 ? 265  LEU C O   1 
ATOM   3851  C CB  . LEU C 1 37  ? 57.344  -20.405 125.577 1.00 13.80 ? 265  LEU C CB  1 
ATOM   3852  C CG  . LEU C 1 37  ? 58.553  -19.983 126.430 1.00 13.94 ? 265  LEU C CG  1 
ATOM   3853  C CD1 . LEU C 1 37  ? 58.594  -20.640 127.816 1.00 13.59 ? 265  LEU C CD1 1 
ATOM   3854  C CD2 . LEU C 1 37  ? 59.829  -20.261 125.668 1.00 13.94 ? 265  LEU C CD2 1 
ATOM   3855  N N   . THR C 1 38  ? 54.687  -19.944 124.147 1.00 13.34 ? 266  THR C N   1 
ATOM   3856  C CA  . THR C 1 38  ? 53.512  -20.295 123.362 1.00 13.16 ? 266  THR C CA  1 
ATOM   3857  C C   . THR C 1 38  ? 53.431  -19.430 122.104 1.00 12.99 ? 266  THR C C   1 
ATOM   3858  O O   . THR C 1 38  ? 53.139  -19.933 121.019 1.00 13.14 ? 266  THR C O   1 
ATOM   3859  C CB  . THR C 1 38  ? 52.201  -20.109 124.176 1.00 13.16 ? 266  THR C CB  1 
ATOM   3860  O OG1 . THR C 1 38  ? 52.221  -20.939 125.344 1.00 13.16 ? 266  THR C OG1 1 
ATOM   3861  C CG2 . THR C 1 38  ? 50.997  -20.470 123.347 1.00 12.93 ? 266  THR C CG2 1 
ATOM   3862  N N   . THR C 1 39  ? 53.700  -18.135 122.255 1.00 12.61 ? 267  THR C N   1 
ATOM   3863  C CA  . THR C 1 39  ? 53.590  -17.188 121.153 1.00 12.34 ? 267  THR C CA  1 
ATOM   3864  C C   . THR C 1 39  ? 54.646  -17.445 120.094 1.00 12.30 ? 267  THR C C   1 
ATOM   3865  O O   . THR C 1 39  ? 54.335  -17.568 118.914 1.00 12.40 ? 267  THR C O   1 
ATOM   3866  C CB  . THR C 1 39  ? 53.717  -15.747 121.645 1.00 12.26 ? 267  THR C CB  1 
ATOM   3867  O OG1 . THR C 1 39  ? 52.469  -15.329 122.200 1.00 12.38 ? 267  THR C OG1 1 
ATOM   3868  C CG2 . THR C 1 39  ? 54.063  -14.812 120.516 1.00 12.73 ? 267  THR C CG2 1 
ATOM   3869  N N   . LEU C 1 40  ? 55.897  -17.531 120.515 1.00 12.09 ? 268  LEU C N   1 
ATOM   3870  C CA  . LEU C 1 40  ? 56.973  -17.782 119.584 1.00 11.88 ? 268  LEU C CA  1 
ATOM   3871  C C   . LEU C 1 40  ? 56.781  -19.104 118.873 1.00 12.21 ? 268  LEU C C   1 
ATOM   3872  O O   . LEU C 1 40  ? 57.109  -19.213 117.700 1.00 12.26 ? 268  LEU C O   1 
ATOM   3873  C CB  . LEU C 1 40  ? 58.305  -17.739 120.302 1.00 11.66 ? 268  LEU C CB  1 
ATOM   3874  C CG  . LEU C 1 40  ? 58.641  -16.305 120.694 1.00 10.93 ? 268  LEU C CG  1 
ATOM   3875  C CD1 . LEU C 1 40  ? 59.573  -16.244 121.896 1.00 9.93  ? 268  LEU C CD1 1 
ATOM   3876  C CD2 . LEU C 1 40  ? 59.221  -15.588 119.492 1.00 10.10 ? 268  LEU C CD2 1 
ATOM   3877  N N   . CYS C 1 41  ? 56.233  -20.097 119.566 1.00 12.51 ? 269  CYS C N   1 
ATOM   3878  C CA  . CYS C 1 41  ? 55.897  -21.375 118.931 1.00 13.24 ? 269  CYS C CA  1 
ATOM   3879  C C   . CYS C 1 41  ? 55.016  -21.229 117.718 1.00 13.38 ? 269  CYS C C   1 
ATOM   3880  O O   . CYS C 1 41  ? 55.411  -21.588 116.609 1.00 13.24 ? 269  CYS C O   1 
ATOM   3881  C CB  . CYS C 1 41  ? 55.193  -22.301 119.904 1.00 13.41 ? 269  CYS C CB  1 
ATOM   3882  S SG  . CYS C 1 41  ? 56.289  -23.540 120.470 1.00 16.10 ? 269  CYS C SG  1 
ATOM   3883  N N   . ASP C 1 42  ? 53.812  -20.710 117.952 1.00 13.89 ? 270  ASP C N   1 
ATOM   3884  C CA  . ASP C 1 42  ? 52.832  -20.461 116.894 1.00 14.12 ? 270  ASP C CA  1 
ATOM   3885  C C   . ASP C 1 42  ? 53.446  -19.608 115.788 1.00 13.94 ? 270  ASP C C   1 
ATOM   3886  O O   . ASP C 1 42  ? 53.155  -19.832 114.609 1.00 14.09 ? 270  ASP C O   1 
ATOM   3887  C CB  . ASP C 1 42  ? 51.579  -19.775 117.475 1.00 14.34 ? 270  ASP C CB  1 
ATOM   3888  C CG  . ASP C 1 42  ? 50.443  -19.606 116.445 1.00 15.46 ? 270  ASP C CG  1 
ATOM   3889  O OD1 . ASP C 1 42  ? 50.516  -18.692 115.584 1.00 15.81 ? 270  ASP C OD1 1 
ATOM   3890  O OD2 . ASP C 1 42  ? 49.453  -20.369 116.522 1.00 16.89 ? 270  ASP C OD2 1 
ATOM   3891  N N   . LEU C 1 43  ? 54.300  -18.649 116.167 1.00 13.55 ? 271  LEU C N   1 
ATOM   3892  C CA  . LEU C 1 43  ? 54.929  -17.751 115.204 1.00 13.10 ? 271  LEU C CA  1 
ATOM   3893  C C   . LEU C 1 43  ? 55.836  -18.525 114.270 1.00 13.56 ? 271  LEU C C   1 
ATOM   3894  O O   . LEU C 1 43  ? 55.754  -18.381 113.047 1.00 13.61 ? 271  LEU C O   1 
ATOM   3895  C CB  . LEU C 1 43  ? 55.737  -16.676 115.921 1.00 12.83 ? 271  LEU C CB  1 
ATOM   3896  C CG  . LEU C 1 43  ? 56.494  -15.706 115.013 1.00 12.01 ? 271  LEU C CG  1 
ATOM   3897  C CD1 . LEU C 1 43  ? 55.587  -15.148 113.946 1.00 10.56 ? 271  LEU C CD1 1 
ATOM   3898  C CD2 . LEU C 1 43  ? 57.127  -14.590 115.805 1.00 12.08 ? 271  LEU C CD2 1 
ATOM   3899  N N   . ALA C 1 44  ? 56.702  -19.339 114.866 1.00 13.84 ? 272  ALA C N   1 
ATOM   3900  C CA  . ALA C 1 44  ? 57.630  -20.178 114.130 1.00 13.97 ? 272  ALA C CA  1 
ATOM   3901  C C   . ALA C 1 44  ? 56.873  -21.072 113.186 1.00 14.24 ? 272  ALA C C   1 
ATOM   3902  O O   . ALA C 1 44  ? 57.155  -21.094 111.990 1.00 14.51 ? 272  ALA C O   1 
ATOM   3903  C CB  . ALA C 1 44  ? 58.449  -21.027 115.088 1.00 13.93 ? 272  ALA C CB  1 
ATOM   3904  N N   . ASP C 1 45  ? 55.907  -21.808 113.723 1.00 14.52 ? 273  ASP C N   1 
ATOM   3905  C CA  . ASP C 1 45  ? 55.136  -22.750 112.910 1.00 15.03 ? 273  ASP C CA  1 
ATOM   3906  C C   . ASP C 1 45  ? 54.579  -22.109 111.633 1.00 15.50 ? 273  ASP C C   1 
ATOM   3907  O O   . ASP C 1 45  ? 54.626  -22.712 110.554 1.00 15.73 ? 273  ASP C O   1 
ATOM   3908  C CB  . ASP C 1 45  ? 54.005  -23.375 113.728 1.00 14.97 ? 273  ASP C CB  1 
ATOM   3909  C CG  . ASP C 1 45  ? 54.511  -24.363 114.761 1.00 14.56 ? 273  ASP C CG  1 
ATOM   3910  O OD1 . ASP C 1 45  ? 55.745  -24.504 114.865 1.00 13.25 ? 273  ASP C OD1 1 
ATOM   3911  O OD2 . ASP C 1 45  ? 53.682  -24.983 115.471 1.00 13.02 ? 273  ASP C OD2 1 
ATOM   3912  N N   . ARG C 1 46  ? 54.067  -20.888 111.756 1.00 15.84 ? 274  ARG C N   1 
ATOM   3913  C CA  . ARG C 1 46  ? 53.593  -20.134 110.591 1.00 16.05 ? 274  ARG C CA  1 
ATOM   3914  C C   . ARG C 1 46  ? 54.732  -19.663 109.689 1.00 15.88 ? 274  ARG C C   1 
ATOM   3915  O O   . ARG C 1 46  ? 54.589  -19.687 108.468 1.00 16.13 ? 274  ARG C O   1 
ATOM   3916  C CB  . ARG C 1 46  ? 52.738  -18.940 111.017 1.00 16.01 ? 274  ARG C CB  1 
ATOM   3917  C CG  . ARG C 1 46  ? 51.295  -19.296 111.316 1.00 16.24 ? 274  ARG C CG  1 
ATOM   3918  C CD  . ARG C 1 46  ? 50.513  -18.056 111.715 1.00 16.57 ? 274  ARG C CD  1 
ATOM   3919  N NE  . ARG C 1 46  ? 50.963  -17.538 113.013 1.00 17.51 ? 274  ARG C NE  1 
ATOM   3920  C CZ  . ARG C 1 46  ? 51.014  -16.248 113.345 1.00 17.27 ? 274  ARG C CZ  1 
ATOM   3921  N NH1 . ARG C 1 46  ? 50.661  -15.300 112.474 1.00 17.66 ? 274  ARG C NH1 1 
ATOM   3922  N NH2 . ARG C 1 46  ? 51.441  -15.907 114.556 1.00 16.66 ? 274  ARG C NH2 1 
ATOM   3923  N N   . GLU C 1 47  ? 55.839  -19.221 110.282 1.00 15.76 ? 275  GLU C N   1 
ATOM   3924  C CA  . GLU C 1 47  ? 57.007  -18.790 109.510 1.00 15.80 ? 275  GLU C CA  1 
ATOM   3925  C C   . GLU C 1 47  ? 57.573  -19.926 108.646 1.00 15.81 ? 275  GLU C C   1 
ATOM   3926  O O   . GLU C 1 47  ? 57.965  -19.708 107.497 1.00 15.69 ? 275  GLU C O   1 
ATOM   3927  C CB  . GLU C 1 47  ? 58.099  -18.245 110.431 1.00 15.92 ? 275  GLU C CB  1 
ATOM   3928  C CG  . GLU C 1 47  ? 57.874  -16.813 110.911 1.00 15.99 ? 275  GLU C CG  1 
ATOM   3929  C CD  . GLU C 1 47  ? 59.125  -16.199 111.539 1.00 16.01 ? 275  GLU C CD  1 
ATOM   3930  O OE1 . GLU C 1 47  ? 60.164  -16.048 110.848 1.00 15.89 ? 275  GLU C OE1 1 
ATOM   3931  O OE2 . GLU C 1 47  ? 59.065  -15.855 112.733 1.00 16.55 ? 275  GLU C OE2 1 
ATOM   3932  N N   . LEU C 1 48  ? 57.605  -21.137 109.202 1.00 15.80 ? 276  LEU C N   1 
ATOM   3933  C CA  . LEU C 1 48  ? 57.989  -22.330 108.444 1.00 15.67 ? 276  LEU C CA  1 
ATOM   3934  C C   . LEU C 1 48  ? 57.189  -22.500 107.158 1.00 15.67 ? 276  LEU C C   1 
ATOM   3935  O O   . LEU C 1 48  ? 57.768  -22.698 106.092 1.00 15.50 ? 276  LEU C O   1 
ATOM   3936  C CB  . LEU C 1 48  ? 57.792  -23.569 109.293 1.00 15.64 ? 276  LEU C CB  1 
ATOM   3937  C CG  . LEU C 1 48  ? 58.807  -23.745 110.411 1.00 16.55 ? 276  LEU C CG  1 
ATOM   3938  C CD1 . LEU C 1 48  ? 58.304  -24.787 111.418 1.00 17.93 ? 276  LEU C CD1 1 
ATOM   3939  C CD2 . LEU C 1 48  ? 60.171  -24.147 109.833 1.00 16.31 ? 276  LEU C CD2 1 
ATOM   3940  N N   . VAL C 1 49  ? 55.857  -22.430 107.269 1.00 15.67 ? 277  VAL C N   1 
ATOM   3941  C CA  . VAL C 1 49  ? 54.957  -22.618 106.115 1.00 15.52 ? 277  VAL C CA  1 
ATOM   3942  C C   . VAL C 1 49  ? 55.332  -21.716 104.948 1.00 15.48 ? 277  VAL C C   1 
ATOM   3943  O O   . VAL C 1 49  ? 55.329  -22.161 103.801 1.00 15.66 ? 277  VAL C O   1 
ATOM   3944  C CB  . VAL C 1 49  ? 53.466  -22.371 106.472 1.00 15.51 ? 277  VAL C CB  1 
ATOM   3945  C CG1 . VAL C 1 49  ? 52.600  -22.284 105.206 1.00 14.79 ? 277  VAL C CG1 1 
ATOM   3946  C CG2 . VAL C 1 49  ? 52.958  -23.468 107.381 1.00 15.60 ? 277  VAL C CG2 1 
ATOM   3947  N N   . VAL C 1 50  ? 55.646  -20.456 105.240 1.00 15.27 ? 278  VAL C N   1 
ATOM   3948  C CA  . VAL C 1 50  ? 56.108  -19.535 104.201 1.00 15.24 ? 278  VAL C CA  1 
ATOM   3949  C C   . VAL C 1 50  ? 57.608  -19.667 103.936 1.00 14.86 ? 278  VAL C C   1 
ATOM   3950  O O   . VAL C 1 50  ? 58.050  -19.402 102.827 1.00 14.93 ? 278  VAL C O   1 
ATOM   3951  C CB  . VAL C 1 50  ? 55.761  -18.058 104.505 1.00 15.35 ? 278  VAL C CB  1 
ATOM   3952  C CG1 . VAL C 1 50  ? 54.261  -17.906 104.775 1.00 15.21 ? 278  VAL C CG1 1 
ATOM   3953  C CG2 . VAL C 1 50  ? 56.598  -17.528 105.667 1.00 15.47 ? 278  VAL C CG2 1 
ATOM   3954  N N   . ILE C 1 51  ? 58.395  -20.062 104.928 1.00 14.50 ? 279  ILE C N   1 
ATOM   3955  C CA  . ILE C 1 51  ? 59.803  -20.338 104.651 1.00 14.59 ? 279  ILE C CA  1 
ATOM   3956  C C   . ILE C 1 51  ? 59.887  -21.489 103.648 1.00 14.59 ? 279  ILE C C   1 
ATOM   3957  O O   . ILE C 1 51  ? 60.677  -21.443 102.723 1.00 14.67 ? 279  ILE C O   1 
ATOM   3958  C CB  . ILE C 1 51  ? 60.633  -20.661 105.931 1.00 14.61 ? 279  ILE C CB  1 
ATOM   3959  C CG1 . ILE C 1 51  ? 61.092  -19.378 106.615 1.00 14.39 ? 279  ILE C CG1 1 
ATOM   3960  C CG2 . ILE C 1 51  ? 61.887  -21.470 105.596 1.00 14.31 ? 279  ILE C CG2 1 
ATOM   3961  C CD1 . ILE C 1 51  ? 61.800  -19.643 107.924 1.00 14.54 ? 279  ILE C CD1 1 
ATOM   3962  N N   . ILE C 1 52  ? 59.059  -22.510 103.828 1.00 14.70 ? 280  ILE C N   1 
ATOM   3963  C CA  . ILE C 1 52  ? 59.046  -23.658 102.928 1.00 14.71 ? 280  ILE C CA  1 
ATOM   3964  C C   . ILE C 1 52  ? 58.691  -23.216 101.519 1.00 14.84 ? 280  ILE C C   1 
ATOM   3965  O O   . ILE C 1 52  ? 59.364  -23.577 100.554 1.00 14.73 ? 280  ILE C O   1 
ATOM   3966  C CB  . ILE C 1 52  ? 58.044  -24.730 103.410 1.00 14.88 ? 280  ILE C CB  1 
ATOM   3967  C CG1 . ILE C 1 52  ? 58.611  -25.447 104.646 1.00 14.93 ? 280  ILE C CG1 1 
ATOM   3968  C CG2 . ILE C 1 52  ? 57.718  -25.723 102.286 1.00 13.71 ? 280  ILE C CG2 1 
ATOM   3969  C CD1 . ILE C 1 52  ? 57.586  -26.240 105.439 1.00 14.66 ? 280  ILE C CD1 1 
ATOM   3970  N N   . GLY C 1 53  ? 57.637  -22.415 101.416 1.00 15.08 ? 281  GLY C N   1 
ATOM   3971  C CA  . GLY C 1 53  ? 57.175  -21.896 100.130 1.00 15.27 ? 281  GLY C CA  1 
ATOM   3972  C C   . GLY C 1 53  ? 58.187  -20.991 99.461  1.00 15.31 ? 281  GLY C C   1 
ATOM   3973  O O   . GLY C 1 53  ? 58.160  -20.802 98.252  1.00 15.79 ? 281  GLY C O   1 
ATOM   3974  N N   . TRP C 1 54  ? 59.075  -20.424 100.261 1.00 15.34 ? 282  TRP C N   1 
ATOM   3975  C CA  . TRP C 1 54  ? 60.134  -19.568 99.769  1.00 15.34 ? 282  TRP C CA  1 
ATOM   3976  C C   . TRP C 1 54  ? 61.245  -20.395 99.176  1.00 15.45 ? 282  TRP C C   1 
ATOM   3977  O O   . TRP C 1 54  ? 61.841  -20.007 98.175  1.00 15.62 ? 282  TRP C O   1 
ATOM   3978  C CB  . TRP C 1 54  ? 60.662  -18.723 100.923 1.00 15.35 ? 282  TRP C CB  1 
ATOM   3979  C CG  . TRP C 1 54  ? 62.007  -18.186 100.747 1.00 15.51 ? 282  TRP C CG  1 
ATOM   3980  C CD1 . TRP C 1 54  ? 62.346  -17.032 100.113 1.00 16.09 ? 282  TRP C CD1 1 
ATOM   3981  C CD2 . TRP C 1 54  ? 63.227  -18.749 101.251 1.00 16.28 ? 282  TRP C CD2 1 
ATOM   3982  N NE1 . TRP C 1 54  ? 63.711  -16.838 100.175 1.00 16.84 ? 282  TRP C NE1 1 
ATOM   3983  C CE2 . TRP C 1 54  ? 64.277  -17.873 100.875 1.00 16.52 ? 282  TRP C CE2 1 
ATOM   3984  C CE3 . TRP C 1 54  ? 63.538  -19.908 101.978 1.00 15.76 ? 282  TRP C CE3 1 
ATOM   3985  C CZ2 . TRP C 1 54  ? 65.618  -18.114 101.208 1.00 15.88 ? 282  TRP C CZ2 1 
ATOM   3986  C CZ3 . TRP C 1 54  ? 64.872  -20.151 102.304 1.00 16.12 ? 282  TRP C CZ3 1 
ATOM   3987  C CH2 . TRP C 1 54  ? 65.898  -19.258 101.912 1.00 15.94 ? 282  TRP C CH2 1 
ATOM   3988  N N   . ALA C 1 55  ? 61.526  -21.532 99.812  1.00 15.62 ? 283  ALA C N   1 
ATOM   3989  C CA  . ALA C 1 55  ? 62.659  -22.387 99.443  1.00 15.56 ? 283  ALA C CA  1 
ATOM   3990  C C   . ALA C 1 55  ? 62.519  -22.886 98.018  1.00 15.58 ? 283  ALA C C   1 
ATOM   3991  O O   . ALA C 1 55  ? 63.510  -23.110 97.339  1.00 15.15 ? 283  ALA C O   1 
ATOM   3992  C CB  . ALA C 1 55  ? 62.781  -23.565 100.407 1.00 15.42 ? 283  ALA C CB  1 
ATOM   3993  N N   . LYS C 1 56  ? 61.273  -23.050 97.582  1.00 16.14 ? 284  LYS C N   1 
ATOM   3994  C CA  . LYS C 1 56  ? 60.966  -23.498 96.228  1.00 16.54 ? 284  LYS C CA  1 
ATOM   3995  C C   . LYS C 1 56  ? 61.470  -22.476 95.198  1.00 16.92 ? 284  LYS C C   1 
ATOM   3996  O O   . LYS C 1 56  ? 61.934  -22.857 94.117  1.00 17.08 ? 284  LYS C O   1 
ATOM   3997  C CB  . LYS C 1 56  ? 59.462  -23.733 96.074  1.00 16.49 ? 284  LYS C CB  1 
ATOM   3998  C CG  . LYS C 1 56  ? 58.866  -24.840 96.987  1.00 16.68 ? 284  LYS C CG  1 
ATOM   3999  C CD  . LYS C 1 56  ? 57.344  -25.068 96.689  1.00 16.96 ? 284  LYS C CD  1 
ATOM   4000  C CE  . LYS C 1 56  ? 56.662  -26.027 97.689  1.00 17.21 ? 284  LYS C CE  1 
ATOM   4001  N NZ  . LYS C 1 56  ? 55.208  -25.710 97.957  1.00 16.90 ? 284  LYS C NZ  1 
ATOM   4002  N N   . HIS C 1 57  ? 61.414  -21.189 95.560  1.00 17.18 ? 285  HIS C N   1 
ATOM   4003  C CA  . HIS C 1 57  ? 61.876  -20.088 94.697  1.00 17.13 ? 285  HIS C CA  1 
ATOM   4004  C C   . HIS C 1 57  ? 63.399  -20.031 94.523  1.00 16.83 ? 285  HIS C C   1 
ATOM   4005  O O   . HIS C 1 57  ? 63.884  -19.388 93.600  1.00 16.82 ? 285  HIS C O   1 
ATOM   4006  C CB  . HIS C 1 57  ? 61.353  -18.729 95.207  1.00 17.21 ? 285  HIS C CB  1 
ATOM   4007  C CG  . HIS C 1 57  ? 59.873  -18.536 95.018  1.00 18.03 ? 285  HIS C CG  1 
ATOM   4008  N ND1 . HIS C 1 57  ? 59.300  -18.310 93.782  1.00 17.90 ? 285  HIS C ND1 1 
ATOM   4009  C CD2 . HIS C 1 57  ? 58.853  -18.515 95.911  1.00 18.96 ? 285  HIS C CD2 1 
ATOM   4010  C CE1 . HIS C 1 57  ? 57.994  -18.165 93.921  1.00 18.00 ? 285  HIS C CE1 1 
ATOM   4011  N NE2 . HIS C 1 57  ? 57.696  -18.285 95.203  1.00 18.77 ? 285  HIS C NE2 1 
ATOM   4012  N N   . ILE C 1 58  ? 64.152  -20.690 95.396  1.00 16.61 ? 286  ILE C N   1 
ATOM   4013  C CA  . ILE C 1 58  ? 65.606  -20.714 95.256  1.00 16.50 ? 286  ILE C CA  1 
ATOM   4014  C C   . ILE C 1 58  ? 65.945  -21.519 94.003  1.00 16.70 ? 286  ILE C C   1 
ATOM   4015  O O   . ILE C 1 58  ? 65.461  -22.645 93.845  1.00 16.79 ? 286  ILE C O   1 
ATOM   4016  C CB  . ILE C 1 58  ? 66.297  -21.348 96.479  1.00 16.50 ? 286  ILE C CB  1 
ATOM   4017  C CG1 . ILE C 1 58  ? 66.057  -20.500 97.730  1.00 16.47 ? 286  ILE C CG1 1 
ATOM   4018  C CG2 . ILE C 1 58  ? 67.790  -21.487 96.243  1.00 16.02 ? 286  ILE C CG2 1 
ATOM   4019  C CD1 . ILE C 1 58  ? 66.435  -21.184 99.028  1.00 16.26 ? 286  ILE C CD1 1 
ATOM   4020  N N   . PRO C 1 59  ? 66.769  -20.950 93.100  1.00 16.72 ? 287  PRO C N   1 
ATOM   4021  C CA  . PRO C 1 59  ? 67.068  -21.665 91.867  1.00 16.59 ? 287  PRO C CA  1 
ATOM   4022  C C   . PRO C 1 59  ? 67.749  -22.985 92.170  1.00 16.66 ? 287  PRO C C   1 
ATOM   4023  O O   . PRO C 1 59  ? 68.654  -23.020 93.007  1.00 16.82 ? 287  PRO C O   1 
ATOM   4024  C CB  . PRO C 1 59  ? 68.033  -20.729 91.137  1.00 16.41 ? 287  PRO C CB  1 
ATOM   4025  C CG  . PRO C 1 59  ? 67.834  -19.408 91.744  1.00 16.60 ? 287  PRO C CG  1 
ATOM   4026  C CD  . PRO C 1 59  ? 67.473  -19.660 93.159  1.00 16.74 ? 287  PRO C CD  1 
ATOM   4027  N N   . GLY C 1 60  ? 67.309  -24.055 91.505  1.00 16.64 ? 288  GLY C N   1 
ATOM   4028  C CA  . GLY C 1 60  ? 67.859  -25.384 91.727  1.00 16.78 ? 288  GLY C CA  1 
ATOM   4029  C C   . GLY C 1 60  ? 67.092  -26.215 92.751  1.00 16.97 ? 288  GLY C C   1 
ATOM   4030  O O   . GLY C 1 60  ? 66.786  -27.378 92.501  1.00 17.43 ? 288  GLY C O   1 
ATOM   4031  N N   . PHE C 1 61  ? 66.767  -25.625 93.897  1.00 16.71 ? 289  PHE C N   1 
ATOM   4032  C CA  . PHE C 1 61  ? 66.137  -26.352 95.000  1.00 16.51 ? 289  PHE C CA  1 
ATOM   4033  C C   . PHE C 1 61  ? 65.001  -27.293 94.588  1.00 16.42 ? 289  PHE C C   1 
ATOM   4034  O O   . PHE C 1 61  ? 64.935  -28.417 95.068  1.00 16.44 ? 289  PHE C O   1 
ATOM   4035  C CB  . PHE C 1 61  ? 65.631  -25.357 96.047  1.00 16.35 ? 289  PHE C CB  1 
ATOM   4036  C CG  . PHE C 1 61  ? 65.075  -25.997 97.288  1.00 16.04 ? 289  PHE C CG  1 
ATOM   4037  C CD1 . PHE C 1 61  ? 65.907  -26.340 98.339  1.00 15.79 ? 289  PHE C CD1 1 
ATOM   4038  C CD2 . PHE C 1 61  ? 63.719  -26.233 97.414  1.00 15.36 ? 289  PHE C CD2 1 
ATOM   4039  C CE1 . PHE C 1 61  ? 65.391  -26.910 99.489  1.00 15.68 ? 289  PHE C CE1 1 
ATOM   4040  C CE2 . PHE C 1 61  ? 63.206  -26.796 98.564  1.00 15.13 ? 289  PHE C CE2 1 
ATOM   4041  C CZ  . PHE C 1 61  ? 64.040  -27.134 99.598  1.00 15.28 ? 289  PHE C CZ  1 
ATOM   4042  N N   . SER C 1 62  ? 64.118  -26.842 93.702  1.00 16.42 ? 290  SER C N   1 
ATOM   4043  C CA  . SER C 1 62  ? 62.961  -27.658 93.285  1.00 16.40 ? 290  SER C CA  1 
ATOM   4044  C C   . SER C 1 62  ? 63.291  -28.817 92.340  1.00 16.17 ? 290  SER C C   1 
ATOM   4045  O O   . SER C 1 62  ? 62.480  -29.738 92.190  1.00 15.99 ? 290  SER C O   1 
ATOM   4046  C CB  . SER C 1 62  ? 61.892  -26.787 92.630  1.00 16.31 ? 290  SER C CB  1 
ATOM   4047  O OG  . SER C 1 62  ? 61.276  -25.972 93.602  1.00 17.13 ? 290  SER C OG  1 
ATOM   4048  N N   . THR C 1 63  ? 64.447  -28.761 91.679  1.00 15.81 ? 291  THR C N   1 
ATOM   4049  C CA  . THR C 1 63  ? 64.854  -29.860 90.810  1.00 15.62 ? 291  THR C CA  1 
ATOM   4050  C C   . THR C 1 63  ? 65.398  -31.020 91.649  1.00 15.16 ? 291  THR C C   1 
ATOM   4051  O O   . THR C 1 63  ? 65.320  -32.169 91.225  1.00 15.46 ? 291  THR C O   1 
ATOM   4052  C CB  . THR C 1 63  ? 65.857  -29.423 89.699  1.00 15.74 ? 291  THR C CB  1 
ATOM   4053  O OG1 . THR C 1 63  ? 67.036  -28.848 90.280  1.00 16.79 ? 291  THR C OG1 1 
ATOM   4054  C CG2 . THR C 1 63  ? 65.209  -28.412 88.760  1.00 15.25 ? 291  THR C CG2 1 
ATOM   4055  N N   . LEU C 1 64  ? 65.907  -30.727 92.848  1.00 14.62 ? 292  LEU C N   1 
ATOM   4056  C CA  . LEU C 1 64  ? 66.329  -31.772 93.797  1.00 14.02 ? 292  LEU C CA  1 
ATOM   4057  C C   . LEU C 1 64  ? 65.168  -32.716 94.093  1.00 13.76 ? 292  LEU C C   1 
ATOM   4058  O O   . LEU C 1 64  ? 64.007  -32.337 93.948  1.00 13.61 ? 292  LEU C O   1 
ATOM   4059  C CB  . LEU C 1 64  ? 66.812  -31.158 95.121  1.00 13.67 ? 292  LEU C CB  1 
ATOM   4060  C CG  . LEU C 1 64  ? 68.077  -30.291 95.163  1.00 12.60 ? 292  LEU C CG  1 
ATOM   4061  C CD1 . LEU C 1 64  ? 68.211  -29.666 96.547  1.00 11.80 ? 292  LEU C CD1 1 
ATOM   4062  C CD2 . LEU C 1 64  ? 69.351  -31.066 94.808  1.00 10.71 ? 292  LEU C CD2 1 
ATOM   4063  N N   . SER C 1 65  ? 65.473  -33.935 94.522  1.00 13.48 ? 293  SER C N   1 
ATOM   4064  C CA  . SER C 1 65  ? 64.418  -34.862 94.940  1.00 13.48 ? 293  SER C CA  1 
ATOM   4065  C C   . SER C 1 65  ? 63.618  -34.283 96.113  1.00 13.73 ? 293  SER C C   1 
ATOM   4066  O O   . SER C 1 65  ? 64.121  -33.420 96.853  1.00 13.85 ? 293  SER C O   1 
ATOM   4067  C CB  . SER C 1 65  ? 64.999  -36.220 95.336  1.00 13.35 ? 293  SER C CB  1 
ATOM   4068  O OG  . SER C 1 65  ? 65.930  -36.101 96.393  1.00 12.60 ? 293  SER C OG  1 
ATOM   4069  N N   . LEU C 1 66  ? 62.374  -34.744 96.272  1.00 13.67 ? 294  LEU C N   1 
ATOM   4070  C CA  . LEU C 1 66  ? 61.561  -34.371 97.431  1.00 13.61 ? 294  LEU C CA  1 
ATOM   4071  C C   . LEU C 1 66  ? 62.281  -34.725 98.733  1.00 13.61 ? 294  LEU C C   1 
ATOM   4072  O O   . LEU C 1 66  ? 62.201  -33.982 99.707  1.00 13.94 ? 294  LEU C O   1 
ATOM   4073  C CB  . LEU C 1 66  ? 60.191  -35.047 97.400  1.00 13.70 ? 294  LEU C CB  1 
ATOM   4074  C CG  . LEU C 1 66  ? 59.083  -34.346 96.605  1.00 14.20 ? 294  LEU C CG  1 
ATOM   4075  C CD1 . LEU C 1 66  ? 57.881  -35.272 96.360  1.00 12.92 ? 294  LEU C CD1 1 
ATOM   4076  C CD2 . LEU C 1 66  ? 58.645  -33.069 97.313  1.00 14.06 ? 294  LEU C CD2 1 
ATOM   4077  N N   . ALA C 1 67  ? 62.993  -35.849 98.742  1.00 13.47 ? 295  ALA C N   1 
ATOM   4078  C CA  . ALA C 1 67  ? 63.728  -36.285 99.925  1.00 13.30 ? 295  ALA C CA  1 
ATOM   4079  C C   . ALA C 1 67  ? 64.827  -35.293 100.299 1.00 13.16 ? 295  ALA C C   1 
ATOM   4080  O O   . ALA C 1 67  ? 64.985  -34.967 101.472 1.00 13.11 ? 295  ALA C O   1 
ATOM   4081  C CB  . ALA C 1 67  ? 64.310  -37.690 99.714  1.00 13.19 ? 295  ALA C CB  1 
ATOM   4082  N N   . ASP C 1 68  ? 65.575  -34.809 99.311  1.00 13.13 ? 296  ASP C N   1 
ATOM   4083  C CA  . ASP C 1 68  ? 66.668  -33.874 99.584  1.00 13.19 ? 296  ASP C CA  1 
ATOM   4084  C C   . ASP C 1 68  ? 66.112  -32.520 99.996  1.00 13.10 ? 296  ASP C C   1 
ATOM   4085  O O   . ASP C 1 68  ? 66.638  -31.897 100.913 1.00 13.25 ? 296  ASP C O   1 
ATOM   4086  C CB  . ASP C 1 68  ? 67.650  -33.749 98.399  1.00 13.25 ? 296  ASP C CB  1 
ATOM   4087  C CG  . ASP C 1 68  ? 68.747  -34.843 98.405  1.00 13.93 ? 296  ASP C CG  1 
ATOM   4088  O OD1 . ASP C 1 68  ? 68.870  -35.577 99.414  1.00 15.26 ? 296  ASP C OD1 1 
ATOM   4089  O OD2 . ASP C 1 68  ? 69.488  -34.978 97.399  1.00 13.56 ? 296  ASP C OD2 1 
ATOM   4090  N N   . GLN C 1 69  ? 65.036  -32.076 99.347  1.00 13.09 ? 297  GLN C N   1 
ATOM   4091  C CA  . GLN C 1 69  ? 64.370  -30.822 99.738  1.00 12.77 ? 297  GLN C CA  1 
ATOM   4092  C C   . GLN C 1 69  ? 63.972  -30.889 101.198 1.00 13.02 ? 297  GLN C C   1 
ATOM   4093  O O   . GLN C 1 69  ? 64.234  -29.958 101.969 1.00 12.87 ? 297  GLN C O   1 
ATOM   4094  C CB  . GLN C 1 69  ? 63.135  -30.573 98.888  1.00 12.37 ? 297  GLN C CB  1 
ATOM   4095  C CG  . GLN C 1 69  ? 63.469  -30.246 97.464  1.00 11.74 ? 297  GLN C CG  1 
ATOM   4096  C CD  . GLN C 1 69  ? 62.269  -30.313 96.563  1.00 10.36 ? 297  GLN C CD  1 
ATOM   4097  O OE1 . GLN C 1 69  ? 61.204  -29.812 96.905  1.00 9.32  ? 297  GLN C OE1 1 
ATOM   4098  N NE2 . GLN C 1 69  ? 62.433  -30.928 95.395  1.00 9.43  ? 297  GLN C NE2 1 
ATOM   4099  N N   . MET C 1 70  ? 63.356  -32.012 101.568 1.00 13.28 ? 298  MET C N   1 
ATOM   4100  C CA  . MET C 1 70  ? 62.968  -32.269 102.947 1.00 13.57 ? 298  MET C CA  1 
ATOM   4101  C C   . MET C 1 70  ? 64.189  -32.283 103.841 1.00 13.37 ? 298  MET C C   1 
ATOM   4102  O O   . MET C 1 70  ? 64.177  -31.640 104.865 1.00 13.90 ? 298  MET C O   1 
ATOM   4103  C CB  . MET C 1 70  ? 62.202  -33.587 103.080 1.00 13.57 ? 298  MET C CB  1 
ATOM   4104  C CG  . MET C 1 70  ? 61.439  -33.735 104.402 1.00 14.19 ? 298  MET C CG  1 
ATOM   4105  S SD  . MET C 1 70  ? 60.522  -35.296 104.588 1.00 14.67 ? 298  MET C SD  1 
ATOM   4106  C CE  . MET C 1 70  ? 59.677  -35.063 106.162 1.00 13.77 ? 298  MET C CE  1 
ATOM   4107  N N   . SER C 1 71  ? 65.249  -32.979 103.447 1.00 13.33 ? 299  SER C N   1 
ATOM   4108  C CA  . SER C 1 71  ? 66.458  -33.073 104.280 1.00 13.33 ? 299  SER C CA  1 
ATOM   4109  C C   . SER C 1 71  ? 67.109  -31.718 104.567 1.00 13.56 ? 299  SER C C   1 
ATOM   4110  O O   . SER C 1 71  ? 67.457  -31.429 105.714 1.00 13.90 ? 299  SER C O   1 
ATOM   4111  C CB  . SER C 1 71  ? 67.500  -34.003 103.649 1.00 13.28 ? 299  SER C CB  1 
ATOM   4112  O OG  . SER C 1 71  ? 67.170  -35.371 103.842 1.00 13.20 ? 299  SER C OG  1 
ATOM   4113  N N   . LEU C 1 72  ? 67.279  -30.888 103.540 1.00 13.65 ? 300  LEU C N   1 
ATOM   4114  C CA  . LEU C 1 72  ? 67.983  -29.602 103.707 1.00 13.66 ? 300  LEU C CA  1 
ATOM   4115  C C   . LEU C 1 72  ? 67.197  -28.663 104.611 1.00 13.66 ? 300  LEU C C   1 
ATOM   4116  O O   . LEU C 1 72  ? 67.778  -27.932 105.391 1.00 14.03 ? 300  LEU C O   1 
ATOM   4117  C CB  . LEU C 1 72  ? 68.229  -28.910 102.358 1.00 13.73 ? 300  LEU C CB  1 
ATOM   4118  C CG  . LEU C 1 72  ? 69.030  -29.662 101.291 1.00 13.70 ? 300  LEU C CG  1 
ATOM   4119  C CD1 . LEU C 1 72  ? 69.227  -28.791 100.049 1.00 12.95 ? 300  LEU C CD1 1 
ATOM   4120  C CD2 . LEU C 1 72  ? 70.368  -30.160 101.859 1.00 13.42 ? 300  LEU C CD2 1 
ATOM   4121  N N   . LEU C 1 73  ? 65.876  -28.675 104.476 1.00 13.55 ? 301  LEU C N   1 
ATOM   4122  C CA  . LEU C 1 73  ? 64.995  -27.880 105.321 1.00 13.41 ? 301  LEU C CA  1 
ATOM   4123  C C   . LEU C 1 73  ? 65.064  -28.363 106.750 1.00 13.55 ? 301  LEU C C   1 
ATOM   4124  O O   . LEU C 1 73  ? 65.173  -27.572 107.688 1.00 13.31 ? 301  LEU C O   1 
ATOM   4125  C CB  . LEU C 1 73  ? 63.546  -28.009 104.838 1.00 13.33 ? 301  LEU C CB  1 
ATOM   4126  C CG  . LEU C 1 73  ? 63.140  -27.143 103.648 1.00 12.48 ? 301  LEU C CG  1 
ATOM   4127  C CD1 . LEU C 1 73  ? 61.832  -27.652 103.022 1.00 10.98 ? 301  LEU C CD1 1 
ATOM   4128  C CD2 . LEU C 1 73  ? 63.031  -25.687 104.096 1.00 10.16 ? 301  LEU C CD2 1 
ATOM   4129  N N   . GLN C 1 74  ? 64.989  -29.682 106.891 1.00 13.83 ? 302  GLN C N   1 
ATOM   4130  C CA  . GLN C 1 74  ? 64.941  -30.344 108.190 1.00 14.23 ? 302  GLN C CA  1 
ATOM   4131  C C   . GLN C 1 74  ? 66.185  -30.046 109.009 1.00 14.17 ? 302  GLN C C   1 
ATOM   4132  O O   . GLN C 1 74  ? 66.152  -30.150 110.234 1.00 14.20 ? 302  GLN C O   1 
ATOM   4133  C CB  . GLN C 1 74  ? 64.806  -31.851 107.996 1.00 14.43 ? 302  GLN C CB  1 
ATOM   4134  C CG  . GLN C 1 74  ? 64.019  -32.578 109.057 1.00 15.68 ? 302  GLN C CG  1 
ATOM   4135  C CD  . GLN C 1 74  ? 63.655  -33.982 108.602 1.00 17.77 ? 302  GLN C CD  1 
ATOM   4136  O OE1 . GLN C 1 74  ? 64.268  -34.520 107.672 1.00 18.29 ? 302  GLN C OE1 1 
ATOM   4137  N NE2 . GLN C 1 74  ? 62.644  -34.581 109.246 1.00 20.06 ? 302  GLN C NE2 1 
ATOM   4138  N N   . SER C 1 75  ? 67.267  -29.676 108.320 1.00 14.07 ? 303  SER C N   1 
ATOM   4139  C CA  . SER C 1 75  ? 68.533  -29.302 108.957 1.00 13.99 ? 303  SER C CA  1 
ATOM   4140  C C   . SER C 1 75  ? 68.690  -27.793 109.187 1.00 13.91 ? 303  SER C C   1 
ATOM   4141  O O   . SER C 1 75  ? 69.364  -27.385 110.122 1.00 13.81 ? 303  SER C O   1 
ATOM   4142  C CB  . SER C 1 75  ? 69.719  -29.808 108.110 1.00 14.04 ? 303  SER C CB  1 
ATOM   4143  O OG  . SER C 1 75  ? 69.872  -31.221 108.176 1.00 13.52 ? 303  SER C OG  1 
ATOM   4144  N N   . ALA C 1 76  ? 68.080  -26.972 108.333 1.00 14.20 ? 304  ALA C N   1 
ATOM   4145  C CA  . ALA C 1 76  ? 68.339  -25.513 108.311 1.00 14.25 ? 304  ALA C CA  1 
ATOM   4146  C C   . ALA C 1 76  ? 67.165  -24.618 108.747 1.00 14.17 ? 304  ALA C C   1 
ATOM   4147  O O   . ALA C 1 76  ? 67.310  -23.408 108.896 1.00 14.06 ? 304  ALA C O   1 
ATOM   4148  C CB  . ALA C 1 76  ? 68.809  -25.109 106.931 1.00 14.11 ? 304  ALA C CB  1 
ATOM   4149  N N   . TRP C 1 77  ? 65.998  -25.209 108.943 1.00 14.57 ? 305  TRP C N   1 
ATOM   4150  C CA  . TRP C 1 77  ? 64.842  -24.449 109.396 1.00 14.44 ? 305  TRP C CA  1 
ATOM   4151  C C   . TRP C 1 77  ? 65.235  -23.454 110.490 1.00 14.52 ? 305  TRP C C   1 
ATOM   4152  O O   . TRP C 1 77  ? 65.194  -22.249 110.251 1.00 14.22 ? 305  TRP C O   1 
ATOM   4153  C CB  . TRP C 1 77  ? 63.694  -25.374 109.821 1.00 14.29 ? 305  TRP C CB  1 
ATOM   4154  C CG  . TRP C 1 77  ? 63.982  -26.265 110.953 1.00 14.00 ? 305  TRP C CG  1 
ATOM   4155  C CD1 . TRP C 1 77  ? 64.836  -27.324 110.967 1.00 14.49 ? 305  TRP C CD1 1 
ATOM   4156  C CD2 . TRP C 1 77  ? 63.393  -26.205 112.249 1.00 13.95 ? 305  TRP C CD2 1 
ATOM   4157  N NE1 . TRP C 1 77  ? 64.829  -27.922 112.203 1.00 14.80 ? 305  TRP C NE1 1 
ATOM   4158  C CE2 . TRP C 1 77  ? 63.948  -27.255 113.010 1.00 14.05 ? 305  TRP C CE2 1 
ATOM   4159  C CE3 . TRP C 1 77  ? 62.437  -25.372 112.840 1.00 14.33 ? 305  TRP C CE3 1 
ATOM   4160  C CZ2 . TRP C 1 77  ? 63.599  -27.485 114.337 1.00 14.12 ? 305  TRP C CZ2 1 
ATOM   4161  C CZ3 . TRP C 1 77  ? 62.085  -25.600 114.162 1.00 14.60 ? 305  TRP C CZ3 1 
ATOM   4162  C CH2 . TRP C 1 77  ? 62.666  -26.650 114.897 1.00 14.53 ? 305  TRP C CH2 1 
ATOM   4163  N N   . MET C 1 78  ? 65.688  -23.940 111.644 1.00 14.77 ? 306  MET C N   1 
ATOM   4164  C CA  . MET C 1 78  ? 65.947  -23.050 112.782 1.00 14.92 ? 306  MET C CA  1 
ATOM   4165  C C   . MET C 1 78  ? 66.934  -21.925 112.430 1.00 15.22 ? 306  MET C C   1 
ATOM   4166  O O   . MET C 1 78  ? 66.685  -20.761 112.748 1.00 15.49 ? 306  MET C O   1 
ATOM   4167  C CB  . MET C 1 78  ? 66.451  -23.835 113.986 1.00 14.79 ? 306  MET C CB  1 
ATOM   4168  C CG  . MET C 1 78  ? 66.607  -22.996 115.247 1.00 14.73 ? 306  MET C CG  1 
ATOM   4169  S SD  . MET C 1 78  ? 65.063  -22.325 115.890 1.00 14.80 ? 306  MET C SD  1 
ATOM   4170  C CE  . MET C 1 78  ? 64.808  -23.409 117.296 1.00 13.63 ? 306  MET C CE  1 
ATOM   4171  N N   . GLU C 1 79  ? 68.042  -22.271 111.778 1.00 15.52 ? 307  GLU C N   1 
ATOM   4172  C CA  . GLU C 1 79  ? 68.996  -21.277 111.270 1.00 15.90 ? 307  GLU C CA  1 
ATOM   4173  C C   . GLU C 1 79  ? 68.255  -20.160 110.509 1.00 15.95 ? 307  GLU C C   1 
ATOM   4174  O O   . GLU C 1 79  ? 68.459  -18.972 110.780 1.00 16.10 ? 307  GLU C O   1 
ATOM   4175  C CB  . GLU C 1 79  ? 70.070  -21.931 110.355 1.00 15.92 ? 307  GLU C CB  1 
ATOM   4176  C CG  . GLU C 1 79  ? 71.115  -22.810 111.089 1.00 16.34 ? 307  GLU C CG  1 
ATOM   4177  C CD  . GLU C 1 79  ? 72.282  -23.314 110.198 1.00 16.83 ? 307  GLU C CD  1 
ATOM   4178  O OE1 . GLU C 1 79  ? 72.768  -22.589 109.303 1.00 16.83 ? 307  GLU C OE1 1 
ATOM   4179  O OE2 . GLU C 1 79  ? 72.741  -24.455 110.418 1.00 19.23 ? 307  GLU C OE2 1 
ATOM   4180  N N   . ILE C 1 80  ? 67.371  -20.535 109.586 1.00 15.82 ? 308  ILE C N   1 
ATOM   4181  C CA  . ILE C 1 80  ? 66.668  -19.530 108.772 1.00 15.71 ? 308  ILE C CA  1 
ATOM   4182  C C   . ILE C 1 80  ? 65.753  -18.620 109.621 1.00 15.89 ? 308  ILE C C   1 
ATOM   4183  O O   . ILE C 1 80  ? 65.689  -17.410 109.394 1.00 16.04 ? 308  ILE C O   1 
ATOM   4184  C CB  . ILE C 1 80  ? 65.870  -20.184 107.611 1.00 15.76 ? 308  ILE C CB  1 
ATOM   4185  C CG1 . ILE C 1 80  ? 66.835  -20.947 106.678 1.00 15.68 ? 308  ILE C CG1 1 
ATOM   4186  C CG2 . ILE C 1 80  ? 65.080  -19.117 106.844 1.00 14.48 ? 308  ILE C CG2 1 
ATOM   4187  C CD1 . ILE C 1 80  ? 66.215  -22.079 105.866 1.00 15.08 ? 308  ILE C CD1 1 
ATOM   4188  N N   . LEU C 1 81  ? 65.064  -19.207 110.600 1.00 15.91 ? 309  LEU C N   1 
ATOM   4189  C CA  . LEU C 1 81  ? 64.160  -18.462 111.472 1.00 15.92 ? 309  LEU C CA  1 
ATOM   4190  C C   . LEU C 1 81  ? 64.941  -17.467 112.294 1.00 16.31 ? 309  LEU C C   1 
ATOM   4191  O O   . LEU C 1 81  ? 64.560  -16.296 112.412 1.00 16.73 ? 309  LEU C O   1 
ATOM   4192  C CB  . LEU C 1 81  ? 63.398  -19.395 112.416 1.00 15.81 ? 309  LEU C CB  1 
ATOM   4193  C CG  . LEU C 1 81  ? 62.130  -20.064 111.878 1.00 15.44 ? 309  LEU C CG  1 
ATOM   4194  C CD1 . LEU C 1 81  ? 61.598  -21.033 112.896 1.00 14.80 ? 309  LEU C CD1 1 
ATOM   4195  C CD2 . LEU C 1 81  ? 61.066  -19.035 111.522 1.00 14.74 ? 309  LEU C CD2 1 
ATOM   4196  N N   . ILE C 1 82  ? 66.039  -17.947 112.859 1.00 16.49 ? 310  ILE C N   1 
ATOM   4197  C CA  . ILE C 1 82  ? 66.881  -17.127 113.719 1.00 16.73 ? 310  ILE C CA  1 
ATOM   4198  C C   . ILE C 1 82  ? 67.533  -16.004 112.905 1.00 16.80 ? 310  ILE C C   1 
ATOM   4199  O O   . ILE C 1 82  ? 67.615  -14.855 113.362 1.00 17.09 ? 310  ILE C O   1 
ATOM   4200  C CB  . ILE C 1 82  ? 67.931  -18.010 114.485 1.00 16.72 ? 310  ILE C CB  1 
ATOM   4201  C CG1 . ILE C 1 82  ? 67.241  -18.678 115.691 1.00 16.86 ? 310  ILE C CG1 1 
ATOM   4202  C CG2 . ILE C 1 82  ? 69.161  -17.185 114.930 1.00 16.26 ? 310  ILE C CG2 1 
ATOM   4203  C CD1 . ILE C 1 82  ? 68.030  -19.842 116.342 1.00 17.04 ? 310  ILE C CD1 1 
ATOM   4204  N N   . LEU C 1 83  ? 67.971  -16.326 111.691 1.00 16.70 ? 311  LEU C N   1 
ATOM   4205  C CA  . LEU C 1 83  ? 68.626  -15.333 110.853 1.00 16.48 ? 311  LEU C CA  1 
ATOM   4206  C C   . LEU C 1 83  ? 67.626  -14.220 110.557 1.00 16.34 ? 311  LEU C C   1 
ATOM   4207  O O   . LEU C 1 83  ? 68.005  -13.039 110.458 1.00 16.31 ? 311  LEU C O   1 
ATOM   4208  C CB  . LEU C 1 83  ? 69.145  -15.969 109.563 1.00 16.47 ? 311  LEU C CB  1 
ATOM   4209  C CG  . LEU C 1 83  ? 70.018  -15.090 108.674 1.00 16.64 ? 311  LEU C CG  1 
ATOM   4210  C CD1 . LEU C 1 83  ? 71.111  -14.427 109.487 1.00 17.11 ? 311  LEU C CD1 1 
ATOM   4211  C CD2 . LEU C 1 83  ? 70.608  -15.912 107.534 1.00 16.49 ? 311  LEU C CD2 1 
ATOM   4212  N N   . GLY C 1 84  ? 66.351  -14.611 110.441 1.00 15.81 ? 312  GLY C N   1 
ATOM   4213  C CA  . GLY C 1 84  ? 65.262  -13.668 110.241 1.00 15.47 ? 312  GLY C CA  1 
ATOM   4214  C C   . GLY C 1 84  ? 65.159  -12.666 111.382 1.00 15.13 ? 312  GLY C C   1 
ATOM   4215  O O   . GLY C 1 84  ? 65.360  -11.475 111.181 1.00 14.97 ? 312  GLY C O   1 
ATOM   4216  N N   . VAL C 1 85  ? 64.852  -13.147 112.584 1.00 14.77 ? 313  VAL C N   1 
ATOM   4217  C CA  . VAL C 1 85  ? 64.742  -12.270 113.756 1.00 14.49 ? 313  VAL C CA  1 
ATOM   4218  C C   . VAL C 1 85  ? 66.022  -11.443 113.970 1.00 14.51 ? 313  VAL C C   1 
ATOM   4219  O O   . VAL C 1 85  ? 65.960  -10.311 114.474 1.00 14.23 ? 313  VAL C O   1 
ATOM   4220  C CB  . VAL C 1 85  ? 64.394  -13.055 115.041 1.00 14.15 ? 313  VAL C CB  1 
ATOM   4221  C CG1 . VAL C 1 85  ? 65.537  -13.953 115.441 1.00 14.05 ? 313  VAL C CG1 1 
ATOM   4222  C CG2 . VAL C 1 85  ? 64.063  -12.094 116.159 1.00 13.86 ? 313  VAL C CG2 1 
ATOM   4223  N N   . VAL C 1 86  ? 67.170  -12.001 113.562 1.00 14.39 ? 314  VAL C N   1 
ATOM   4224  C CA  . VAL C 1 86  ? 68.447  -11.274 113.595 1.00 13.91 ? 314  VAL C CA  1 
ATOM   4225  C C   . VAL C 1 86  ? 68.462  -10.113 112.604 1.00 13.76 ? 314  VAL C C   1 
ATOM   4226  O O   . VAL C 1 86  ? 68.724  -8.974  112.991 1.00 13.86 ? 314  VAL C O   1 
ATOM   4227  C CB  . VAL C 1 86  ? 69.641  -12.208 113.349 1.00 13.84 ? 314  VAL C CB  1 
ATOM   4228  C CG1 . VAL C 1 86  ? 70.844  -11.439 112.833 1.00 13.55 ? 314  VAL C CG1 1 
ATOM   4229  C CG2 . VAL C 1 86  ? 69.987  -12.949 114.626 1.00 13.46 ? 314  VAL C CG2 1 
ATOM   4230  N N   . TYR C 1 87  ? 68.175  -10.375 111.335 1.00 13.55 ? 315  TYR C N   1 
ATOM   4231  C CA  . TYR C 1 87  ? 68.152  -9.274  110.371 1.00 13.51 ? 315  TYR C CA  1 
ATOM   4232  C C   . TYR C 1 87  ? 67.151  -8.201  110.795 1.00 13.36 ? 315  TYR C C   1 
ATOM   4233  O O   . TYR C 1 87  ? 67.465  -7.013  110.735 1.00 13.42 ? 315  TYR C O   1 
ATOM   4234  C CB  . TYR C 1 87  ? 67.858  -9.733  108.936 1.00 13.65 ? 315  TYR C CB  1 
ATOM   4235  C CG  . TYR C 1 87  ? 67.876  -8.573  107.969 1.00 13.76 ? 315  TYR C CG  1 
ATOM   4236  C CD1 . TYR C 1 87  ? 69.081  -7.999  107.574 1.00 13.82 ? 315  TYR C CD1 1 
ATOM   4237  C CD2 . TYR C 1 87  ? 66.690  -8.011  107.496 1.00 14.34 ? 315  TYR C CD2 1 
ATOM   4238  C CE1 . TYR C 1 87  ? 69.114  -6.916  106.723 1.00 13.44 ? 315  TYR C CE1 1 
ATOM   4239  C CE2 . TYR C 1 87  ? 66.712  -6.925  106.628 1.00 13.93 ? 315  TYR C CE2 1 
ATOM   4240  C CZ  . TYR C 1 87  ? 67.931  -6.387  106.251 1.00 13.74 ? 315  TYR C CZ  1 
ATOM   4241  O OH  . TYR C 1 87  ? 67.976  -5.314  105.401 1.00 13.94 ? 315  TYR C OH  1 
ATOM   4242  N N   . ARG C 1 88  ? 65.969  -8.624  111.244 1.00 13.17 ? 316  ARG C N   1 
ATOM   4243  C CA  . ARG C 1 88  ? 64.919  -7.695  111.687 1.00 13.22 ? 316  ARG C CA  1 
ATOM   4244  C C   . ARG C 1 88  ? 65.341  -6.853  112.885 1.00 13.08 ? 316  ARG C C   1 
ATOM   4245  O O   . ARG C 1 88  ? 64.869  -5.726  113.042 1.00 13.15 ? 316  ARG C O   1 
ATOM   4246  C CB  . ARG C 1 88  ? 63.620  -8.444  112.028 1.00 13.12 ? 316  ARG C CB  1 
ATOM   4247  C CG  . ARG C 1 88  ? 62.943  -9.115  110.837 1.00 13.51 ? 316  ARG C CG  1 
ATOM   4248  C CD  . ARG C 1 88  ? 61.511  -9.545  111.139 1.00 14.07 ? 316  ARG C CD  1 
ATOM   4249  N NE  . ARG C 1 88  ? 61.430  -10.583 112.171 1.00 14.98 ? 316  ARG C NE  1 
ATOM   4250  C CZ  . ARG C 1 88  ? 61.704  -11.873 111.980 1.00 14.99 ? 316  ARG C CZ  1 
ATOM   4251  N NH1 . ARG C 1 88  ? 62.091  -12.336 110.798 1.00 15.38 ? 316  ARG C NH1 1 
ATOM   4252  N NH2 . ARG C 1 88  ? 61.591  -12.716 112.989 1.00 15.85 ? 316  ARG C NH2 1 
ATOM   4253  N N   . SER C 1 89  ? 66.220  -7.399  113.725 1.00 13.12 ? 317  SER C N   1 
ATOM   4254  C CA  . SER C 1 89  ? 66.689  -6.701  114.922 1.00 13.22 ? 317  SER C CA  1 
ATOM   4255  C C   . SER C 1 89  ? 67.827  -5.708  114.682 1.00 13.35 ? 317  SER C C   1 
ATOM   4256  O O   . SER C 1 89  ? 68.214  -5.008  115.624 1.00 13.38 ? 317  SER C O   1 
ATOM   4257  C CB  . SER C 1 89  ? 67.175  -7.711  115.955 1.00 13.27 ? 317  SER C CB  1 
ATOM   4258  O OG  . SER C 1 89  ? 66.170  -8.644  116.288 1.00 14.31 ? 317  SER C OG  1 
ATOM   4259  N N   . LEU C 1 90  ? 68.352  -5.631  113.451 1.00 13.56 ? 318  LEU C N   1 
ATOM   4260  C CA  . LEU C 1 90  ? 69.627  -4.911  113.181 1.00 13.84 ? 318  LEU C CA  1 
ATOM   4261  C C   . LEU C 1 90  ? 69.661  -3.431  113.581 1.00 13.86 ? 318  LEU C C   1 
ATOM   4262  O O   . LEU C 1 90  ? 70.651  -2.976  114.150 1.00 14.10 ? 318  LEU C O   1 
ATOM   4263  C CB  . LEU C 1 90  ? 70.083  -5.053  111.714 1.00 13.90 ? 318  LEU C CB  1 
ATOM   4264  C CG  . LEU C 1 90  ? 70.865  -6.319  111.310 1.00 14.61 ? 318  LEU C CG  1 
ATOM   4265  C CD1 . LEU C 1 90  ? 71.324  -6.180  109.871 1.00 14.52 ? 318  LEU C CD1 1 
ATOM   4266  C CD2 . LEU C 1 90  ? 72.075  -6.624  112.217 1.00 14.28 ? 318  LEU C CD2 1 
ATOM   4267  N N   . SER C 1 91  ? 68.604  -2.677  113.303 1.00 13.75 ? 319  SER C N   1 
ATOM   4268  C CA  . SER C 1 91  ? 68.615  -1.256  113.646 1.00 13.71 ? 319  SER C CA  1 
ATOM   4269  C C   . SER C 1 91  ? 68.025  -0.973  115.037 1.00 13.71 ? 319  SER C C   1 
ATOM   4270  O O   . SER C 1 91  ? 67.624  0.160   115.318 1.00 13.46 ? 319  SER C O   1 
ATOM   4271  C CB  . SER C 1 91  ? 67.909  -0.442  112.557 1.00 13.78 ? 319  SER C CB  1 
ATOM   4272  O OG  . SER C 1 91  ? 66.630  -0.967  112.270 1.00 14.10 ? 319  SER C OG  1 
ATOM   4273  N N   . PHE C 1 92  ? 68.002  -1.996  115.901 1.00 13.76 ? 320  PHE C N   1 
ATOM   4274  C CA  . PHE C 1 92  ? 67.513  -1.874  117.281 1.00 13.91 ? 320  PHE C CA  1 
ATOM   4275  C C   . PHE C 1 92  ? 68.646  -2.128  118.258 1.00 14.04 ? 320  PHE C C   1 
ATOM   4276  O O   . PHE C 1 92  ? 69.652  -2.721  117.883 1.00 14.09 ? 320  PHE C O   1 
ATOM   4277  C CB  . PHE C 1 92  ? 66.397  -2.884  117.542 1.00 14.09 ? 320  PHE C CB  1 
ATOM   4278  C CG  . PHE C 1 92  ? 65.051  -2.462  117.018 1.00 14.25 ? 320  PHE C CG  1 
ATOM   4279  C CD1 . PHE C 1 92  ? 64.781  -2.484  115.658 1.00 14.35 ? 320  PHE C CD1 1 
ATOM   4280  C CD2 . PHE C 1 92  ? 64.045  -2.057  117.891 1.00 14.58 ? 320  PHE C CD2 1 
ATOM   4281  C CE1 . PHE C 1 92  ? 63.530  -2.100  115.174 1.00 14.31 ? 320  PHE C CE1 1 
ATOM   4282  C CE2 . PHE C 1 92  ? 62.787  -1.672  117.415 1.00 14.47 ? 320  PHE C CE2 1 
ATOM   4283  C CZ  . PHE C 1 92  ? 62.533  -1.696  116.055 1.00 14.48 ? 320  PHE C CZ  1 
ATOM   4284  N N   . GLU C 1 93  ? 68.464  -1.708  119.512 1.00 14.37 ? 321  GLU C N   1 
ATOM   4285  C CA  . GLU C 1 93  ? 69.515  -1.806  120.537 1.00 14.84 ? 321  GLU C CA  1 
ATOM   4286  C C   . GLU C 1 93  ? 69.148  -2.753  121.686 1.00 14.56 ? 321  GLU C C   1 
ATOM   4287  O O   . GLU C 1 93  ? 68.253  -2.464  122.473 1.00 14.33 ? 321  GLU C O   1 
ATOM   4288  C CB  . GLU C 1 93  ? 69.831  -0.415  121.100 1.00 15.36 ? 321  GLU C CB  1 
ATOM   4289  C CG  . GLU C 1 93  ? 70.572  0.537   120.125 1.00 17.31 ? 321  GLU C CG  1 
ATOM   4290  C CD  . GLU C 1 93  ? 72.029  0.110   119.824 1.00 19.98 ? 321  GLU C CD  1 
ATOM   4291  O OE1 . GLU C 1 93  ? 72.748  -0.305  120.771 1.00 20.70 ? 321  GLU C OE1 1 
ATOM   4292  O OE2 . GLU C 1 93  ? 72.451  0.195   118.638 1.00 21.04 ? 321  GLU C OE2 1 
ATOM   4293  N N   . ASP C 1 94  ? 69.864  -3.875  121.773 1.00 14.50 ? 322  ASP C N   1 
ATOM   4294  C CA  . ASP C 1 94  ? 69.620  -4.922  122.778 1.00 14.40 ? 322  ASP C CA  1 
ATOM   4295  C C   . ASP C 1 94  ? 68.130  -5.291  122.876 1.00 14.38 ? 322  ASP C C   1 
ATOM   4296  O O   . ASP C 1 94  ? 67.566  -5.452  123.964 1.00 14.63 ? 322  ASP C O   1 
ATOM   4297  C CB  . ASP C 1 94  ? 70.212  -4.527  124.138 1.00 14.38 ? 322  ASP C CB  1 
ATOM   4298  C CG  . ASP C 1 94  ? 71.726  -4.268  124.074 1.00 14.61 ? 322  ASP C CG  1 
ATOM   4299  O OD1 . ASP C 1 94  ? 72.389  -4.747  123.130 1.00 14.20 ? 322  ASP C OD1 1 
ATOM   4300  O OD2 . ASP C 1 94  ? 72.261  -3.580  124.972 1.00 14.93 ? 322  ASP C OD2 1 
ATOM   4301  N N   . GLU C 1 95  ? 67.513  -5.425  121.708 1.00 14.25 ? 323  GLU C N   1 
ATOM   4302  C CA  . GLU C 1 95  ? 66.123  -5.836  121.573 1.00 14.31 ? 323  GLU C CA  1 
ATOM   4303  C C   . GLU C 1 95  ? 65.994  -6.719  120.342 1.00 13.94 ? 323  GLU C C   1 
ATOM   4304  O O   . GLU C 1 95  ? 66.624  -6.448  119.309 1.00 13.80 ? 323  GLU C O   1 
ATOM   4305  C CB  . GLU C 1 95  ? 65.229  -4.619  121.368 1.00 14.47 ? 323  GLU C CB  1 
ATOM   4306  C CG  . GLU C 1 95  ? 64.787  -3.907  122.617 1.00 14.74 ? 323  GLU C CG  1 
ATOM   4307  C CD  . GLU C 1 95  ? 64.021  -2.642  122.287 1.00 15.18 ? 323  GLU C CD  1 
ATOM   4308  O OE1 . GLU C 1 95  ? 64.559  -1.808  121.518 1.00 16.63 ? 323  GLU C OE1 1 
ATOM   4309  O OE2 . GLU C 1 95  ? 62.887  -2.478  122.790 1.00 16.67 ? 323  GLU C OE2 1 
ATOM   4310  N N   . LEU C 1 96  ? 65.171  -7.759  120.439 1.00 13.65 ? 324  LEU C N   1 
ATOM   4311  C CA  . LEU C 1 96  ? 64.973  -8.678  119.319 1.00 13.45 ? 324  LEU C CA  1 
ATOM   4312  C C   . LEU C 1 96  ? 63.611  -8.447  118.683 1.00 13.36 ? 324  LEU C C   1 
ATOM   4313  O O   . LEU C 1 96  ? 62.605  -8.391  119.390 1.00 13.64 ? 324  LEU C O   1 
ATOM   4314  C CB  . LEU C 1 96  ? 65.112  -10.124 119.791 1.00 13.32 ? 324  LEU C CB  1 
ATOM   4315  C CG  . LEU C 1 96  ? 66.557  -10.534 120.099 1.00 12.96 ? 324  LEU C CG  1 
ATOM   4316  C CD1 . LEU C 1 96  ? 66.652  -11.992 120.585 1.00 11.92 ? 324  LEU C CD1 1 
ATOM   4317  C CD2 . LEU C 1 96  ? 67.404  -10.313 118.853 1.00 12.35 ? 324  LEU C CD2 1 
ATOM   4318  N N   . VAL C 1 97  ? 63.577  -8.287  117.360 1.00 13.05 ? 325  VAL C N   1 
ATOM   4319  C CA  . VAL C 1 97  ? 62.315  -8.071  116.666 1.00 13.11 ? 325  VAL C CA  1 
ATOM   4320  C C   . VAL C 1 97  ? 61.832  -9.381  116.075 1.00 12.98 ? 325  VAL C C   1 
ATOM   4321  O O   . VAL C 1 97  ? 62.103  -9.691  114.927 1.00 12.93 ? 325  VAL C O   1 
ATOM   4322  C CB  . VAL C 1 97  ? 62.414  -6.989  115.571 1.00 13.29 ? 325  VAL C CB  1 
ATOM   4323  C CG1 . VAL C 1 97  ? 61.072  -6.844  114.842 1.00 13.13 ? 325  VAL C CG1 1 
ATOM   4324  C CG2 . VAL C 1 97  ? 62.824  -5.645  116.180 1.00 13.47 ? 325  VAL C CG2 1 
ATOM   4325  N N   . TYR C 1 98  ? 61.117  -10.151 116.886 1.00 12.95 ? 326  TYR C N   1 
ATOM   4326  C CA  . TYR C 1 98  ? 60.576  -11.425 116.449 1.00 12.86 ? 326  TYR C CA  1 
ATOM   4327  C C   . TYR C 1 98  ? 59.495  -11.175 115.420 1.00 12.80 ? 326  TYR C C   1 
ATOM   4328  O O   . TYR C 1 98  ? 59.319  -11.955 114.501 1.00 13.12 ? 326  TYR C O   1 
ATOM   4329  C CB  . TYR C 1 98  ? 60.071  -12.242 117.649 1.00 13.01 ? 326  TYR C CB  1 
ATOM   4330  C CG  . TYR C 1 98  ? 61.204  -12.874 118.432 1.00 12.98 ? 326  TYR C CG  1 
ATOM   4331  C CD1 . TYR C 1 98  ? 61.889  -13.964 117.925 1.00 12.79 ? 326  TYR C CD1 1 
ATOM   4332  C CD2 . TYR C 1 98  ? 61.607  -12.368 119.657 1.00 13.86 ? 326  TYR C CD2 1 
ATOM   4333  C CE1 . TYR C 1 98  ? 62.930  -14.530 118.598 1.00 12.41 ? 326  TYR C CE1 1 
ATOM   4334  C CE2 . TYR C 1 98  ? 62.657  -12.950 120.352 1.00 13.75 ? 326  TYR C CE2 1 
ATOM   4335  C CZ  . TYR C 1 98  ? 63.312  -14.031 119.808 1.00 13.08 ? 326  TYR C CZ  1 
ATOM   4336  O OH  . TYR C 1 98  ? 64.357  -14.624 120.478 1.00 14.10 ? 326  TYR C OH  1 
ATOM   4337  N N   . ALA C 1 99  ? 58.793  -10.066 115.582 1.00 12.92 ? 327  ALA C N   1 
ATOM   4338  C CA  . ALA C 1 99  ? 57.887  -9.536  114.573 1.00 13.08 ? 327  ALA C CA  1 
ATOM   4339  C C   . ALA C 1 99  ? 57.478  -8.146  115.062 1.00 13.27 ? 327  ALA C C   1 
ATOM   4340  O O   . ALA C 1 99  ? 57.596  -7.863  116.251 1.00 13.29 ? 327  ALA C O   1 
ATOM   4341  C CB  . ALA C 1 99  ? 56.693  -10.440 114.399 1.00 12.87 ? 327  ALA C CB  1 
ATOM   4342  N N   . ASP C 1 100 ? 57.022  -7.271  114.170 1.00 13.57 ? 328  ASP C N   1 
ATOM   4343  C CA  . ASP C 1 100 ? 56.801  -5.855  114.531 1.00 13.87 ? 328  ASP C CA  1 
ATOM   4344  C C   . ASP C 1 100 ? 56.005  -5.637  115.825 1.00 13.88 ? 328  ASP C C   1 
ATOM   4345  O O   . ASP C 1 100 ? 56.262  -4.678  116.560 1.00 14.05 ? 328  ASP C O   1 
ATOM   4346  C CB  . ASP C 1 100 ? 56.125  -5.097  113.382 1.00 14.14 ? 328  ASP C CB  1 
ATOM   4347  C CG  . ASP C 1 100 ? 57.110  -4.644  112.315 1.00 15.10 ? 328  ASP C CG  1 
ATOM   4348  O OD1 . ASP C 1 100 ? 58.157  -4.055  112.671 1.00 16.88 ? 328  ASP C OD1 1 
ATOM   4349  O OD2 . ASP C 1 100 ? 56.827  -4.858  111.118 1.00 15.96 ? 328  ASP C OD2 1 
ATOM   4350  N N   . ASP C 1 101 ? 55.043  -6.523  116.090 1.00 13.86 ? 329  ASP C N   1 
ATOM   4351  C CA  . ASP C 1 101 ? 54.216  -6.456  117.299 1.00 13.64 ? 329  ASP C CA  1 
ATOM   4352  C C   . ASP C 1 101 ? 54.768  -7.263  118.465 1.00 13.70 ? 329  ASP C C   1 
ATOM   4353  O O   . ASP C 1 101 ? 54.196  -7.232  119.549 1.00 14.23 ? 329  ASP C O   1 
ATOM   4354  C CB  . ASP C 1 101 ? 52.784  -6.914  117.001 1.00 13.59 ? 329  ASP C CB  1 
ATOM   4355  C CG  . ASP C 1 101 ? 52.708  -8.354  116.529 1.00 13.41 ? 329  ASP C CG  1 
ATOM   4356  O OD1 . ASP C 1 101 ? 53.719  -8.874  116.005 1.00 13.37 ? 329  ASP C OD1 1 
ATOM   4357  O OD2 . ASP C 1 101 ? 51.628  -8.965  116.670 1.00 12.83 ? 329  ASP C OD2 1 
ATOM   4358  N N   . TYR C 1 102 ? 55.870  -7.978  118.258 1.00 13.77 ? 330  TYR C N   1 
ATOM   4359  C CA  . TYR C 1 102 ? 56.483  -8.758  119.332 1.00 13.89 ? 330  TYR C CA  1 
ATOM   4360  C C   . TYR C 1 102 ? 57.988  -8.541  119.444 1.00 13.91 ? 330  TYR C C   1 
ATOM   4361  O O   . TYR C 1 102 ? 58.774  -9.230  118.794 1.00 13.82 ? 330  TYR C O   1 
ATOM   4362  C CB  . TYR C 1 102 ? 56.184  -10.239 119.139 1.00 13.96 ? 330  TYR C CB  1 
ATOM   4363  C CG  . TYR C 1 102 ? 56.282  -11.015 120.425 1.00 14.10 ? 330  TYR C CG  1 
ATOM   4364  C CD1 . TYR C 1 102 ? 55.340  -10.825 121.435 1.00 13.30 ? 330  TYR C CD1 1 
ATOM   4365  C CD2 . TYR C 1 102 ? 57.307  -11.926 120.639 1.00 14.01 ? 330  TYR C CD2 1 
ATOM   4366  C CE1 . TYR C 1 102 ? 55.409  -11.518 122.612 1.00 13.38 ? 330  TYR C CE1 1 
ATOM   4367  C CE2 . TYR C 1 102 ? 57.387  -12.631 121.826 1.00 14.26 ? 330  TYR C CE2 1 
ATOM   4368  C CZ  . TYR C 1 102 ? 56.429  -12.424 122.807 1.00 14.41 ? 330  TYR C CZ  1 
ATOM   4369  O OH  . TYR C 1 102 ? 56.495  -13.106 123.999 1.00 14.72 ? 330  TYR C OH  1 
ATOM   4370  N N   . ILE C 1 103 ? 58.377  -7.589  120.291 1.00 14.06 ? 331  ILE C N   1 
ATOM   4371  C CA  . ILE C 1 103 ? 59.776  -7.188  120.431 1.00 14.31 ? 331  ILE C CA  1 
ATOM   4372  C C   . ILE C 1 103 ? 60.242  -7.452  121.857 1.00 14.96 ? 331  ILE C C   1 
ATOM   4373  O O   . ILE C 1 103 ? 59.650  -6.925  122.794 1.00 15.57 ? 331  ILE C O   1 
ATOM   4374  C CB  . ILE C 1 103 ? 59.955  -5.686  120.112 1.00 14.24 ? 331  ILE C CB  1 
ATOM   4375  C CG1 . ILE C 1 103 ? 59.475  -5.370  118.683 1.00 13.83 ? 331  ILE C CG1 1 
ATOM   4376  C CG2 . ILE C 1 103 ? 61.405  -5.283  120.307 1.00 14.10 ? 331  ILE C CG2 1 
ATOM   4377  C CD1 . ILE C 1 103 ? 59.427  -3.897  118.340 1.00 13.45 ? 331  ILE C CD1 1 
ATOM   4378  N N   . MET C 1 104 ? 61.295  -8.251  122.031 1.00 15.53 ? 332  MET C N   1 
ATOM   4379  C CA  . MET C 1 104 ? 61.765  -8.633  123.382 1.00 16.11 ? 332  MET C CA  1 
ATOM   4380  C C   . MET C 1 104 ? 63.022  -7.884  123.858 1.00 16.17 ? 332  MET C C   1 
ATOM   4381  O O   . MET C 1 104 ? 64.102  -8.011  123.279 1.00 16.06 ? 332  MET C O   1 
ATOM   4382  C CB  . MET C 1 104 ? 62.024  -10.144 123.456 1.00 16.27 ? 332  MET C CB  1 
ATOM   4383  C CG  . MET C 1 104 ? 60.781  -11.003 123.271 1.00 16.87 ? 332  MET C CG  1 
ATOM   4384  S SD  . MET C 1 104 ? 61.063  -12.754 123.622 1.00 16.92 ? 332  MET C SD  1 
ATOM   4385  C CE  . MET C 1 104 ? 61.038  -12.731 125.406 1.00 16.22 ? 332  MET C CE  1 
ATOM   4386  N N   . ASP C 1 105 ? 62.860  -7.115  124.931 1.00 16.64 ? 333  ASP C N   1 
ATOM   4387  C CA  . ASP C 1 105 ? 63.979  -6.466  125.621 1.00 17.02 ? 333  ASP C CA  1 
ATOM   4388  C C   . ASP C 1 105 ? 64.558  -7.419  126.667 1.00 17.15 ? 333  ASP C C   1 
ATOM   4389  O O   . ASP C 1 105 ? 64.092  -8.550  126.810 1.00 16.92 ? 333  ASP C O   1 
ATOM   4390  C CB  . ASP C 1 105 ? 63.523  -5.143  126.262 1.00 17.09 ? 333  ASP C CB  1 
ATOM   4391  C CG  . ASP C 1 105 ? 62.384  -5.326  127.265 1.00 17.81 ? 333  ASP C CG  1 
ATOM   4392  O OD1 . ASP C 1 105 ? 62.608  -5.931  128.334 1.00 19.51 ? 333  ASP C OD1 1 
ATOM   4393  O OD2 . ASP C 1 105 ? 61.266  -4.843  126.996 1.00 18.30 ? 333  ASP C OD2 1 
ATOM   4394  N N   . GLU C 1 106 ? 65.572  -6.971  127.396 1.00 17.56 ? 334  GLU C N   1 
ATOM   4395  C CA  . GLU C 1 106 ? 66.169  -7.807  128.441 1.00 18.07 ? 334  GLU C CA  1 
ATOM   4396  C C   . GLU C 1 106 ? 65.095  -8.345  129.405 1.00 18.02 ? 334  GLU C C   1 
ATOM   4397  O O   . GLU C 1 106 ? 65.020  -9.557  129.630 1.00 18.11 ? 334  GLU C O   1 
ATOM   4398  C CB  . GLU C 1 106 ? 67.267  -7.043  129.218 1.00 18.28 ? 334  GLU C CB  1 
ATOM   4399  C CG  . GLU C 1 106 ? 68.436  -7.927  129.709 1.00 18.67 ? 334  GLU C CG  1 
ATOM   4400  C CD  . GLU C 1 106 ? 69.538  -7.134  130.417 1.00 18.66 ? 334  GLU C CD  1 
ATOM   4401  O OE1 . GLU C 1 106 ? 69.217  -6.420  131.395 1.00 18.85 ? 334  GLU C OE1 1 
ATOM   4402  O OE2 . GLU C 1 106 ? 70.719  -7.239  130.002 1.00 18.70 ? 334  GLU C OE2 1 
ATOM   4403  N N   . ASP C 1 107 ? 64.261  -7.451  129.940 1.00 17.93 ? 335  ASP C N   1 
ATOM   4404  C CA  . ASP C 1 107 ? 63.291  -7.811  130.989 1.00 17.98 ? 335  ASP C CA  1 
ATOM   4405  C C   . ASP C 1 107 ? 62.325  -8.927  130.572 1.00 17.92 ? 335  ASP C C   1 
ATOM   4406  O O   . ASP C 1 107 ? 62.014  -9.809  131.369 1.00 17.78 ? 335  ASP C O   1 
ATOM   4407  C CB  . ASP C 1 107 ? 62.480  -6.581  131.447 1.00 18.10 ? 335  ASP C CB  1 
ATOM   4408  C CG  . ASP C 1 107 ? 63.343  -5.482  132.082 1.00 18.19 ? 335  ASP C CG  1 
ATOM   4409  O OD1 . ASP C 1 107 ? 64.498  -5.752  132.488 1.00 17.95 ? 335  ASP C OD1 1 
ATOM   4410  O OD2 . ASP C 1 107 ? 62.843  -4.338  132.182 1.00 17.85 ? 335  ASP C OD2 1 
ATOM   4411  N N   . GLN C 1 108 ? 61.850  -8.877  129.331 1.00 18.04 ? 336  GLN C N   1 
ATOM   4412  C CA  . GLN C 1 108 ? 60.944  -9.903  128.800 1.00 18.17 ? 336  GLN C CA  1 
ATOM   4413  C C   . GLN C 1 108 ? 61.654  -11.222 128.512 1.00 18.27 ? 336  GLN C C   1 
ATOM   4414  O O   . GLN C 1 108 ? 61.073  -12.290 128.691 1.00 18.44 ? 336  GLN C O   1 
ATOM   4415  C CB  . GLN C 1 108 ? 60.234  -9.403  127.542 1.00 18.12 ? 336  GLN C CB  1 
ATOM   4416  C CG  . GLN C 1 108 ? 58.989  -8.595  127.853 1.00 18.47 ? 336  GLN C CG  1 
ATOM   4417  C CD  . GLN C 1 108 ? 58.578  -7.649  126.736 1.00 18.89 ? 336  GLN C CD  1 
ATOM   4418  O OE1 . GLN C 1 108 ? 58.947  -7.825  125.569 1.00 18.08 ? 336  GLN C OE1 1 
ATOM   4419  N NE2 . GLN C 1 108 ? 57.792  -6.638  127.094 1.00 19.25 ? 336  GLN C NE2 1 
ATOM   4420  N N   . SER C 1 109 ? 62.901  -11.150 128.057 1.00 18.35 ? 337  SER C N   1 
ATOM   4421  C CA  . SER C 1 109 ? 63.725  -12.345 127.915 1.00 18.47 ? 337  SER C CA  1 
ATOM   4422  C C   . SER C 1 109 ? 63.917  -13.025 129.274 1.00 18.66 ? 337  SER C C   1 
ATOM   4423  O O   . SER C 1 109 ? 63.840  -14.248 129.373 1.00 18.74 ? 337  SER C O   1 
ATOM   4424  C CB  . SER C 1 109 ? 65.088  -12.004 127.305 1.00 18.55 ? 337  SER C CB  1 
ATOM   4425  O OG  . SER C 1 109 ? 64.971  -11.520 125.974 1.00 18.75 ? 337  SER C OG  1 
ATOM   4426  N N   . LYS C 1 110 ? 64.171  -12.228 130.314 1.00 18.79 ? 338  LYS C N   1 
ATOM   4427  C CA  . LYS C 1 110 ? 64.238  -12.746 131.676 1.00 18.95 ? 338  LYS C CA  1 
ATOM   4428  C C   . LYS C 1 110 ? 62.931  -13.446 132.030 1.00 19.27 ? 338  LYS C C   1 
ATOM   4429  O O   . LYS C 1 110 ? 62.941  -14.558 132.553 1.00 19.60 ? 338  LYS C O   1 
ATOM   4430  C CB  . LYS C 1 110 ? 64.504  -11.632 132.705 1.00 18.94 ? 338  LYS C CB  1 
ATOM   4431  C CG  . LYS C 1 110 ? 65.890  -11.011 132.641 1.00 18.89 ? 338  LYS C CG  1 
ATOM   4432  C CD  . LYS C 1 110 ? 66.391  -10.500 134.008 1.00 18.80 ? 338  LYS C CD  1 
ATOM   4433  C CE  . LYS C 1 110 ? 67.922  -10.310 133.995 1.00 18.81 ? 338  LYS C CE  1 
ATOM   4434  N NZ  . LYS C 1 110 ? 68.526  -9.986  135.313 1.00 18.46 ? 338  LYS C NZ  1 
ATOM   4435  N N   . LEU C 1 111 ? 61.804  -12.796 131.750 1.00 19.39 ? 339  LEU C N   1 
ATOM   4436  C CA  . LEU C 1 111 ? 60.507  -13.354 132.121 1.00 19.53 ? 339  LEU C CA  1 
ATOM   4437  C C   . LEU C 1 111 ? 60.227  -14.654 131.376 1.00 19.43 ? 339  LEU C C   1 
ATOM   4438  O O   . LEU C 1 111 ? 59.554  -15.527 131.908 1.00 19.76 ? 339  LEU C O   1 
ATOM   4439  C CB  . LEU C 1 111 ? 59.361  -12.352 131.885 1.00 19.66 ? 339  LEU C CB  1 
ATOM   4440  C CG  . LEU C 1 111 ? 59.322  -11.030 132.684 1.00 20.21 ? 339  LEU C CG  1 
ATOM   4441  C CD1 . LEU C 1 111 ? 57.907  -10.440 132.650 1.00 20.21 ? 339  LEU C CD1 1 
ATOM   4442  C CD2 . LEU C 1 111 ? 59.805  -11.159 134.139 1.00 19.85 ? 339  LEU C CD2 1 
ATOM   4443  N N   . ALA C 1 112 ? 60.757  -14.790 130.162 1.00 19.18 ? 340  ALA C N   1 
ATOM   4444  C CA  . ALA C 1 112 ? 60.463  -15.953 129.320 1.00 19.09 ? 340  ALA C CA  1 
ATOM   4445  C C   . ALA C 1 112 ? 61.408  -17.140 129.535 1.00 19.09 ? 340  ALA C C   1 
ATOM   4446  O O   . ALA C 1 112 ? 61.127  -18.248 129.060 1.00 19.06 ? 340  ALA C O   1 
ATOM   4447  C CB  . ALA C 1 112 ? 60.468  -15.548 127.854 1.00 18.97 ? 340  ALA C CB  1 
ATOM   4448  N N   . GLY C 1 113 ? 62.520  -16.906 130.237 1.00 19.10 ? 341  GLY C N   1 
ATOM   4449  C CA  . GLY C 1 113 ? 63.578  -17.915 130.412 1.00 19.01 ? 341  GLY C CA  1 
ATOM   4450  C C   . GLY C 1 113 ? 64.510  -18.020 129.217 1.00 18.96 ? 341  GLY C C   1 
ATOM   4451  O O   . GLY C 1 113 ? 65.336  -18.929 129.145 1.00 19.15 ? 341  GLY C O   1 
ATOM   4452  N N   . LEU C 1 114 ? 64.395  -17.075 128.288 1.00 18.82 ? 342  LEU C N   1 
ATOM   4453  C CA  . LEU C 1 114 ? 65.168  -17.098 127.059 1.00 18.83 ? 342  LEU C CA  1 
ATOM   4454  C C   . LEU C 1 114 ? 66.354  -16.135 127.118 1.00 18.92 ? 342  LEU C C   1 
ATOM   4455  O O   . LEU C 1 114 ? 66.891  -15.754 126.083 1.00 19.17 ? 342  LEU C O   1 
ATOM   4456  C CB  . LEU C 1 114 ? 64.269  -16.723 125.880 1.00 18.82 ? 342  LEU C CB  1 
ATOM   4457  C CG  . LEU C 1 114 ? 63.042  -17.607 125.637 1.00 18.87 ? 342  LEU C CG  1 
ATOM   4458  C CD1 . LEU C 1 114 ? 62.059  -16.923 124.695 1.00 18.10 ? 342  LEU C CD1 1 
ATOM   4459  C CD2 . LEU C 1 114 ? 63.461  -18.966 125.091 1.00 18.85 ? 342  LEU C CD2 1 
ATOM   4460  N N   . LEU C 1 115 ? 66.779  -15.756 128.319 1.00 18.81 ? 343  LEU C N   1 
ATOM   4461  C CA  . LEU C 1 115 ? 67.808  -14.738 128.467 1.00 18.63 ? 343  LEU C CA  1 
ATOM   4462  C C   . LEU C 1 115 ? 69.125  -15.114 127.789 1.00 18.53 ? 343  LEU C C   1 
ATOM   4463  O O   . LEU C 1 115 ? 69.712  -14.291 127.093 1.00 18.37 ? 343  LEU C O   1 
ATOM   4464  C CB  . LEU C 1 115 ? 68.044  -14.439 129.942 1.00 18.51 ? 343  LEU C CB  1 
ATOM   4465  C CG  . LEU C 1 115 ? 69.059  -13.338 130.257 1.00 18.89 ? 343  LEU C CG  1 
ATOM   4466  C CD1 . LEU C 1 115 ? 68.885  -12.103 129.378 1.00 18.90 ? 343  LEU C CD1 1 
ATOM   4467  C CD2 . LEU C 1 115 ? 68.961  -12.963 131.730 1.00 18.85 ? 343  LEU C CD2 1 
ATOM   4468  N N   . ASP C 1 116 ? 69.581  -16.349 127.993 1.00 18.47 ? 344  ASP C N   1 
ATOM   4469  C CA  . ASP C 1 116 ? 70.878  -16.788 127.453 1.00 18.45 ? 344  ASP C CA  1 
ATOM   4470  C C   . ASP C 1 116 ? 70.792  -17.105 125.969 1.00 17.80 ? 344  ASP C C   1 
ATOM   4471  O O   . ASP C 1 116 ? 71.750  -16.891 125.220 1.00 18.12 ? 344  ASP C O   1 
ATOM   4472  C CB  . ASP C 1 116 ? 71.425  -17.992 128.230 1.00 18.71 ? 344  ASP C CB  1 
ATOM   4473  C CG  . ASP C 1 116 ? 72.029  -17.589 129.577 1.00 20.74 ? 344  ASP C CG  1 
ATOM   4474  O OD1 . ASP C 1 116 ? 71.466  -16.675 130.231 1.00 22.89 ? 344  ASP C OD1 1 
ATOM   4475  O OD2 . ASP C 1 116 ? 73.069  -18.169 129.982 1.00 23.27 ? 344  ASP C OD2 1 
ATOM   4476  N N   . LEU C 1 117 ? 69.640  -17.613 125.552 1.00 16.92 ? 345  LEU C N   1 
ATOM   4477  C CA  . LEU C 1 117 ? 69.383  -17.883 124.151 1.00 16.14 ? 345  LEU C CA  1 
ATOM   4478  C C   . LEU C 1 117 ? 69.271  -16.557 123.388 1.00 15.88 ? 345  LEU C C   1 
ATOM   4479  O O   . LEU C 1 117 ? 69.915  -16.360 122.362 1.00 15.90 ? 345  LEU C O   1 
ATOM   4480  C CB  . LEU C 1 117 ? 68.103  -18.713 124.023 1.00 15.97 ? 345  LEU C CB  1 
ATOM   4481  C CG  . LEU C 1 117 ? 67.688  -19.229 122.652 1.00 15.59 ? 345  LEU C CG  1 
ATOM   4482  C CD1 . LEU C 1 117 ? 68.802  -20.043 122.026 1.00 14.74 ? 345  LEU C CD1 1 
ATOM   4483  C CD2 . LEU C 1 117 ? 66.405  -20.050 122.771 1.00 15.65 ? 345  LEU C CD2 1 
ATOM   4484  N N   . ASN C 1 118 ? 68.472  -15.636 123.910 1.00 15.60 ? 346  ASN C N   1 
ATOM   4485  C CA  . ASN C 1 118 ? 68.303  -14.336 123.270 1.00 15.32 ? 346  ASN C CA  1 
ATOM   4486  C C   . ASN C 1 118 ? 69.595  -13.537 123.274 1.00 15.14 ? 346  ASN C C   1 
ATOM   4487  O O   . ASN C 1 118 ? 69.867  -12.834 122.307 1.00 15.27 ? 346  ASN C O   1 
ATOM   4488  C CB  . ASN C 1 118 ? 67.171  -13.527 123.920 1.00 15.49 ? 346  ASN C CB  1 
ATOM   4489  C CG  . ASN C 1 118 ? 65.773  -13.968 123.456 1.00 15.54 ? 346  ASN C CG  1 
ATOM   4490  O OD1 . ASN C 1 118 ? 65.628  -14.872 122.641 1.00 16.27 ? 346  ASN C OD1 1 
ATOM   4491  N ND2 . ASN C 1 118 ? 64.744  -13.303 123.969 1.00 15.16 ? 346  ASN C ND2 1 
ATOM   4492  N N   . ASN C 1 119 ? 70.391  -13.644 124.343 1.00 14.97 ? 347  ASN C N   1 
ATOM   4493  C CA  . ASN C 1 119 ? 71.739  -13.033 124.369 1.00 14.72 ? 347  ASN C CA  1 
ATOM   4494  C C   . ASN C 1 119 ? 72.633  -13.646 123.309 1.00 14.67 ? 347  ASN C C   1 
ATOM   4495  O O   . ASN C 1 119 ? 73.366  -12.926 122.637 1.00 14.85 ? 347  ASN C O   1 
ATOM   4496  C CB  . ASN C 1 119 ? 72.426  -13.163 125.737 1.00 14.58 ? 347  ASN C CB  1 
ATOM   4497  C CG  . ASN C 1 119 ? 72.030  -12.055 126.720 1.00 14.65 ? 347  ASN C CG  1 
ATOM   4498  O OD1 . ASN C 1 119 ? 71.301  -11.110 126.389 1.00 13.60 ? 347  ASN C OD1 1 
ATOM   4499  N ND2 . ASN C 1 119 ? 72.524  -12.175 127.944 1.00 14.57 ? 347  ASN C ND2 1 
ATOM   4500  N N   . ALA C 1 120 ? 72.568  -14.967 123.155 1.00 14.61 ? 348  ALA C N   1 
ATOM   4501  C CA  . ALA C 1 120 ? 73.312  -15.651 122.096 1.00 14.82 ? 348  ALA C CA  1 
ATOM   4502  C C   . ALA C 1 120 ? 72.936  -15.096 120.704 1.00 15.10 ? 348  ALA C C   1 
ATOM   4503  O O   . ALA C 1 120 ? 73.808  -14.816 119.877 1.00 15.10 ? 348  ALA C O   1 
ATOM   4504  C CB  . ALA C 1 120 ? 73.077  -17.160 122.167 1.00 14.59 ? 348  ALA C CB  1 
ATOM   4505  N N   . ILE C 1 121 ? 71.639  -14.911 120.469 1.00 15.18 ? 349  ILE C N   1 
ATOM   4506  C CA  . ILE C 1 121 ? 71.152  -14.325 119.223 1.00 15.32 ? 349  ILE C CA  1 
ATOM   4507  C C   . ILE C 1 121 ? 71.622  -12.870 119.066 1.00 15.46 ? 349  ILE C C   1 
ATOM   4508  O O   . ILE C 1 121 ? 71.921  -12.413 117.955 1.00 15.37 ? 349  ILE C O   1 
ATOM   4509  C CB  . ILE C 1 121 ? 69.619  -14.372 119.163 1.00 15.38 ? 349  ILE C CB  1 
ATOM   4510  C CG1 . ILE C 1 121 ? 69.135  -15.823 119.050 1.00 15.64 ? 349  ILE C CG1 1 
ATOM   4511  C CG2 . ILE C 1 121 ? 69.078  -13.522 117.997 1.00 14.95 ? 349  ILE C CG2 1 
ATOM   4512  C CD1 . ILE C 1 121 ? 67.635  -16.002 119.391 1.00 15.93 ? 349  ILE C CD1 1 
ATOM   4513  N N   . LEU C 1 122 ? 71.682  -12.145 120.181 1.00 15.53 ? 350  LEU C N   1 
ATOM   4514  C CA  . LEU C 1 122 ? 72.171  -10.763 120.175 1.00 15.52 ? 350  LEU C CA  1 
ATOM   4515  C C   . LEU C 1 122 ? 73.624  -10.708 119.753 1.00 15.73 ? 350  LEU C C   1 
ATOM   4516  O O   . LEU C 1 122 ? 74.054  -9.724  119.155 1.00 15.68 ? 350  LEU C O   1 
ATOM   4517  C CB  . LEU C 1 122 ? 72.011  -10.103 121.551 1.00 15.38 ? 350  LEU C CB  1 
ATOM   4518  C CG  . LEU C 1 122 ? 70.656  -9.461  121.841 1.00 14.88 ? 350  LEU C CG  1 
ATOM   4519  C CD1 . LEU C 1 122 ? 70.512  -9.126  123.334 1.00 14.91 ? 350  LEU C CD1 1 
ATOM   4520  C CD2 . LEU C 1 122 ? 70.487  -8.221  120.980 1.00 14.24 ? 350  LEU C CD2 1 
ATOM   4521  N N   . GLN C 1 123 ? 74.374  -11.758 120.074 1.00 15.98 ? 351  GLN C N   1 
ATOM   4522  C CA  . GLN C 1 123 ? 75.770  -11.836 119.679 1.00 16.51 ? 351  GLN C CA  1 
ATOM   4523  C C   . GLN C 1 123 ? 75.832  -11.811 118.152 1.00 16.37 ? 351  GLN C C   1 
ATOM   4524  O O   . GLN C 1 123 ? 76.713  -11.184 117.577 1.00 16.57 ? 351  GLN C O   1 
ATOM   4525  C CB  . GLN C 1 123 ? 76.452  -13.104 120.256 1.00 16.79 ? 351  GLN C CB  1 
ATOM   4526  C CG  . GLN C 1 123 ? 78.011  -13.031 120.342 1.00 17.37 ? 351  GLN C CG  1 
ATOM   4527  C CD  . GLN C 1 123 ? 78.693  -14.361 120.729 1.00 17.41 ? 351  GLN C CD  1 
ATOM   4528  O OE1 . GLN C 1 123 ? 78.050  -15.410 120.812 1.00 18.93 ? 351  GLN C OE1 1 
ATOM   4529  N NE2 . GLN C 1 123 ? 80.005  -14.308 120.962 1.00 17.86 ? 351  GLN C NE2 1 
ATOM   4530  N N   . LEU C 1 124 ? 74.878  -12.480 117.506 1.00 16.33 ? 352  LEU C N   1 
ATOM   4531  C CA  . LEU C 1 124 ? 74.780  -12.506 116.042 1.00 16.12 ? 352  LEU C CA  1 
ATOM   4532  C C   . LEU C 1 124 ? 74.447  -11.148 115.473 1.00 15.73 ? 352  LEU C C   1 
ATOM   4533  O O   . LEU C 1 124 ? 74.935  -10.785 114.407 1.00 15.40 ? 352  LEU C O   1 
ATOM   4534  C CB  . LEU C 1 124 ? 73.705  -13.497 115.584 1.00 16.39 ? 352  LEU C CB  1 
ATOM   4535  C CG  . LEU C 1 124 ? 74.205  -14.848 115.098 1.00 16.93 ? 352  LEU C CG  1 
ATOM   4536  C CD1 . LEU C 1 124 ? 73.094  -15.892 115.185 1.00 16.93 ? 352  LEU C CD1 1 
ATOM   4537  C CD2 . LEU C 1 124 ? 74.743  -14.700 113.670 1.00 17.37 ? 352  LEU C CD2 1 
ATOM   4538  N N   . VAL C 1 125 ? 73.584  -10.416 116.170 1.00 15.70 ? 353  VAL C N   1 
ATOM   4539  C CA  . VAL C 1 125 ? 73.243  -9.060  115.756 1.00 15.70 ? 353  VAL C CA  1 
ATOM   4540  C C   . VAL C 1 125 ? 74.501  -8.200  115.857 1.00 15.89 ? 353  VAL C C   1 
ATOM   4541  O O   . VAL C 1 125 ? 74.915  -7.595  114.874 1.00 15.91 ? 353  VAL C O   1 
ATOM   4542  C CB  . VAL C 1 125 ? 72.080  -8.441  116.582 1.00 15.51 ? 353  VAL C CB  1 
ATOM   4543  C CG1 . VAL C 1 125 ? 71.792  -7.033  116.111 1.00 15.17 ? 353  VAL C CG1 1 
ATOM   4544  C CG2 . VAL C 1 125 ? 70.822  -9.279  116.464 1.00 14.81 ? 353  VAL C CG2 1 
ATOM   4545  N N   . LYS C 1 126 ? 75.136  -8.183  117.024 1.00 16.20 ? 354  LYS C N   1 
ATOM   4546  C CA  . LYS C 1 126 ? 76.348  -7.375  117.218 1.00 16.52 ? 354  LYS C CA  1 
ATOM   4547  C C   . LYS C 1 126 ? 77.277  -7.499  116.016 1.00 16.52 ? 354  LYS C C   1 
ATOM   4548  O O   . LYS C 1 126 ? 77.665  -6.497  115.416 1.00 16.45 ? 354  LYS C O   1 
ATOM   4549  C CB  . LYS C 1 126 ? 77.086  -7.771  118.510 1.00 16.64 ? 354  LYS C CB  1 
ATOM   4550  C CG  . LYS C 1 126 ? 78.214  -6.808  118.943 1.00 16.73 ? 354  LYS C CG  1 
ATOM   4551  C CD  . LYS C 1 126 ? 78.758  -7.145  120.349 1.00 16.91 ? 354  LYS C CD  1 
ATOM   4552  C CE  . LYS C 1 126 ? 80.289  -6.992  120.467 1.00 17.29 ? 354  LYS C CE  1 
ATOM   4553  N NZ  . LYS C 1 126 ? 80.741  -5.602  120.763 1.00 17.59 ? 354  LYS C NZ  1 
ATOM   4554  N N   . LYS C 1 127 ? 77.591  -8.732  115.643 1.00 16.80 ? 355  LYS C N   1 
ATOM   4555  C CA  . LYS C 1 127 ? 78.535  -8.979  114.559 1.00 17.24 ? 355  LYS C CA  1 
ATOM   4556  C C   . LYS C 1 127 ? 78.065  -8.358  113.240 1.00 17.07 ? 355  LYS C C   1 
ATOM   4557  O O   . LYS C 1 127 ? 78.786  -7.547  112.653 1.00 17.34 ? 355  LYS C O   1 
ATOM   4558  C CB  . LYS C 1 127 ? 78.820  -10.479 114.388 1.00 17.23 ? 355  LYS C CB  1 
ATOM   4559  C CG  . LYS C 1 127 ? 80.193  -10.752 113.734 1.00 18.20 ? 355  LYS C CG  1 
ATOM   4560  C CD  . LYS C 1 127 ? 80.419  -12.241 113.395 1.00 18.35 ? 355  LYS C CD  1 
ATOM   4561  C CE  . LYS C 1 127 ? 80.789  -13.095 114.613 1.00 18.76 ? 355  LYS C CE  1 
ATOM   4562  N NZ  . LYS C 1 127 ? 81.007  -14.530 114.233 1.00 19.34 ? 355  LYS C NZ  1 
ATOM   4563  N N   . TYR C 1 128 ? 76.866  -8.723  112.783 1.00 16.87 ? 356  TYR C N   1 
ATOM   4564  C CA  . TYR C 1 128 ? 76.346  -8.199  111.513 1.00 16.91 ? 356  TYR C CA  1 
ATOM   4565  C C   . TYR C 1 128 ? 76.173  -6.659  111.514 1.00 17.22 ? 356  TYR C C   1 
ATOM   4566  O O   . TYR C 1 128 ? 76.366  -6.003  110.480 1.00 17.47 ? 356  TYR C O   1 
ATOM   4567  C CB  . TYR C 1 128 ? 75.019  -8.859  111.146 1.00 16.91 ? 356  TYR C CB  1 
ATOM   4568  C CG  . TYR C 1 128 ? 75.099  -10.305 110.689 1.00 17.14 ? 356  TYR C CG  1 
ATOM   4569  C CD1 . TYR C 1 128 ? 75.915  -10.700 109.627 1.00 17.55 ? 356  TYR C CD1 1 
ATOM   4570  C CD2 . TYR C 1 128 ? 74.315  -11.269 111.291 1.00 17.85 ? 356  TYR C CD2 1 
ATOM   4571  C CE1 . TYR C 1 128 ? 75.966  -12.032 109.216 1.00 17.54 ? 356  TYR C CE1 1 
ATOM   4572  C CE2 . TYR C 1 128 ? 74.350  -12.590 110.886 1.00 18.10 ? 356  TYR C CE2 1 
ATOM   4573  C CZ  . TYR C 1 128 ? 75.164  -12.973 109.857 1.00 17.57 ? 356  TYR C CZ  1 
ATOM   4574  O OH  . TYR C 1 128 ? 75.144  -14.300 109.505 1.00 16.43 ? 356  TYR C OH  1 
ATOM   4575  N N   . LYS C 1 129 ? 75.802  -6.094  112.665 1.00 17.24 ? 357  LYS C N   1 
ATOM   4576  C CA  . LYS C 1 129 ? 75.754  -4.639  112.845 1.00 17.13 ? 357  LYS C CA  1 
ATOM   4577  C C   . LYS C 1 129 ? 77.107  -4.022  112.515 1.00 17.26 ? 357  LYS C C   1 
ATOM   4578  O O   . LYS C 1 129 ? 77.179  -2.966  111.894 1.00 17.37 ? 357  LYS C O   1 
ATOM   4579  C CB  . LYS C 1 129 ? 75.404  -4.268  114.296 1.00 17.20 ? 357  LYS C CB  1 
ATOM   4580  C CG  . LYS C 1 129 ? 73.925  -4.085  114.644 1.00 16.57 ? 357  LYS C CG  1 
ATOM   4581  C CD  . LYS C 1 129 ? 73.811  -3.123  115.840 1.00 16.28 ? 357  LYS C CD  1 
ATOM   4582  C CE  . LYS C 1 129 ? 72.576  -3.337  116.690 1.00 15.85 ? 357  LYS C CE  1 
ATOM   4583  N NZ  . LYS C 1 129 ? 72.583  -2.415  117.853 1.00 15.22 ? 357  LYS C NZ  1 
ATOM   4584  N N   . SER C 1 130 ? 78.177  -4.682  112.949 1.00 17.38 ? 358  SER C N   1 
ATOM   4585  C CA  . SER C 1 130 ? 79.533  -4.199  112.695 1.00 17.62 ? 358  SER C CA  1 
ATOM   4586  C C   . SER C 1 130 ? 79.852  -4.169  111.216 1.00 17.62 ? 358  SER C C   1 
ATOM   4587  O O   . SER C 1 130 ? 80.662  -3.365  110.769 1.00 17.45 ? 358  SER C O   1 
ATOM   4588  C CB  . SER C 1 130 ? 80.561  -5.087  113.391 1.00 17.67 ? 358  SER C CB  1 
ATOM   4589  O OG  . SER C 1 130 ? 80.239  -5.248  114.759 1.00 18.33 ? 358  SER C OG  1 
ATOM   4590  N N   . MET C 1 131 ? 79.229  -5.070  110.467 1.00 17.85 ? 359  MET C N   1 
ATOM   4591  C CA  . MET C 1 131 ? 79.476  -5.172  109.043 1.00 18.10 ? 359  MET C CA  1 
ATOM   4592  C C   . MET C 1 131 ? 78.470  -4.398  108.229 1.00 17.82 ? 359  MET C C   1 
ATOM   4593  O O   . MET C 1 131 ? 78.675  -4.223  107.043 1.00 18.02 ? 359  MET C O   1 
ATOM   4594  C CB  . MET C 1 131 ? 79.438  -6.624  108.611 1.00 18.18 ? 359  MET C CB  1 
ATOM   4595  C CG  . MET C 1 131 ? 80.417  -7.501  109.361 1.00 18.58 ? 359  MET C CG  1 
ATOM   4596  S SD  . MET C 1 131 ? 80.052  -9.230  109.092 1.00 18.96 ? 359  MET C SD  1 
ATOM   4597  C CE  . MET C 1 131 ? 80.027  -9.283  107.302 1.00 19.24 ? 359  MET C CE  1 
ATOM   4598  N N   . LYS C 1 132 ? 77.396  -3.933  108.862 1.00 17.60 ? 360  LYS C N   1 
ATOM   4599  C CA  . LYS C 1 132 ? 76.314  -3.203  108.178 1.00 17.48 ? 360  LYS C CA  1 
ATOM   4600  C C   . LYS C 1 132 ? 75.620  -4.091  107.141 1.00 16.96 ? 360  LYS C C   1 
ATOM   4601  O O   . LYS C 1 132 ? 75.511  -3.727  105.969 1.00 16.94 ? 360  LYS C O   1 
ATOM   4602  C CB  . LYS C 1 132 ? 76.820  -1.899  107.524 1.00 17.58 ? 360  LYS C CB  1 
ATOM   4603  C CG  . LYS C 1 132 ? 77.363  -0.834  108.495 1.00 17.75 ? 360  LYS C CG  1 
ATOM   4604  C CD  . LYS C 1 132 ? 78.183  0.210   107.733 1.00 17.96 ? 360  LYS C CD  1 
ATOM   4605  C CE  . LYS C 1 132 ? 78.880  1.181   108.655 1.00 19.01 ? 360  LYS C CE  1 
ATOM   4606  N NZ  . LYS C 1 132 ? 77.915  2.160   109.243 1.00 20.35 ? 360  LYS C NZ  1 
ATOM   4607  N N   . LEU C 1 133 ? 75.150  -5.250  107.596 1.00 16.45 ? 361  LEU C N   1 
ATOM   4608  C CA  . LEU C 1 133 ? 74.543  -6.251  106.723 1.00 16.22 ? 361  LEU C CA  1 
ATOM   4609  C C   . LEU C 1 133 ? 73.398  -5.667  105.896 1.00 16.05 ? 361  LEU C C   1 
ATOM   4610  O O   . LEU C 1 133 ? 72.434  -5.143  106.453 1.00 16.42 ? 361  LEU C O   1 
ATOM   4611  C CB  . LEU C 1 133 ? 74.038  -7.429  107.560 1.00 16.18 ? 361  LEU C CB  1 
ATOM   4612  C CG  . LEU C 1 133 ? 73.308  -8.553  106.821 1.00 16.46 ? 361  LEU C CG  1 
ATOM   4613  C CD1 . LEU C 1 133 ? 74.252  -9.188  105.828 1.00 16.71 ? 361  LEU C CD1 1 
ATOM   4614  C CD2 . LEU C 1 133 ? 72.747  -9.606  107.776 1.00 16.14 ? 361  LEU C CD2 1 
ATOM   4615  N N   . GLU C 1 134 ? 73.515  -5.759  104.571 1.00 15.72 ? 362  GLU C N   1 
ATOM   4616  C CA  . GLU C 1 134 ? 72.490  -5.263  103.645 1.00 15.58 ? 362  GLU C CA  1 
ATOM   4617  C C   . GLU C 1 134 ? 71.510  -6.376  103.296 1.00 15.35 ? 362  GLU C C   1 
ATOM   4618  O O   . GLU C 1 134 ? 71.833  -7.546  103.439 1.00 15.28 ? 362  GLU C O   1 
ATOM   4619  C CB  . GLU C 1 134 ? 73.145  -4.734  102.372 1.00 15.55 ? 362  GLU C CB  1 
ATOM   4620  C CG  . GLU C 1 134 ? 73.870  -3.417  102.561 1.00 16.09 ? 362  GLU C CG  1 
ATOM   4621  C CD  . GLU C 1 134 ? 75.092  -3.260  101.662 1.00 17.02 ? 362  GLU C CD  1 
ATOM   4622  O OE1 . GLU C 1 134 ? 75.291  -4.083  100.734 1.00 17.01 ? 362  GLU C OE1 1 
ATOM   4623  O OE2 . GLU C 1 134 ? 75.864  -2.305  101.897 1.00 17.16 ? 362  GLU C OE2 1 
ATOM   4624  N N   . LYS C 1 135 ? 70.325  -6.017  102.821 1.00 15.23 ? 363  LYS C N   1 
ATOM   4625  C CA  . LYS C 1 135 ? 69.280  -7.010  102.597 1.00 15.66 ? 363  LYS C CA  1 
ATOM   4626  C C   . LYS C 1 135 ? 69.694  -8.082  101.577 1.00 15.66 ? 363  LYS C C   1 
ATOM   4627  O O   . LYS C 1 135 ? 69.508  -9.283  101.805 1.00 15.75 ? 363  LYS C O   1 
ATOM   4628  C CB  . LYS C 1 135 ? 67.969  -6.342  102.173 1.00 15.55 ? 363  LYS C CB  1 
ATOM   4629  C CG  . LYS C 1 135 ? 66.765  -7.261  102.332 1.00 16.01 ? 363  LYS C CG  1 
ATOM   4630  C CD  . LYS C 1 135 ? 65.424  -6.535  102.170 1.00 16.58 ? 363  LYS C CD  1 
ATOM   4631  C CE  . LYS C 1 135 ? 64.249  -7.515  102.312 1.00 17.19 ? 363  LYS C CE  1 
ATOM   4632  N NZ  . LYS C 1 135 ? 62.926  -6.854  102.541 1.00 18.16 ? 363  LYS C NZ  1 
ATOM   4633  N N   . GLU C 1 136 ? 70.271  -7.633  100.463 1.00 15.59 ? 364  GLU C N   1 
ATOM   4634  C CA  . GLU C 1 136 ? 70.765  -8.509  99.393  1.00 15.37 ? 364  GLU C CA  1 
ATOM   4635  C C   . GLU C 1 136 ? 71.627  -9.633  99.948  1.00 15.38 ? 364  GLU C C   1 
ATOM   4636  O O   . GLU C 1 136 ? 71.615  -10.752 99.438  1.00 15.11 ? 364  GLU C O   1 
ATOM   4637  C CB  . GLU C 1 136 ? 71.600  -7.698  98.397  1.00 15.46 ? 364  GLU C CB  1 
ATOM   4638  C CG  . GLU C 1 136 ? 70.808  -6.671  97.558  1.00 15.13 ? 364  GLU C CG  1 
ATOM   4639  C CD  . GLU C 1 136 ? 70.497  -5.377  98.294  1.00 14.52 ? 364  GLU C CD  1 
ATOM   4640  O OE1 . GLU C 1 136 ? 70.780  -5.280  99.497  1.00 14.57 ? 364  GLU C OE1 1 
ATOM   4641  O OE2 . GLU C 1 136 ? 69.957  -4.441  97.676  1.00 15.68 ? 364  GLU C OE2 1 
ATOM   4642  N N   . GLU C 1 137 ? 72.372  -9.292  100.999 1.00 15.53 ? 365  GLU C N   1 
ATOM   4643  C CA  . GLU C 1 137 ? 73.262  -10.195 101.726 1.00 15.34 ? 365  GLU C CA  1 
ATOM   4644  C C   . GLU C 1 137 ? 72.509  -11.092 102.712 1.00 15.47 ? 365  GLU C C   1 
ATOM   4645  O O   . GLU C 1 137 ? 72.847  -12.266 102.883 1.00 16.11 ? 365  GLU C O   1 
ATOM   4646  C CB  . GLU C 1 137 ? 74.311  -9.371  102.479 1.00 15.26 ? 365  GLU C CB  1 
ATOM   4647  C CG  . GLU C 1 137 ? 75.166  -8.479  101.567 1.00 15.22 ? 365  GLU C CG  1 
ATOM   4648  C CD  . GLU C 1 137 ? 76.051  -7.497  102.324 1.00 15.17 ? 365  GLU C CD  1 
ATOM   4649  O OE1 . GLU C 1 137 ? 75.665  -7.012  103.408 1.00 14.71 ? 365  GLU C OE1 1 
ATOM   4650  O OE2 . GLU C 1 137 ? 77.140  -7.185  101.812 1.00 15.62 ? 365  GLU C OE2 1 
ATOM   4651  N N   . PHE C 1 138 ? 71.500  -10.548 103.374 1.00 15.23 ? 366  PHE C N   1 
ATOM   4652  C CA  . PHE C 1 138 ? 70.670  -11.345 104.264 1.00 15.13 ? 366  PHE C CA  1 
ATOM   4653  C C   . PHE C 1 138 ? 70.046  -12.512 103.504 1.00 15.04 ? 366  PHE C C   1 
ATOM   4654  O O   . PHE C 1 138 ? 70.286  -13.685 103.829 1.00 15.27 ? 366  PHE C O   1 
ATOM   4655  C CB  . PHE C 1 138 ? 69.585  -10.457 104.866 1.00 15.53 ? 366  PHE C CB  1 
ATOM   4656  C CG  . PHE C 1 138 ? 68.423  -11.204 105.465 1.00 15.22 ? 366  PHE C CG  1 
ATOM   4657  C CD1 . PHE C 1 138 ? 68.623  -12.235 106.362 1.00 15.81 ? 366  PHE C CD1 1 
ATOM   4658  C CD2 . PHE C 1 138 ? 67.131  -10.819 105.175 1.00 15.71 ? 366  PHE C CD2 1 
ATOM   4659  C CE1 . PHE C 1 138 ? 67.555  -12.886 106.932 1.00 16.27 ? 366  PHE C CE1 1 
ATOM   4660  C CE2 . PHE C 1 138 ? 66.051  -11.461 105.736 1.00 15.71 ? 366  PHE C CE2 1 
ATOM   4661  C CZ  . PHE C 1 138 ? 66.259  -12.496 106.617 1.00 16.56 ? 366  PHE C CZ  1 
ATOM   4662  N N   . VAL C 1 139 ? 69.273  -12.167 102.473 1.00 14.71 ? 367  VAL C N   1 
ATOM   4663  C CA  . VAL C 1 139 ? 68.486  -13.128 101.680 1.00 14.25 ? 367  VAL C CA  1 
ATOM   4664  C C   . VAL C 1 139 ? 69.344  -14.232 101.088 1.00 14.07 ? 367  VAL C C   1 
ATOM   4665  O O   . VAL C 1 139 ? 68.918  -15.389 100.999 1.00 14.19 ? 367  VAL C O   1 
ATOM   4666  C CB  . VAL C 1 139 ? 67.728  -12.425 100.514 1.00 14.10 ? 367  VAL C CB  1 
ATOM   4667  C CG1 . VAL C 1 139 ? 66.605  -11.575 101.041 1.00 13.79 ? 367  VAL C CG1 1 
ATOM   4668  C CG2 . VAL C 1 139 ? 68.678  -11.576 99.683  1.00 14.12 ? 367  VAL C CG2 1 
ATOM   4669  N N   . THR C 1 140 ? 70.553  -13.868 100.674 1.00 13.79 ? 368  THR C N   1 
ATOM   4670  C CA  . THR C 1 140 ? 71.457  -14.827 100.060 1.00 13.68 ? 368  THR C CA  1 
ATOM   4671  C C   . THR C 1 140 ? 72.090  -15.674 101.153 1.00 13.67 ? 368  THR C C   1 
ATOM   4672  O O   . THR C 1 140 ? 72.388  -16.852 100.944 1.00 13.34 ? 368  THR C O   1 
ATOM   4673  C CB  . THR C 1 140 ? 72.547  -14.136 99.204  1.00 13.73 ? 368  THR C CB  1 
ATOM   4674  O OG1 . THR C 1 140 ? 71.991  -12.999 98.520  1.00 14.14 ? 368  THR C OG1 1 
ATOM   4675  C CG2 . THR C 1 140 ? 73.114  -15.115 98.181  1.00 12.83 ? 368  THR C CG2 1 
ATOM   4676  N N   . LEU C 1 141 ? 72.293  -15.085 102.329 1.00 13.78 ? 369  LEU C N   1 
ATOM   4677  C CA  . LEU C 1 141 ? 72.792  -15.877 103.448 1.00 13.81 ? 369  LEU C CA  1 
ATOM   4678  C C   . LEU C 1 141 ? 71.744  -16.900 103.846 1.00 13.76 ? 369  LEU C C   1 
ATOM   4679  O O   . LEU C 1 141 ? 72.081  -18.048 104.107 1.00 13.80 ? 369  LEU C O   1 
ATOM   4680  C CB  . LEU C 1 141 ? 73.216  -15.020 104.647 1.00 13.80 ? 369  LEU C CB  1 
ATOM   4681  C CG  . LEU C 1 141 ? 74.714  -14.681 104.788 1.00 13.64 ? 369  LEU C CG  1 
ATOM   4682  C CD1 . LEU C 1 141 ? 75.003  -14.082 106.159 1.00 13.15 ? 369  LEU C CD1 1 
ATOM   4683  C CD2 . LEU C 1 141 ? 75.599  -15.872 104.586 1.00 12.12 ? 369  LEU C CD2 1 
ATOM   4684  N N   . LYS C 1 142 ? 70.474  -16.505 103.873 1.00 13.80 ? 370  LYS C N   1 
ATOM   4685  C CA  . LYS C 1 142 ? 69.413  -17.473 104.173 1.00 13.77 ? 370  LYS C CA  1 
ATOM   4686  C C   . LYS C 1 142 ? 69.470  -18.614 103.167 1.00 13.68 ? 370  LYS C C   1 
ATOM   4687  O O   . LYS C 1 142 ? 69.475  -19.806 103.546 1.00 13.36 ? 370  LYS C O   1 
ATOM   4688  C CB  . LYS C 1 142 ? 68.040  -16.826 104.141 1.00 13.65 ? 370  LYS C CB  1 
ATOM   4689  C CG  . LYS C 1 142 ? 67.660  -16.110 105.425 1.00 14.03 ? 370  LYS C CG  1 
ATOM   4690  C CD  . LYS C 1 142 ? 66.158  -15.777 105.445 1.00 14.11 ? 370  LYS C CD  1 
ATOM   4691  C CE  . LYS C 1 142 ? 65.732  -14.884 104.267 1.00 14.66 ? 370  LYS C CE  1 
ATOM   4692  N NZ  . LYS C 1 142 ? 64.279  -14.944 103.970 1.00 15.09 ? 370  LYS C NZ  1 
ATOM   4693  N N   . ALA C 1 143 ? 69.531  -18.244 101.884 1.00 13.49 ? 371  ALA C N   1 
ATOM   4694  C CA  . ALA C 1 143 ? 69.611  -19.243 100.810 1.00 13.53 ? 371  ALA C CA  1 
ATOM   4695  C C   . ALA C 1 143 ? 70.826  -20.189 101.014 1.00 13.25 ? 371  ALA C C   1 
ATOM   4696  O O   . ALA C 1 143 ? 70.707  -21.403 100.881 1.00 13.10 ? 371  ALA C O   1 
ATOM   4697  C CB  . ALA C 1 143 ? 69.657  -18.559 99.447  1.00 13.34 ? 371  ALA C CB  1 
ATOM   4698  N N   . ILE C 1 144 ? 71.966  -19.617 101.390 1.00 13.00 ? 372  ILE C N   1 
ATOM   4699  C CA  . ILE C 1 144 ? 73.188  -20.383 101.634 1.00 12.93 ? 372  ILE C CA  1 
ATOM   4700  C C   . ILE C 1 144 ? 73.098  -21.284 102.868 1.00 12.63 ? 372  ILE C C   1 
ATOM   4701  O O   . ILE C 1 144 ? 73.535  -22.421 102.830 1.00 12.65 ? 372  ILE C O   1 
ATOM   4702  C CB  . ILE C 1 144 ? 74.413  -19.447 101.778 1.00 12.97 ? 372  ILE C CB  1 
ATOM   4703  C CG1 . ILE C 1 144 ? 74.758  -18.813 100.425 1.00 12.93 ? 372  ILE C CG1 1 
ATOM   4704  C CG2 . ILE C 1 144 ? 75.609  -20.212 102.314 1.00 13.21 ? 372  ILE C CG2 1 
ATOM   4705  C CD1 . ILE C 1 144 ? 75.912  -17.838 100.493 1.00 12.91 ? 372  ILE C CD1 1 
ATOM   4706  N N   . ALA C 1 145 ? 72.545  -20.773 103.960 1.00 12.64 ? 373  ALA C N   1 
ATOM   4707  C CA  . ALA C 1 145 ? 72.403  -21.562 105.195 1.00 12.65 ? 373  ALA C CA  1 
ATOM   4708  C C   . ALA C 1 145 ? 71.609  -22.863 104.949 1.00 12.68 ? 373  ALA C C   1 
ATOM   4709  O O   . ALA C 1 145 ? 71.984  -23.928 105.442 1.00 12.98 ? 373  ALA C O   1 
ATOM   4710  C CB  . ALA C 1 145 ? 71.738  -20.728 106.279 1.00 12.22 ? 373  ALA C CB  1 
ATOM   4711  N N   . LEU C 1 146 ? 70.521  -22.744 104.184 1.00 12.70 ? 374  LEU C N   1 
ATOM   4712  C CA  . LEU C 1 146 ? 69.738  -23.876 103.680 1.00 12.13 ? 374  LEU C CA  1 
ATOM   4713  C C   . LEU C 1 146 ? 70.571  -24.815 102.835 1.00 12.40 ? 374  LEU C C   1 
ATOM   4714  O O   . LEU C 1 146 ? 70.604  -26.005 103.091 1.00 12.77 ? 374  LEU C O   1 
ATOM   4715  C CB  . LEU C 1 146 ? 68.564  -23.374 102.830 1.00 12.11 ? 374  LEU C CB  1 
ATOM   4716  C CG  . LEU C 1 146 ? 67.582  -24.409 102.288 1.00 11.02 ? 374  LEU C CG  1 
ATOM   4717  C CD1 . LEU C 1 146 ? 66.940  -25.149 103.422 1.00 10.54 ? 374  LEU C CD1 1 
ATOM   4718  C CD2 . LEU C 1 146 ? 66.522  -23.741 101.443 1.00 10.74 ? 374  LEU C CD2 1 
ATOM   4719  N N   . ALA C 1 147 ? 71.236  -24.287 101.819 1.00 12.65 ? 375  ALA C N   1 
ATOM   4720  C CA  . ALA C 1 147 ? 72.010  -25.134 100.901 1.00 13.08 ? 375  ALA C CA  1 
ATOM   4721  C C   . ALA C 1 147 ? 73.207  -25.826 101.582 1.00 13.57 ? 375  ALA C C   1 
ATOM   4722  O O   . ALA C 1 147 ? 73.504  -26.985 101.290 1.00 13.89 ? 375  ALA C O   1 
ATOM   4723  C CB  . ALA C 1 147 ? 72.474  -24.323 99.715  1.00 12.77 ? 375  ALA C CB  1 
ATOM   4724  N N   . ASN C 1 148 ? 73.858  -25.111 102.503 1.00 13.89 ? 376  ASN C N   1 
ATOM   4725  C CA  . ASN C 1 148 ? 75.050  -25.567 103.197 1.00 14.01 ? 376  ASN C CA  1 
ATOM   4726  C C   . ASN C 1 148 ? 74.751  -26.193 104.567 1.00 14.76 ? 376  ASN C C   1 
ATOM   4727  O O   . ASN C 1 148 ? 75.628  -26.221 105.445 1.00 14.69 ? 376  ASN C O   1 
ATOM   4728  C CB  . ASN C 1 148 ? 75.977  -24.377 103.373 1.00 14.02 ? 376  ASN C CB  1 
ATOM   4729  C CG  . ASN C 1 148 ? 77.333  -24.762 103.902 1.00 14.14 ? 376  ASN C CG  1 
ATOM   4730  O OD1 . ASN C 1 148 ? 77.876  -25.797 103.546 1.00 15.14 ? 376  ASN C OD1 1 
ATOM   4731  N ND2 . ASN C 1 148 ? 77.894  -23.918 104.754 1.00 14.67 ? 376  ASN C ND2 1 
ATOM   4732  N N   . SER C 1 149 ? 73.537  -26.735 104.725 1.00 15.31 ? 377  SER C N   1 
ATOM   4733  C CA  . SER C 1 149 ? 73.037  -27.217 106.022 1.00 15.86 ? 377  SER C CA  1 
ATOM   4734  C C   . SER C 1 149 ? 73.579  -28.575 106.497 1.00 16.16 ? 377  SER C C   1 
ATOM   4735  O O   . SER C 1 149 ? 73.208  -29.027 107.589 1.00 16.23 ? 377  SER C O   1 
ATOM   4736  C CB  . SER C 1 149 ? 71.508  -27.298 105.993 1.00 16.08 ? 377  SER C CB  1 
ATOM   4737  O OG  . SER C 1 149 ? 71.073  -28.346 105.136 1.00 17.31 ? 377  SER C OG  1 
ATOM   4738  N N   . ASP C 1 150 ? 74.417  -29.228 105.688 1.00 16.39 ? 378  ASP C N   1 
ATOM   4739  C CA  . ASP C 1 150 ? 75.191  -30.418 106.116 1.00 16.93 ? 378  ASP C CA  1 
ATOM   4740  C C   . ASP C 1 150 ? 74.379  -31.579 106.719 1.00 17.06 ? 378  ASP C C   1 
ATOM   4741  O O   . ASP C 1 150 ? 74.815  -32.245 107.663 1.00 16.71 ? 378  ASP C O   1 
ATOM   4742  C CB  . ASP C 1 150 ? 76.322  -30.010 107.071 1.00 17.08 ? 378  ASP C CB  1 
ATOM   4743  C CG  . ASP C 1 150 ? 77.395  -29.202 106.383 1.00 18.52 ? 378  ASP C CG  1 
ATOM   4744  O OD1 . ASP C 1 150 ? 77.900  -29.657 105.328 1.00 20.65 ? 378  ASP C OD1 1 
ATOM   4745  O OD2 . ASP C 1 150 ? 77.737  -28.108 106.889 1.00 20.71 ? 378  ASP C OD2 1 
ATOM   4746  N N   . SER C 1 151 ? 73.209  -31.829 106.145 1.00 17.56 ? 379  SER C N   1 
ATOM   4747  C CA  . SER C 1 151 ? 72.450  -33.023 106.466 1.00 18.04 ? 379  SER C CA  1 
ATOM   4748  C C   . SER C 1 151 ? 73.297  -34.256 106.150 1.00 18.51 ? 379  SER C C   1 
ATOM   4749  O O   . SER C 1 151 ? 74.110  -34.240 105.227 1.00 18.72 ? 379  SER C O   1 
ATOM   4750  C CB  . SER C 1 151 ? 71.142  -33.064 105.669 1.00 18.01 ? 379  SER C CB  1 
ATOM   4751  O OG  . SER C 1 151 ? 70.307  -34.120 106.115 1.00 18.27 ? 379  SER C OG  1 
ATOM   4752  N N   . MET C 1 152 ? 73.093  -35.324 106.915 1.00 18.90 ? 380  MET C N   1 
ATOM   4753  C CA  . MET C 1 152 ? 73.830  -36.564 106.725 1.00 19.28 ? 380  MET C CA  1 
ATOM   4754  C C   . MET C 1 152 ? 73.039  -37.460 105.770 1.00 18.87 ? 380  MET C C   1 
ATOM   4755  O O   . MET C 1 152 ? 73.480  -38.564 105.436 1.00 18.90 ? 380  MET C O   1 
ATOM   4756  C CB  . MET C 1 152 ? 74.020  -37.306 108.058 1.00 19.30 ? 380  MET C CB  1 
ATOM   4757  C CG  . MET C 1 152 ? 74.080  -36.441 109.326 1.00 20.00 ? 380  MET C CG  1 
ATOM   4758  S SD  . MET C 1 152 ? 73.864  -37.409 110.853 1.00 21.53 ? 380  MET C SD  1 
ATOM   4759  C CE  . MET C 1 152 ? 72.111  -37.859 110.824 1.00 20.07 ? 380  MET C CE  1 
ATOM   4760  N N   . HIS C 1 153 ? 71.878  -36.975 105.331 1.00 18.38 ? 381  HIS C N   1 
ATOM   4761  C CA  . HIS C 1 153 ? 70.862  -37.813 104.709 1.00 18.04 ? 381  HIS C CA  1 
ATOM   4762  C C   . HIS C 1 153 ? 70.629  -37.501 103.237 1.00 17.62 ? 381  HIS C C   1 
ATOM   4763  O O   . HIS C 1 153 ? 69.602  -37.857 102.687 1.00 17.16 ? 381  HIS C O   1 
ATOM   4764  C CB  . HIS C 1 153 ? 69.565  -37.651 105.499 1.00 18.15 ? 381  HIS C CB  1 
ATOM   4765  C CG  . HIS C 1 153 ? 69.694  -38.044 106.942 1.00 18.70 ? 381  HIS C CG  1 
ATOM   4766  N ND1 . HIS C 1 153 ? 70.237  -39.250 107.337 1.00 18.20 ? 381  HIS C ND1 1 
ATOM   4767  C CD2 . HIS C 1 153 ? 69.348  -37.395 108.081 1.00 18.62 ? 381  HIS C CD2 1 
ATOM   4768  C CE1 . HIS C 1 153 ? 70.219  -39.324 108.657 1.00 18.83 ? 381  HIS C CE1 1 
ATOM   4769  N NE2 . HIS C 1 153 ? 69.684  -38.213 109.133 1.00 18.33 ? 381  HIS C NE2 1 
ATOM   4770  N N   . ILE C 1 154 ? 71.610  -36.866 102.598 1.00 17.59 ? 382  ILE C N   1 
ATOM   4771  C CA  . ILE C 1 154 ? 71.477  -36.400 101.219 1.00 17.24 ? 382  ILE C CA  1 
ATOM   4772  C C   . ILE C 1 154 ? 71.635  -37.518 100.192 1.00 17.16 ? 382  ILE C C   1 
ATOM   4773  O O   . ILE C 1 154 ? 72.615  -38.251 100.205 1.00 17.21 ? 382  ILE C O   1 
ATOM   4774  C CB  . ILE C 1 154 ? 72.516  -35.323 100.896 1.00 17.00 ? 382  ILE C CB  1 
ATOM   4775  C CG1 . ILE C 1 154 ? 72.284  -34.088 101.762 1.00 16.92 ? 382  ILE C CG1 1 
ATOM   4776  C CG2 . ILE C 1 154 ? 72.444  -34.936 99.434  1.00 16.91 ? 382  ILE C CG2 1 
ATOM   4777  C CD1 . ILE C 1 154 ? 70.950  -33.422 101.542 1.00 16.85 ? 382  ILE C CD1 1 
ATOM   4778  N N   . GLU C 1 155 ? 70.659  -37.628 99.301  1.00 16.93 ? 383  GLU C N   1 
ATOM   4779  C CA  . GLU C 1 155 ? 70.732  -38.541 98.175  1.00 16.74 ? 383  GLU C CA  1 
ATOM   4780  C C   . GLU C 1 155 ? 71.766  -38.047 97.174  1.00 16.76 ? 383  GLU C C   1 
ATOM   4781  O O   . GLU C 1 155 ? 72.711  -38.756 96.837  1.00 16.69 ? 383  GLU C O   1 
ATOM   4782  C CB  . GLU C 1 155 ? 69.368  -38.630 97.472  1.00 16.84 ? 383  GLU C CB  1 
ATOM   4783  C CG  . GLU C 1 155 ? 68.311  -39.494 98.184  1.00 16.66 ? 383  GLU C CG  1 
ATOM   4784  C CD  . GLU C 1 155 ? 66.926  -39.426 97.531  1.00 16.29 ? 383  GLU C CD  1 
ATOM   4785  O OE1 . GLU C 1 155 ? 66.714  -38.628 96.596  1.00 15.42 ? 383  GLU C OE1 1 
ATOM   4786  O OE2 . GLU C 1 155 ? 66.033  -40.171 97.966  1.00 15.79 ? 383  GLU C OE2 1 
ATOM   4787  N N   . ASP C 1 156 ? 71.569  -36.819 96.705  1.00 16.70 ? 384  ASP C N   1 
ATOM   4788  C CA  . ASP C 1 156 ? 72.339  -36.261 95.600  1.00 16.56 ? 384  ASP C CA  1 
ATOM   4789  C C   . ASP C 1 156 ? 73.276  -35.182 96.127  1.00 16.63 ? 384  ASP C C   1 
ATOM   4790  O O   . ASP C 1 156 ? 72.882  -34.033 96.328  1.00 16.28 ? 384  ASP C O   1 
ATOM   4791  C CB  . ASP C 1 156 ? 71.376  -35.682 94.560  1.00 16.58 ? 384  ASP C CB  1 
ATOM   4792  C CG  . ASP C 1 156 ? 72.018  -35.471 93.208  1.00 16.20 ? 384  ASP C CG  1 
ATOM   4793  O OD1 . ASP C 1 156 ? 73.259  -35.393 93.112  1.00 17.37 ? 384  ASP C OD1 1 
ATOM   4794  O OD2 . ASP C 1 156 ? 71.261  -35.367 92.230  1.00 15.15 ? 384  ASP C OD2 1 
ATOM   4795  N N   . VAL C 1 157 ? 74.524  -35.570 96.354  1.00 16.91 ? 385  VAL C N   1 
ATOM   4796  C CA  . VAL C 1 157 ? 75.517  -34.681 96.955  1.00 17.04 ? 385  VAL C CA  1 
ATOM   4797  C C   . VAL C 1 157 ? 76.046  -33.693 95.928  1.00 17.28 ? 385  VAL C C   1 
ATOM   4798  O O   . VAL C 1 157 ? 76.119  -32.482 96.197  1.00 17.27 ? 385  VAL C O   1 
ATOM   4799  C CB  . VAL C 1 157 ? 76.674  -35.488 97.555  1.00 16.95 ? 385  VAL C CB  1 
ATOM   4800  C CG1 . VAL C 1 157 ? 77.827  -34.588 97.928  1.00 16.92 ? 385  VAL C CG1 1 
ATOM   4801  C CG2 . VAL C 1 157 ? 76.174  -36.278 98.756  1.00 17.00 ? 385  VAL C CG2 1 
ATOM   4802  N N   . GLU C 1 158 ? 76.407  -34.233 94.763  1.00 17.46 ? 386  GLU C N   1 
ATOM   4803  C CA  . GLU C 1 158 ? 76.841  -33.457 93.591  1.00 17.79 ? 386  GLU C CA  1 
ATOM   4804  C C   . GLU C 1 158 ? 75.880  -32.280 93.336  1.00 17.74 ? 386  GLU C C   1 
ATOM   4805  O O   . GLU C 1 158 ? 76.317  -31.150 93.087  1.00 17.94 ? 386  GLU C O   1 
ATOM   4806  C CB  . GLU C 1 158 ? 76.891  -34.380 92.347  1.00 17.78 ? 386  GLU C CB  1 
ATOM   4807  C CG  . GLU C 1 158 ? 78.135  -34.271 91.461  1.00 18.00 ? 386  GLU C CG  1 
ATOM   4808  C CD  . GLU C 1 158 ? 78.241  -35.420 90.433  1.00 18.76 ? 386  GLU C CD  1 
ATOM   4809  O OE1 . GLU C 1 158 ? 77.593  -35.356 89.358  1.00 18.94 ? 386  GLU C OE1 1 
ATOM   4810  O OE2 . GLU C 1 158 ? 78.984  -36.395 90.698  1.00 20.68 ? 386  GLU C OE2 1 
ATOM   4811  N N   . ALA C 1 159 ? 74.576  -32.550 93.410  1.00 17.52 ? 387  ALA C N   1 
ATOM   4812  C CA  . ALA C 1 159 ? 73.567  -31.540 93.123  1.00 17.59 ? 387  ALA C CA  1 
ATOM   4813  C C   . ALA C 1 159 ? 73.487  -30.472 94.220  1.00 17.73 ? 387  ALA C C   1 
ATOM   4814  O O   . ALA C 1 159 ? 73.427  -29.277 93.916  1.00 18.04 ? 387  ALA C O   1 
ATOM   4815  C CB  . ALA C 1 159 ? 72.213  -32.189 92.913  1.00 17.58 ? 387  ALA C CB  1 
ATOM   4816  N N   . VAL C 1 160 ? 73.479  -30.904 95.482  1.00 17.62 ? 388  VAL C N   1 
ATOM   4817  C CA  . VAL C 1 160 ? 73.443  -29.986 96.620  1.00 17.39 ? 388  VAL C CA  1 
ATOM   4818  C C   . VAL C 1 160 ? 74.699  -29.120 96.626  1.00 17.69 ? 388  VAL C C   1 
ATOM   4819  O O   . VAL C 1 160 ? 74.645  -27.936 96.987  1.00 17.54 ? 388  VAL C O   1 
ATOM   4820  C CB  . VAL C 1 160 ? 73.340  -30.751 97.964  1.00 17.33 ? 388  VAL C CB  1 
ATOM   4821  C CG1 . VAL C 1 160 ? 73.737  -29.863 99.140  1.00 17.04 ? 388  VAL C CG1 1 
ATOM   4822  C CG2 . VAL C 1 160 ? 71.954  -31.294 98.161  1.00 16.78 ? 388  VAL C CG2 1 
ATOM   4823  N N   . GLN C 1 161 ? 75.825  -29.721 96.234  1.00 17.82 ? 389  GLN C N   1 
ATOM   4824  C CA  . GLN C 1 161 ? 77.085  -28.998 96.130  1.00 17.90 ? 389  GLN C CA  1 
ATOM   4825  C C   . GLN C 1 161 ? 76.977  -27.980 95.019  1.00 17.71 ? 389  GLN C C   1 
ATOM   4826  O O   . GLN C 1 161 ? 77.404  -26.834 95.178  1.00 18.09 ? 389  GLN C O   1 
ATOM   4827  C CB  . GLN C 1 161 ? 78.254  -29.950 95.863  1.00 18.13 ? 389  GLN C CB  1 
ATOM   4828  C CG  . GLN C 1 161 ? 79.607  -29.270 95.607  1.00 19.07 ? 389  GLN C CG  1 
ATOM   4829  C CD  . GLN C 1 161 ? 80.105  -28.431 96.788  1.00 20.88 ? 389  GLN C CD  1 
ATOM   4830  O OE1 . GLN C 1 161 ? 80.400  -28.965 97.863  1.00 22.48 ? 389  GLN C OE1 1 
ATOM   4831  N NE2 . GLN C 1 161 ? 80.226  -27.120 96.582  1.00 20.01 ? 389  GLN C NE2 1 
ATOM   4832  N N   . LYS C 1 162 ? 76.400  -28.385 93.895  1.00 17.29 ? 390  LYS C N   1 
ATOM   4833  C CA  . LYS C 1 162 ? 76.236  -27.460 92.781  1.00 17.08 ? 390  LYS C CA  1 
ATOM   4834  C C   . LYS C 1 162 ? 75.451  -26.235 93.251  1.00 16.71 ? 390  LYS C C   1 
ATOM   4835  O O   . LYS C 1 162 ? 75.825  -25.111 92.929  1.00 16.59 ? 390  LYS C O   1 
ATOM   4836  C CB  . LYS C 1 162 ? 75.535  -28.132 91.593  1.00 17.11 ? 390  LYS C CB  1 
ATOM   4837  C CG  . LYS C 1 162 ? 75.907  -27.544 90.240  1.00 17.47 ? 390  LYS C CG  1 
ATOM   4838  C CD  . LYS C 1 162 ? 76.926  -28.409 89.495  1.00 18.51 ? 390  LYS C CD  1 
ATOM   4839  C CE  . LYS C 1 162 ? 76.236  -29.576 88.759  1.00 18.79 ? 390  LYS C CE  1 
ATOM   4840  N NZ  . LYS C 1 162 ? 77.190  -30.572 88.197  1.00 18.12 ? 390  LYS C NZ  1 
ATOM   4841  N N   . LEU C 1 163 ? 74.387  -26.482 94.028  1.00 16.35 ? 391  LEU C N   1 
ATOM   4842  C CA  . LEU C 1 163 ? 73.480  -25.445 94.563  1.00 16.10 ? 391  LEU C CA  1 
ATOM   4843  C C   . LEU C 1 163 ? 74.193  -24.469 95.480  1.00 16.00 ? 391  LEU C C   1 
ATOM   4844  O O   . LEU C 1 163 ? 73.970  -23.252 95.403  1.00 15.83 ? 391  LEU C O   1 
ATOM   4845  C CB  . LEU C 1 163 ? 72.305  -26.092 95.328  1.00 16.24 ? 391  LEU C CB  1 
ATOM   4846  C CG  . LEU C 1 163 ? 71.327  -25.217 96.145  1.00 16.26 ? 391  LEU C CG  1 
ATOM   4847  C CD1 . LEU C 1 163 ? 70.700  -24.089 95.305  1.00 15.39 ? 391  LEU C CD1 1 
ATOM   4848  C CD2 . LEU C 1 163 ? 70.238  -26.077 96.799  1.00 15.56 ? 391  LEU C CD2 1 
ATOM   4849  N N   . GLN C 1 164 ? 75.033  -25.009 96.358  1.00 15.80 ? 392  GLN C N   1 
ATOM   4850  C CA  . GLN C 1 164 ? 75.916  -24.182 97.161  1.00 15.64 ? 392  GLN C CA  1 
ATOM   4851  C C   . GLN C 1 164 ? 76.741  -23.247 96.266  1.00 15.95 ? 392  GLN C C   1 
ATOM   4852  O O   . GLN C 1 164 ? 76.783  -22.048 96.514  1.00 16.10 ? 392  GLN C O   1 
ATOM   4853  C CB  . GLN C 1 164 ? 76.823  -25.050 98.033  1.00 15.52 ? 392  GLN C CB  1 
ATOM   4854  C CG  . GLN C 1 164 ? 76.110  -25.678 99.225  1.00 15.43 ? 392  GLN C CG  1 
ATOM   4855  C CD  . GLN C 1 164 ? 76.895  -26.817 99.885  1.00 15.12 ? 392  GLN C CD  1 
ATOM   4856  O OE1 . GLN C 1 164 ? 78.116  -26.889 99.806  1.00 14.21 ? 392  GLN C OE1 1 
ATOM   4857  N NE2 . GLN C 1 164 ? 76.180  -27.706 100.541 1.00 14.86 ? 392  GLN C NE2 1 
ATOM   4858  N N   . ASP C 1 165 ? 77.363  -23.775 95.214  1.00 16.03 ? 393  ASP C N   1 
ATOM   4859  C CA  . ASP C 1 165 ? 78.216  -22.945 94.352  1.00 16.53 ? 393  ASP C CA  1 
ATOM   4860  C C   . ASP C 1 165 ? 77.435  -21.827 93.684  1.00 15.96 ? 393  ASP C C   1 
ATOM   4861  O O   . ASP C 1 165 ? 77.890  -20.690 93.631  1.00 16.06 ? 393  ASP C O   1 
ATOM   4862  C CB  . ASP C 1 165 ? 78.909  -23.771 93.257  1.00 17.08 ? 393  ASP C CB  1 
ATOM   4863  C CG  . ASP C 1 165 ? 79.715  -24.922 93.815  1.00 19.06 ? 393  ASP C CG  1 
ATOM   4864  O OD1 . ASP C 1 165 ? 80.125  -24.823 94.989  1.00 23.51 ? 393  ASP C OD1 1 
ATOM   4865  O OD2 . ASP C 1 165 ? 79.923  -25.929 93.098  1.00 20.85 ? 393  ASP C OD2 1 
ATOM   4866  N N   . VAL C 1 166 ? 76.269  -22.158 93.155  1.00 15.42 ? 394  VAL C N   1 
ATOM   4867  C CA  . VAL C 1 166 ? 75.432  -21.175 92.467  1.00 15.13 ? 394  VAL C CA  1 
ATOM   4868  C C   . VAL C 1 166 ? 75.156  -19.974 93.379  1.00 14.76 ? 394  VAL C C   1 
ATOM   4869  O O   . VAL C 1 166 ? 75.390  -18.831 93.000  1.00 14.74 ? 394  VAL C O   1 
ATOM   4870  C CB  . VAL C 1 166 ? 74.094  -21.810 92.009  1.00 15.28 ? 394  VAL C CB  1 
ATOM   4871  C CG1 . VAL C 1 166 ? 73.148  -20.752 91.472  1.00 15.02 ? 394  VAL C CG1 1 
ATOM   4872  C CG2 . VAL C 1 166 ? 74.348  -22.919 90.962  1.00 14.83 ? 394  VAL C CG2 1 
ATOM   4873  N N   . LEU C 1 167 ? 74.675  -20.260 94.587  1.00 14.50 ? 395  LEU C N   1 
ATOM   4874  C CA  . LEU C 1 167 ? 74.404  -19.236 95.616  1.00 14.15 ? 395  LEU C CA  1 
ATOM   4875  C C   . LEU C 1 167 ? 75.676  -18.549 96.157  1.00 13.96 ? 395  LEU C C   1 
ATOM   4876  O O   . LEU C 1 167 ? 75.658  -17.355 96.459  1.00 14.20 ? 395  LEU C O   1 
ATOM   4877  C CB  . LEU C 1 167 ? 73.632  -19.857 96.780  1.00 13.82 ? 395  LEU C CB  1 
ATOM   4878  C CG  . LEU C 1 167 ? 72.240  -20.373 96.423  1.00 13.99 ? 395  LEU C CG  1 
ATOM   4879  C CD1 . LEU C 1 167 ? 71.756  -21.386 97.456  1.00 14.47 ? 395  LEU C CD1 1 
ATOM   4880  C CD2 . LEU C 1 167 ? 71.246  -19.219 96.286  1.00 13.45 ? 395  LEU C CD2 1 
ATOM   4881  N N   . HIS C 1 168 ? 76.764  -19.298 96.293  1.00 13.30 ? 396  HIS C N   1 
ATOM   4882  C CA  . HIS C 1 168 ? 78.023  -18.718 96.700  1.00 13.26 ? 396  HIS C CA  1 
ATOM   4883  C C   . HIS C 1 168 ? 78.503  -17.704 95.630  1.00 13.45 ? 396  HIS C C   1 
ATOM   4884  O O   . HIS C 1 168 ? 78.899  -16.569 95.952  1.00 13.35 ? 396  HIS C O   1 
ATOM   4885  C CB  . HIS C 1 168 ? 79.054  -19.830 96.938  1.00 13.20 ? 396  HIS C CB  1 
ATOM   4886  C CG  . HIS C 1 168 ? 80.418  -19.333 97.315  1.00 13.10 ? 396  HIS C CG  1 
ATOM   4887  N ND1 . HIS C 1 168 ? 81.559  -20.072 97.106  1.00 12.40 ? 396  HIS C ND1 1 
ATOM   4888  C CD2 . HIS C 1 168 ? 80.823  -18.172 97.885  1.00 14.30 ? 396  HIS C CD2 1 
ATOM   4889  C CE1 . HIS C 1 168 ? 82.607  -19.392 97.531  1.00 13.06 ? 396  HIS C CE1 1 
ATOM   4890  N NE2 . HIS C 1 168 ? 82.190  -18.233 98.005  1.00 14.29 ? 396  HIS C NE2 1 
ATOM   4891  N N   . GLU C 1 169 ? 78.449  -18.116 94.363  1.00 13.38 ? 397  GLU C N   1 
ATOM   4892  C CA  . GLU C 1 169 ? 78.802  -17.244 93.239  1.00 13.25 ? 397  GLU C CA  1 
ATOM   4893  C C   . GLU C 1 169 ? 78.015  -15.949 93.306  1.00 12.96 ? 397  GLU C C   1 
ATOM   4894  O O   . GLU C 1 169 ? 78.555  -14.869 93.096  1.00 12.62 ? 397  GLU C O   1 
ATOM   4895  C CB  . GLU C 1 169 ? 78.527  -17.939 91.898  1.00 13.11 ? 397  GLU C CB  1 
ATOM   4896  C CG  . GLU C 1 169 ? 78.600  -16.998 90.717  1.00 13.71 ? 397  GLU C CG  1 
ATOM   4897  C CD  . GLU C 1 169 ? 78.623  -17.689 89.372  1.00 14.16 ? 397  GLU C CD  1 
ATOM   4898  O OE1 . GLU C 1 169 ? 78.045  -18.794 89.249  1.00 16.09 ? 397  GLU C OE1 1 
ATOM   4899  O OE2 . GLU C 1 169 ? 79.202  -17.098 88.428  1.00 13.95 ? 397  GLU C OE2 1 
ATOM   4900  N N   . ALA C 1 170 ? 76.727  -16.076 93.592  1.00 13.06 ? 398  ALA C N   1 
ATOM   4901  C CA  . ALA C 1 170 ? 75.850  -14.929 93.703  1.00 13.20 ? 398  ALA C CA  1 
ATOM   4902  C C   . ALA C 1 170 ? 76.377  -13.932 94.753  1.00 13.41 ? 398  ALA C C   1 
ATOM   4903  O O   . ALA C 1 170 ? 76.533  -12.738 94.467  1.00 13.43 ? 398  ALA C O   1 
ATOM   4904  C CB  . ALA C 1 170 ? 74.443  -15.390 94.034  1.00 13.20 ? 398  ALA C CB  1 
ATOM   4905  N N   . LEU C 1 171 ? 76.677  -14.432 95.952  1.00 13.59 ? 399  LEU C N   1 
ATOM   4906  C CA  . LEU C 1 171 ? 77.286  -13.611 97.010  1.00 13.66 ? 399  LEU C CA  1 
ATOM   4907  C C   . LEU C 1 171 ? 78.583  -12.942 96.521  1.00 13.68 ? 399  LEU C C   1 
ATOM   4908  O O   . LEU C 1 171 ? 78.772  -11.739 96.670  1.00 13.27 ? 399  LEU C O   1 
ATOM   4909  C CB  . LEU C 1 171 ? 77.573  -14.475 98.250  1.00 13.60 ? 399  LEU C CB  1 
ATOM   4910  C CG  . LEU C 1 171 ? 78.176  -13.778 99.475  1.00 13.69 ? 399  LEU C CG  1 
ATOM   4911  C CD1 . LEU C 1 171 ? 77.264  -12.677 100.001 1.00 13.14 ? 399  LEU C CD1 1 
ATOM   4912  C CD2 . LEU C 1 171 ? 78.473  -14.805 100.566 1.00 13.53 ? 399  LEU C CD2 1 
ATOM   4913  N N   A GLN C 1 172 ? 79.460  -13.744 95.926  0.60 13.95 ? 400  GLN C N   1 
ATOM   4914  N N   B GLN C 1 172 ? 79.452  -13.753 95.926  0.40 13.75 ? 400  GLN C N   1 
ATOM   4915  C CA  A GLN C 1 172 ? 80.762  -13.272 95.465  0.60 14.15 ? 400  GLN C CA  1 
ATOM   4916  C CA  B GLN C 1 172 ? 80.759  -13.305 95.451  0.40 13.79 ? 400  GLN C CA  1 
ATOM   4917  C C   A GLN C 1 172 ? 80.631  -12.263 94.330  0.60 14.19 ? 400  GLN C C   1 
ATOM   4918  C C   B GLN C 1 172 ? 80.626  -12.268 94.339  0.40 14.01 ? 400  GLN C C   1 
ATOM   4919  O O   A GLN C 1 172 ? 81.437  -11.340 94.219  0.60 14.25 ? 400  GLN C O   1 
ATOM   4920  O O   B GLN C 1 172 ? 81.424  -11.334 94.254  0.40 14.06 ? 400  GLN C O   1 
ATOM   4921  C CB  A GLN C 1 172 ? 81.625  -14.459 95.024  0.60 14.27 ? 400  GLN C CB  1 
ATOM   4922  C CB  B GLN C 1 172 ? 81.572  -14.504 94.951  0.40 13.81 ? 400  GLN C CB  1 
ATOM   4923  C CG  A GLN C 1 172 ? 83.091  -14.125 94.783  0.60 14.85 ? 400  GLN C CG  1 
ATOM   4924  C CG  B GLN C 1 172 ? 83.070  -14.380 95.165  0.40 13.72 ? 400  GLN C CG  1 
ATOM   4925  C CD  A GLN C 1 172 ? 83.786  -13.581 96.019  0.60 15.01 ? 400  GLN C CD  1 
ATOM   4926  C CD  B GLN C 1 172 ? 83.841  -15.527 94.541  0.40 13.33 ? 400  GLN C CD  1 
ATOM   4927  O OE1 A GLN C 1 172 ? 84.034  -12.379 96.122  0.60 14.26 ? 400  GLN C OE1 1 
ATOM   4928  O OE1 B GLN C 1 172 ? 83.586  -15.907 93.397  0.40 12.07 ? 400  GLN C OE1 1 
ATOM   4929  N NE2 A GLN C 1 172 ? 84.095  -14.464 96.965  0.60 15.61 ? 400  GLN C NE2 1 
ATOM   4930  N NE2 B GLN C 1 172 ? 84.793  -16.079 95.288  0.40 12.25 ? 400  GLN C NE2 1 
ATOM   4931  N N   . ASP C 1 173 ? 79.613  -12.435 93.494  1.00 14.30 ? 401  ASP C N   1 
ATOM   4932  C CA  . ASP C 1 173 ? 79.371  -11.514 92.380  1.00 14.58 ? 401  ASP C CA  1 
ATOM   4933  C C   . ASP C 1 173 ? 78.758  -10.211 92.875  1.00 14.30 ? 401  ASP C C   1 
ATOM   4934  O O   . ASP C 1 173 ? 79.117  -9.143  92.389  1.00 14.33 ? 401  ASP C O   1 
ATOM   4935  C CB  . ASP C 1 173 ? 78.465  -12.159 91.326  1.00 14.89 ? 401  ASP C CB  1 
ATOM   4936  C CG  . ASP C 1 173 ? 78.834  -11.757 89.910  1.00 16.61 ? 401  ASP C CG  1 
ATOM   4937  O OD1 . ASP C 1 173 ? 80.010  -11.370 89.674  1.00 18.30 ? 401  ASP C OD1 1 
ATOM   4938  O OD2 . ASP C 1 173 ? 77.947  -11.852 89.027  1.00 18.94 ? 401  ASP C OD2 1 
ATOM   4939  N N   . TYR C 1 174 ? 77.848  -10.300 93.849  1.00 14.02 ? 402  TYR C N   1 
ATOM   4940  C CA  . TYR C 1 174 ? 77.291  -9.103  94.500  1.00 13.77 ? 402  TYR C CA  1 
ATOM   4941  C C   . TYR C 1 174 ? 78.375  -8.294  95.186  1.00 13.60 ? 402  TYR C C   1 
ATOM   4942  O O   . TYR C 1 174 ? 78.558  -7.119  94.914  1.00 13.26 ? 402  TYR C O   1 
ATOM   4943  C CB  . TYR C 1 174 ? 76.248  -9.476  95.556  1.00 13.66 ? 402  TYR C CB  1 
ATOM   4944  C CG  . TYR C 1 174 ? 75.716  -8.280  96.321  1.00 13.27 ? 402  TYR C CG  1 
ATOM   4945  C CD1 . TYR C 1 174 ? 74.746  -7.462  95.764  1.00 13.67 ? 402  TYR C CD1 1 
ATOM   4946  C CD2 . TYR C 1 174 ? 76.182  -7.966  97.588  1.00 13.14 ? 402  TYR C CD2 1 
ATOM   4947  C CE1 . TYR C 1 174 ? 74.245  -6.368  96.442  1.00 13.76 ? 402  TYR C CE1 1 
ATOM   4948  C CE2 . TYR C 1 174 ? 75.683  -6.865  98.284  1.00 13.54 ? 402  TYR C CE2 1 
ATOM   4949  C CZ  . TYR C 1 174 ? 74.712  -6.068  97.699  1.00 13.63 ? 402  TYR C CZ  1 
ATOM   4950  O OH  . TYR C 1 174 ? 74.194  -4.967  98.350  1.00 13.07 ? 402  TYR C OH  1 
ATOM   4951  N N   . GLU C 1 175 ? 79.094  -8.950  96.083  1.00 13.75 ? 403  GLU C N   1 
ATOM   4952  C CA  . GLU C 1 175 ? 80.118  -8.289  96.870  1.00 13.83 ? 403  GLU C CA  1 
ATOM   4953  C C   . GLU C 1 175 ? 81.187  -7.678  95.978  1.00 14.02 ? 403  GLU C C   1 
ATOM   4954  O O   . GLU C 1 175 ? 81.809  -6.669  96.347  1.00 14.02 ? 403  GLU C O   1 
ATOM   4955  C CB  . GLU C 1 175 ? 80.743  -9.269  97.855  1.00 13.70 ? 403  GLU C CB  1 
ATOM   4956  C CG  . GLU C 1 175 ? 79.747  -9.848  98.858  1.00 13.89 ? 403  GLU C CG  1 
ATOM   4957  C CD  . GLU C 1 175 ? 79.257  -8.842  99.871  1.00 13.81 ? 403  GLU C CD  1 
ATOM   4958  O OE1 . GLU C 1 175 ? 79.462  -7.624  99.687  1.00 13.32 ? 403  GLU C OE1 1 
ATOM   4959  O OE2 . GLU C 1 175 ? 78.651  -9.285  100.866 1.00 15.71 ? 403  GLU C OE2 1 
ATOM   4960  N N   . ALA C 1 176 ? 81.387  -8.280  94.806  1.00 14.03 ? 404  ALA C N   1 
ATOM   4961  C CA  . ALA C 1 176 ? 82.332  -7.757  93.816  1.00 14.22 ? 404  ALA C CA  1 
ATOM   4962  C C   . ALA C 1 176 ? 81.942  -6.362  93.302  1.00 14.18 ? 404  ALA C C   1 
ATOM   4963  O O   . ALA C 1 176 ? 82.741  -5.431  93.348  1.00 14.07 ? 404  ALA C O   1 
ATOM   4964  C CB  . ALA C 1 176 ? 82.451  -8.733  92.652  1.00 14.41 ? 404  ALA C CB  1 
ATOM   4965  N N   . GLY C 1 177 ? 80.707  -6.232  92.830  1.00 14.28 ? 405  GLY C N   1 
ATOM   4966  C CA  . GLY C 1 177 ? 80.228  -4.993  92.216  1.00 14.40 ? 405  GLY C CA  1 
ATOM   4967  C C   . GLY C 1 177 ? 79.751  -3.931  93.190  1.00 14.54 ? 405  GLY C C   1 
ATOM   4968  O O   . GLY C 1 177 ? 79.806  -2.741  92.885  1.00 14.76 ? 405  GLY C O   1 
ATOM   4969  N N   . GLN C 1 178 ? 79.292  -4.357  94.362  1.00 14.69 ? 406  GLN C N   1 
ATOM   4970  C CA  . GLN C 1 178 ? 78.749  -3.447  95.369  1.00 14.88 ? 406  GLN C CA  1 
ATOM   4971  C C   . GLN C 1 178 ? 79.740  -3.104  96.477  1.00 14.91 ? 406  GLN C C   1 
ATOM   4972  O O   . GLN C 1 178 ? 79.615  -2.065  97.106  1.00 15.17 ? 406  GLN C O   1 
ATOM   4973  C CB  . GLN C 1 178 ? 77.487  -4.057  95.983  1.00 15.01 ? 406  GLN C CB  1 
ATOM   4974  C CG  . GLN C 1 178 ? 76.760  -3.188  97.031  1.00 15.24 ? 406  GLN C CG  1 
ATOM   4975  C CD  . GLN C 1 178 ? 76.081  -1.947  96.465  1.00 14.59 ? 406  GLN C CD  1 
ATOM   4976  O OE1 . GLN C 1 178 ? 75.811  -1.844  95.267  1.00 13.63 ? 406  GLN C OE1 1 
ATOM   4977  N NE2 . GLN C 1 178 ? 75.789  -1.003  97.343  1.00 15.16 ? 406  GLN C NE2 1 
ATOM   4978  N N   . HIS C 1 179 ? 80.716  -3.963  96.724  1.00 15.16 ? 407  HIS C N   1 
ATOM   4979  C CA  . HIS C 1 179 ? 81.664  -3.720  97.805  1.00 15.27 ? 407  HIS C CA  1 
ATOM   4980  C C   . HIS C 1 179 ? 83.104  -3.860  97.347  1.00 15.58 ? 407  HIS C C   1 
ATOM   4981  O O   . HIS C 1 179 ? 83.866  -4.663  97.880  1.00 15.87 ? 407  HIS C O   1 
ATOM   4982  C CB  . HIS C 1 179 ? 81.353  -4.635  98.995  1.00 14.96 ? 407  HIS C CB  1 
ATOM   4983  C CG  . HIS C 1 179 ? 80.185  -4.170  99.800  1.00 14.48 ? 407  HIS C CG  1 
ATOM   4984  N ND1 . HIS C 1 179 ? 80.315  -3.297  100.859 1.00 13.15 ? 407  HIS C ND1 1 
ATOM   4985  C CD2 . HIS C 1 179 ? 78.860  -4.420  99.676  1.00 13.69 ? 407  HIS C CD2 1 
ATOM   4986  C CE1 . HIS C 1 179 ? 79.121  -3.048  101.366 1.00 13.48 ? 407  HIS C CE1 1 
ATOM   4987  N NE2 . HIS C 1 179 ? 78.221  -3.717  100.666 1.00 13.43 ? 407  HIS C NE2 1 
ATOM   4988  N N   . MET C 1 180 ? 83.476  -3.066  96.354  1.00 15.87 ? 408  MET C N   1 
ATOM   4989  C CA  . MET C 1 180 ? 84.859  -3.033  95.899  1.00 16.45 ? 408  MET C CA  1 
ATOM   4990  C C   . MET C 1 180 ? 85.808  -2.720  97.061  1.00 16.37 ? 408  MET C C   1 
ATOM   4991  O O   . MET C 1 180 ? 86.889  -3.301  97.139  1.00 16.63 ? 408  MET C O   1 
ATOM   4992  C CB  . MET C 1 180 ? 85.061  -1.972  94.808  1.00 16.52 ? 408  MET C CB  1 
ATOM   4993  C CG  . MET C 1 180 ? 84.423  -2.277  93.469  1.00 16.82 ? 408  MET C CG  1 
ATOM   4994  S SD  . MET C 1 180 ? 84.874  -1.028  92.236  1.00 17.79 ? 408  MET C SD  1 
ATOM   4995  C CE  . MET C 1 180 ? 83.999  0.436   92.817  1.00 17.55 ? 408  MET C CE  1 
ATOM   4996  N N   . GLU C 1 181 ? 85.399  -1.811  97.954  1.00 16.24 ? 409  GLU C N   1 
ATOM   4997  C CA  . GLU C 1 181 ? 86.266  -1.315  99.043  1.00 15.96 ? 409  GLU C CA  1 
ATOM   4998  C C   . GLU C 1 181 ? 86.821  -2.414  99.960  1.00 15.91 ? 409  GLU C C   1 
ATOM   4999  O O   . GLU C 1 181 ? 87.890  -2.244  100.556 1.00 15.79 ? 409  GLU C O   1 
ATOM   5000  C CB  . GLU C 1 181 ? 85.537  -0.255  99.887  1.00 15.85 ? 409  GLU C CB  1 
ATOM   5001  C CG  . GLU C 1 181 ? 84.644  -0.786  101.029 1.00 15.63 ? 409  GLU C CG  1 
ATOM   5002  C CD  . GLU C 1 181 ? 83.363  -1.447  100.557 1.00 15.22 ? 409  GLU C CD  1 
ATOM   5003  O OE1 . GLU C 1 181 ? 83.033  -1.306  99.360  1.00 15.25 ? 409  GLU C OE1 1 
ATOM   5004  O OE2 . GLU C 1 181 ? 82.686  -2.098  101.392 1.00 13.96 ? 409  GLU C OE2 1 
ATOM   5005  N N   . ASP C 1 182 ? 86.072  -3.515  100.076 1.00 15.80 ? 410  ASP C N   1 
ATOM   5006  C CA  . ASP C 1 182 ? 86.467  -4.705  100.832 1.00 15.65 ? 410  ASP C CA  1 
ATOM   5007  C C   . ASP C 1 182 ? 86.469  -5.904  99.870  1.00 15.48 ? 410  ASP C C   1 
ATOM   5008  O O   . ASP C 1 182 ? 85.398  -6.422  99.536  1.00 15.65 ? 410  ASP C O   1 
ATOM   5009  C CB  . ASP C 1 182 ? 85.467  -4.929  101.986 1.00 15.68 ? 410  ASP C CB  1 
ATOM   5010  C CG  . ASP C 1 182 ? 85.872  -6.062  102.935 1.00 16.01 ? 410  ASP C CG  1 
ATOM   5011  O OD1 . ASP C 1 182 ? 86.997  -6.590  102.815 1.00 17.20 ? 410  ASP C OD1 1 
ATOM   5012  O OD2 . ASP C 1 182 ? 85.058  -6.415  103.823 1.00 15.55 ? 410  ASP C OD2 1 
ATOM   5013  N N   . PRO C 1 183 ? 87.659  -6.345  99.404  1.00 15.11 ? 411  PRO C N   1 
ATOM   5014  C CA  . PRO C 1 183 ? 87.705  -7.504  98.509  1.00 14.80 ? 411  PRO C CA  1 
ATOM   5015  C C   . PRO C 1 183 ? 87.521  -8.841  99.233  1.00 14.63 ? 411  PRO C C   1 
ATOM   5016  O O   . PRO C 1 183 ? 87.361  -9.858  98.583  1.00 14.61 ? 411  PRO C O   1 
ATOM   5017  C CB  . PRO C 1 183 ? 89.099  -7.413  97.894  1.00 14.70 ? 411  PRO C CB  1 
ATOM   5018  C CG  . PRO C 1 183 ? 89.916  -6.777  98.932  1.00 14.98 ? 411  PRO C CG  1 
ATOM   5019  C CD  . PRO C 1 183 ? 89.009  -5.823  99.678  1.00 15.14 ? 411  PRO C CD  1 
ATOM   5020  N N   . ARG C 1 184 ? 87.544  -8.835  100.563 1.00 14.69 ? 412  ARG C N   1 
ATOM   5021  C CA  . ARG C 1 184 ? 87.303  -10.037 101.365 1.00 14.80 ? 412  ARG C CA  1 
ATOM   5022  C C   . ARG C 1 184 ? 86.003  -9.927  102.184 1.00 14.76 ? 412  ARG C C   1 
ATOM   5023  O O   . ARG C 1 184 ? 85.910  -10.475 103.274 1.00 14.95 ? 412  ARG C O   1 
ATOM   5024  C CB  . ARG C 1 184 ? 88.479  -10.269 102.322 1.00 14.69 ? 412  ARG C CB  1 
ATOM   5025  C CG  . ARG C 1 184 ? 89.835  -10.423 101.653 1.00 15.23 ? 412  ARG C CG  1 
ATOM   5026  C CD  . ARG C 1 184 ? 90.904  -10.678 102.685 1.00 14.96 ? 412  ARG C CD  1 
ATOM   5027  N NE  . ARG C 1 184 ? 91.086  -9.504  103.530 1.00 15.15 ? 412  ARG C NE  1 
ATOM   5028  C CZ  . ARG C 1 184 ? 91.913  -8.491  103.267 1.00 15.30 ? 412  ARG C CZ  1 
ATOM   5029  N NH1 . ARG C 1 184 ? 92.674  -8.487  102.178 1.00 15.32 ? 412  ARG C NH1 1 
ATOM   5030  N NH2 . ARG C 1 184 ? 91.985  -7.469  104.111 1.00 14.95 ? 412  ARG C NH2 1 
ATOM   5031  N N   . ARG C 1 185 ? 84.998  -9.229  101.679 1.00 14.57 ? 413  ARG C N   1 
ATOM   5032  C CA  . ARG C 1 185 ? 83.744  -9.147  102.411 1.00 14.60 ? 413  ARG C CA  1 
ATOM   5033  C C   . ARG C 1 185 ? 83.004  -10.488 102.436 1.00 14.57 ? 413  ARG C C   1 
ATOM   5034  O O   . ARG C 1 185 ? 82.538  -10.922 103.494 1.00 14.65 ? 413  ARG C O   1 
ATOM   5035  C CB  . ARG C 1 185 ? 82.832  -8.060  101.843 1.00 14.59 ? 413  ARG C CB  1 
ATOM   5036  C CG  . ARG C 1 185 ? 81.644  -7.749  102.750 1.00 14.65 ? 413  ARG C CG  1 
ATOM   5037  C CD  . ARG C 1 185 ? 80.897  -6.503  102.306 1.00 14.64 ? 413  ARG C CD  1 
ATOM   5038  N NE  . ARG C 1 185 ? 79.600  -6.397  102.973 1.00 14.29 ? 413  ARG C NE  1 
ATOM   5039  C CZ  . ARG C 1 185 ? 79.357  -5.662  104.058 1.00 13.85 ? 413  ARG C CZ  1 
ATOM   5040  N NH1 . ARG C 1 185 ? 80.316  -4.946  104.623 1.00 13.36 ? 413  ARG C NH1 1 
ATOM   5041  N NH2 . ARG C 1 185 ? 78.134  -5.651  104.580 1.00 14.04 ? 413  ARG C NH2 1 
ATOM   5042  N N   . ALA C 1 186 ? 82.891  -11.135 101.277 1.00 14.48 ? 414  ALA C N   1 
ATOM   5043  C CA  . ALA C 1 186 ? 82.149  -12.397 101.169 1.00 14.44 ? 414  ALA C CA  1 
ATOM   5044  C C   . ALA C 1 186 ? 82.677  -13.427 102.179 1.00 14.58 ? 414  ALA C C   1 
ATOM   5045  O O   . ALA C 1 186 ? 81.888  -14.100 102.862 1.00 15.06 ? 414  ALA C O   1 
ATOM   5046  C CB  . ALA C 1 186 ? 82.211  -12.953 99.743  1.00 14.20 ? 414  ALA C CB  1 
ATOM   5047  N N   . GLY C 1 187 ? 84.001  -13.529 102.300 1.00 14.24 ? 415  GLY C N   1 
ATOM   5048  C CA  . GLY C 1 187 ? 84.599  -14.399 103.309 1.00 14.10 ? 415  GLY C CA  1 
ATOM   5049  C C   . GLY C 1 187 ? 84.202  -14.034 104.733 1.00 14.02 ? 415  GLY C C   1 
ATOM   5050  O O   . GLY C 1 187 ? 83.923  -14.913 105.561 1.00 13.75 ? 415  GLY C O   1 
ATOM   5051  N N   . LYS C 1 188 ? 84.167  -12.732 105.017 1.00 14.07 ? 416  LYS C N   1 
ATOM   5052  C CA  . LYS C 1 188 ? 83.704  -12.232 106.318 1.00 14.01 ? 416  LYS C CA  1 
ATOM   5053  C C   . LYS C 1 188 ? 82.254  -12.639 106.567 1.00 14.26 ? 416  LYS C C   1 
ATOM   5054  O O   . LYS C 1 188 ? 81.876  -12.933 107.705 1.00 14.04 ? 416  LYS C O   1 
ATOM   5055  C CB  . LYS C 1 188 ? 83.842  -10.705 106.414 1.00 13.78 ? 416  LYS C CB  1 
ATOM   5056  C CG  . LYS C 1 188 ? 85.249  -10.208 106.684 1.00 13.63 ? 416  LYS C CG  1 
ATOM   5057  C CD  . LYS C 1 188 ? 85.330  -8.681  106.609 1.00 13.76 ? 416  LYS C CD  1 
ATOM   5058  C CE  . LYS C 1 188 ? 86.754  -8.201  106.452 1.00 13.52 ? 416  LYS C CE  1 
ATOM   5059  N NZ  . LYS C 1 188 ? 86.804  -6.873  105.807 1.00 13.87 ? 416  LYS C NZ  1 
ATOM   5060  N N   . MET C 1 189 ? 81.454  -12.639 105.498 1.00 14.62 ? 417  MET C N   1 
ATOM   5061  C CA  . MET C 1 189 ? 80.044  -13.017 105.581 1.00 15.12 ? 417  MET C CA  1 
ATOM   5062  C C   . MET C 1 189 ? 79.922  -14.497 105.875 1.00 14.72 ? 417  MET C C   1 
ATOM   5063  O O   . MET C 1 189 ? 79.294  -14.897 106.856 1.00 14.51 ? 417  MET C O   1 
ATOM   5064  C CB  . MET C 1 189 ? 79.301  -12.702 104.275 1.00 15.77 ? 417  MET C CB  1 
ATOM   5065  C CG  . MET C 1 189 ? 78.929  -11.244 104.110 1.00 17.30 ? 417  MET C CG  1 
ATOM   5066  S SD  . MET C 1 189 ? 77.637  -10.766 105.263 1.00 21.16 ? 417  MET C SD  1 
ATOM   5067  C CE  . MET C 1 189 ? 77.701  -8.967  105.130 1.00 17.59 ? 417  MET C CE  1 
ATOM   5068  N N   . LEU C 1 190 ? 80.539  -15.306 105.023 1.00 14.34 ? 418  LEU C N   1 
ATOM   5069  C CA  . LEU C 1 190 ? 80.537  -16.753 105.211 1.00 14.16 ? 418  LEU C CA  1 
ATOM   5070  C C   . LEU C 1 190 ? 81.080  -17.151 106.587 1.00 14.11 ? 418  LEU C C   1 
ATOM   5071  O O   . LEU C 1 190 ? 80.645  -18.158 107.150 1.00 13.94 ? 418  LEU C O   1 
ATOM   5072  C CB  . LEU C 1 190 ? 81.355  -17.420 104.118 1.00 13.91 ? 418  LEU C CB  1 
ATOM   5073  C CG  . LEU C 1 190 ? 80.735  -17.282 102.738 1.00 14.27 ? 418  LEU C CG  1 
ATOM   5074  C CD1 . LEU C 1 190 ? 81.702  -17.814 101.694 1.00 14.13 ? 418  LEU C CD1 1 
ATOM   5075  C CD2 . LEU C 1 190 ? 79.380  -18.021 102.694 1.00 15.30 ? 418  LEU C CD2 1 
ATOM   5076  N N   . MET C 1 191 ? 82.007  -16.347 107.127 1.00 13.95 ? 419  MET C N   1 
ATOM   5077  C CA  . MET C 1 191 ? 82.611  -16.616 108.443 1.00 13.66 ? 419  MET C CA  1 
ATOM   5078  C C   . MET C 1 191 ? 81.654  -16.432 109.614 1.00 13.41 ? 419  MET C C   1 
ATOM   5079  O O   . MET C 1 191 ? 81.972  -16.833 110.730 1.00 13.60 ? 419  MET C O   1 
ATOM   5080  C CB  . MET C 1 191 ? 83.876  -15.771 108.669 1.00 13.51 ? 419  MET C CB  1 
ATOM   5081  C CG  . MET C 1 191 ? 85.130  -16.433 108.140 1.00 13.51 ? 419  MET C CG  1 
ATOM   5082  S SD  . MET C 1 191 ? 86.485  -15.296 107.858 1.00 13.67 ? 419  MET C SD  1 
ATOM   5083  C CE  . MET C 1 191 ? 87.319  -15.260 109.441 1.00 14.21 ? 419  MET C CE  1 
ATOM   5084  N N   . THR C 1 192 ? 80.502  -15.819 109.372 1.00 13.11 ? 420  THR C N   1 
ATOM   5085  C CA  . THR C 1 192 ? 79.479  -15.709 110.396 1.00 12.93 ? 420  THR C CA  1 
ATOM   5086  C C   . THR C 1 192 ? 78.686  -17.003 110.500 1.00 12.80 ? 420  THR C C   1 
ATOM   5087  O O   . THR C 1 192 ? 78.121  -17.286 111.528 1.00 13.33 ? 420  THR C O   1 
ATOM   5088  C CB  . THR C 1 192 ? 78.526  -14.526 110.125 1.00 13.10 ? 420  THR C CB  1 
ATOM   5089  O OG1 . THR C 1 192 ? 77.705  -14.788 108.982 1.00 12.45 ? 420  THR C OG1 1 
ATOM   5090  C CG2 . THR C 1 192 ? 79.322  -13.246 109.894 1.00 13.34 ? 420  THR C CG2 1 
ATOM   5091  N N   . LEU C 1 193 ? 78.684  -17.807 109.447 1.00 12.76 ? 421  LEU C N   1 
ATOM   5092  C CA  . LEU C 1 193 ? 77.876  -19.028 109.399 1.00 12.70 ? 421  LEU C CA  1 
ATOM   5093  C C   . LEU C 1 193 ? 78.006  -19.980 110.604 1.00 12.74 ? 421  LEU C C   1 
ATOM   5094  O O   . LEU C 1 193 ? 76.992  -20.476 111.096 1.00 12.70 ? 421  LEU C O   1 
ATOM   5095  C CB  . LEU C 1 193 ? 78.146  -19.801 108.096 1.00 12.55 ? 421  LEU C CB  1 
ATOM   5096  C CG  . LEU C 1 193 ? 77.647  -19.149 106.804 1.00 11.32 ? 421  LEU C CG  1 
ATOM   5097  C CD1 . LEU C 1 193 ? 77.946  -20.023 105.591 1.00 9.55  ? 421  LEU C CD1 1 
ATOM   5098  C CD2 . LEU C 1 193 ? 76.165  -18.900 106.937 1.00 9.97  ? 421  LEU C CD2 1 
ATOM   5099  N N   . PRO C 1 194 ? 79.238  -20.249 111.076 1.00 12.76 ? 422  PRO C N   1 
ATOM   5100  C CA  . PRO C 1 194 ? 79.347  -21.200 112.194 1.00 12.80 ? 422  PRO C CA  1 
ATOM   5101  C C   . PRO C 1 194 ? 78.560  -20.778 113.433 1.00 12.95 ? 422  PRO C C   1 
ATOM   5102  O O   . PRO C 1 194 ? 77.927  -21.625 114.075 1.00 13.33 ? 422  PRO C O   1 
ATOM   5103  C CB  . PRO C 1 194 ? 80.858  -21.253 112.494 1.00 12.69 ? 422  PRO C CB  1 
ATOM   5104  C CG  . PRO C 1 194 ? 81.536  -20.719 111.274 1.00 12.42 ? 422  PRO C CG  1 
ATOM   5105  C CD  . PRO C 1 194 ? 80.556  -19.751 110.640 1.00 12.77 ? 422  PRO C CD  1 
ATOM   5106  N N   . LEU C 1 195 ? 78.580  -19.490 113.769 1.00 12.75 ? 423  LEU C N   1 
ATOM   5107  C CA  . LEU C 1 195 ? 77.820  -19.024 114.931 1.00 12.66 ? 423  LEU C CA  1 
ATOM   5108  C C   . LEU C 1 195 ? 76.315  -19.167 114.698 1.00 12.43 ? 423  LEU C C   1 
ATOM   5109  O O   . LEU C 1 195 ? 75.544  -19.362 115.645 1.00 12.37 ? 423  LEU C O   1 
ATOM   5110  C CB  . LEU C 1 195 ? 78.166  -17.575 115.280 1.00 12.80 ? 423  LEU C CB  1 
ATOM   5111  C CG  . LEU C 1 195 ? 77.662  -17.074 116.642 1.00 12.61 ? 423  LEU C CG  1 
ATOM   5112  C CD1 . LEU C 1 195 ? 78.024  -18.022 117.788 1.00 11.32 ? 423  LEU C CD1 1 
ATOM   5113  C CD2 . LEU C 1 195 ? 78.201  -15.671 116.908 1.00 12.64 ? 423  LEU C CD2 1 
ATOM   5114  N N   . LEU C 1 196 ? 75.898  -19.070 113.438 1.00 12.12 ? 424  LEU C N   1 
ATOM   5115  C CA  . LEU C 1 196 ? 74.501  -19.313 113.097 1.00 11.79 ? 424  LEU C CA  1 
ATOM   5116  C C   . LEU C 1 196 ? 74.128  -20.746 113.437 1.00 11.50 ? 424  LEU C C   1 
ATOM   5117  O O   . LEU C 1 196 ? 73.081  -20.987 114.012 1.00 11.31 ? 424  LEU C O   1 
ATOM   5118  C CB  . LEU C 1 196 ? 74.234  -19.028 111.619 1.00 11.67 ? 424  LEU C CB  1 
ATOM   5119  C CG  . LEU C 1 196 ? 72.753  -19.010 111.236 1.00 11.42 ? 424  LEU C CG  1 
ATOM   5120  C CD1 . LEU C 1 196 ? 71.943  -18.086 112.165 1.00 10.09 ? 424  LEU C CD1 1 
ATOM   5121  C CD2 . LEU C 1 196 ? 72.618  -18.596 109.763 1.00 11.39 ? 424  LEU C CD2 1 
ATOM   5122  N N   . ARG C 1 197 ? 75.017  -21.672 113.084 1.00 11.32 ? 425  ARG C N   1 
ATOM   5123  C CA  . ARG C 1 197 ? 74.868  -23.091 113.362 1.00 11.13 ? 425  ARG C CA  1 
ATOM   5124  C C   . ARG C 1 197 ? 74.792  -23.360 114.874 1.00 11.38 ? 425  ARG C C   1 
ATOM   5125  O O   . ARG C 1 197 ? 73.855  -23.991 115.363 1.00 10.94 ? 425  ARG C O   1 
ATOM   5126  C CB  . ARG C 1 197 ? 76.070  -23.831 112.747 1.00 11.08 ? 425  ARG C CB  1 
ATOM   5127  C CG  . ARG C 1 197 ? 76.078  -25.358 112.863 1.00 9.81  ? 425  ARG C CG  1 
ATOM   5128  C CD  . ARG C 1 197 ? 75.016  -25.943 112.018 1.00 8.96  ? 425  ARG C CD  1 
ATOM   5129  N NE  . ARG C 1 197 ? 75.159  -25.596 110.604 1.00 7.81  ? 425  ARG C NE  1 
ATOM   5130  C CZ  . ARG C 1 197 ? 75.921  -26.260 109.748 1.00 7.79  ? 425  ARG C CZ  1 
ATOM   5131  N NH1 . ARG C 1 197 ? 76.645  -27.284 110.159 1.00 9.37  ? 425  ARG C NH1 1 
ATOM   5132  N NH2 . ARG C 1 197 ? 75.968  -25.905 108.478 1.00 7.69  ? 425  ARG C NH2 1 
ATOM   5133  N N   . GLN C 1 198 ? 75.795  -22.873 115.599 1.00 11.66 ? 426  GLN C N   1 
ATOM   5134  C CA  . GLN C 1 198 ? 75.878  -23.034 117.059 1.00 12.06 ? 426  GLN C CA  1 
ATOM   5135  C C   . GLN C 1 198 ? 74.607  -22.552 117.747 1.00 12.31 ? 426  GLN C C   1 
ATOM   5136  O O   . GLN C 1 198 ? 73.951  -23.290 118.485 1.00 12.55 ? 426  GLN C O   1 
ATOM   5137  C CB  . GLN C 1 198 ? 77.085  -22.248 117.586 1.00 11.96 ? 426  GLN C CB  1 
ATOM   5138  C CG  . GLN C 1 198 ? 77.154  -22.001 119.088 1.00 11.80 ? 426  GLN C CG  1 
ATOM   5139  C CD  . GLN C 1 198 ? 78.415  -21.230 119.472 1.00 12.40 ? 426  GLN C CD  1 
ATOM   5140  O OE1 . GLN C 1 198 ? 79.485  -21.474 118.913 1.00 12.36 ? 426  GLN C OE1 1 
ATOM   5141  N NE2 . GLN C 1 198 ? 78.295  -20.294 120.427 1.00 12.54 ? 426  GLN C NE2 1 
ATOM   5142  N N   . THR C 1 199 ? 74.281  -21.294 117.499 1.00 12.54 ? 427  THR C N   1 
ATOM   5143  C CA  . THR C 1 199 ? 73.122  -20.667 118.086 1.00 12.67 ? 427  THR C CA  1 
ATOM   5144  C C   . THR C 1 199 ? 71.854  -21.440 117.744 1.00 12.86 ? 427  THR C C   1 
ATOM   5145  O O   . THR C 1 199 ? 71.045  -21.691 118.623 1.00 12.86 ? 427  THR C O   1 
ATOM   5146  C CB  . THR C 1 199 ? 73.016  -19.216 117.613 1.00 12.77 ? 427  THR C CB  1 
ATOM   5147  O OG1 . THR C 1 199 ? 74.298  -18.584 117.756 1.00 12.36 ? 427  THR C OG1 1 
ATOM   5148  C CG2 . THR C 1 199 ? 71.980  -18.468 118.428 1.00 12.84 ? 427  THR C CG2 1 
ATOM   5149  N N   . SER C 1 200 ? 71.698  -21.829 116.478 1.00 13.23 ? 428  SER C N   1 
ATOM   5150  C CA  . SER C 1 200 ? 70.573  -22.668 116.047 1.00 13.54 ? 428  SER C CA  1 
ATOM   5151  C C   . SER C 1 200 ? 70.520  -24.013 116.798 1.00 13.82 ? 428  SER C C   1 
ATOM   5152  O O   . SER C 1 200 ? 69.453  -24.419 117.250 1.00 14.05 ? 428  SER C O   1 
ATOM   5153  C CB  . SER C 1 200 ? 70.607  -22.906 114.529 1.00 13.57 ? 428  SER C CB  1 
ATOM   5154  O OG  . SER C 1 200 ? 70.010  -24.153 114.162 1.00 14.64 ? 428  SER C OG  1 
ATOM   5155  N N   . THR C 1 201 ? 71.649  -24.708 116.927 1.00 14.19 ? 429  THR C N   1 
ATOM   5156  C CA  . THR C 1 201 ? 71.678  -25.955 117.714 1.00 14.52 ? 429  THR C CA  1 
ATOM   5157  C C   . THR C 1 201 ? 71.116  -25.704 119.113 1.00 14.91 ? 429  THR C C   1 
ATOM   5158  O O   . THR C 1 201 ? 70.213  -26.416 119.552 1.00 14.88 ? 429  THR C O   1 
ATOM   5159  C CB  . THR C 1 201 ? 73.107  -26.557 117.858 1.00 14.53 ? 429  THR C CB  1 
ATOM   5160  O OG1 . THR C 1 201 ? 73.587  -26.996 116.581 1.00 14.99 ? 429  THR C OG1 1 
ATOM   5161  C CG2 . THR C 1 201 ? 73.103  -27.744 118.809 1.00 13.80 ? 429  THR C CG2 1 
ATOM   5162  N N   . LYS C 1 202 ? 71.659  -24.696 119.798 1.00 15.40 ? 430  LYS C N   1 
ATOM   5163  C CA  . LYS C 1 202 ? 71.182  -24.291 121.131 1.00 16.13 ? 430  LYS C CA  1 
ATOM   5164  C C   . LYS C 1 202 ? 69.671  -24.041 121.182 1.00 15.88 ? 430  LYS C C   1 
ATOM   5165  O O   . LYS C 1 202 ? 68.999  -24.459 122.138 1.00 15.83 ? 430  LYS C O   1 
ATOM   5166  C CB  . LYS C 1 202 ? 71.926  -23.036 121.628 1.00 16.54 ? 430  LYS C CB  1 
ATOM   5167  C CG  . LYS C 1 202 ? 73.224  -23.353 122.374 1.00 17.53 ? 430  LYS C CG  1 
ATOM   5168  C CD  . LYS C 1 202 ? 74.163  -22.149 122.502 1.00 17.59 ? 430  LYS C CD  1 
ATOM   5169  C CE  . LYS C 1 202 ? 75.384  -22.513 123.374 1.00 18.84 ? 430  LYS C CE  1 
ATOM   5170  N NZ  . LYS C 1 202 ? 76.694  -22.224 122.698 1.00 19.05 ? 430  LYS C NZ  1 
ATOM   5171  N N   . ALA C 1 203 ? 69.154  -23.363 120.157 1.00 15.54 ? 431  ALA C N   1 
ATOM   5172  C CA  . ALA C 1 203 ? 67.724  -23.071 120.047 1.00 15.51 ? 431  ALA C CA  1 
ATOM   5173  C C   . ALA C 1 203 ? 66.915  -24.363 119.990 1.00 15.53 ? 431  ALA C C   1 
ATOM   5174  O O   . ALA C 1 203 ? 65.948  -24.530 120.722 1.00 15.33 ? 431  ALA C O   1 
ATOM   5175  C CB  . ALA C 1 203 ? 67.441  -22.195 118.807 1.00 15.23 ? 431  ALA C CB  1 
ATOM   5176  N N   . VAL C 1 204 ? 67.327  -25.281 119.125 1.00 15.87 ? 432  VAL C N   1 
ATOM   5177  C CA  . VAL C 1 204 ? 66.620  -26.549 118.979 1.00 16.10 ? 432  VAL C CA  1 
ATOM   5178  C C   . VAL C 1 204 ? 66.653  -27.297 120.302 1.00 16.83 ? 432  VAL C C   1 
ATOM   5179  O O   . VAL C 1 204 ? 65.629  -27.777 120.765 1.00 16.96 ? 432  VAL C O   1 
ATOM   5180  C CB  . VAL C 1 204 ? 67.206  -27.441 117.865 1.00 15.86 ? 432  VAL C CB  1 
ATOM   5181  C CG1 . VAL C 1 204 ? 66.379  -28.692 117.724 1.00 14.55 ? 432  VAL C CG1 1 
ATOM   5182  C CG2 . VAL C 1 204 ? 67.264  -26.674 116.537 1.00 15.30 ? 432  VAL C CG2 1 
ATOM   5183  N N   . GLN C 1 205 ? 67.823  -27.370 120.925 1.00 17.59 ? 433  GLN C N   1 
ATOM   5184  C CA  . GLN C 1 205 ? 67.944  -28.070 122.203 1.00 18.27 ? 433  GLN C CA  1 
ATOM   5185  C C   . GLN C 1 205 ? 67.027  -27.467 123.289 1.00 18.57 ? 433  GLN C C   1 
ATOM   5186  O O   . GLN C 1 205 ? 66.214  -28.178 123.884 1.00 18.40 ? 433  GLN C O   1 
ATOM   5187  C CB  . GLN C 1 205 ? 69.416  -28.149 122.651 1.00 18.42 ? 433  GLN C CB  1 
ATOM   5188  C CG  . GLN C 1 205 ? 70.027  -29.563 122.523 1.00 19.62 ? 433  GLN C CG  1 
ATOM   5189  C CD  . GLN C 1 205 ? 71.348  -29.603 121.746 1.00 20.98 ? 433  GLN C CD  1 
ATOM   5190  O OE1 . GLN C 1 205 ? 72.426  -29.799 122.325 1.00 21.34 ? 433  GLN C OE1 1 
ATOM   5191  N NE2 . GLN C 1 205 ? 71.262  -29.432 120.424 1.00 21.23 ? 433  GLN C NE2 1 
ATOM   5192  N N   . HIS C 1 206 ? 67.127  -26.158 123.508 1.00 19.10 ? 434  HIS C N   1 
ATOM   5193  C CA  . HIS C 1 206 ? 66.303  -25.473 124.516 1.00 19.34 ? 434  HIS C CA  1 
ATOM   5194  C C   . HIS C 1 206 ? 64.822  -25.795 124.369 1.00 20.18 ? 434  HIS C C   1 
ATOM   5195  O O   . HIS C 1 206 ? 64.126  -25.965 125.369 1.00 20.42 ? 434  HIS C O   1 
ATOM   5196  C CB  . HIS C 1 206 ? 66.490  -23.960 124.442 1.00 18.99 ? 434  HIS C CB  1 
ATOM   5197  C CG  . HIS C 1 206 ? 65.873  -23.228 125.587 1.00 18.31 ? 434  HIS C CG  1 
ATOM   5198  N ND1 . HIS C 1 206 ? 66.058  -23.611 126.895 1.00 17.61 ? 434  HIS C ND1 1 
ATOM   5199  C CD2 . HIS C 1 206 ? 65.074  -22.136 125.624 1.00 18.24 ? 434  HIS C CD2 1 
ATOM   5200  C CE1 . HIS C 1 206 ? 65.400  -22.787 127.690 1.00 17.89 ? 434  HIS C CE1 1 
ATOM   5201  N NE2 . HIS C 1 206 ? 64.793  -21.883 126.944 1.00 17.91 ? 434  HIS C NE2 1 
ATOM   5202  N N   . PHE C 1 207 ? 64.349  -25.871 123.126 1.00 21.12 ? 435  PHE C N   1 
ATOM   5203  C CA  . PHE C 1 207 ? 62.957  -26.230 122.835 1.00 21.92 ? 435  PHE C CA  1 
ATOM   5204  C C   . PHE C 1 207 ? 62.671  -27.658 123.297 1.00 22.88 ? 435  PHE C C   1 
ATOM   5205  O O   . PHE C 1 207 ? 61.693  -27.905 124.000 1.00 22.97 ? 435  PHE C O   1 
ATOM   5206  C CB  . PHE C 1 207 ? 62.647  -26.066 121.334 1.00 21.77 ? 435  PHE C CB  1 
ATOM   5207  C CG  . PHE C 1 207 ? 61.301  -26.611 120.919 1.00 21.75 ? 435  PHE C CG  1 
ATOM   5208  C CD1 . PHE C 1 207 ? 61.150  -27.948 120.564 1.00 21.97 ? 435  PHE C CD1 1 
ATOM   5209  C CD2 . PHE C 1 207 ? 60.185  -25.793 120.883 1.00 22.17 ? 435  PHE C CD2 1 
ATOM   5210  C CE1 . PHE C 1 207 ? 59.917  -28.461 120.186 1.00 21.41 ? 435  PHE C CE1 1 
ATOM   5211  C CE2 . PHE C 1 207 ? 58.935  -26.305 120.501 1.00 21.91 ? 435  PHE C CE2 1 
ATOM   5212  C CZ  . PHE C 1 207 ? 58.812  -27.639 120.151 1.00 21.76 ? 435  PHE C CZ  1 
ATOM   5213  N N   . TYR C 1 208 ? 63.537  -28.589 122.912 1.00 24.15 ? 436  TYR C N   1 
ATOM   5214  C CA  . TYR C 1 208 ? 63.358  -29.990 123.276 1.00 25.25 ? 436  TYR C CA  1 
ATOM   5215  C C   . TYR C 1 208 ? 63.579  -30.181 124.783 1.00 25.41 ? 436  TYR C C   1 
ATOM   5216  O O   . TYR C 1 208 ? 63.007  -31.088 125.376 1.00 25.48 ? 436  TYR C O   1 
ATOM   5217  C CB  . TYR C 1 208 ? 64.287  -30.901 122.458 1.00 26.23 ? 436  TYR C CB  1 
ATOM   5218  C CG  . TYR C 1 208 ? 63.877  -31.081 120.994 1.00 27.35 ? 436  TYR C CG  1 
ATOM   5219  C CD1 . TYR C 1 208 ? 63.849  -29.999 120.118 1.00 27.87 ? 436  TYR C CD1 1 
ATOM   5220  C CD2 . TYR C 1 208 ? 63.543  -32.345 120.485 1.00 28.68 ? 436  TYR C CD2 1 
ATOM   5221  C CE1 . TYR C 1 208 ? 63.482  -30.145 118.784 1.00 28.95 ? 436  TYR C CE1 1 
ATOM   5222  C CE2 . TYR C 1 208 ? 63.176  -32.511 119.137 1.00 29.10 ? 436  TYR C CE2 1 
ATOM   5223  C CZ  . TYR C 1 208 ? 63.146  -31.401 118.290 1.00 29.22 ? 436  TYR C CZ  1 
ATOM   5224  O OH  . TYR C 1 208 ? 62.783  -31.530 116.955 1.00 29.14 ? 436  TYR C OH  1 
ATOM   5225  N N   . ASN C 1 209 ? 64.391  -29.317 125.394 1.00 25.63 ? 437  ASN C N   1 
ATOM   5226  C CA  . ASN C 1 209 ? 64.610  -29.343 126.842 1.00 25.85 ? 437  ASN C CA  1 
ATOM   5227  C C   . ASN C 1 209 ? 63.380  -28.974 127.641 1.00 26.24 ? 437  ASN C C   1 
ATOM   5228  O O   . ASN C 1 209 ? 63.209  -29.444 128.762 1.00 26.39 ? 437  ASN C O   1 
ATOM   5229  C CB  . ASN C 1 209 ? 65.727  -28.383 127.258 1.00 25.79 ? 437  ASN C CB  1 
ATOM   5230  C CG  . ASN C 1 209 ? 67.102  -28.890 126.897 1.00 25.89 ? 437  ASN C CG  1 
ATOM   5231  O OD1 . ASN C 1 209 ? 67.359  -30.091 126.914 1.00 25.78 ? 437  ASN C OD1 1 
ATOM   5232  N ND2 . ASN C 1 209 ? 68.004  -27.969 126.573 1.00 26.02 ? 437  ASN C ND2 1 
ATOM   5233  N N   . ILE C 1 210 ? 62.537  -28.114 127.084 1.00 26.72 ? 438  ILE C N   1 
ATOM   5234  C CA  . ILE C 1 210 ? 61.382  -27.600 127.831 1.00 27.10 ? 438  ILE C CA  1 
ATOM   5235  C C   . ILE C 1 210 ? 60.059  -28.226 127.409 1.00 27.37 ? 438  ILE C C   1 
ATOM   5236  O O   . ILE C 1 210 ? 59.074  -28.111 128.135 1.00 27.40 ? 438  ILE C O   1 
ATOM   5237  C CB  . ILE C 1 210 ? 61.296  -26.045 127.798 1.00 27.19 ? 438  ILE C CB  1 
ATOM   5238  C CG1 . ILE C 1 210 ? 61.168  -25.502 126.365 1.00 26.92 ? 438  ILE C CG1 1 
ATOM   5239  C CG2 . ILE C 1 210 ? 62.514  -25.439 128.508 1.00 27.55 ? 438  ILE C CG2 1 
ATOM   5240  C CD1 . ILE C 1 210 ? 59.756  -25.423 125.863 1.00 26.71 ? 438  ILE C CD1 1 
ATOM   5241  N N   . LYS C 1 211 ? 60.032  -28.892 126.253 1.00 27.71 ? 439  LYS C N   1 
ATOM   5242  C CA  . LYS C 1 211 ? 58.911  -29.782 125.924 1.00 28.01 ? 439  LYS C CA  1 
ATOM   5243  C C   . LYS C 1 211 ? 58.925  -30.939 126.920 1.00 28.18 ? 439  LYS C C   1 
ATOM   5244  O O   . LYS C 1 211 ? 57.910  -31.212 127.550 1.00 28.42 ? 439  LYS C O   1 
ATOM   5245  C CB  . LYS C 1 211 ? 58.976  -30.310 124.480 1.00 28.04 ? 439  LYS C CB  1 
ATOM   5246  C CG  . LYS C 1 211 ? 58.096  -29.558 123.453 1.00 28.13 ? 439  LYS C CG  1 
ATOM   5247  C CD  . LYS C 1 211 ? 56.655  -30.123 123.338 1.00 28.19 ? 439  LYS C CD  1 
ATOM   5248  C CE  . LYS C 1 211 ? 56.159  -30.222 121.870 1.00 27.89 ? 439  LYS C CE  1 
ATOM   5249  N NZ  . LYS C 1 211 ? 55.962  -28.918 121.165 1.00 26.61 ? 439  LYS C NZ  1 
ATOM   5250  N N   . LEU C 1 212 ? 60.082  -31.582 127.090 1.00 28.37 ? 440  LEU C N   1 
ATOM   5251  C CA  . LEU C 1 212 ? 60.236  -32.682 128.065 1.00 28.58 ? 440  LEU C CA  1 
ATOM   5252  C C   . LEU C 1 212 ? 60.297  -32.201 129.538 1.00 28.60 ? 440  LEU C C   1 
ATOM   5253  O O   . LEU C 1 212 ? 60.630  -32.982 130.440 1.00 28.60 ? 440  LEU C O   1 
ATOM   5254  C CB  . LEU C 1 212 ? 61.474  -33.548 127.725 1.00 28.70 ? 440  LEU C CB  1 
ATOM   5255  C CG  . LEU C 1 212 ? 61.499  -34.316 126.388 1.00 28.86 ? 440  LEU C CG  1 
ATOM   5256  C CD1 . LEU C 1 212 ? 62.856  -34.985 126.158 1.00 28.60 ? 440  LEU C CD1 1 
ATOM   5257  C CD2 . LEU C 1 212 ? 60.385  -35.354 126.324 1.00 29.33 ? 440  LEU C CD2 1 
ATOM   5258  N N   . GLU C 1 213 ? 59.985  -30.922 129.766 1.00 28.62 ? 441  GLU C N   1 
ATOM   5259  C CA  . GLU C 1 213 ? 59.838  -30.346 131.110 1.00 28.64 ? 441  GLU C CA  1 
ATOM   5260  C C   . GLU C 1 213 ? 58.379  -29.928 131.393 1.00 28.70 ? 441  GLU C C   1 
ATOM   5261  O O   . GLU C 1 213 ? 58.082  -29.351 132.439 1.00 28.73 ? 441  GLU C O   1 
ATOM   5262  C CB  . GLU C 1 213 ? 60.780  -29.146 131.261 1.00 28.67 ? 441  GLU C CB  1 
ATOM   5263  C CG  . GLU C 1 213 ? 61.231  -28.853 132.690 1.00 28.55 ? 441  GLU C CG  1 
ATOM   5264  C CD  . GLU C 1 213 ? 62.362  -27.836 132.748 1.00 28.43 ? 441  GLU C CD  1 
ATOM   5265  O OE1 . GLU C 1 213 ? 62.499  -27.033 131.799 1.00 28.06 ? 441  GLU C OE1 1 
ATOM   5266  O OE2 . GLU C 1 213 ? 63.114  -27.841 133.745 1.00 27.81 ? 441  GLU C OE2 1 
ATOM   5267  N N   . GLY C 1 214 ? 57.487  -30.197 130.440 1.00 28.73 ? 442  GLY C N   1 
ATOM   5268  C CA  . GLY C 1 214 ? 56.027  -30.129 130.628 1.00 28.76 ? 442  GLY C CA  1 
ATOM   5269  C C   . GLY C 1 214 ? 55.400  -29.056 131.511 1.00 28.77 ? 442  GLY C C   1 
ATOM   5270  O O   . GLY C 1 214 ? 54.429  -29.331 132.217 1.00 28.80 ? 442  GLY C O   1 
ATOM   5271  N N   . LYS C 1 215 ? 55.931  -27.835 131.462 1.00 28.77 ? 443  LYS C N   1 
ATOM   5272  C CA  . LYS C 1 215 ? 55.368  -26.703 132.209 1.00 28.68 ? 443  LYS C CA  1 
ATOM   5273  C C   . LYS C 1 215 ? 54.397  -25.874 131.358 1.00 28.65 ? 443  LYS C C   1 
ATOM   5274  O O   . LYS C 1 215 ? 53.600  -25.100 131.896 1.00 28.58 ? 443  LYS C O   1 
ATOM   5275  C CB  . LYS C 1 215 ? 56.490  -25.808 132.748 1.00 28.69 ? 443  LYS C CB  1 
ATOM   5276  N N   . VAL C 1 216 ? 54.473  -26.027 130.035 1.00 28.63 ? 444  VAL C N   1 
ATOM   5277  C CA  . VAL C 1 216 ? 53.536  -25.359 129.117 1.00 28.68 ? 444  VAL C CA  1 
ATOM   5278  C C   . VAL C 1 216 ? 52.088  -25.856 129.269 1.00 28.61 ? 444  VAL C C   1 
ATOM   5279  O O   . VAL C 1 216 ? 51.172  -25.039 129.364 1.00 28.73 ? 444  VAL C O   1 
ATOM   5280  C CB  . VAL C 1 216 ? 53.969  -25.479 127.625 1.00 28.74 ? 444  VAL C CB  1 
ATOM   5281  C CG1 . VAL C 1 216 ? 52.942  -24.806 126.704 1.00 28.51 ? 444  VAL C CG1 1 
ATOM   5282  C CG2 . VAL C 1 216 ? 55.343  -24.864 127.414 1.00 28.83 ? 444  VAL C CG2 1 
ATOM   5283  N N   . PRO C 1 217 ? 51.868  -27.187 129.266 1.00 28.47 ? 445  PRO C N   1 
ATOM   5284  C CA  . PRO C 1 217 ? 50.511  -27.688 129.519 1.00 28.35 ? 445  PRO C CA  1 
ATOM   5285  C C   . PRO C 1 217 ? 49.908  -27.245 130.856 1.00 28.16 ? 445  PRO C C   1 
ATOM   5286  O O   . PRO C 1 217 ? 48.738  -26.855 130.888 1.00 28.07 ? 445  PRO C O   1 
ATOM   5287  C CB  . PRO C 1 217 ? 50.680  -29.214 129.492 1.00 28.44 ? 445  PRO C CB  1 
ATOM   5288  C CG  . PRO C 1 217 ? 52.141  -29.456 129.643 1.00 28.61 ? 445  PRO C CG  1 
ATOM   5289  C CD  . PRO C 1 217 ? 52.805  -28.291 128.995 1.00 28.54 ? 445  PRO C CD  1 
ATOM   5290  N N   . MET C 1 218 ? 50.691  -27.310 131.939 1.00 27.90 ? 446  MET C N   1 
ATOM   5291  C CA  . MET C 1 218 ? 50.209  -26.900 133.266 1.00 27.61 ? 446  MET C CA  1 
ATOM   5292  C C   . MET C 1 218 ? 49.552  -25.532 133.170 1.00 27.50 ? 446  MET C C   1 
ATOM   5293  O O   . MET C 1 218 ? 48.360  -25.395 133.436 1.00 27.59 ? 446  MET C O   1 
ATOM   5294  C CB  . MET C 1 218 ? 51.341  -26.856 134.297 1.00 27.54 ? 446  MET C CB  1 
ATOM   5295  C CG  . MET C 1 218 ? 51.847  -28.221 134.739 1.00 27.48 ? 446  MET C CG  1 
ATOM   5296  S SD  . MET C 1 218 ? 52.368  -28.261 136.469 1.00 27.39 ? 446  MET C SD  1 
ATOM   5297  C CE  . MET C 1 218 ? 50.787  -28.217 137.306 1.00 27.06 ? 446  MET C CE  1 
ATOM   5298  N N   . HIS C 1 219 ? 50.332  -24.538 132.753 1.00 27.23 ? 447  HIS C N   1 
ATOM   5299  C CA  . HIS C 1 219 ? 49.841  -23.175 132.538 1.00 27.06 ? 447  HIS C CA  1 
ATOM   5300  C C   . HIS C 1 219 ? 48.457  -23.148 131.871 1.00 26.88 ? 447  HIS C C   1 
ATOM   5301  O O   . HIS C 1 219 ? 47.625  -22.305 132.205 1.00 26.92 ? 447  HIS C O   1 
ATOM   5302  C CB  . HIS C 1 219 ? 50.885  -22.384 131.729 1.00 27.09 ? 447  HIS C CB  1 
ATOM   5303  C CG  . HIS C 1 219 ? 50.373  -21.119 131.102 1.00 27.40 ? 447  HIS C CG  1 
ATOM   5304  N ND1 . HIS C 1 219 ? 50.633  -19.869 131.625 1.00 27.76 ? 447  HIS C ND1 1 
ATOM   5305  C CD2 . HIS C 1 219 ? 49.656  -20.908 129.971 1.00 27.46 ? 447  HIS C CD2 1 
ATOM   5306  C CE1 . HIS C 1 219 ? 50.078  -18.946 130.857 1.00 27.68 ? 447  HIS C CE1 1 
ATOM   5307  N NE2 . HIS C 1 219 ? 49.478  -19.551 129.848 1.00 27.22 ? 447  HIS C NE2 1 
ATOM   5308  N N   . LYS C 1 220 ? 48.202  -24.069 130.945 1.00 26.70 ? 448  LYS C N   1 
ATOM   5309  C CA  . LYS C 1 220 ? 46.884  -24.145 130.305 1.00 26.60 ? 448  LYS C CA  1 
ATOM   5310  C C   . LYS C 1 220 ? 45.813  -24.541 131.325 1.00 26.33 ? 448  LYS C C   1 
ATOM   5311  O O   . LYS C 1 220 ? 44.777  -23.886 131.417 1.00 26.22 ? 448  LYS C O   1 
ATOM   5312  C CB  . LYS C 1 220 ? 46.875  -25.113 129.109 1.00 26.69 ? 448  LYS C CB  1 
ATOM   5313  C CG  . LYS C 1 220 ? 48.036  -24.922 128.127 1.00 26.93 ? 448  LYS C CG  1 
ATOM   5314  C CD  . LYS C 1 220 ? 47.653  -25.281 126.685 1.00 27.08 ? 448  LYS C CD  1 
ATOM   5315  C CE  . LYS C 1 220 ? 48.814  -25.046 125.709 1.00 26.94 ? 448  LYS C CE  1 
ATOM   5316  N NZ  . LYS C 1 220 ? 48.355  -24.614 124.348 1.00 26.47 ? 448  LYS C NZ  1 
ATOM   5317  N N   . LEU C 1 221 ? 46.072  -25.595 132.098 1.00 26.06 ? 449  LEU C N   1 
ATOM   5318  C CA  . LEU C 1 221 ? 45.139  -26.026 133.139 1.00 25.87 ? 449  LEU C CA  1 
ATOM   5319  C C   . LEU C 1 221 ? 44.865  -24.881 134.111 1.00 25.73 ? 449  LEU C C   1 
ATOM   5320  O O   . LEU C 1 221 ? 43.718  -24.514 134.331 1.00 25.61 ? 449  LEU C O   1 
ATOM   5321  C CB  . LEU C 1 221 ? 45.677  -27.245 133.901 1.00 25.91 ? 449  LEU C CB  1 
ATOM   5322  C CG  . LEU C 1 221 ? 44.702  -27.946 134.863 1.00 25.89 ? 449  LEU C CG  1 
ATOM   5323  C CD1 . LEU C 1 221 ? 43.615  -28.690 134.094 1.00 25.92 ? 449  LEU C CD1 1 
ATOM   5324  C CD2 . LEU C 1 221 ? 45.437  -28.907 135.797 1.00 25.76 ? 449  LEU C CD2 1 
ATOM   5325  N N   . PHE C 1 222 ? 45.933  -24.305 134.657 1.00 25.69 ? 450  PHE C N   1 
ATOM   5326  C CA  . PHE C 1 222 ? 45.839  -23.225 135.649 1.00 25.75 ? 450  PHE C CA  1 
ATOM   5327  C C   . PHE C 1 222 ? 44.952  -22.079 135.161 1.00 25.81 ? 450  PHE C C   1 
ATOM   5328  O O   . PHE C 1 222 ? 43.939  -21.758 135.783 1.00 25.81 ? 450  PHE C O   1 
ATOM   5329  C CB  . PHE C 1 222 ? 47.233  -22.662 135.960 1.00 25.79 ? 450  PHE C CB  1 
ATOM   5330  C CG  . PHE C 1 222 ? 48.104  -23.560 136.818 1.00 26.01 ? 450  PHE C CG  1 
ATOM   5331  C CD1 . PHE C 1 222 ? 47.823  -24.916 137.001 1.00 26.22 ? 450  PHE C CD1 1 
ATOM   5332  C CD2 . PHE C 1 222 ? 49.242  -23.039 137.421 1.00 26.20 ? 450  PHE C CD2 1 
ATOM   5333  C CE1 . PHE C 1 222 ? 48.648  -25.716 137.788 1.00 26.08 ? 450  PHE C CE1 1 
ATOM   5334  C CE2 . PHE C 1 222 ? 50.066  -23.836 138.205 1.00 26.19 ? 450  PHE C CE2 1 
ATOM   5335  C CZ  . PHE C 1 222 ? 49.770  -25.175 138.386 1.00 26.04 ? 450  PHE C CZ  1 
ATOM   5336  N N   . LEU C 1 223 ? 45.345  -21.479 134.039 1.00 25.78 ? 451  LEU C N   1 
ATOM   5337  C CA  . LEU C 1 223 ? 44.657  -20.319 133.484 1.00 25.82 ? 451  LEU C CA  1 
ATOM   5338  C C   . LEU C 1 223 ? 43.188  -20.602 133.197 1.00 25.97 ? 451  LEU C C   1 
ATOM   5339  O O   . LEU C 1 223 ? 42.331  -19.747 133.436 1.00 26.04 ? 451  LEU C O   1 
ATOM   5340  C CB  . LEU C 1 223 ? 45.353  -19.852 132.201 1.00 25.81 ? 451  LEU C CB  1 
ATOM   5341  C CG  . LEU C 1 223 ? 44.648  -18.758 131.386 1.00 25.87 ? 451  LEU C CG  1 
ATOM   5342  C CD1 . LEU C 1 223 ? 44.350  -17.547 132.250 1.00 26.03 ? 451  LEU C CD1 1 
ATOM   5343  C CD2 . LEU C 1 223 ? 45.467  -18.360 130.160 1.00 25.89 ? 451  LEU C CD2 1 
ATOM   5344  N N   . GLU C 1 224 ? 42.905  -21.788 132.660 1.00 26.10 ? 452  GLU C N   1 
ATOM   5345  C CA  . GLU C 1 224 ? 41.521  -22.216 132.423 1.00 26.31 ? 452  GLU C CA  1 
ATOM   5346  C C   . GLU C 1 224 ? 40.703  -22.136 133.712 1.00 25.92 ? 452  GLU C C   1 
ATOM   5347  O O   . GLU C 1 224 ? 39.632  -21.520 133.734 1.00 26.04 ? 452  GLU C O   1 
ATOM   5348  C CB  . GLU C 1 224 ? 41.472  -23.654 131.879 1.00 26.44 ? 452  GLU C CB  1 
ATOM   5349  C CG  . GLU C 1 224 ? 41.759  -23.790 130.378 1.00 26.97 ? 452  GLU C CG  1 
ATOM   5350  C CD  . GLU C 1 224 ? 42.152  -25.217 129.968 1.00 27.20 ? 452  GLU C CD  1 
ATOM   5351  O OE1 . GLU C 1 224 ? 42.120  -26.133 130.834 1.00 27.13 ? 452  GLU C OE1 1 
ATOM   5352  O OE2 . GLU C 1 224 ? 42.500  -25.413 128.774 1.00 28.29 ? 452  GLU C OE2 1 
ATOM   5353  N N   . MET C 1 225 ? 41.237  -22.720 134.785 1.00 25.40 ? 453  MET C N   1 
ATOM   5354  C CA  . MET C 1 225 ? 40.470  -22.928 136.014 1.00 25.12 ? 453  MET C CA  1 
ATOM   5355  C C   . MET C 1 225 ? 40.420  -21.735 136.951 1.00 24.91 ? 453  MET C C   1 
ATOM   5356  O O   . MET C 1 225 ? 39.580  -21.712 137.843 1.00 24.98 ? 453  MET C O   1 
ATOM   5357  C CB  . MET C 1 225 ? 41.008  -24.108 136.811 1.00 25.00 ? 453  MET C CB  1 
ATOM   5358  C CG  . MET C 1 225 ? 41.528  -25.256 135.985 1.00 25.11 ? 453  MET C CG  1 
ATOM   5359  S SD  . MET C 1 225 ? 40.900  -26.832 136.529 1.00 25.39 ? 453  MET C SD  1 
ATOM   5360  C CE  . MET C 1 225 ? 40.908  -26.634 138.311 1.00 26.07 ? 453  MET C CE  1 
ATOM   5361  N N   . LEU C 1 226 ? 41.313  -20.761 136.777 1.00 24.70 ? 454  LEU C N   1 
ATOM   5362  C CA  . LEU C 1 226 ? 41.282  -19.542 137.600 1.00 24.48 ? 454  LEU C CA  1 
ATOM   5363  C C   . LEU C 1 226 ? 40.179  -18.574 137.169 1.00 24.50 ? 454  LEU C C   1 
ATOM   5364  O O   . LEU C 1 226 ? 39.943  -17.568 137.839 1.00 24.54 ? 454  LEU C O   1 
ATOM   5365  C CB  . LEU C 1 226 ? 42.636  -18.825 137.589 1.00 24.37 ? 454  LEU C CB  1 
ATOM   5366  C CG  . LEU C 1 226 ? 43.744  -19.477 138.414 1.00 24.05 ? 454  LEU C CG  1 
ATOM   5367  C CD1 . LEU C 1 226 ? 45.045  -18.760 138.182 1.00 24.08 ? 454  LEU C CD1 1 
ATOM   5368  C CD2 . LEU C 1 226 ? 43.412  -19.477 139.893 1.00 24.09 ? 454  LEU C CD2 1 
ATOM   5369  N N   . GLU C 1 227 ? 39.506  -18.881 136.060 1.00 24.55 ? 455  GLU C N   1 
ATOM   5370  C CA  . GLU C 1 227 ? 38.450  -18.022 135.526 1.00 24.62 ? 455  GLU C CA  1 
ATOM   5371  C C   . GLU C 1 227 ? 37.405  -18.841 134.771 1.00 24.58 ? 455  GLU C C   1 
ATOM   5372  O O   . GLU C 1 227 ? 37.044  -19.942 135.195 1.00 24.59 ? 455  GLU C O   1 
ATOM   5373  C CB  . GLU C 1 227 ? 39.061  -16.966 134.609 1.00 24.59 ? 455  GLU C CB  1 
ATOM   5374  C CG  . GLU C 1 227 ? 40.148  -17.508 133.682 1.00 24.63 ? 455  GLU C CG  1 
ATOM   5375  C CD  . GLU C 1 227 ? 40.504  -16.535 132.571 1.00 24.83 ? 455  GLU C CD  1 
ATOM   5376  O OE1 . GLU C 1 227 ? 40.841  -15.375 132.893 1.00 25.12 ? 455  GLU C OE1 1 
ATOM   5377  O OE2 . GLU C 1 227 ? 40.445  -16.924 131.379 1.00 24.77 ? 455  GLU C OE2 1 
ATOM   5378  N N   . PRO D 1 5   ? 41.444  -30.826 21.729  1.00 28.35 ? 233  PRO D N   1 
ATOM   5379  C CA  . PRO D 1 5   ? 42.076  -31.939 22.453  1.00 28.39 ? 233  PRO D CA  1 
ATOM   5380  C C   . PRO D 1 5   ? 41.094  -32.674 23.384  1.00 28.28 ? 233  PRO D C   1 
ATOM   5381  O O   . PRO D 1 5   ? 39.874  -32.581 23.183  1.00 28.65 ? 233  PRO D O   1 
ATOM   5382  C CB  . PRO D 1 5   ? 43.204  -31.250 23.256  1.00 28.43 ? 233  PRO D CB  1 
ATOM   5383  C CG  . PRO D 1 5   ? 42.984  -29.758 23.101  1.00 28.36 ? 233  PRO D CG  1 
ATOM   5384  C CD  . PRO D 1 5   ? 42.224  -29.581 21.830  1.00 28.32 ? 233  PRO D CD  1 
ATOM   5385  N N   . TYR D 1 6   ? 41.637  -33.428 24.349  1.00 27.73 ? 234  TYR D N   1 
ATOM   5386  C CA  . TYR D 1 6   ? 40.891  -33.975 25.500  1.00 27.07 ? 234  TYR D CA  1 
ATOM   5387  C C   . TYR D 1 6   ? 41.583  -33.486 26.770  1.00 26.16 ? 234  TYR D C   1 
ATOM   5388  O O   . TYR D 1 6   ? 42.815  -33.453 26.828  1.00 26.22 ? 234  TYR D O   1 
ATOM   5389  C CB  . TYR D 1 6   ? 40.860  -35.512 25.436  1.00 27.31 ? 234  TYR D CB  1 
ATOM   5390  C CG  . TYR D 1 6   ? 40.892  -36.273 26.767  1.00 27.70 ? 234  TYR D CG  1 
ATOM   5391  C CD1 . TYR D 1 6   ? 42.098  -36.517 27.433  1.00 27.86 ? 234  TYR D CD1 1 
ATOM   5392  C CD2 . TYR D 1 6   ? 39.721  -36.803 27.329  1.00 27.97 ? 234  TYR D CD2 1 
ATOM   5393  C CE1 . TYR D 1 6   ? 42.130  -37.230 28.648  1.00 27.56 ? 234  TYR D CE1 1 
ATOM   5394  C CE2 . TYR D 1 6   ? 39.750  -37.519 28.537  1.00 27.42 ? 234  TYR D CE2 1 
ATOM   5395  C CZ  . TYR D 1 6   ? 40.954  -37.724 29.185  1.00 27.09 ? 234  TYR D CZ  1 
ATOM   5396  O OH  . TYR D 1 6   ? 40.972  -38.418 30.364  1.00 27.26 ? 234  TYR D OH  1 
ATOM   5397  N N   . ASN D 1 7   ? 40.795  -33.109 27.772  1.00 24.77 ? 235  ASN D N   1 
ATOM   5398  C CA  . ASN D 1 7   ? 41.324  -32.560 29.010  1.00 23.81 ? 235  ASN D CA  1 
ATOM   5399  C C   . ASN D 1 7   ? 40.985  -33.481 30.176  1.00 22.85 ? 235  ASN D C   1 
ATOM   5400  O O   . ASN D 1 7   ? 39.820  -33.812 30.387  1.00 22.81 ? 235  ASN D O   1 
ATOM   5401  C CB  . ASN D 1 7   ? 40.726  -31.172 29.224  1.00 23.85 ? 235  ASN D CB  1 
ATOM   5402  C CG  . ASN D 1 7   ? 41.154  -30.527 30.532  1.00 24.08 ? 235  ASN D CG  1 
ATOM   5403  O OD1 . ASN D 1 7   ? 40.650  -29.461 30.863  1.00 25.29 ? 235  ASN D OD1 1 
ATOM   5404  N ND2 . ASN D 1 7   ? 42.076  -31.155 31.278  1.00 23.44 ? 235  ASN D ND2 1 
ATOM   5405  N N   . LYS D 1 8   ? 41.997  -33.874 30.944  1.00 21.66 ? 236  LYS D N   1 
ATOM   5406  C CA  . LYS D 1 8   ? 41.806  -34.868 32.000  1.00 20.88 ? 236  LYS D CA  1 
ATOM   5407  C C   . LYS D 1 8   ? 40.799  -34.418 33.059  1.00 19.77 ? 236  LYS D C   1 
ATOM   5408  O O   . LYS D 1 8   ? 39.870  -35.150 33.395  1.00 19.45 ? 236  LYS D O   1 
ATOM   5409  C CB  . LYS D 1 8   ? 43.152  -35.239 32.648  1.00 20.98 ? 236  LYS D CB  1 
ATOM   5410  C CG  . LYS D 1 8   ? 43.089  -36.517 33.471  1.00 21.59 ? 236  LYS D CG  1 
ATOM   5411  C CD  . LYS D 1 8   ? 44.381  -37.361 33.480  1.00 21.45 ? 236  LYS D CD  1 
ATOM   5412  C CE  . LYS D 1 8   ? 44.141  -38.626 34.344  1.00 22.05 ? 236  LYS D CE  1 
ATOM   5413  N NZ  . LYS D 1 8   ? 45.361  -39.342 34.819  1.00 22.44 ? 236  LYS D NZ  1 
ATOM   5414  N N   . ILE D 1 9   ? 40.975  -33.193 33.544  1.00 18.88 ? 237  ILE D N   1 
ATOM   5415  C CA  . ILE D 1 9   ? 40.211  -32.671 34.684  1.00 17.91 ? 237  ILE D CA  1 
ATOM   5416  C C   . ILE D 1 9   ? 38.750  -32.347 34.355  1.00 17.60 ? 237  ILE D C   1 
ATOM   5417  O O   . ILE D 1 9   ? 37.880  -32.498 35.203  1.00 17.44 ? 237  ILE D O   1 
ATOM   5418  C CB  . ILE D 1 9   ? 40.912  -31.432 35.290  1.00 17.50 ? 237  ILE D CB  1 
ATOM   5419  C CG1 . ILE D 1 9   ? 42.059  -31.869 36.196  1.00 16.64 ? 237  ILE D CG1 1 
ATOM   5420  C CG2 . ILE D 1 9   ? 39.946  -30.605 36.094  1.00 17.93 ? 237  ILE D CG2 1 
ATOM   5421  C CD1 . ILE D 1 9   ? 43.185  -30.895 36.254  1.00 15.89 ? 237  ILE D CD1 1 
ATOM   5422  N N   . VAL D 1 10  ? 38.470  -31.901 33.137  1.00 17.38 ? 238  VAL D N   1 
ATOM   5423  C CA  . VAL D 1 10  ? 37.082  -31.635 32.755  1.00 17.26 ? 238  VAL D CA  1 
ATOM   5424  C C   . VAL D 1 10  ? 36.317  -32.937 32.558  1.00 17.03 ? 238  VAL D C   1 
ATOM   5425  O O   . VAL D 1 10  ? 35.155  -33.034 32.939  1.00 17.16 ? 238  VAL D O   1 
ATOM   5426  C CB  . VAL D 1 10  ? 36.964  -30.791 31.466  1.00 17.46 ? 238  VAL D CB  1 
ATOM   5427  C CG1 . VAL D 1 10  ? 35.491  -30.664 31.047  1.00 17.65 ? 238  VAL D CG1 1 
ATOM   5428  C CG2 . VAL D 1 10  ? 37.590  -29.404 31.659  1.00 17.38 ? 238  VAL D CG2 1 
ATOM   5429  N N   . SER D 1 11  ? 36.965  -33.932 31.961  1.00 16.77 ? 239  SER D N   1 
ATOM   5430  C CA  . SER D 1 11  ? 36.312  -35.205 31.703  1.00 16.56 ? 239  SER D CA  1 
ATOM   5431  C C   . SER D 1 11  ? 35.923  -35.867 33.007  1.00 16.66 ? 239  SER D C   1 
ATOM   5432  O O   . SER D 1 11  ? 34.864  -36.485 33.099  1.00 16.96 ? 239  SER D O   1 
ATOM   5433  C CB  . SER D 1 11  ? 37.204  -36.125 30.879  1.00 16.54 ? 239  SER D CB  1 
ATOM   5434  O OG  . SER D 1 11  ? 37.179  -35.743 29.512  1.00 16.70 ? 239  SER D OG  1 
ATOM   5435  N N   . HIS D 1 12  ? 36.765  -35.726 34.026  1.00 16.69 ? 240  HIS D N   1 
ATOM   5436  C CA  . HIS D 1 12  ? 36.426  -36.238 35.349  1.00 16.68 ? 240  HIS D CA  1 
ATOM   5437  C C   . HIS D 1 12  ? 35.249  -35.497 36.001  1.00 16.24 ? 240  HIS D C   1 
ATOM   5438  O O   . HIS D 1 12  ? 34.414  -36.128 36.665  1.00 16.33 ? 240  HIS D O   1 
ATOM   5439  C CB  . HIS D 1 12  ? 37.623  -36.197 36.291  1.00 16.97 ? 240  HIS D CB  1 
ATOM   5440  C CG  . HIS D 1 12  ? 37.388  -36.953 37.564  1.00 18.98 ? 240  HIS D CG  1 
ATOM   5441  N ND1 . HIS D 1 12  ? 37.651  -38.302 37.690  1.00 20.33 ? 240  HIS D ND1 1 
ATOM   5442  C CD2 . HIS D 1 12  ? 36.845  -36.566 38.745  1.00 20.21 ? 240  HIS D CD2 1 
ATOM   5443  C CE1 . HIS D 1 12  ? 37.317  -38.703 38.905  1.00 20.00 ? 240  HIS D CE1 1 
ATOM   5444  N NE2 . HIS D 1 12  ? 36.826  -37.670 39.566  1.00 19.45 ? 240  HIS D NE2 1 
ATOM   5445  N N   . LEU D 1 13  ? 35.200  -34.174 35.835  1.00 15.62 ? 241  LEU D N   1 
ATOM   5446  C CA  . LEU D 1 13  ? 34.092  -33.370 36.365  1.00 15.26 ? 241  LEU D CA  1 
ATOM   5447  C C   . LEU D 1 13  ? 32.791  -33.723 35.655  1.00 15.27 ? 241  LEU D C   1 
ATOM   5448  O O   . LEU D 1 13  ? 31.736  -33.818 36.290  1.00 15.05 ? 241  LEU D O   1 
ATOM   5449  C CB  . LEU D 1 13  ? 34.373  -31.865 36.230  1.00 15.03 ? 241  LEU D CB  1 
ATOM   5450  C CG  . LEU D 1 13  ? 35.427  -31.273 37.172  1.00 14.50 ? 241  LEU D CG  1 
ATOM   5451  C CD1 . LEU D 1 13  ? 35.832  -29.865 36.752  1.00 13.84 ? 241  LEU D CD1 1 
ATOM   5452  C CD2 . LEU D 1 13  ? 34.935  -31.275 38.599  1.00 13.60 ? 241  LEU D CD2 1 
ATOM   5453  N N   . LEU D 1 14  ? 32.880  -33.926 34.340  1.00 15.30 ? 242  LEU D N   1 
ATOM   5454  C CA  . LEU D 1 14  ? 31.742  -34.369 33.537  1.00 15.25 ? 242  LEU D CA  1 
ATOM   5455  C C   . LEU D 1 14  ? 31.111  -35.656 34.094  1.00 15.50 ? 242  LEU D C   1 
ATOM   5456  O O   . LEU D 1 14  ? 29.891  -35.746 34.196  1.00 15.59 ? 242  LEU D O   1 
ATOM   5457  C CB  . LEU D 1 14  ? 32.150  -34.568 32.069  1.00 15.02 ? 242  LEU D CB  1 
ATOM   5458  C CG  . LEU D 1 14  ? 32.306  -33.322 31.191  1.00 14.72 ? 242  LEU D CG  1 
ATOM   5459  C CD1 . LEU D 1 14  ? 32.704  -33.676 29.770  1.00 13.37 ? 242  LEU D CD1 1 
ATOM   5460  C CD2 . LEU D 1 14  ? 31.019  -32.535 31.178  1.00 15.42 ? 242  LEU D CD2 1 
ATOM   5461  N N   . VAL D 1 15  ? 31.933  -36.643 34.454  1.00 15.68 ? 243  VAL D N   1 
ATOM   5462  C CA  . VAL D 1 15  ? 31.421  -37.895 35.029  1.00 15.88 ? 243  VAL D CA  1 
ATOM   5463  C C   . VAL D 1 15  ? 31.113  -37.754 36.524  1.00 16.05 ? 243  VAL D C   1 
ATOM   5464  O O   . VAL D 1 15  ? 30.343  -38.527 37.073  1.00 15.99 ? 243  VAL D O   1 
ATOM   5465  C CB  . VAL D 1 15  ? 32.377  -39.107 34.787  1.00 15.89 ? 243  VAL D CB  1 
ATOM   5466  C CG1 . VAL D 1 15  ? 32.800  -39.163 33.336  1.00 15.63 ? 243  VAL D CG1 1 
ATOM   5467  C CG2 . VAL D 1 15  ? 33.599  -39.056 35.699  1.00 16.25 ? 243  VAL D CG2 1 
ATOM   5468  N N   . ALA D 1 16  ? 31.722  -36.766 37.174  1.00 16.60 ? 244  ALA D N   1 
ATOM   5469  C CA  . ALA D 1 16  ? 31.367  -36.396 38.554  1.00 16.84 ? 244  ALA D CA  1 
ATOM   5470  C C   . ALA D 1 16  ? 29.992  -35.731 38.660  1.00 16.95 ? 244  ALA D C   1 
ATOM   5471  O O   . ALA D 1 16  ? 29.382  -35.758 39.718  1.00 17.00 ? 244  ALA D O   1 
ATOM   5472  C CB  . ALA D 1 16  ? 32.427  -35.475 39.144  1.00 16.70 ? 244  ALA D CB  1 
ATOM   5473  N N   . GLU D 1 17  ? 29.514  -35.140 37.569  1.00 17.31 ? 245  GLU D N   1 
ATOM   5474  C CA  . GLU D 1 17  ? 28.243  -34.422 37.571  1.00 17.64 ? 245  GLU D CA  1 
ATOM   5475  C C   . GLU D 1 17  ? 27.112  -35.305 38.099  1.00 18.09 ? 245  GLU D C   1 
ATOM   5476  O O   . GLU D 1 17  ? 26.929  -36.434 37.620  1.00 18.06 ? 245  GLU D O   1 
ATOM   5477  C CB  . GLU D 1 17  ? 27.898  -33.925 36.166  1.00 17.59 ? 245  GLU D CB  1 
ATOM   5478  C CG  . GLU D 1 17  ? 26.652  -33.046 36.085  1.00 18.18 ? 245  GLU D CG  1 
ATOM   5479  C CD  . GLU D 1 17  ? 26.794  -31.698 36.798  1.00 19.87 ? 245  GLU D CD  1 
ATOM   5480  O OE1 . GLU D 1 17  ? 27.940  -31.218 36.995  1.00 20.47 ? 245  GLU D OE1 1 
ATOM   5481  O OE2 . GLU D 1 17  ? 25.746  -31.108 37.154  1.00 20.48 ? 245  GLU D OE2 1 
ATOM   5482  N N   . PRO D 1 18  ? 26.367  -34.805 39.109  1.00 18.45 ? 246  PRO D N   1 
ATOM   5483  C CA  . PRO D 1 18  ? 25.201  -35.495 39.647  1.00 18.53 ? 246  PRO D CA  1 
ATOM   5484  C C   . PRO D 1 18  ? 24.090  -35.781 38.644  1.00 18.72 ? 246  PRO D C   1 
ATOM   5485  O O   . PRO D 1 18  ? 24.077  -35.242 37.537  1.00 18.47 ? 246  PRO D O   1 
ATOM   5486  C CB  . PRO D 1 18  ? 24.680  -34.522 40.715  1.00 18.50 ? 246  PRO D CB  1 
ATOM   5487  C CG  . PRO D 1 18  ? 25.830  -33.725 41.096  1.00 18.49 ? 246  PRO D CG  1 
ATOM   5488  C CD  . PRO D 1 18  ? 26.638  -33.563 39.854  1.00 18.38 ? 246  PRO D CD  1 
ATOM   5489  N N   . GLU D 1 19  ? 23.164  -36.636 39.075  1.00 19.14 ? 247  GLU D N   1 
ATOM   5490  C CA  . GLU D 1 19  ? 21.973  -36.990 38.314  1.00 19.27 ? 247  GLU D CA  1 
ATOM   5491  C C   . GLU D 1 19  ? 20.808  -36.069 38.672  1.00 19.24 ? 247  GLU D C   1 
ATOM   5492  O O   . GLU D 1 19  ? 20.794  -35.460 39.745  1.00 19.31 ? 247  GLU D O   1 
ATOM   5493  C CB  . GLU D 1 19  ? 21.589  -38.450 38.582  1.00 19.35 ? 247  GLU D CB  1 
ATOM   5494  C CG  . GLU D 1 19  ? 22.519  -39.467 37.924  1.00 19.76 ? 247  GLU D CG  1 
ATOM   5495  C CD  . GLU D 1 19  ? 22.223  -39.678 36.437  1.00 20.11 ? 247  GLU D CD  1 
ATOM   5496  O OE1 . GLU D 1 19  ? 21.984  -38.682 35.717  1.00 19.62 ? 247  GLU D OE1 1 
ATOM   5497  O OE2 . GLU D 1 19  ? 22.231  -40.846 35.987  1.00 20.40 ? 247  GLU D OE2 1 
ATOM   5498  N N   . LYS D 1 20  ? 19.834  -35.992 37.766  1.00 19.11 ? 248  LYS D N   1 
ATOM   5499  C CA  . LYS D 1 20  ? 18.694  -35.086 37.898  1.00 18.97 ? 248  LYS D CA  1 
ATOM   5500  C C   . LYS D 1 20  ? 17.931  -35.300 39.207  1.00 18.73 ? 248  LYS D C   1 
ATOM   5501  O O   . LYS D 1 20  ? 17.539  -36.429 39.522  1.00 18.65 ? 248  LYS D O   1 
ATOM   5502  C CB  . LYS D 1 20  ? 17.731  -35.273 36.722  1.00 19.13 ? 248  LYS D CB  1 
ATOM   5503  C CG  . LYS D 1 20  ? 18.277  -34.789 35.390  1.00 19.62 ? 248  LYS D CG  1 
ATOM   5504  C CD  . LYS D 1 20  ? 17.164  -34.585 34.367  1.00 20.33 ? 248  LYS D CD  1 
ATOM   5505  C CE  . LYS D 1 20  ? 17.689  -33.960 33.080  1.00 20.55 ? 248  LYS D CE  1 
ATOM   5506  N NZ  . LYS D 1 20  ? 16.582  -33.588 32.158  1.00 21.05 ? 248  LYS D NZ  1 
ATOM   5507  N N   . ILE D 1 21  ? 17.727  -34.213 39.957  1.00 18.30 ? 249  ILE D N   1 
ATOM   5508  C CA  . ILE D 1 21  ? 16.908  -34.241 41.169  1.00 17.99 ? 249  ILE D CA  1 
ATOM   5509  C C   . ILE D 1 21  ? 15.620  -33.466 40.935  1.00 17.70 ? 249  ILE D C   1 
ATOM   5510  O O   . ILE D 1 21  ? 15.623  -32.413 40.288  1.00 17.53 ? 249  ILE D O   1 
ATOM   5511  C CB  . ILE D 1 21  ? 17.649  -33.667 42.389  1.00 18.13 ? 249  ILE D CB  1 
ATOM   5512  C CG1 . ILE D 1 21  ? 18.845  -34.553 42.736  1.00 18.53 ? 249  ILE D CG1 1 
ATOM   5513  C CG2 . ILE D 1 21  ? 16.724  -33.578 43.604  1.00 17.63 ? 249  ILE D CG2 1 
ATOM   5514  C CD1 . ILE D 1 21  ? 19.848  -33.869 43.643  1.00 19.09 ? 249  ILE D CD1 1 
ATOM   5515  N N   . TYR D 1 22  ? 14.536  -34.011 41.490  1.00 17.43 ? 250  TYR D N   1 
ATOM   5516  C CA  . TYR D 1 22  ? 13.177  -33.571 41.230  1.00 17.16 ? 250  TYR D CA  1 
ATOM   5517  C C   . TYR D 1 22  ? 12.588  -32.940 42.487  1.00 16.94 ? 250  TYR D C   1 
ATOM   5518  O O   . TYR D 1 22  ? 12.794  -33.440 43.585  1.00 16.86 ? 250  TYR D O   1 
ATOM   5519  C CB  . TYR D 1 22  ? 12.346  -34.772 40.761  1.00 17.23 ? 250  TYR D CB  1 
ATOM   5520  C CG  . TYR D 1 22  ? 12.773  -35.267 39.394  1.00 17.31 ? 250  TYR D CG  1 
ATOM   5521  C CD1 . TYR D 1 22  ? 13.886  -36.088 39.244  1.00 17.40 ? 250  TYR D CD1 1 
ATOM   5522  C CD2 . TYR D 1 22  ? 12.081  -34.883 38.246  1.00 17.70 ? 250  TYR D CD2 1 
ATOM   5523  C CE1 . TYR D 1 22  ? 14.298  -36.522 37.984  1.00 17.94 ? 250  TYR D CE1 1 
ATOM   5524  C CE2 . TYR D 1 22  ? 12.479  -35.313 36.980  1.00 17.92 ? 250  TYR D CE2 1 
ATOM   5525  C CZ  . TYR D 1 22  ? 13.590  -36.132 36.852  1.00 18.02 ? 250  TYR D CZ  1 
ATOM   5526  O OH  . TYR D 1 22  ? 13.993  -36.552 35.598  1.00 17.51 ? 250  TYR D OH  1 
ATOM   5527  N N   . ALA D 1 23  ? 11.865  -31.836 42.316  1.00 16.73 ? 251  ALA D N   1 
ATOM   5528  C CA  . ALA D 1 23  ? 11.315  -31.067 43.441  1.00 16.56 ? 251  ALA D CA  1 
ATOM   5529  C C   . ALA D 1 23  ? 10.150  -31.748 44.166  1.00 16.53 ? 251  ALA D C   1 
ATOM   5530  O O   . ALA D 1 23  ? 9.888   -31.438 45.333  1.00 16.50 ? 251  ALA D O   1 
ATOM   5531  C CB  . ALA D 1 23  ? 10.879  -29.685 42.963  1.00 16.46 ? 251  ALA D CB  1 
ATOM   5532  N N   . MET D 1 24  ? 9.456   -32.656 43.474  1.00 16.43 ? 252  MET D N   1 
ATOM   5533  C CA  . MET D 1 24  ? 8.243   -33.310 43.991  1.00 16.41 ? 252  MET D CA  1 
ATOM   5534  C C   . MET D 1 24  ? 7.393   -32.364 44.831  1.00 16.11 ? 252  MET D C   1 
ATOM   5535  O O   . MET D 1 24  ? 7.308   -32.520 46.047  1.00 15.97 ? 252  MET D O   1 
ATOM   5536  C CB  . MET D 1 24  ? 8.606   -34.566 44.792  1.00 16.46 ? 252  MET D CB  1 
ATOM   5537  C CG  . MET D 1 24  ? 8.720   -35.833 43.943  1.00 16.78 ? 252  MET D CG  1 
ATOM   5538  S SD  . MET D 1 24  ? 10.299  -36.669 44.202  1.00 17.16 ? 252  MET D SD  1 
ATOM   5539  C CE  . MET D 1 24  ? 10.221  -36.990 45.977  1.00 18.21 ? 252  MET D CE  1 
ATOM   5540  N N   . PRO D 1 25  ? 6.776   -31.363 44.180  1.00 16.04 ? 253  PRO D N   1 
ATOM   5541  C CA  . PRO D 1 25  ? 5.904   -30.448 44.907  1.00 16.01 ? 253  PRO D CA  1 
ATOM   5542  C C   . PRO D 1 25  ? 4.607   -31.142 45.305  1.00 15.97 ? 253  PRO D C   1 
ATOM   5543  O O   . PRO D 1 25  ? 3.968   -31.786 44.468  1.00 15.91 ? 253  PRO D O   1 
ATOM   5544  C CB  . PRO D 1 25  ? 5.649   -29.319 43.902  1.00 16.04 ? 253  PRO D CB  1 
ATOM   5545  C CG  . PRO D 1 25  ? 5.862   -29.931 42.568  1.00 16.01 ? 253  PRO D CG  1 
ATOM   5546  C CD  . PRO D 1 25  ? 6.861   -31.032 42.744  1.00 16.05 ? 253  PRO D CD  1 
ATOM   5547  N N   . ASP D 1 26  ? 4.240   -31.017 46.578  1.00 15.94 ? 254  ASP D N   1 
ATOM   5548  C CA  . ASP D 1 26  ? 3.082   -31.719 47.131  1.00 15.91 ? 254  ASP D CA  1 
ATOM   5549  C C   . ASP D 1 26  ? 1.782   -31.221 46.486  1.00 15.94 ? 254  ASP D C   1 
ATOM   5550  O O   . ASP D 1 26  ? 1.440   -30.044 46.602  1.00 15.93 ? 254  ASP D O   1 
ATOM   5551  C CB  . ASP D 1 26  ? 3.031   -31.538 48.655  1.00 15.87 ? 254  ASP D CB  1 
ATOM   5552  C CG  . ASP D 1 26  ? 2.102   -32.524 49.335  1.00 15.64 ? 254  ASP D CG  1 
ATOM   5553  O OD1 . ASP D 1 26  ? 1.004   -32.784 48.806  1.00 15.19 ? 254  ASP D OD1 1 
ATOM   5554  O OD2 . ASP D 1 26  ? 2.467   -33.037 50.410  1.00 15.54 ? 254  ASP D OD2 1 
ATOM   5555  N N   . PRO D 1 27  ? 1.047   -32.120 45.808  1.00 16.04 ? 255  PRO D N   1 
ATOM   5556  C CA  . PRO D 1 27  ? -0.197  -31.723 45.153  1.00 16.10 ? 255  PRO D CA  1 
ATOM   5557  C C   . PRO D 1 27  ? -1.374  -31.573 46.126  1.00 16.11 ? 255  PRO D C   1 
ATOM   5558  O O   . PRO D 1 27  ? -2.386  -30.966 45.771  1.00 15.99 ? 255  PRO D O   1 
ATOM   5559  C CB  . PRO D 1 27  ? -0.453  -32.877 44.186  1.00 16.11 ? 255  PRO D CB  1 
ATOM   5560  C CG  . PRO D 1 27  ? 0.097   -34.058 44.891  1.00 16.06 ? 255  PRO D CG  1 
ATOM   5561  C CD  . PRO D 1 27  ? 1.314   -33.560 45.631  1.00 16.10 ? 255  PRO D CD  1 
ATOM   5562  N N   . THR D 1 28  ? -1.241  -32.128 47.332  1.00 16.20 ? 256  THR D N   1 
ATOM   5563  C CA  . THR D 1 28  ? -2.288  -32.029 48.356  1.00 16.37 ? 256  THR D CA  1 
ATOM   5564  C C   . THR D 1 28  ? -2.347  -30.635 48.994  1.00 16.34 ? 256  THR D C   1 
ATOM   5565  O O   . THR D 1 28  ? -3.410  -30.194 49.441  1.00 16.29 ? 256  THR D O   1 
ATOM   5566  C CB  . THR D 1 28  ? -2.093  -33.078 49.490  1.00 16.47 ? 256  THR D CB  1 
ATOM   5567  O OG1 . THR D 1 28  ? -0.874  -32.809 50.201  1.00 16.69 ? 256  THR D OG1 1 
ATOM   5568  C CG2 . THR D 1 28  ? -2.067  -34.504 48.926  1.00 16.33 ? 256  THR D CG2 1 
ATOM   5569  N N   . VAL D 1 29  ? -1.206  -29.952 49.035  1.00 16.30 ? 257  VAL D N   1 
ATOM   5570  C CA  . VAL D 1 29  ? -1.106  -28.631 49.654  1.00 16.37 ? 257  VAL D CA  1 
ATOM   5571  C C   . VAL D 1 29  ? -1.464  -27.528 48.640  1.00 16.47 ? 257  VAL D C   1 
ATOM   5572  O O   . VAL D 1 29  ? -0.935  -27.520 47.527  1.00 16.53 ? 257  VAL D O   1 
ATOM   5573  C CB  . VAL D 1 29  ? 0.314   -28.415 50.229  1.00 16.38 ? 257  VAL D CB  1 
ATOM   5574  C CG1 . VAL D 1 29  ? 0.517   -26.974 50.687  1.00 16.19 ? 257  VAL D CG1 1 
ATOM   5575  C CG2 . VAL D 1 29  ? 0.558   -29.394 51.374  1.00 16.36 ? 257  VAL D CG2 1 
ATOM   5576  N N   . PRO D 1 30  ? -2.368  -26.598 49.019  1.00 16.55 ? 258  PRO D N   1 
ATOM   5577  C CA  . PRO D 1 30  ? -2.845  -25.575 48.080  1.00 16.53 ? 258  PRO D CA  1 
ATOM   5578  C C   . PRO D 1 30  ? -1.788  -24.527 47.752  1.00 16.41 ? 258  PRO D C   1 
ATOM   5579  O O   . PRO D 1 30  ? -1.089  -24.068 48.651  1.00 16.42 ? 258  PRO D O   1 
ATOM   5580  C CB  . PRO D 1 30  ? -4.025  -24.935 48.826  1.00 16.60 ? 258  PRO D CB  1 
ATOM   5581  C CG  . PRO D 1 30  ? -3.725  -25.138 50.259  1.00 16.61 ? 258  PRO D CG  1 
ATOM   5582  C CD  . PRO D 1 30  ? -2.997  -26.453 50.347  1.00 16.63 ? 258  PRO D CD  1 
ATOM   5583  N N   . ASP D 1 31  ? -1.700  -24.153 46.477  1.00 16.40 ? 259  ASP D N   1 
ATOM   5584  C CA  . ASP D 1 31  ? -0.667  -23.230 45.977  1.00 16.52 ? 259  ASP D CA  1 
ATOM   5585  C C   . ASP D 1 31  ? -0.518  -21.983 46.862  1.00 16.59 ? 259  ASP D C   1 
ATOM   5586  O O   . ASP D 1 31  ? -1.514  -21.327 47.171  1.00 16.67 ? 259  ASP D O   1 
ATOM   5587  C CB  . ASP D 1 31  ? -0.990  -22.815 44.534  1.00 16.45 ? 259  ASP D CB  1 
ATOM   5588  C CG  . ASP D 1 31  ? -0.838  -23.966 43.542  1.00 16.22 ? 259  ASP D CG  1 
ATOM   5589  O OD1 . ASP D 1 31  ? 0.313   -24.361 43.248  1.00 15.85 ? 259  ASP D OD1 1 
ATOM   5590  O OD2 . ASP D 1 31  ? -1.868  -24.470 43.049  1.00 15.22 ? 259  ASP D OD2 1 
ATOM   5591  N N   . SER D 1 32  ? 0.714   -21.670 47.276  1.00 16.55 ? 260  SER D N   1 
ATOM   5592  C CA  . SER D 1 32  ? 0.952   -20.551 48.203  1.00 16.58 ? 260  SER D CA  1 
ATOM   5593  C C   . SER D 1 32  ? 2.416   -20.141 48.352  1.00 16.51 ? 260  SER D C   1 
ATOM   5594  O O   . SER D 1 32  ? 3.320   -20.765 47.799  1.00 16.58 ? 260  SER D O   1 
ATOM   5595  C CB  . SER D 1 32  ? 0.421   -20.897 49.601  1.00 16.63 ? 260  SER D CB  1 
ATOM   5596  O OG  . SER D 1 32  ? 1.359   -21.690 50.315  1.00 16.74 ? 260  SER D OG  1 
ATOM   5597  N N   . ASP D 1 33  ? 2.619   -19.074 49.121  1.00 16.46 ? 261  ASP D N   1 
ATOM   5598  C CA  . ASP D 1 33  ? 3.948   -18.633 49.560  1.00 16.40 ? 261  ASP D CA  1 
ATOM   5599  C C   . ASP D 1 33  ? 4.746   -19.747 50.243  1.00 16.34 ? 261  ASP D C   1 
ATOM   5600  O O   . ASP D 1 33  ? 5.790   -20.175 49.729  1.00 16.41 ? 261  ASP D O   1 
ATOM   5601  C CB  . ASP D 1 33  ? 3.848   -17.404 50.492  1.00 16.36 ? 261  ASP D CB  1 
ATOM   5602  C CG  . ASP D 1 33  ? 2.535   -17.350 51.293  1.00 16.34 ? 261  ASP D CG  1 
ATOM   5603  O OD1 . ASP D 1 33  ? 1.874   -18.397 51.479  1.00 16.41 ? 261  ASP D OD1 1 
ATOM   5604  O OD2 . ASP D 1 33  ? 2.161   -16.245 51.736  1.00 15.73 ? 261  ASP D OD2 1 
ATOM   5605  N N   . ILE D 1 34  ? 4.243   -20.225 51.381  1.00 16.15 ? 262  ILE D N   1 
ATOM   5606  C CA  . ILE D 1 34  ? 4.954   -21.221 52.197  1.00 16.02 ? 262  ILE D CA  1 
ATOM   5607  C C   . ILE D 1 34  ? 5.340   -22.445 51.355  1.00 15.92 ? 262  ILE D C   1 
ATOM   5608  O O   . ILE D 1 34  ? 6.489   -22.905 51.396  1.00 15.85 ? 262  ILE D O   1 
ATOM   5609  C CB  . ILE D 1 34  ? 4.121   -21.679 53.431  1.00 15.97 ? 262  ILE D CB  1 
ATOM   5610  C CG1 . ILE D 1 34  ? 3.761   -20.489 54.335  1.00 16.23 ? 262  ILE D CG1 1 
ATOM   5611  C CG2 . ILE D 1 34  ? 4.883   -22.718 54.240  1.00 15.71 ? 262  ILE D CG2 1 
ATOM   5612  C CD1 . ILE D 1 34  ? 4.963   -19.674 54.826  1.00 16.39 ? 262  ILE D CD1 1 
ATOM   5613  N N   . LYS D 1 35  ? 4.376   -22.944 50.581  1.00 15.69 ? 263  LYS D N   1 
ATOM   5614  C CA  . LYS D 1 35  ? 4.586   -24.097 49.698  1.00 15.48 ? 263  LYS D CA  1 
ATOM   5615  C C   . LYS D 1 35  ? 5.877   -23.965 48.883  1.00 15.09 ? 263  LYS D C   1 
ATOM   5616  O O   . LYS D 1 35  ? 6.813   -24.748 49.062  1.00 14.81 ? 263  LYS D O   1 
ATOM   5617  C CB  . LYS D 1 35  ? 3.371   -24.276 48.771  1.00 15.56 ? 263  LYS D CB  1 
ATOM   5618  C CG  . LYS D 1 35  ? 3.483   -25.427 47.775  1.00 15.63 ? 263  LYS D CG  1 
ATOM   5619  C CD  . LYS D 1 35  ? 2.137   -25.712 47.112  1.00 15.55 ? 263  LYS D CD  1 
ATOM   5620  C CE  . LYS D 1 35  ? 2.228   -26.869 46.128  1.00 15.37 ? 263  LYS D CE  1 
ATOM   5621  N NZ  . LYS D 1 35  ? 0.917   -27.174 45.498  1.00 15.00 ? 263  LYS D NZ  1 
ATOM   5622  N N   . ALA D 1 36  ? 5.923   -22.959 48.013  1.00 14.88 ? 264  ALA D N   1 
ATOM   5623  C CA  . ALA D 1 36  ? 7.091   -22.714 47.158  1.00 14.83 ? 264  ALA D CA  1 
ATOM   5624  C C   . ALA D 1 36  ? 8.393   -22.798 47.945  1.00 14.65 ? 264  ALA D C   1 
ATOM   5625  O O   . ALA D 1 36  ? 9.360   -23.413 47.504  1.00 14.57 ? 264  ALA D O   1 
ATOM   5626  C CB  . ALA D 1 36  ? 6.976   -21.352 46.484  1.00 14.84 ? 264  ALA D CB  1 
ATOM   5627  N N   . LEU D 1 37  ? 8.381   -22.191 49.126  1.00 14.59 ? 265  LEU D N   1 
ATOM   5628  C CA  . LEU D 1 37  ? 9.533   -22.164 50.021  1.00 14.36 ? 265  LEU D CA  1 
ATOM   5629  C C   . LEU D 1 37  ? 9.779   -23.541 50.660  1.00 14.19 ? 265  LEU D C   1 
ATOM   5630  O O   . LEU D 1 37  ? 10.898  -24.047 50.633  1.00 14.21 ? 265  LEU D O   1 
ATOM   5631  C CB  . LEU D 1 37  ? 9.319   -21.092 51.094  1.00 14.36 ? 265  LEU D CB  1 
ATOM   5632  C CG  . LEU D 1 37  ? 9.032   -19.680 50.555  1.00 14.44 ? 265  LEU D CG  1 
ATOM   5633  C CD1 . LEU D 1 37  ? 8.380   -18.790 51.626  1.00 13.49 ? 265  LEU D CD1 1 
ATOM   5634  C CD2 . LEU D 1 37  ? 10.315  -19.053 49.985  1.00 13.84 ? 265  LEU D CD2 1 
ATOM   5635  N N   . THR D 1 38  ? 8.741   -24.160 51.215  1.00 13.92 ? 266  THR D N   1 
ATOM   5636  C CA  . THR D 1 38  ? 8.888   -25.503 51.773  1.00 13.86 ? 266  THR D CA  1 
ATOM   5637  C C   . THR D 1 38  ? 9.494   -26.479 50.758  1.00 13.85 ? 266  THR D C   1 
ATOM   5638  O O   . THR D 1 38  ? 10.272  -27.359 51.137  1.00 14.08 ? 266  THR D O   1 
ATOM   5639  C CB  . THR D 1 38  ? 7.551   -26.073 52.260  1.00 13.86 ? 266  THR D CB  1 
ATOM   5640  O OG1 . THR D 1 38  ? 7.046   -25.255 53.321  1.00 14.41 ? 266  THR D OG1 1 
ATOM   5641  C CG2 . THR D 1 38  ? 7.727   -27.505 52.767  1.00 13.49 ? 266  THR D CG2 1 
ATOM   5642  N N   . THR D 1 39  ? 9.138   -26.320 49.480  1.00 13.59 ? 267  THR D N   1 
ATOM   5643  C CA  . THR D 1 39  ? 9.663   -27.173 48.401  1.00 13.32 ? 267  THR D CA  1 
ATOM   5644  C C   . THR D 1 39  ? 11.134  -26.876 48.063  1.00 13.19 ? 267  THR D C   1 
ATOM   5645  O O   . THR D 1 39  ? 11.951  -27.796 47.959  1.00 13.09 ? 267  THR D O   1 
ATOM   5646  C CB  . THR D 1 39  ? 8.836   -27.015 47.109  1.00 13.31 ? 267  THR D CB  1 
ATOM   5647  O OG1 . THR D 1 39  ? 7.470   -27.341 47.370  1.00 12.56 ? 267  THR D OG1 1 
ATOM   5648  C CG2 . THR D 1 39  ? 9.373   -27.918 46.003  1.00 13.46 ? 267  THR D CG2 1 
ATOM   5649  N N   . LEU D 1 40  ? 11.458  -25.598 47.881  1.00 12.95 ? 268  LEU D N   1 
ATOM   5650  C CA  . LEU D 1 40  ? 12.826  -25.187 47.557  1.00 12.89 ? 268  LEU D CA  1 
ATOM   5651  C C   . LEU D 1 40  ? 13.815  -25.543 48.675  1.00 13.19 ? 268  LEU D C   1 
ATOM   5652  O O   . LEU D 1 40  ? 14.967  -25.901 48.409  1.00 13.09 ? 268  LEU D O   1 
ATOM   5653  C CB  . LEU D 1 40  ? 12.879  -23.685 47.263  1.00 12.72 ? 268  LEU D CB  1 
ATOM   5654  C CG  . LEU D 1 40  ? 12.158  -23.195 46.001  1.00 12.14 ? 268  LEU D CG  1 
ATOM   5655  C CD1 . LEU D 1 40  ? 12.099  -21.671 45.998  1.00 10.71 ? 268  LEU D CD1 1 
ATOM   5656  C CD2 . LEU D 1 40  ? 12.815  -23.717 44.724  1.00 11.52 ? 268  LEU D CD2 1 
ATOM   5657  N N   . CYS D 1 41  ? 13.354  -25.453 49.920  1.00 13.62 ? 269  CYS D N   1 
ATOM   5658  C CA  . CYS D 1 41  ? 14.165  -25.831 51.077  1.00 14.08 ? 269  CYS D CA  1 
ATOM   5659  C C   . CYS D 1 41  ? 14.508  -27.308 51.044  1.00 14.28 ? 269  CYS D C   1 
ATOM   5660  O O   . CYS D 1 41  ? 15.686  -27.670 51.094  1.00 14.53 ? 269  CYS D O   1 
ATOM   5661  C CB  . CYS D 1 41  ? 13.435  -25.507 52.381  1.00 14.15 ? 269  CYS D CB  1 
ATOM   5662  S SG  . CYS D 1 41  ? 13.323  -23.735 52.691  1.00 14.89 ? 269  CYS D SG  1 
ATOM   5663  N N   . ASP D 1 42  ? 13.479  -28.149 50.950  1.00 14.28 ? 270  ASP D N   1 
ATOM   5664  C CA  . ASP D 1 42  ? 13.671  -29.590 50.827  1.00 14.47 ? 270  ASP D CA  1 
ATOM   5665  C C   . ASP D 1 42  ? 14.477  -29.934 49.563  1.00 14.48 ? 270  ASP D C   1 
ATOM   5666  O O   . ASP D 1 42  ? 15.309  -30.842 49.586  1.00 14.50 ? 270  ASP D O   1 
ATOM   5667  C CB  . ASP D 1 42  ? 12.329  -30.323 50.810  1.00 14.61 ? 270  ASP D CB  1 
ATOM   5668  C CG  . ASP D 1 42  ? 11.574  -30.227 52.143  1.00 15.53 ? 270  ASP D CG  1 
ATOM   5669  O OD1 . ASP D 1 42  ? 11.885  -29.331 52.962  1.00 16.96 ? 270  ASP D OD1 1 
ATOM   5670  O OD2 . ASP D 1 42  ? 10.655  -31.046 52.372  1.00 15.79 ? 270  ASP D OD2 1 
ATOM   5671  N N   . LEU D 1 43  ? 14.241  -29.203 48.471  1.00 14.43 ? 271  LEU D N   1 
ATOM   5672  C CA  . LEU D 1 43  ? 14.997  -29.399 47.228  1.00 14.36 ? 271  LEU D CA  1 
ATOM   5673  C C   . LEU D 1 43  ? 16.479  -29.125 47.453  1.00 14.49 ? 271  LEU D C   1 
ATOM   5674  O O   . LEU D 1 43  ? 17.326  -29.981 47.180  1.00 14.37 ? 271  LEU D O   1 
ATOM   5675  C CB  . LEU D 1 43  ? 14.470  -28.492 46.111  1.00 14.24 ? 271  LEU D CB  1 
ATOM   5676  C CG  . LEU D 1 43  ? 15.312  -28.470 44.826  1.00 14.49 ? 271  LEU D CG  1 
ATOM   5677  C CD1 . LEU D 1 43  ? 15.403  -29.857 44.195  1.00 14.45 ? 271  LEU D CD1 1 
ATOM   5678  C CD2 . LEU D 1 43  ? 14.772  -27.460 43.819  1.00 14.56 ? 271  LEU D CD2 1 
ATOM   5679  N N   . ALA D 1 44  ? 16.779  -27.922 47.941  1.00 14.73 ? 272  ALA D N   1 
ATOM   5680  C CA  . ALA D 1 44  ? 18.156  -27.524 48.258  1.00 14.87 ? 272  ALA D CA  1 
ATOM   5681  C C   . ALA D 1 44  ? 18.801  -28.528 49.215  1.00 15.10 ? 272  ALA D C   1 
ATOM   5682  O O   . ALA D 1 44  ? 19.931  -28.973 48.998  1.00 14.86 ? 272  ALA D O   1 
ATOM   5683  C CB  . ALA D 1 44  ? 18.175  -26.128 48.864  1.00 14.85 ? 272  ALA D CB  1 
ATOM   5684  N N   . ASP D 1 45  ? 18.063  -28.879 50.267  1.00 15.54 ? 273  ASP D N   1 
ATOM   5685  C CA  . ASP D 1 45  ? 18.511  -29.872 51.253  1.00 15.93 ? 273  ASP D CA  1 
ATOM   5686  C C   . ASP D 1 45  ? 18.945  -31.188 50.609  1.00 15.92 ? 273  ASP D C   1 
ATOM   5687  O O   . ASP D 1 45  ? 19.991  -31.743 50.959  1.00 15.94 ? 273  ASP D O   1 
ATOM   5688  C CB  . ASP D 1 45  ? 17.409  -30.142 52.293  1.00 16.16 ? 273  ASP D CB  1 
ATOM   5689  C CG  . ASP D 1 45  ? 17.413  -29.129 53.433  1.00 17.12 ? 273  ASP D CG  1 
ATOM   5690  O OD1 . ASP D 1 45  ? 18.510  -28.644 53.787  1.00 18.40 ? 273  ASP D OD1 1 
ATOM   5691  O OD2 . ASP D 1 45  ? 16.326  -28.831 53.983  1.00 18.13 ? 273  ASP D OD2 1 
ATOM   5692  N N   . ARG D 1 46  ? 18.142  -31.678 49.672  1.00 16.01 ? 274  ARG D N   1 
ATOM   5693  C CA  . ARG D 1 46  ? 18.460  -32.926 48.975  1.00 16.31 ? 274  ARG D CA  1 
ATOM   5694  C C   . ARG D 1 46  ? 19.597  -32.733 47.970  1.00 16.05 ? 274  ARG D C   1 
ATOM   5695  O O   . ARG D 1 46  ? 20.452  -33.611 47.823  1.00 16.01 ? 274  ARG D O   1 
ATOM   5696  C CB  . ARG D 1 46  ? 17.202  -33.534 48.325  1.00 16.26 ? 274  ARG D CB  1 
ATOM   5697  C CG  . ARG D 1 46  ? 16.265  -34.142 49.375  1.00 16.84 ? 274  ARG D CG  1 
ATOM   5698  C CD  . ARG D 1 46  ? 15.064  -34.887 48.797  1.00 17.36 ? 274  ARG D CD  1 
ATOM   5699  N NE  . ARG D 1 46  ? 13.984  -33.992 48.369  1.00 18.06 ? 274  ARG D NE  1 
ATOM   5700  C CZ  . ARG D 1 46  ? 13.755  -33.610 47.112  1.00 18.30 ? 274  ARG D CZ  1 
ATOM   5701  N NH1 . ARG D 1 46  ? 14.530  -34.029 46.111  1.00 18.29 ? 274  ARG D NH1 1 
ATOM   5702  N NH2 . ARG D 1 46  ? 12.740  -32.793 46.855  1.00 18.53 ? 274  ARG D NH2 1 
ATOM   5703  N N   . GLU D 1 47  ? 19.621  -31.575 47.313  1.00 16.02 ? 275  GLU D N   1 
ATOM   5704  C CA  . GLU D 1 47  ? 20.705  -31.239 46.390  1.00 15.99 ? 275  GLU D CA  1 
ATOM   5705  C C   . GLU D 1 47  ? 22.066  -31.215 47.092  1.00 15.87 ? 275  GLU D C   1 
ATOM   5706  O O   . GLU D 1 47  ? 23.026  -31.813 46.602  1.00 15.96 ? 275  GLU D O   1 
ATOM   5707  C CB  . GLU D 1 47  ? 20.436  -29.903 45.683  1.00 15.99 ? 275  GLU D CB  1 
ATOM   5708  C CG  . GLU D 1 47  ? 19.418  -30.000 44.548  1.00 16.12 ? 275  GLU D CG  1 
ATOM   5709  C CD  . GLU D 1 47  ? 19.414  -28.777 43.653  1.00 16.15 ? 275  GLU D CD  1 
ATOM   5710  O OE1 . GLU D 1 47  ? 20.386  -28.604 42.881  1.00 15.45 ? 275  GLU D OE1 1 
ATOM   5711  O OE2 . GLU D 1 47  ? 18.434  -27.998 43.722  1.00 16.18 ? 275  GLU D OE2 1 
ATOM   5712  N N   . LEU D 1 48  ? 22.133  -30.547 48.244  1.00 15.69 ? 276  LEU D N   1 
ATOM   5713  C CA  . LEU D 1 48  ? 23.371  -30.444 49.013  1.00 15.62 ? 276  LEU D CA  1 
ATOM   5714  C C   . LEU D 1 48  ? 24.044  -31.793 49.226  1.00 15.62 ? 276  LEU D C   1 
ATOM   5715  O O   . LEU D 1 48  ? 25.253  -31.923 49.047  1.00 15.78 ? 276  LEU D O   1 
ATOM   5716  C CB  . LEU D 1 48  ? 23.116  -29.780 50.369  1.00 15.69 ? 276  LEU D CB  1 
ATOM   5717  C CG  . LEU D 1 48  ? 23.127  -28.243 50.400  1.00 15.55 ? 276  LEU D CG  1 
ATOM   5718  C CD1 . LEU D 1 48  ? 22.684  -27.750 51.769  1.00 14.62 ? 276  LEU D CD1 1 
ATOM   5719  C CD2 . LEU D 1 48  ? 24.515  -27.669 50.027  1.00 14.18 ? 276  LEU D CD2 1 
ATOM   5720  N N   . VAL D 1 49  ? 23.266  -32.801 49.594  1.00 15.54 ? 277  VAL D N   1 
ATOM   5721  C CA  . VAL D 1 49  ? 23.831  -34.126 49.815  1.00 15.53 ? 277  VAL D CA  1 
ATOM   5722  C C   . VAL D 1 49  ? 24.688  -34.588 48.634  1.00 15.55 ? 277  VAL D C   1 
ATOM   5723  O O   . VAL D 1 49  ? 25.827  -35.002 48.833  1.00 15.78 ? 277  VAL D O   1 
ATOM   5724  C CB  . VAL D 1 49  ? 22.750  -35.169 50.141  1.00 15.39 ? 277  VAL D CB  1 
ATOM   5725  C CG1 . VAL D 1 49  ? 23.232  -36.566 49.806  1.00 15.20 ? 277  VAL D CG1 1 
ATOM   5726  C CG2 . VAL D 1 49  ? 22.391  -35.074 51.601  1.00 15.09 ? 277  VAL D CG2 1 
ATOM   5727  N N   . VAL D 1 50  ? 24.166  -34.499 47.414  1.00 15.41 ? 278  VAL D N   1 
ATOM   5728  C CA  . VAL D 1 50  ? 24.942  -34.945 46.247  1.00 15.29 ? 278  VAL D CA  1 
ATOM   5729  C C   . VAL D 1 50  ? 26.003  -33.911 45.848  1.00 15.17 ? 278  VAL D C   1 
ATOM   5730  O O   . VAL D 1 50  ? 26.973  -34.256 45.177  1.00 15.50 ? 278  VAL D O   1 
ATOM   5731  C CB  . VAL D 1 50  ? 24.053  -35.319 45.022  1.00 15.20 ? 278  VAL D CB  1 
ATOM   5732  C CG1 . VAL D 1 50  ? 22.928  -36.255 45.439  1.00 14.73 ? 278  VAL D CG1 1 
ATOM   5733  C CG2 . VAL D 1 50  ? 23.496  -34.078 44.344  1.00 15.31 ? 278  VAL D CG2 1 
ATOM   5734  N N   . ILE D 1 51  ? 25.816  -32.656 46.256  1.00 14.84 ? 279  ILE D N   1 
ATOM   5735  C CA  . ILE D 1 51  ? 26.830  -31.611 46.051  1.00 14.52 ? 279  ILE D CA  1 
ATOM   5736  C C   . ILE D 1 51  ? 28.089  -31.909 46.879  1.00 14.73 ? 279  ILE D C   1 
ATOM   5737  O O   . ILE D 1 51  ? 29.218  -31.701 46.409  1.00 14.64 ? 279  ILE D O   1 
ATOM   5738  C CB  . ILE D 1 51  ? 26.289  -30.185 46.401  1.00 14.39 ? 279  ILE D CB  1 
ATOM   5739  C CG1 . ILE D 1 51  ? 25.359  -29.669 45.298  1.00 13.96 ? 279  ILE D CG1 1 
ATOM   5740  C CG2 . ILE D 1 51  ? 27.424  -29.205 46.594  1.00 13.66 ? 279  ILE D CG2 1 
ATOM   5741  C CD1 . ILE D 1 51  ? 24.863  -28.271 45.524  1.00 13.57 ? 279  ILE D CD1 1 
ATOM   5742  N N   . ILE D 1 52  ? 27.891  -32.405 48.102  1.00 14.62 ? 280  ILE D N   1 
ATOM   5743  C CA  . ILE D 1 52  ? 29.013  -32.756 48.979  1.00 14.46 ? 280  ILE D CA  1 
ATOM   5744  C C   . ILE D 1 52  ? 29.748  -33.955 48.399  1.00 14.66 ? 280  ILE D C   1 
ATOM   5745  O O   . ILE D 1 52  ? 30.967  -33.931 48.259  1.00 14.67 ? 280  ILE D O   1 
ATOM   5746  C CB  . ILE D 1 52  ? 28.567  -33.053 50.444  1.00 14.35 ? 280  ILE D CB  1 
ATOM   5747  C CG1 . ILE D 1 52  ? 27.937  -31.810 51.077  1.00 14.04 ? 280  ILE D CG1 1 
ATOM   5748  C CG2 . ILE D 1 52  ? 29.756  -33.437 51.286  1.00 13.91 ? 280  ILE D CG2 1 
ATOM   5749  C CD1 . ILE D 1 52  ? 27.254  -32.046 52.384  1.00 13.70 ? 280  ILE D CD1 1 
ATOM   5750  N N   . GLY D 1 53  ? 28.996  -34.995 48.055  1.00 14.92 ? 281  GLY D N   1 
ATOM   5751  C CA  . GLY D 1 53  ? 29.553  -36.168 47.382  1.00 15.12 ? 281  GLY D CA  1 
ATOM   5752  C C   . GLY D 1 53  ? 30.262  -35.791 46.089  1.00 15.27 ? 281  GLY D C   1 
ATOM   5753  O O   . GLY D 1 53  ? 31.343  -36.307 45.785  1.00 15.42 ? 281  GLY D O   1 
ATOM   5754  N N   . TRP D 1 54  ? 29.641  -34.891 45.329  1.00 15.34 ? 282  TRP D N   1 
ATOM   5755  C CA  . TRP D 1 54  ? 30.257  -34.295 44.138  1.00 15.42 ? 282  TRP D CA  1 
ATOM   5756  C C   . TRP D 1 54  ? 31.614  -33.644 44.459  1.00 15.48 ? 282  TRP D C   1 
ATOM   5757  O O   . TRP D 1 54  ? 32.602  -33.904 43.781  1.00 15.38 ? 282  TRP D O   1 
ATOM   5758  C CB  . TRP D 1 54  ? 29.305  -33.250 43.522  1.00 15.41 ? 282  TRP D CB  1 
ATOM   5759  C CG  . TRP D 1 54  ? 29.955  -32.378 42.505  1.00 15.24 ? 282  TRP D CG  1 
ATOM   5760  C CD1 . TRP D 1 54  ? 30.235  -32.704 41.218  1.00 15.27 ? 282  TRP D CD1 1 
ATOM   5761  C CD2 . TRP D 1 54  ? 30.415  -31.038 42.689  1.00 15.34 ? 282  TRP D CD2 1 
ATOM   5762  N NE1 . TRP D 1 54  ? 30.840  -31.654 40.583  1.00 15.44 ? 282  TRP D NE1 1 
ATOM   5763  C CE2 . TRP D 1 54  ? 30.962  -30.614 41.467  1.00 15.59 ? 282  TRP D CE2 1 
ATOM   5764  C CE3 . TRP D 1 54  ? 30.421  -30.153 43.768  1.00 15.94 ? 282  TRP D CE3 1 
ATOM   5765  C CZ2 . TRP D 1 54  ? 31.508  -29.337 41.291  1.00 15.66 ? 282  TRP D CZ2 1 
ATOM   5766  C CZ3 . TRP D 1 54  ? 30.969  -28.878 43.588  1.00 15.71 ? 282  TRP D CZ3 1 
ATOM   5767  C CH2 . TRP D 1 54  ? 31.502  -28.491 42.360  1.00 15.28 ? 282  TRP D CH2 1 
ATOM   5768  N N   . ALA D 1 55  ? 31.643  -32.803 45.492  1.00 15.64 ? 283  ALA D N   1 
ATOM   5769  C CA  . ALA D 1 55  ? 32.854  -32.084 45.895  1.00 15.70 ? 283  ALA D CA  1 
ATOM   5770  C C   . ALA D 1 55  ? 34.064  -32.995 46.093  1.00 15.97 ? 283  ALA D C   1 
ATOM   5771  O O   . ALA D 1 55  ? 35.184  -32.612 45.749  1.00 16.03 ? 283  ALA D O   1 
ATOM   5772  C CB  . ALA D 1 55  ? 32.595  -31.290 47.166  1.00 15.61 ? 283  ALA D CB  1 
ATOM   5773  N N   . LYS D 1 56  ? 33.846  -34.185 46.654  1.00 16.24 ? 284  LYS D N   1 
ATOM   5774  C CA  . LYS D 1 56  ? 34.936  -35.137 46.891  1.00 16.58 ? 284  LYS D CA  1 
ATOM   5775  C C   . LYS D 1 56  ? 35.613  -35.568 45.589  1.00 16.76 ? 284  LYS D C   1 
ATOM   5776  O O   . LYS D 1 56  ? 36.826  -35.788 45.562  1.00 17.06 ? 284  LYS D O   1 
ATOM   5777  C CB  . LYS D 1 56  ? 34.423  -36.387 47.594  1.00 16.83 ? 284  LYS D CB  1 
ATOM   5778  C CG  . LYS D 1 56  ? 33.988  -36.217 49.052  1.00 17.34 ? 284  LYS D CG  1 
ATOM   5779  C CD  . LYS D 1 56  ? 33.539  -37.584 49.558  1.00 17.90 ? 284  LYS D CD  1 
ATOM   5780  C CE  . LYS D 1 56  ? 33.167  -37.597 51.006  1.00 18.34 ? 284  LYS D CE  1 
ATOM   5781  N NZ  . LYS D 1 56  ? 32.806  -38.992 51.382  1.00 18.81 ? 284  LYS D NZ  1 
ATOM   5782  N N   . HIS D 1 57  ? 34.821  -35.683 44.522  1.00 16.75 ? 285  HIS D N   1 
ATOM   5783  C CA  . HIS D 1 57  ? 35.318  -36.075 43.200  1.00 16.58 ? 285  HIS D CA  1 
ATOM   5784  C C   . HIS D 1 57  ? 36.106  -34.965 42.474  1.00 16.61 ? 285  HIS D C   1 
ATOM   5785  O O   . HIS D 1 57  ? 36.691  -35.218 41.424  1.00 16.64 ? 285  HIS D O   1 
ATOM   5786  C CB  . HIS D 1 57  ? 34.163  -36.547 42.308  1.00 16.43 ? 285  HIS D CB  1 
ATOM   5787  C CG  . HIS D 1 57  ? 33.358  -37.673 42.891  1.00 16.95 ? 285  HIS D CG  1 
ATOM   5788  N ND1 . HIS D 1 57  ? 33.879  -38.931 43.111  1.00 17.59 ? 285  HIS D ND1 1 
ATOM   5789  C CD2 . HIS D 1 57  ? 32.059  -37.737 43.274  1.00 16.87 ? 285  HIS D CD2 1 
ATOM   5790  C CE1 . HIS D 1 57  ? 32.945  -39.712 43.622  1.00 17.03 ? 285  HIS D CE1 1 
ATOM   5791  N NE2 . HIS D 1 57  ? 31.830  -39.013 43.726  1.00 16.75 ? 285  HIS D NE2 1 
ATOM   5792  N N   . ILE D 1 58  ? 36.127  -33.743 43.004  1.00 16.58 ? 286  ILE D N   1 
ATOM   5793  C CA  . ILE D 1 58  ? 36.949  -32.692 42.398  1.00 16.53 ? 286  ILE D CA  1 
ATOM   5794  C C   . ILE D 1 58  ? 38.423  -33.024 42.653  1.00 16.67 ? 286  ILE D C   1 
ATOM   5795  O O   . ILE D 1 58  ? 38.816  -33.222 43.798  1.00 16.81 ? 286  ILE D O   1 
ATOM   5796  C CB  . ILE D 1 58  ? 36.634  -31.279 42.946  1.00 16.45 ? 286  ILE D CB  1 
ATOM   5797  C CG1 . ILE D 1 58  ? 35.200  -30.862 42.595  1.00 16.35 ? 286  ILE D CG1 1 
ATOM   5798  C CG2 . ILE D 1 58  ? 37.621  -30.262 42.380  1.00 15.80 ? 286  ILE D CG2 1 
ATOM   5799  C CD1 . ILE D 1 58  ? 34.657  -29.688 43.440  1.00 16.02 ? 286  ILE D CD1 1 
ATOM   5800  N N   . PRO D 1 59  ? 39.238  -33.113 41.586  1.00 16.65 ? 287  PRO D N   1 
ATOM   5801  C CA  . PRO D 1 59  ? 40.661  -33.396 41.777  1.00 16.51 ? 287  PRO D CA  1 
ATOM   5802  C C   . PRO D 1 59  ? 41.316  -32.467 42.803  1.00 16.34 ? 287  PRO D C   1 
ATOM   5803  O O   . PRO D 1 59  ? 41.235  -31.261 42.660  1.00 16.68 ? 287  PRO D O   1 
ATOM   5804  C CB  . PRO D 1 59  ? 41.247  -33.160 40.382  1.00 16.49 ? 287  PRO D CB  1 
ATOM   5805  C CG  . PRO D 1 59  ? 40.118  -33.430 39.452  1.00 16.41 ? 287  PRO D CG  1 
ATOM   5806  C CD  . PRO D 1 59  ? 38.890  -32.966 40.157  1.00 16.60 ? 287  PRO D CD  1 
ATOM   5807  N N   . GLY D 1 60  ? 41.933  -33.032 43.834  1.00 16.28 ? 288  GLY D N   1 
ATOM   5808  C CA  . GLY D 1 60  ? 42.653  -32.257 44.837  1.00 16.38 ? 288  GLY D CA  1 
ATOM   5809  C C   . GLY D 1 60  ? 41.842  -31.928 46.078  1.00 16.52 ? 288  GLY D C   1 
ATOM   5810  O O   . GLY D 1 60  ? 42.402  -31.771 47.163  1.00 16.72 ? 288  GLY D O   1 
ATOM   5811  N N   . PHE D 1 61  ? 40.525  -31.824 45.924  1.00 16.57 ? 289  PHE D N   1 
ATOM   5812  C CA  . PHE D 1 61  ? 39.636  -31.419 47.015  1.00 16.45 ? 289  PHE D CA  1 
ATOM   5813  C C   . PHE D 1 61  ? 39.796  -32.356 48.195  1.00 16.40 ? 289  PHE D C   1 
ATOM   5814  O O   . PHE D 1 61  ? 39.966  -31.908 49.325  1.00 16.38 ? 289  PHE D O   1 
ATOM   5815  C CB  . PHE D 1 61  ? 38.174  -31.401 46.535  1.00 16.46 ? 289  PHE D CB  1 
ATOM   5816  C CG  . PHE D 1 61  ? 37.197  -30.846 47.544  1.00 16.51 ? 289  PHE D CG  1 
ATOM   5817  C CD1 . PHE D 1 61  ? 37.017  -29.472 47.682  1.00 16.95 ? 289  PHE D CD1 1 
ATOM   5818  C CD2 . PHE D 1 61  ? 36.445  -31.693 48.341  1.00 16.57 ? 289  PHE D CD2 1 
ATOM   5819  C CE1 . PHE D 1 61  ? 36.119  -28.953 48.608  1.00 16.15 ? 289  PHE D CE1 1 
ATOM   5820  C CE2 . PHE D 1 61  ? 35.546  -31.184 49.263  1.00 16.54 ? 289  PHE D CE2 1 
ATOM   5821  C CZ  . PHE D 1 61  ? 35.387  -29.808 49.399  1.00 16.51 ? 289  PHE D CZ  1 
ATOM   5822  N N   . SER D 1 62  ? 39.770  -33.657 47.928  1.00 16.54 ? 290  SER D N   1 
ATOM   5823  C CA  . SER D 1 62  ? 39.846  -34.663 49.011  1.00 16.72 ? 290  SER D CA  1 
ATOM   5824  C C   . SER D 1 62  ? 41.218  -34.764 49.705  1.00 16.21 ? 290  SER D C   1 
ATOM   5825  O O   . SER D 1 62  ? 41.326  -35.399 50.746  1.00 16.09 ? 290  SER D O   1 
ATOM   5826  C CB  . SER D 1 62  ? 39.405  -36.052 48.510  1.00 16.74 ? 290  SER D CB  1 
ATOM   5827  O OG  . SER D 1 62  ? 38.000  -36.095 48.302  1.00 17.41 ? 290  SER D OG  1 
ATOM   5828  N N   . THR D 1 63  ? 42.256  -34.150 49.143  1.00 15.76 ? 291  THR D N   1 
ATOM   5829  C CA  . THR D 1 63  ? 43.549  -34.101 49.826  1.00 15.56 ? 291  THR D CA  1 
ATOM   5830  C C   . THR D 1 63  ? 43.665  -32.882 50.762  1.00 15.10 ? 291  THR D C   1 
ATOM   5831  O O   . THR D 1 63  ? 44.637  -32.758 51.503  1.00 15.13 ? 291  THR D O   1 
ATOM   5832  C CB  . THR D 1 63  ? 44.732  -34.152 48.826  1.00 15.59 ? 291  THR D CB  1 
ATOM   5833  O OG1 . THR D 1 63  ? 44.658  -33.043 47.917  1.00 16.25 ? 291  THR D OG1 1 
ATOM   5834  C CG2 . THR D 1 63  ? 44.704  -35.457 48.050  1.00 15.06 ? 291  THR D CG2 1 
ATOM   5835  N N   . LEU D 1 64  ? 42.672  -31.997 50.739  1.00 14.64 ? 292  LEU D N   1 
ATOM   5836  C CA  . LEU D 1 64  ? 42.590  -30.915 51.722  1.00 14.26 ? 292  LEU D CA  1 
ATOM   5837  C C   . LEU D 1 64  ? 42.193  -31.465 53.090  1.00 14.27 ? 292  LEU D C   1 
ATOM   5838  O O   . LEU D 1 64  ? 41.655  -32.578 53.196  1.00 14.31 ? 292  LEU D O   1 
ATOM   5839  C CB  . LEU D 1 64  ? 41.578  -29.849 51.292  1.00 14.03 ? 292  LEU D CB  1 
ATOM   5840  C CG  . LEU D 1 64  ? 41.895  -29.044 50.035  1.00 13.08 ? 292  LEU D CG  1 
ATOM   5841  C CD1 . LEU D 1 64  ? 40.738  -28.143 49.674  1.00 12.70 ? 292  LEU D CD1 1 
ATOM   5842  C CD2 . LEU D 1 64  ? 43.144  -28.229 50.234  1.00 12.55 ? 292  LEU D CD2 1 
ATOM   5843  N N   . SER D 1 65  ? 42.469  -30.681 54.133  1.00 14.16 ? 293  SER D N   1 
ATOM   5844  C CA  . SER D 1 65  ? 42.085  -31.044 55.496  1.00 14.25 ? 293  SER D CA  1 
ATOM   5845  C C   . SER D 1 65  ? 40.566  -31.007 55.601  1.00 14.29 ? 293  SER D C   1 
ATOM   5846  O O   . SER D 1 65  ? 39.916  -30.200 54.919  1.00 14.08 ? 293  SER D O   1 
ATOM   5847  C CB  . SER D 1 65  ? 42.703  -30.078 56.519  1.00 14.37 ? 293  SER D CB  1 
ATOM   5848  O OG  . SER D 1 65  ? 42.050  -28.807 56.518  1.00 14.47 ? 293  SER D OG  1 
ATOM   5849  N N   . LEU D 1 66  ? 39.997  -31.864 56.453  1.00 14.24 ? 294  LEU D N   1 
ATOM   5850  C CA  . LEU D 1 66  ? 38.549  -31.831 56.683  1.00 14.14 ? 294  LEU D CA  1 
ATOM   5851  C C   . LEU D 1 66  ? 38.093  -30.419 57.038  1.00 13.89 ? 294  LEU D C   1 
ATOM   5852  O O   . LEU D 1 66  ? 37.092  -29.955 56.497  1.00 13.98 ? 294  LEU D O   1 
ATOM   5853  C CB  . LEU D 1 66  ? 38.110  -32.853 57.736  1.00 14.16 ? 294  LEU D CB  1 
ATOM   5854  C CG  . LEU D 1 66  ? 38.104  -34.265 57.139  1.00 14.63 ? 294  LEU D CG  1 
ATOM   5855  C CD1 . LEU D 1 66  ? 38.043  -35.358 58.205  1.00 15.47 ? 294  LEU D CD1 1 
ATOM   5856  C CD2 . LEU D 1 66  ? 36.949  -34.410 56.155  1.00 14.95 ? 294  LEU D CD2 1 
ATOM   5857  N N   . ALA D 1 67  ? 38.859  -29.730 57.889  1.00 13.59 ? 295  ALA D N   1 
ATOM   5858  C CA  . ALA D 1 67  ? 38.589  -28.321 58.236  1.00 13.36 ? 295  ALA D CA  1 
ATOM   5859  C C   . ALA D 1 67  ? 38.478  -27.395 57.019  1.00 13.18 ? 295  ALA D C   1 
ATOM   5860  O O   . ALA D 1 67  ? 37.639  -26.498 57.000  1.00 12.88 ? 295  ALA D O   1 
ATOM   5861  C CB  . ALA D 1 67  ? 39.654  -27.799 59.174  1.00 13.32 ? 295  ALA D CB  1 
ATOM   5862  N N   . ASP D 1 68  ? 39.327  -27.605 56.014  1.00 13.26 ? 296  ASP D N   1 
ATOM   5863  C CA  . ASP D 1 68  ? 39.290  -26.783 54.791  1.00 13.24 ? 296  ASP D CA  1 
ATOM   5864  C C   . ASP D 1 68  ? 38.189  -27.233 53.822  1.00 13.29 ? 296  ASP D C   1 
ATOM   5865  O O   . ASP D 1 68  ? 37.481  -26.399 53.256  1.00 13.37 ? 296  ASP D O   1 
ATOM   5866  C CB  . ASP D 1 68  ? 40.653  -26.765 54.090  1.00 13.10 ? 296  ASP D CB  1 
ATOM   5867  C CG  . ASP D 1 68  ? 41.691  -25.947 54.841  1.00 13.23 ? 296  ASP D CG  1 
ATOM   5868  O OD1 . ASP D 1 68  ? 41.338  -25.301 55.853  1.00 14.17 ? 296  ASP D OD1 1 
ATOM   5869  O OD2 . ASP D 1 68  ? 42.865  -25.941 54.419  1.00 12.74 ? 296  ASP D OD2 1 
ATOM   5870  N N   . GLN D 1 69  ? 38.031  -28.542 53.640  1.00 13.21 ? 297  GLN D N   1 
ATOM   5871  C CA  . GLN D 1 69  ? 36.947  -29.057 52.808  1.00 13.18 ? 297  GLN D CA  1 
ATOM   5872  C C   . GLN D 1 69  ? 35.610  -28.477 53.255  1.00 13.52 ? 297  GLN D C   1 
ATOM   5873  O O   . GLN D 1 69  ? 34.743  -28.182 52.432  1.00 13.43 ? 297  GLN D O   1 
ATOM   5874  C CB  . GLN D 1 69  ? 36.874  -30.576 52.894  1.00 13.38 ? 297  GLN D CB  1 
ATOM   5875  C CG  . GLN D 1 69  ? 38.038  -31.317 52.249  1.00 13.20 ? 297  GLN D CG  1 
ATOM   5876  C CD  . GLN D 1 69  ? 37.876  -32.823 52.341  1.00 12.40 ? 297  GLN D CD  1 
ATOM   5877  O OE1 . GLN D 1 69  ? 36.760  -33.340 52.284  1.00 9.97  ? 297  GLN D OE1 1 
ATOM   5878  N NE2 . GLN D 1 69  ? 38.988  -33.531 52.475  1.00 11.06 ? 297  GLN D NE2 1 
ATOM   5879  N N   . MET D 1 70  ? 35.460  -28.330 54.572  1.00 13.96 ? 298  MET D N   1 
ATOM   5880  C CA  . MET D 1 70  ? 34.259  -27.758 55.195  1.00 14.25 ? 298  MET D CA  1 
ATOM   5881  C C   . MET D 1 70  ? 34.164  -26.277 54.912  1.00 14.10 ? 298  MET D C   1 
ATOM   5882  O O   . MET D 1 70  ? 33.163  -25.804 54.389  1.00 14.55 ? 298  MET D O   1 
ATOM   5883  C CB  . MET D 1 70  ? 34.317  -27.946 56.708  1.00 14.68 ? 298  MET D CB  1 
ATOM   5884  C CG  . MET D 1 70  ? 34.425  -29.389 57.146  1.00 15.66 ? 298  MET D CG  1 
ATOM   5885  S SD  . MET D 1 70  ? 32.874  -29.974 57.762  1.00 19.11 ? 298  MET D SD  1 
ATOM   5886  C CE  . MET D 1 70  ? 32.872  -29.175 59.358  1.00 17.59 ? 298  MET D CE  1 
ATOM   5887  N N   . SER D 1 71  ? 35.218  -25.546 55.261  1.00 13.83 ? 299  SER D N   1 
ATOM   5888  C CA  . SER D 1 71  ? 35.262  -24.106 55.053  1.00 13.58 ? 299  SER D CA  1 
ATOM   5889  C C   . SER D 1 71  ? 34.884  -23.738 53.618  1.00 13.64 ? 299  SER D C   1 
ATOM   5890  O O   . SER D 1 71  ? 34.014  -22.897 53.401  1.00 13.75 ? 299  SER D O   1 
ATOM   5891  C CB  . SER D 1 71  ? 36.646  -23.570 55.403  1.00 13.49 ? 299  SER D CB  1 
ATOM   5892  O OG  . SER D 1 71  ? 36.919  -23.758 56.784  1.00 12.88 ? 299  SER D OG  1 
ATOM   5893  N N   . LEU D 1 72  ? 35.511  -24.389 52.644  1.00 13.66 ? 300  LEU D N   1 
ATOM   5894  C CA  . LEU D 1 72  ? 35.170  -24.159 51.250  1.00 13.71 ? 300  LEU D CA  1 
ATOM   5895  C C   . LEU D 1 72  ? 33.707  -24.430 51.025  1.00 13.42 ? 300  LEU D C   1 
ATOM   5896  O O   . LEU D 1 72  ? 33.022  -23.618 50.416  1.00 13.47 ? 300  LEU D O   1 
ATOM   5897  C CB  . LEU D 1 72  ? 35.983  -25.047 50.315  1.00 13.97 ? 300  LEU D CB  1 
ATOM   5898  C CG  . LEU D 1 72  ? 37.473  -24.725 50.209  1.00 14.69 ? 300  LEU D CG  1 
ATOM   5899  C CD1 . LEU D 1 72  ? 38.232  -25.838 49.433  1.00 15.15 ? 300  LEU D CD1 1 
ATOM   5900  C CD2 . LEU D 1 72  ? 37.665  -23.373 49.561  1.00 14.81 ? 300  LEU D CD2 1 
ATOM   5901  N N   . LEU D 1 73  ? 33.221  -25.562 51.510  1.00 13.24 ? 301  LEU D N   1 
ATOM   5902  C CA  . LEU D 1 73  ? 31.800  -25.861 51.370  1.00 13.57 ? 301  LEU D CA  1 
ATOM   5903  C C   . LEU D 1 73  ? 30.912  -24.917 52.185  1.00 14.04 ? 301  LEU D C   1 
ATOM   5904  O O   . LEU D 1 73  ? 29.886  -24.472 51.682  1.00 14.36 ? 301  LEU D O   1 
ATOM   5905  C CB  . LEU D 1 73  ? 31.485  -27.309 51.720  1.00 13.36 ? 301  LEU D CB  1 
ATOM   5906  C CG  . LEU D 1 73  ? 31.651  -28.286 50.558  1.00 13.89 ? 301  LEU D CG  1 
ATOM   5907  C CD1 . LEU D 1 73  ? 31.395  -29.732 51.020  1.00 13.91 ? 301  LEU D CD1 1 
ATOM   5908  C CD2 . LEU D 1 73  ? 30.739  -27.910 49.397  1.00 13.36 ? 301  LEU D CD2 1 
ATOM   5909  N N   . GLN D 1 74  ? 31.288  -24.593 53.419  1.00 14.37 ? 302  GLN D N   1 
ATOM   5910  C CA  . GLN D 1 74  ? 30.473  -23.674 54.209  1.00 15.18 ? 302  GLN D CA  1 
ATOM   5911  C C   . GLN D 1 74  ? 30.365  -22.319 53.516  1.00 14.85 ? 302  GLN D C   1 
ATOM   5912  O O   . GLN D 1 74  ? 29.345  -21.643 53.643  1.00 14.81 ? 302  GLN D O   1 
ATOM   5913  C CB  . GLN D 1 74  ? 30.982  -23.525 55.656  1.00 15.29 ? 302  GLN D CB  1 
ATOM   5914  C CG  . GLN D 1 74  ? 30.293  -24.492 56.648  1.00 16.88 ? 302  GLN D CG  1 
ATOM   5915  C CD  . GLN D 1 74  ? 30.623  -24.212 58.110  1.00 17.56 ? 302  GLN D CD  1 
ATOM   5916  O OE1 . GLN D 1 74  ? 29.734  -24.218 58.980  1.00 20.10 ? 302  GLN D OE1 1 
ATOM   5917  N NE2 . GLN D 1 74  ? 31.904  -23.966 58.390  1.00 20.85 ? 302  GLN D NE2 1 
ATOM   5918  N N   . SER D 1 75  ? 31.401  -21.941 52.768  1.00 14.63 ? 303  SER D N   1 
ATOM   5919  C CA  . SER D 1 75  ? 31.371  -20.714 51.962  1.00 14.68 ? 303  SER D CA  1 
ATOM   5920  C C   . SER D 1 75  ? 30.544  -20.857 50.675  1.00 14.76 ? 303  SER D C   1 
ATOM   5921  O O   . SER D 1 75  ? 29.685  -20.021 50.394  1.00 15.33 ? 303  SER D O   1 
ATOM   5922  C CB  . SER D 1 75  ? 32.790  -20.256 51.575  1.00 14.68 ? 303  SER D CB  1 
ATOM   5923  O OG  . SER D 1 75  ? 33.426  -19.538 52.612  1.00 14.61 ? 303  SER D OG  1 
ATOM   5924  N N   . ALA D 1 76  ? 30.801  -21.907 49.899  1.00 14.49 ? 304  ALA D N   1 
ATOM   5925  C CA  . ALA D 1 76  ? 30.387  -21.937 48.496  1.00 14.33 ? 304  ALA D CA  1 
ATOM   5926  C C   . ALA D 1 76  ? 28.959  -22.425 48.237  1.00 14.40 ? 304  ALA D C   1 
ATOM   5927  O O   . ALA D 1 76  ? 28.393  -22.107 47.194  1.00 14.75 ? 304  ALA D O   1 
ATOM   5928  C CB  . ALA D 1 76  ? 31.372  -22.780 47.690  1.00 14.20 ? 304  ALA D CB  1 
ATOM   5929  N N   . TRP D 1 77  ? 28.381  -23.183 49.168  1.00 14.16 ? 305  TRP D N   1 
ATOM   5930  C CA  . TRP D 1 77  ? 27.218  -24.018 48.867  1.00 13.97 ? 305  TRP D CA  1 
ATOM   5931  C C   . TRP D 1 77  ? 26.114  -23.328 48.074  1.00 13.97 ? 305  TRP D C   1 
ATOM   5932  O O   . TRP D 1 77  ? 25.662  -23.855 47.065  1.00 13.85 ? 305  TRP D O   1 
ATOM   5933  C CB  . TRP D 1 77  ? 26.660  -24.675 50.136  1.00 14.15 ? 305  TRP D CB  1 
ATOM   5934  C CG  . TRP D 1 77  ? 26.152  -23.741 51.168  1.00 14.28 ? 305  TRP D CG  1 
ATOM   5935  C CD1 . TRP D 1 77  ? 26.886  -23.071 52.094  1.00 14.29 ? 305  TRP D CD1 1 
ATOM   5936  C CD2 . TRP D 1 77  ? 24.790  -23.380 51.395  1.00 14.27 ? 305  TRP D CD2 1 
ATOM   5937  N NE1 . TRP D 1 77  ? 26.068  -22.300 52.877  1.00 14.62 ? 305  TRP D NE1 1 
ATOM   5938  C CE2 . TRP D 1 77  ? 24.773  -22.473 52.472  1.00 14.46 ? 305  TRP D CE2 1 
ATOM   5939  C CE3 . TRP D 1 77  ? 23.583  -23.730 50.790  1.00 14.28 ? 305  TRP D CE3 1 
ATOM   5940  C CZ2 . TRP D 1 77  ? 23.591  -21.909 52.962  1.00 14.25 ? 305  TRP D CZ2 1 
ATOM   5941  C CZ3 . TRP D 1 77  ? 22.412  -23.172 51.277  1.00 14.38 ? 305  TRP D CZ3 1 
ATOM   5942  C CH2 . TRP D 1 77  ? 22.425  -22.268 52.352  1.00 14.06 ? 305  TRP D CH2 1 
ATOM   5943  N N   . MET D 1 78  ? 25.695  -22.146 48.501  1.00 14.36 ? 306  MET D N   1 
ATOM   5944  C CA  . MET D 1 78  ? 24.634  -21.426 47.792  1.00 14.47 ? 306  MET D CA  1 
ATOM   5945  C C   . MET D 1 78  ? 25.024  -21.084 46.358  1.00 14.68 ? 306  MET D C   1 
ATOM   5946  O O   . MET D 1 78  ? 24.190  -21.164 45.451  1.00 14.59 ? 306  MET D O   1 
ATOM   5947  C CB  . MET D 1 78  ? 24.275  -20.136 48.518  1.00 14.51 ? 306  MET D CB  1 
ATOM   5948  C CG  . MET D 1 78  ? 23.074  -19.396 47.917  1.00 13.53 ? 306  MET D CG  1 
ATOM   5949  S SD  . MET D 1 78  ? 21.560  -20.313 48.122  1.00 10.58 ? 306  MET D SD  1 
ATOM   5950  C CE  . MET D 1 78  ? 21.308  -20.125 49.884  1.00 10.81 ? 306  MET D CE  1 
ATOM   5951  N N   . GLU D 1 79  ? 26.283  -20.686 46.172  1.00 14.90 ? 307  GLU D N   1 
ATOM   5952  C CA  . GLU D 1 79  ? 26.825  -20.404 44.838  1.00 15.31 ? 307  GLU D CA  1 
ATOM   5953  C C   . GLU D 1 79  ? 26.686  -21.610 43.914  1.00 15.16 ? 307  GLU D C   1 
ATOM   5954  O O   . GLU D 1 79  ? 26.359  -21.462 42.746  1.00 15.10 ? 307  GLU D O   1 
ATOM   5955  C CB  . GLU D 1 79  ? 28.295  -19.935 44.910  1.00 15.15 ? 307  GLU D CB  1 
ATOM   5956  C CG  . GLU D 1 79  ? 28.453  -18.443 45.214  1.00 15.89 ? 307  GLU D CG  1 
ATOM   5957  C CD  . GLU D 1 79  ? 29.903  -17.933 45.188  1.00 16.60 ? 307  GLU D CD  1 
ATOM   5958  O OE1 . GLU D 1 79  ? 30.498  -17.750 44.096  1.00 18.35 ? 307  GLU D OE1 1 
ATOM   5959  O OE2 . GLU D 1 79  ? 30.442  -17.674 46.282  1.00 18.69 ? 307  GLU D OE2 1 
ATOM   5960  N N   . ILE D 1 80  ? 26.912  -22.802 44.453  1.00 15.35 ? 308  ILE D N   1 
ATOM   5961  C CA  . ILE D 1 80  ? 26.828  -24.030 43.676  1.00 15.56 ? 308  ILE D CA  1 
ATOM   5962  C C   . ILE D 1 80  ? 25.380  -24.388 43.366  1.00 15.53 ? 308  ILE D C   1 
ATOM   5963  O O   . ILE D 1 80  ? 25.090  -24.919 42.303  1.00 15.92 ? 308  ILE D O   1 
ATOM   5964  C CB  . ILE D 1 80  ? 27.487  -25.195 44.414  1.00 15.59 ? 308  ILE D CB  1 
ATOM   5965  C CG1 . ILE D 1 80  ? 28.967  -24.898 44.663  1.00 16.19 ? 308  ILE D CG1 1 
ATOM   5966  C CG2 . ILE D 1 80  ? 27.370  -26.482 43.606  1.00 15.90 ? 308  ILE D CG2 1 
ATOM   5967  C CD1 . ILE D 1 80  ? 29.670  -25.955 45.490  1.00 16.48 ? 308  ILE D CD1 1 
ATOM   5968  N N   . LEU D 1 81  ? 24.471  -24.103 44.288  1.00 15.46 ? 309  LEU D N   1 
ATOM   5969  C CA  . LEU D 1 81  ? 23.046  -24.263 44.011  1.00 15.63 ? 309  LEU D CA  1 
ATOM   5970  C C   . LEU D 1 81  ? 22.588  -23.340 42.888  1.00 15.66 ? 309  LEU D C   1 
ATOM   5971  O O   . LEU D 1 81  ? 21.941  -23.765 41.924  1.00 15.83 ? 309  LEU D O   1 
ATOM   5972  C CB  . LEU D 1 81  ? 22.211  -23.963 45.259  1.00 15.54 ? 309  LEU D CB  1 
ATOM   5973  C CG  . LEU D 1 81  ? 22.278  -24.959 46.418  1.00 15.43 ? 309  LEU D CG  1 
ATOM   5974  C CD1 . LEU D 1 81  ? 21.613  -24.335 47.638  1.00 15.52 ? 309  LEU D CD1 1 
ATOM   5975  C CD2 . LEU D 1 81  ? 21.636  -26.303 46.060  1.00 13.54 ? 309  LEU D CD2 1 
ATOM   5976  N N   . ILE D 1 82  ? 22.933  -22.070 43.031  1.00 15.72 ? 310  ILE D N   1 
ATOM   5977  C CA  . ILE D 1 82  ? 22.446  -21.024 42.144  1.00 15.58 ? 310  ILE D CA  1 
ATOM   5978  C C   . ILE D 1 82  ? 22.984  -21.187 40.724  1.00 15.66 ? 310  ILE D C   1 
ATOM   5979  O O   . ILE D 1 82  ? 22.263  -21.006 39.755  1.00 15.85 ? 310  ILE D O   1 
ATOM   5980  C CB  . ILE D 1 82  ? 22.778  -19.654 42.741  1.00 15.29 ? 310  ILE D CB  1 
ATOM   5981  C CG1 . ILE D 1 82  ? 21.863  -19.420 43.943  1.00 15.51 ? 310  ILE D CG1 1 
ATOM   5982  C CG2 . ILE D 1 82  ? 22.597  -18.560 41.733  1.00 15.01 ? 310  ILE D CG2 1 
ATOM   5983  C CD1 . ILE D 1 82  ? 22.083  -18.124 44.631  1.00 16.10 ? 310  ILE D CD1 1 
ATOM   5984  N N   . LEU D 1 83  ? 24.245  -21.562 40.605  1.00 15.65 ? 311  LEU D N   1 
ATOM   5985  C CA  . LEU D 1 83  ? 24.828  -21.863 39.305  1.00 15.46 ? 311  LEU D CA  1 
ATOM   5986  C C   . LEU D 1 83  ? 24.111  -23.061 38.681  1.00 15.41 ? 311  LEU D C   1 
ATOM   5987  O O   . LEU D 1 83  ? 23.808  -23.077 37.485  1.00 15.19 ? 311  LEU D O   1 
ATOM   5988  C CB  . LEU D 1 83  ? 26.313  -22.162 39.472  1.00 15.35 ? 311  LEU D CB  1 
ATOM   5989  C CG  . LEU D 1 83  ? 27.184  -21.962 38.246  1.00 14.89 ? 311  LEU D CG  1 
ATOM   5990  C CD1 . LEU D 1 83  ? 27.028  -20.564 37.699  1.00 15.12 ? 311  LEU D CD1 1 
ATOM   5991  C CD2 . LEU D 1 83  ? 28.613  -22.222 38.629  1.00 15.11 ? 311  LEU D CD2 1 
ATOM   5992  N N   . GLY D 1 84  ? 23.856  -24.060 39.521  1.00 15.40 ? 312  GLY D N   1 
ATOM   5993  C CA  . GLY D 1 84  ? 22.965  -25.172 39.201  1.00 15.27 ? 312  GLY D CA  1 
ATOM   5994  C C   . GLY D 1 84  ? 21.709  -24.733 38.485  1.00 15.04 ? 312  GLY D C   1 
ATOM   5995  O O   . GLY D 1 84  ? 21.536  -25.037 37.307  1.00 15.19 ? 312  GLY D O   1 
ATOM   5996  N N   . VAL D 1 85  ? 20.830  -24.011 39.173  1.00 14.79 ? 313  VAL D N   1 
ATOM   5997  C CA  . VAL D 1 85  ? 19.597  -23.550 38.520  1.00 14.81 ? 313  VAL D CA  1 
ATOM   5998  C C   . VAL D 1 85  ? 19.897  -22.705 37.278  1.00 14.57 ? 313  VAL D C   1 
ATOM   5999  O O   . VAL D 1 85  ? 19.283  -22.921 36.232  1.00 14.76 ? 313  VAL D O   1 
ATOM   6000  C CB  . VAL D 1 85  ? 18.621  -22.783 39.465  1.00 14.86 ? 313  VAL D CB  1 
ATOM   6001  C CG1 . VAL D 1 85  ? 19.263  -21.511 40.035  1.00 15.28 ? 313  VAL D CG1 1 
ATOM   6002  C CG2 . VAL D 1 85  ? 17.331  -22.436 38.717  1.00 14.49 ? 313  VAL D CG2 1 
ATOM   6003  N N   . VAL D 1 86  ? 20.846  -21.771 37.382  1.00 14.30 ? 314  VAL D N   1 
ATOM   6004  C CA  . VAL D 1 86  ? 21.221  -20.923 36.235  1.00 14.09 ? 314  VAL D CA  1 
ATOM   6005  C C   . VAL D 1 86  ? 21.439  -21.794 34.991  1.00 14.14 ? 314  VAL D C   1 
ATOM   6006  O O   . VAL D 1 86  ? 20.865  -21.528 33.927  1.00 14.40 ? 314  VAL D O   1 
ATOM   6007  C CB  . VAL D 1 86  ? 22.508  -20.071 36.486  1.00 14.09 ? 314  VAL D CB  1 
ATOM   6008  C CG1 . VAL D 1 86  ? 22.890  -19.322 35.228  1.00 13.06 ? 314  VAL D CG1 1 
ATOM   6009  C CG2 . VAL D 1 86  ? 22.323  -19.088 37.644  1.00 13.14 ? 314  VAL D CG2 1 
ATOM   6010  N N   . TYR D 1 87  ? 22.237  -22.850 35.133  1.00 13.84 ? 315  TYR D N   1 
ATOM   6011  C CA  . TYR D 1 87  ? 22.532  -23.712 33.997  1.00 13.74 ? 315  TYR D CA  1 
ATOM   6012  C C   . TYR D 1 87  ? 21.279  -24.369 33.427  1.00 13.64 ? 315  TYR D C   1 
ATOM   6013  O O   . TYR D 1 87  ? 21.023  -24.300 32.227  1.00 13.70 ? 315  TYR D O   1 
ATOM   6014  C CB  . TYR D 1 87  ? 23.536  -24.794 34.364  1.00 13.80 ? 315  TYR D CB  1 
ATOM   6015  C CG  . TYR D 1 87  ? 24.019  -25.519 33.145  1.00 13.76 ? 315  TYR D CG  1 
ATOM   6016  C CD1 . TYR D 1 87  ? 24.839  -24.871 32.232  1.00 13.96 ? 315  TYR D CD1 1 
ATOM   6017  C CD2 . TYR D 1 87  ? 23.627  -26.829 32.875  1.00 13.26 ? 315  TYR D CD2 1 
ATOM   6018  C CE1 . TYR D 1 87  ? 25.284  -25.508 31.094  1.00 13.81 ? 315  TYR D CE1 1 
ATOM   6019  C CE2 . TYR D 1 87  ? 24.064  -27.476 31.732  1.00 13.25 ? 315  TYR D CE2 1 
ATOM   6020  C CZ  . TYR D 1 87  ? 24.897  -26.802 30.851  1.00 13.91 ? 315  TYR D CZ  1 
ATOM   6021  O OH  . TYR D 1 87  ? 25.355  -27.396 29.709  1.00 14.64 ? 315  TYR D OH  1 
ATOM   6022  N N   . ARG D 1 88  ? 20.494  -25.004 34.287  1.00 13.47 ? 316  ARG D N   1 
ATOM   6023  C CA  . ARG D 1 88  ? 19.297  -25.705 33.824  1.00 13.52 ? 316  ARG D CA  1 
ATOM   6024  C C   . ARG D 1 88  ? 18.311  -24.747 33.127  1.00 13.33 ? 316  ARG D C   1 
ATOM   6025  O O   . ARG D 1 88  ? 17.456  -25.180 32.351  1.00 13.20 ? 316  ARG D O   1 
ATOM   6026  C CB  . ARG D 1 88  ? 18.614  -26.440 34.987  1.00 13.60 ? 316  ARG D CB  1 
ATOM   6027  C CG  . ARG D 1 88  ? 19.504  -27.483 35.661  1.00 14.03 ? 316  ARG D CG  1 
ATOM   6028  C CD  . ARG D 1 88  ? 18.741  -28.402 36.637  1.00 14.00 ? 316  ARG D CD  1 
ATOM   6029  N NE  . ARG D 1 88  ? 18.312  -27.724 37.868  1.00 14.96 ? 316  ARG D NE  1 
ATOM   6030  C CZ  . ARG D 1 88  ? 19.122  -27.330 38.855  1.00 14.41 ? 316  ARG D CZ  1 
ATOM   6031  N NH1 . ARG D 1 88  ? 20.442  -27.515 38.783  1.00 14.20 ? 316  ARG D NH1 1 
ATOM   6032  N NH2 . ARG D 1 88  ? 18.603  -26.734 39.925  1.00 13.72 ? 316  ARG D NH2 1 
ATOM   6033  N N   . SER D 1 89  ? 18.457  -23.449 33.389  1.00 13.16 ? 317  SER D N   1 
ATOM   6034  C CA  . SER D 1 89  ? 17.560  -22.432 32.848  1.00 13.06 ? 317  SER D CA  1 
ATOM   6035  C C   . SER D 1 89  ? 18.007  -21.803 31.509  1.00 13.08 ? 317  SER D C   1 
ATOM   6036  O O   . SER D 1 89  ? 17.293  -20.959 30.962  1.00 12.89 ? 317  SER D O   1 
ATOM   6037  C CB  . SER D 1 89  ? 17.383  -21.336 33.897  1.00 12.98 ? 317  SER D CB  1 
ATOM   6038  O OG  . SER D 1 89  ? 17.179  -21.909 35.179  1.00 12.99 ? 317  SER D OG  1 
ATOM   6039  N N   . LEU D 1 90  ? 19.156  -22.218 30.974  1.00 13.12 ? 318  LEU D N   1 
ATOM   6040  C CA  . LEU D 1 90  ? 19.745  -21.555 29.797  1.00 13.19 ? 318  LEU D CA  1 
ATOM   6041  C C   . LEU D 1 90  ? 18.872  -21.561 28.539  1.00 13.28 ? 318  LEU D C   1 
ATOM   6042  O O   . LEU D 1 90  ? 18.793  -20.552 27.835  1.00 13.31 ? 318  LEU D O   1 
ATOM   6043  C CB  . LEU D 1 90  ? 21.115  -22.145 29.449  1.00 13.00 ? 318  LEU D CB  1 
ATOM   6044  C CG  . LEU D 1 90  ? 22.257  -21.830 30.411  1.00 13.05 ? 318  LEU D CG  1 
ATOM   6045  C CD1 . LEU D 1 90  ? 23.515  -22.525 29.928  1.00 13.39 ? 318  LEU D CD1 1 
ATOM   6046  C CD2 . LEU D 1 90  ? 22.500  -20.342 30.554  1.00 12.54 ? 318  LEU D CD2 1 
ATOM   6047  N N   . SER D 1 91  ? 18.224  -22.682 28.246  1.00 13.23 ? 319  SER D N   1 
ATOM   6048  C CA  . SER D 1 91  ? 17.408  -22.768 27.032  1.00 13.27 ? 319  SER D CA  1 
ATOM   6049  C C   . SER D 1 91  ? 15.962  -22.281 27.220  1.00 13.30 ? 319  SER D C   1 
ATOM   6050  O O   . SER D 1 91  ? 15.137  -22.456 26.333  1.00 13.23 ? 319  SER D O   1 
ATOM   6051  C CB  . SER D 1 91  ? 17.413  -24.194 26.488  1.00 13.32 ? 319  SER D CB  1 
ATOM   6052  O OG  . SER D 1 91  ? 16.634  -25.047 27.297  1.00 13.20 ? 319  SER D OG  1 
ATOM   6053  N N   . PHE D 1 92  ? 15.665  -21.665 28.362  1.00 13.50 ? 320  PHE D N   1 
ATOM   6054  C CA  . PHE D 1 92  ? 14.332  -21.140 28.651  1.00 13.51 ? 320  PHE D CA  1 
ATOM   6055  C C   . PHE D 1 92  ? 14.322  -19.611 28.587  1.00 13.90 ? 320  PHE D C   1 
ATOM   6056  O O   . PHE D 1 92  ? 15.367  -18.966 28.681  1.00 13.95 ? 320  PHE D O   1 
ATOM   6057  C CB  . PHE D 1 92  ? 13.869  -21.601 30.033  1.00 13.29 ? 320  PHE D CB  1 
ATOM   6058  C CG  . PHE D 1 92  ? 13.513  -23.062 30.105  1.00 13.29 ? 320  PHE D CG  1 
ATOM   6059  C CD1 . PHE D 1 92  ? 14.497  -24.025 30.304  1.00 12.82 ? 320  PHE D CD1 1 
ATOM   6060  C CD2 . PHE D 1 92  ? 12.186  -23.477 29.989  1.00 13.55 ? 320  PHE D CD2 1 
ATOM   6061  C CE1 . PHE D 1 92  ? 14.167  -25.377 30.379  1.00 12.77 ? 320  PHE D CE1 1 
ATOM   6062  C CE2 . PHE D 1 92  ? 11.851  -24.828 30.061  1.00 13.28 ? 320  PHE D CE2 1 
ATOM   6063  C CZ  . PHE D 1 92  ? 12.846  -25.777 30.258  1.00 13.07 ? 320  PHE D CZ  1 
ATOM   6064  N N   . GLU D 1 93  ? 13.122  -19.055 28.433  1.00 14.36 ? 321  GLU D N   1 
ATOM   6065  C CA  . GLU D 1 93  ? 12.885  -17.612 28.339  1.00 14.65 ? 321  GLU D CA  1 
ATOM   6066  C C   . GLU D 1 93  ? 12.168  -17.127 29.599  1.00 14.62 ? 321  GLU D C   1 
ATOM   6067  O O   . GLU D 1 93  ? 11.035  -17.537 29.861  1.00 14.74 ? 321  GLU D O   1 
ATOM   6068  C CB  . GLU D 1 93  ? 11.999  -17.303 27.122  1.00 14.91 ? 321  GLU D CB  1 
ATOM   6069  C CG  . GLU D 1 93  ? 12.739  -17.148 25.804  1.00 15.95 ? 321  GLU D CG  1 
ATOM   6070  C CD  . GLU D 1 93  ? 13.309  -15.746 25.614  1.00 17.29 ? 321  GLU D CD  1 
ATOM   6071  O OE1 . GLU D 1 93  ? 12.517  -14.771 25.576  1.00 17.86 ? 321  GLU D OE1 1 
ATOM   6072  O OE2 . GLU D 1 93  ? 14.549  -15.621 25.493  1.00 17.41 ? 321  GLU D OE2 1 
ATOM   6073  N N   . ASP D 1 94  ? 12.823  -16.270 30.379  1.00 14.59 ? 322  ASP D N   1 
ATOM   6074  C CA  . ASP D 1 94  ? 12.210  -15.659 31.570  1.00 14.51 ? 322  ASP D CA  1 
ATOM   6075  C C   . ASP D 1 94  ? 11.541  -16.677 32.526  1.00 14.39 ? 322  ASP D C   1 
ATOM   6076  O O   . ASP D 1 94  ? 10.521  -16.386 33.162  1.00 14.30 ? 322  ASP D O   1 
ATOM   6077  C CB  . ASP D 1 94  ? 11.216  -14.581 31.132  1.00 14.54 ? 322  ASP D CB  1 
ATOM   6078  C CG  . ASP D 1 94  ? 11.826  -13.583 30.149  1.00 15.05 ? 322  ASP D CG  1 
ATOM   6079  O OD1 . ASP D 1 94  ? 12.983  -13.160 30.367  1.00 15.44 ? 322  ASP D OD1 1 
ATOM   6080  O OD2 . ASP D 1 94  ? 11.145  -13.215 29.161  1.00 15.57 ? 322  ASP D OD2 1 
ATOM   6081  N N   . GLU D 1 95  ? 12.136  -17.869 32.608  1.00 14.20 ? 323  GLU D N   1 
ATOM   6082  C CA  . GLU D 1 95  ? 11.696  -18.935 33.506  1.00 13.95 ? 323  GLU D CA  1 
ATOM   6083  C C   . GLU D 1 95  ? 12.934  -19.557 34.149  1.00 13.77 ? 323  GLU D C   1 
ATOM   6084  O O   . GLU D 1 95  ? 14.009  -19.582 33.541  1.00 13.59 ? 323  GLU D O   1 
ATOM   6085  C CB  . GLU D 1 95  ? 10.931  -20.020 32.741  1.00 14.03 ? 323  GLU D CB  1 
ATOM   6086  C CG  . GLU D 1 95  ? 9.570   -19.600 32.171  1.00 14.02 ? 323  GLU D CG  1 
ATOM   6087  C CD  . GLU D 1 95  ? 9.101   -20.512 31.039  1.00 13.69 ? 323  GLU D CD  1 
ATOM   6088  O OE1 . GLU D 1 95  ? 9.923   -20.830 30.147  1.00 12.85 ? 323  GLU D OE1 1 
ATOM   6089  O OE2 . GLU D 1 95  ? 7.910   -20.896 31.035  1.00 12.53 ? 323  GLU D OE2 1 
ATOM   6090  N N   . LEU D 1 96  ? 12.775  -20.060 35.372  1.00 13.53 ? 324  LEU D N   1 
ATOM   6091  C CA  . LEU D 1 96  ? 13.865  -20.709 36.097  1.00 13.14 ? 324  LEU D CA  1 
ATOM   6092  C C   . LEU D 1 96  ? 13.513  -22.164 36.412  1.00 13.10 ? 324  LEU D C   1 
ATOM   6093  O O   . LEU D 1 96  ? 12.425  -22.459 36.930  1.00 12.99 ? 324  LEU D O   1 
ATOM   6094  C CB  . LEU D 1 96  ? 14.182  -19.932 37.375  1.00 12.99 ? 324  LEU D CB  1 
ATOM   6095  C CG  . LEU D 1 96  ? 14.909  -18.603 37.152  1.00 12.43 ? 324  LEU D CG  1 
ATOM   6096  C CD1 . LEU D 1 96  ? 14.923  -17.777 38.421  1.00 11.80 ? 324  LEU D CD1 1 
ATOM   6097  C CD2 . LEU D 1 96  ? 16.331  -18.833 36.648  1.00 11.94 ? 324  LEU D CD2 1 
ATOM   6098  N N   . VAL D 1 97  ? 14.445  -23.063 36.094  1.00 12.97 ? 325  VAL D N   1 
ATOM   6099  C CA  . VAL D 1 97  ? 14.225  -24.503 36.213  1.00 13.01 ? 325  VAL D CA  1 
ATOM   6100  C C   . VAL D 1 97  ? 14.916  -25.069 37.454  1.00 12.83 ? 325  VAL D C   1 
ATOM   6101  O O   . VAL D 1 97  ? 16.010  -25.623 37.365  1.00 12.94 ? 325  VAL D O   1 
ATOM   6102  C CB  . VAL D 1 97  ? 14.718  -25.229 34.937  1.00 13.00 ? 325  VAL D CB  1 
ATOM   6103  C CG1 . VAL D 1 97  ? 14.496  -26.730 35.043  1.00 13.13 ? 325  VAL D CG1 1 
ATOM   6104  C CG2 . VAL D 1 97  ? 13.992  -24.686 33.719  1.00 13.11 ? 325  VAL D CG2 1 
ATOM   6105  N N   . TYR D 1 98  ? 14.278  -24.918 38.611  1.00 12.68 ? 326  TYR D N   1 
ATOM   6106  C CA  . TYR D 1 98  ? 14.816  -25.468 39.861  1.00 12.77 ? 326  TYR D CA  1 
ATOM   6107  C C   . TYR D 1 98  ? 14.827  -26.994 39.798  1.00 12.98 ? 326  TYR D C   1 
ATOM   6108  O O   . TYR D 1 98  ? 15.662  -27.659 40.414  1.00 12.95 ? 326  TYR D O   1 
ATOM   6109  C CB  . TYR D 1 98  ? 14.023  -24.961 41.076  1.00 12.74 ? 326  TYR D CB  1 
ATOM   6110  C CG  . TYR D 1 98  ? 14.301  -23.509 41.380  1.00 12.66 ? 326  TYR D CG  1 
ATOM   6111  C CD1 . TYR D 1 98  ? 15.565  -23.113 41.808  1.00 12.69 ? 326  TYR D CD1 1 
ATOM   6112  C CD2 . TYR D 1 98  ? 13.322  -22.530 41.227  1.00 12.64 ? 326  TYR D CD2 1 
ATOM   6113  C CE1 . TYR D 1 98  ? 15.856  -21.795 42.080  1.00 12.48 ? 326  TYR D CE1 1 
ATOM   6114  C CE2 . TYR D 1 98  ? 13.604  -21.193 41.501  1.00 12.65 ? 326  TYR D CE2 1 
ATOM   6115  C CZ  . TYR D 1 98  ? 14.882  -20.836 41.925  1.00 12.69 ? 326  TYR D CZ  1 
ATOM   6116  O OH  . TYR D 1 98  ? 15.211  -19.524 42.206  1.00 12.94 ? 326  TYR D OH  1 
ATOM   6117  N N   . ALA D 1 99  ? 13.878  -27.530 39.040  1.00 13.25 ? 327  ALA D N   1 
ATOM   6118  C CA  . ALA D 1 99  ? 13.856  -28.935 38.668  1.00 13.30 ? 327  ALA D CA  1 
ATOM   6119  C C   . ALA D 1 99  ? 12.951  -29.064 37.447  1.00 13.37 ? 327  ALA D C   1 
ATOM   6120  O O   . ALA D 1 99  ? 12.285  -28.097 37.062  1.00 13.45 ? 327  ALA D O   1 
ATOM   6121  C CB  . ALA D 1 99  ? 13.338  -29.780 39.817  1.00 13.28 ? 327  ALA D CB  1 
ATOM   6122  N N   . ASP D 1 100 ? 12.928  -30.243 36.834  1.00 13.39 ? 328  ASP D N   1 
ATOM   6123  C CA  . ASP D 1 100 ? 12.028  -30.493 35.705  1.00 13.36 ? 328  ASP D CA  1 
ATOM   6124  C C   . ASP D 1 100 ? 10.546  -30.381 36.103  1.00 13.32 ? 328  ASP D C   1 
ATOM   6125  O O   . ASP D 1 100 ? 9.718   -29.952 35.299  1.00 13.22 ? 328  ASP D O   1 
ATOM   6126  C CB  . ASP D 1 100 ? 12.316  -31.862 35.086  1.00 13.32 ? 328  ASP D CB  1 
ATOM   6127  C CG  . ASP D 1 100 ? 13.665  -31.917 34.395  1.00 13.27 ? 328  ASP D CG  1 
ATOM   6128  O OD1 . ASP D 1 100 ? 14.605  -31.228 34.854  1.00 12.73 ? 328  ASP D OD1 1 
ATOM   6129  O OD2 . ASP D 1 100 ? 13.782  -32.647 33.388  1.00 13.10 ? 328  ASP D OD2 1 
ATOM   6130  N N   . ASP D 1 101 ? 10.225  -30.748 37.345  1.00 13.38 ? 329  ASP D N   1 
ATOM   6131  C CA  . ASP D 1 101 ? 8.841   -30.706 37.855  1.00 13.49 ? 329  ASP D CA  1 
ATOM   6132  C C   . ASP D 1 101 ? 8.529   -29.461 38.700  1.00 13.49 ? 329  ASP D C   1 
ATOM   6133  O O   . ASP D 1 101 ? 7.496   -29.402 39.372  1.00 13.40 ? 329  ASP D O   1 
ATOM   6134  C CB  . ASP D 1 101 ? 8.531   -31.972 38.670  1.00 13.48 ? 329  ASP D CB  1 
ATOM   6135  C CG  . ASP D 1 101 ? 9.297   -32.027 39.985  1.00 13.39 ? 329  ASP D CG  1 
ATOM   6136  O OD1 . ASP D 1 101 ? 10.390  -31.425 40.070  1.00 13.74 ? 329  ASP D OD1 1 
ATOM   6137  O OD2 . ASP D 1 101 ? 8.808   -32.673 40.933  1.00 12.56 ? 329  ASP D OD2 1 
ATOM   6138  N N   . TYR D 1 102 ? 9.426   -28.482 38.674  1.00 13.66 ? 330  TYR D N   1 
ATOM   6139  C CA  . TYR D 1 102 ? 9.184   -27.201 39.332  1.00 13.84 ? 330  TYR D CA  1 
ATOM   6140  C C   . TYR D 1 102 ? 9.906   -26.075 38.581  1.00 13.89 ? 330  TYR D C   1 
ATOM   6141  O O   . TYR D 1 102 ? 11.110  -25.873 38.750  1.00 13.73 ? 330  TYR D O   1 
ATOM   6142  C CB  . TYR D 1 102 ? 9.592   -27.255 40.817  1.00 13.95 ? 330  TYR D CB  1 
ATOM   6143  C CG  . TYR D 1 102 ? 8.881   -26.228 41.671  1.00 13.82 ? 330  TYR D CG  1 
ATOM   6144  C CD1 . TYR D 1 102 ? 7.492   -26.220 41.753  1.00 14.58 ? 330  TYR D CD1 1 
ATOM   6145  C CD2 . TYR D 1 102 ? 9.585   -25.271 42.390  1.00 13.79 ? 330  TYR D CD2 1 
ATOM   6146  C CE1 . TYR D 1 102 ? 6.819   -25.286 42.523  1.00 14.70 ? 330  TYR D CE1 1 
ATOM   6147  C CE2 . TYR D 1 102 ? 8.922   -24.326 43.167  1.00 13.87 ? 330  TYR D CE2 1 
ATOM   6148  C CZ  . TYR D 1 102 ? 7.536   -24.340 43.227  1.00 14.42 ? 330  TYR D CZ  1 
ATOM   6149  O OH  . TYR D 1 102 ? 6.843   -23.422 43.984  1.00 14.15 ? 330  TYR D OH  1 
ATOM   6150  N N   . ILE D 1 103 ? 9.147   -25.374 37.735  1.00 14.10 ? 331  ILE D N   1 
ATOM   6151  C CA  . ILE D 1 103 ? 9.654   -24.282 36.904  1.00 14.49 ? 331  ILE D CA  1 
ATOM   6152  C C   . ILE D 1 103 ? 8.971   -22.967 37.288  1.00 14.89 ? 331  ILE D C   1 
ATOM   6153  O O   . ILE D 1 103 ? 7.743   -22.889 37.312  1.00 14.83 ? 331  ILE D O   1 
ATOM   6154  C CB  . ILE D 1 103 ? 9.409   -24.564 35.407  1.00 14.39 ? 331  ILE D CB  1 
ATOM   6155  C CG1 . ILE D 1 103 ? 10.268  -25.743 34.936  1.00 14.67 ? 331  ILE D CG1 1 
ATOM   6156  C CG2 . ILE D 1 103 ? 9.728   -23.334 34.573  1.00 14.47 ? 331  ILE D CG2 1 
ATOM   6157  C CD1 . ILE D 1 103 ? 9.950   -26.225 33.524  1.00 14.40 ? 331  ILE D CD1 1 
ATOM   6158  N N   . MET D 1 104 ? 9.765   -21.938 37.583  1.00 15.46 ? 332  MET D N   1 
ATOM   6159  C CA  . MET D 1 104 ? 9.226   -20.661 38.062  1.00 15.98 ? 332  MET D CA  1 
ATOM   6160  C C   . MET D 1 104 ? 9.334   -19.542 37.025  1.00 16.08 ? 332  MET D C   1 
ATOM   6161  O O   . MET D 1 104 ? 10.418  -19.234 36.527  1.00 15.85 ? 332  MET D O   1 
ATOM   6162  C CB  . MET D 1 104 ? 9.908   -20.233 39.369  1.00 16.05 ? 332  MET D CB  1 
ATOM   6163  C CG  . MET D 1 104 ? 9.544   -21.113 40.570  1.00 16.43 ? 332  MET D CG  1 
ATOM   6164  S SD  . MET D 1 104 ? 10.122  -20.475 42.165  1.00 17.03 ? 332  MET D SD  1 
ATOM   6165  C CE  . MET D 1 104 ? 8.848   -19.267 42.543  1.00 16.62 ? 332  MET D CE  1 
ATOM   6166  N N   . ASP D 1 105 ? 8.180   -18.952 36.720  1.00 16.46 ? 333  ASP D N   1 
ATOM   6167  C CA  . ASP D 1 105 ? 8.067   -17.769 35.870  1.00 16.68 ? 333  ASP D CA  1 
ATOM   6168  C C   . ASP D 1 105 ? 7.740   -16.582 36.756  1.00 16.85 ? 333  ASP D C   1 
ATOM   6169  O O   . ASP D 1 105 ? 7.525   -16.739 37.960  1.00 16.74 ? 333  ASP D O   1 
ATOM   6170  C CB  . ASP D 1 105 ? 6.967   -17.959 34.815  1.00 16.76 ? 333  ASP D CB  1 
ATOM   6171  C CG  . ASP D 1 105 ? 5.606   -18.289 35.429  1.00 16.53 ? 333  ASP D CG  1 
ATOM   6172  O OD1 . ASP D 1 105 ? 5.200   -17.626 36.407  1.00 16.71 ? 333  ASP D OD1 1 
ATOM   6173  O OD2 . ASP D 1 105 ? 4.944   -19.217 34.926  1.00 15.81 ? 333  ASP D OD2 1 
ATOM   6174  N N   . GLU D 1 106 ? 7.665   -15.403 36.150  1.00 17.20 ? 334  GLU D N   1 
ATOM   6175  C CA  . GLU D 1 106 ? 7.467   -14.162 36.900  1.00 17.53 ? 334  GLU D CA  1 
ATOM   6176  C C   . GLU D 1 106 ? 6.334   -14.272 37.923  1.00 17.57 ? 334  GLU D C   1 
ATOM   6177  O O   . GLU D 1 106 ? 6.508   -13.908 39.088  1.00 17.60 ? 334  GLU D O   1 
ATOM   6178  C CB  . GLU D 1 106 ? 7.203   -12.980 35.948  1.00 17.57 ? 334  GLU D CB  1 
ATOM   6179  C CG  . GLU D 1 106 ? 7.665   -11.620 36.499  1.00 17.76 ? 334  GLU D CG  1 
ATOM   6180  C CD  . GLU D 1 106 ? 7.149   -10.431 35.694  1.00 17.63 ? 334  GLU D CD  1 
ATOM   6181  O OE1 . GLU D 1 106 ? 6.621   -10.637 34.577  1.00 17.99 ? 334  GLU D OE1 1 
ATOM   6182  O OE2 . GLU D 1 106 ? 7.272   -9.288  36.186  1.00 17.14 ? 334  GLU D OE2 1 
ATOM   6183  N N   . ASP D 1 107 ? 5.192   -14.797 37.490  1.00 17.68 ? 335  ASP D N   1 
ATOM   6184  C CA  . ASP D 1 107 ? 3.973   -14.754 38.300  1.00 17.73 ? 335  ASP D CA  1 
ATOM   6185  C C   . ASP D 1 107 ? 3.974   -15.729 39.471  1.00 17.76 ? 335  ASP D C   1 
ATOM   6186  O O   . ASP D 1 107 ? 3.321   -15.469 40.480  1.00 17.63 ? 335  ASP D O   1 
ATOM   6187  C CB  . ASP D 1 107 ? 2.742   -14.953 37.421  1.00 17.73 ? 335  ASP D CB  1 
ATOM   6188  C CG  . ASP D 1 107 ? 2.568   -13.830 36.415  1.00 17.88 ? 335  ASP D CG  1 
ATOM   6189  O OD1 . ASP D 1 107 ? 3.497   -13.619 35.605  1.00 18.37 ? 335  ASP D OD1 1 
ATOM   6190  O OD2 . ASP D 1 107 ? 1.518   -13.154 36.436  1.00 17.41 ? 335  ASP D OD2 1 
ATOM   6191  N N   . GLN D 1 108 ? 4.700   -16.840 39.339  1.00 17.88 ? 336  GLN D N   1 
ATOM   6192  C CA  . GLN D 1 108 ? 4.940   -17.740 40.473  1.00 17.88 ? 336  GLN D CA  1 
ATOM   6193  C C   . GLN D 1 108 ? 5.929   -17.107 41.437  1.00 18.10 ? 336  GLN D C   1 
ATOM   6194  O O   . GLN D 1 108 ? 5.753   -17.164 42.656  1.00 18.10 ? 336  GLN D O   1 
ATOM   6195  C CB  . GLN D 1 108 ? 5.484   -19.084 40.009  1.00 17.66 ? 336  GLN D CB  1 
ATOM   6196  C CG  . GLN D 1 108 ? 4.437   -20.002 39.442  1.00 17.16 ? 336  GLN D CG  1 
ATOM   6197  C CD  . GLN D 1 108 ? 5.051   -21.203 38.770  1.00 16.40 ? 336  GLN D CD  1 
ATOM   6198  O OE1 . GLN D 1 108 ? 5.725   -22.009 39.407  1.00 15.37 ? 336  GLN D OE1 1 
ATOM   6199  N NE2 . GLN D 1 108 ? 4.831   -21.326 37.472  1.00 16.56 ? 336  GLN D NE2 1 
ATOM   6200  N N   . SER D 1 109 ? 6.968   -16.499 40.876  1.00 18.36 ? 337  SER D N   1 
ATOM   6201  C CA  . SER D 1 109 ? 7.974   -15.810 41.675  1.00 18.62 ? 337  SER D CA  1 
ATOM   6202  C C   . SER D 1 109 ? 7.391   -14.583 42.386  1.00 18.86 ? 337  SER D C   1 
ATOM   6203  O O   . SER D 1 109 ? 7.957   -14.117 43.377  1.00 18.96 ? 337  SER D O   1 
ATOM   6204  C CB  . SER D 1 109 ? 9.176   -15.421 40.807  1.00 18.62 ? 337  SER D CB  1 
ATOM   6205  O OG  . SER D 1 109 ? 9.805   -16.578 40.274  1.00 18.51 ? 337  SER D OG  1 
ATOM   6206  N N   . LYS D 1 110 ? 6.270   -14.064 41.882  1.00 19.07 ? 338  LYS D N   1 
ATOM   6207  C CA  . LYS D 1 110 ? 5.511   -13.039 42.605  1.00 19.34 ? 338  LYS D CA  1 
ATOM   6208  C C   . LYS D 1 110 ? 4.840   -13.628 43.844  1.00 19.28 ? 338  LYS D C   1 
ATOM   6209  O O   . LYS D 1 110 ? 4.877   -13.022 44.916  1.00 19.22 ? 338  LYS D O   1 
ATOM   6210  C CB  . LYS D 1 110 ? 4.464   -12.365 41.702  1.00 19.42 ? 338  LYS D CB  1 
ATOM   6211  C CG  . LYS D 1 110 ? 4.986   -11.127 40.967  1.00 19.75 ? 338  LYS D CG  1 
ATOM   6212  C CD  . LYS D 1 110 ? 3.973   -10.577 39.950  1.00 19.87 ? 338  LYS D CD  1 
ATOM   6213  C CE  . LYS D 1 110 ? 4.572   -9.425  39.129  1.00 20.02 ? 338  LYS D CE  1 
ATOM   6214  N NZ  . LYS D 1 110 ? 3.935   -9.278  37.788  1.00 19.59 ? 338  LYS D NZ  1 
ATOM   6215  N N   . LEU D 1 111 ? 4.243   -14.809 43.696  1.00 19.37 ? 339  LEU D N   1 
ATOM   6216  C CA  . LEU D 1 111 ? 3.511   -15.458 44.793  1.00 19.41 ? 339  LEU D CA  1 
ATOM   6217  C C   . LEU D 1 111 ? 4.416   -15.906 45.937  1.00 19.39 ? 339  LEU D C   1 
ATOM   6218  O O   . LEU D 1 111 ? 4.019   -15.836 47.105  1.00 19.46 ? 339  LEU D O   1 
ATOM   6219  C CB  . LEU D 1 111 ? 2.722   -16.665 44.281  1.00 19.41 ? 339  LEU D CB  1 
ATOM   6220  C CG  . LEU D 1 111 ? 1.584   -16.378 43.303  1.00 19.49 ? 339  LEU D CG  1 
ATOM   6221  C CD1 . LEU D 1 111 ? 0.708   -17.619 43.166  1.00 19.41 ? 339  LEU D CD1 1 
ATOM   6222  C CD2 . LEU D 1 111 ? 0.753   -15.168 43.742  1.00 19.51 ? 339  LEU D CD2 1 
ATOM   6223  N N   . ALA D 1 112 ? 5.616   -16.373 45.595  1.00 19.21 ? 340  ALA D N   1 
ATOM   6224  C CA  . ALA D 1 112 ? 6.610   -16.776 46.589  1.00 19.06 ? 340  ALA D CA  1 
ATOM   6225  C C   . ALA D 1 112 ? 7.372   -15.580 47.174  1.00 19.02 ? 340  ALA D C   1 
ATOM   6226  O O   . ALA D 1 112 ? 8.105   -15.732 48.151  1.00 19.08 ? 340  ALA D O   1 
ATOM   6227  C CB  . ALA D 1 112 ? 7.584   -17.760 45.979  1.00 19.03 ? 340  ALA D CB  1 
ATOM   6228  N N   . GLY D 1 113 ? 7.206   -14.402 46.576  1.00 18.95 ? 341  GLY D N   1 
ATOM   6229  C CA  . GLY D 1 113 ? 7.883   -13.189 47.036  1.00 18.89 ? 341  GLY D CA  1 
ATOM   6230  C C   . GLY D 1 113 ? 9.372   -13.224 46.767  1.00 18.88 ? 341  GLY D C   1 
ATOM   6231  O O   . GLY D 1 113 ? 10.157  -12.643 47.517  1.00 18.89 ? 341  GLY D O   1 
ATOM   6232  N N   . LEU D 1 114 ? 9.751   -13.913 45.691  1.00 18.81 ? 342  LEU D N   1 
ATOM   6233  C CA  . LEU D 1 114 ? 11.147  -14.086 45.304  1.00 18.70 ? 342  LEU D CA  1 
ATOM   6234  C C   . LEU D 1 114 ? 11.492  -13.304 44.034  1.00 18.71 ? 342  LEU D C   1 
ATOM   6235  O O   . LEU D 1 114 ? 12.528  -13.556 43.414  1.00 18.94 ? 342  LEU D O   1 
ATOM   6236  C CB  . LEU D 1 114 ? 11.438  -15.573 45.067  1.00 18.64 ? 342  LEU D CB  1 
ATOM   6237  C CG  . LEU D 1 114 ? 11.400  -16.513 46.271  1.00 18.33 ? 342  LEU D CG  1 
ATOM   6238  C CD1 . LEU D 1 114 ? 11.339  -17.955 45.804  1.00 18.30 ? 342  LEU D CD1 1 
ATOM   6239  C CD2 . LEU D 1 114 ? 12.608  -16.300 47.155  1.00 17.68 ? 342  LEU D CD2 1 
ATOM   6240  N N   . LEU D 1 115 ? 10.640  -12.353 43.653  1.00 18.54 ? 343  LEU D N   1 
ATOM   6241  C CA  . LEU D 1 115 ? 10.820  -11.604 42.404  1.00 18.40 ? 343  LEU D CA  1 
ATOM   6242  C C   . LEU D 1 115 ? 12.225  -11.026 42.302  1.00 18.29 ? 343  LEU D C   1 
ATOM   6243  O O   . LEU D 1 115 ? 12.919  -11.243 41.309  1.00 18.44 ? 343  LEU D O   1 
ATOM   6244  C CB  . LEU D 1 115 ? 9.792   -10.469 42.292  1.00 18.42 ? 343  LEU D CB  1 
ATOM   6245  C CG  . LEU D 1 115 ? 9.862   -9.559  41.057  1.00 18.40 ? 343  LEU D CG  1 
ATOM   6246  C CD1 . LEU D 1 115 ? 9.843   -10.360 39.750  1.00 17.80 ? 343  LEU D CD1 1 
ATOM   6247  C CD2 . LEU D 1 115 ? 8.723   -8.552  41.101  1.00 18.41 ? 343  LEU D CD2 1 
ATOM   6248  N N   . ASP D 1 116 ? 12.639  -10.304 43.341  1.00 17.96 ? 344  ASP D N   1 
ATOM   6249  C CA  . ASP D 1 116 ? 13.921  -9.618  43.336  1.00 17.66 ? 344  ASP D CA  1 
ATOM   6250  C C   . ASP D 1 116 ? 15.052  -10.635 43.230  1.00 17.33 ? 344  ASP D C   1 
ATOM   6251  O O   . ASP D 1 116 ? 16.019  -10.431 42.485  1.00 17.41 ? 344  ASP D O   1 
ATOM   6252  C CB  . ASP D 1 116 ? 14.094  -8.770  44.603  1.00 17.82 ? 344  ASP D CB  1 
ATOM   6253  C CG  . ASP D 1 116 ? 12.973  -7.742  44.795  1.00 18.54 ? 344  ASP D CG  1 
ATOM   6254  O OD1 . ASP D 1 116 ? 13.177  -6.559  44.438  1.00 19.14 ? 344  ASP D OD1 1 
ATOM   6255  O OD2 . ASP D 1 116 ? 11.889  -8.118  45.309  1.00 19.03 ? 344  ASP D OD2 1 
ATOM   6256  N N   . LEU D 1 117 ? 14.908  -11.744 43.956  1.00 16.67 ? 345  LEU D N   1 
ATOM   6257  C CA  . LEU D 1 117 ? 15.961  -12.761 44.047  1.00 16.03 ? 345  LEU D CA  1 
ATOM   6258  C C   . LEU D 1 117 ? 16.092  -13.588 42.767  1.00 15.85 ? 345  LEU D C   1 
ATOM   6259  O O   . LEU D 1 117 ? 17.209  -13.866 42.319  1.00 16.00 ? 345  LEU D O   1 
ATOM   6260  C CB  . LEU D 1 117 ? 15.698  -13.674 45.248  1.00 15.87 ? 345  LEU D CB  1 
ATOM   6261  C CG  . LEU D 1 117 ? 16.695  -14.787 45.547  1.00 15.36 ? 345  LEU D CG  1 
ATOM   6262  C CD1 . LEU D 1 117 ? 18.125  -14.309 45.370  1.00 15.38 ? 345  LEU D CD1 1 
ATOM   6263  C CD2 . LEU D 1 117 ? 16.460  -15.312 46.955  1.00 15.44 ? 345  LEU D CD2 1 
ATOM   6264  N N   . ASN D 1 118 ? 14.956  -13.982 42.192  1.00 15.41 ? 346  ASN D N   1 
ATOM   6265  C CA  . ASN D 1 118 ? 14.943  -14.728 40.929  1.00 15.07 ? 346  ASN D CA  1 
ATOM   6266  C C   . ASN D 1 118 ? 15.363  -13.823 39.762  1.00 14.96 ? 346  ASN D C   1 
ATOM   6267  O O   . ASN D 1 118 ? 16.090  -14.263 38.866  1.00 15.09 ? 346  ASN D O   1 
ATOM   6268  C CB  . ASN D 1 118 ? 13.560  -15.376 40.661  1.00 14.97 ? 346  ASN D CB  1 
ATOM   6269  C CG  . ASN D 1 118 ? 13.347  -16.709 41.422  1.00 14.44 ? 346  ASN D CG  1 
ATOM   6270  O OD1 . ASN D 1 118 ? 14.160  -17.113 42.252  1.00 14.33 ? 346  ASN D OD1 1 
ATOM   6271  N ND2 . ASN D 1 118 ? 12.240  -17.383 41.131  1.00 13.20 ? 346  ASN D ND2 1 
ATOM   6272  N N   . ASN D 1 119 ? 14.921  -12.565 39.773  1.00 14.70 ? 347  ASN D N   1 
ATOM   6273  C CA  . ASN D 1 119 ? 15.346  -11.604 38.749  1.00 14.60 ? 347  ASN D CA  1 
ATOM   6274  C C   . ASN D 1 119 ? 16.840  -11.451 38.736  1.00 14.77 ? 347  ASN D C   1 
ATOM   6275  O O   . ASN D 1 119 ? 17.439  -11.268 37.675  1.00 15.02 ? 347  ASN D O   1 
ATOM   6276  C CB  . ASN D 1 119 ? 14.736  -10.222 38.967  1.00 14.49 ? 347  ASN D CB  1 
ATOM   6277  C CG  . ASN D 1 119 ? 13.383  -10.063 38.303  1.00 13.99 ? 347  ASN D CG  1 
ATOM   6278  O OD1 . ASN D 1 119 ? 12.805  -11.019 37.781  1.00 13.00 ? 347  ASN D OD1 1 
ATOM   6279  N ND2 . ASN D 1 119 ? 12.876  -8.838  38.309  1.00 12.92 ? 347  ASN D ND2 1 
ATOM   6280  N N   . ALA D 1 120 ? 17.438  -11.503 39.923  1.00 14.87 ? 348  ALA D N   1 
ATOM   6281  C CA  . ALA D 1 120 ? 18.887  -11.511 40.047  1.00 14.81 ? 348  ALA D CA  1 
ATOM   6282  C C   . ALA D 1 120 ? 19.431  -12.794 39.414  1.00 14.84 ? 348  ALA D C   1 
ATOM   6283  O O   . ALA D 1 120 ? 20.328  -12.752 38.570  1.00 15.11 ? 348  ALA D O   1 
ATOM   6284  C CB  . ALA D 1 120 ? 19.299  -11.404 41.501  1.00 14.67 ? 348  ALA D CB  1 
ATOM   6285  N N   . ILE D 1 121 ? 18.860  -13.928 39.789  1.00 14.71 ? 349  ILE D N   1 
ATOM   6286  C CA  . ILE D 1 121 ? 19.275  -15.207 39.214  1.00 14.72 ? 349  ILE D CA  1 
ATOM   6287  C C   . ILE D 1 121 ? 19.157  -15.202 37.684  1.00 14.56 ? 349  ILE D C   1 
ATOM   6288  O O   . ILE D 1 121 ? 19.943  -15.840 36.994  1.00 14.18 ? 349  ILE D O   1 
ATOM   6289  C CB  . ILE D 1 121 ? 18.475  -16.384 39.832  1.00 14.78 ? 349  ILE D CB  1 
ATOM   6290  C CG1 . ILE D 1 121 ? 18.874  -16.586 41.297  1.00 14.50 ? 349  ILE D CG1 1 
ATOM   6291  C CG2 . ILE D 1 121 ? 18.705  -17.677 39.054  1.00 14.72 ? 349  ILE D CG2 1 
ATOM   6292  C CD1 . ILE D 1 121 ? 17.911  -17.467 42.068  1.00 14.50 ? 349  ILE D CD1 1 
ATOM   6293  N N   . LEU D 1 122 ? 18.188  -14.464 37.162  1.00 14.74 ? 350  LEU D N   1 
ATOM   6294  C CA  . LEU D 1 122 ? 18.000  -14.371 35.718  1.00 15.12 ? 350  LEU D CA  1 
ATOM   6295  C C   . LEU D 1 122 ? 19.008  -13.459 35.035  1.00 15.33 ? 350  LEU D C   1 
ATOM   6296  O O   . LEU D 1 122 ? 19.250  -13.584 33.843  1.00 15.24 ? 350  LEU D O   1 
ATOM   6297  C CB  . LEU D 1 122 ? 16.581  -13.907 35.397  1.00 15.10 ? 350  LEU D CB  1 
ATOM   6298  C CG  . LEU D 1 122 ? 15.545  -14.998 35.653  1.00 15.18 ? 350  LEU D CG  1 
ATOM   6299  C CD1 . LEU D 1 122 ? 14.138  -14.427 35.534  1.00 15.50 ? 350  LEU D CD1 1 
ATOM   6300  C CD2 . LEU D 1 122 ? 15.755  -16.171 34.693  1.00 14.58 ? 350  LEU D CD2 1 
ATOM   6301  N N   . GLN D 1 123 ? 19.581  -12.531 35.784  1.00 15.73 ? 351  GLN D N   1 
ATOM   6302  C CA  . GLN D 1 123 ? 20.636  -11.695 35.247  1.00 16.35 ? 351  GLN D CA  1 
ATOM   6303  C C   . GLN D 1 123 ? 21.834  -12.593 34.901  1.00 16.39 ? 351  GLN D C   1 
ATOM   6304  O O   . GLN D 1 123 ? 22.539  -12.370 33.907  1.00 16.83 ? 351  GLN D O   1 
ATOM   6305  C CB  . GLN D 1 123 ? 21.022  -10.593 36.254  1.00 16.42 ? 351  GLN D CB  1 
ATOM   6306  C CG  . GLN D 1 123 ? 21.546  -9.287  35.618  1.00 16.89 ? 351  GLN D CG  1 
ATOM   6307  C CD  . GLN D 1 123 ? 22.013  -8.239  36.651  1.00 17.52 ? 351  GLN D CD  1 
ATOM   6308  O OE1 . GLN D 1 123 ? 21.507  -8.168  37.790  1.00 18.64 ? 351  GLN D OE1 1 
ATOM   6309  N NE2 . GLN D 1 123 ? 22.980  -7.414  36.245  1.00 18.59 ? 351  GLN D NE2 1 
ATOM   6310  N N   . LEU D 1 124 ? 22.051  -13.618 35.720  1.00 16.36 ? 352  LEU D N   1 
ATOM   6311  C CA  . LEU D 1 124 ? 23.140  -14.564 35.497  1.00 16.24 ? 352  LEU D CA  1 
ATOM   6312  C C   . LEU D 1 124 ? 22.849  -15.478 34.324  1.00 16.21 ? 352  LEU D C   1 
ATOM   6313  O O   . LEU D 1 124 ? 23.750  -15.774 33.527  1.00 16.25 ? 352  LEU D O   1 
ATOM   6314  C CB  . LEU D 1 124 ? 23.414  -15.398 36.747  1.00 16.20 ? 352  LEU D CB  1 
ATOM   6315  C CG  . LEU D 1 124 ? 24.632  -14.916 37.537  1.00 16.68 ? 352  LEU D CG  1 
ATOM   6316  C CD1 . LEU D 1 124 ? 24.662  -15.529 38.926  1.00 16.45 ? 352  LEU D CD1 1 
ATOM   6317  C CD2 . LEU D 1 124 ? 25.941  -15.211 36.764  1.00 17.29 ? 352  LEU D CD2 1 
ATOM   6318  N N   . VAL D 1 125 ? 21.599  -15.930 34.232  1.00 15.99 ? 353  VAL D N   1 
ATOM   6319  C CA  . VAL D 1 125 ? 21.148  -16.708 33.087  1.00 15.94 ? 353  VAL D CA  1 
ATOM   6320  C C   . VAL D 1 125 ? 21.344  -15.891 31.823  1.00 16.15 ? 353  VAL D C   1 
ATOM   6321  O O   . VAL D 1 125 ? 21.992  -16.352 30.877  1.00 16.05 ? 353  VAL D O   1 
ATOM   6322  C CB  . VAL D 1 125 ? 19.672  -17.115 33.222  1.00 15.96 ? 353  VAL D CB  1 
ATOM   6323  C CG1 . VAL D 1 125 ? 19.119  -17.627 31.902  1.00 15.54 ? 353  VAL D CG1 1 
ATOM   6324  C CG2 . VAL D 1 125 ? 19.525  -18.176 34.301  1.00 16.41 ? 353  VAL D CG2 1 
ATOM   6325  N N   . LYS D 1 126 ? 20.810  -14.667 31.833  1.00 16.39 ? 354  LYS D N   1 
ATOM   6326  C CA  . LYS D 1 126 ? 20.883  -13.752 30.687  1.00 16.64 ? 354  LYS D CA  1 
ATOM   6327  C C   . LYS D 1 126 ? 22.308  -13.609 30.173  1.00 16.53 ? 354  LYS D C   1 
ATOM   6328  O O   . LYS D 1 126 ? 22.527  -13.514 28.967  1.00 16.60 ? 354  LYS D O   1 
ATOM   6329  C CB  . LYS D 1 126 ? 20.324  -12.373 31.066  1.00 16.79 ? 354  LYS D CB  1 
ATOM   6330  C CG  . LYS D 1 126 ? 20.500  -11.263 30.009  1.00 16.99 ? 354  LYS D CG  1 
ATOM   6331  C CD  . LYS D 1 126 ? 19.999  -9.919  30.549  1.00 17.61 ? 354  LYS D CD  1 
ATOM   6332  C CE  . LYS D 1 126 ? 20.462  -8.723  29.707  1.00 17.96 ? 354  LYS D CE  1 
ATOM   6333  N NZ  . LYS D 1 126 ? 19.765  -8.619  28.399  1.00 18.34 ? 354  LYS D NZ  1 
ATOM   6334  N N   . LYS D 1 127 ? 23.272  -13.600 31.085  1.00 16.42 ? 355  LYS D N   1 
ATOM   6335  C CA  . LYS D 1 127 ? 24.661  -13.450 30.692  1.00 16.53 ? 355  LYS D CA  1 
ATOM   6336  C C   . LYS D 1 127 ? 25.185  -14.730 30.041  1.00 16.35 ? 355  LYS D C   1 
ATOM   6337  O O   . LYS D 1 127 ? 25.607  -14.721 28.893  1.00 16.48 ? 355  LYS D O   1 
ATOM   6338  C CB  . LYS D 1 127 ? 25.517  -13.064 31.898  1.00 16.65 ? 355  LYS D CB  1 
ATOM   6339  C CG  . LYS D 1 127 ? 26.679  -12.160 31.551  1.00 16.43 ? 355  LYS D CG  1 
ATOM   6340  C CD  . LYS D 1 127 ? 27.586  -11.960 32.734  1.00 17.35 ? 355  LYS D CD  1 
ATOM   6341  C CE  . LYS D 1 127 ? 26.929  -11.184 33.879  1.00 17.93 ? 355  LYS D CE  1 
ATOM   6342  N NZ  . LYS D 1 127 ? 27.820  -11.138 35.098  1.00 18.40 ? 355  LYS D NZ  1 
ATOM   6343  N N   . TYR D 1 128 ? 25.130  -15.838 30.759  1.00 16.13 ? 356  TYR D N   1 
ATOM   6344  C CA  . TYR D 1 128 ? 25.671  -17.086 30.226  1.00 16.19 ? 356  TYR D CA  1 
ATOM   6345  C C   . TYR D 1 128 ? 25.054  -17.468 28.865  1.00 16.68 ? 356  TYR D C   1 
ATOM   6346  O O   . TYR D 1 128 ? 25.734  -18.064 28.021  1.00 16.62 ? 356  TYR D O   1 
ATOM   6347  C CB  . TYR D 1 128 ? 25.495  -18.224 31.234  1.00 15.77 ? 356  TYR D CB  1 
ATOM   6348  C CG  . TYR D 1 128 ? 26.398  -18.138 32.453  1.00 15.17 ? 356  TYR D CG  1 
ATOM   6349  C CD1 . TYR D 1 128 ? 27.771  -17.971 32.317  1.00 14.24 ? 356  TYR D CD1 1 
ATOM   6350  C CD2 . TYR D 1 128 ? 25.882  -18.260 33.736  1.00 14.73 ? 356  TYR D CD2 1 
ATOM   6351  C CE1 . TYR D 1 128 ? 28.592  -17.907 33.413  1.00 14.14 ? 356  TYR D CE1 1 
ATOM   6352  C CE2 . TYR D 1 128 ? 26.702  -18.204 34.849  1.00 14.81 ? 356  TYR D CE2 1 
ATOM   6353  C CZ  . TYR D 1 128 ? 28.061  -18.024 34.681  1.00 15.22 ? 356  TYR D CZ  1 
ATOM   6354  O OH  . TYR D 1 128 ? 28.903  -17.961 35.777  1.00 15.36 ? 356  TYR D OH  1 
ATOM   6355  N N   . LYS D 1 129 ? 23.775  -17.130 28.665  1.00 17.00 ? 357  LYS D N   1 
ATOM   6356  C CA  . LYS D 1 129 ? 23.111  -17.309 27.369  1.00 17.26 ? 357  LYS D CA  1 
ATOM   6357  C C   . LYS D 1 129 ? 23.902  -16.627 26.254  1.00 17.52 ? 357  LYS D C   1 
ATOM   6358  O O   . LYS D 1 129 ? 24.141  -17.222 25.196  1.00 17.63 ? 357  LYS D O   1 
ATOM   6359  C CB  . LYS D 1 129 ? 21.717  -16.680 27.367  1.00 17.37 ? 357  LYS D CB  1 
ATOM   6360  C CG  . LYS D 1 129 ? 20.553  -17.582 27.740  1.00 17.90 ? 357  LYS D CG  1 
ATOM   6361  C CD  . LYS D 1 129 ? 19.270  -17.105 27.014  1.00 18.43 ? 357  LYS D CD  1 
ATOM   6362  C CE  . LYS D 1 129 ? 17.989  -17.384 27.794  1.00 18.57 ? 357  LYS D CE  1 
ATOM   6363  N NZ  . LYS D 1 129 ? 16.781  -17.162 26.956  1.00 18.47 ? 357  LYS D NZ  1 
ATOM   6364  N N   . SER D 1 130 ? 24.277  -15.369 26.489  1.00 17.45 ? 358  SER D N   1 
ATOM   6365  C CA  . SER D 1 130 ? 25.024  -14.594 25.509  1.00 17.65 ? 358  SER D CA  1 
ATOM   6366  C C   . SER D 1 130 ? 26.283  -15.327 25.128  1.00 17.53 ? 358  SER D C   1 
ATOM   6367  O O   . SER D 1 130 ? 26.622  -15.414 23.960  1.00 17.41 ? 358  SER D O   1 
ATOM   6368  C CB  . SER D 1 130 ? 25.399  -13.232 26.074  1.00 17.94 ? 358  SER D CB  1 
ATOM   6369  O OG  . SER D 1 130 ? 24.287  -12.636 26.722  1.00 19.42 ? 358  SER D OG  1 
ATOM   6370  N N   . MET D 1 131 ? 26.944  -15.903 26.125  1.00 17.65 ? 359  MET D N   1 
ATOM   6371  C CA  . MET D 1 131 ? 28.241  -16.545 25.927  1.00 17.89 ? 359  MET D CA  1 
ATOM   6372  C C   . MET D 1 131 ? 28.140  -17.954 25.335  1.00 17.58 ? 359  MET D C   1 
ATOM   6373  O O   . MET D 1 131 ? 29.150  -18.529 24.964  1.00 17.32 ? 359  MET D O   1 
ATOM   6374  C CB  . MET D 1 131 ? 28.985  -16.626 27.252  1.00 17.80 ? 359  MET D CB  1 
ATOM   6375  C CG  . MET D 1 131 ? 28.900  -15.366 28.073  1.00 18.65 ? 359  MET D CG  1 
ATOM   6376  S SD  . MET D 1 131 ? 29.763  -15.520 29.631  1.00 19.47 ? 359  MET D SD  1 
ATOM   6377  C CE  . MET D 1 131 ? 31.379  -14.945 29.105  1.00 19.40 ? 359  MET D CE  1 
ATOM   6378  N N   . LYS D 1 132 ? 26.931  -18.505 25.246  1.00 17.38 ? 360  LYS D N   1 
ATOM   6379  C CA  . LYS D 1 132 ? 26.733  -19.887 24.814  1.00 17.42 ? 360  LYS D CA  1 
ATOM   6380  C C   . LYS D 1 132 ? 27.469  -20.836 25.752  1.00 16.65 ? 360  LYS D C   1 
ATOM   6381  O O   . LYS D 1 132 ? 28.243  -21.682 25.304  1.00 16.32 ? 360  LYS D O   1 
ATOM   6382  C CB  . LYS D 1 132 ? 27.199  -20.110 23.365  1.00 17.46 ? 360  LYS D CB  1 
ATOM   6383  C CG  . LYS D 1 132 ? 26.513  -19.234 22.337  1.00 18.10 ? 360  LYS D CG  1 
ATOM   6384  C CD  . LYS D 1 132 ? 27.267  -19.279 21.011  1.00 19.05 ? 360  LYS D CD  1 
ATOM   6385  C CE  . LYS D 1 132 ? 26.786  -18.201 20.022  1.00 20.91 ? 360  LYS D CE  1 
ATOM   6386  N NZ  . LYS D 1 132 ? 25.661  -18.700 19.161  1.00 21.80 ? 360  LYS D NZ  1 
ATOM   6387  N N   . LEU D 1 133 ? 27.214  -20.680 27.051  1.00 16.04 ? 361  LEU D N   1 
ATOM   6388  C CA  . LEU D 1 133 ? 27.852  -21.505 28.079  1.00 15.74 ? 361  LEU D CA  1 
ATOM   6389  C C   . LEU D 1 133 ? 27.576  -22.977 27.807  1.00 15.76 ? 361  LEU D C   1 
ATOM   6390  O O   . LEU D 1 133 ? 26.451  -23.352 27.489  1.00 15.81 ? 361  LEU D O   1 
ATOM   6391  C CB  . LEU D 1 133 ? 27.374  -21.129 29.490  1.00 15.53 ? 361  LEU D CB  1 
ATOM   6392  C CG  . LEU D 1 133 ? 28.094  -21.822 30.656  1.00 14.97 ? 361  LEU D CG  1 
ATOM   6393  C CD1 . LEU D 1 133 ? 29.462  -21.236 30.841  1.00 13.77 ? 361  LEU D CD1 1 
ATOM   6394  C CD2 . LEU D 1 133 ? 27.312  -21.717 31.946  1.00 14.70 ? 361  LEU D CD2 1 
ATOM   6395  N N   . GLU D 1 134 ? 28.624  -23.782 27.941  1.00 15.62 ? 362  GLU D N   1 
ATOM   6396  C CA  . GLU D 1 134 ? 28.617  -25.189 27.593  1.00 16.00 ? 362  GLU D CA  1 
ATOM   6397  C C   . GLU D 1 134 ? 28.845  -25.981 28.870  1.00 16.03 ? 362  GLU D C   1 
ATOM   6398  O O   . GLU D 1 134 ? 29.419  -25.460 29.825  1.00 16.30 ? 362  GLU D O   1 
ATOM   6399  C CB  . GLU D 1 134 ? 29.745  -25.476 26.596  1.00 16.05 ? 362  GLU D CB  1 
ATOM   6400  C CG  . GLU D 1 134 ? 29.788  -24.498 25.411  1.00 16.69 ? 362  GLU D CG  1 
ATOM   6401  C CD  . GLU D 1 134 ? 31.011  -24.656 24.514  1.00 16.88 ? 362  GLU D CD  1 
ATOM   6402  O OE1 . GLU D 1 134 ? 31.858  -25.534 24.794  1.00 18.37 ? 362  GLU D OE1 1 
ATOM   6403  O OE2 . GLU D 1 134 ? 31.116  -23.894 23.522  1.00 16.61 ? 362  GLU D OE2 1 
ATOM   6404  N N   . LYS D 1 135 ? 28.411  -27.235 28.890  1.00 15.97 ? 363  LYS D N   1 
ATOM   6405  C CA  . LYS D 1 135 ? 28.474  -28.049 30.107  1.00 16.07 ? 363  LYS D CA  1 
ATOM   6406  C C   . LYS D 1 135 ? 29.904  -28.194 30.622  1.00 15.95 ? 363  LYS D C   1 
ATOM   6407  O O   . LYS D 1 135 ? 30.146  -28.190 31.825  1.00 16.23 ? 363  LYS D O   1 
ATOM   6408  C CB  . LYS D 1 135 ? 27.878  -29.436 29.852  1.00 16.34 ? 363  LYS D CB  1 
ATOM   6409  C CG  . LYS D 1 135 ? 27.478  -30.174 31.107  1.00 17.33 ? 363  LYS D CG  1 
ATOM   6410  C CD  . LYS D 1 135 ? 26.569  -31.351 30.794  1.00 18.37 ? 363  LYS D CD  1 
ATOM   6411  C CE  . LYS D 1 135 ? 25.923  -31.886 32.065  1.00 18.83 ? 363  LYS D CE  1 
ATOM   6412  N NZ  . LYS D 1 135 ? 24.944  -32.969 31.771  1.00 18.96 ? 363  LYS D NZ  1 
ATOM   6413  N N   . GLU D 1 136 ? 30.855  -28.314 29.707  1.00 15.75 ? 364  GLU D N   1 
ATOM   6414  C CA  . GLU D 1 136 ? 32.253  -28.432 30.087  1.00 15.55 ? 364  GLU D CA  1 
ATOM   6415  C C   . GLU D 1 136 ? 32.703  -27.227 30.903  1.00 15.42 ? 364  GLU D C   1 
ATOM   6416  O O   . GLU D 1 136 ? 33.636  -27.325 31.696  1.00 15.42 ? 364  GLU D O   1 
ATOM   6417  C CB  . GLU D 1 136 ? 33.124  -28.559 28.842  1.00 15.49 ? 364  GLU D CB  1 
ATOM   6418  C CG  . GLU D 1 136 ? 33.075  -29.935 28.177  1.00 16.11 ? 364  GLU D CG  1 
ATOM   6419  C CD  . GLU D 1 136 ? 31.911  -30.135 27.211  1.00 16.11 ? 364  GLU D CD  1 
ATOM   6420  O OE1 . GLU D 1 136 ? 31.063  -29.225 27.066  1.00 14.44 ? 364  GLU D OE1 1 
ATOM   6421  O OE2 . GLU D 1 136 ? 31.860  -31.230 26.598  1.00 16.65 ? 364  GLU D OE2 1 
ATOM   6422  N N   . GLU D 1 137 ? 32.039  -26.094 30.683  1.00 15.32 ? 365  GLU D N   1 
ATOM   6423  C CA  . GLU D 1 137 ? 32.394  -24.823 31.309  1.00 15.42 ? 365  GLU D CA  1 
ATOM   6424  C C   . GLU D 1 137 ? 31.584  -24.604 32.591  1.00 15.24 ? 365  GLU D C   1 
ATOM   6425  O O   . GLU D 1 137 ? 32.080  -24.056 33.575  1.00 15.20 ? 365  GLU D O   1 
ATOM   6426  C CB  . GLU D 1 137 ? 32.168  -23.675 30.314  1.00 15.17 ? 365  GLU D CB  1 
ATOM   6427  C CG  . GLU D 1 137 ? 32.973  -23.814 29.033  1.00 15.14 ? 365  GLU D CG  1 
ATOM   6428  C CD  . GLU D 1 137 ? 32.546  -22.833 27.945  1.00 16.03 ? 365  GLU D CD  1 
ATOM   6429  O OE1 . GLU D 1 137 ? 31.337  -22.741 27.660  1.00 17.21 ? 365  GLU D OE1 1 
ATOM   6430  O OE2 . GLU D 1 137 ? 33.416  -22.158 27.355  1.00 16.04 ? 365  GLU D OE2 1 
ATOM   6431  N N   . PHE D 1 138 ? 30.326  -25.023 32.555  1.00 15.21 ? 366  PHE D N   1 
ATOM   6432  C CA  . PHE D 1 138 ? 29.484  -25.068 33.743  1.00 15.07 ? 366  PHE D CA  1 
ATOM   6433  C C   . PHE D 1 138 ? 30.211  -25.819 34.853  1.00 14.70 ? 366  PHE D C   1 
ATOM   6434  O O   . PHE D 1 138 ? 30.517  -25.241 35.896  1.00 14.99 ? 366  PHE D O   1 
ATOM   6435  C CB  . PHE D 1 138 ? 28.152  -25.744 33.408  1.00 14.96 ? 366  PHE D CB  1 
ATOM   6436  C CG  . PHE D 1 138 ? 27.298  -26.062 34.607  1.00 15.46 ? 366  PHE D CG  1 
ATOM   6437  C CD1 . PHE D 1 138 ? 26.861  -25.058 35.460  1.00 15.31 ? 366  PHE D CD1 1 
ATOM   6438  C CD2 . PHE D 1 138 ? 26.892  -27.376 34.864  1.00 15.63 ? 366  PHE D CD2 1 
ATOM   6439  C CE1 . PHE D 1 138 ? 26.053  -25.372 36.565  1.00 15.44 ? 366  PHE D CE1 1 
ATOM   6440  C CE2 . PHE D 1 138 ? 26.086  -27.682 35.957  1.00 14.45 ? 366  PHE D CE2 1 
ATOM   6441  C CZ  . PHE D 1 138 ? 25.668  -26.683 36.803  1.00 14.49 ? 366  PHE D CZ  1 
ATOM   6442  N N   . VAL D 1 139 ? 30.530  -27.085 34.600  1.00 14.25 ? 367  VAL D N   1 
ATOM   6443  C CA  . VAL D 1 139 ? 31.126  -27.958 35.621  1.00 13.77 ? 367  VAL D CA  1 
ATOM   6444  C C   . VAL D 1 139 ? 32.441  -27.429 36.135  1.00 13.63 ? 367  VAL D C   1 
ATOM   6445  O O   . VAL D 1 139 ? 32.693  -27.486 37.328  1.00 13.94 ? 367  VAL D O   1 
ATOM   6446  C CB  . VAL D 1 139 ? 31.357  -29.396 35.116  1.00 13.55 ? 367  VAL D CB  1 
ATOM   6447  C CG1 . VAL D 1 139 ? 30.044  -30.000 34.634  1.00 13.56 ? 367  VAL D CG1 1 
ATOM   6448  C CG2 . VAL D 1 139 ? 32.407  -29.431 34.026  1.00 12.79 ? 367  VAL D CG2 1 
ATOM   6449  N N   . THR D 1 140 ? 33.266  -26.901 35.238  1.00 13.61 ? 368  THR D N   1 
ATOM   6450  C CA  . THR D 1 140 ? 34.578  -26.397 35.607  1.00 13.62 ? 368  THR D CA  1 
ATOM   6451  C C   . THR D 1 140 ? 34.376  -25.146 36.463  1.00 13.92 ? 368  THR D C   1 
ATOM   6452  O O   . THR D 1 140 ? 35.060  -24.962 37.478  1.00 14.01 ? 368  THR D O   1 
ATOM   6453  C CB  . THR D 1 140 ? 35.476  -26.099 34.353  1.00 13.74 ? 368  THR D CB  1 
ATOM   6454  O OG1 . THR D 1 140 ? 35.643  -27.287 33.559  1.00 12.67 ? 368  THR D OG1 1 
ATOM   6455  C CG2 . THR D 1 140 ? 36.854  -25.597 34.777  1.00 13.46 ? 368  THR D CG2 1 
ATOM   6456  N N   . LEU D 1 141 ? 33.406  -24.314 36.084  1.00 14.08 ? 369  LEU D N   1 
ATOM   6457  C CA  . LEU D 1 141 ? 33.100  -23.104 36.863  1.00 14.13 ? 369  LEU D CA  1 
ATOM   6458  C C   . LEU D 1 141 ? 32.524  -23.396 38.256  1.00 14.31 ? 369  LEU D C   1 
ATOM   6459  O O   . LEU D 1 141 ? 32.870  -22.689 39.205  1.00 15.06 ? 369  LEU D O   1 
ATOM   6460  C CB  . LEU D 1 141 ? 32.164  -22.138 36.114  1.00 14.08 ? 369  LEU D CB  1 
ATOM   6461  C CG  . LEU D 1 141 ? 32.783  -21.027 35.250  1.00 13.59 ? 369  LEU D CG  1 
ATOM   6462  C CD1 . LEU D 1 141 ? 31.702  -20.007 34.876  1.00 12.69 ? 369  LEU D CD1 1 
ATOM   6463  C CD2 . LEU D 1 141 ? 33.957  -20.318 35.938  1.00 12.72 ? 369  LEU D CD2 1 
ATOM   6464  N N   . LYS D 1 142 ? 31.648  -24.395 38.396  1.00 13.87 ? 370  LYS D N   1 
ATOM   6465  C CA  . LYS D 1 142 ? 31.175  -24.800 39.733  1.00 13.53 ? 370  LYS D CA  1 
ATOM   6466  C C   . LYS D 1 142 ? 32.380  -25.127 40.607  1.00 13.17 ? 370  LYS D C   1 
ATOM   6467  O O   . LYS D 1 142 ? 32.453  -24.732 41.770  1.00 13.14 ? 370  LYS D O   1 
ATOM   6468  C CB  . LYS D 1 142 ? 30.254  -26.036 39.675  1.00 13.67 ? 370  LYS D CB  1 
ATOM   6469  C CG  . LYS D 1 142 ? 28.795  -25.749 39.324  1.00 14.12 ? 370  LYS D CG  1 
ATOM   6470  C CD  . LYS D 1 142 ? 27.837  -26.876 39.771  1.00 13.90 ? 370  LYS D CD  1 
ATOM   6471  C CE  . LYS D 1 142 ? 27.966  -28.118 38.896  1.00 14.21 ? 370  LYS D CE  1 
ATOM   6472  N NZ  . LYS D 1 142 ? 26.820  -29.078 39.053  1.00 14.17 ? 370  LYS D NZ  1 
ATOM   6473  N N   . ALA D 1 143 ? 33.326  -25.861 40.035  1.00 12.79 ? 371  ALA D N   1 
ATOM   6474  C CA  . ALA D 1 143 ? 34.481  -26.306 40.784  1.00 12.67 ? 371  ALA D CA  1 
ATOM   6475  C C   . ALA D 1 143 ? 35.262  -25.097 41.273  1.00 12.25 ? 371  ALA D C   1 
ATOM   6476  O O   . ALA D 1 143 ? 35.575  -24.991 42.456  1.00 11.92 ? 371  ALA D O   1 
ATOM   6477  C CB  . ALA D 1 143 ? 35.354  -27.208 39.921  1.00 12.85 ? 371  ALA D CB  1 
ATOM   6478  N N   . ILE D 1 144 ? 35.545  -24.185 40.348  1.00 11.89 ? 372  ILE D N   1 
ATOM   6479  C CA  . ILE D 1 144 ? 36.282  -22.956 40.637  1.00 11.59 ? 372  ILE D CA  1 
ATOM   6480  C C   . ILE D 1 144 ? 35.634  -22.123 41.740  1.00 11.70 ? 372  ILE D C   1 
ATOM   6481  O O   . ILE D 1 144 ? 36.316  -21.569 42.596  1.00 11.74 ? 372  ILE D O   1 
ATOM   6482  C CB  . ILE D 1 144 ? 36.435  -22.084 39.353  1.00 11.51 ? 372  ILE D CB  1 
ATOM   6483  C CG1 . ILE D 1 144 ? 37.507  -22.682 38.422  1.00 11.75 ? 372  ILE D CG1 1 
ATOM   6484  C CG2 . ILE D 1 144 ? 36.798  -20.648 39.706  1.00 10.71 ? 372  ILE D CG2 1 
ATOM   6485  C CD1 . ILE D 1 144 ? 37.791  -21.871 37.161  1.00 10.88 ? 372  ILE D CD1 1 
ATOM   6486  N N   . ALA D 1 145 ? 34.314  -22.017 41.725  1.00 11.87 ? 373  ALA D N   1 
ATOM   6487  C CA  . ALA D 1 145 ? 33.638  -21.208 42.728  1.00 12.00 ? 373  ALA D CA  1 
ATOM   6488  C C   . ALA D 1 145 ? 33.916  -21.799 44.098  1.00 12.15 ? 373  ALA D C   1 
ATOM   6489  O O   . ALA D 1 145 ? 34.289  -21.082 45.009  1.00 12.82 ? 373  ALA D O   1 
ATOM   6490  C CB  . ALA D 1 145 ? 32.151  -21.129 42.463  1.00 11.96 ? 373  ALA D CB  1 
ATOM   6491  N N   . LEU D 1 146 ? 33.757  -23.112 44.229  1.00 12.13 ? 374  LEU D N   1 
ATOM   6492  C CA  . LEU D 1 146 ? 34.070  -23.806 45.467  1.00 11.77 ? 374  LEU D CA  1 
ATOM   6493  C C   . LEU D 1 146 ? 35.483  -23.523 45.938  1.00 11.91 ? 374  LEU D C   1 
ATOM   6494  O O   . LEU D 1 146 ? 35.705  -23.305 47.122  1.00 12.04 ? 374  LEU D O   1 
ATOM   6495  C CB  . LEU D 1 146 ? 33.903  -25.307 45.285  1.00 11.57 ? 374  LEU D CB  1 
ATOM   6496  C CG  . LEU D 1 146 ? 34.173  -26.159 46.520  1.00 10.97 ? 374  LEU D CG  1 
ATOM   6497  C CD1 . LEU D 1 146 ? 33.284  -25.739 47.666  1.00 9.60  ? 374  LEU D CD1 1 
ATOM   6498  C CD2 . LEU D 1 146 ? 33.973  -27.631 46.177  1.00 11.43 ? 374  LEU D CD2 1 
ATOM   6499  N N   . ALA D 1 147 ? 36.436  -23.544 45.014  1.00 12.07 ? 375  ALA D N   1 
ATOM   6500  C CA  . ALA D 1 147 ? 37.846  -23.383 45.368  1.00 12.34 ? 375  ALA D CA  1 
ATOM   6501  C C   . ALA D 1 147 ? 38.209  -21.925 45.648  1.00 13.01 ? 375  ALA D C   1 
ATOM   6502  O O   . ALA D 1 147 ? 39.101  -21.646 46.464  1.00 13.12 ? 375  ALA D O   1 
ATOM   6503  C CB  . ALA D 1 147 ? 38.716  -23.927 44.283  1.00 11.88 ? 375  ALA D CB  1 
ATOM   6504  N N   . ASN D 1 148 ? 37.519  -21.003 44.971  1.00 13.44 ? 376  ASN D N   1 
ATOM   6505  C CA  . ASN D 1 148 ? 37.767  -19.572 45.109  1.00 13.48 ? 376  ASN D CA  1 
ATOM   6506  C C   . ASN D 1 148 ? 36.723  -18.904 46.014  1.00 13.95 ? 376  ASN D C   1 
ATOM   6507  O O   . ASN D 1 148 ? 36.396  -17.739 45.818  1.00 13.78 ? 376  ASN D O   1 
ATOM   6508  C CB  . ASN D 1 148 ? 37.758  -18.924 43.722  1.00 13.26 ? 376  ASN D CB  1 
ATOM   6509  C CG  . ASN D 1 148 ? 38.396  -17.543 43.708  1.00 12.38 ? 376  ASN D CG  1 
ATOM   6510  O OD1 . ASN D 1 148 ? 39.509  -17.363 44.191  1.00 10.93 ? 376  ASN D OD1 1 
ATOM   6511  N ND2 . ASN D 1 148 ? 37.695  -16.568 43.138  1.00 9.27  ? 376  ASN D ND2 1 
ATOM   6512  N N   . SER D 1 149 ? 36.219  -19.631 47.014  1.00 14.45 ? 377  SER D N   1 
ATOM   6513  C CA  . SER D 1 149 ? 35.100  -19.131 47.824  1.00 15.10 ? 377  SER D CA  1 
ATOM   6514  C C   . SER D 1 149 ? 35.514  -18.180 48.976  1.00 15.82 ? 377  SER D C   1 
ATOM   6515  O O   . SER D 1 149 ? 34.660  -17.747 49.759  1.00 15.83 ? 377  SER D O   1 
ATOM   6516  C CB  . SER D 1 149 ? 34.230  -20.287 48.330  1.00 14.98 ? 377  SER D CB  1 
ATOM   6517  O OG  . SER D 1 149 ? 35.009  -21.306 48.903  1.00 14.60 ? 377  SER D OG  1 
ATOM   6518  N N   . ASP D 1 150 ? 36.810  -17.847 49.057  1.00 16.38 ? 378  ASP D N   1 
ATOM   6519  C CA  . ASP D 1 150 ? 37.302  -16.728 49.882  1.00 16.64 ? 378  ASP D CA  1 
ATOM   6520  C C   . ASP D 1 150 ? 36.929  -16.847 51.343  1.00 16.89 ? 378  ASP D C   1 
ATOM   6521  O O   . ASP D 1 150 ? 36.549  -15.865 51.976  1.00 16.70 ? 378  ASP D O   1 
ATOM   6522  C CB  . ASP D 1 150 ? 36.786  -15.374 49.344  1.00 16.78 ? 378  ASP D CB  1 
ATOM   6523  C CG  . ASP D 1 150 ? 37.472  -14.948 48.065  1.00 16.45 ? 378  ASP D CG  1 
ATOM   6524  O OD1 . ASP D 1 150 ? 38.700  -14.682 48.079  1.00 15.73 ? 378  ASP D OD1 1 
ATOM   6525  O OD2 . ASP D 1 150 ? 36.766  -14.854 47.050  1.00 15.88 ? 378  ASP D OD2 1 
ATOM   6526  N N   . SER D 1 151 ? 37.041  -18.054 51.877  1.00 17.72 ? 379  SER D N   1 
ATOM   6527  C CA  . SER D 1 151 ? 36.762  -18.297 53.289  1.00 18.10 ? 379  SER D CA  1 
ATOM   6528  C C   . SER D 1 151 ? 37.810  -17.653 54.193  1.00 18.31 ? 379  SER D C   1 
ATOM   6529  O O   . SER D 1 151 ? 38.987  -17.547 53.853  1.00 17.61 ? 379  SER D O   1 
ATOM   6530  C CB  . SER D 1 151 ? 36.682  -19.792 53.568  1.00 18.09 ? 379  SER D CB  1 
ATOM   6531  O OG  . SER D 1 151 ? 36.502  -20.026 54.956  1.00 19.40 ? 379  SER D OG  1 
ATOM   6532  N N   . MET D 1 152 ? 37.358  -17.232 55.364  1.00 19.27 ? 380  MET D N   1 
ATOM   6533  C CA  . MET D 1 152 ? 38.221  -16.501 56.303  1.00 20.20 ? 380  MET D CA  1 
ATOM   6534  C C   . MET D 1 152 ? 39.189  -17.370 57.096  1.00 19.55 ? 380  MET D C   1 
ATOM   6535  O O   . MET D 1 152 ? 40.236  -16.884 57.534  1.00 19.55 ? 380  MET D O   1 
ATOM   6536  C CB  . MET D 1 152 ? 37.381  -15.723 57.307  1.00 20.10 ? 380  MET D CB  1 
ATOM   6537  C CG  . MET D 1 152 ? 37.379  -14.231 57.099  1.00 21.11 ? 380  MET D CG  1 
ATOM   6538  S SD  . MET D 1 152 ? 36.079  -13.502 58.139  1.00 23.47 ? 380  MET D SD  1 
ATOM   6539  C CE  . MET D 1 152 ? 36.203  -14.460 59.678  1.00 21.65 ? 380  MET D CE  1 
ATOM   6540  N N   A HIS D 1 153 ? 38.850  -18.637 57.304  0.60 19.16 ? 381  HIS D N   1 
ATOM   6541  N N   B HIS D 1 153 ? 38.833  -18.642 57.262  0.40 19.34 ? 381  HIS D N   1 
ATOM   6542  C CA  A HIS D 1 153 ? 39.670  -19.474 58.161  0.60 18.91 ? 381  HIS D CA  1 
ATOM   6543  C CA  B HIS D 1 153 ? 39.542  -19.534 58.167  0.40 19.19 ? 381  HIS D CA  1 
ATOM   6544  C C   A HIS D 1 153 ? 40.087  -20.765 57.472  0.60 18.84 ? 381  HIS D C   1 
ATOM   6545  C C   B HIS D 1 153 ? 40.049  -20.791 57.449  0.40 18.97 ? 381  HIS D C   1 
ATOM   6546  O O   A HIS D 1 153 ? 39.773  -21.873 57.915  0.60 18.98 ? 381  HIS D O   1 
ATOM   6547  O O   B HIS D 1 153 ? 39.753  -21.919 57.854  0.40 19.06 ? 381  HIS D O   1 
ATOM   6548  C CB  A HIS D 1 153 ? 38.967  -19.710 59.503  0.60 18.85 ? 381  HIS D CB  1 
ATOM   6549  C CB  B HIS D 1 153 ? 38.667  -19.872 59.401  0.40 19.26 ? 381  HIS D CB  1 
ATOM   6550  C CG  A HIS D 1 153 ? 38.947  -18.498 60.382  0.60 18.07 ? 381  HIS D CG  1 
ATOM   6551  C CG  B HIS D 1 153 ? 37.199  -19.620 59.211  0.40 19.19 ? 381  HIS D CG  1 
ATOM   6552  N ND1 A HIS D 1 153 ? 37.780  -17.918 60.826  0.60 17.58 ? 381  HIS D ND1 1 
ATOM   6553  N ND1 B HIS D 1 153 ? 36.356  -20.525 58.600  0.40 19.30 ? 381  HIS D ND1 1 
ATOM   6554  C CD2 A HIS D 1 153 ? 39.956  -17.746 60.883  0.60 17.31 ? 381  HIS D CD2 1 
ATOM   6555  C CD2 B HIS D 1 153 ? 36.423  -18.568 59.567  0.40 18.93 ? 381  HIS D CD2 1 
ATOM   6556  C CE1 A HIS D 1 153 ? 38.070  -16.868 61.574  0.60 17.65 ? 381  HIS D CE1 1 
ATOM   6557  C CE1 B HIS D 1 153 ? 35.128  -20.037 58.581  0.40 19.22 ? 381  HIS D CE1 1 
ATOM   6558  N NE2 A HIS D 1 153 ? 39.385  -16.742 61.624  0.60 17.24 ? 381  HIS D NE2 1 
ATOM   6559  N NE2 B HIS D 1 153 ? 35.142  -18.851 59.162  0.40 18.80 ? 381  HIS D NE2 1 
ATOM   6560  N N   . ILE D 1 154 ? 40.827  -20.591 56.384  1.00 18.68 ? 382  ILE D N   1 
ATOM   6561  C CA  . ILE D 1 154 ? 41.490  -21.709 55.714  1.00 18.28 ? 382  ILE D CA  1 
ATOM   6562  C C   . ILE D 1 154 ? 42.707  -22.074 56.548  1.00 18.08 ? 382  ILE D C   1 
ATOM   6563  O O   . ILE D 1 154 ? 43.428  -21.203 57.031  1.00 17.82 ? 382  ILE D O   1 
ATOM   6564  C CB  . ILE D 1 154 ? 41.936  -21.383 54.268  1.00 18.07 ? 382  ILE D CB  1 
ATOM   6565  C CG1 . ILE D 1 154 ? 40.752  -20.875 53.448  1.00 17.79 ? 382  ILE D CG1 1 
ATOM   6566  C CG2 . ILE D 1 154 ? 42.524  -22.625 53.600  1.00 17.76 ? 382  ILE D CG2 1 
ATOM   6567  C CD1 . ILE D 1 154 ? 39.498  -21.669 53.644  1.00 16.80 ? 382  ILE D CD1 1 
ATOM   6568  N N   . GLU D 1 155 ? 42.910  -23.369 56.747  1.00 18.03 ? 383  GLU D N   1 
ATOM   6569  C CA  . GLU D 1 155 ? 44.089  -23.842 57.457  1.00 18.25 ? 383  GLU D CA  1 
ATOM   6570  C C   . GLU D 1 155 ? 45.273  -23.752 56.499  1.00 18.06 ? 383  GLU D C   1 
ATOM   6571  O O   . GLU D 1 155 ? 46.178  -22.939 56.707  1.00 18.04 ? 383  GLU D O   1 
ATOM   6572  C CB  . GLU D 1 155 ? 43.859  -25.255 58.037  1.00 18.21 ? 383  GLU D CB  1 
ATOM   6573  C CG  . GLU D 1 155 ? 42.878  -25.210 59.235  1.00 18.87 ? 383  GLU D CG  1 
ATOM   6574  C CD  . GLU D 1 155 ? 42.548  -26.560 59.880  1.00 19.20 ? 383  GLU D CD  1 
ATOM   6575  O OE1 . GLU D 1 155 ? 41.750  -26.549 60.849  1.00 20.21 ? 383  GLU D OE1 1 
ATOM   6576  O OE2 . GLU D 1 155 ? 43.067  -27.612 59.440  1.00 20.10 ? 383  GLU D OE2 1 
ATOM   6577  N N   . ASP D 1 156 ? 45.220  -24.536 55.421  1.00 17.98 ? 384  ASP D N   1 
ATOM   6578  C CA  . ASP D 1 156 ? 46.279  -24.570 54.416  1.00 17.62 ? 384  ASP D CA  1 
ATOM   6579  C C   . ASP D 1 156 ? 45.877  -23.712 53.227  1.00 17.38 ? 384  ASP D C   1 
ATOM   6580  O O   . ASP D 1 156 ? 45.038  -24.114 52.415  1.00 17.50 ? 384  ASP D O   1 
ATOM   6581  C CB  . ASP D 1 156 ? 46.539  -26.011 53.967  1.00 17.66 ? 384  ASP D CB  1 
ATOM   6582  C CG  . ASP D 1 156 ? 47.830  -26.154 53.186  1.00 18.05 ? 384  ASP D CG  1 
ATOM   6583  O OD1 . ASP D 1 156 ? 48.319  -25.145 52.630  1.00 18.98 ? 384  ASP D OD1 1 
ATOM   6584  O OD2 . ASP D 1 156 ? 48.360  -27.277 53.127  1.00 17.84 ? 384  ASP D OD2 1 
ATOM   6585  N N   . VAL D 1 157 ? 46.476  -22.529 53.131  1.00 17.15 ? 385  VAL D N   1 
ATOM   6586  C CA  . VAL D 1 157 ? 46.180  -21.599 52.042  1.00 16.79 ? 385  VAL D CA  1 
ATOM   6587  C C   . VAL D 1 157 ? 46.832  -22.065 50.732  1.00 17.11 ? 385  VAL D C   1 
ATOM   6588  O O   . VAL D 1 157 ? 46.187  -22.046 49.673  1.00 17.13 ? 385  VAL D O   1 
ATOM   6589  C CB  . VAL D 1 157 ? 46.636  -20.164 52.394  1.00 16.57 ? 385  VAL D CB  1 
ATOM   6590  C CG1 . VAL D 1 157 ? 46.453  -19.216 51.204  1.00 15.97 ? 385  VAL D CG1 1 
ATOM   6591  C CG2 . VAL D 1 157 ? 45.873  -19.665 53.606  1.00 15.67 ? 385  VAL D CG2 1 
ATOM   6592  N N   . GLU D 1 158 ? 48.096  -22.492 50.809  1.00 17.17 ? 386  GLU D N   1 
ATOM   6593  C CA  . GLU D 1 158 ? 48.846  -22.946 49.625  1.00 17.23 ? 386  GLU D CA  1 
ATOM   6594  C C   . GLU D 1 158 ? 48.128  -24.076 48.892  1.00 17.27 ? 386  GLU D C   1 
ATOM   6595  O O   . GLU D 1 158 ? 47.966  -24.021 47.676  1.00 17.18 ? 386  GLU D O   1 
ATOM   6596  C CB  . GLU D 1 158 ? 50.261  -23.398 50.010  1.00 17.18 ? 386  GLU D CB  1 
ATOM   6597  N N   . ALA D 1 159 ? 47.698  -25.090 49.645  1.00 17.43 ? 387  ALA D N   1 
ATOM   6598  C CA  . ALA D 1 159 ? 46.975  -26.242 49.091  1.00 17.51 ? 387  ALA D CA  1 
ATOM   6599  C C   . ALA D 1 159 ? 45.701  -25.801 48.392  1.00 17.60 ? 387  ALA D C   1 
ATOM   6600  O O   . ALA D 1 159 ? 45.385  -26.272 47.299  1.00 17.92 ? 387  ALA D O   1 
ATOM   6601  C CB  . ALA D 1 159 ? 46.641  -27.235 50.186  1.00 17.45 ? 387  ALA D CB  1 
ATOM   6602  N N   . VAL D 1 160 ? 44.972  -24.895 49.028  1.00 17.53 ? 388  VAL D N   1 
ATOM   6603  C CA  . VAL D 1 160 ? 43.770  -24.339 48.431  1.00 17.67 ? 388  VAL D CA  1 
ATOM   6604  C C   . VAL D 1 160 ? 44.094  -23.476 47.196  1.00 17.95 ? 388  VAL D C   1 
ATOM   6605  O O   . VAL D 1 160 ? 43.344  -23.503 46.223  1.00 17.93 ? 388  VAL D O   1 
ATOM   6606  C CB  . VAL D 1 160 ? 42.948  -23.556 49.481  1.00 17.80 ? 388  VAL D CB  1 
ATOM   6607  C CG1 . VAL D 1 160 ? 41.848  -22.725 48.820  1.00 17.23 ? 388  VAL D CG1 1 
ATOM   6608  C CG2 . VAL D 1 160 ? 42.375  -24.524 50.510  1.00 16.85 ? 388  VAL D CG2 1 
ATOM   6609  N N   . GLN D 1 161 ? 45.202  -22.729 47.221  1.00 18.36 ? 389  GLN D N   1 
ATOM   6610  C CA  . GLN D 1 161 ? 45.631  -21.950 46.031  1.00 18.72 ? 389  GLN D CA  1 
ATOM   6611  C C   . GLN D 1 161 ? 45.960  -22.855 44.849  1.00 18.30 ? 389  GLN D C   1 
ATOM   6612  O O   . GLN D 1 161 ? 45.539  -22.585 43.719  1.00 18.11 ? 389  GLN D O   1 
ATOM   6613  C CB  . GLN D 1 161 ? 46.853  -21.064 46.315  1.00 18.94 ? 389  GLN D CB  1 
ATOM   6614  C CG  . GLN D 1 161 ? 46.641  -20.024 47.422  1.00 20.93 ? 389  GLN D CG  1 
ATOM   6615  C CD  . GLN D 1 161 ? 47.142  -18.619 47.056  1.00 23.11 ? 389  GLN D CD  1 
ATOM   6616  O OE1 . GLN D 1 161 ? 47.855  -18.427 46.055  1.00 23.53 ? 389  GLN D OE1 1 
ATOM   6617  N NE2 . GLN D 1 161 ? 46.767  -17.630 47.873  1.00 23.24 ? 389  GLN D NE2 1 
ATOM   6618  N N   . LYS D 1 162 ? 46.725  -23.914 45.128  1.00 17.98 ? 390  LYS D N   1 
ATOM   6619  C CA  . LYS D 1 162 ? 47.111  -24.908 44.124  1.00 17.76 ? 390  LYS D CA  1 
ATOM   6620  C C   . LYS D 1 162 ? 45.892  -25.585 43.513  1.00 17.39 ? 390  LYS D C   1 
ATOM   6621  O O   . LYS D 1 162 ? 45.855  -25.824 42.303  1.00 17.46 ? 390  LYS D O   1 
ATOM   6622  C CB  . LYS D 1 162 ? 48.038  -25.968 44.733  1.00 18.01 ? 390  LYS D CB  1 
ATOM   6623  C CG  . LYS D 1 162 ? 48.254  -27.218 43.865  1.00 18.58 ? 390  LYS D CG  1 
ATOM   6624  C CD  . LYS D 1 162 ? 48.989  -26.907 42.558  1.00 19.76 ? 390  LYS D CD  1 
ATOM   6625  C CE  . LYS D 1 162 ? 50.383  -27.539 42.526  1.00 20.51 ? 390  LYS D CE  1 
ATOM   6626  N NZ  . LYS D 1 162 ? 51.207  -27.189 43.727  1.00 21.39 ? 390  LYS D NZ  1 
ATOM   6627  N N   . LEU D 1 163 ? 44.905  -25.904 44.344  1.00 16.80 ? 391  LEU D N   1 
ATOM   6628  C CA  . LEU D 1 163 ? 43.649  -26.414 43.826  1.00 16.61 ? 391  LEU D CA  1 
ATOM   6629  C C   . LEU D 1 163 ? 43.060  -25.407 42.858  1.00 16.49 ? 391  LEU D C   1 
ATOM   6630  O O   . LEU D 1 163 ? 42.669  -25.777 41.760  1.00 16.46 ? 391  LEU D O   1 
ATOM   6631  C CB  . LEU D 1 163 ? 42.647  -26.681 44.948  1.00 16.81 ? 391  LEU D CB  1 
ATOM   6632  C CG  . LEU D 1 163 ? 41.326  -27.280 44.460  1.00 16.72 ? 391  LEU D CG  1 
ATOM   6633  C CD1 . LEU D 1 163 ? 41.572  -28.700 43.988  1.00 16.22 ? 391  LEU D CD1 1 
ATOM   6634  C CD2 . LEU D 1 163 ? 40.274  -27.243 45.534  1.00 16.59 ? 391  LEU D CD2 1 
ATOM   6635  N N   . GLN D 1 164 ? 42.998  -24.139 43.275  1.00 16.51 ? 392  GLN D N   1 
ATOM   6636  C CA  . GLN D 1 164 ? 42.516  -23.050 42.417  1.00 16.40 ? 392  GLN D CA  1 
ATOM   6637  C C   . GLN D 1 164 ? 43.186  -23.030 41.059  1.00 16.22 ? 392  GLN D C   1 
ATOM   6638  O O   . GLN D 1 164 ? 42.514  -22.876 40.048  1.00 16.11 ? 392  GLN D O   1 
ATOM   6639  C CB  . GLN D 1 164 ? 42.733  -21.691 43.066  1.00 16.42 ? 392  GLN D CB  1 
ATOM   6640  C CG  . GLN D 1 164 ? 41.692  -21.329 44.086  1.00 16.75 ? 392  GLN D CG  1 
ATOM   6641  C CD  . GLN D 1 164 ? 41.959  -19.978 44.726  1.00 16.99 ? 392  GLN D CD  1 
ATOM   6642  O OE1 . GLN D 1 164 ? 42.625  -19.108 44.142  1.00 17.37 ? 392  GLN D OE1 1 
ATOM   6643  N NE2 . GLN D 1 164 ? 41.441  -19.794 45.930  1.00 16.97 ? 392  GLN D NE2 1 
ATOM   6644  N N   . ASP D 1 165 ? 44.505  -23.177 41.031  1.00 16.09 ? 393  ASP D N   1 
ATOM   6645  C CA  . ASP D 1 165 ? 45.215  -23.180 39.750  1.00 16.38 ? 393  ASP D CA  1 
ATOM   6646  C C   . ASP D 1 165 ? 44.853  -24.373 38.900  1.00 15.58 ? 393  ASP D C   1 
ATOM   6647  O O   . ASP D 1 165 ? 44.474  -24.221 37.747  1.00 15.38 ? 393  ASP D O   1 
ATOM   6648  C CB  . ASP D 1 165 ? 46.727  -23.091 39.935  1.00 16.63 ? 393  ASP D CB  1 
ATOM   6649  C CG  . ASP D 1 165 ? 47.196  -21.663 39.961  1.00 19.34 ? 393  ASP D CG  1 
ATOM   6650  O OD1 . ASP D 1 165 ? 47.294  -21.070 38.854  1.00 21.88 ? 393  ASP D OD1 1 
ATOM   6651  O OD2 . ASP D 1 165 ? 47.404  -21.114 41.081  1.00 22.20 ? 393  ASP D OD2 1 
ATOM   6652  N N   . VAL D 1 166 ? 44.942  -25.558 39.479  1.00 14.89 ? 394  VAL D N   1 
ATOM   6653  C CA  . VAL D 1 166 ? 44.662  -26.771 38.734  1.00 14.49 ? 394  VAL D CA  1 
ATOM   6654  C C   . VAL D 1 166 ? 43.354  -26.614 37.944  1.00 14.58 ? 394  VAL D C   1 
ATOM   6655  O O   . VAL D 1 166 ? 43.309  -26.957 36.752  1.00 14.98 ? 394  VAL D O   1 
ATOM   6656  C CB  . VAL D 1 166 ? 44.644  -28.022 39.657  1.00 14.23 ? 394  VAL D CB  1 
ATOM   6657  C CG1 . VAL D 1 166 ? 44.019  -29.198 38.955  1.00 13.30 ? 394  VAL D CG1 1 
ATOM   6658  C CG2 . VAL D 1 166 ? 46.061  -28.359 40.116  1.00 12.43 ? 394  VAL D CG2 1 
ATOM   6659  N N   . LEU D 1 167 ? 42.325  -26.061 38.598  1.00 14.21 ? 395  LEU D N   1 
ATOM   6660  C CA  . LEU D 1 167 ? 41.001  -25.843 37.993  1.00 13.76 ? 395  LEU D CA  1 
ATOM   6661  C C   . LEU D 1 167 ? 41.023  -24.718 36.981  1.00 13.48 ? 395  LEU D C   1 
ATOM   6662  O O   . LEU D 1 167 ? 40.499  -24.842 35.878  1.00 13.52 ? 395  LEU D O   1 
ATOM   6663  C CB  . LEU D 1 167 ? 39.972  -25.521 39.075  1.00 13.74 ? 395  LEU D CB  1 
ATOM   6664  C CG  . LEU D 1 167 ? 39.567  -26.726 39.933  1.00 13.65 ? 395  LEU D CG  1 
ATOM   6665  C CD1 . LEU D 1 167 ? 38.893  -26.315 41.218  1.00 11.97 ? 395  LEU D CD1 1 
ATOM   6666  C CD2 . LEU D 1 167 ? 38.669  -27.677 39.135  1.00 14.04 ? 395  LEU D CD2 1 
ATOM   6667  N N   . HIS D 1 168 ? 41.636  -23.615 37.374  1.00 13.32 ? 396  HIS D N   1 
ATOM   6668  C CA  . HIS D 1 168 ? 41.893  -22.497 36.474  1.00 13.22 ? 396  HIS D CA  1 
ATOM   6669  C C   . HIS D 1 168 ? 42.636  -22.958 35.192  1.00 13.38 ? 396  HIS D C   1 
ATOM   6670  O O   . HIS D 1 168 ? 42.186  -22.695 34.069  1.00 13.41 ? 396  HIS D O   1 
ATOM   6671  C CB  . HIS D 1 168 ? 42.681  -21.434 37.247  1.00 13.11 ? 396  HIS D CB  1 
ATOM   6672  C CG  . HIS D 1 168 ? 42.946  -20.182 36.480  1.00 12.37 ? 396  HIS D CG  1 
ATOM   6673  N ND1 . HIS D 1 168 ? 43.746  -19.179 36.974  1.00 11.33 ? 396  HIS D ND1 1 
ATOM   6674  C CD2 . HIS D 1 168 ? 42.529  -19.770 35.260  1.00 12.16 ? 396  HIS D CD2 1 
ATOM   6675  C CE1 . HIS D 1 168 ? 43.812  -18.201 36.089  1.00 12.47 ? 396  HIS D CE1 1 
ATOM   6676  N NE2 . HIS D 1 168 ? 43.085  -18.536 35.038  1.00 12.12 ? 396  HIS D NE2 1 
ATOM   6677  N N   . GLU D 1 169 ? 43.744  -23.678 35.364  1.00 13.23 ? 397  GLU D N   1 
ATOM   6678  C CA  . GLU D 1 169 ? 44.497  -24.218 34.227  1.00 13.18 ? 397  GLU D CA  1 
ATOM   6679  C C   . GLU D 1 169 ? 43.634  -25.107 33.350  1.00 12.75 ? 397  GLU D C   1 
ATOM   6680  O O   . GLU D 1 169 ? 43.864  -25.193 32.154  1.00 12.48 ? 397  GLU D O   1 
ATOM   6681  C CB  . GLU D 1 169 ? 45.734  -24.999 34.692  1.00 13.06 ? 397  GLU D CB  1 
ATOM   6682  C CG  . GLU D 1 169 ? 46.557  -25.576 33.538  1.00 13.89 ? 397  GLU D CG  1 
ATOM   6683  C CD  . GLU D 1 169 ? 47.694  -26.478 33.987  1.00 14.52 ? 397  GLU D CD  1 
ATOM   6684  O OE1 . GLU D 1 169 ? 47.463  -27.325 34.876  1.00 17.17 ? 397  GLU D OE1 1 
ATOM   6685  O OE2 . GLU D 1 169 ? 48.811  -26.361 33.431  1.00 16.19 ? 397  GLU D OE2 1 
ATOM   6686  N N   . ALA D 1 170 ? 42.656  -25.783 33.945  1.00 12.84 ? 398  ALA D N   1 
ATOM   6687  C CA  . ALA D 1 170 ? 41.750  -26.642 33.182  1.00 12.85 ? 398  ALA D CA  1 
ATOM   6688  C C   . ALA D 1 170 ? 40.877  -25.791 32.297  1.00 12.81 ? 398  ALA D C   1 
ATOM   6689  O O   . ALA D 1 170 ? 40.752  -26.055 31.116  1.00 12.71 ? 398  ALA D O   1 
ATOM   6690  C CB  . ALA D 1 170 ? 40.893  -27.476 34.098  1.00 12.77 ? 398  ALA D CB  1 
ATOM   6691  N N   . LEU D 1 171 ? 40.272  -24.763 32.881  1.00 13.13 ? 399  LEU D N   1 
ATOM   6692  C CA  . LEU D 1 171 ? 39.445  -23.829 32.114  1.00 13.15 ? 399  LEU D CA  1 
ATOM   6693  C C   . LEU D 1 171 ? 40.274  -23.244 30.977  1.00 13.47 ? 399  LEU D C   1 
ATOM   6694  O O   . LEU D 1 171 ? 39.870  -23.278 29.816  1.00 13.50 ? 399  LEU D O   1 
ATOM   6695  C CB  . LEU D 1 171 ? 38.918  -22.706 33.012  1.00 12.97 ? 399  LEU D CB  1 
ATOM   6696  C CG  . LEU D 1 171 ? 37.910  -21.731 32.398  1.00 12.49 ? 399  LEU D CG  1 
ATOM   6697  C CD1 . LEU D 1 171 ? 36.664  -22.459 31.952  1.00 11.91 ? 399  LEU D CD1 1 
ATOM   6698  C CD2 . LEU D 1 171 ? 37.547  -20.616 33.382  1.00 12.30 ? 399  LEU D CD2 1 
ATOM   6699  N N   . GLN D 1 172 ? 41.452  -22.745 31.332  1.00 13.71 ? 400  GLN D N   1 
ATOM   6700  C CA  . GLN D 1 172 ? 42.359  -22.106 30.390  1.00 14.20 ? 400  GLN D CA  1 
ATOM   6701  C C   . GLN D 1 172 ? 42.677  -23.029 29.183  1.00 14.09 ? 400  GLN D C   1 
ATOM   6702  O O   . GLN D 1 172 ? 42.510  -22.632 28.028  1.00 14.11 ? 400  GLN D O   1 
ATOM   6703  C CB  . GLN D 1 172 ? 43.626  -21.689 31.151  1.00 14.58 ? 400  GLN D CB  1 
ATOM   6704  C CG  . GLN D 1 172 ? 44.489  -20.632 30.500  1.00 16.35 ? 400  GLN D CG  1 
ATOM   6705  C CD  . GLN D 1 172 ? 43.769  -19.323 30.331  1.00 19.73 ? 400  GLN D CD  1 
ATOM   6706  O OE1 . GLN D 1 172 ? 43.502  -18.906 29.205  1.00 23.27 ? 400  GLN D OE1 1 
ATOM   6707  N NE2 . GLN D 1 172 ? 43.429  -18.666 31.447  1.00 20.11 ? 400  GLN D NE2 1 
ATOM   6708  N N   . ASP D 1 173 ? 43.092  -24.261 29.462  1.00 13.96 ? 401  ASP D N   1 
ATOM   6709  C CA  . ASP D 1 173 ? 43.410  -25.248 28.418  1.00 13.92 ? 401  ASP D CA  1 
ATOM   6710  C C   . ASP D 1 173 ? 42.212  -25.639 27.587  1.00 13.67 ? 401  ASP D C   1 
ATOM   6711  O O   . ASP D 1 173 ? 42.336  -25.845 26.384  1.00 13.61 ? 401  ASP D O   1 
ATOM   6712  C CB  . ASP D 1 173 ? 43.987  -26.529 29.029  1.00 13.94 ? 401  ASP D CB  1 
ATOM   6713  C CG  . ASP D 1 173 ? 45.412  -26.357 29.524  1.00 14.62 ? 401  ASP D CG  1 
ATOM   6714  O OD1 . ASP D 1 173 ? 45.977  -25.245 29.434  1.00 17.06 ? 401  ASP D OD1 1 
ATOM   6715  O OD2 . ASP D 1 173 ? 45.974  -27.342 30.021  1.00 14.99 ? 401  ASP D OD2 1 
ATOM   6716  N N   . TYR D 1 174 ? 41.066  -25.789 28.240  1.00 13.59 ? 402  TYR D N   1 
ATOM   6717  C CA  . TYR D 1 174 ? 39.825  -26.082 27.541  1.00 13.47 ? 402  TYR D CA  1 
ATOM   6718  C C   . TYR D 1 174 ? 39.545  -24.984 26.536  1.00 13.55 ? 402  TYR D C   1 
ATOM   6719  O O   . TYR D 1 174 ? 39.316  -25.266 25.353  1.00 13.42 ? 402  TYR D O   1 
ATOM   6720  C CB  . TYR D 1 174 ? 38.641  -26.174 28.504  1.00 13.43 ? 402  TYR D CB  1 
ATOM   6721  C CG  . TYR D 1 174 ? 37.317  -26.382 27.807  1.00 12.84 ? 402  TYR D CG  1 
ATOM   6722  C CD1 . TYR D 1 174 ? 36.992  -27.611 27.270  1.00 12.83 ? 402  TYR D CD1 1 
ATOM   6723  C CD2 . TYR D 1 174 ? 36.398  -25.348 27.671  1.00 13.18 ? 402  TYR D CD2 1 
ATOM   6724  C CE1 . TYR D 1 174 ? 35.780  -27.819 26.618  1.00 13.38 ? 402  TYR D CE1 1 
ATOM   6725  C CE2 . TYR D 1 174 ? 35.175  -25.543 27.018  1.00 13.47 ? 402  TYR D CE2 1 
ATOM   6726  C CZ  . TYR D 1 174 ? 34.875  -26.789 26.497  1.00 13.56 ? 402  TYR D CZ  1 
ATOM   6727  O OH  . TYR D 1 174 ? 33.686  -27.028 25.848  1.00 13.36 ? 402  TYR D OH  1 
ATOM   6728  N N   . GLU D 1 175 ? 39.570  -23.735 27.003  1.00 13.43 ? 403  GLU D N   1 
ATOM   6729  C CA  . GLU D 1 175 ? 39.248  -22.602 26.134  1.00 13.45 ? 403  GLU D CA  1 
ATOM   6730  C C   . GLU D 1 175 ? 40.287  -22.413 25.024  1.00 13.52 ? 403  GLU D C   1 
ATOM   6731  O O   . GLU D 1 175 ? 39.946  -22.020 23.915  1.00 13.41 ? 403  GLU D O   1 
ATOM   6732  C CB  . GLU D 1 175 ? 39.085  -21.306 26.937  1.00 13.51 ? 403  GLU D CB  1 
ATOM   6733  C CG  . GLU D 1 175 ? 37.919  -21.283 27.940  1.00 13.48 ? 403  GLU D CG  1 
ATOM   6734  C CD  . GLU D 1 175 ? 36.564  -21.592 27.318  1.00 13.04 ? 403  GLU D CD  1 
ATOM   6735  O OE1 . GLU D 1 175 ? 36.465  -21.561 26.081  1.00 12.70 ? 403  GLU D OE1 1 
ATOM   6736  O OE2 . GLU D 1 175 ? 35.600  -21.868 28.070  1.00 12.12 ? 403  GLU D OE2 1 
ATOM   6737  N N   . ALA D 1 176 ? 41.549  -22.705 25.325  1.00 13.66 ? 404  ALA D N   1 
ATOM   6738  C CA  . ALA D 1 176 ? 42.615  -22.637 24.331  1.00 13.68 ? 404  ALA D CA  1 
ATOM   6739  C C   . ALA D 1 176 ? 42.368  -23.587 23.170  1.00 13.86 ? 404  ALA D C   1 
ATOM   6740  O O   . ALA D 1 176 ? 42.759  -23.303 22.039  1.00 13.98 ? 404  ALA D O   1 
ATOM   6741  C CB  . ALA D 1 176 ? 43.945  -22.951 24.974  1.00 13.64 ? 404  ALA D CB  1 
ATOM   6742  N N   . GLY D 1 177 ? 41.717  -24.710 23.457  1.00 14.16 ? 405  GLY D N   1 
ATOM   6743  C CA  . GLY D 1 177 ? 41.487  -25.753 22.464  1.00 14.26 ? 405  GLY D CA  1 
ATOM   6744  C C   . GLY D 1 177 ? 40.164  -25.632 21.745  1.00 14.26 ? 405  GLY D C   1 
ATOM   6745  O O   . GLY D 1 177 ? 40.114  -25.715 20.524  1.00 14.23 ? 405  GLY D O   1 
ATOM   6746  N N   . GLN D 1 178 ? 39.095  -25.428 22.507  1.00 14.63 ? 406  GLN D N   1 
ATOM   6747  C CA  . GLN D 1 178 ? 37.718  -25.451 21.976  1.00 14.97 ? 406  GLN D CA  1 
ATOM   6748  C C   . GLN D 1 178 ? 37.256  -24.077 21.477  1.00 15.12 ? 406  GLN D C   1 
ATOM   6749  O O   . GLN D 1 178 ? 36.271  -23.976 20.740  1.00 15.24 ? 406  GLN D O   1 
ATOM   6750  C CB  . GLN D 1 178 ? 36.761  -25.973 23.064  1.00 14.99 ? 406  GLN D CB  1 
ATOM   6751  C CG  . GLN D 1 178 ? 35.309  -26.185 22.656  1.00 15.10 ? 406  GLN D CG  1 
ATOM   6752  C CD  . GLN D 1 178 ? 35.152  -27.188 21.546  1.00 15.28 ? 406  GLN D CD  1 
ATOM   6753  O OE1 . GLN D 1 178 ? 35.890  -28.166 21.469  1.00 13.80 ? 406  GLN D OE1 1 
ATOM   6754  N NE2 . GLN D 1 178 ? 34.179  -26.952 20.672  1.00 16.33 ? 406  GLN D NE2 1 
ATOM   6755  N N   . HIS D 1 179 ? 37.976  -23.030 21.875  1.00 15.32 ? 407  HIS D N   1 
ATOM   6756  C CA  . HIS D 1 179 ? 37.587  -21.660 21.577  1.00 15.45 ? 407  HIS D CA  1 
ATOM   6757  C C   . HIS D 1 179 ? 38.801  -20.767 21.352  1.00 15.84 ? 407  HIS D C   1 
ATOM   6758  O O   . HIS D 1 179 ? 39.033  -19.792 22.085  1.00 16.03 ? 407  HIS D O   1 
ATOM   6759  C CB  . HIS D 1 179 ? 36.720  -21.112 22.710  1.00 15.19 ? 407  HIS D CB  1 
ATOM   6760  C CG  . HIS D 1 179 ? 35.388  -21.772 22.802  1.00 14.88 ? 407  HIS D CG  1 
ATOM   6761  N ND1 . HIS D 1 179 ? 34.335  -21.426 21.986  1.00 16.00 ? 407  HIS D ND1 1 
ATOM   6762  C CD2 . HIS D 1 179 ? 34.941  -22.778 23.590  1.00 14.79 ? 407  HIS D CD2 1 
ATOM   6763  C CE1 . HIS D 1 179 ? 33.290  -22.182 22.279  1.00 15.98 ? 407  HIS D CE1 1 
ATOM   6764  N NE2 . HIS D 1 179 ? 33.630  -23.009 23.251  1.00 14.39 ? 407  HIS D NE2 1 
ATOM   6765  N N   . MET D 1 180 ? 39.584  -21.118 20.339  1.00 16.19 ? 408  MET D N   1 
ATOM   6766  C CA  . MET D 1 180 ? 40.683  -20.264 19.896  1.00 16.69 ? 408  MET D CA  1 
ATOM   6767  C C   . MET D 1 180 ? 40.129  -18.991 19.283  1.00 16.42 ? 408  MET D C   1 
ATOM   6768  O O   . MET D 1 180 ? 40.791  -17.958 19.300  1.00 16.56 ? 408  MET D O   1 
ATOM   6769  C CB  . MET D 1 180 ? 41.576  -20.971 18.865  1.00 16.85 ? 408  MET D CB  1 
ATOM   6770  C CG  . MET D 1 180 ? 42.966  -21.349 19.366  1.00 17.48 ? 408  MET D CG  1 
ATOM   6771  S SD  . MET D 1 180 ? 44.031  -21.849 17.990  1.00 17.84 ? 408  MET D SD  1 
ATOM   6772  C CE  . MET D 1 180 ? 43.249  -23.420 17.568  1.00 17.97 ? 408  MET D CE  1 
ATOM   6773  N N   . GLU D 1 181 ? 38.918  -19.063 18.735  1.00 16.18 ? 409  GLU D N   1 
ATOM   6774  C CA  . GLU D 1 181 ? 38.346  -17.908 18.061  1.00 16.08 ? 409  GLU D CA  1 
ATOM   6775  C C   . GLU D 1 181 ? 38.127  -16.735 19.002  1.00 15.72 ? 409  GLU D C   1 
ATOM   6776  O O   . GLU D 1 181 ? 38.010  -15.620 18.534  1.00 15.73 ? 409  GLU D O   1 
ATOM   6777  C CB  . GLU D 1 181 ? 37.057  -18.259 17.300  1.00 16.18 ? 409  GLU D CB  1 
ATOM   6778  C CG  . GLU D 1 181 ? 35.808  -18.426 18.133  1.00 16.62 ? 409  GLU D CG  1 
ATOM   6779  C CD  . GLU D 1 181 ? 35.713  -19.778 18.804  1.00 18.03 ? 409  GLU D CD  1 
ATOM   6780  O OE1 . GLU D 1 181 ? 35.797  -20.804 18.081  1.00 18.43 ? 409  GLU D OE1 1 
ATOM   6781  O OE2 . GLU D 1 181 ? 35.518  -19.802 20.049  1.00 18.30 ? 409  GLU D OE2 1 
ATOM   6782  N N   . ASP D 1 182 ? 38.056  -16.990 20.308  1.00 15.53 ? 410  ASP D N   1 
ATOM   6783  C CA  . ASP D 1 182 ? 38.058  -15.927 21.316  1.00 15.38 ? 410  ASP D CA  1 
ATOM   6784  C C   . ASP D 1 182 ? 39.148  -16.185 22.350  1.00 15.40 ? 410  ASP D C   1 
ATOM   6785  O O   . ASP D 1 182 ? 38.969  -17.016 23.241  1.00 15.52 ? 410  ASP D O   1 
ATOM   6786  C CB  . ASP D 1 182 ? 36.709  -15.818 22.029  1.00 15.41 ? 410  ASP D CB  1 
ATOM   6787  C CG  . ASP D 1 182 ? 36.700  -14.731 23.092  1.00 15.35 ? 410  ASP D CG  1 
ATOM   6788  O OD1 . ASP D 1 182 ? 37.641  -13.929 23.120  1.00 16.61 ? 410  ASP D OD1 1 
ATOM   6789  O OD2 . ASP D 1 182 ? 35.761  -14.663 23.903  1.00 15.64 ? 410  ASP D OD2 1 
ATOM   6790  N N   . PRO D 1 183 ? 40.263  -15.437 22.268  1.00 15.36 ? 411  PRO D N   1 
ATOM   6791  C CA  . PRO D 1 183 ? 41.402  -15.690 23.152  1.00 15.23 ? 411  PRO D CA  1 
ATOM   6792  C C   . PRO D 1 183 ? 41.169  -15.250 24.595  1.00 14.97 ? 411  PRO D C   1 
ATOM   6793  O O   . PRO D 1 183 ? 42.039  -15.459 25.440  1.00 14.88 ? 411  PRO D O   1 
ATOM   6794  C CB  . PRO D 1 183 ? 42.533  -14.867 22.510  1.00 15.16 ? 411  PRO D CB  1 
ATOM   6795  C CG  . PRO D 1 183 ? 41.856  -13.778 21.802  1.00 15.30 ? 411  PRO D CG  1 
ATOM   6796  C CD  . PRO D 1 183 ? 40.514  -14.294 21.367  1.00 15.37 ? 411  PRO D CD  1 
ATOM   6797  N N   . ARG D 1 184 ? 40.007  -14.657 24.859  1.00 14.86 ? 412  ARG D N   1 
ATOM   6798  C CA  . ARG D 1 184 ? 39.664  -14.129 26.172  1.00 15.11 ? 412  ARG D CA  1 
ATOM   6799  C C   . ARG D 1 184 ? 38.400  -14.767 26.717  1.00 15.15 ? 412  ARG D C   1 
ATOM   6800  O O   . ARG D 1 184 ? 37.789  -14.245 27.653  1.00 15.70 ? 412  ARG D O   1 
ATOM   6801  C CB  . ARG D 1 184 ? 39.452  -12.617 26.085  1.00 15.29 ? 412  ARG D CB  1 
ATOM   6802  C CG  . ARG D 1 184 ? 40.742  -11.838 26.103  1.00 15.97 ? 412  ARG D CG  1 
ATOM   6803  C CD  . ARG D 1 184 ? 40.503  -10.373 25.924  1.00 16.14 ? 412  ARG D CD  1 
ATOM   6804  N NE  . ARG D 1 184 ? 39.962  -10.081 24.606  1.00 16.20 ? 412  ARG D NE  1 
ATOM   6805  C CZ  . ARG D 1 184 ? 40.687  -10.012 23.495  1.00 16.32 ? 412  ARG D CZ  1 
ATOM   6806  N NH1 . ARG D 1 184 ? 41.998  -10.221 23.526  1.00 16.26 ? 412  ARG D NH1 1 
ATOM   6807  N NH2 . ARG D 1 184 ? 40.091  -9.739  22.344  1.00 16.21 ? 412  ARG D NH2 1 
ATOM   6808  N N   . ARG D 1 185 ? 37.993  -15.894 26.149  1.00 14.91 ? 413  ARG D N   1 
ATOM   6809  C CA  . ARG D 1 185 ? 36.772  -16.534 26.603  1.00 14.44 ? 413  ARG D CA  1 
ATOM   6810  C C   . ARG D 1 185 ? 36.889  -16.952 28.058  1.00 14.38 ? 413  ARG D C   1 
ATOM   6811  O O   . ARG D 1 185 ? 35.946  -16.776 28.819  1.00 14.51 ? 413  ARG D O   1 
ATOM   6812  C CB  . ARG D 1 185 ? 36.446  -17.736 25.738  1.00 14.22 ? 413  ARG D CB  1 
ATOM   6813  C CG  . ARG D 1 185 ? 35.145  -18.377 26.095  1.00 13.58 ? 413  ARG D CG  1 
ATOM   6814  C CD  . ARG D 1 185 ? 34.668  -19.228 24.966  1.00 13.35 ? 413  ARG D CD  1 
ATOM   6815  N NE  . ARG D 1 185 ? 33.479  -19.982 25.313  1.00 12.47 ? 413  ARG D NE  1 
ATOM   6816  C CZ  . ARG D 1 185 ? 32.250  -19.487 25.335  1.00 13.04 ? 413  ARG D CZ  1 
ATOM   6817  N NH1 . ARG D 1 185 ? 32.028  -18.217 25.043  1.00 13.99 ? 413  ARG D NH1 1 
ATOM   6818  N NH2 . ARG D 1 185 ? 31.239  -20.273 25.675  1.00 14.27 ? 413  ARG D NH2 1 
ATOM   6819  N N   . ALA D 1 186 ? 38.040  -17.500 28.444  1.00 14.39 ? 414  ALA D N   1 
ATOM   6820  C CA  . ALA D 1 186 ? 38.221  -17.995 29.817  1.00 14.42 ? 414  ALA D CA  1 
ATOM   6821  C C   . ALA D 1 186 ? 38.075  -16.846 30.805  1.00 14.54 ? 414  ALA D C   1 
ATOM   6822  O O   . ALA D 1 186 ? 37.321  -16.938 31.782  1.00 14.73 ? 414  ALA D O   1 
ATOM   6823  C CB  . ALA D 1 186 ? 39.579  -18.674 29.990  1.00 14.23 ? 414  ALA D CB  1 
ATOM   6824  N N   . GLY D 1 187 ? 38.780  -15.753 30.540  1.00 14.36 ? 415  GLY D N   1 
ATOM   6825  C CA  . GLY D 1 187 ? 38.694  -14.584 31.402  1.00 14.28 ? 415  GLY D CA  1 
ATOM   6826  C C   . GLY D 1 187 ? 37.259  -14.130 31.532  1.00 14.03 ? 415  GLY D C   1 
ATOM   6827  O O   . GLY D 1 187 ? 36.790  -13.814 32.633  1.00 13.95 ? 415  GLY D O   1 
ATOM   6828  N N   . LYS D 1 188 ? 36.561  -14.111 30.403  1.00 13.85 ? 416  LYS D N   1 
ATOM   6829  C CA  . LYS D 1 188 ? 35.171  -13.720 30.399  1.00 13.93 ? 416  LYS D CA  1 
ATOM   6830  C C   . LYS D 1 188 ? 34.399  -14.611 31.364  1.00 14.35 ? 416  LYS D C   1 
ATOM   6831  O O   . LYS D 1 188 ? 33.581  -14.107 32.140  1.00 14.96 ? 416  LYS D O   1 
ATOM   6832  C CB  . LYS D 1 188 ? 34.586  -13.756 28.990  1.00 13.61 ? 416  LYS D CB  1 
ATOM   6833  C CG  . LYS D 1 188 ? 35.104  -12.656 28.107  1.00 13.21 ? 416  LYS D CG  1 
ATOM   6834  C CD  . LYS D 1 188 ? 34.494  -12.690 26.706  1.00 14.18 ? 416  LYS D CD  1 
ATOM   6835  C CE  . LYS D 1 188 ? 35.424  -12.005 25.678  1.00 15.10 ? 416  LYS D CE  1 
ATOM   6836  N NZ  . LYS D 1 188 ? 34.729  -11.318 24.550  1.00 14.10 ? 416  LYS D NZ  1 
ATOM   6837  N N   . MET D 1 189 ? 34.700  -15.914 31.363  1.00 14.49 ? 417  MET D N   1 
ATOM   6838  C CA  . MET D 1 189 ? 34.031  -16.884 32.260  1.00 14.47 ? 417  MET D CA  1 
ATOM   6839  C C   . MET D 1 189 ? 34.270  -16.568 33.739  1.00 14.23 ? 417  MET D C   1 
ATOM   6840  O O   . MET D 1 189 ? 33.346  -16.557 34.552  1.00 14.16 ? 417  MET D O   1 
ATOM   6841  C CB  . MET D 1 189 ? 34.505  -18.308 31.957  1.00 14.57 ? 417  MET D CB  1 
ATOM   6842  C CG  . MET D 1 189 ? 34.099  -18.804 30.587  1.00 14.94 ? 417  MET D CG  1 
ATOM   6843  S SD  . MET D 1 189 ? 32.322  -19.076 30.565  1.00 17.45 ? 417  MET D SD  1 
ATOM   6844  C CE  . MET D 1 189 ? 31.917  -18.952 28.823  1.00 15.20 ? 417  MET D CE  1 
ATOM   6845  N N   . LEU D 1 190 ? 35.516  -16.284 34.075  1.00 14.07 ? 418  LEU D N   1 
ATOM   6846  C CA  . LEU D 1 190 ? 35.873  -15.940 35.442  1.00 13.92 ? 418  LEU D CA  1 
ATOM   6847  C C   . LEU D 1 190 ? 35.263  -14.606 35.867  1.00 14.26 ? 418  LEU D C   1 
ATOM   6848  O O   . LEU D 1 190 ? 35.042  -14.375 37.068  1.00 14.74 ? 418  LEU D O   1 
ATOM   6849  C CB  . LEU D 1 190 ? 37.387  -15.874 35.592  1.00 13.79 ? 418  LEU D CB  1 
ATOM   6850  C CG  . LEU D 1 190 ? 38.197  -17.125 35.225  1.00 13.10 ? 418  LEU D CG  1 
ATOM   6851  C CD1 . LEU D 1 190 ? 39.652  -16.739 35.006  1.00 13.73 ? 418  LEU D CD1 1 
ATOM   6852  C CD2 . LEU D 1 190 ? 38.088  -18.187 36.280  1.00 11.39 ? 418  LEU D CD2 1 
ATOM   6853  N N   . MET D 1 191 ? 34.979  -13.733 34.898  1.00 14.27 ? 419  MET D N   1 
ATOM   6854  C CA  . MET D 1 191 ? 34.432  -12.402 35.208  1.00 14.23 ? 419  MET D CA  1 
ATOM   6855  C C   . MET D 1 191 ? 32.960  -12.415 35.564  1.00 13.82 ? 419  MET D C   1 
ATOM   6856  O O   . MET D 1 191 ? 32.404  -11.353 35.843  1.00 14.28 ? 419  MET D O   1 
ATOM   6857  C CB  . MET D 1 191 ? 34.660  -11.430 34.047  1.00 14.20 ? 419  MET D CB  1 
ATOM   6858  C CG  . MET D 1 191 ? 36.024  -10.786 34.069  1.00 14.01 ? 419  MET D CG  1 
ATOM   6859  S SD  . MET D 1 191 ? 36.279  -9.722  32.648  1.00 15.04 ? 419  MET D SD  1 
ATOM   6860  C CE  . MET D 1 191 ? 35.196  -8.337  33.005  1.00 13.88 ? 419  MET D CE  1 
ATOM   6861  N N   . THR D 1 192 ? 32.335  -13.598 35.535  1.00 13.22 ? 420  THR D N   1 
ATOM   6862  C CA  . THR D 1 192 ? 30.910  -13.768 35.867  1.00 12.50 ? 420  THR D CA  1 
ATOM   6863  C C   . THR D 1 192 ? 30.687  -14.272 37.297  1.00 12.48 ? 420  THR D C   1 
ATOM   6864  O O   . THR D 1 192 ? 29.555  -14.429 37.748  1.00 12.22 ? 420  THR D O   1 
ATOM   6865  C CB  . THR D 1 192 ? 30.235  -14.760 34.902  1.00 12.25 ? 420  THR D CB  1 
ATOM   6866  O OG1 . THR D 1 192 ? 30.749  -16.074 35.126  1.00 10.87 ? 420  THR D OG1 1 
ATOM   6867  C CG2 . THR D 1 192 ? 30.487  -14.364 33.469  1.00 11.61 ? 420  THR D CG2 1 
ATOM   6868  N N   . LEU D 1 193 ? 31.777  -14.543 37.999  1.00 12.60 ? 421  LEU D N   1 
ATOM   6869  C CA  . LEU D 1 193 ? 31.711  -15.036 39.365  1.00 12.63 ? 421  LEU D CA  1 
ATOM   6870  C C   . LEU D 1 193 ? 31.288  -13.948 40.367  1.00 12.65 ? 421  LEU D C   1 
ATOM   6871  O O   . LEU D 1 193 ? 30.525  -14.223 41.295  1.00 12.56 ? 421  LEU D O   1 
ATOM   6872  C CB  . LEU D 1 193 ? 33.062  -15.650 39.758  1.00 12.68 ? 421  LEU D CB  1 
ATOM   6873  C CG  . LEU D 1 193 ? 33.508  -16.887 38.956  1.00 12.80 ? 421  LEU D CG  1 
ATOM   6874  C CD1 . LEU D 1 193 ? 34.927  -17.306 39.328  1.00 12.49 ? 421  LEU D CD1 1 
ATOM   6875  C CD2 . LEU D 1 193 ? 32.568  -18.063 39.153  1.00 11.69 ? 421  LEU D CD2 1 
ATOM   6876  N N   . PRO D 1 194 ? 31.796  -12.709 40.200  1.00 12.80 ? 422  PRO D N   1 
ATOM   6877  C CA  . PRO D 1 194 ? 31.344  -11.653 41.111  1.00 12.76 ? 422  PRO D CA  1 
ATOM   6878  C C   . PRO D 1 194 ? 29.810  -11.495 41.179  1.00 12.55 ? 422  PRO D C   1 
ATOM   6879  O O   . PRO D 1 194 ? 29.268  -11.220 42.243  1.00 12.63 ? 422  PRO D O   1 
ATOM   6880  C CB  . PRO D 1 194 ? 32.026  -10.405 40.537  1.00 12.84 ? 422  PRO D CB  1 
ATOM   6881  C CG  . PRO D 1 194 ? 33.277  -10.948 39.895  1.00 12.20 ? 422  PRO D CG  1 
ATOM   6882  C CD  . PRO D 1 194 ? 32.802  -12.194 39.245  1.00 12.71 ? 422  PRO D CD  1 
ATOM   6883  N N   . LEU D 1 195 ? 29.117  -11.685 40.067  1.00 12.24 ? 423  LEU D N   1 
ATOM   6884  C CA  . LEU D 1 195 ? 27.667  -11.643 40.103  1.00 12.24 ? 423  LEU D CA  1 
ATOM   6885  C C   . LEU D 1 195 ? 27.129  -12.848 40.854  1.00 12.40 ? 423  LEU D C   1 
ATOM   6886  O O   . LEU D 1 195 ? 26.186  -12.732 41.638  1.00 12.72 ? 423  LEU D O   1 
ATOM   6887  C CB  . LEU D 1 195 ? 27.063  -11.618 38.692  1.00 12.24 ? 423  LEU D CB  1 
ATOM   6888  C CG  . LEU D 1 195 ? 25.547  -11.372 38.697  1.00 11.66 ? 423  LEU D CG  1 
ATOM   6889  C CD1 . LEU D 1 195 ? 25.169  -10.245 39.640  1.00 8.76  ? 423  LEU D CD1 1 
ATOM   6890  C CD2 . LEU D 1 195 ? 25.035  -11.095 37.298  1.00 11.92 ? 423  LEU D CD2 1 
ATOM   6891  N N   . LEU D 1 196 ? 27.726  -14.010 40.601  1.00 12.25 ? 424  LEU D N   1 
ATOM   6892  C CA  . LEU D 1 196 ? 27.286  -15.245 41.233  1.00 11.82 ? 424  LEU D CA  1 
ATOM   6893  C C   . LEU D 1 196 ? 27.456  -15.134 42.730  1.00 11.71 ? 424  LEU D C   1 
ATOM   6894  O O   . LEU D 1 196 ? 26.598  -15.586 43.476  1.00 12.11 ? 424  LEU D O   1 
ATOM   6895  C CB  . LEU D 1 196 ? 28.037  -16.453 40.661  1.00 11.67 ? 424  LEU D CB  1 
ATOM   6896  C CG  . LEU D 1 196 ? 27.907  -17.788 41.391  1.00 11.86 ? 424  LEU D CG  1 
ATOM   6897  C CD1 . LEU D 1 196 ? 26.454  -18.065 41.756  1.00 11.12 ? 424  LEU D CD1 1 
ATOM   6898  C CD2 . LEU D 1 196 ? 28.536  -18.929 40.549  1.00 11.43 ? 424  LEU D CD2 1 
ATOM   6899  N N   . ARG D 1 197 ? 28.544  -14.510 43.166  1.00 11.66 ? 425  ARG D N   1 
ATOM   6900  C CA  . ARG D 1 197 ? 28.781  -14.275 44.589  1.00 11.97 ? 425  ARG D CA  1 
ATOM   6901  C C   . ARG D 1 197 ? 27.772  -13.286 45.180  1.00 12.08 ? 425  ARG D C   1 
ATOM   6902  O O   . ARG D 1 197 ? 27.145  -13.556 46.215  1.00 11.79 ? 425  ARG D O   1 
ATOM   6903  C CB  . ARG D 1 197 ? 30.188  -13.743 44.786  1.00 12.14 ? 425  ARG D CB  1 
ATOM   6904  C CG  . ARG D 1 197 ? 30.527  -13.376 46.204  1.00 12.83 ? 425  ARG D CG  1 
ATOM   6905  C CD  . ARG D 1 197 ? 30.794  -14.578 47.073  1.00 13.69 ? 425  ARG D CD  1 
ATOM   6906  N NE  . ARG D 1 197 ? 31.997  -15.317 46.691  1.00 14.95 ? 425  ARG D NE  1 
ATOM   6907  C CZ  . ARG D 1 197 ? 33.252  -14.881 46.842  1.00 16.88 ? 425  ARG D CZ  1 
ATOM   6908  N NH1 . ARG D 1 197 ? 33.518  -13.671 47.333  1.00 18.44 ? 425  ARG D NH1 1 
ATOM   6909  N NH2 . ARG D 1 197 ? 34.261  -15.662 46.474  1.00 16.29 ? 425  ARG D NH2 1 
ATOM   6910  N N   . GLN D 1 198 ? 27.645  -12.136 44.521  1.00 12.10 ? 426  GLN D N   1 
ATOM   6911  C CA  . GLN D 1 198 ? 26.640  -11.140 44.874  1.00 12.37 ? 426  GLN D CA  1 
ATOM   6912  C C   . GLN D 1 198 ? 25.281  -11.795 45.075  1.00 12.77 ? 426  GLN D C   1 
ATOM   6913  O O   . GLN D 1 198 ? 24.642  -11.625 46.129  1.00 13.02 ? 426  GLN D O   1 
ATOM   6914  C CB  . GLN D 1 198 ? 26.538  -10.089 43.767  1.00 12.33 ? 426  GLN D CB  1 
ATOM   6915  C CG  . GLN D 1 198 ? 25.690  -8.851  44.082  1.00 12.30 ? 426  GLN D CG  1 
ATOM   6916  C CD  . GLN D 1 198 ? 25.690  -7.849  42.920  1.00 12.34 ? 426  GLN D CD  1 
ATOM   6917  O OE1 . GLN D 1 198 ? 26.267  -6.771  43.001  1.00 12.11 ? 426  GLN D OE1 1 
ATOM   6918  N NE2 . GLN D 1 198 ? 25.059  -8.226  41.829  1.00 13.52 ? 426  GLN D NE2 1 
ATOM   6919  N N   . THR D 1 199 ? 24.841  -12.544 44.062  1.00 12.97 ? 427  THR D N   1 
ATOM   6920  C CA  . THR D 1 199 ? 23.508  -13.155 44.086  1.00 13.12 ? 427  THR D CA  1 
ATOM   6921  C C   . THR D 1 199 ? 23.435  -14.231 45.170  1.00 13.29 ? 427  THR D C   1 
ATOM   6922  O O   . THR D 1 199 ? 22.417  -14.361 45.866  1.00 13.03 ? 427  THR D O   1 
ATOM   6923  C CB  . THR D 1 199 ? 23.115  -13.760 42.728  1.00 12.85 ? 427  THR D CB  1 
ATOM   6924  O OG1 . THR D 1 199 ? 23.286  -12.788 41.704  1.00 13.08 ? 427  THR D OG1 1 
ATOM   6925  C CG2 . THR D 1 199 ? 21.671  -14.149 42.732  1.00 13.58 ? 427  THR D CG2 1 
ATOM   6926  N N   . SER D 1 200 ? 24.522  -14.988 45.317  1.00 13.56 ? 428  SER D N   1 
ATOM   6927  C CA  . SER D 1 200 ? 24.607  -15.979 46.370  1.00 13.81 ? 428  SER D CA  1 
ATOM   6928  C C   . SER D 1 200 ? 24.338  -15.353 47.740  1.00 14.08 ? 428  SER D C   1 
ATOM   6929  O O   . SER D 1 200 ? 23.503  -15.846 48.484  1.00 14.45 ? 428  SER D O   1 
ATOM   6930  C CB  . SER D 1 200 ? 25.963  -16.652 46.375  1.00 13.66 ? 428  SER D CB  1 
ATOM   6931  O OG  . SER D 1 200 ? 26.285  -17.055 47.696  1.00 14.64 ? 428  SER D OG  1 
ATOM   6932  N N   . THR D 1 201 ? 25.031  -14.261 48.058  1.00 14.31 ? 429  THR D N   1 
ATOM   6933  C CA  . THR D 1 201 ? 24.875  -13.593 49.357  1.00 14.27 ? 429  THR D CA  1 
ATOM   6934  C C   . THR D 1 201 ? 23.445  -13.129 49.610  1.00 14.33 ? 429  THR D C   1 
ATOM   6935  O O   . THR D 1 201 ? 22.944  -13.286 50.713  1.00 13.96 ? 429  THR D O   1 
ATOM   6936  C CB  . THR D 1 201 ? 25.836  -12.394 49.501  1.00 14.27 ? 429  THR D CB  1 
ATOM   6937  O OG1 . THR D 1 201 ? 27.147  -12.784 49.075  1.00 15.71 ? 429  THR D OG1 1 
ATOM   6938  C CG2 . THR D 1 201 ? 25.907  -11.916 50.938  1.00 13.29 ? 429  THR D CG2 1 
ATOM   6939  N N   . LYS D 1 202 ? 22.797  -12.557 48.597  1.00 14.81 ? 430  LYS D N   1 
ATOM   6940  C CA  . LYS D 1 202 ? 21.398  -12.128 48.727  1.00 15.34 ? 430  LYS D CA  1 
ATOM   6941  C C   . LYS D 1 202 ? 20.517  -13.285 49.153  1.00 15.33 ? 430  LYS D C   1 
ATOM   6942  O O   . LYS D 1 202 ? 19.736  -13.150 50.092  1.00 15.36 ? 430  LYS D O   1 
ATOM   6943  C CB  . LYS D 1 202 ? 20.841  -11.593 47.409  1.00 15.37 ? 430  LYS D CB  1 
ATOM   6944  C CG  . LYS D 1 202 ? 21.098  -10.132 47.133  1.00 16.45 ? 430  LYS D CG  1 
ATOM   6945  C CD  . LYS D 1 202 ? 20.334  -9.675  45.868  1.00 16.70 ? 430  LYS D CD  1 
ATOM   6946  C CE  . LYS D 1 202 ? 20.923  -8.374  45.263  1.00 17.98 ? 430  LYS D CE  1 
ATOM   6947  N NZ  . LYS D 1 202 ? 20.194  -7.936  44.025  1.00 17.17 ? 430  LYS D NZ  1 
ATOM   6948  N N   . ALA D 1 203 ? 20.641  -14.411 48.439  1.00 15.49 ? 431  ALA D N   1 
ATOM   6949  C CA  . ALA D 1 203 ? 19.835  -15.617 48.695  1.00 15.46 ? 431  ALA D CA  1 
ATOM   6950  C C   . ALA D 1 203 ? 19.976  -16.063 50.139  1.00 15.70 ? 431  ALA D C   1 
ATOM   6951  O O   . ALA D 1 203 ? 18.973  -16.234 50.847  1.00 15.84 ? 431  ALA D O   1 
ATOM   6952  C CB  . ALA D 1 203 ? 20.227  -16.745 47.757  1.00 14.99 ? 431  ALA D CB  1 
ATOM   6953  N N   . VAL D 1 204 ? 21.223  -16.234 50.571  1.00 15.89 ? 432  VAL D N   1 
ATOM   6954  C CA  . VAL D 1 204 ? 21.523  -16.545 51.967  1.00 16.39 ? 432  VAL D CA  1 
ATOM   6955  C C   . VAL D 1 204 ? 20.797  -15.583 52.933  1.00 16.96 ? 432  VAL D C   1 
ATOM   6956  O O   . VAL D 1 204 ? 19.967  -16.009 53.733  1.00 16.86 ? 432  VAL D O   1 
ATOM   6957  C CB  . VAL D 1 204 ? 23.039  -16.483 52.245  1.00 16.34 ? 432  VAL D CB  1 
ATOM   6958  C CG1 . VAL D 1 204 ? 23.315  -16.605 53.747  1.00 16.27 ? 432  VAL D CG1 1 
ATOM   6959  C CG2 . VAL D 1 204 ? 23.772  -17.563 51.461  1.00 16.32 ? 432  VAL D CG2 1 
ATOM   6960  N N   . GLN D 1 205 ? 21.127  -14.295 52.841  1.00 17.76 ? 433  GLN D N   1 
ATOM   6961  C CA  . GLN D 1 205 ? 20.510  -13.249 53.641  1.00 18.31 ? 433  GLN D CA  1 
ATOM   6962  C C   . GLN D 1 205 ? 18.996  -13.385 53.528  1.00 18.80 ? 433  GLN D C   1 
ATOM   6963  O O   . GLN D 1 205 ? 18.299  -13.474 54.541  1.00 19.06 ? 433  GLN D O   1 
ATOM   6964  C CB  . GLN D 1 205 ? 21.020  -11.861 53.192  1.00 18.55 ? 433  GLN D CB  1 
ATOM   6965  C CG  . GLN D 1 205 ? 20.149  -10.628 53.533  1.00 19.90 ? 433  GLN D CG  1 
ATOM   6966  C CD  . GLN D 1 205 ? 20.185  -10.191 55.017  1.00 21.54 ? 433  GLN D CD  1 
ATOM   6967  O OE1 . GLN D 1 205 ? 20.028  -8.997  55.327  1.00 22.39 ? 433  GLN D OE1 1 
ATOM   6968  N NE2 . GLN D 1 205 ? 20.374  -11.147 55.927  1.00 21.36 ? 433  GLN D NE2 1 
ATOM   6969  N N   . HIS D 1 206 ? 18.479  -13.462 52.309  1.00 19.30 ? 434  HIS D N   1 
ATOM   6970  C CA  . HIS D 1 206 ? 17.040  -13.613 52.146  1.00 19.69 ? 434  HIS D CA  1 
ATOM   6971  C C   . HIS D 1 206 ? 16.513  -14.830 52.894  1.00 20.35 ? 434  HIS D C   1 
ATOM   6972  O O   . HIS D 1 206 ? 15.467  -14.758 53.528  1.00 20.35 ? 434  HIS D O   1 
ATOM   6973  C CB  . HIS D 1 206 ? 16.637  -13.710 50.682  1.00 19.66 ? 434  HIS D CB  1 
ATOM   6974  C CG  . HIS D 1 206 ? 15.159  -13.675 50.486  1.00 19.36 ? 434  HIS D CG  1 
ATOM   6975  N ND1 . HIS D 1 206 ? 14.344  -12.808 51.182  1.00 19.27 ? 434  HIS D ND1 1 
ATOM   6976  C CD2 . HIS D 1 206 ? 14.342  -14.407 49.698  1.00 19.72 ? 434  HIS D CD2 1 
ATOM   6977  C CE1 . HIS D 1 206 ? 13.089  -12.999 50.823  1.00 19.35 ? 434  HIS D CE1 1 
ATOM   6978  N NE2 . HIS D 1 206 ? 13.059  -13.967 49.925  1.00 20.15 ? 434  HIS D NE2 1 
ATOM   6979  N N   . PHE D 1 207 ? 17.238  -15.943 52.817  1.00 21.34 ? 435  PHE D N   1 
ATOM   6980  C CA  . PHE D 1 207 ? 16.839  -17.145 53.534  1.00 22.06 ? 435  PHE D CA  1 
ATOM   6981  C C   . PHE D 1 207 ? 16.797  -16.901 55.034  1.00 22.94 ? 435  PHE D C   1 
ATOM   6982  O O   . PHE D 1 207 ? 15.795  -17.216 55.675  1.00 23.28 ? 435  PHE D O   1 
ATOM   6983  C CB  . PHE D 1 207 ? 17.761  -18.325 53.241  1.00 21.85 ? 435  PHE D CB  1 
ATOM   6984  C CG  . PHE D 1 207 ? 17.392  -19.562 54.005  1.00 21.94 ? 435  PHE D CG  1 
ATOM   6985  C CD1 . PHE D 1 207 ? 16.184  -20.200 53.762  1.00 21.81 ? 435  PHE D CD1 1 
ATOM   6986  C CD2 . PHE D 1 207 ? 18.233  -20.079 54.984  1.00 22.06 ? 435  PHE D CD2 1 
ATOM   6987  C CE1 . PHE D 1 207 ? 15.824  -21.348 54.479  1.00 21.67 ? 435  PHE D CE1 1 
ATOM   6988  C CE2 . PHE D 1 207 ? 17.879  -21.224 55.703  1.00 21.78 ? 435  PHE D CE2 1 
ATOM   6989  C CZ  . PHE D 1 207 ? 16.673  -21.857 55.450  1.00 21.41 ? 435  PHE D CZ  1 
ATOM   6990  N N   . TYR D 1 208 ? 17.872  -16.340 55.596  1.00 23.98 ? 436  TYR D N   1 
ATOM   6991  C CA  . TYR D 1 208 ? 17.940  -16.130 57.052  1.00 24.87 ? 436  TYR D CA  1 
ATOM   6992  C C   . TYR D 1 208 ? 16.948  -15.055 57.493  1.00 25.27 ? 436  TYR D C   1 
ATOM   6993  O O   . TYR D 1 208 ? 16.386  -15.142 58.582  1.00 25.18 ? 436  TYR D O   1 
ATOM   6994  C CB  . TYR D 1 208 ? 19.379  -15.852 57.546  1.00 25.29 ? 436  TYR D CB  1 
ATOM   6995  C CG  . TYR D 1 208 ? 20.308  -17.079 57.446  1.00 26.00 ? 436  TYR D CG  1 
ATOM   6996  C CD1 . TYR D 1 208 ? 19.963  -18.299 58.050  1.00 26.63 ? 436  TYR D CD1 1 
ATOM   6997  C CD2 . TYR D 1 208 ? 21.525  -17.021 56.742  1.00 26.70 ? 436  TYR D CD2 1 
ATOM   6998  C CE1 . TYR D 1 208 ? 20.795  -19.432 57.952  1.00 26.85 ? 436  TYR D CE1 1 
ATOM   6999  C CE2 . TYR D 1 208 ? 22.372  -18.155 56.638  1.00 26.63 ? 436  TYR D CE2 1 
ATOM   7000  C CZ  . TYR D 1 208 ? 21.999  -19.360 57.246  1.00 27.06 ? 436  TYR D CZ  1 
ATOM   7001  O OH  . TYR D 1 208 ? 22.807  -20.492 57.159  1.00 26.33 ? 436  TYR D OH  1 
ATOM   7002  N N   . ASN D 1 209 ? 16.699  -14.077 56.624  1.00 25.82 ? 437  ASN D N   1 
ATOM   7003  C CA  . ASN D 1 209 ? 15.695  -13.043 56.889  1.00 26.23 ? 437  ASN D CA  1 
ATOM   7004  C C   . ASN D 1 209 ? 14.302  -13.619 57.029  1.00 26.75 ? 437  ASN D C   1 
ATOM   7005  O O   . ASN D 1 209 ? 13.554  -13.220 57.925  1.00 27.08 ? 437  ASN D O   1 
ATOM   7006  C CB  . ASN D 1 209 ? 15.678  -11.974 55.786  1.00 26.23 ? 437  ASN D CB  1 
ATOM   7007  C CG  . ASN D 1 209 ? 16.902  -11.054 55.825  1.00 26.63 ? 437  ASN D CG  1 
ATOM   7008  O OD1 . ASN D 1 209 ? 17.718  -11.101 56.754  1.00 26.98 ? 437  ASN D OD1 1 
ATOM   7009  N ND2 . ASN D 1 209 ? 17.031  -10.211 54.804  1.00 26.61 ? 437  ASN D ND2 1 
ATOM   7010  N N   . ILE D 1 210 ? 13.939  -14.553 56.158  1.00 27.46 ? 438  ILE D N   1 
ATOM   7011  C CA  . ILE D 1 210 ? 12.578  -15.097 56.196  1.00 28.36 ? 438  ILE D CA  1 
ATOM   7012  C C   . ILE D 1 210 ? 12.367  -16.170 57.269  1.00 29.16 ? 438  ILE D C   1 
ATOM   7013  O O   . ILE D 1 210 ? 11.231  -16.612 57.475  1.00 29.00 ? 438  ILE D O   1 
ATOM   7014  C CB  . ILE D 1 210 ? 12.097  -15.630 54.827  1.00 28.39 ? 438  ILE D CB  1 
ATOM   7015  C CG1 . ILE D 1 210 ? 12.929  -16.823 54.360  1.00 28.43 ? 438  ILE D CG1 1 
ATOM   7016  C CG2 . ILE D 1 210 ? 12.120  -14.520 53.794  1.00 28.82 ? 438  ILE D CG2 1 
ATOM   7017  C CD1 . ILE D 1 210 ? 12.343  -17.521 53.157  1.00 28.53 ? 438  ILE D CD1 1 
ATOM   7018  N N   . LYS D 1 211 ? 13.437  -16.567 57.968  1.00 30.37 ? 439  LYS D N   1 
ATOM   7019  C CA  . LYS D 1 211 ? 13.296  -17.431 59.161  1.00 31.27 ? 439  LYS D CA  1 
ATOM   7020  C C   . LYS D 1 211 ? 12.597  -16.748 60.345  1.00 32.17 ? 439  LYS D C   1 
ATOM   7021  O O   . LYS D 1 211 ? 12.537  -17.303 61.442  1.00 32.33 ? 439  LYS D O   1 
ATOM   7022  C CB  . LYS D 1 211 ? 14.647  -17.996 59.617  1.00 31.21 ? 439  LYS D CB  1 
ATOM   7023  C CG  . LYS D 1 211 ? 14.884  -19.428 59.191  1.00 30.88 ? 439  LYS D CG  1 
ATOM   7024  C CD  . LYS D 1 211 ? 16.134  -19.964 59.848  1.00 31.02 ? 439  LYS D CD  1 
ATOM   7025  C CE  . LYS D 1 211 ? 16.703  -21.148 59.095  1.00 31.58 ? 439  LYS D CE  1 
ATOM   7026  N NZ  . LYS D 1 211 ? 18.178  -21.002 58.909  1.00 31.96 ? 439  LYS D NZ  1 
ATOM   7027  N N   . LEU D 1 212 ? 12.088  -15.543 60.117  1.00 33.36 ? 440  LEU D N   1 
ATOM   7028  C CA  . LEU D 1 212 ? 11.231  -14.848 61.077  1.00 34.43 ? 440  LEU D CA  1 
ATOM   7029  C C   . LEU D 1 212 ? 9.773   -14.859 60.558  1.00 35.13 ? 440  LEU D C   1 
ATOM   7030  O O   . LEU D 1 212 ? 8.820   -15.031 61.328  1.00 35.38 ? 440  LEU D O   1 
ATOM   7031  C CB  . LEU D 1 212 ? 11.785  -13.432 61.307  1.00 34.52 ? 440  LEU D CB  1 
ATOM   7032  C CG  . LEU D 1 212 ? 13.293  -13.443 61.678  1.00 34.72 ? 440  LEU D CG  1 
ATOM   7033  C CD1 . LEU D 1 212 ? 14.086  -12.263 61.086  1.00 33.63 ? 440  LEU D CD1 1 
ATOM   7034  C CD2 . LEU D 1 212 ? 13.479  -13.518 63.196  1.00 34.88 ? 440  LEU D CD2 1 
ATOM   7035  N N   . GLU D 1 213 ? 9.617   -14.718 59.245  1.00 35.82 ? 441  GLU D N   1 
ATOM   7036  C CA  . GLU D 1 213 ? 8.312   -14.893 58.577  1.00 36.60 ? 441  GLU D CA  1 
ATOM   7037  C C   . GLU D 1 213 ? 7.720   -16.318 58.696  1.00 36.45 ? 441  GLU D C   1 
ATOM   7038  O O   . GLU D 1 213 ? 8.268   -17.200 59.372  1.00 36.42 ? 441  GLU D O   1 
ATOM   7039  C CB  . GLU D 1 213 ? 8.414   -14.484 57.092  1.00 36.64 ? 441  GLU D CB  1 
ATOM   7040  C CG  . GLU D 1 213 ? 9.033   -13.088 56.867  1.00 37.54 ? 441  GLU D CG  1 
ATOM   7041  C CD  . GLU D 1 213 ? 8.975   -12.622 55.418  1.00 38.03 ? 441  GLU D CD  1 
ATOM   7042  O OE1 . GLU D 1 213 ? 8.701   -13.456 54.523  1.00 39.80 ? 441  GLU D OE1 1 
ATOM   7043  O OE2 . GLU D 1 213 ? 9.210   -11.414 55.179  1.00 40.16 ? 441  GLU D OE2 1 
ATOM   7044  N N   . TYR E 1 6   ? 24.022  17.322  105.781 1.00 27.82 ? 234  TYR E N   1 
ATOM   7045  C CA  . TYR E 1 6   ? 24.762  16.095  105.335 1.00 27.96 ? 234  TYR E CA  1 
ATOM   7046  C C   . TYR E 1 6   ? 26.148  16.416  104.746 1.00 26.99 ? 234  TYR E C   1 
ATOM   7047  O O   . TYR E 1 6   ? 27.123  16.624  105.476 1.00 27.19 ? 234  TYR E O   1 
ATOM   7048  C CB  . TYR E 1 6   ? 23.936  15.211  104.328 1.00 28.72 ? 234  TYR E CB  1 
ATOM   7049  C CG  . TYR E 1 6   ? 22.757  15.882  103.611 1.00 29.79 ? 234  TYR E CG  1 
ATOM   7050  C CD1 . TYR E 1 6   ? 22.933  16.986  102.755 1.00 30.52 ? 234  TYR E CD1 1 
ATOM   7051  C CD2 . TYR E 1 6   ? 21.453  15.401  103.797 1.00 30.97 ? 234  TYR E CD2 1 
ATOM   7052  C CE1 . TYR E 1 6   ? 21.828  17.598  102.115 1.00 31.19 ? 234  TYR E CE1 1 
ATOM   7053  C CE2 . TYR E 1 6   ? 20.345  16.002  103.163 1.00 31.35 ? 234  TYR E CE2 1 
ATOM   7054  C CZ  . TYR E 1 6   ? 20.535  17.096  102.325 1.00 31.03 ? 234  TYR E CZ  1 
ATOM   7055  O OH  . TYR E 1 6   ? 19.434  17.676  101.719 1.00 30.39 ? 234  TYR E OH  1 
ATOM   7056  N N   . ASN E 1 7   ? 26.188  16.514  103.422 1.00 25.56 ? 235  ASN E N   1 
ATOM   7057  C CA  . ASN E 1 7   ? 27.351  16.188  102.628 1.00 24.45 ? 235  ASN E CA  1 
ATOM   7058  C C   . ASN E 1 7   ? 27.518  17.224  101.519 1.00 23.14 ? 235  ASN E C   1 
ATOM   7059  O O   . ASN E 1 7   ? 26.538  17.724  100.963 1.00 22.89 ? 235  ASN E O   1 
ATOM   7060  C CB  . ASN E 1 7   ? 27.124  14.782  102.062 1.00 24.52 ? 235  ASN E CB  1 
ATOM   7061  C CG  . ASN E 1 7   ? 28.227  14.321  101.156 1.00 24.99 ? 235  ASN E CG  1 
ATOM   7062  O OD1 . ASN E 1 7   ? 28.624  15.015  100.221 1.00 25.40 ? 235  ASN E OD1 1 
ATOM   7063  N ND2 . ASN E 1 7   ? 28.712  13.113  101.407 1.00 27.15 ? 235  ASN E ND2 1 
ATOM   7064  N N   . LYS E 1 8   ? 28.759  17.545  101.195 1.00 21.74 ? 236  LYS E N   1 
ATOM   7065  C CA  . LYS E 1 8   ? 29.016  18.629  100.257 1.00 20.97 ? 236  LYS E CA  1 
ATOM   7066  C C   . LYS E 1 8   ? 28.633  18.246  98.817  1.00 19.98 ? 236  LYS E C   1 
ATOM   7067  O O   . LYS E 1 8   ? 28.139  19.075  98.055  1.00 20.15 ? 236  LYS E O   1 
ATOM   7068  C CB  . LYS E 1 8   ? 30.482  19.070  100.346 1.00 21.01 ? 236  LYS E CB  1 
ATOM   7069  C CG  . LYS E 1 8   ? 30.680  20.560  100.185 1.00 21.19 ? 236  LYS E CG  1 
ATOM   7070  C CD  . LYS E 1 8   ? 32.019  21.031  100.763 1.00 21.63 ? 236  LYS E CD  1 
ATOM   7071  C CE  . LYS E 1 8   ? 31.964  21.256  102.273 1.00 21.63 ? 236  LYS E CE  1 
ATOM   7072  N NZ  . LYS E 1 8   ? 32.703  22.500  102.665 1.00 21.83 ? 236  LYS E NZ  1 
ATOM   7073  N N   . ILE E 1 9   ? 28.835  16.981  98.466  1.00 18.79 ? 237  ILE E N   1 
ATOM   7074  C CA  . ILE E 1 9   ? 28.621  16.502  97.100  1.00 17.85 ? 237  ILE E CA  1 
ATOM   7075  C C   . ILE E 1 9   ? 27.144  16.247  96.811  1.00 17.18 ? 237  ILE E C   1 
ATOM   7076  O O   . ILE E 1 9   ? 26.670  16.534  95.728  1.00 16.64 ? 237  ILE E O   1 
ATOM   7077  C CB  . ILE E 1 9   ? 29.508  15.245  96.829  1.00 17.79 ? 237  ILE E CB  1 
ATOM   7078  C CG1 . ILE E 1 9   ? 30.981  15.683  96.762  1.00 17.87 ? 237  ILE E CG1 1 
ATOM   7079  C CG2 . ILE E 1 9   ? 29.106  14.543  95.552  1.00 16.63 ? 237  ILE E CG2 1 
ATOM   7080  C CD1 . ILE E 1 9   ? 31.954  14.590  96.480  1.00 18.10 ? 237  ILE E CD1 1 
ATOM   7081  N N   . VAL E 1 10  ? 26.418  15.715  97.791  1.00 16.99 ? 238  VAL E N   1 
ATOM   7082  C CA  . VAL E 1 10  ? 24.972  15.489  97.656  1.00 16.69 ? 238  VAL E CA  1 
ATOM   7083  C C   . VAL E 1 10  ? 24.216  16.810  97.540  1.00 16.70 ? 238  VAL E C   1 
ATOM   7084  O O   . VAL E 1 10  ? 23.332  16.953  96.698  1.00 16.55 ? 238  VAL E O   1 
ATOM   7085  C CB  . VAL E 1 10  ? 24.415  14.677  98.835  1.00 16.63 ? 238  VAL E CB  1 
ATOM   7086  C CG1 . VAL E 1 10  ? 22.892  14.689  98.830  1.00 16.00 ? 238  VAL E CG1 1 
ATOM   7087  C CG2 . VAL E 1 10  ? 24.944  13.244  98.772  1.00 16.49 ? 238  VAL E CG2 1 
ATOM   7088  N N   . SER E 1 11  ? 24.574  17.768  98.391  1.00 16.68 ? 239  SER E N   1 
ATOM   7089  C CA  . SER E 1 11  ? 24.063  19.129  98.280  1.00 16.58 ? 239  SER E CA  1 
ATOM   7090  C C   . SER E 1 11  ? 24.342  19.718  96.897  1.00 16.60 ? 239  SER E C   1 
ATOM   7091  O O   . SER E 1 11  ? 23.451  20.305  96.283  1.00 16.72 ? 239  SER E O   1 
ATOM   7092  C CB  . SER E 1 11  ? 24.660  20.028  99.366  1.00 16.48 ? 239  SER E CB  1 
ATOM   7093  O OG  . SER E 1 11  ? 24.054  19.761  100.618 1.00 16.31 ? 239  SER E OG  1 
ATOM   7094  N N   . HIS E 1 12  ? 25.566  19.556  96.402  1.00 16.41 ? 240  HIS E N   1 
ATOM   7095  C CA  . HIS E 1 12  ? 25.913  20.111  95.103  1.00 16.58 ? 240  HIS E CA  1 
ATOM   7096  C C   . HIS E 1 12  ? 25.087  19.491  93.979  1.00 16.24 ? 240  HIS E C   1 
ATOM   7097  O O   . HIS E 1 12  ? 24.714  20.176  93.040  1.00 16.55 ? 240  HIS E O   1 
ATOM   7098  C CB  . HIS E 1 12  ? 27.400  19.953  94.811  1.00 17.15 ? 240  HIS E CB  1 
ATOM   7099  C CG  . HIS E 1 12  ? 27.874  20.801  93.670  1.00 19.35 ? 240  HIS E CG  1 
ATOM   7100  N ND1 . HIS E 1 12  ? 28.572  21.981  93.854  1.00 21.18 ? 240  HIS E ND1 1 
ATOM   7101  C CD2 . HIS E 1 12  ? 27.722  20.657  92.328  1.00 20.78 ? 240  HIS E CD2 1 
ATOM   7102  C CE1 . HIS E 1 12  ? 28.836  22.518  92.672  1.00 21.57 ? 240  HIS E CE1 1 
ATOM   7103  N NE2 . HIS E 1 12  ? 28.329  21.738  91.731  1.00 21.23 ? 240  HIS E NE2 1 
ATOM   7104  N N   . LEU E 1 13  ? 24.797  18.198  94.082  1.00 16.13 ? 241  LEU E N   1 
ATOM   7105  C CA  . LEU E 1 13  ? 23.937  17.502  93.120  1.00 15.71 ? 241  LEU E CA  1 
ATOM   7106  C C   . LEU E 1 13  ? 22.469  17.915  93.213  1.00 15.76 ? 241  LEU E C   1 
ATOM   7107  O O   . LEU E 1 13  ? 21.766  17.903  92.201  1.00 16.06 ? 241  LEU E O   1 
ATOM   7108  C CB  . LEU E 1 13  ? 24.003  16.002  93.355  1.00 15.49 ? 241  LEU E CB  1 
ATOM   7109  C CG  . LEU E 1 13  ? 25.331  15.331  93.096  1.00 14.76 ? 241  LEU E CG  1 
ATOM   7110  C CD1 . LEU E 1 13  ? 25.233  13.865  93.488  1.00 14.09 ? 241  LEU E CD1 1 
ATOM   7111  C CD2 . LEU E 1 13  ? 25.690  15.481  91.643  1.00 14.97 ? 241  LEU E CD2 1 
ATOM   7112  N N   . LEU E 1 14  ? 22.009  18.235  94.426  1.00 15.57 ? 242  LEU E N   1 
ATOM   7113  C CA  . LEU E 1 14  ? 20.619  18.648  94.671  1.00 15.25 ? 242  LEU E CA  1 
ATOM   7114  C C   . LEU E 1 14  ? 20.312  19.923  93.931  1.00 15.31 ? 242  LEU E C   1 
ATOM   7115  O O   . LEU E 1 14  ? 19.245  20.060  93.346  1.00 15.02 ? 242  LEU E O   1 
ATOM   7116  C CB  . LEU E 1 14  ? 20.364  18.863  96.169  1.00 14.99 ? 242  LEU E CB  1 
ATOM   7117  C CG  . LEU E 1 14  ? 20.184  17.601  97.010  1.00 14.41 ? 242  LEU E CG  1 
ATOM   7118  C CD1 . LEU E 1 14  ? 20.437  17.868  98.472  1.00 12.88 ? 242  LEU E CD1 1 
ATOM   7119  C CD2 . LEU E 1 14  ? 18.793  17.040  96.792  1.00 14.50 ? 242  LEU E CD2 1 
ATOM   7120  N N   . VAL E 1 15  ? 21.268  20.848  93.973  1.00 15.84 ? 243  VAL E N   1 
ATOM   7121  C CA  . VAL E 1 15  ? 21.137  22.168  93.344  1.00 16.07 ? 243  VAL E CA  1 
ATOM   7122  C C   . VAL E 1 15  ? 21.380  22.111  91.842  1.00 16.10 ? 243  VAL E C   1 
ATOM   7123  O O   . VAL E 1 15  ? 20.833  22.913  91.111  1.00 16.32 ? 243  VAL E O   1 
ATOM   7124  C CB  . VAL E 1 15  ? 22.094  23.213  93.972  1.00 16.04 ? 243  VAL E CB  1 
ATOM   7125  C CG1 . VAL E 1 15  ? 21.860  23.310  95.469  1.00 15.56 ? 243  VAL E CG1 1 
ATOM   7126  C CG2 . VAL E 1 15  ? 23.558  22.870  93.667  1.00 16.22 ? 243  VAL E CG2 1 
ATOM   7127  N N   . ALA E 1 16  ? 22.189  21.160  91.387  1.00 16.30 ? 244  ALA E N   1 
ATOM   7128  C CA  . ALA E 1 16  ? 22.400  20.954  89.951  1.00 16.52 ? 244  ALA E CA  1 
ATOM   7129  C C   . ALA E 1 16  ? 21.182  20.367  89.241  1.00 16.77 ? 244  ALA E C   1 
ATOM   7130  O O   . ALA E 1 16  ? 21.124  20.387  88.021  1.00 17.14 ? 244  ALA E O   1 
ATOM   7131  C CB  . ALA E 1 16  ? 23.610  20.061  89.710  1.00 16.36 ? 244  ALA E CB  1 
ATOM   7132  N N   . GLU E 1 17  ? 20.219  19.839  89.993  1.00 17.13 ? 245  GLU E N   1 
ATOM   7133  C CA  . GLU E 1 17  ? 19.069  19.155  89.413  1.00 17.26 ? 245  GLU E CA  1 
ATOM   7134  C C   . GLU E 1 17  ? 18.369  20.095  88.464  1.00 17.54 ? 245  GLU E C   1 
ATOM   7135  O O   . GLU E 1 17  ? 18.076  21.221  88.848  1.00 17.96 ? 245  GLU E O   1 
ATOM   7136  C CB  . GLU E 1 17  ? 18.104  18.691  90.515  1.00 17.17 ? 245  GLU E CB  1 
ATOM   7137  C CG  . GLU E 1 17  ? 16.939  17.811  90.049  1.00 17.13 ? 245  GLU E CG  1 
ATOM   7138  C CD  . GLU E 1 17  ? 17.371  16.456  89.475  1.00 17.61 ? 245  GLU E CD  1 
ATOM   7139  O OE1 . GLU E 1 17  ? 18.578  16.098  89.533  1.00 16.06 ? 245  GLU E OE1 1 
ATOM   7140  O OE2 . GLU E 1 17  ? 16.482  15.753  88.949  1.00 17.65 ? 245  GLU E OE2 1 
ATOM   7141  N N   . PRO E 1 18  ? 18.116  19.655  87.217  1.00 18.02 ? 246  PRO E N   1 
ATOM   7142  C CA  . PRO E 1 18  ? 17.419  20.518  86.263  1.00 18.37 ? 246  PRO E CA  1 
ATOM   7143  C C   . PRO E 1 18  ? 15.984  20.810  86.704  1.00 18.90 ? 246  PRO E C   1 
ATOM   7144  O O   . PRO E 1 18  ? 15.432  20.059  87.522  1.00 18.95 ? 246  PRO E O   1 
ATOM   7145  C CB  . PRO E 1 18  ? 17.405  19.693  84.969  1.00 18.13 ? 246  PRO E CB  1 
ATOM   7146  C CG  . PRO E 1 18  ? 18.356  18.612  85.163  1.00 18.07 ? 246  PRO E CG  1 
ATOM   7147  C CD  . PRO E 1 18  ? 18.432  18.346  86.623  1.00 18.10 ? 246  PRO E CD  1 
ATOM   7148  N N   . GLU E 1 19  ? 15.393  21.883  86.171  1.00 19.31 ? 247  GLU E N   1 
ATOM   7149  C CA  . GLU E 1 19  ? 13.981  22.201  86.449  1.00 19.70 ? 247  GLU E CA  1 
ATOM   7150  C C   . GLU E 1 19  ? 13.102  21.308  85.565  1.00 19.52 ? 247  GLU E C   1 
ATOM   7151  O O   . GLU E 1 19  ? 13.585  20.771  84.561  1.00 19.47 ? 247  GLU E O   1 
ATOM   7152  C CB  . GLU E 1 19  ? 13.664  23.689  86.203  1.00 19.90 ? 247  GLU E CB  1 
ATOM   7153  C CG  . GLU E 1 19  ? 14.609  24.703  86.907  1.00 21.14 ? 247  GLU E CG  1 
ATOM   7154  C CD  . GLU E 1 19  ? 14.490  24.724  88.449  1.00 22.91 ? 247  GLU E CD  1 
ATOM   7155  O OE1 . GLU E 1 19  ? 14.930  23.751  89.129  1.00 22.81 ? 247  GLU E OE1 1 
ATOM   7156  O OE2 . GLU E 1 19  ? 13.978  25.742  88.978  1.00 23.76 ? 247  GLU E OE2 1 
ATOM   7157  N N   . LYS E 1 20  ? 11.830  21.149  85.948  1.00 19.23 ? 248  LYS E N   1 
ATOM   7158  C CA  . LYS E 1 20  ? 10.865  20.327  85.200  1.00 18.97 ? 248  LYS E CA  1 
ATOM   7159  C C   . LYS E 1 20  ? 10.837  20.702  83.728  1.00 18.69 ? 248  LYS E C   1 
ATOM   7160  O O   . LYS E 1 20  ? 11.042  21.868  83.372  1.00 18.77 ? 248  LYS E O   1 
ATOM   7161  C CB  . LYS E 1 20  ? 9.447   20.517  85.734  1.00 18.99 ? 248  LYS E CB  1 
ATOM   7162  C CG  . LYS E 1 20  ? 9.109   19.785  87.012  1.00 19.63 ? 248  LYS E CG  1 
ATOM   7163  C CD  . LYS E 1 20  ? 7.668   20.108  87.440  1.00 19.81 ? 248  LYS E CD  1 
ATOM   7164  C CE  . LYS E 1 20  ? 7.440   19.805  88.913  1.00 20.50 ? 248  LYS E CE  1 
ATOM   7165  N NZ  . LYS E 1 20  ? 7.912   18.427  89.245  1.00 20.73 ? 248  LYS E NZ  1 
ATOM   7166  N N   . ILE E 1 21  ? 10.561  19.714  82.882  1.00 18.27 ? 249  ILE E N   1 
ATOM   7167  C CA  . ILE E 1 21  ? 10.383  19.932  81.448  1.00 17.95 ? 249  ILE E CA  1 
ATOM   7168  C C   . ILE E 1 21  ? 9.073   19.267  81.023  1.00 17.74 ? 249  ILE E C   1 
ATOM   7169  O O   . ILE E 1 21  ? 8.695   18.239  81.576  1.00 17.61 ? 249  ILE E O   1 
ATOM   7170  C CB  . ILE E 1 21  ? 11.597  19.390  80.661  1.00 17.95 ? 249  ILE E CB  1 
ATOM   7171  C CG1 . ILE E 1 21  ? 12.778  20.354  80.799  1.00 18.20 ? 249  ILE E CG1 1 
ATOM   7172  C CG2 . ILE E 1 21  ? 11.268  19.199  79.191  1.00 17.96 ? 249  ILE E CG2 1 
ATOM   7173  C CD1 . ILE E 1 21  ? 14.112  19.741  80.431  1.00 18.54 ? 249  ILE E CD1 1 
ATOM   7174  N N   . TYR E 1 22  ? 8.377   19.869  80.058  1.00 17.69 ? 250  TYR E N   1 
ATOM   7175  C CA  . TYR E 1 22  ? 7.033   19.418  79.662  1.00 17.52 ? 250  TYR E CA  1 
ATOM   7176  C C   . TYR E 1 22  ? 6.976   18.791  78.260  1.00 17.26 ? 250  TYR E C   1 
ATOM   7177  O O   . TYR E 1 22  ? 7.686   19.211  77.350  1.00 17.12 ? 250  TYR E O   1 
ATOM   7178  C CB  . TYR E 1 22  ? 6.065   20.588  79.749  1.00 17.61 ? 250  TYR E CB  1 
ATOM   7179  C CG  . TYR E 1 22  ? 5.945   21.143  81.145  1.00 17.82 ? 250  TYR E CG  1 
ATOM   7180  C CD1 . TYR E 1 22  ? 5.056   20.588  82.061  1.00 17.87 ? 250  TYR E CD1 1 
ATOM   7181  C CD2 . TYR E 1 22  ? 6.725   22.223  81.553  1.00 18.25 ? 250  TYR E CD2 1 
ATOM   7182  C CE1 . TYR E 1 22  ? 4.940   21.098  83.351  1.00 18.20 ? 250  TYR E CE1 1 
ATOM   7183  C CE2 . TYR E 1 22  ? 6.618   22.745  82.838  1.00 18.51 ? 250  TYR E CE2 1 
ATOM   7184  C CZ  . TYR E 1 22  ? 5.724   22.177  83.732  1.00 18.52 ? 250  TYR E CZ  1 
ATOM   7185  O OH  . TYR E 1 22  ? 5.620   22.689  85.004  1.00 18.54 ? 250  TYR E OH  1 
ATOM   7186  N N   . ALA E 1 23  ? 6.122   17.784  78.095  1.00 16.89 ? 251  ALA E N   1 
ATOM   7187  C CA  . ALA E 1 23  ? 6.008   17.077  76.818  1.00 16.64 ? 251  ALA E CA  1 
ATOM   7188  C C   . ALA E 1 23  ? 5.216   17.883  75.798  1.00 16.55 ? 251  ALA E C   1 
ATOM   7189  O O   . ALA E 1 23  ? 5.370   17.686  74.590  1.00 16.36 ? 251  ALA E O   1 
ATOM   7190  C CB  . ALA E 1 23  ? 5.357   15.715  77.025  1.00 16.73 ? 251  ALA E CB  1 
ATOM   7191  N N   . MET E 1 24  ? 4.359   18.775  76.301  1.00 16.45 ? 252  MET E N   1 
ATOM   7192  C CA  . MET E 1 24  ? 3.465   19.601  75.483  1.00 16.49 ? 252  MET E CA  1 
ATOM   7193  C C   . MET E 1 24  ? 2.988   18.916  74.204  1.00 16.16 ? 252  MET E C   1 
ATOM   7194  O O   . MET E 1 24  ? 3.200   19.428  73.111  1.00 16.15 ? 252  MET E O   1 
ATOM   7195  C CB  . MET E 1 24  ? 4.133   20.940  75.152  1.00 16.43 ? 252  MET E CB  1 
ATOM   7196  C CG  . MET E 1 24  ? 4.274   21.852  76.353  1.00 17.01 ? 252  MET E CG  1 
ATOM   7197  S SD  . MET E 1 24  ? 5.000   23.458  75.978  1.00 17.61 ? 252  MET E SD  1 
ATOM   7198  C CE  . MET E 1 24  ? 6.719   22.965  75.778  1.00 16.60 ? 252  MET E CE  1 
ATOM   7199  N N   . PRO E 1 25  ? 2.321   17.760  74.336  1.00 15.93 ? 253  PRO E N   1 
ATOM   7200  C CA  . PRO E 1 25  ? 1.824   17.101  73.137  1.00 15.85 ? 253  PRO E CA  1 
ATOM   7201  C C   . PRO E 1 25  ? 0.894   18.019  72.367  1.00 15.91 ? 253  PRO E C   1 
ATOM   7202  O O   . PRO E 1 25  ? 0.197   18.827  72.974  1.00 16.14 ? 253  PRO E O   1 
ATOM   7203  C CB  . PRO E 1 25  ? 1.042   15.904  73.687  1.00 15.87 ? 253  PRO E CB  1 
ATOM   7204  C CG  . PRO E 1 25  ? 0.821   16.190  75.128  1.00 15.88 ? 253  PRO E CG  1 
ATOM   7205  C CD  . PRO E 1 25  ? 1.973   17.018  75.559  1.00 15.94 ? 253  PRO E CD  1 
ATOM   7206  N N   . ASP E 1 26  ? 0.880   17.911  71.047  1.00 15.93 ? 254  ASP E N   1 
ATOM   7207  C CA  . ASP E 1 26  ? -0.051  18.710  70.254  1.00 15.86 ? 254  ASP E CA  1 
ATOM   7208  C C   . ASP E 1 26  ? -1.460  18.131  70.419  1.00 15.77 ? 254  ASP E C   1 
ATOM   7209  O O   . ASP E 1 26  ? -1.709  16.989  70.034  1.00 15.71 ? 254  ASP E O   1 
ATOM   7210  C CB  . ASP E 1 26  ? 0.359   18.719  68.781  1.00 15.93 ? 254  ASP E CB  1 
ATOM   7211  C CG  . ASP E 1 26  ? -0.143  19.938  68.039  1.00 16.06 ? 254  ASP E CG  1 
ATOM   7212  O OD1 . ASP E 1 26  ? -1.138  20.555  68.474  1.00 16.02 ? 254  ASP E OD1 1 
ATOM   7213  O OD2 . ASP E 1 26  ? 0.468   20.282  67.008  1.00 16.94 ? 254  ASP E OD2 1 
ATOM   7214  N N   . PRO E 1 27  ? -2.385  18.909  71.011  1.00 15.74 ? 255  PRO E N   1 
ATOM   7215  C CA  . PRO E 1 27  ? -3.728  18.365  71.212  1.00 15.66 ? 255  PRO E CA  1 
ATOM   7216  C C   . PRO E 1 27  ? -4.551  18.221  69.922  1.00 15.64 ? 255  PRO E C   1 
ATOM   7217  O O   . PRO E 1 27  ? -5.512  17.454  69.901  1.00 15.51 ? 255  PRO E O   1 
ATOM   7218  C CB  . PRO E 1 27  ? -4.371  19.370  72.177  1.00 15.56 ? 255  PRO E CB  1 
ATOM   7219  C CG  . PRO E 1 27  ? -3.647  20.644  71.951  1.00 15.48 ? 255  PRO E CG  1 
ATOM   7220  C CD  . PRO E 1 27  ? -2.261  20.289  71.525  1.00 15.78 ? 255  PRO E CD  1 
ATOM   7221  N N   . THR E 1 28  ? -4.179  18.943  68.865  1.00 15.73 ? 256  THR E N   1 
ATOM   7222  C CA  . THR E 1 28  ? -4.876  18.839  67.577  1.00 15.78 ? 256  THR E CA  1 
ATOM   7223  C C   . THR E 1 28  ? -4.657  17.486  66.920  1.00 15.89 ? 256  THR E C   1 
ATOM   7224  O O   . THR E 1 28  ? -5.555  16.967  66.263  1.00 16.02 ? 256  THR E O   1 
ATOM   7225  C CB  . THR E 1 28  ? -4.449  19.940  66.578  1.00 15.66 ? 256  THR E CB  1 
ATOM   7226  O OG1 . THR E 1 28  ? -3.126  20.386  66.885  1.00 15.43 ? 256  THR E OG1 1 
ATOM   7227  C CG2 . THR E 1 28  ? -5.402  21.124  66.640  1.00 15.74 ? 256  THR E CG2 1 
ATOM   7228  N N   . VAL E 1 29  ? -3.465  16.927  67.099  1.00 16.05 ? 257  VAL E N   1 
ATOM   7229  C CA  . VAL E 1 29  ? -3.117  15.639  66.508  1.00 16.12 ? 257  VAL E CA  1 
ATOM   7230  C C   . VAL E 1 29  ? -3.834  14.507  67.242  1.00 16.21 ? 257  VAL E C   1 
ATOM   7231  O O   . VAL E 1 29  ? -3.593  14.298  68.433  1.00 16.19 ? 257  VAL E O   1 
ATOM   7232  C CB  . VAL E 1 29  ? -1.601  15.380  66.575  1.00 16.10 ? 257  VAL E CB  1 
ATOM   7233  C CG1 . VAL E 1 29  ? -1.284  13.967  66.111  1.00 16.08 ? 257  VAL E CG1 1 
ATOM   7234  C CG2 . VAL E 1 29  ? -0.848  16.406  65.743  1.00 15.87 ? 257  VAL E CG2 1 
ATOM   7235  N N   . PRO E 1 30  ? -4.717  13.772  66.537  1.00 16.30 ? 258  PRO E N   1 
ATOM   7236  C CA  . PRO E 1 30  ? -5.393  12.625  67.149  1.00 16.36 ? 258  PRO E CA  1 
ATOM   7237  C C   . PRO E 1 30  ? -4.426  11.642  67.806  1.00 16.41 ? 258  PRO E C   1 
ATOM   7238  O O   . PRO E 1 30  ? -3.308  11.457  67.316  1.00 16.31 ? 258  PRO E O   1 
ATOM   7239  C CB  . PRO E 1 30  ? -6.100  11.960  65.962  1.00 16.42 ? 258  PRO E CB  1 
ATOM   7240  C CG  . PRO E 1 30  ? -6.320  13.055  64.987  1.00 16.30 ? 258  PRO E CG  1 
ATOM   7241  C CD  . PRO E 1 30  ? -5.139  13.972  65.137  1.00 16.30 ? 258  PRO E CD  1 
ATOM   7242  N N   . ASP E 1 31  ? -4.859  11.035  68.911  1.00 16.54 ? 259  ASP E N   1 
ATOM   7243  C CA  . ASP E 1 31  ? -4.051  10.043  69.635  1.00 16.69 ? 259  ASP E CA  1 
ATOM   7244  C C   . ASP E 1 31  ? -3.689  8.855   68.755  1.00 16.68 ? 259  ASP E C   1 
ATOM   7245  O O   . ASP E 1 31  ? -4.532  8.372   67.996  1.00 16.88 ? 259  ASP E O   1 
ATOM   7246  C CB  . ASP E 1 31  ? -4.809  9.520   70.857  1.00 16.71 ? 259  ASP E CB  1 
ATOM   7247  C CG  . ASP E 1 31  ? -4.769  10.477  72.014  1.00 17.27 ? 259  ASP E CG  1 
ATOM   7248  O OD1 . ASP E 1 31  ? -4.990  11.685  71.783  1.00 19.13 ? 259  ASP E OD1 1 
ATOM   7249  O OD2 . ASP E 1 31  ? -4.518  10.025  73.153  1.00 17.29 ? 259  ASP E OD2 1 
ATOM   7250  N N   . SER E 1 32  ? -2.449  8.381   68.871  1.00 16.57 ? 260  SER E N   1 
ATOM   7251  C CA  . SER E 1 32  ? -1.981  7.210   68.118  1.00 16.47 ? 260  SER E CA  1 
ATOM   7252  C C   . SER E 1 32  ? -0.613  6.710   68.598  1.00 16.51 ? 260  SER E C   1 
ATOM   7253  O O   . SER E 1 32  ? 0.002   7.296   69.492  1.00 16.48 ? 260  SER E O   1 
ATOM   7254  C CB  . SER E 1 32  ? -1.894  7.538   66.623  1.00 16.39 ? 260  SER E CB  1 
ATOM   7255  O OG  . SER E 1 32  ? -0.960  8.575   66.385  1.00 16.21 ? 260  SER E OG  1 
ATOM   7256  N N   . ASP E 1 33  ? -0.150  5.617   67.995  1.00 16.54 ? 261  ASP E N   1 
ATOM   7257  C CA  . ASP E 1 33  ? 1.218   5.122   68.217  1.00 16.54 ? 261  ASP E CA  1 
ATOM   7258  C C   . ASP E 1 33  ? 2.273   6.167   67.822  1.00 16.44 ? 261  ASP E C   1 
ATOM   7259  O O   . ASP E 1 33  ? 3.213   6.427   68.584  1.00 16.36 ? 261  ASP E O   1 
ATOM   7260  C CB  . ASP E 1 33  ? 1.480   3.770   67.500  1.00 16.45 ? 261  ASP E CB  1 
ATOM   7261  C CG  . ASP E 1 33  ? 0.856   3.686   66.102  1.00 16.71 ? 261  ASP E CG  1 
ATOM   7262  O OD1 . ASP E 1 33  ? 0.707   4.728   65.424  1.00 16.76 ? 261  ASP E OD1 1 
ATOM   7263  O OD2 . ASP E 1 33  ? 0.515   2.560   65.678  1.00 16.49 ? 261  ASP E OD2 1 
ATOM   7264  N N   . ILE E 1 34  ? 2.095   6.786   66.655  1.00 16.17 ? 262  ILE E N   1 
ATOM   7265  C CA  . ILE E 1 34  ? 3.092   7.721   66.118  1.00 16.02 ? 262  ILE E CA  1 
ATOM   7266  C C   . ILE E 1 34  ? 3.318   8.901   67.076  1.00 15.85 ? 262  ILE E C   1 
ATOM   7267  O O   . ILE E 1 34  ? 4.445   9.125   67.534  1.00 15.79 ? 262  ILE E O   1 
ATOM   7268  C CB  . ILE E 1 34  ? 2.705   8.246   64.697  1.00 16.08 ? 262  ILE E CB  1 
ATOM   7269  C CG1 . ILE E 1 34  ? 2.502   7.087   63.706  1.00 16.23 ? 262  ILE E CG1 1 
ATOM   7270  C CG2 . ILE E 1 34  ? 3.769   9.212   64.158  1.00 15.93 ? 262  ILE E CG2 1 
ATOM   7271  C CD1 . ILE E 1 34  ? 3.668   6.094   63.625  1.00 15.98 ? 262  ILE E CD1 1 
ATOM   7272  N N   . LYS E 1 35  ? 2.238   9.623   67.383  1.00 15.51 ? 263  LYS E N   1 
ATOM   7273  C CA  . LYS E 1 35  ? 2.259   10.779  68.296  1.00 15.25 ? 263  LYS E CA  1 
ATOM   7274  C C   . LYS E 1 35  ? 2.974   10.480  69.635  1.00 14.95 ? 263  LYS E C   1 
ATOM   7275  O O   . LYS E 1 35  ? 3.850   11.242  70.064  1.00 14.57 ? 263  LYS E O   1 
ATOM   7276  C CB  . LYS E 1 35  ? 0.816   11.260  68.546  1.00 15.27 ? 263  LYS E CB  1 
ATOM   7277  C CG  . LYS E 1 35  ? 0.648   12.526  69.395  1.00 15.22 ? 263  LYS E CG  1 
ATOM   7278  C CD  . LYS E 1 35  ? -0.835  12.775  69.692  1.00 15.40 ? 263  LYS E CD  1 
ATOM   7279  C CE  . LYS E 1 35  ? -1.055  13.917  70.674  1.00 15.20 ? 263  LYS E CE  1 
ATOM   7280  N NZ  . LYS E 1 35  ? -2.447  13.931  71.201  1.00 14.59 ? 263  LYS E NZ  1 
ATOM   7281  N N   . ALA E 1 36  ? 2.599   9.379   70.284  1.00 14.62 ? 264  ALA E N   1 
ATOM   7282  C CA  . ALA E 1 36  ? 3.226   8.987   71.546  1.00 14.53 ? 264  ALA E CA  1 
ATOM   7283  C C   . ALA E 1 36  ? 4.734   8.918   71.358  1.00 14.51 ? 264  ALA E C   1 
ATOM   7284  O O   . ALA E 1 36  ? 5.502   9.541   72.088  1.00 14.60 ? 264  ALA E O   1 
ATOM   7285  C CB  . ALA E 1 36  ? 2.692   7.640   72.015  1.00 14.33 ? 264  ALA E CB  1 
ATOM   7286  N N   . LEU E 1 37  ? 5.151   8.172   70.346  1.00 14.44 ? 265  LEU E N   1 
ATOM   7287  C CA  . LEU E 1 37  ? 6.565   8.014   70.060  1.00 14.31 ? 265  LEU E CA  1 
ATOM   7288  C C   . LEU E 1 37  ? 7.180   9.362   69.638  1.00 14.19 ? 265  LEU E C   1 
ATOM   7289  O O   . LEU E 1 37  ? 8.288   9.695   70.048  1.00 14.37 ? 265  LEU E O   1 
ATOM   7290  C CB  . LEU E 1 37  ? 6.771   6.924   68.998  1.00 14.29 ? 265  LEU E CB  1 
ATOM   7291  C CG  . LEU E 1 37  ? 6.210   5.526   69.333  1.00 14.23 ? 265  LEU E CG  1 
ATOM   7292  C CD1 . LEU E 1 37  ? 6.440   4.534   68.182  1.00 14.13 ? 265  LEU E CD1 1 
ATOM   7293  C CD2 . LEU E 1 37  ? 6.790   4.984   70.621  1.00 13.52 ? 265  LEU E CD2 1 
ATOM   7294  N N   . THR E 1 38  ? 6.444   10.140  68.847  1.00 14.00 ? 266  THR E N   1 
ATOM   7295  C CA  . THR E 1 38  ? 6.848   11.501  68.467  1.00 13.85 ? 266  THR E CA  1 
ATOM   7296  C C   . THR E 1 38  ? 7.054   12.420  69.680  1.00 13.64 ? 266  THR E C   1 
ATOM   7297  O O   . THR E 1 38  ? 8.073   13.106  69.777  1.00 13.60 ? 266  THR E O   1 
ATOM   7298  C CB  . THR E 1 38  ? 5.781   12.151  67.553  1.00 14.00 ? 266  THR E CB  1 
ATOM   7299  O OG1 . THR E 1 38  ? 5.551   11.317  66.409  1.00 13.90 ? 266  THR E OG1 1 
ATOM   7300  C CG2 . THR E 1 38  ? 6.211   13.547  67.104  1.00 14.20 ? 266  THR E CG2 1 
ATOM   7301  N N   . THR E 1 39  ? 6.073   12.436  70.584  1.00 13.37 ? 267  THR E N   1 
ATOM   7302  C CA  . THR E 1 39  ? 6.127   13.254  71.802  1.00 13.21 ? 267  THR E CA  1 
ATOM   7303  C C   . THR E 1 39  ? 7.277   12.850  72.726  1.00 13.17 ? 267  THR E C   1 
ATOM   7304  O O   . THR E 1 39  ? 7.898   13.714  73.348  1.00 13.37 ? 267  THR E O   1 
ATOM   7305  C CB  . THR E 1 39  ? 4.815   13.153  72.615  1.00 13.18 ? 267  THR E CB  1 
ATOM   7306  O OG1 . THR E 1 39  ? 3.698   13.384  71.755  1.00 13.48 ? 267  THR E OG1 1 
ATOM   7307  C CG2 . THR E 1 39  ? 4.788   14.173  73.739  1.00 13.11 ? 267  THR E CG2 1 
ATOM   7308  N N   . LEU E 1 40  ? 7.545   11.544  72.821  1.00 13.00 ? 268  LEU E N   1 
ATOM   7309  C CA  . LEU E 1 40  ? 8.595   11.016  73.700  1.00 12.76 ? 268  LEU E CA  1 
ATOM   7310  C C   . LEU E 1 40  ? 9.995   11.248  73.138  1.00 13.14 ? 268  LEU E C   1 
ATOM   7311  O O   . LEU E 1 40  ? 10.940  11.440  73.901  1.00 13.20 ? 268  LEU E O   1 
ATOM   7312  C CB  . LEU E 1 40  ? 8.371   9.526   73.983  1.00 12.54 ? 268  LEU E CB  1 
ATOM   7313  C CG  . LEU E 1 40  ? 7.151   9.189   74.852  1.00 11.37 ? 268  LEU E CG  1 
ATOM   7314  C CD1 . LEU E 1 40  ? 6.913   7.691   74.928  1.00 9.43  ? 268  LEU E CD1 1 
ATOM   7315  C CD2 . LEU E 1 40  ? 7.311   9.764   76.238  1.00 10.63 ? 268  LEU E CD2 1 
ATOM   7316  N N   . CYS E 1 41  ? 10.122  11.225  71.813  1.00 13.70 ? 269  CYS E N   1 
ATOM   7317  C CA  . CYS E 1 41  ? 11.356  11.640  71.129  1.00 14.34 ? 269  CYS E CA  1 
ATOM   7318  C C   . CYS E 1 41  ? 11.677  13.111  71.327  1.00 14.49 ? 269  CYS E C   1 
ATOM   7319  O O   . CYS E 1 41  ? 12.836  13.483  71.526  1.00 14.72 ? 269  CYS E O   1 
ATOM   7320  C CB  . CYS E 1 41  ? 11.250  11.389  69.631  1.00 14.23 ? 269  CYS E CB  1 
ATOM   7321  S SG  . CYS E 1 41  ? 11.138  9.664   69.288  1.00 16.42 ? 269  CYS E SG  1 
ATOM   7322  N N   . ASP E 1 42  ? 10.651  13.948  71.239  1.00 14.53 ? 270  ASP E N   1 
ATOM   7323  C CA  . ASP E 1 42  ? 10.826  15.377  71.396  1.00 14.74 ? 270  ASP E CA  1 
ATOM   7324  C C   . ASP E 1 42  ? 11.192  15.719  72.836  1.00 14.59 ? 270  ASP E C   1 
ATOM   7325  O O   . ASP E 1 42  ? 11.907  16.686  73.079  1.00 14.66 ? 270  ASP E O   1 
ATOM   7326  C CB  . ASP E 1 42  ? 9.545   16.099  70.983  1.00 15.12 ? 270  ASP E CB  1 
ATOM   7327  C CG  . ASP E 1 42  ? 9.700   17.610  70.959  1.00 16.07 ? 270  ASP E CG  1 
ATOM   7328  O OD1 . ASP E 1 42  ? 10.739  18.103  70.471  1.00 16.80 ? 270  ASP E OD1 1 
ATOM   7329  O OD2 . ASP E 1 42  ? 8.768   18.301  71.426  1.00 17.37 ? 270  ASP E OD2 1 
ATOM   7330  N N   . LEU E 1 43  ? 10.701  14.915  73.781  1.00 14.50 ? 271  LEU E N   1 
ATOM   7331  C CA  . LEU E 1 43  ? 10.944  15.132  75.215  1.00 14.41 ? 271  LEU E CA  1 
ATOM   7332  C C   . LEU E 1 43  ? 12.364  14.719  75.597  1.00 14.53 ? 271  LEU E C   1 
ATOM   7333  O O   . LEU E 1 43  ? 13.085  15.480  76.244  1.00 14.83 ? 271  LEU E O   1 
ATOM   7334  C CB  . LEU E 1 43  ? 9.922   14.352  76.061  1.00 14.28 ? 271  LEU E CB  1 
ATOM   7335  C CG  . LEU E 1 43  ? 10.031  14.495  77.584  1.00 14.17 ? 271  LEU E CG  1 
ATOM   7336  C CD1 . LEU E 1 43  ? 9.755   15.924  78.012  1.00 13.62 ? 271  LEU E CD1 1 
ATOM   7337  C CD2 . LEU E 1 43  ? 9.096   13.532  78.296  1.00 14.19 ? 271  LEU E CD2 1 
ATOM   7338  N N   . ALA E 1 44  ? 12.752  13.508  75.207  1.00 14.46 ? 272  ALA E N   1 
ATOM   7339  C CA  . ALA E 1 44  ? 14.105  13.014  75.431  1.00 14.35 ? 272  ALA E CA  1 
ATOM   7340  C C   . ALA E 1 44  ? 15.138  13.989  74.859  1.00 14.50 ? 272  ALA E C   1 
ATOM   7341  O O   . ALA E 1 44  ? 16.082  14.366  75.550  1.00 14.46 ? 272  ALA E O   1 
ATOM   7342  C CB  . ALA E 1 44  ? 14.263  11.632  74.816  1.00 14.07 ? 272  ALA E CB  1 
ATOM   7343  N N   . ASP E 1 45  ? 14.939  14.411  73.609  1.00 14.78 ? 273  ASP E N   1 
ATOM   7344  C CA  . ASP E 1 45  ? 15.837  15.366  72.952  1.00 15.07 ? 273  ASP E CA  1 
ATOM   7345  C C   . ASP E 1 45  ? 16.085  16.586  73.854  1.00 15.53 ? 273  ASP E C   1 
ATOM   7346  O O   . ASP E 1 45  ? 17.234  16.967  74.105  1.00 15.96 ? 273  ASP E O   1 
ATOM   7347  C CB  . ASP E 1 45  ? 15.272  15.820  71.586  1.00 15.05 ? 273  ASP E CB  1 
ATOM   7348  C CG  . ASP E 1 45  ? 15.471  14.778  70.465  1.00 15.00 ? 273  ASP E CG  1 
ATOM   7349  O OD1 . ASP E 1 45  ? 16.306  13.872  70.639  1.00 14.78 ? 273  ASP E OD1 1 
ATOM   7350  O OD2 . ASP E 1 45  ? 14.798  14.873  69.403  1.00 13.55 ? 273  ASP E OD2 1 
ATOM   7351  N N   . ARG E 1 46  ? 15.010  17.182  74.360  1.00 15.62 ? 274  ARG E N   1 
ATOM   7352  C CA  . ARG E 1 46  ? 15.126  18.386  75.171  1.00 15.80 ? 274  ARG E CA  1 
ATOM   7353  C C   . ARG E 1 46  ? 15.612  18.095  76.577  1.00 15.91 ? 274  ARG E C   1 
ATOM   7354  O O   . ARG E 1 46  ? 16.251  18.934  77.190  1.00 16.40 ? 274  ARG E O   1 
ATOM   7355  C CB  . ARG E 1 46  ? 13.803  19.141  75.203  1.00 15.99 ? 274  ARG E CB  1 
ATOM   7356  C CG  . ARG E 1 46  ? 13.502  19.870  73.879  1.00 16.23 ? 274  ARG E CG  1 
ATOM   7357  C CD  . ARG E 1 46  ? 12.182  20.626  73.909  1.00 16.49 ? 274  ARG E CD  1 
ATOM   7358  N NE  . ARG E 1 46  ? 11.015  19.732  73.956  1.00 17.54 ? 274  ARG E NE  1 
ATOM   7359  C CZ  . ARG E 1 46  ? 10.182  19.586  74.995  1.00 17.22 ? 274  ARG E CZ  1 
ATOM   7360  N NH1 . ARG E 1 46  ? 10.350  20.276  76.129  1.00 16.69 ? 274  ARG E NH1 1 
ATOM   7361  N NH2 . ARG E 1 46  ? 9.162   18.738  74.886  1.00 16.64 ? 274  ARG E NH2 1 
ATOM   7362  N N   . GLU E 1 47  ? 15.311  16.910  77.091  1.00 16.00 ? 275  GLU E N   1 
ATOM   7363  C CA  . GLU E 1 47  ? 15.885  16.466  78.348  1.00 15.92 ? 275  GLU E CA  1 
ATOM   7364  C C   . GLU E 1 47  ? 17.375  16.264  78.194  1.00 16.00 ? 275  GLU E C   1 
ATOM   7365  O O   . GLU E 1 47  ? 18.148  16.644  79.076  1.00 16.17 ? 275  GLU E O   1 
ATOM   7366  C CB  . GLU E 1 47  ? 15.235  15.169  78.820  1.00 15.97 ? 275  GLU E CB  1 
ATOM   7367  C CG  . GLU E 1 47  ? 13.910  15.397  79.534  1.00 16.47 ? 275  GLU E CG  1 
ATOM   7368  C CD  . GLU E 1 47  ? 13.467  14.191  80.324  1.00 16.71 ? 275  GLU E CD  1 
ATOM   7369  O OE1 . GLU E 1 47  ? 12.830  13.298  79.727  1.00 16.83 ? 275  GLU E OE1 1 
ATOM   7370  O OE2 . GLU E 1 47  ? 13.753  14.144  81.540  1.00 16.81 ? 275  GLU E OE2 1 
ATOM   7371  N N   . LEU E 1 48  ? 17.776  15.660  77.075  1.00 15.96 ? 276  LEU E N   1 
ATOM   7372  C CA  . LEU E 1 48  ? 19.185  15.367  76.828  1.00 15.78 ? 276  LEU E CA  1 
ATOM   7373  C C   . LEU E 1 48  ? 20.034  16.634  76.868  1.00 15.85 ? 276  LEU E C   1 
ATOM   7374  O O   . LEU E 1 48  ? 21.160  16.603  77.357  1.00 16.23 ? 276  LEU E O   1 
ATOM   7375  C CB  . LEU E 1 48  ? 19.387  14.635  75.496  1.00 15.66 ? 276  LEU E CB  1 
ATOM   7376  C CG  . LEU E 1 48  ? 19.134  13.125  75.486  1.00 15.30 ? 276  LEU E CG  1 
ATOM   7377  C CD1 . LEU E 1 48  ? 19.597  12.498  74.175  1.00 13.62 ? 276  LEU E CD1 1 
ATOM   7378  C CD2 . LEU E 1 48  ? 19.821  12.461  76.656  1.00 15.43 ? 276  LEU E CD2 1 
ATOM   7379  N N   . VAL E 1 49  ? 19.495  17.749  76.384  1.00 15.53 ? 277  VAL E N   1 
ATOM   7380  C CA  . VAL E 1 49  ? 20.226  19.007  76.432  1.00 15.27 ? 277  VAL E CA  1 
ATOM   7381  C C   . VAL E 1 49  ? 20.487  19.450  77.883  1.00 15.43 ? 277  VAL E C   1 
ATOM   7382  O O   . VAL E 1 49  ? 21.606  19.837  78.204  1.00 15.66 ? 277  VAL E O   1 
ATOM   7383  C CB  . VAL E 1 49  ? 19.498  20.130  75.656  1.00 15.25 ? 277  VAL E CB  1 
ATOM   7384  C CG1 . VAL E 1 49  ? 20.305  21.425  75.714  1.00 14.65 ? 277  VAL E CG1 1 
ATOM   7385  C CG2 . VAL E 1 49  ? 19.238  19.707  74.203  1.00 14.54 ? 277  VAL E CG2 1 
ATOM   7386  N N   . VAL E 1 50  ? 19.473  19.387  78.752  1.00 15.39 ? 278  VAL E N   1 
ATOM   7387  C CA  . VAL E 1 50  ? 19.650  19.767  80.166  1.00 15.29 ? 278  VAL E CA  1 
ATOM   7388  C C   . VAL E 1 50  ? 20.458  18.729  80.916  1.00 15.09 ? 278  VAL E C   1 
ATOM   7389  O O   . VAL E 1 50  ? 21.149  19.064  81.880  1.00 15.29 ? 278  VAL E O   1 
ATOM   7390  C CB  . VAL E 1 50  ? 18.311  19.960  80.944  1.00 15.36 ? 278  VAL E CB  1 
ATOM   7391  C CG1 . VAL E 1 50  ? 17.510  21.128  80.382  1.00 15.52 ? 278  VAL E CG1 1 
ATOM   7392  C CG2 . VAL E 1 50  ? 17.485  18.680  80.946  1.00 15.48 ? 278  VAL E CG2 1 
ATOM   7393  N N   . ILE E 1 51  ? 20.339  17.470  80.494  1.00 14.89 ? 279  ILE E N   1 
ATOM   7394  C CA  . ILE E 1 51  ? 21.098  16.378  81.097  1.00 14.58 ? 279  ILE E CA  1 
ATOM   7395  C C   . ILE E 1 51  ? 22.581  16.598  80.864  1.00 14.86 ? 279  ILE E C   1 
ATOM   7396  O O   . ILE E 1 51  ? 23.380  16.472  81.789  1.00 15.05 ? 279  ILE E O   1 
ATOM   7397  C CB  . ILE E 1 51  ? 20.689  15.001  80.535  1.00 14.65 ? 279  ILE E CB  1 
ATOM   7398  C CG1 . ILE E 1 51  ? 19.488  14.446  81.323  1.00 14.16 ? 279  ILE E CG1 1 
ATOM   7399  C CG2 . ILE E 1 51  ? 21.881  14.035  80.581  1.00 13.83 ? 279  ILE E CG2 1 
ATOM   7400  C CD1 . ILE E 1 51  ? 18.847  13.219  80.723  1.00 13.54 ? 279  ILE E CD1 1 
ATOM   7401  N N   . ILE E 1 52  ? 22.943  16.939  79.631  1.00 14.75 ? 280  ILE E N   1 
ATOM   7402  C CA  . ILE E 1 52  ? 24.334  17.227  79.302  1.00 14.68 ? 280  ILE E CA  1 
ATOM   7403  C C   . ILE E 1 52  ? 24.862  18.401  80.136  1.00 14.98 ? 280  ILE E C   1 
ATOM   7404  O O   . ILE E 1 52  ? 25.947  18.309  80.718  1.00 15.38 ? 280  ILE E O   1 
ATOM   7405  C CB  . ILE E 1 52  ? 24.528  17.489  77.794  1.00 14.49 ? 280  ILE E CB  1 
ATOM   7406  C CG1 . ILE E 1 52  ? 24.293  16.195  77.015  1.00 14.62 ? 280  ILE E CG1 1 
ATOM   7407  C CG2 . ILE E 1 52  ? 25.934  17.991  77.518  1.00 13.63 ? 280  ILE E CG2 1 
ATOM   7408  C CD1 . ILE E 1 52  ? 24.169  16.371  75.514  1.00 14.02 ? 280  ILE E CD1 1 
ATOM   7409  N N   . GLY E 1 53  ? 24.096  19.487  80.211  1.00 14.98 ? 281  GLY E N   1 
ATOM   7410  C CA  . GLY E 1 53  ? 24.451  20.615  81.075  1.00 15.10 ? 281  GLY E CA  1 
ATOM   7411  C C   . GLY E 1 53  ? 24.635  20.197  82.530  1.00 15.09 ? 281  GLY E C   1 
ATOM   7412  O O   . GLY E 1 53  ? 25.491  20.732  83.241  1.00 14.95 ? 281  GLY E O   1 
ATOM   7413  N N   . TRP E 1 54  ? 23.830  19.229  82.957  1.00 15.24 ? 282  TRP E N   1 
ATOM   7414  C CA  . TRP E 1 54  ? 23.867  18.695  84.324  1.00 15.61 ? 282  TRP E CA  1 
ATOM   7415  C C   . TRP E 1 54  ? 25.189  17.982  84.651  1.00 15.79 ? 282  TRP E C   1 
ATOM   7416  O O   . TRP E 1 54  ? 25.796  18.245  85.693  1.00 16.12 ? 282  TRP E O   1 
ATOM   7417  C CB  . TRP E 1 54  ? 22.663  17.761  84.534  1.00 15.57 ? 282  TRP E CB  1 
ATOM   7418  C CG  . TRP E 1 54  ? 22.685  16.900  85.754  1.00 15.50 ? 282  TRP E CG  1 
ATOM   7419  C CD1 . TRP E 1 54  ? 22.312  17.257  87.008  1.00 15.61 ? 282  TRP E CD1 1 
ATOM   7420  C CD2 . TRP E 1 54  ? 23.040  15.515  85.819  1.00 15.32 ? 282  TRP E CD2 1 
ATOM   7421  N NE1 . TRP E 1 54  ? 22.424  16.187  87.860  1.00 15.67 ? 282  TRP E NE1 1 
ATOM   7422  C CE2 . TRP E 1 54  ? 22.873  15.104  87.153  1.00 15.51 ? 282  TRP E CE2 1 
ATOM   7423  C CE3 . TRP E 1 54  ? 23.499  14.585  84.882  1.00 15.68 ? 282  TRP E CE3 1 
ATOM   7424  C CZ2 . TRP E 1 54  ? 23.163  13.803  87.578  1.00 15.65 ? 282  TRP E CZ2 1 
ATOM   7425  C CZ3 . TRP E 1 54  ? 23.782  13.283  85.307  1.00 15.32 ? 282  TRP E CZ3 1 
ATOM   7426  C CH2 . TRP E 1 54  ? 23.615  12.911  86.639  1.00 15.39 ? 282  TRP E CH2 1 
ATOM   7427  N N   . ALA E 1 55  ? 25.636  17.103  83.753  1.00 15.92 ? 283  ALA E N   1 
ATOM   7428  C CA  . ALA E 1 55  ? 26.869  16.332  83.956  1.00 15.81 ? 283  ALA E CA  1 
ATOM   7429  C C   . ALA E 1 55  ? 28.064  17.237  84.206  1.00 15.86 ? 283  ALA E C   1 
ATOM   7430  O O   . ALA E 1 55  ? 28.904  16.926  85.032  1.00 16.15 ? 283  ALA E O   1 
ATOM   7431  C CB  . ALA E 1 55  ? 27.138  15.425  82.775  1.00 15.64 ? 283  ALA E CB  1 
ATOM   7432  N N   . LYS E 1 56  ? 28.138  18.368  83.520  1.00 15.97 ? 284  LYS E N   1 
ATOM   7433  C CA  . LYS E 1 56  ? 29.209  19.327  83.794  1.00 16.16 ? 284  LYS E CA  1 
ATOM   7434  C C   . LYS E 1 56  ? 29.264  19.781  85.258  1.00 16.36 ? 284  LYS E C   1 
ATOM   7435  O O   . LYS E 1 56  ? 30.339  20.100  85.754  1.00 16.31 ? 284  LYS E O   1 
ATOM   7436  C CB  . LYS E 1 56  ? 29.088  20.553  82.900  1.00 16.06 ? 284  LYS E CB  1 
ATOM   7437  C CG  . LYS E 1 56  ? 29.540  20.342  81.463  1.00 15.80 ? 284  LYS E CG  1 
ATOM   7438  C CD  . LYS E 1 56  ? 29.999  21.671  80.871  1.00 15.93 ? 284  LYS E CD  1 
ATOM   7439  C CE  . LYS E 1 56  ? 29.476  21.910  79.474  1.00 16.07 ? 284  LYS E CE  1 
ATOM   7440  N NZ  . LYS E 1 56  ? 29.001  23.309  79.337  1.00 16.26 ? 284  LYS E NZ  1 
ATOM   7441  N N   . HIS E 1 57  ? 28.111  19.809  85.933  1.00 16.62 ? 285  HIS E N   1 
ATOM   7442  C CA  . HIS E 1 57  ? 28.027  20.218  87.337  1.00 16.73 ? 285  HIS E CA  1 
ATOM   7443  C C   . HIS E 1 57  ? 28.229  19.056  88.312  1.00 16.86 ? 285  HIS E C   1 
ATOM   7444  O O   . HIS E 1 57  ? 28.126  19.243  89.520  1.00 17.12 ? 285  HIS E O   1 
ATOM   7445  C CB  . HIS E 1 57  ? 26.686  20.904  87.637  1.00 16.85 ? 285  HIS E CB  1 
ATOM   7446  C CG  . HIS E 1 57  ? 26.487  22.200  86.913  1.00 17.39 ? 285  HIS E CG  1 
ATOM   7447  N ND1 . HIS E 1 57  ? 27.459  23.178  86.845  1.00 18.18 ? 285  HIS E ND1 1 
ATOM   7448  C CD2 . HIS E 1 57  ? 25.420  22.685  86.234  1.00 17.53 ? 285  HIS E CD2 1 
ATOM   7449  C CE1 . HIS E 1 57  ? 27.009  24.198  86.137  1.00 17.55 ? 285  HIS E CE1 1 
ATOM   7450  N NE2 . HIS E 1 57  ? 25.774  23.925  85.756  1.00 17.81 ? 285  HIS E NE2 1 
ATOM   7451  N N   . ILE E 1 58  ? 28.499  17.855  87.815  1.00 16.90 ? 286  ILE E N   1 
ATOM   7452  C CA  . ILE E 1 58  ? 28.953  16.788  88.703  1.00 17.05 ? 286  ILE E CA  1 
ATOM   7453  C C   . ILE E 1 58  ? 30.408  17.087  89.089  1.00 17.06 ? 286  ILE E C   1 
ATOM   7454  O O   . ILE E 1 58  ? 31.202  17.479  88.237  1.00 17.39 ? 286  ILE E O   1 
ATOM   7455  C CB  . ILE E 1 58  ? 28.881  15.396  88.055  1.00 17.17 ? 286  ILE E CB  1 
ATOM   7456  C CG1 . ILE E 1 58  ? 27.425  14.960  87.869  1.00 17.30 ? 286  ILE E CG1 1 
ATOM   7457  C CG2 . ILE E 1 58  ? 29.622  14.383  88.926  1.00 17.55 ? 286  ILE E CG2 1 
ATOM   7458  C CD1 . ILE E 1 58  ? 27.258  13.716  87.002  1.00 16.88 ? 286  ILE E CD1 1 
ATOM   7459  N N   . PRO E 1 59  ? 30.750  16.950  90.378  1.00 16.99 ? 287  PRO E N   1 
ATOM   7460  C CA  . PRO E 1 59  ? 32.122  17.112  90.860  1.00 16.89 ? 287  PRO E CA  1 
ATOM   7461  C C   . PRO E 1 59  ? 33.169  16.176  90.239  1.00 16.90 ? 287  PRO E C   1 
ATOM   7462  O O   . PRO E 1 59  ? 33.226  14.997  90.578  1.00 17.62 ? 287  PRO E O   1 
ATOM   7463  C CB  . PRO E 1 59  ? 31.989  16.835  92.359  1.00 16.88 ? 287  PRO E CB  1 
ATOM   7464  C CG  . PRO E 1 59  ? 30.566  17.173  92.674  1.00 17.28 ? 287  PRO E CG  1 
ATOM   7465  C CD  . PRO E 1 59  ? 29.809  16.710  91.489  1.00 17.28 ? 287  PRO E CD  1 
ATOM   7466  N N   . GLY E 1 60  ? 34.002  16.710  89.354  1.00 16.68 ? 288  GLY E N   1 
ATOM   7467  C CA  . GLY E 1 60  ? 35.072  15.938  88.743  1.00 16.66 ? 288  GLY E CA  1 
ATOM   7468  C C   . GLY E 1 60  ? 34.868  15.656  87.270  1.00 16.70 ? 288  GLY E C   1 
ATOM   7469  O O   . GLY E 1 60  ? 35.845  15.512  86.532  1.00 16.86 ? 288  GLY E O   1 
ATOM   7470  N N   . PHE E 1 61  ? 33.609  15.577  86.838  1.00 16.64 ? 289  PHE E N   1 
ATOM   7471  C CA  . PHE E 1 61  ? 33.277  15.323  85.427  1.00 16.80 ? 289  PHE E CA  1 
ATOM   7472  C C   . PHE E 1 61  ? 34.069  16.233  84.480  1.00 16.77 ? 289  PHE E C   1 
ATOM   7473  O O   . PHE E 1 61  ? 34.767  15.767  83.578  1.00 16.85 ? 289  PHE E O   1 
ATOM   7474  C CB  . PHE E 1 61  ? 31.772  15.507  85.196  1.00 16.89 ? 289  PHE E CB  1 
ATOM   7475  C CG  . PHE E 1 61  ? 31.263  14.879  83.924  1.00 17.22 ? 289  PHE E CG  1 
ATOM   7476  C CD1 . PHE E 1 61  ? 31.155  13.498  83.807  1.00 17.84 ? 289  PHE E CD1 1 
ATOM   7477  C CD2 . PHE E 1 61  ? 30.864  15.664  82.853  1.00 17.59 ? 289  PHE E CD2 1 
ATOM   7478  C CE1 . PHE E 1 61  ? 30.675  12.913  82.632  1.00 17.96 ? 289  PHE E CE1 1 
ATOM   7479  C CE2 . PHE E 1 61  ? 30.381  15.079  81.676  1.00 17.56 ? 289  PHE E CE2 1 
ATOM   7480  C CZ  . PHE E 1 61  ? 30.290  13.710  81.567  1.00 17.12 ? 289  PHE E CZ  1 
ATOM   7481  N N   . SER E 1 62  ? 33.993  17.534  84.726  1.00 16.86 ? 290  SER E N   1 
ATOM   7482  C CA  . SER E 1 62  ? 34.623  18.528  83.849  1.00 16.86 ? 290  SER E CA  1 
ATOM   7483  C C   . SER E 1 62  ? 36.148  18.481  83.799  1.00 16.47 ? 290  SER E C   1 
ATOM   7484  O O   . SER E 1 62  ? 36.738  19.169  82.973  1.00 16.60 ? 290  SER E O   1 
ATOM   7485  C CB  . SER E 1 62  ? 34.190  19.944  84.241  1.00 16.88 ? 290  SER E CB  1 
ATOM   7486  O OG  . SER E 1 62  ? 32.778  20.054  84.253  1.00 17.77 ? 290  SER E OG  1 
ATOM   7487  N N   . THR E 1 63  ? 36.792  17.708  84.670  1.00 16.03 ? 291  THR E N   1 
ATOM   7488  C CA  . THR E 1 63  ? 38.252  17.616  84.632  1.00 15.89 ? 291  THR E CA  1 
ATOM   7489  C C   . THR E 1 63  ? 38.726  16.435  83.794  1.00 15.48 ? 291  THR E C   1 
ATOM   7490  O O   . THR E 1 63  ? 39.905  16.366  83.451  1.00 15.86 ? 291  THR E O   1 
ATOM   7491  C CB  . THR E 1 63  ? 38.892  17.557  86.049  1.00 16.05 ? 291  THR E CB  1 
ATOM   7492  O OG1 . THR E 1 63  ? 38.245  16.551  86.848  1.00 17.00 ? 291  THR E OG1 1 
ATOM   7493  C CG2 . THR E 1 63  ? 38.805  18.928  86.742  1.00 15.98 ? 291  THR E CG2 1 
ATOM   7494  N N   . LEU E 1 64  ? 37.823  15.517  83.449  1.00 14.87 ? 292  LEU E N   1 
ATOM   7495  C CA  . LEU E 1 64  ? 38.163  14.435  82.523  1.00 14.37 ? 292  LEU E CA  1 
ATOM   7496  C C   . LEU E 1 64  ? 38.301  14.996  81.095  1.00 14.27 ? 292  LEU E C   1 
ATOM   7497  O O   . LEU E 1 64  ? 37.906  16.135  80.819  1.00 14.23 ? 292  LEU E O   1 
ATOM   7498  C CB  . LEU E 1 64  ? 37.100  13.335  82.542  1.00 14.38 ? 292  LEU E CB  1 
ATOM   7499  C CG  . LEU E 1 64  ? 36.614  12.739  83.868  1.00 13.40 ? 292  LEU E CG  1 
ATOM   7500  C CD1 . LEU E 1 64  ? 35.383  11.881  83.615  1.00 11.96 ? 292  LEU E CD1 1 
ATOM   7501  C CD2 . LEU E 1 64  ? 37.698  11.940  84.561  1.00 12.65 ? 292  LEU E CD2 1 
ATOM   7502  N N   . SER E 1 65  ? 38.870  14.200  80.194  1.00 14.02 ? 293  SER E N   1 
ATOM   7503  C CA  . SER E 1 65  ? 39.052  14.626  78.806  1.00 13.96 ? 293  SER E CA  1 
ATOM   7504  C C   . SER E 1 65  ? 37.705  14.595  78.110  1.00 13.94 ? 293  SER E C   1 
ATOM   7505  O O   . SER E 1 65  ? 36.860  13.785  78.461  1.00 14.41 ? 293  SER E O   1 
ATOM   7506  C CB  . SER E 1 65  ? 40.016  13.690  78.093  1.00 13.80 ? 293  SER E CB  1 
ATOM   7507  O OG  . SER E 1 65  ? 39.567  12.356  78.218  1.00 13.94 ? 293  SER E OG  1 
ATOM   7508  N N   . LEU E 1 66  ? 37.494  15.469  77.134  1.00 13.77 ? 294  LEU E N   1 
ATOM   7509  C CA  . LEU E 1 66  ? 36.243  15.462  76.371  1.00 13.87 ? 294  LEU E CA  1 
ATOM   7510  C C   . LEU E 1 66  ? 35.879  14.069  75.851  1.00 13.85 ? 294  LEU E C   1 
ATOM   7511  O O   . LEU E 1 66  ? 34.713  13.681  75.884  1.00 14.00 ? 294  LEU E O   1 
ATOM   7512  C CB  . LEU E 1 66  ? 36.328  16.412  75.181  1.00 13.95 ? 294  LEU E CB  1 
ATOM   7513  C CG  . LEU E 1 66  ? 36.326  17.896  75.515  1.00 14.29 ? 294  LEU E CG  1 
ATOM   7514  C CD1 . LEU E 1 66  ? 36.734  18.713  74.280  1.00 14.45 ? 294  LEU E CD1 1 
ATOM   7515  C CD2 . LEU E 1 66  ? 34.958  18.299  76.035  1.00 13.71 ? 294  LEU E CD2 1 
ATOM   7516  N N   . ALA E 1 67  ? 36.871  13.327  75.356  1.00 13.70 ? 295  ALA E N   1 
ATOM   7517  C CA  . ALA E 1 67  ? 36.636  11.972  74.857  1.00 13.30 ? 295  ALA E CA  1 
ATOM   7518  C C   . ALA E 1 67  ? 35.969  11.133  75.934  1.00 12.92 ? 295  ALA E C   1 
ATOM   7519  O O   . ALA E 1 67  ? 35.011  10.431  75.660  1.00 12.82 ? 295  ALA E O   1 
ATOM   7520  C CB  . ALA E 1 67  ? 37.934  11.326  74.401  1.00 13.18 ? 295  ALA E CB  1 
ATOM   7521  N N   . ASP E 1 68  ? 36.471  11.228  77.162  1.00 12.81 ? 296  ASP E N   1 
ATOM   7522  C CA  . ASP E 1 68  ? 35.907  10.474  78.297  1.00 12.95 ? 296  ASP E CA  1 
ATOM   7523  C C   . ASP E 1 68  ? 34.513  10.922  78.708  1.00 12.81 ? 296  ASP E C   1 
ATOM   7524  O O   . ASP E 1 68  ? 33.718  10.108  79.147  1.00 12.79 ? 296  ASP E O   1 
ATOM   7525  C CB  . ASP E 1 68  ? 36.816  10.562  79.529  1.00 12.89 ? 296  ASP E CB  1 
ATOM   7526  C CG  . ASP E 1 68  ? 37.894  9.512   79.538  1.00 13.14 ? 296  ASP E CG  1 
ATOM   7527  O OD1 . ASP E 1 68  ? 37.955  8.700   78.591  1.00 12.95 ? 296  ASP E OD1 1 
ATOM   7528  O OD2 . ASP E 1 68  ? 38.684  9.500   80.506  1.00 14.37 ? 296  ASP E OD2 1 
ATOM   7529  N N   . GLN E 1 69  ? 34.235  12.215  78.580  1.00 12.86 ? 297  GLN E N   1 
ATOM   7530  C CA  . GLN E 1 69  ? 32.958  12.783  78.985  1.00 12.65 ? 297  GLN E CA  1 
ATOM   7531  C C   . GLN E 1 69  ? 31.857  12.380  78.026  1.00 12.80 ? 297  GLN E C   1 
ATOM   7532  O O   . GLN E 1 69  ? 30.764  12.019  78.444  1.00 12.77 ? 297  GLN E O   1 
ATOM   7533  C CB  . GLN E 1 69  ? 33.055  14.301  79.025  1.00 12.75 ? 297  GLN E CB  1 
ATOM   7534  C CG  . GLN E 1 69  ? 34.133  14.849  79.952  1.00 12.45 ? 297  GLN E CG  1 
ATOM   7535  C CD  . GLN E 1 69  ? 34.060  16.351  80.067  1.00 11.85 ? 297  GLN E CD  1 
ATOM   7536  O OE1 . GLN E 1 69  ? 32.985  16.925  79.951  1.00 11.24 ? 297  GLN E OE1 1 
ATOM   7537  N NE2 . GLN E 1 69  ? 35.197  16.995  80.287  1.00 9.40  ? 297  GLN E NE2 1 
ATOM   7538  N N   . MET E 1 70  ? 32.156  12.473  76.737  1.00 13.09 ? 298  MET E N   1 
ATOM   7539  C CA  . MET E 1 70  ? 31.276  11.977  75.684  1.00 13.66 ? 298  MET E CA  1 
ATOM   7540  C C   . MET E 1 70  ? 31.042  10.487  75.850  1.00 13.40 ? 298  MET E C   1 
ATOM   7541  O O   . MET E 1 70  ? 29.925  10.008  75.705  1.00 13.75 ? 298  MET E O   1 
ATOM   7542  C CB  . MET E 1 70  ? 31.895  12.210  74.304  1.00 13.55 ? 298  MET E CB  1 
ATOM   7543  C CG  . MET E 1 70  ? 31.476  13.488  73.618  1.00 14.09 ? 298  MET E CG  1 
ATOM   7544  S SD  . MET E 1 70  ? 32.698  14.027  72.384  1.00 15.47 ? 298  MET E SD  1 
ATOM   7545  C CE  . MET E 1 70  ? 33.320  12.463  71.742  1.00 16.62 ? 298  MET E CE  1 
ATOM   7546  N N   . SER E 1 71  ? 32.112  9.755   76.136  1.00 13.24 ? 299  SER E N   1 
ATOM   7547  C CA  . SER E 1 71  ? 32.033  8.312   76.270  1.00 12.97 ? 299  SER E CA  1 
ATOM   7548  C C   . SER E 1 71  ? 31.025  7.923   77.352  1.00 13.25 ? 299  SER E C   1 
ATOM   7549  O O   . SER E 1 71  ? 30.117  7.133   77.098  1.00 13.58 ? 299  SER E O   1 
ATOM   7550  C CB  . SER E 1 71  ? 33.410  7.733   76.582  1.00 12.83 ? 299  SER E CB  1 
ATOM   7551  O OG  . SER E 1 71  ? 34.265  7.817   75.461  1.00 11.51 ? 299  SER E OG  1 
ATOM   7552  N N   . LEU E 1 72  ? 31.168  8.501   78.541  1.00 13.19 ? 300  LEU E N   1 
ATOM   7553  C CA  . LEU E 1 72  ? 30.322  8.141   79.666  1.00 13.22 ? 300  LEU E CA  1 
ATOM   7554  C C   . LEU E 1 72  ? 28.869  8.498   79.423  1.00 13.13 ? 300  LEU E C   1 
ATOM   7555  O O   . LEU E 1 72  ? 27.976  7.772   79.850  1.00 13.13 ? 300  LEU E O   1 
ATOM   7556  C CB  . LEU E 1 72  ? 30.789  8.839   80.938  1.00 13.55 ? 300  LEU E CB  1 
ATOM   7557  C CG  . LEU E 1 72  ? 32.163  8.508   81.520  1.00 13.18 ? 300  LEU E CG  1 
ATOM   7558  C CD1 . LEU E 1 72  ? 32.377  9.293   82.817  1.00 12.64 ? 300  LEU E CD1 1 
ATOM   7559  C CD2 . LEU E 1 72  ? 32.263  7.047   81.767  1.00 13.54 ? 300  LEU E CD2 1 
ATOM   7560  N N   . LEU E 1 73  ? 28.638  9.627   78.767  1.00 13.03 ? 301  LEU E N   1 
ATOM   7561  C CA  . LEU E 1 73  ? 27.286  10.041  78.433  1.00 13.17 ? 301  LEU E CA  1 
ATOM   7562  C C   . LEU E 1 73  ? 26.741  9.142   77.350  1.00 13.52 ? 301  LEU E C   1 
ATOM   7563  O O   . LEU E 1 73  ? 25.629  8.651   77.467  1.00 13.98 ? 301  LEU E O   1 
ATOM   7564  C CB  . LEU E 1 73  ? 27.252  11.486  77.961  1.00 13.09 ? 301  LEU E CB  1 
ATOM   7565  C CG  . LEU E 1 73  ? 27.441  12.526  79.063  1.00 13.23 ? 301  LEU E CG  1 
ATOM   7566  C CD1 . LEU E 1 73  ? 27.652  13.926  78.470  1.00 13.13 ? 301  LEU E CD1 1 
ATOM   7567  C CD2 . LEU E 1 73  ? 26.255  12.516  80.003  1.00 11.91 ? 301  LEU E CD2 1 
ATOM   7568  N N   . GLN E 1 74  ? 27.521  8.915   76.298  1.00 13.61 ? 302  GLN E N   1 
ATOM   7569  C CA  . GLN E 1 74  ? 27.103  8.008   75.242  1.00 13.93 ? 302  GLN E CA  1 
ATOM   7570  C C   . GLN E 1 74  ? 26.683  6.681   75.853  1.00 13.75 ? 302  GLN E C   1 
ATOM   7571  O O   . GLN E 1 74  ? 25.735  6.064   75.384  1.00 13.69 ? 302  GLN E O   1 
ATOM   7572  C CB  . GLN E 1 74  ? 28.212  7.770   74.203  1.00 13.97 ? 302  GLN E CB  1 
ATOM   7573  C CG  . GLN E 1 74  ? 28.151  8.656   72.966  1.00 14.40 ? 302  GLN E CG  1 
ATOM   7574  C CD  . GLN E 1 74  ? 29.139  8.232   71.876  1.00 15.56 ? 302  GLN E CD  1 
ATOM   7575  O OE1 . GLN E 1 74  ? 29.090  8.742   70.749  1.00 18.33 ? 302  GLN E OE1 1 
ATOM   7576  N NE2 . GLN E 1 74  ? 30.039  7.300   72.203  1.00 16.52 ? 302  GLN E NE2 1 
ATOM   7577  N N   . SER E 1 75  ? 27.394  6.241   76.888  1.00 13.77 ? 303  SER E N   1 
ATOM   7578  C CA  . SER E 1 75  ? 27.040  5.003   77.586  1.00 13.98 ? 303  SER E CA  1 
ATOM   7579  C C   . SER E 1 75  ? 25.787  5.137   78.458  1.00 14.18 ? 303  SER E C   1 
ATOM   7580  O O   . SER E 1 75  ? 24.954  4.237   78.480  1.00 14.51 ? 303  SER E O   1 
ATOM   7581  C CB  . SER E 1 75  ? 28.196  4.518   78.460  1.00 13.87 ? 303  SER E CB  1 
ATOM   7582  O OG  . SER E 1 75  ? 29.302  4.129   77.668  1.00 13.97 ? 303  SER E OG  1 
ATOM   7583  N N   . ALA E 1 76  ? 25.647  6.254   79.162  1.00 14.12 ? 304  ALA E N   1 
ATOM   7584  C CA  . ALA E 1 76  ? 24.693  6.337   80.263  1.00 14.33 ? 304  ALA E CA  1 
ATOM   7585  C C   . ALA E 1 76  ? 23.346  7.004   79.925  1.00 14.73 ? 304  ALA E C   1 
ATOM   7586  O O   . ALA E 1 76  ? 22.414  6.986   80.752  1.00 14.71 ? 304  ALA E O   1 
ATOM   7587  C CB  . ALA E 1 76  ? 25.349  7.053   81.441  1.00 14.02 ? 304  ALA E CB  1 
ATOM   7588  N N   . TRP E 1 77  ? 23.221  7.596   78.737  1.00 14.80 ? 305  TRP E N   1 
ATOM   7589  C CA  . TRP E 1 77  ? 22.142  8.574   78.543  1.00 14.90 ? 305  TRP E CA  1 
ATOM   7590  C C   . TRP E 1 77  ? 20.761  7.989   78.779  1.00 14.77 ? 305  TRP E C   1 
ATOM   7591  O O   . TRP E 1 77  ? 19.904  8.645   79.351  1.00 14.89 ? 305  TRP E O   1 
ATOM   7592  C CB  . TRP E 1 77  ? 22.220  9.300   77.188  1.00 15.25 ? 305  TRP E CB  1 
ATOM   7593  C CG  . TRP E 1 77  ? 22.091  8.438   75.981  1.00 15.54 ? 305  TRP E CG  1 
ATOM   7594  C CD1 . TRP E 1 77  ? 23.057  7.663   75.434  1.00 15.82 ? 305  TRP E CD1 1 
ATOM   7595  C CD2 . TRP E 1 77  ? 20.938  8.292   75.151  1.00 15.68 ? 305  TRP E CD2 1 
ATOM   7596  N NE1 . TRP E 1 77  ? 22.579  7.023   74.322  1.00 16.18 ? 305  TRP E NE1 1 
ATOM   7597  C CE2 . TRP E 1 77  ? 21.278  7.393   74.123  1.00 15.67 ? 305  TRP E CE2 1 
ATOM   7598  C CE3 . TRP E 1 77  ? 19.647  8.821   75.186  1.00 15.91 ? 305  TRP E CE3 1 
ATOM   7599  C CZ2 . TRP E 1 77  ? 20.377  7.009   73.131  1.00 15.73 ? 305  TRP E CZ2 1 
ATOM   7600  C CZ3 . TRP E 1 77  ? 18.753  8.442   74.196  1.00 16.03 ? 305  TRP E CZ3 1 
ATOM   7601  C CH2 . TRP E 1 77  ? 19.123  7.539   73.185  1.00 15.68 ? 305  TRP E CH2 1 
ATOM   7602  N N   . MET E 1 78  ? 20.548  6.751   78.374  1.00 14.86 ? 306  MET E N   1 
ATOM   7603  C CA  . MET E 1 78  ? 19.236  6.165   78.516  1.00 14.96 ? 306  MET E CA  1 
ATOM   7604  C C   . MET E 1 78  ? 18.939  5.852   79.974  1.00 15.15 ? 306  MET E C   1 
ATOM   7605  O O   . MET E 1 78  ? 17.801  6.019   80.419  1.00 15.39 ? 306  MET E O   1 
ATOM   7606  C CB  . MET E 1 78  ? 19.118  4.913   77.662  1.00 15.15 ? 306  MET E CB  1 
ATOM   7607  C CG  . MET E 1 78  ? 17.705  4.355   77.596  1.00 15.35 ? 306  MET E CG  1 
ATOM   7608  S SD  . MET E 1 78  ? 16.618  5.473   76.714  1.00 16.53 ? 306  MET E SD  1 
ATOM   7609  C CE  . MET E 1 78  ? 17.177  5.254   75.014  1.00 12.29 ? 306  MET E CE  1 
ATOM   7610  N N   . GLU E 1 79  ? 19.948  5.396   80.714  1.00 15.17 ? 307  GLU E N   1 
ATOM   7611  C CA  . GLU E 1 79  ? 19.779  5.109   82.140  1.00 15.30 ? 307  GLU E CA  1 
ATOM   7612  C C   . GLU E 1 79  ? 19.371  6.368   82.911  1.00 15.29 ? 307  GLU E C   1 
ATOM   7613  O O   . GLU E 1 79  ? 18.498  6.324   83.765  1.00 15.60 ? 307  GLU E O   1 
ATOM   7614  C CB  . GLU E 1 79  ? 21.056  4.497   82.742  1.00 15.36 ? 307  GLU E CB  1 
ATOM   7615  C CG  . GLU E 1 79  ? 21.314  3.048   82.295  1.00 15.85 ? 307  GLU E CG  1 
ATOM   7616  C CD  . GLU E 1 79  ? 22.622  2.418   82.801  1.00 15.28 ? 307  GLU E CD  1 
ATOM   7617  O OE1 . GLU E 1 79  ? 23.196  2.819   83.828  1.00 16.32 ? 307  GLU E OE1 1 
ATOM   7618  O OE2 . GLU E 1 79  ? 23.073  1.481   82.145  1.00 15.04 ? 307  GLU E OE2 1 
ATOM   7619  N N   . ILE E 1 80  ? 19.984  7.493   82.586  1.00 15.35 ? 308  ILE E N   1 
ATOM   7620  C CA  . ILE E 1 80  ? 19.662  8.761   83.234  1.00 15.39 ? 308  ILE E CA  1 
ATOM   7621  C C   . ILE E 1 80  ? 18.268  9.259   82.862  1.00 15.43 ? 308  ILE E C   1 
ATOM   7622  O O   . ILE E 1 80  ? 17.607  9.893   83.672  1.00 15.48 ? 308  ILE E O   1 
ATOM   7623  C CB  . ILE E 1 80  ? 20.732  9.820   82.903  1.00 15.43 ? 308  ILE E CB  1 
ATOM   7624  C CG1 . ILE E 1 80  ? 22.040  9.440   83.610  1.00 16.46 ? 308  ILE E CG1 1 
ATOM   7625  C CG2 . ILE E 1 80  ? 20.295  11.191  83.328  1.00 14.42 ? 308  ILE E CG2 1 
ATOM   7626  C CD1 . ILE E 1 80  ? 23.271  10.095  83.028  1.00 18.30 ? 308  ILE E CD1 1 
ATOM   7627  N N   . LEU E 1 81  ? 17.819  8.963   81.646  1.00 15.60 ? 309  LEU E N   1 
ATOM   7628  C CA  . LEU E 1 81  ? 16.475  9.343   81.216  1.00 15.55 ? 309  LEU E CA  1 
ATOM   7629  C C   . LEU E 1 81  ? 15.450  8.510   81.971  1.00 15.69 ? 309  LEU E C   1 
ATOM   7630  O O   . LEU E 1 81  ? 14.542  9.047   82.590  1.00 15.87 ? 309  LEU E O   1 
ATOM   7631  C CB  . LEU E 1 81  ? 16.301  9.161   79.702  1.00 15.38 ? 309  LEU E CB  1 
ATOM   7632  C CG  . LEU E 1 81  ? 16.942  10.189  78.756  1.00 15.40 ? 309  LEU E CG  1 
ATOM   7633  C CD1 . LEU E 1 81  ? 16.826  9.729   77.300  1.00 14.59 ? 309  LEU E CD1 1 
ATOM   7634  C CD2 . LEU E 1 81  ? 16.328  11.585  78.927  1.00 15.13 ? 309  LEU E CD2 1 
ATOM   7635  N N   . ILE E 1 82  ? 15.622  7.196   81.942  1.00 16.02 ? 310  ILE E N   1 
ATOM   7636  C CA  . ILE E 1 82  ? 14.649  6.276   82.530  1.00 16.14 ? 310  ILE E CA  1 
ATOM   7637  C C   . ILE E 1 82  ? 14.596  6.440   84.040  1.00 16.25 ? 310  ILE E C   1 
ATOM   7638  O O   . ILE E 1 82  ? 13.512  6.441   84.646  1.00 16.48 ? 310  ILE E O   1 
ATOM   7639  C CB  . ILE E 1 82  ? 14.974  4.817   82.195  1.00 16.27 ? 310  ILE E CB  1 
ATOM   7640  C CG1 . ILE E 1 82  ? 14.825  4.583   80.694  1.00 16.84 ? 310  ILE E CG1 1 
ATOM   7641  C CG2 . ILE E 1 82  ? 14.038  3.877   82.938  1.00 15.67 ? 310  ILE E CG2 1 
ATOM   7642  C CD1 . ILE E 1 82  ? 15.179  3.198   80.277  1.00 18.26 ? 310  ILE E CD1 1 
ATOM   7643  N N   . LEU E 1 83  ? 15.766  6.593   84.651  1.00 15.96 ? 311  LEU E N   1 
ATOM   7644  C CA  . LEU E 1 83  ? 15.824  6.846   86.085  1.00 15.49 ? 311  LEU E CA  1 
ATOM   7645  C C   . LEU E 1 83  ? 14.998  8.089   86.412  1.00 15.41 ? 311  LEU E C   1 
ATOM   7646  O O   . LEU E 1 83  ? 14.272  8.097   87.389  1.00 15.59 ? 311  LEU E O   1 
ATOM   7647  C CB  . LEU E 1 83  ? 17.274  6.985   86.555  1.00 15.31 ? 311  LEU E CB  1 
ATOM   7648  C CG  . LEU E 1 83  ? 17.529  7.130   88.048  1.00 14.39 ? 311  LEU E CG  1 
ATOM   7649  C CD1 . LEU E 1 83  ? 16.919  5.977   88.790  1.00 13.55 ? 311  LEU E CD1 1 
ATOM   7650  C CD2 . LEU E 1 83  ? 19.024  7.218   88.320  1.00 14.76 ? 311  LEU E CD2 1 
ATOM   7651  N N   . GLY E 1 84  ? 15.086  9.114   85.569  1.00 15.16 ? 312  GLY E N   1 
ATOM   7652  C CA  . GLY E 1 84  ? 14.252  10.309  85.701  1.00 14.83 ? 312  GLY E CA  1 
ATOM   7653  C C   . GLY E 1 84  ? 12.762  10.011  85.760  1.00 14.49 ? 312  GLY E C   1 
ATOM   7654  O O   . GLY E 1 84  ? 12.090  10.388  86.712  1.00 14.12 ? 312  GLY E O   1 
ATOM   7655  N N   . VAL E 1 85  ? 12.233  9.325   84.755  1.00 14.26 ? 313  VAL E N   1 
ATOM   7656  C CA  . VAL E 1 85  ? 10.814  8.992   84.774  1.00 14.07 ? 313  VAL E CA  1 
ATOM   7657  C C   . VAL E 1 85  ? 10.476  8.090   85.960  1.00 14.18 ? 313  VAL E C   1 
ATOM   7658  O O   . VAL E 1 85  ? 9.430   8.259   86.583  1.00 14.42 ? 313  VAL E O   1 
ATOM   7659  C CB  . VAL E 1 85  ? 10.326  8.340   83.467  1.00 14.06 ? 313  VAL E CB  1 
ATOM   7660  C CG1 . VAL E 1 85  ? 11.173  7.148   83.096  1.00 13.40 ? 313  VAL E CG1 1 
ATOM   7661  C CG2 . VAL E 1 85  ? 8.847   7.942   83.601  1.00 13.76 ? 313  VAL E CG2 1 
ATOM   7662  N N   . VAL E 1 86  ? 11.358  7.148   86.282  1.00 14.01 ? 314  VAL E N   1 
ATOM   7663  C CA  . VAL E 1 86  ? 11.159  6.291   87.457  1.00 13.70 ? 314  VAL E CA  1 
ATOM   7664  C C   . VAL E 1 86  ? 10.951  7.146   88.717  1.00 13.53 ? 314  VAL E C   1 
ATOM   7665  O O   . VAL E 1 86  ? 9.990   6.936   89.447  1.00 13.89 ? 314  VAL E O   1 
ATOM   7666  C CB  . VAL E 1 86  ? 12.331  5.275   87.643  1.00 13.79 ? 314  VAL E CB  1 
ATOM   7667  C CG1 . VAL E 1 86  ? 12.280  4.624   89.012  1.00 13.34 ? 314  VAL E CG1 1 
ATOM   7668  C CG2 . VAL E 1 86  ? 12.304  4.208   86.547  1.00 12.97 ? 314  VAL E CG2 1 
ATOM   7669  N N   . TYR E 1 87  ? 11.811  8.136   88.944  1.00 13.28 ? 315  TYR E N   1 
ATOM   7670  C CA  . TYR E 1 87  ? 11.696  9.001   90.134  1.00 13.11 ? 315  TYR E CA  1 
ATOM   7671  C C   . TYR E 1 87  ? 10.431  9.864   90.192  1.00 12.89 ? 315  TYR E C   1 
ATOM   7672  O O   . TYR E 1 87  ? 9.810   9.973   91.240  1.00 12.94 ? 315  TYR E O   1 
ATOM   7673  C CB  . TYR E 1 87  ? 12.901  9.930   90.287  1.00 13.09 ? 315  TYR E CB  1 
ATOM   7674  C CG  . TYR E 1 87  ? 12.785  10.759  91.545  1.00 12.85 ? 315  TYR E CG  1 
ATOM   7675  C CD1 . TYR E 1 87  ? 12.864  10.150  92.793  1.00 12.90 ? 315  TYR E CD1 1 
ATOM   7676  C CD2 . TYR E 1 87  ? 12.548  12.122  91.494  1.00 12.16 ? 315  TYR E CD2 1 
ATOM   7677  C CE1 . TYR E 1 87  ? 12.730  10.868  93.956  1.00 13.03 ? 315  TYR E CE1 1 
ATOM   7678  C CE2 . TYR E 1 87  ? 12.414  12.862  92.661  1.00 12.94 ? 315  TYR E CE2 1 
ATOM   7679  C CZ  . TYR E 1 87  ? 12.503  12.225  93.899  1.00 13.17 ? 315  TYR E CZ  1 
ATOM   7680  O OH  . TYR E 1 87  ? 12.381  12.929  95.082  1.00 12.23 ? 315  TYR E OH  1 
ATOM   7681  N N   . ARG E 1 88  ? 10.080  10.498  89.077  1.00 12.74 ? 316  ARG E N   1 
ATOM   7682  C CA  . ARG E 1 88  ? 8.851   11.291  88.975  1.00 12.37 ? 316  ARG E CA  1 
ATOM   7683  C C   . ARG E 1 88  ? 7.614   10.429  89.154  1.00 12.59 ? 316  ARG E C   1 
ATOM   7684  O O   . ARG E 1 88  ? 6.554   10.941  89.501  1.00 12.56 ? 316  ARG E O   1 
ATOM   7685  C CB  . ARG E 1 88  ? 8.757   11.984  87.620  1.00 12.09 ? 316  ARG E CB  1 
ATOM   7686  C CG  . ARG E 1 88  ? 9.855   12.984  87.358  1.00 12.03 ? 316  ARG E CG  1 
ATOM   7687  C CD  . ARG E 1 88  ? 9.611   13.764  86.082  1.00 12.10 ? 316  ARG E CD  1 
ATOM   7688  N NE  . ARG E 1 88  ? 9.806   12.991  84.846  1.00 11.84 ? 316  ARG E NE  1 
ATOM   7689  C CZ  . ARG E 1 88  ? 10.984  12.762  84.262  1.00 12.05 ? 316  ARG E CZ  1 
ATOM   7690  N NH1 . ARG E 1 88  ? 12.114  13.204  84.805  1.00 11.85 ? 316  ARG E NH1 1 
ATOM   7691  N NH2 . ARG E 1 88  ? 11.039  12.068  83.128  1.00 12.81 ? 316  ARG E NH2 1 
ATOM   7692  N N   . SER E 1 89  ? 7.754   9.125   88.913  1.00 12.63 ? 317  SER E N   1 
ATOM   7693  C CA  . SER E 1 89  ? 6.634   8.198   89.015  1.00 12.87 ? 317  SER E CA  1 
ATOM   7694  C C   . SER E 1 89  ? 6.389   7.639   90.432  1.00 12.94 ? 317  SER E C   1 
ATOM   7695  O O   . SER E 1 89  ? 5.385   6.965   90.661  1.00 12.65 ? 317  SER E O   1 
ATOM   7696  C CB  . SER E 1 89  ? 6.852   7.042   88.035  1.00 12.93 ? 317  SER E CB  1 
ATOM   7697  O OG  . SER E 1 89  ? 7.198   7.541   86.754  1.00 13.23 ? 317  SER E OG  1 
ATOM   7698  N N   . LEU E 1 90  ? 7.283   7.933   91.376  1.00 13.19 ? 318  LEU E N   1 
ATOM   7699  C CA  . LEU E 1 90  ? 7.274   7.279   92.703  1.00 13.31 ? 318  LEU E CA  1 
ATOM   7700  C C   . LEU E 1 90  ? 5.979   7.354   93.504  1.00 13.45 ? 318  LEU E C   1 
ATOM   7701  O O   . LEU E 1 90  ? 5.611   6.380   94.153  1.00 14.02 ? 318  LEU E O   1 
ATOM   7702  C CB  . LEU E 1 90  ? 8.399   7.811   93.591  1.00 13.06 ? 318  LEU E CB  1 
ATOM   7703  C CG  . LEU E 1 90  ? 9.802   7.306   93.301  1.00 13.25 ? 318  LEU E CG  1 
ATOM   7704  C CD1 . LEU E 1 90  ? 10.746  8.008   94.264  1.00 13.75 ? 318  LEU E CD1 1 
ATOM   7705  C CD2 . LEU E 1 90  ? 9.914   5.784   93.414  1.00 12.76 ? 318  LEU E CD2 1 
ATOM   7706  N N   . SER E 1 91  ? 5.301   8.496   93.497  1.00 13.54 ? 319  SER E N   1 
ATOM   7707  C CA  . SER E 1 91  ? 4.073   8.647   94.298  1.00 13.37 ? 319  SER E CA  1 
ATOM   7708  C C   . SER E 1 91  ? 2.792   8.349   93.501  1.00 13.31 ? 319  SER E C   1 
ATOM   7709  O O   . SER E 1 91  ? 1.711   8.817   93.856  1.00 13.23 ? 319  SER E O   1 
ATOM   7710  C CB  . SER E 1 91  ? 4.029   10.038  94.953  1.00 13.17 ? 319  SER E CB  1 
ATOM   7711  O OG  . SER E 1 91  ? 4.512   11.033  94.083  1.00 12.81 ? 319  SER E OG  1 
ATOM   7712  N N   . PHE E 1 92  ? 2.932   7.538   92.452  1.00 13.41 ? 320  PHE E N   1 
ATOM   7713  C CA  . PHE E 1 92  ? 1.837   7.173   91.558  1.00 13.51 ? 320  PHE E CA  1 
ATOM   7714  C C   . PHE E 1 92  ? 1.709   5.657   91.483  1.00 13.75 ? 320  PHE E C   1 
ATOM   7715  O O   . PHE E 1 92  ? 2.683   4.943   91.682  1.00 13.61 ? 320  PHE E O   1 
ATOM   7716  C CB  . PHE E 1 92  ? 2.095   7.716   90.156  1.00 13.42 ? 320  PHE E CB  1 
ATOM   7717  C CG  . PHE E 1 92  ? 2.006   9.220   90.050  1.00 13.39 ? 320  PHE E CG  1 
ATOM   7718  C CD1 . PHE E 1 92  ? 3.035   10.029  90.519  1.00 12.94 ? 320  PHE E CD1 1 
ATOM   7719  C CD2 . PHE E 1 92  ? 0.898   9.826   89.451  1.00 13.47 ? 320  PHE E CD2 1 
ATOM   7720  C CE1 . PHE E 1 92  ? 2.961   11.411  90.405  1.00 12.92 ? 320  PHE E CE1 1 
ATOM   7721  C CE2 . PHE E 1 92  ? 0.813   11.210  89.330  1.00 13.11 ? 320  PHE E CE2 1 
ATOM   7722  C CZ  . PHE E 1 92  ? 1.846   12.005  89.805  1.00 13.43 ? 320  PHE E CZ  1 
ATOM   7723  N N   . GLU E 1 93  ? 0.501   5.183   91.177  1.00 14.23 ? 321  GLU E N   1 
ATOM   7724  C CA  . GLU E 1 93  ? 0.172   3.752   91.133  1.00 14.51 ? 321  GLU E CA  1 
ATOM   7725  C C   . GLU E 1 93  ? 0.056   3.262   89.699  1.00 14.23 ? 321  GLU E C   1 
ATOM   7726  O O   . GLU E 1 93  ? -0.881  3.622   89.005  1.00 13.97 ? 321  GLU E O   1 
ATOM   7727  C CB  . GLU E 1 93  ? -1.162  3.499   91.835  1.00 14.97 ? 321  GLU E CB  1 
ATOM   7728  C CG  . GLU E 1 93  ? -1.084  3.433   93.345  1.00 16.81 ? 321  GLU E CG  1 
ATOM   7729  C CD  . GLU E 1 93  ? -0.290  2.240   93.811  1.00 19.57 ? 321  GLU E CD  1 
ATOM   7730  O OE1 . GLU E 1 93  ? -0.582  1.112   93.341  1.00 21.10 ? 321  GLU E OE1 1 
ATOM   7731  O OE2 . GLU E 1 93  ? 0.635   2.435   94.634  1.00 21.73 ? 321  GLU E OE2 1 
ATOM   7732  N N   . ASP E 1 94  ? 1.011   2.445   89.259  1.00 14.18 ? 322  ASP E N   1 
ATOM   7733  C CA  . ASP E 1 94  ? 0.943   1.790   87.952  1.00 14.02 ? 322  ASP E CA  1 
ATOM   7734  C C   . ASP E 1 94  ? 0.817   2.824   86.820  1.00 13.93 ? 322  ASP E C   1 
ATOM   7735  O O   . ASP E 1 94  ? -0.001  2.686   85.906  1.00 13.59 ? 322  ASP E O   1 
ATOM   7736  C CB  . ASP E 1 94  ? -0.216  0.772   87.927  1.00 13.95 ? 322  ASP E CB  1 
ATOM   7737  C CG  . ASP E 1 94  ? -0.179  -0.220  89.117  1.00 13.65 ? 322  ASP E CG  1 
ATOM   7738  O OD1 . ASP E 1 94  ? 0.762   -0.213  89.934  1.00 12.68 ? 322  ASP E OD1 1 
ATOM   7739  O OD2 . ASP E 1 94  ? -1.114  -1.025  89.241  1.00 13.87 ? 322  ASP E OD2 1 
ATOM   7740  N N   . GLU E 1 95  ? 1.660   3.851   86.900  1.00 13.85 ? 323  GLU E N   1 
ATOM   7741  C CA  . GLU E 1 95  ? 1.619   4.992   85.984  1.00 13.92 ? 323  GLU E CA  1 
ATOM   7742  C C   . GLU E 1 95  ? 2.990   5.652   85.891  1.00 13.57 ? 323  GLU E C   1 
ATOM   7743  O O   . GLU E 1 95  ? 3.693   5.756   86.895  1.00 13.55 ? 323  GLU E O   1 
ATOM   7744  C CB  . GLU E 1 95  ? 0.611   6.029   86.480  1.00 13.93 ? 323  GLU E CB  1 
ATOM   7745  C CG  . GLU E 1 95  ? -0.652  6.136   85.647  1.00 14.36 ? 323  GLU E CG  1 
ATOM   7746  C CD  . GLU E 1 95  ? -1.589  7.224   86.151  1.00 14.27 ? 323  GLU E CD  1 
ATOM   7747  O OE1 . GLU E 1 95  ? -1.353  7.728   87.272  1.00 14.67 ? 323  GLU E OE1 1 
ATOM   7748  O OE2 . GLU E 1 95  ? -2.559  7.568   85.435  1.00 14.14 ? 323  GLU E OE2 1 
ATOM   7749  N N   . LEU E 1 96  ? 3.349   6.113   84.696  1.00 13.21 ? 324  LEU E N   1 
ATOM   7750  C CA  . LEU E 1 96  ? 4.682   6.654   84.443  1.00 12.89 ? 324  LEU E CA  1 
ATOM   7751  C C   . LEU E 1 96  ? 4.599   8.123   84.073  1.00 12.66 ? 324  LEU E C   1 
ATOM   7752  O O   . LEU E 1 96  ? 3.993   8.486   83.069  1.00 12.37 ? 324  LEU E O   1 
ATOM   7753  C CB  . LEU E 1 96  ? 5.376   5.873   83.326  1.00 12.87 ? 324  LEU E CB  1 
ATOM   7754  C CG  . LEU E 1 96  ? 5.774   4.425   83.652  1.00 12.71 ? 324  LEU E CG  1 
ATOM   7755  C CD1 . LEU E 1 96  ? 6.086   3.668   82.377  1.00 12.43 ? 324  LEU E CD1 1 
ATOM   7756  C CD2 . LEU E 1 96  ? 6.963   4.359   84.608  1.00 11.85 ? 324  LEU E CD2 1 
ATOM   7757  N N   . VAL E 1 97  ? 5.223   8.956   84.898  1.00 12.45 ? 325  VAL E N   1 
ATOM   7758  C CA  . VAL E 1 97  ? 5.165   10.396  84.746  1.00 12.33 ? 325  VAL E CA  1 
ATOM   7759  C C   . VAL E 1 97  ? 6.340   10.851  83.902  1.00 12.33 ? 325  VAL E C   1 
ATOM   7760  O O   . VAL E 1 97  ? 7.408   11.154  84.421  1.00 12.33 ? 325  VAL E O   1 
ATOM   7761  C CB  . VAL E 1 97  ? 5.184   11.095  86.131  1.00 12.29 ? 325  VAL E CB  1 
ATOM   7762  C CG1 . VAL E 1 97  ? 5.160   12.615  85.995  1.00 11.78 ? 325  VAL E CG1 1 
ATOM   7763  C CG2 . VAL E 1 97  ? 4.013   10.626  86.962  1.00 12.53 ? 325  VAL E CG2 1 
ATOM   7764  N N   . TYR E 1 98  ? 6.156   10.887  82.589  1.00 12.46 ? 326  TYR E N   1 
ATOM   7765  C CA  . TYR E 1 98  ? 7.247   11.304  81.707  1.00 12.63 ? 326  TYR E CA  1 
ATOM   7766  C C   . TYR E 1 98  ? 7.455   12.810  81.857  1.00 12.85 ? 326  TYR E C   1 
ATOM   7767  O O   . TYR E 1 98  ? 8.576   13.317  81.753  1.00 13.05 ? 326  TYR E O   1 
ATOM   7768  C CB  . TYR E 1 98  ? 6.998   10.866  80.250  1.00 12.39 ? 326  TYR E CB  1 
ATOM   7769  C CG  . TYR E 1 98  ? 7.283   9.393   80.028  1.00 11.99 ? 326  TYR E CG  1 
ATOM   7770  C CD1 . TYR E 1 98  ? 8.578   8.898   80.123  1.00 12.78 ? 326  TYR E CD1 1 
ATOM   7771  C CD2 . TYR E 1 98  ? 6.265   8.494   79.742  1.00 11.95 ? 326  TYR E CD2 1 
ATOM   7772  C CE1 . TYR E 1 98  ? 8.853   7.549   79.933  1.00 12.63 ? 326  TYR E CE1 1 
ATOM   7773  C CE2 . TYR E 1 98  ? 6.529   7.141   79.547  1.00 11.81 ? 326  TYR E CE2 1 
ATOM   7774  C CZ  . TYR E 1 98  ? 7.826   6.680   79.644  1.00 11.97 ? 326  TYR E CZ  1 
ATOM   7775  O OH  . TYR E 1 98  ? 8.110   5.352   79.462  1.00 11.90 ? 326  TYR E OH  1 
ATOM   7776  N N   . ALA E 1 99  ? 6.358   13.506  82.130  1.00 13.03 ? 327  ALA E N   1 
ATOM   7777  C CA  . ALA E 1 99  ? 6.387   14.911  82.506  1.00 13.23 ? 327  ALA E CA  1 
ATOM   7778  C C   . ALA E 1 99  ? 5.022   15.251  83.093  1.00 13.43 ? 327  ALA E C   1 
ATOM   7779  O O   . ALA E 1 99  ? 4.057   14.505  82.870  1.00 13.37 ? 327  ALA E O   1 
ATOM   7780  C CB  . ALA E 1 99  ? 6.683   15.766  81.298  1.00 13.45 ? 327  ALA E CB  1 
ATOM   7781  N N   . ASP E 1 100 ? 4.920   16.361  83.827  1.00 13.58 ? 328  ASP E N   1 
ATOM   7782  C CA  . ASP E 1 100 ? 3.653   16.698  84.514  1.00 13.71 ? 328  ASP E CA  1 
ATOM   7783  C C   . ASP E 1 100 ? 2.451   16.668  83.582  1.00 13.57 ? 328  ASP E C   1 
ATOM   7784  O O   . ASP E 1 100 ? 1.337   16.356  84.014  1.00 13.40 ? 328  ASP E O   1 
ATOM   7785  C CB  . ASP E 1 100 ? 3.735   18.061  85.196  1.00 13.74 ? 328  ASP E CB  1 
ATOM   7786  C CG  . ASP E 1 100 ? 4.329   17.984  86.586  1.00 14.66 ? 328  ASP E CG  1 
ATOM   7787  O OD1 . ASP E 1 100 ? 4.607   16.861  87.071  1.00 14.00 ? 328  ASP E OD1 1 
ATOM   7788  O OD2 . ASP E 1 100 ? 4.510   19.061  87.201  1.00 17.40 ? 328  ASP E OD2 1 
ATOM   7789  N N   . ASP E 1 101 ? 2.701   16.980  82.310  1.00 13.38 ? 329  ASP E N   1 
ATOM   7790  C CA  . ASP E 1 101 ? 1.678   17.004  81.285  1.00 13.29 ? 329  ASP E CA  1 
ATOM   7791  C C   . ASP E 1 101 ? 1.781   15.836  80.298  1.00 13.49 ? 329  ASP E C   1 
ATOM   7792  O O   . ASP E 1 101 ? 1.342   15.958  79.155  1.00 13.84 ? 329  ASP E O   1 
ATOM   7793  C CB  . ASP E 1 101 ? 1.754   18.338  80.532  1.00 13.23 ? 329  ASP E CB  1 
ATOM   7794  C CG  . ASP E 1 101 ? 2.962   18.438  79.604  1.00 12.71 ? 329  ASP E CG  1 
ATOM   7795  O OD1 . ASP E 1 101 ? 3.952   17.688  79.766  1.00 11.65 ? 329  ASP E OD1 1 
ATOM   7796  O OD2 . ASP E 1 101 ? 2.908   19.287  78.698  1.00 12.11 ? 329  ASP E OD2 1 
ATOM   7797  N N   . TYR E 1 102 ? 2.378   14.724  80.717  1.00 13.56 ? 330  TYR E N   1 
ATOM   7798  C CA  . TYR E 1 102 ? 2.333   13.490  79.924  1.00 13.67 ? 330  TYR E CA  1 
ATOM   7799  C C   . TYR E 1 102 ? 2.556   12.274  80.808  1.00 13.85 ? 330  TYR E C   1 
ATOM   7800  O O   . TYR E 1 102 ? 3.691   11.892  81.082  1.00 13.96 ? 330  TYR E O   1 
ATOM   7801  C CB  . TYR E 1 102 ? 3.331   13.504  78.755  1.00 13.73 ? 330  TYR E CB  1 
ATOM   7802  C CG  . TYR E 1 102 ? 2.997   12.481  77.684  1.00 13.46 ? 330  TYR E CG  1 
ATOM   7803  C CD1 . TYR E 1 102 ? 1.834   12.592  76.949  1.00 13.68 ? 330  TYR E CD1 1 
ATOM   7804  C CD2 . TYR E 1 102 ? 3.830   11.408  77.417  1.00 13.53 ? 330  TYR E CD2 1 
ATOM   7805  C CE1 . TYR E 1 102 ? 1.501   11.677  75.985  1.00 13.73 ? 330  TYR E CE1 1 
ATOM   7806  C CE2 . TYR E 1 102 ? 3.503   10.475  76.439  1.00 13.72 ? 330  TYR E CE2 1 
ATOM   7807  C CZ  . TYR E 1 102 ? 2.331   10.625  75.727  1.00 13.91 ? 330  TYR E CZ  1 
ATOM   7808  O OH  . TYR E 1 102 ? 1.965   9.733   74.746  1.00 14.13 ? 330  TYR E OH  1 
ATOM   7809  N N   . ILE E 1 103 ? 1.454   11.676  81.245  1.00 14.11 ? 331  ILE E N   1 
ATOM   7810  C CA  . ILE E 1 103 ? 1.473   10.558  82.173  1.00 14.36 ? 331  ILE E CA  1 
ATOM   7811  C C   . ILE E 1 103 ? 0.853   9.322   81.505  1.00 14.96 ? 331  ILE E C   1 
ATOM   7812  O O   . ILE E 1 103 ? -0.335  9.329   81.156  1.00 14.91 ? 331  ILE E O   1 
ATOM   7813  C CB  . ILE E 1 103 ? 0.712   10.922  83.470  1.00 14.24 ? 331  ILE E CB  1 
ATOM   7814  C CG1 . ILE E 1 103 ? 1.386   12.113  84.164  1.00 14.23 ? 331  ILE E CG1 1 
ATOM   7815  C CG2 . ILE E 1 103 ? 0.647   9.735   84.415  1.00 14.15 ? 331  ILE E CG2 1 
ATOM   7816  C CD1 . ILE E 1 103 ? 0.718   12.552  85.471  1.00 14.12 ? 331  ILE E CD1 1 
ATOM   7817  N N   . MET E 1 104 ? 1.658   8.267   81.336  1.00 15.55 ? 332  MET E N   1 
ATOM   7818  C CA  . MET E 1 104 ? 1.217   7.035   80.664  1.00 16.18 ? 332  MET E CA  1 
ATOM   7819  C C   . MET E 1 104 ? 0.751   5.936   81.634  1.00 16.28 ? 332  MET E C   1 
ATOM   7820  O O   . MET E 1 104 ? 1.502   5.510   82.519  1.00 16.10 ? 332  MET E O   1 
ATOM   7821  C CB  . MET E 1 104 ? 2.338   6.496   79.777  1.00 16.17 ? 332  MET E CB  1 
ATOM   7822  C CG  . MET E 1 104 ? 2.814   7.494   78.726  1.00 16.87 ? 332  MET E CG  1 
ATOM   7823  S SD  . MET E 1 104 ? 3.609   6.755   77.266  1.00 17.61 ? 332  MET E SD  1 
ATOM   7824  C CE  . MET E 1 104 ? 2.221   5.859   76.543  1.00 16.44 ? 332  MET E CE  1 
ATOM   7825  N N   . ASP E 1 105 ? -0.502  5.505   81.453  1.00 16.71 ? 333  ASP E N   1 
ATOM   7826  C CA  . ASP E 1 105 ? -1.090  4.362   82.172  1.00 17.06 ? 333  ASP E CA  1 
ATOM   7827  C C   . ASP E 1 105 ? -1.140  3.146   81.241  1.00 17.25 ? 333  ASP E C   1 
ATOM   7828  O O   . ASP E 1 105 ? -0.814  3.268   80.060  1.00 17.26 ? 333  ASP E O   1 
ATOM   7829  C CB  . ASP E 1 105 ? -2.495  4.700   82.699  1.00 17.19 ? 333  ASP E CB  1 
ATOM   7830  C CG  . ASP E 1 105 ? -3.500  5.014   81.587  1.00 17.93 ? 333  ASP E CG  1 
ATOM   7831  O OD1 . ASP E 1 105 ? -3.089  5.499   80.510  1.00 19.53 ? 333  ASP E OD1 1 
ATOM   7832  O OD2 . ASP E 1 105 ? -4.712  4.792   81.799  1.00 18.68 ? 333  ASP E OD2 1 
ATOM   7833  N N   . GLU E 1 106 ? -1.550  1.988   81.760  1.00 17.54 ? 334  GLU E N   1 
ATOM   7834  C CA  . GLU E 1 106 ? -1.524  0.739   80.980  1.00 17.86 ? 334  GLU E CA  1 
ATOM   7835  C C   . GLU E 1 106 ? -2.157  0.877   79.590  1.00 17.91 ? 334  GLU E C   1 
ATOM   7836  O O   . GLU E 1 106 ? -1.578  0.437   78.598  1.00 17.95 ? 334  GLU E O   1 
ATOM   7837  C CB  . GLU E 1 106 ? -2.198  -0.414  81.742  1.00 17.91 ? 334  GLU E CB  1 
ATOM   7838  C CG  . GLU E 1 106 ? -2.512  -1.647  80.864  1.00 18.33 ? 334  GLU E CG  1 
ATOM   7839  C CD  . GLU E 1 106 ? -2.716  -2.929  81.662  1.00 18.42 ? 334  GLU E CD  1 
ATOM   7840  O OE1 . GLU E 1 106 ? -1.727  -3.427  82.248  1.00 19.77 ? 334  GLU E OE1 1 
ATOM   7841  O OE2 . GLU E 1 106 ? -3.854  -3.450  81.682  1.00 17.89 ? 334  GLU E OE2 1 
ATOM   7842  N N   . ASP E 1 107 ? -3.339  1.475   79.514  1.00 17.94 ? 335  ASP E N   1 
ATOM   7843  C CA  . ASP E 1 107 ? -3.992  1.631   78.223  1.00 18.15 ? 335  ASP E CA  1 
ATOM   7844  C C   . ASP E 1 107 ? -3.135  2.439   77.253  1.00 18.32 ? 335  ASP E C   1 
ATOM   7845  O O   . ASP E 1 107 ? -2.850  1.976   76.149  1.00 18.41 ? 335  ASP E O   1 
ATOM   7846  C CB  . ASP E 1 107 ? -5.374  2.268   78.372  1.00 18.27 ? 335  ASP E CB  1 
ATOM   7847  C CG  . ASP E 1 107 ? -6.438  1.273   78.809  1.00 18.22 ? 335  ASP E CG  1 
ATOM   7848  O OD1 . ASP E 1 107 ? -6.148  0.060   78.915  1.00 18.67 ? 335  ASP E OD1 1 
ATOM   7849  O OD2 . ASP E 1 107 ? -7.577  1.715   79.043  1.00 17.91 ? 335  ASP E OD2 1 
ATOM   7850  N N   . GLN E 1 108 ? -2.717  3.635   77.660  1.00 18.42 ? 336  GLN E N   1 
ATOM   7851  C CA  . GLN E 1 108 ? -1.884  4.476   76.791  1.00 18.58 ? 336  GLN E CA  1 
ATOM   7852  C C   . GLN E 1 108 ? -0.591  3.773   76.407  1.00 18.66 ? 336  GLN E C   1 
ATOM   7853  O O   . GLN E 1 108 ? -0.123  3.910   75.275  1.00 18.79 ? 336  GLN E O   1 
ATOM   7854  C CB  . GLN E 1 108 ? -1.566  5.813   77.453  1.00 18.59 ? 336  GLN E CB  1 
ATOM   7855  C CG  . GLN E 1 108 ? -2.737  6.754   77.457  1.00 19.15 ? 336  GLN E CG  1 
ATOM   7856  C CD  . GLN E 1 108 ? -2.515  7.942   78.352  1.00 19.83 ? 336  GLN E CD  1 
ATOM   7857  O OE1 . GLN E 1 108 ? -1.630  8.761   78.104  1.00 21.05 ? 336  GLN E OE1 1 
ATOM   7858  N NE2 . GLN E 1 108 ? -3.325  8.053   79.399  1.00 20.21 ? 336  GLN E NE2 1 
ATOM   7859  N N   . SER E 1 109 ? -0.023  3.024   77.353  1.00 18.70 ? 337  SER E N   1 
ATOM   7860  C CA  . SER E 1 109 ? 1.172   2.226   77.101  1.00 18.67 ? 337  SER E CA  1 
ATOM   7861  C C   . SER E 1 109 ? 0.911   1.183   76.012  1.00 18.87 ? 337  SER E C   1 
ATOM   7862  O O   . SER E 1 109 ? 1.779   0.944   75.177  1.00 19.08 ? 337  SER E O   1 
ATOM   7863  C CB  . SER E 1 109 ? 1.662   1.531   78.381  1.00 18.81 ? 337  SER E CB  1 
ATOM   7864  O OG  . SER E 1 109 ? 2.091   2.444   79.386  1.00 18.57 ? 337  SER E OG  1 
ATOM   7865  N N   . LYS E 1 110 ? -0.277  0.571   76.012  1.00 19.05 ? 338  LYS E N   1 
ATOM   7866  C CA  . LYS E 1 110 ? -0.659  -0.378  74.944  1.00 19.18 ? 338  LYS E CA  1 
ATOM   7867  C C   . LYS E 1 110 ? -0.665  0.264   73.560  1.00 19.12 ? 338  LYS E C   1 
ATOM   7868  O O   . LYS E 1 110 ? -0.176  -0.320  72.594  1.00 19.02 ? 338  LYS E O   1 
ATOM   7869  C CB  . LYS E 1 110 ? -2.040  -0.981  75.195  1.00 19.27 ? 338  LYS E CB  1 
ATOM   7870  C CG  . LYS E 1 110 ? -2.056  -2.196  76.086  1.00 19.73 ? 338  LYS E CG  1 
ATOM   7871  C CD  . LYS E 1 110 ? -3.467  -2.752  76.155  1.00 20.35 ? 338  LYS E CD  1 
ATOM   7872  C CE  . LYS E 1 110 ? -3.554  -3.975  77.040  1.00 20.96 ? 338  LYS E CE  1 
ATOM   7873  N NZ  . LYS E 1 110 ? -4.972  -4.369  77.232  1.00 21.36 ? 338  LYS E NZ  1 
ATOM   7874  N N   . LEU E 1 111 ? -1.209  1.471   73.480  1.00 19.17 ? 339  LEU E N   1 
ATOM   7875  C CA  . LEU E 1 111 ? -1.405  2.150   72.200  1.00 19.35 ? 339  LEU E CA  1 
ATOM   7876  C C   . LEU E 1 111 ? -0.089  2.612   71.586  1.00 19.35 ? 339  LEU E C   1 
ATOM   7877  O O   . LEU E 1 111 ? 0.005   2.782   70.376  1.00 19.50 ? 339  LEU E O   1 
ATOM   7878  C CB  . LEU E 1 111 ? -2.340  3.338   72.378  1.00 19.35 ? 339  LEU E CB  1 
ATOM   7879  C CG  . LEU E 1 111 ? -3.672  2.944   73.026  1.00 19.87 ? 339  LEU E CG  1 
ATOM   7880  C CD1 . LEU E 1 111 ? -4.410  4.173   73.527  1.00 20.63 ? 339  LEU E CD1 1 
ATOM   7881  C CD2 . LEU E 1 111 ? -4.525  2.141   72.058  1.00 20.15 ? 339  LEU E CD2 1 
ATOM   7882  N N   . ALA E 1 112 ? 0.923   2.805   72.428  1.00 19.31 ? 340  ALA E N   1 
ATOM   7883  C CA  . ALA E 1 112 ? 2.254   3.220   71.979  1.00 19.20 ? 340  ALA E CA  1 
ATOM   7884  C C   . ALA E 1 112 ? 3.103   2.051   71.502  1.00 19.12 ? 340  ALA E C   1 
ATOM   7885  O O   . ALA E 1 112 ? 4.191   2.262   70.948  1.00 19.00 ? 340  ALA E O   1 
ATOM   7886  C CB  . ALA E 1 112 ? 2.976   3.934   73.104  1.00 19.20 ? 340  ALA E CB  1 
ATOM   7887  N N   . GLY E 1 113 ? 2.617   0.833   71.734  1.00 19.03 ? 341  GLY E N   1 
ATOM   7888  C CA  . GLY E 1 113 ? 3.390   -0.377  71.473  1.00 19.04 ? 341  GLY E CA  1 
ATOM   7889  C C   . GLY E 1 113 ? 4.490   -0.582  72.499  1.00 18.98 ? 341  GLY E C   1 
ATOM   7890  O O   . GLY E 1 113 ? 5.452   -1.308  72.239  1.00 19.08 ? 341  GLY E O   1 
ATOM   7891  N N   . LEU E 1 114 ? 4.325   0.037   73.672  1.00 18.92 ? 342  LEU E N   1 
ATOM   7892  C CA  . LEU E 1 114 ? 5.364   0.099   74.711  1.00 18.83 ? 342  LEU E CA  1 
ATOM   7893  C C   . LEU E 1 114 ? 4.995   -0.620  76.022  1.00 18.82 ? 342  LEU E C   1 
ATOM   7894  O O   . LEU E 1 114 ? 5.594   -0.333  77.057  1.00 19.04 ? 342  LEU E O   1 
ATOM   7895  C CB  . LEU E 1 114 ? 5.678   1.566   75.046  1.00 18.71 ? 342  LEU E CB  1 
ATOM   7896  C CG  . LEU E 1 114 ? 6.087   2.494   73.902  1.00 18.75 ? 342  LEU E CG  1 
ATOM   7897  C CD1 . LEU E 1 114 ? 6.217   3.931   74.388  1.00 18.19 ? 342  LEU E CD1 1 
ATOM   7898  C CD2 . LEU E 1 114 ? 7.380   2.023   73.257  1.00 18.62 ? 342  LEU E CD2 1 
ATOM   7899  N N   . LEU E 1 115 ? 4.036   -1.546  75.991  1.00 18.70 ? 343  LEU E N   1 
ATOM   7900  C CA  . LEU E 1 115 ? 3.615   -2.260  77.212  1.00 18.64 ? 343  LEU E CA  1 
ATOM   7901  C C   . LEU E 1 115 ? 4.785   -2.966  77.922  1.00 18.32 ? 343  LEU E C   1 
ATOM   7902  O O   . LEU E 1 115 ? 5.024   -2.740  79.108  1.00 18.09 ? 343  LEU E O   1 
ATOM   7903  C CB  . LEU E 1 115 ? 2.499   -3.273  76.901  1.00 18.80 ? 343  LEU E CB  1 
ATOM   7904  C CG  . LEU E 1 115 ? 2.004   -4.189  78.038  1.00 18.84 ? 343  LEU E CG  1 
ATOM   7905  C CD1 . LEU E 1 115 ? 1.462   -3.370  79.201  1.00 19.11 ? 343  LEU E CD1 1 
ATOM   7906  C CD2 . LEU E 1 115 ? 0.937   -5.167  77.538  1.00 18.81 ? 343  LEU E CD2 1 
ATOM   7907  N N   . ASP E 1 116 ? 5.513   -3.807  77.192  1.00 18.03 ? 344  ASP E N   1 
ATOM   7908  C CA  . ASP E 1 116 ? 6.637   -4.553  77.777  1.00 17.83 ? 344  ASP E CA  1 
ATOM   7909  C C   . ASP E 1 116 ? 7.689   -3.602  78.358  1.00 17.20 ? 344  ASP E C   1 
ATOM   7910  O O   . ASP E 1 116 ? 8.217   -3.848  79.444  1.00 17.43 ? 344  ASP E O   1 
ATOM   7911  C CB  . ASP E 1 116 ? 7.290   -5.489  76.750  1.00 17.84 ? 344  ASP E CB  1 
ATOM   7912  C CG  . ASP E 1 116 ? 6.276   -6.292  75.961  1.00 18.54 ? 344  ASP E CG  1 
ATOM   7913  O OD1 . ASP E 1 116 ? 5.199   -6.598  76.513  1.00 19.77 ? 344  ASP E OD1 1 
ATOM   7914  O OD2 . ASP E 1 116 ? 6.548   -6.607  74.784  1.00 19.31 ? 344  ASP E OD2 1 
ATOM   7915  N N   . LEU E 1 117 ? 7.974   -2.512  77.650  1.00 16.23 ? 345  LEU E N   1 
ATOM   7916  C CA  . LEU E 1 117 ? 9.023   -1.590  78.072  1.00 15.49 ? 345  LEU E CA  1 
ATOM   7917  C C   . LEU E 1 117 ? 8.599   -0.787  79.307  1.00 15.41 ? 345  LEU E C   1 
ATOM   7918  O O   . LEU E 1 117 ? 9.304   -0.795  80.319  1.00 15.38 ? 345  LEU E O   1 
ATOM   7919  C CB  . LEU E 1 117 ? 9.431   -0.668  76.916  1.00 15.31 ? 345  LEU E CB  1 
ATOM   7920  C CG  . LEU E 1 117 ? 10.661  0.216   77.129  1.00 14.61 ? 345  LEU E CG  1 
ATOM   7921  C CD1 . LEU E 1 117 ? 11.775  -0.571  77.747  1.00 14.86 ? 345  LEU E CD1 1 
ATOM   7922  C CD2 . LEU E 1 117 ? 11.122  0.836   75.827  1.00 14.63 ? 345  LEU E CD2 1 
ATOM   7923  N N   . ASN E 1 118 ? 7.451   -0.108  79.227  1.00 15.11 ? 346  ASN E N   1 
ATOM   7924  C CA  . ASN E 1 118 ? 6.882   0.602   80.383  1.00 14.84 ? 346  ASN E CA  1 
ATOM   7925  C C   . ASN E 1 118 ? 6.678   -0.314  81.597  1.00 14.84 ? 346  ASN E C   1 
ATOM   7926  O O   . ASN E 1 118 ? 6.885   0.114   82.738  1.00 14.86 ? 346  ASN E O   1 
ATOM   7927  C CB  . ASN E 1 118 ? 5.561   1.301   80.025  1.00 14.69 ? 346  ASN E CB  1 
ATOM   7928  C CG  . ASN E 1 118 ? 5.771   2.687   79.425  1.00 14.78 ? 346  ASN E CG  1 
ATOM   7929  O OD1 . ASN E 1 118 ? 6.870   3.231   79.479  1.00 15.21 ? 346  ASN E OD1 1 
ATOM   7930  N ND2 . ASN E 1 118 ? 4.710   3.266   78.858  1.00 13.41 ? 346  ASN E ND2 1 
ATOM   7931  N N   . ASN E 1 119 ? 6.295   -1.570  81.352  1.00 14.63 ? 347  ASN E N   1 
ATOM   7932  C CA  . ASN E 1 119 ? 6.176   -2.552  82.426  1.00 14.40 ? 347  ASN E CA  1 
ATOM   7933  C C   . ASN E 1 119 ? 7.482   -2.678  83.168  1.00 14.41 ? 347  ASN E C   1 
ATOM   7934  O O   . ASN E 1 119 ? 7.517   -2.615  84.394  1.00 14.39 ? 347  ASN E O   1 
ATOM   7935  C CB  . ASN E 1 119 ? 5.778   -3.929  81.887  1.00 14.45 ? 347  ASN E CB  1 
ATOM   7936  C CG  . ASN E 1 119 ? 4.273   -4.103  81.755  1.00 13.97 ? 347  ASN E CG  1 
ATOM   7937  O OD1 . ASN E 1 119 ? 3.490   -3.330  82.301  1.00 12.34 ? 347  ASN E OD1 1 
ATOM   7938  N ND2 . ASN E 1 119 ? 3.866   -5.142  81.035  1.00 14.39 ? 347  ASN E ND2 1 
ATOM   7939  N N   . ALA E 1 120 ? 8.557   -2.852  82.407  1.00 14.60 ? 348  ALA E N   1 
ATOM   7940  C CA  . ALA E 1 120 ? 9.894   -2.974  82.972  1.00 14.71 ? 348  ALA E CA  1 
ATOM   7941  C C   . ALA E 1 120 ? 10.266  -1.710  83.735  1.00 14.99 ? 348  ALA E C   1 
ATOM   7942  O O   . ALA E 1 120 ? 10.883  -1.767  84.788  1.00 15.22 ? 348  ALA E O   1 
ATOM   7943  C CB  . ALA E 1 120 ? 10.895  -3.239  81.883  1.00 14.53 ? 348  ALA E CB  1 
ATOM   7944  N N   . ILE E 1 121 ? 9.878   -0.561  83.208  1.00 15.28 ? 349  ILE E N   1 
ATOM   7945  C CA  . ILE E 1 121 ? 10.147  0.690   83.892  1.00 15.37 ? 349  ILE E CA  1 
ATOM   7946  C C   . ILE E 1 121 ? 9.382   0.711   85.210  1.00 15.41 ? 349  ILE E C   1 
ATOM   7947  O O   . ILE E 1 121 ? 9.899   1.187   86.223  1.00 15.32 ? 349  ILE E O   1 
ATOM   7948  C CB  . ILE E 1 121 ? 9.798   1.900   82.999  1.00 15.46 ? 349  ILE E CB  1 
ATOM   7949  C CG1 . ILE E 1 121 ? 10.747  1.929   81.796  1.00 15.35 ? 349  ILE E CG1 1 
ATOM   7950  C CG2 . ILE E 1 121 ? 9.910   3.213   83.778  1.00 15.42 ? 349  ILE E CG2 1 
ATOM   7951  C CD1 . ILE E 1 121 ? 10.295  2.827   80.678  1.00 15.74 ? 349  ILE E CD1 1 
ATOM   7952  N N   . LEU E 1 122 ? 8.164   0.170   85.207  1.00 15.46 ? 350  LEU E N   1 
ATOM   7953  C CA  . LEU E 1 122 ? 7.379   0.099   86.445  1.00 15.64 ? 350  LEU E CA  1 
ATOM   7954  C C   . LEU E 1 122 ? 8.035   -0.822  87.461  1.00 15.77 ? 350  LEU E C   1 
ATOM   7955  O O   . LEU E 1 122 ? 7.922   -0.598  88.670  1.00 15.58 ? 350  LEU E O   1 
ATOM   7956  C CB  . LEU E 1 122 ? 5.931   -0.331  86.187  1.00 15.36 ? 350  LEU E CB  1 
ATOM   7957  C CG  . LEU E 1 122 ? 5.062   0.718   85.486  1.00 15.74 ? 350  LEU E CG  1 
ATOM   7958  C CD1 . LEU E 1 122 ? 3.613   0.255   85.375  1.00 16.28 ? 350  LEU E CD1 1 
ATOM   7959  C CD2 . LEU E 1 122 ? 5.132   2.059   86.196  1.00 15.36 ? 350  LEU E CD2 1 
ATOM   7960  N N   . GLN E 1 123 ? 8.726   -1.848  86.971  1.00 15.96 ? 351  GLN E N   1 
ATOM   7961  C CA  . GLN E 1 123 ? 9.398   -2.785  87.855  1.00 16.47 ? 351  GLN E CA  1 
ATOM   7962  C C   . GLN E 1 123 ? 10.472  -2.040  88.664  1.00 16.23 ? 351  GLN E C   1 
ATOM   7963  O O   . GLN E 1 123 ? 10.623  -2.274  89.863  1.00 16.29 ? 351  GLN E O   1 
ATOM   7964  C CB  . GLN E 1 123 ? 9.971   -3.976  87.070  1.00 16.43 ? 351  GLN E CB  1 
ATOM   7965  C CG  . GLN E 1 123 ? 10.451  -5.137  87.947  1.00 17.27 ? 351  GLN E CG  1 
ATOM   7966  C CD  . GLN E 1 123 ? 10.951  -6.338  87.131  1.00 17.88 ? 351  GLN E CD  1 
ATOM   7967  O OE1 . GLN E 1 123 ? 10.175  -6.968  86.404  1.00 19.26 ? 351  GLN E OE1 1 
ATOM   7968  N NE2 . GLN E 1 123 ? 12.244  -6.669  87.269  1.00 18.12 ? 351  GLN E NE2 1 
ATOM   7969  N N   . LEU E 1 124 ? 11.189  -1.124  88.019  1.00 16.24 ? 352  LEU E N   1 
ATOM   7970  C CA  . LEU E 1 124 ? 12.089  -0.214  88.735  1.00 16.31 ? 352  LEU E CA  1 
ATOM   7971  C C   . LEU E 1 124 ? 11.332  0.658   89.746  1.00 16.21 ? 352  LEU E C   1 
ATOM   7972  O O   . LEU E 1 124 ? 11.726  0.748   90.909  1.00 16.15 ? 352  LEU E O   1 
ATOM   7973  C CB  . LEU E 1 124 ? 12.823  0.704   87.770  1.00 16.40 ? 352  LEU E CB  1 
ATOM   7974  C CG  . LEU E 1 124 ? 14.043  0.179   87.044  1.00 16.85 ? 352  LEU E CG  1 
ATOM   7975  C CD1 . LEU E 1 124 ? 14.433  1.179   85.958  1.00 17.87 ? 352  LEU E CD1 1 
ATOM   7976  C CD2 . LEU E 1 124 ? 15.180  -0.033  88.017  1.00 17.86 ? 352  LEU E CD2 1 
ATOM   7977  N N   . VAL E 1 125 ? 10.248  1.295   89.306  1.00 16.06 ? 353  VAL E N   1 
ATOM   7978  C CA  . VAL E 1 125 ? 9.445   2.128   90.212  1.00 16.08 ? 353  VAL E CA  1 
ATOM   7979  C C   . VAL E 1 125 ? 9.020   1.333   91.441  1.00 16.19 ? 353  VAL E C   1 
ATOM   7980  O O   . VAL E 1 125 ? 9.161   1.794   92.572  1.00 15.98 ? 353  VAL E O   1 
ATOM   7981  C CB  . VAL E 1 125 ? 8.178   2.675   89.539  1.00 16.01 ? 353  VAL E CB  1 
ATOM   7982  C CG1 . VAL E 1 125 ? 7.352   3.483   90.546  1.00 15.18 ? 353  VAL E CG1 1 
ATOM   7983  C CG2 . VAL E 1 125 ? 8.546   3.511   88.314  1.00 16.05 ? 353  VAL E CG2 1 
ATOM   7984  N N   . LYS E 1 126 ? 8.506   0.132   91.200  1.00 16.49 ? 354  LYS E N   1 
ATOM   7985  C CA  . LYS E 1 126 ? 8.081   -0.755  92.268  1.00 16.74 ? 354  LYS E CA  1 
ATOM   7986  C C   . LYS E 1 126 ? 9.186   -0.986  93.292  1.00 16.76 ? 354  LYS E C   1 
ATOM   7987  O O   . LYS E 1 126 ? 8.923   -0.971  94.493  1.00 16.86 ? 354  LYS E O   1 
ATOM   7988  C CB  . LYS E 1 126 ? 7.633   -2.085  91.689  1.00 16.91 ? 354  LYS E CB  1 
ATOM   7989  C CG  . LYS E 1 126 ? 7.161   -3.078  92.722  1.00 17.83 ? 354  LYS E CG  1 
ATOM   7990  C CD  . LYS E 1 126 ? 6.390   -4.213  92.064  1.00 19.33 ? 354  LYS E CD  1 
ATOM   7991  C CE  . LYS E 1 126 ? 6.212   -5.390  93.015  1.00 20.22 ? 354  LYS E CE  1 
ATOM   7992  N NZ  . LYS E 1 126 ? 5.644   -6.590  92.321  1.00 21.21 ? 354  LYS E NZ  1 
ATOM   7993  N N   . LYS E 1 127 ? 10.419  -1.184  92.831  1.00 16.70 ? 355  LYS E N   1 
ATOM   7994  C CA  . LYS E 1 127 ? 11.515  -1.444  93.761  1.00 16.77 ? 355  LYS E CA  1 
ATOM   7995  C C   . LYS E 1 127 ? 11.790  -0.218  94.636  1.00 16.39 ? 355  LYS E C   1 
ATOM   7996  O O   . LYS E 1 127 ? 11.839  -0.321  95.861  1.00 16.57 ? 355  LYS E O   1 
ATOM   7997  C CB  . LYS E 1 127 ? 12.794  -1.896  93.037  1.00 16.77 ? 355  LYS E CB  1 
ATOM   7998  C CG  . LYS E 1 127 ? 13.570  -2.968  93.837  1.00 17.36 ? 355  LYS E CG  1 
ATOM   7999  C CD  . LYS E 1 127 ? 15.029  -3.145  93.413  1.00 17.77 ? 355  LYS E CD  1 
ATOM   8000  C CE  . LYS E 1 127 ? 15.208  -3.908  92.087  1.00 18.37 ? 355  LYS E CE  1 
ATOM   8001  N NZ  . LYS E 1 127 ? 16.666  -4.119  91.766  1.00 18.14 ? 355  LYS E NZ  1 
ATOM   8002  N N   . TYR E 1 128 ? 11.949  0.937   93.998  1.00 15.90 ? 356  TYR E N   1 
ATOM   8003  C CA  . TYR E 1 128 ? 12.300  2.174   94.691  1.00 15.49 ? 356  TYR E CA  1 
ATOM   8004  C C   . TYR E 1 128 ? 11.202  2.668   95.639  1.00 16.15 ? 356  TYR E C   1 
ATOM   8005  O O   . TYR E 1 128 ? 11.496  3.337   96.651  1.00 16.16 ? 356  TYR E O   1 
ATOM   8006  C CB  . TYR E 1 128 ? 12.629  3.271   93.676  1.00 14.59 ? 356  TYR E CB  1 
ATOM   8007  C CG  . TYR E 1 128 ? 13.959  3.096   92.985  1.00 13.92 ? 356  TYR E CG  1 
ATOM   8008  C CD1 . TYR E 1 128 ? 15.108  2.758   93.703  1.00 13.36 ? 356  TYR E CD1 1 
ATOM   8009  C CD2 . TYR E 1 128 ? 14.088  3.296   91.620  1.00 13.01 ? 356  TYR E CD2 1 
ATOM   8010  C CE1 . TYR E 1 128 ? 16.335  2.603   93.076  1.00 12.41 ? 356  TYR E CE1 1 
ATOM   8011  C CE2 . TYR E 1 128 ? 15.315  3.143   90.989  1.00 12.92 ? 356  TYR E CE2 1 
ATOM   8012  C CZ  . TYR E 1 128 ? 16.430  2.798   91.726  1.00 12.83 ? 356  TYR E CZ  1 
ATOM   8013  O OH  . TYR E 1 128 ? 17.651  2.666   91.120  1.00 13.20 ? 356  TYR E OH  1 
ATOM   8014  N N   . LYS E 1 129 ? 9.947   2.362   95.296  1.00 16.38 ? 357  LYS E N   1 
ATOM   8015  C CA  . LYS E 1 129 ? 8.817   2.662   96.162  1.00 16.73 ? 357  LYS E CA  1 
ATOM   8016  C C   . LYS E 1 129 ? 9.001   1.986   97.524  1.00 17.12 ? 357  LYS E C   1 
ATOM   8017  O O   . LYS E 1 129 ? 8.848   2.617   98.571  1.00 17.03 ? 357  LYS E O   1 
ATOM   8018  C CB  . LYS E 1 129 ? 7.503   2.175   95.536  1.00 16.88 ? 357  LYS E CB  1 
ATOM   8019  C CG  . LYS E 1 129 ? 6.731   3.206   94.700  1.00 16.61 ? 357  LYS E CG  1 
ATOM   8020  C CD  . LYS E 1 129 ? 5.258   2.843   94.695  1.00 16.73 ? 357  LYS E CD  1 
ATOM   8021  C CE  . LYS E 1 129 ? 4.487   3.451   93.540  1.00 17.19 ? 357  LYS E CE  1 
ATOM   8022  N NZ  . LYS E 1 129 ? 3.097   2.880   93.455  1.00 17.27 ? 357  LYS E NZ  1 
ATOM   8023  N N   . SER E 1 130 ? 9.336   0.697   97.482  1.00 17.43 ? 358  SER E N   1 
ATOM   8024  C CA  . SER E 1 130 ? 9.568   -0.115  98.674  1.00 17.49 ? 358  SER E CA  1 
ATOM   8025  C C   . SER E 1 130 ? 10.671  0.383   99.582  1.00 17.54 ? 358  SER E C   1 
ATOM   8026  O O   . SER E 1 130 ? 10.592  0.189   100.788 1.00 17.77 ? 358  SER E O   1 
ATOM   8027  C CB  . SER E 1 130 ? 9.913   -1.534  98.257  1.00 17.49 ? 358  SER E CB  1 
ATOM   8028  O OG  . SER E 1 130 ? 8.909   -2.018  97.387  1.00 18.58 ? 358  SER E OG  1 
ATOM   8029  N N   . MET E 1 131 ? 11.708  0.993   99.012  1.00 17.70 ? 359  MET E N   1 
ATOM   8030  C CA  . MET E 1 131 ? 12.813  1.530   99.810  1.00 17.94 ? 359  MET E CA  1 
ATOM   8031  C C   . MET E 1 131 ? 12.544  2.938   100.292 1.00 17.48 ? 359  MET E C   1 
ATOM   8032  O O   . MET E 1 131 ? 13.239  3.405   101.179 1.00 17.43 ? 359  MET E O   1 
ATOM   8033  C CB  . MET E 1 131 ? 14.116  1.541   99.022  1.00 17.95 ? 359  MET E CB  1 
ATOM   8034  C CG  . MET E 1 131 ? 14.581  0.181   98.576  1.00 18.52 ? 359  MET E CG  1 
ATOM   8035  S SD  . MET E 1 131 ? 15.657  0.353   97.153  1.00 20.11 ? 359  MET E SD  1 
ATOM   8036  C CE  . MET E 1 131 ? 17.225  -0.220  97.822  1.00 20.30 ? 359  MET E CE  1 
ATOM   8037  N N   . LYS E 1 132 ? 11.542  3.606   99.718  1.00 17.14 ? 360  LYS E N   1 
ATOM   8038  C CA  . LYS E 1 132 ? 11.238  5.003   100.041 1.00 16.82 ? 360  LYS E CA  1 
ATOM   8039  C C   . LYS E 1 132 ? 12.417  5.864   99.619  1.00 16.41 ? 360  LYS E C   1 
ATOM   8040  O O   . LYS E 1 132 ? 13.020  6.575   100.427 1.00 15.96 ? 360  LYS E O   1 
ATOM   8041  C CB  . LYS E 1 132 ? 10.916  5.202   101.527 1.00 16.83 ? 360  LYS E CB  1 
ATOM   8042  C CG  . LYS E 1 132 ? 9.864   4.262   102.070 1.00 16.80 ? 360  LYS E CG  1 
ATOM   8043  C CD  . LYS E 1 132 ? 9.611   4.539   103.537 1.00 17.52 ? 360  LYS E CD  1 
ATOM   8044  C CE  . LYS E 1 132 ? 8.767   3.444   104.158 1.00 18.37 ? 360  LYS E CE  1 
ATOM   8045  N NZ  . LYS E 1 132 ? 8.047   3.910   105.375 1.00 18.44 ? 360  LYS E NZ  1 
ATOM   8046  N N   . LEU E 1 133 ? 12.737  5.760   98.329  1.00 16.31 ? 361  LEU E N   1 
ATOM   8047  C CA  . LEU E 1 133 ? 13.842  6.492   97.725  1.00 16.04 ? 361  LEU E CA  1 
ATOM   8048  C C   . LEU E 1 133 ? 13.618  7.987   97.897  1.00 15.88 ? 361  LEU E C   1 
ATOM   8049  O O   . LEU E 1 133 ? 12.501  8.491   97.737  1.00 15.67 ? 361  LEU E O   1 
ATOM   8050  C CB  . LEU E 1 133 ? 13.988  6.140   96.237  1.00 16.10 ? 361  LEU E CB  1 
ATOM   8051  C CG  . LEU E 1 133 ? 15.268  6.626   95.529  1.00 15.89 ? 361  LEU E CG  1 
ATOM   8052  C CD1 . LEU E 1 133 ? 16.468  5.844   96.010  1.00 14.96 ? 361  LEU E CD1 1 
ATOM   8053  C CD2 . LEU E 1 133 ? 15.153  6.505   94.011  1.00 15.56 ? 361  LEU E CD2 1 
ATOM   8054  N N   . GLU E 1 134 ? 14.701  8.671   98.236  1.00 15.67 ? 362  GLU E N   1 
ATOM   8055  C CA  . GLU E 1 134 ? 14.682  10.068  98.596  1.00 15.54 ? 362  GLU E CA  1 
ATOM   8056  C C   . GLU E 1 134 ? 15.449  10.814  97.541  1.00 15.51 ? 362  GLU E C   1 
ATOM   8057  O O   . GLU E 1 134 ? 16.351  10.249  96.929  1.00 15.29 ? 362  GLU E O   1 
ATOM   8058  C CB  . GLU E 1 134 ? 15.366  10.252  99.940  1.00 15.45 ? 362  GLU E CB  1 
ATOM   8059  C CG  . GLU E 1 134 ? 14.757  9.410   101.038 1.00 15.79 ? 362  GLU E CG  1 
ATOM   8060  C CD  . GLU E 1 134 ? 15.585  9.405   102.303 1.00 17.18 ? 362  GLU E CD  1 
ATOM   8061  O OE1 . GLU E 1 134 ? 16.709  9.967   102.292 1.00 17.27 ? 362  GLU E OE1 1 
ATOM   8062  O OE2 . GLU E 1 134 ? 15.105  8.827   103.308 1.00 17.11 ? 362  GLU E OE2 1 
ATOM   8063  N N   . LYS E 1 135 ? 15.111  12.086  97.346  1.00 15.59 ? 363  LYS E N   1 
ATOM   8064  C CA  . LYS E 1 135 ? 15.693  12.871  96.267  1.00 15.78 ? 363  LYS E CA  1 
ATOM   8065  C C   . LYS E 1 135 ? 17.221  12.837  96.283  1.00 15.51 ? 363  LYS E C   1 
ATOM   8066  O O   . LYS E 1 135 ? 17.842  12.718  95.229  1.00 15.31 ? 363  LYS E O   1 
ATOM   8067  C CB  . LYS E 1 135 ? 15.203  14.320  96.302  1.00 16.06 ? 363  LYS E CB  1 
ATOM   8068  C CG  . LYS E 1 135 ? 15.525  15.076  95.012  1.00 17.59 ? 363  LYS E CG  1 
ATOM   8069  C CD  . LYS E 1 135 ? 14.607  16.267  94.791  1.00 19.85 ? 363  LYS E CD  1 
ATOM   8070  C CE  . LYS E 1 135 ? 14.428  16.539  93.297  1.00 21.01 ? 363  LYS E CE  1 
ATOM   8071  N NZ  . LYS E 1 135 ? 13.345  17.523  93.047  1.00 21.57 ? 363  LYS E NZ  1 
ATOM   8072  N N   . GLU E 1 136 ? 17.809  12.922  97.478  1.00 15.16 ? 364  GLU E N   1 
ATOM   8073  C CA  . GLU E 1 136 ? 19.267  12.894  97.649  1.00 14.92 ? 364  GLU E CA  1 
ATOM   8074  C C   . GLU E 1 136 ? 19.880  11.581  97.149  1.00 14.93 ? 364  GLU E C   1 
ATOM   8075  O O   . GLU E 1 136 ? 21.038  11.538  96.718  1.00 14.78 ? 364  GLU E O   1 
ATOM   8076  C CB  . GLU E 1 136 ? 19.653  13.073  99.121  1.00 14.84 ? 364  GLU E CB  1 
ATOM   8077  C CG  . GLU E 1 136 ? 19.163  14.344  99.812  1.00 15.10 ? 364  GLU E CG  1 
ATOM   8078  C CD  . GLU E 1 136 ? 17.717  14.253  100.276 1.00 15.86 ? 364  GLU E CD  1 
ATOM   8079  O OE1 . GLU E 1 136 ? 17.002  13.343  99.783  1.00 15.69 ? 364  GLU E OE1 1 
ATOM   8080  O OE2 . GLU E 1 136 ? 17.289  15.096  101.109 1.00 15.79 ? 364  GLU E OE2 1 
ATOM   8081  N N   . GLU E 1 137 ? 19.106  10.508  97.233  1.00 14.95 ? 365  GLU E N   1 
ATOM   8082  C CA  . GLU E 1 137 ? 19.573  9.199   96.825  1.00 15.28 ? 365  GLU E CA  1 
ATOM   8083  C C   . GLU E 1 137 ? 19.429  9.074   95.307  1.00 15.10 ? 365  GLU E C   1 
ATOM   8084  O O   . GLU E 1 137 ? 20.332  8.588   94.614  1.00 15.40 ? 365  GLU E O   1 
ATOM   8085  C CB  . GLU E 1 137 ? 18.797  8.103   97.577  1.00 15.15 ? 365  GLU E CB  1 
ATOM   8086  C CG  . GLU E 1 137 ? 18.995  8.166   99.089  1.00 15.62 ? 365  GLU E CG  1 
ATOM   8087  C CD  . GLU E 1 137 ? 18.079  7.237   99.886  1.00 16.17 ? 365  GLU E CD  1 
ATOM   8088  O OE1 . GLU E 1 137 ? 16.840  7.421   99.869  1.00 17.34 ? 365  GLU E OE1 1 
ATOM   8089  O OE2 . GLU E 1 137 ? 18.604  6.331   100.560 1.00 17.61 ? 365  GLU E OE2 1 
ATOM   8090  N N   . PHE E 1 138 ? 18.291  9.534   94.807  1.00 14.75 ? 366  PHE E N   1 
ATOM   8091  C CA  . PHE E 1 138 ? 17.996  9.567   93.372  1.00 14.47 ? 366  PHE E CA  1 
ATOM   8092  C C   . PHE E 1 138 ? 19.093  10.305  92.578  1.00 14.03 ? 366  PHE E C   1 
ATOM   8093  O O   . PHE E 1 138 ? 19.602  9.805   91.577  1.00 14.06 ? 366  PHE E O   1 
ATOM   8094  C CB  . PHE E 1 138 ? 16.592  10.189  93.162  1.00 14.29 ? 366  PHE E CB  1 
ATOM   8095  C CG  . PHE E 1 138 ? 16.403  10.825  91.835  1.00 14.54 ? 366  PHE E CG  1 
ATOM   8096  C CD1 . PHE E 1 138 ? 16.296  10.056  90.692  1.00 15.10 ? 366  PHE E CD1 1 
ATOM   8097  C CD2 . PHE E 1 138 ? 16.331  12.202  91.718  1.00 14.35 ? 366  PHE E CD2 1 
ATOM   8098  C CE1 . PHE E 1 138 ? 16.127  10.664  89.448  1.00 14.57 ? 366  PHE E CE1 1 
ATOM   8099  C CE2 . PHE E 1 138 ? 16.160  12.801  90.492  1.00 13.22 ? 366  PHE E CE2 1 
ATOM   8100  C CZ  . PHE E 1 138 ? 16.062  12.040  89.364  1.00 13.76 ? 366  PHE E CZ  1 
ATOM   8101  N N   . VAL E 1 139 ? 19.488  11.474  93.059  1.00 13.75 ? 367  VAL E N   1 
ATOM   8102  C CA  . VAL E 1 139 ? 20.421  12.314  92.322  1.00 13.29 ? 367  VAL E CA  1 
ATOM   8103  C C   . VAL E 1 139 ? 21.850  11.807  92.428  1.00 13.32 ? 367  VAL E C   1 
ATOM   8104  O O   . VAL E 1 139 ? 22.608  11.924  91.468  1.00 13.57 ? 367  VAL E O   1 
ATOM   8105  C CB  . VAL E 1 139 ? 20.346  13.772  92.769  1.00 12.94 ? 367  VAL E CB  1 
ATOM   8106  C CG1 . VAL E 1 139 ? 18.912  14.245  92.718  1.00 12.12 ? 367  VAL E CG1 1 
ATOM   8107  C CG2 . VAL E 1 139 ? 20.940  13.946  94.149  1.00 12.50 ? 367  VAL E CG2 1 
ATOM   8108  N N   . THR E 1 140 ? 22.215  11.258  93.586  1.00 13.14 ? 368  THR E N   1 
ATOM   8109  C CA  . THR E 1 140 ? 23.527  10.633  93.766  1.00 12.86 ? 368  THR E CA  1 
ATOM   8110  C C   . THR E 1 140 ? 23.613  9.380   92.883  1.00 13.07 ? 368  THR E C   1 
ATOM   8111  O O   . THR E 1 140 ? 24.615  9.173   92.189  1.00 12.73 ? 368  THR E O   1 
ATOM   8112  C CB  . THR E 1 140 ? 23.809  10.282  95.257  1.00 12.72 ? 368  THR E CB  1 
ATOM   8113  O OG1 . THR E 1 140 ? 23.652  11.446  96.079  1.00 12.05 ? 368  THR E OG1 1 
ATOM   8114  C CG2 . THR E 1 140 ? 25.210  9.747   95.430  1.00 11.74 ? 368  THR E CG2 1 
ATOM   8115  N N   . LEU E 1 141 ? 22.547  8.570   92.899  1.00 13.42 ? 369  LEU E N   1 
ATOM   8116  C CA  . LEU E 1 141 ? 22.447  7.372   92.042  1.00 13.54 ? 369  LEU E CA  1 
ATOM   8117  C C   . LEU E 1 141 ? 22.546  7.745   90.557  1.00 13.51 ? 369  LEU E C   1 
ATOM   8118  O O   . LEU E 1 141 ? 23.286  7.101   89.809  1.00 13.49 ? 369  LEU E O   1 
ATOM   8119  C CB  . LEU E 1 141 ? 21.147  6.568   92.287  1.00 13.44 ? 369  LEU E CB  1 
ATOM   8120  C CG  . LEU E 1 141 ? 21.141  5.338   93.220  1.00 13.88 ? 369  LEU E CG  1 
ATOM   8121  C CD1 . LEU E 1 141 ? 19.890  4.482   92.996  1.00 13.08 ? 369  LEU E CD1 1 
ATOM   8122  C CD2 . LEU E 1 141 ? 22.373  4.437   93.064  1.00 14.15 ? 369  LEU E CD2 1 
ATOM   8123  N N   . LYS E 1 142 ? 21.802  8.769   90.127  1.00 13.21 ? 370  LYS E N   1 
ATOM   8124  C CA  . LYS E 1 142 ? 21.936  9.266   88.746  1.00 12.83 ? 370  LYS E CA  1 
ATOM   8125  C C   . LYS E 1 142 ? 23.377  9.566   88.433  1.00 12.59 ? 370  LYS E C   1 
ATOM   8126  O O   . LYS E 1 142 ? 23.862  9.223   87.365  1.00 12.76 ? 370  LYS E O   1 
ATOM   8127  C CB  . LYS E 1 142 ? 21.139  10.547  88.508  1.00 12.68 ? 370  LYS E CB  1 
ATOM   8128  C CG  . LYS E 1 142 ? 19.905  10.370  87.664  1.00 12.08 ? 370  LYS E CG  1 
ATOM   8129  C CD  . LYS E 1 142 ? 19.463  11.684  87.036  1.00 12.23 ? 370  LYS E CD  1 
ATOM   8130  C CE  . LYS E 1 142 ? 19.216  12.790  88.049  1.00 10.87 ? 370  LYS E CE  1 
ATOM   8131  N NZ  . LYS E 1 142 ? 18.243  13.742  87.493  1.00 10.39 ? 370  LYS E NZ  1 
ATOM   8132  N N   . ALA E 1 143 ? 24.049  10.224  89.374  1.00 12.41 ? 371  ALA E N   1 
ATOM   8133  C CA  . ALA E 1 143 ? 25.436  10.621  89.206  1.00 12.12 ? 371  ALA E CA  1 
ATOM   8134  C C   . ALA E 1 143 ? 26.271  9.392   88.953  1.00 11.84 ? 371  ALA E C   1 
ATOM   8135  O O   . ALA E 1 143 ? 26.980  9.302   87.960  1.00 11.37 ? 371  ALA E O   1 
ATOM   8136  C CB  . ALA E 1 143 ? 25.912  11.331  90.439  1.00 12.17 ? 371  ALA E CB  1 
ATOM   8137  N N   . ILE E 1 144 ? 26.135  8.435   89.870  1.00 12.01 ? 372  ILE E N   1 
ATOM   8138  C CA  . ILE E 1 144 ? 26.838  7.143   89.827  1.00 11.52 ? 372  ILE E CA  1 
ATOM   8139  C C   . ILE E 1 144 ? 26.592  6.368   88.533  1.00 11.55 ? 372  ILE E C   1 
ATOM   8140  O O   . ILE E 1 144 ? 27.519  5.798   87.976  1.00 11.72 ? 372  ILE E O   1 
ATOM   8141  C CB  . ILE E 1 144 ? 26.447  6.259   91.023  1.00 10.94 ? 372  ILE E CB  1 
ATOM   8142  C CG1 . ILE E 1 144 ? 27.015  6.831   92.322  1.00 11.22 ? 372  ILE E CG1 1 
ATOM   8143  C CG2 . ILE E 1 144 ? 26.993  4.902   90.841  1.00 10.60 ? 372  ILE E CG2 1 
ATOM   8144  C CD1 . ILE E 1 144 ? 26.521  6.132   93.602  1.00 11.07 ? 372  ILE E CD1 1 
ATOM   8145  N N   . ALA E 1 145 ? 25.353  6.355   88.054  1.00 11.63 ? 373  ALA E N   1 
ATOM   8146  C CA  . ALA E 1 145 ? 25.029  5.702   86.785  1.00 11.83 ? 373  ALA E CA  1 
ATOM   8147  C C   . ALA E 1 145 ? 25.819  6.312   85.618  1.00 12.02 ? 373  ALA E C   1 
ATOM   8148  O O   . ALA E 1 145 ? 26.254  5.612   84.712  1.00 12.35 ? 373  ALA E O   1 
ATOM   8149  C CB  . ALA E 1 145 ? 23.535  5.772   86.512  1.00 11.54 ? 373  ALA E CB  1 
ATOM   8150  N N   . LEU E 1 146 ? 26.010  7.619   85.635  1.00 12.25 ? 374  LEU E N   1 
ATOM   8151  C CA  . LEU E 1 146 ? 26.844  8.229   84.633  1.00 12.32 ? 374  LEU E CA  1 
ATOM   8152  C C   . LEU E 1 146 ? 28.239  7.668   84.768  1.00 12.53 ? 374  LEU E C   1 
ATOM   8153  O O   . LEU E 1 146 ? 28.828  7.253   83.784  1.00 12.99 ? 374  LEU E O   1 
ATOM   8154  C CB  . LEU E 1 146 ? 26.866  9.749   84.780  1.00 12.35 ? 374  LEU E CB  1 
ATOM   8155  C CG  . LEU E 1 146 ? 27.625  10.497  83.690  1.00 12.09 ? 374  LEU E CG  1 
ATOM   8156  C CD1 . LEU E 1 146 ? 27.319  9.906   82.325  1.00 11.82 ? 374  LEU E CD1 1 
ATOM   8157  C CD2 . LEU E 1 146 ? 27.262  11.948  83.749  1.00 11.87 ? 374  LEU E CD2 1 
ATOM   8158  N N   . ALA E 1 147 ? 28.744  7.630   85.998  1.00 12.84 ? 375  ALA E N   1 
ATOM   8159  C CA  . ALA E 1 147 ? 30.150  7.299   86.270  1.00 13.08 ? 375  ALA E CA  1 
ATOM   8160  C C   . ALA E 1 147 ? 30.497  5.791   86.280  1.00 13.49 ? 375  ALA E C   1 
ATOM   8161  O O   . ALA E 1 147 ? 31.655  5.419   86.103  1.00 13.57 ? 375  ALA E O   1 
ATOM   8162  C CB  . ALA E 1 147 ? 30.581  7.955   87.581  1.00 12.75 ? 375  ALA E CB  1 
ATOM   8163  N N   . ASN E 1 148 ? 29.515  4.922   86.496  1.00 14.04 ? 376  ASN E N   1 
ATOM   8164  C CA  . ASN E 1 148 ? 29.756  3.472   86.480  1.00 14.40 ? 376  ASN E CA  1 
ATOM   8165  C C   . ASN E 1 148 ? 29.257  2.880   85.144  1.00 14.92 ? 376  ASN E C   1 
ATOM   8166  O O   . ASN E 1 148 ? 28.812  1.745   85.087  1.00 15.19 ? 376  ASN E O   1 
ATOM   8167  C CB  . ASN E 1 148 ? 29.061  2.828   87.699  1.00 14.17 ? 376  ASN E CB  1 
ATOM   8168  C CG  . ASN E 1 148 ? 29.494  1.378   87.951  1.00 14.19 ? 376  ASN E CG  1 
ATOM   8169  O OD1 . ASN E 1 148 ? 30.680  1.063   87.997  1.00 14.51 ? 376  ASN E OD1 1 
ATOM   8170  N ND2 . ASN E 1 148 ? 28.521  0.496   88.122  1.00 13.31 ? 376  ASN E ND2 1 
ATOM   8171  N N   . SER E 1 149 ? 29.360  3.648   84.062  1.00 15.28 ? 377  SER E N   1 
ATOM   8172  C CA  . SER E 1 149 ? 28.676  3.310   82.816  1.00 15.79 ? 377  SER E CA  1 
ATOM   8173  C C   . SER E 1 149 ? 29.403  2.275   81.939  1.00 16.17 ? 377  SER E C   1 
ATOM   8174  O O   . SER E 1 149 ? 28.858  1.799   80.930  1.00 16.05 ? 377  SER E O   1 
ATOM   8175  C CB  . SER E 1 149 ? 28.422  4.581   82.024  1.00 15.93 ? 377  SER E CB  1 
ATOM   8176  O OG  . SER E 1 149 ? 29.614  5.329   81.915  1.00 17.02 ? 377  SER E OG  1 
ATOM   8177  N N   . ASP E 1 150 ? 30.622  1.918   82.322  1.00 16.70 ? 378  ASP E N   1 
ATOM   8178  C CA  . ASP E 1 150 ? 31.311  0.779   81.715  1.00 17.24 ? 378  ASP E CA  1 
ATOM   8179  C C   . ASP E 1 150 ? 31.397  0.908   80.200  1.00 17.75 ? 378  ASP E C   1 
ATOM   8180  O O   . ASP E 1 150 ? 30.954  0.029   79.464  1.00 18.10 ? 378  ASP E O   1 
ATOM   8181  C CB  . ASP E 1 150 ? 30.612  -0.540  82.095  1.00 17.25 ? 378  ASP E CB  1 
ATOM   8182  C CG  . ASP E 1 150 ? 30.681  -0.835  83.583  1.00 17.82 ? 378  ASP E CG  1 
ATOM   8183  O OD1 . ASP E 1 150 ? 31.785  -0.751  84.164  1.00 19.98 ? 378  ASP E OD1 1 
ATOM   8184  O OD2 . ASP E 1 150 ? 29.639  -1.165  84.175  1.00 16.77 ? 378  ASP E OD2 1 
ATOM   8185  N N   . SER E 1 151 ? 31.944  2.023   79.732  1.00 18.41 ? 379  SER E N   1 
ATOM   8186  C CA  . SER E 1 151 ? 32.305  2.158   78.325  1.00 18.79 ? 379  SER E CA  1 
ATOM   8187  C C   . SER E 1 151 ? 33.594  1.383   78.064  1.00 19.05 ? 379  SER E C   1 
ATOM   8188  O O   . SER E 1 151 ? 34.447  1.256   78.948  1.00 18.85 ? 379  SER E O   1 
ATOM   8189  C CB  . SER E 1 151 ? 32.497  3.633   77.945  1.00 19.11 ? 379  SER E CB  1 
ATOM   8190  O OG  . SER E 1 151 ? 32.970  3.759   76.606  1.00 19.47 ? 379  SER E OG  1 
ATOM   8191  N N   . MET E 1 152 ? 33.733  0.872   76.845  1.00 19.66 ? 380  MET E N   1 
ATOM   8192  C CA  . MET E 1 152 ? 34.926  0.117   76.459  1.00 20.13 ? 380  MET E CA  1 
ATOM   8193  C C   . MET E 1 152 ? 36.113  1.061   76.179  1.00 19.92 ? 380  MET E C   1 
ATOM   8194  O O   . MET E 1 152 ? 37.260  0.739   76.492  1.00 19.60 ? 380  MET E O   1 
ATOM   8195  C CB  . MET E 1 152 ? 34.623  -0.737  75.229  1.00 20.68 ? 380  MET E CB  1 
ATOM   8196  C CG  . MET E 1 152 ? 35.540  -1.960  75.053  1.00 22.27 ? 380  MET E CG  1 
ATOM   8197  S SD  . MET E 1 152 ? 34.761  -3.521  75.556  1.00 26.48 ? 380  MET E SD  1 
ATOM   8198  C CE  . MET E 1 152 ? 35.798  -4.752  74.755  1.00 23.41 ? 380  MET E CE  1 
ATOM   8199  N N   . HIS E 1 153 ? 35.816  2.236   75.626  1.00 19.93 ? 381  HIS E N   1 
ATOM   8200  C CA  . HIS E 1 153 ? 36.836  3.187   75.176  1.00 19.95 ? 381  HIS E CA  1 
ATOM   8201  C C   . HIS E 1 153 ? 37.008  4.366   76.127  1.00 19.35 ? 381  HIS E C   1 
ATOM   8202  O O   . HIS E 1 153 ? 36.755  5.526   75.779  1.00 19.34 ? 381  HIS E O   1 
ATOM   8203  C CB  . HIS E 1 153 ? 36.478  3.675   73.781  1.00 20.39 ? 381  HIS E CB  1 
ATOM   8204  C CG  . HIS E 1 153 ? 36.070  2.570   72.864  1.00 21.61 ? 381  HIS E CG  1 
ATOM   8205  N ND1 . HIS E 1 153 ? 36.981  1.709   72.286  1.00 22.73 ? 381  HIS E ND1 1 
ATOM   8206  C CD2 . HIS E 1 153 ? 34.847  2.160   72.453  1.00 22.75 ? 381  HIS E CD2 1 
ATOM   8207  C CE1 . HIS E 1 153 ? 36.337  0.830   71.539  1.00 23.14 ? 381  HIS E CE1 1 
ATOM   8208  N NE2 . HIS E 1 153 ? 35.041  1.084   71.620  1.00 23.90 ? 381  HIS E NE2 1 
ATOM   8209  N N   . ILE E 1 154 ? 37.442  4.038   77.336  1.00 18.71 ? 382  ILE E N   1 
ATOM   8210  C CA  . ILE E 1 154 ? 37.825  5.027   78.330  1.00 18.19 ? 382  ILE E CA  1 
ATOM   8211  C C   . ILE E 1 154 ? 39.299  5.380   78.116  1.00 17.97 ? 382  ILE E C   1 
ATOM   8212  O O   . ILE E 1 154 ? 40.119  4.498   77.881  1.00 17.80 ? 382  ILE E O   1 
ATOM   8213  C CB  . ILE E 1 154 ? 37.638  4.495   79.756  1.00 17.90 ? 382  ILE E CB  1 
ATOM   8214  C CG1 . ILE E 1 154 ? 36.215  3.991   79.958  1.00 17.70 ? 382  ILE E CG1 1 
ATOM   8215  C CG2 . ILE E 1 154 ? 37.924  5.593   80.762  1.00 18.18 ? 382  ILE E CG2 1 
ATOM   8216  C CD1 . ILE E 1 154 ? 35.186  5.097   79.875  1.00 17.26 ? 382  ILE E CD1 1 
ATOM   8217  N N   . GLU E 1 155 ? 39.623  6.669   78.173  1.00 17.87 ? 383  GLU E N   1 
ATOM   8218  C CA  . GLU E 1 155 ? 41.009  7.130   78.057  1.00 17.72 ? 383  GLU E CA  1 
ATOM   8219  C C   . GLU E 1 155 ? 41.716  7.130   79.409  1.00 17.60 ? 383  GLU E C   1 
ATOM   8220  O O   . GLU E 1 155 ? 42.836  6.646   79.512  1.00 17.63 ? 383  GLU E O   1 
ATOM   8221  C CB  . GLU E 1 155 ? 41.083  8.532   77.450  1.00 17.72 ? 383  GLU E CB  1 
ATOM   8222  C CG  . GLU E 1 155 ? 40.931  8.561   75.936  1.00 17.89 ? 383  GLU E CG  1 
ATOM   8223  C CD  . GLU E 1 155 ? 41.324  9.905   75.326  1.00 17.74 ? 383  GLU E CD  1 
ATOM   8224  O OE1 . GLU E 1 155 ? 41.502  10.877  76.099  1.00 17.30 ? 383  GLU E OE1 1 
ATOM   8225  O OE2 . GLU E 1 155 ? 41.458  9.983   74.077  1.00 16.95 ? 383  GLU E OE2 1 
ATOM   8226  N N   . ASP E 1 156 ? 41.069  7.678   80.436  1.00 17.47 ? 384  ASP E N   1 
ATOM   8227  C CA  . ASP E 1 156 ? 41.674  7.793   81.771  1.00 17.20 ? 384  ASP E CA  1 
ATOM   8228  C C   . ASP E 1 156 ? 40.889  6.948   82.772  1.00 17.17 ? 384  ASP E C   1 
ATOM   8229  O O   . ASP E 1 156 ? 40.006  7.449   83.464  1.00 17.19 ? 384  ASP E O   1 
ATOM   8230  C CB  . ASP E 1 156 ? 41.722  9.265   82.211  1.00 17.16 ? 384  ASP E CB  1 
ATOM   8231  C CG  . ASP E 1 156 ? 42.819  9.543   83.227  1.00 16.54 ? 384  ASP E CG  1 
ATOM   8232  O OD1 . ASP E 1 156 ? 43.170  8.642   84.017  1.00 15.63 ? 384  ASP E OD1 1 
ATOM   8233  O OD2 . ASP E 1 156 ? 43.332  10.679  83.234  1.00 15.86 ? 384  ASP E OD2 1 
ATOM   8234  N N   . VAL E 1 157 ? 41.225  5.662   82.832  1.00 17.17 ? 385  VAL E N   1 
ATOM   8235  C CA  . VAL E 1 157 ? 40.534  4.695   83.693  1.00 17.25 ? 385  VAL E CA  1 
ATOM   8236  C C   . VAL E 1 157 ? 40.667  5.055   85.175  1.00 17.51 ? 385  VAL E C   1 
ATOM   8237  O O   . VAL E 1 157 ? 39.768  4.778   85.977  1.00 17.55 ? 385  VAL E O   1 
ATOM   8238  C CB  . VAL E 1 157 ? 41.083  3.247   83.463  1.00 17.42 ? 385  VAL E CB  1 
ATOM   8239  C CG1 . VAL E 1 157 ? 40.507  2.242   84.486  1.00 16.52 ? 385  VAL E CG1 1 
ATOM   8240  C CG2 . VAL E 1 157 ? 40.819  2.787   82.020  1.00 17.47 ? 385  VAL E CG2 1 
ATOM   8241  N N   . GLU E 1 158 ? 41.797  5.658   85.534  1.00 17.83 ? 386  GLU E N   1 
ATOM   8242  C CA  . GLU E 1 158 ? 42.088  5.992   86.929  1.00 18.18 ? 386  GLU E CA  1 
ATOM   8243  C C   . GLU E 1 158 ? 41.262  7.199   87.385  1.00 17.88 ? 386  GLU E C   1 
ATOM   8244  O O   . GLU E 1 158 ? 40.746  7.215   88.498  1.00 17.92 ? 386  GLU E O   1 
ATOM   8245  C CB  . GLU E 1 158 ? 43.597  6.246   87.132  1.00 18.39 ? 386  GLU E CB  1 
ATOM   8246  C CG  . GLU E 1 158 ? 44.489  4.974   87.041  1.00 19.85 ? 386  GLU E CG  1 
ATOM   8247  C CD  . GLU E 1 158 ? 45.367  4.864   85.754  1.00 22.36 ? 386  GLU E CD  1 
ATOM   8248  O OE1 . GLU E 1 158 ? 45.376  5.790   84.885  1.00 22.26 ? 386  GLU E OE1 1 
ATOM   8249  O OE2 . GLU E 1 158 ? 46.070  3.825   85.630  1.00 23.08 ? 386  GLU E OE2 1 
ATOM   8250  N N   . ALA E 1 159 ? 41.139  8.189   86.507  1.00 17.74 ? 387  ALA E N   1 
ATOM   8251  C CA  . ALA E 1 159 ? 40.378  9.404   86.781  1.00 17.86 ? 387  ALA E CA  1 
ATOM   8252  C C   . ALA E 1 159 ? 38.890  9.123   86.863  1.00 18.15 ? 387  ALA E C   1 
ATOM   8253  O O   . ALA E 1 159 ? 38.187  9.743   87.663  1.00 18.52 ? 387  ALA E O   1 
ATOM   8254  C CB  . ALA E 1 159 ? 40.634  10.439  85.696  1.00 17.70 ? 387  ALA E CB  1 
ATOM   8255  N N   . VAL E 1 160 ? 38.420  8.209   86.012  1.00 18.24 ? 388  VAL E N   1 
ATOM   8256  C CA  . VAL E 1 160 ? 37.009  7.815   85.960  1.00 18.20 ? 388  VAL E CA  1 
ATOM   8257  C C   . VAL E 1 160 ? 36.684  6.922   87.150  1.00 18.38 ? 388  VAL E C   1 
ATOM   8258  O O   . VAL E 1 160 ? 35.589  6.988   87.715  1.00 18.26 ? 388  VAL E O   1 
ATOM   8259  C CB  . VAL E 1 160 ? 36.683  7.063   84.650  1.00 18.23 ? 388  VAL E CB  1 
ATOM   8260  C CG1 . VAL E 1 160 ? 35.245  6.563   84.654  1.00 17.80 ? 388  VAL E CG1 1 
ATOM   8261  C CG2 . VAL E 1 160 ? 36.946  7.956   83.439  1.00 18.04 ? 388  VAL E CG2 1 
ATOM   8262  N N   . GLN E 1 161 ? 37.645  6.074   87.502  1.00 18.65 ? 389  GLN E N   1 
ATOM   8263  C CA  . GLN E 1 161 ? 37.591  5.268   88.726  1.00 19.07 ? 389  GLN E CA  1 
ATOM   8264  C C   . GLN E 1 161 ? 37.475  6.178   89.955  1.00 18.56 ? 389  GLN E C   1 
ATOM   8265  O O   . GLN E 1 161 ? 36.726  5.884   90.893  1.00 18.54 ? 389  GLN E O   1 
ATOM   8266  C CB  . GLN E 1 161 ? 38.858  4.397   88.806  1.00 19.60 ? 389  GLN E CB  1 
ATOM   8267  C CG  . GLN E 1 161 ? 39.321  4.003   90.208  1.00 21.67 ? 389  GLN E CG  1 
ATOM   8268  C CD  . GLN E 1 161 ? 38.654  2.754   90.708  1.00 23.78 ? 389  GLN E CD  1 
ATOM   8269  O OE1 . GLN E 1 161 ? 38.838  1.683   90.122  1.00 25.86 ? 389  GLN E OE1 1 
ATOM   8270  N NE2 . GLN E 1 161 ? 37.888  2.869   91.799  1.00 24.80 ? 389  GLN E NE2 1 
ATOM   8271  N N   . LYS E 1 162 ? 38.234  7.270   89.942  1.00 18.09 ? 390  LYS E N   1 
ATOM   8272  C CA  . LYS E 1 162 ? 38.241  8.213   91.048  1.00 18.02 ? 390  LYS E CA  1 
ATOM   8273  C C   . LYS E 1 162 ? 36.881  8.890   91.155  1.00 17.58 ? 390  LYS E C   1 
ATOM   8274  O O   . LYS E 1 162 ? 36.356  9.038   92.258  1.00 17.65 ? 390  LYS E O   1 
ATOM   8275  C CB  . LYS E 1 162 ? 39.363  9.247   90.875  1.00 18.32 ? 390  LYS E CB  1 
ATOM   8276  C CG  . LYS E 1 162 ? 39.298  10.478  91.799  1.00 19.84 ? 390  LYS E CG  1 
ATOM   8277  C CD  . LYS E 1 162 ? 39.287  10.123  93.300  1.00 21.84 ? 390  LYS E CD  1 
ATOM   8278  C CE  . LYS E 1 162 ? 40.672  9.722   93.837  1.00 22.19 ? 390  LYS E CE  1 
ATOM   8279  N NZ  . LYS E 1 162 ? 40.562  8.885   95.079  1.00 22.52 ? 390  LYS E NZ  1 
ATOM   8280  N N   . LEU E 1 163 ? 36.309  9.287   90.015  1.00 16.95 ? 391  LEU E N   1 
ATOM   8281  C CA  . LEU E 1 163 ? 34.977  9.878   89.997  1.00 16.32 ? 391  LEU E CA  1 
ATOM   8282  C C   . LEU E 1 163 ? 33.943  8.906   90.563  1.00 16.32 ? 391  LEU E C   1 
ATOM   8283  O O   . LEU E 1 163 ? 32.985  9.336   91.213  1.00 16.03 ? 391  LEU E O   1 
ATOM   8284  C CB  . LEU E 1 163 ? 34.574  10.311  88.589  1.00 16.30 ? 391  LEU E CB  1 
ATOM   8285  C CG  . LEU E 1 163 ? 33.207  11.015  88.477  1.00 16.44 ? 391  LEU E CG  1 
ATOM   8286  C CD1 . LEU E 1 163 ? 33.185  12.293  89.317  1.00 16.13 ? 391  LEU E CD1 1 
ATOM   8287  C CD2 . LEU E 1 163 ? 32.832  11.327  87.035  1.00 15.80 ? 391  LEU E CD2 1 
ATOM   8288  N N   . GLN E 1 164 ? 34.131  7.603   90.332  1.00 16.30 ? 392  GLN E N   1 
ATOM   8289  C CA  . GLN E 1 164 ? 33.229  6.603   90.911  1.00 16.20 ? 392  GLN E CA  1 
ATOM   8290  C C   . GLN E 1 164 ? 33.407  6.597   92.406  1.00 16.32 ? 392  GLN E C   1 
ATOM   8291  O O   . GLN E 1 164 ? 32.440  6.518   93.166  1.00 15.99 ? 392  GLN E O   1 
ATOM   8292  C CB  . GLN E 1 164 ? 33.497  5.202   90.382  1.00 15.94 ? 392  GLN E CB  1 
ATOM   8293  C CG  . GLN E 1 164 ? 33.103  4.988   88.931  1.00 16.69 ? 392  GLN E CG  1 
ATOM   8294  C CD  . GLN E 1 164 ? 33.452  3.583   88.420  1.00 16.43 ? 392  GLN E CD  1 
ATOM   8295  O OE1 . GLN E 1 164 ? 33.135  2.568   89.057  1.00 16.87 ? 392  GLN E OE1 1 
ATOM   8296  N NE2 . GLN E 1 164 ? 34.110  3.528   87.276  1.00 14.72 ? 392  GLN E NE2 1 
ATOM   8297  N N   . ASP E 1 165 ? 34.654  6.673   92.840  1.00 16.67 ? 393  ASP E N   1 
ATOM   8298  C CA  . ASP E 1 165 ? 34.922  6.471   94.250  1.00 17.15 ? 393  ASP E CA  1 
ATOM   8299  C C   . ASP E 1 165 ? 34.396  7.628   95.066  1.00 16.39 ? 393  ASP E C   1 
ATOM   8300  O O   . ASP E 1 165 ? 33.839  7.417   96.133  1.00 16.53 ? 393  ASP E O   1 
ATOM   8301  C CB  . ASP E 1 165 ? 36.406  6.249   94.524  1.00 17.75 ? 393  ASP E CB  1 
ATOM   8302  C CG  . ASP E 1 165 ? 36.627  5.280   95.668  1.00 20.88 ? 393  ASP E CG  1 
ATOM   8303  O OD1 . ASP E 1 165 ? 36.165  4.110   95.557  1.00 23.33 ? 393  ASP E OD1 1 
ATOM   8304  O OD2 . ASP E 1 165 ? 37.231  5.695   96.685  1.00 24.52 ? 393  ASP E OD2 1 
ATOM   8305  N N   . VAL E 1 166 ? 34.553  8.840   94.536  1.00 15.61 ? 394  VAL E N   1 
ATOM   8306  C CA  . VAL E 1 166 ? 34.125  10.051  95.206  1.00 14.76 ? 394  VAL E CA  1 
ATOM   8307  C C   . VAL E 1 166 ? 32.611  10.077  95.355  1.00 14.80 ? 394  VAL E C   1 
ATOM   8308  O O   . VAL E 1 166 ? 32.100  10.425  96.418  1.00 15.35 ? 394  VAL E O   1 
ATOM   8309  C CB  . VAL E 1 166 ? 34.577  11.304  94.442  1.00 14.56 ? 394  VAL E CB  1 
ATOM   8310  C CG1 . VAL E 1 166 ? 33.929  12.544  95.032  1.00 13.72 ? 394  VAL E CG1 1 
ATOM   8311  C CG2 . VAL E 1 166 ? 36.087  11.415  94.462  1.00 13.68 ? 394  VAL E CG2 1 
ATOM   8312  N N   . LEU E 1 167 ? 31.897  9.720   94.292  1.00 14.51 ? 395  LEU E N   1 
ATOM   8313  C CA  . LEU E 1 167 ? 30.429  9.704   94.301  1.00 14.14 ? 395  LEU E CA  1 
ATOM   8314  C C   . LEU E 1 167 ? 29.854  8.584   95.143  1.00 13.86 ? 395  LEU E C   1 
ATOM   8315  O O   . LEU E 1 167 ? 28.775  8.729   95.685  1.00 14.25 ? 395  LEU E O   1 
ATOM   8316  C CB  . LEU E 1 167 ? 29.887  9.533   92.888  1.00 14.41 ? 395  LEU E CB  1 
ATOM   8317  C CG  . LEU E 1 167 ? 30.003  10.730  91.955  1.00 14.63 ? 395  LEU E CG  1 
ATOM   8318  C CD1 . LEU E 1 167 ? 29.554  10.334  90.535  1.00 13.92 ? 395  LEU E CD1 1 
ATOM   8319  C CD2 . LEU E 1 167 ? 29.176  11.887  92.515  1.00 14.33 ? 395  LEU E CD2 1 
ATOM   8320  N N   . HIS E 1 168 ? 30.548  7.453   95.194  1.00 13.63 ? 396  HIS E N   1 
ATOM   8321  C CA  . HIS E 1 168 ? 30.191  6.323   96.066  1.00 13.43 ? 396  HIS E CA  1 
ATOM   8322  C C   . HIS E 1 168 ? 30.282  6.795   97.513  1.00 13.35 ? 396  HIS E C   1 
ATOM   8323  O O   . HIS E 1 168 ? 29.318  6.699   98.275  1.00 13.26 ? 396  HIS E O   1 
ATOM   8324  C CB  . HIS E 1 168 ? 31.157  5.157   95.783  1.00 13.53 ? 396  HIS E CB  1 
ATOM   8325  C CG  . HIS E 1 168 ? 30.842  3.877   96.498  1.00 13.06 ? 396  HIS E CG  1 
ATOM   8326  N ND1 . HIS E 1 168 ? 31.710  2.805   96.492  1.00 13.06 ? 396  HIS E ND1 1 
ATOM   8327  C CD2 . HIS E 1 168 ? 29.778  3.490   97.235  1.00 13.40 ? 396  HIS E CD2 1 
ATOM   8328  C CE1 . HIS E 1 168 ? 31.194  1.814   97.194  1.00 12.00 ? 396  HIS E CE1 1 
ATOM   8329  N NE2 . HIS E 1 168 ? 30.020  2.200   97.652  1.00 13.00 ? 396  HIS E NE2 1 
ATOM   8330  N N   . GLU E 1 169 ? 31.436  7.353   97.863  1.00 13.21 ? 397  GLU E N   1 
ATOM   8331  C CA  . GLU E 1 169 ? 31.704  7.804   99.219  1.00 13.35 ? 397  GLU E CA  1 
ATOM   8332  C C   . GLU E 1 169 ? 30.601  8.745   99.699  1.00 12.86 ? 397  GLU E C   1 
ATOM   8333  O O   . GLU E 1 169 ? 30.195  8.680   100.849 1.00 12.67 ? 397  GLU E O   1 
ATOM   8334  C CB  . GLU E 1 169 ? 33.079  8.463   99.280  1.00 13.06 ? 397  GLU E CB  1 
ATOM   8335  C CG  . GLU E 1 169 ? 33.554  8.838   100.661 1.00 14.23 ? 397  GLU E CG  1 
ATOM   8336  C CD  . GLU E 1 169 ? 34.910  9.543   100.631 1.00 15.45 ? 397  GLU E CD  1 
ATOM   8337  O OE1 . GLU E 1 169 ? 35.006  10.627  99.992  1.00 18.19 ? 397  GLU E OE1 1 
ATOM   8338  O OE2 . GLU E 1 169 ? 35.882  9.016   101.246 1.00 18.40 ? 397  GLU E OE2 1 
ATOM   8339  N N   . ALA E 1 170 ? 30.104  9.592   98.801  1.00 12.83 ? 398  ALA E N   1 
ATOM   8340  C CA  . ALA E 1 170 ? 28.957  10.465  99.080  1.00 12.69 ? 398  ALA E CA  1 
ATOM   8341  C C   . ALA E 1 170 ? 27.671  9.681   99.393  1.00 12.80 ? 398  ALA E C   1 
ATOM   8342  O O   . ALA E 1 170 ? 26.934  10.046  100.304 1.00 12.59 ? 398  ALA E O   1 
ATOM   8343  C CB  . ALA E 1 170 ? 28.722  11.392  97.910  1.00 12.24 ? 398  ALA E CB  1 
ATOM   8344  N N   . LEU E 1 171 ? 27.398  8.622   98.629  1.00 13.01 ? 399  LEU E N   1 
ATOM   8345  C CA  . LEU E 1 171 ? 26.245  7.760   98.898  1.00 13.31 ? 399  LEU E CA  1 
ATOM   8346  C C   . LEU E 1 171 ? 26.432  7.083   100.245 1.00 14.03 ? 399  LEU E C   1 
ATOM   8347  O O   . LEU E 1 171 ? 25.523  7.041   101.071 1.00 14.20 ? 399  LEU E O   1 
ATOM   8348  C CB  . LEU E 1 171 ? 26.085  6.685   97.816  1.00 13.26 ? 399  LEU E CB  1 
ATOM   8349  C CG  . LEU E 1 171 ? 24.874  5.746   97.962  1.00 12.71 ? 399  LEU E CG  1 
ATOM   8350  C CD1 . LEU E 1 171 ? 23.565  6.510   97.830  1.00 11.30 ? 399  LEU E CD1 1 
ATOM   8351  C CD2 . LEU E 1 171 ? 24.926  4.602   96.950  1.00 12.32 ? 399  LEU E CD2 1 
ATOM   8352  N N   . GLN E 1 172 ? 27.627  6.540   100.432 1.00 14.86 ? 400  GLN E N   1 
ATOM   8353  C CA  . GLN E 1 172 ? 28.041  5.905   101.676 1.00 15.55 ? 400  GLN E CA  1 
ATOM   8354  C C   . GLN E 1 172 ? 27.735  6.825   102.873 1.00 15.31 ? 400  GLN E C   1 
ATOM   8355  O O   . GLN E 1 172 ? 26.951  6.479   103.764 1.00 15.35 ? 400  GLN E O   1 
ATOM   8356  C CB  . GLN E 1 172 ? 29.554  5.604   101.585 1.00 16.24 ? 400  GLN E CB  1 
ATOM   8357  C CG  . GLN E 1 172 ? 30.084  4.548   102.526 1.00 18.05 ? 400  GLN E CG  1 
ATOM   8358  C CD  . GLN E 1 172 ? 29.711  3.165   102.081 1.00 20.55 ? 400  GLN E CD  1 
ATOM   8359  O OE1 . GLN E 1 172 ? 28.530  2.865   101.831 1.00 21.37 ? 400  GLN E OE1 1 
ATOM   8360  N NE2 . GLN E 1 172 ? 30.716  2.299   101.975 1.00 21.97 ? 400  GLN E NE2 1 
ATOM   8361  N N   . ASP E 1 173 ? 28.331  8.009   102.862 1.00 14.88 ? 401  ASP E N   1 
ATOM   8362  C CA  . ASP E 1 173 ? 28.203  8.944   103.973 1.00 15.06 ? 401  ASP E CA  1 
ATOM   8363  C C   . ASP E 1 173 ? 26.785  9.416   104.178 1.00 14.55 ? 401  ASP E C   1 
ATOM   8364  O O   . ASP E 1 173 ? 26.394  9.727   105.296 1.00 14.59 ? 401  ASP E O   1 
ATOM   8365  C CB  . ASP E 1 173 ? 29.107  10.162  103.760 1.00 15.38 ? 401  ASP E CB  1 
ATOM   8366  C CG  . ASP E 1 173 ? 30.591  9.788   103.745 1.00 17.35 ? 401  ASP E CG  1 
ATOM   8367  O OD1 . ASP E 1 173 ? 30.913  8.564   103.836 1.00 19.07 ? 401  ASP E OD1 1 
ATOM   8368  O OD2 . ASP E 1 173 ? 31.427  10.718  103.627 1.00 19.09 ? 401  ASP E OD2 1 
ATOM   8369  N N   . TYR E 1 174 ? 26.017  9.494   103.103 1.00 14.12 ? 402  TYR E N   1 
ATOM   8370  C CA  . TYR E 1 174 ? 24.668  9.958   103.237 1.00 13.83 ? 402  TYR E CA  1 
ATOM   8371  C C   . TYR E 1 174 ? 23.899  8.901   103.994 1.00 13.94 ? 402  TYR E C   1 
ATOM   8372  O O   . TYR E 1 174 ? 23.205  9.207   104.974 1.00 13.83 ? 402  TYR E O   1 
ATOM   8373  C CB  . TYR E 1 174 ? 24.028  10.234  101.890 1.00 13.60 ? 402  TYR E CB  1 
ATOM   8374  C CG  . TYR E 1 174 ? 22.591  10.653  102.037 1.00 13.35 ? 402  TYR E CG  1 
ATOM   8375  C CD1 . TYR E 1 174 ? 22.261  11.925  102.416 1.00 12.28 ? 402  TYR E CD1 1 
ATOM   8376  C CD2 . TYR E 1 174 ? 21.561  9.748   101.834 1.00 13.83 ? 402  TYR E CD2 1 
ATOM   8377  C CE1 . TYR E 1 174 ? 20.954  12.296  102.558 1.00 12.12 ? 402  TYR E CE1 1 
ATOM   8378  C CE2 . TYR E 1 174 ? 20.252  10.113  101.973 1.00 12.48 ? 402  TYR E CE2 1 
ATOM   8379  C CZ  . TYR E 1 174 ? 19.959  11.387  102.332 1.00 12.69 ? 402  TYR E CZ  1 
ATOM   8380  O OH  . TYR E 1 174 ? 18.649  11.760  102.476 1.00 14.25 ? 402  TYR E OH  1 
ATOM   8381  N N   . GLU E 1 175 ? 24.052  7.650   103.565 1.00 13.93 ? 403  GLU E N   1 
ATOM   8382  C CA  . GLU E 1 175 ? 23.323  6.548   104.203 1.00 14.21 ? 403  GLU E CA  1 
ATOM   8383  C C   . GLU E 1 175 ? 23.837  6.235   105.623 1.00 14.51 ? 403  GLU E C   1 
ATOM   8384  O O   . GLU E 1 175 ? 23.104  5.660   106.439 1.00 14.43 ? 403  GLU E O   1 
ATOM   8385  C CB  . GLU E 1 175 ? 23.380  5.280   103.358 1.00 14.14 ? 403  GLU E CB  1 
ATOM   8386  C CG  . GLU E 1 175 ? 22.923  5.438   101.920 1.00 14.58 ? 403  GLU E CG  1 
ATOM   8387  C CD  . GLU E 1 175 ? 21.465  5.804   101.771 1.00 14.26 ? 403  GLU E CD  1 
ATOM   8388  O OE1 . GLU E 1 175 ? 20.723  5.727   102.762 1.00 14.51 ? 403  GLU E OE1 1 
ATOM   8389  O OE2 . GLU E 1 175 ? 21.063  6.164   100.643 1.00 13.62 ? 403  GLU E OE2 1 
ATOM   8390  N N   . ALA E 1 176 ? 25.091  6.609   105.898 1.00 14.59 ? 404  ALA E N   1 
ATOM   8391  C CA  . ALA E 1 176 ? 25.714  6.420   107.215 1.00 14.43 ? 404  ALA E CA  1 
ATOM   8392  C C   . ALA E 1 176 ? 25.165  7.374   108.262 1.00 14.38 ? 404  ALA E C   1 
ATOM   8393  O O   . ALA E 1 176 ? 25.123  7.040   109.445 1.00 14.60 ? 404  ALA E O   1 
ATOM   8394  C CB  . ALA E 1 176 ? 27.231  6.600   107.114 1.00 14.40 ? 404  ALA E CB  1 
ATOM   8395  N N   . GLY E 1 177 ? 24.772  8.566   107.833 1.00 14.40 ? 405  GLY E N   1 
ATOM   8396  C CA  . GLY E 1 177 ? 24.364  9.612   108.765 1.00 14.57 ? 405  GLY E CA  1 
ATOM   8397  C C   . GLY E 1 177 ? 22.861  9.732   108.856 1.00 14.75 ? 405  GLY E C   1 
ATOM   8398  O O   . GLY E 1 177 ? 22.305  9.913   109.939 1.00 14.89 ? 405  GLY E O   1 
ATOM   8399  N N   . GLN E 1 178 ? 22.211  9.628   107.706 1.00 15.00 ? 406  GLN E N   1 
ATOM   8400  C CA  . GLN E 1 178 ? 20.776  9.821   107.584 1.00 15.10 ? 406  GLN E CA  1 
ATOM   8401  C C   . GLN E 1 178 ? 19.983  8.512   107.700 1.00 15.24 ? 406  GLN E C   1 
ATOM   8402  O O   . GLN E 1 178 ? 18.768  8.531   107.817 1.00 15.03 ? 406  GLN E O   1 
ATOM   8403  C CB  . GLN E 1 178 ? 20.512  10.480  106.226 1.00 15.23 ? 406  GLN E CB  1 
ATOM   8404  C CG  . GLN E 1 178 ? 19.095  10.956  105.967 1.00 15.56 ? 406  GLN E CG  1 
ATOM   8405  C CD  . GLN E 1 178 ? 18.579  11.871  107.051 1.00 15.64 ? 406  GLN E CD  1 
ATOM   8406  O OE1 . GLN E 1 178 ? 19.351  12.569  107.709 1.00 15.73 ? 406  GLN E OE1 1 
ATOM   8407  N NE2 . GLN E 1 178 ? 17.265  11.861  107.254 1.00 14.94 ? 406  GLN E NE2 1 
ATOM   8408  N N   . HIS E 1 179 ? 20.671  7.374   107.648 1.00 15.87 ? 407  HIS E N   1 
ATOM   8409  C CA  . HIS E 1 179 ? 20.014  6.056   107.589 1.00 16.11 ? 407  HIS E CA  1 
ATOM   8410  C C   . HIS E 1 179 ? 20.878  5.026   108.275 1.00 16.22 ? 407  HIS E C   1 
ATOM   8411  O O   . HIS E 1 179 ? 21.227  4.012   107.686 1.00 16.38 ? 407  HIS E O   1 
ATOM   8412  C CB  . HIS E 1 179 ? 19.737  5.631   106.132 1.00 16.08 ? 407  HIS E CB  1 
ATOM   8413  C CG  . HIS E 1 179 ? 18.571  6.338   105.519 1.00 16.47 ? 407  HIS E CG  1 
ATOM   8414  N ND1 . HIS E 1 179 ? 17.267  6.025   105.833 1.00 17.44 ? 407  HIS E ND1 1 
ATOM   8415  C CD2 . HIS E 1 179 ? 18.510  7.367   104.641 1.00 17.30 ? 407  HIS E CD2 1 
ATOM   8416  C CE1 . HIS E 1 179 ? 16.451  6.825   105.168 1.00 17.32 ? 407  HIS E CE1 1 
ATOM   8417  N NE2 . HIS E 1 179 ? 17.180  7.649   104.438 1.00 17.36 ? 407  HIS E NE2 1 
ATOM   8418  N N   . MET E 1 180 ? 21.233  5.314   109.521 1.00 16.46 ? 408  MET E N   1 
ATOM   8419  C CA  . MET E 1 180 ? 22.056  4.423   110.315 1.00 16.85 ? 408  MET E CA  1 
ATOM   8420  C C   . MET E 1 180 ? 21.251  3.179   110.676 1.00 16.81 ? 408  MET E C   1 
ATOM   8421  O O   . MET E 1 180 ? 21.830  2.101   110.806 1.00 17.12 ? 408  MET E O   1 
ATOM   8422  C CB  . MET E 1 180 ? 22.575  5.132   111.582 1.00 17.06 ? 408  MET E CB  1 
ATOM   8423  C CG  . MET E 1 180 ? 23.842  4.491   112.216 1.00 17.93 ? 408  MET E CG  1 
ATOM   8424  S SD  . MET E 1 180 ? 24.489  5.290   113.726 1.00 17.86 ? 408  MET E SD  1 
ATOM   8425  C CE  . MET E 1 180 ? 24.548  7.010   113.200 1.00 17.60 ? 408  MET E CE  1 
ATOM   8426  N N   . GLU E 1 181 ? 19.922  3.312   110.795 1.00 16.72 ? 409  GLU E N   1 
ATOM   8427  C CA  . GLU E 1 181 ? 19.049  2.155   111.128 1.00 16.63 ? 409  GLU E CA  1 
ATOM   8428  C C   . GLU E 1 181 ? 19.088  1.026   110.093 1.00 16.14 ? 409  GLU E C   1 
ATOM   8429  O O   . GLU E 1 181 ? 18.628  -0.083  110.380 1.00 16.03 ? 409  GLU E O   1 
ATOM   8430  C CB  . GLU E 1 181 ? 17.585  2.578   111.333 1.00 16.71 ? 409  GLU E CB  1 
ATOM   8431  C CG  . GLU E 1 181 ? 16.750  2.705   110.042 1.00 17.54 ? 409  GLU E CG  1 
ATOM   8432  C CD  . GLU E 1 181 ? 16.984  4.011   109.308 1.00 18.35 ? 409  GLU E CD  1 
ATOM   8433  O OE1 . GLU E 1 181 ? 16.925  5.056   109.998 1.00 20.05 ? 409  GLU E OE1 1 
ATOM   8434  O OE2 . GLU E 1 181 ? 17.197  3.995   108.062 1.00 16.38 ? 409  GLU E OE2 1 
ATOM   8435  N N   . ASP E 1 182 ? 19.582  1.325   108.891 1.00 15.62 ? 410  ASP E N   1 
ATOM   8436  C CA  . ASP E 1 182 ? 19.842  0.303   107.895 1.00 15.58 ? 410  ASP E CA  1 
ATOM   8437  C C   . ASP E 1 182 ? 21.285  0.352   107.410 1.00 15.75 ? 410  ASP E C   1 
ATOM   8438  O O   . ASP E 1 182 ? 21.593  1.037   106.418 1.00 15.58 ? 410  ASP E O   1 
ATOM   8439  C CB  . ASP E 1 182 ? 18.913  0.429   106.697 1.00 15.57 ? 410  ASP E CB  1 
ATOM   8440  C CG  . ASP E 1 182 ? 19.096  -0.700  105.719 1.00 15.33 ? 410  ASP E CG  1 
ATOM   8441  O OD1 . ASP E 1 182 ? 19.789  -1.674  106.064 1.00 14.95 ? 410  ASP E OD1 1 
ATOM   8442  O OD2 . ASP E 1 182 ? 18.545  -0.624  104.613 1.00 16.95 ? 410  ASP E OD2 1 
ATOM   8443  N N   . PRO E 1 183 ? 22.169  -0.426  108.068 1.00 15.85 ? 411  PRO E N   1 
ATOM   8444  C CA  . PRO E 1 183 ? 23.611  -0.410  107.738 1.00 15.57 ? 411  PRO E CA  1 
ATOM   8445  C C   . PRO E 1 183 ? 23.954  -0.828  106.310 1.00 15.29 ? 411  PRO E C   1 
ATOM   8446  O O   . PRO E 1 183 ? 25.099  -0.656  105.892 1.00 15.29 ? 411  PRO E O   1 
ATOM   8447  C CB  . PRO E 1 183 ? 24.212  -1.411  108.733 1.00 15.51 ? 411  PRO E CB  1 
ATOM   8448  C CG  . PRO E 1 183 ? 23.055  -2.263  109.184 1.00 15.95 ? 411  PRO E CG  1 
ATOM   8449  C CD  . PRO E 1 183 ? 21.856  -1.390  109.146 1.00 15.75 ? 411  PRO E CD  1 
ATOM   8450  N N   . ARG E 1 184 ? 22.977  -1.373  105.581 1.00 15.17 ? 412  ARG E N   1 
ATOM   8451  C CA  . ARG E 1 184 ? 23.173  -1.834  104.209 1.00 15.15 ? 412  ARG E CA  1 
ATOM   8452  C C   . ARG E 1 184 ? 22.350  -1.076  103.179 1.00 15.27 ? 412  ARG E C   1 
ATOM   8453  O O   . ARG E 1 184 ? 22.244  -1.523  102.044 1.00 16.01 ? 412  ARG E O   1 
ATOM   8454  C CB  . ARG E 1 184 ? 22.787  -3.311  104.122 1.00 15.31 ? 412  ARG E CB  1 
ATOM   8455  C CG  . ARG E 1 184 ? 23.890  -4.250  104.547 1.00 15.60 ? 412  ARG E CG  1 
ATOM   8456  C CD  . ARG E 1 184 ? 23.419  -5.698  104.606 1.00 14.86 ? 412  ARG E CD  1 
ATOM   8457  N NE  . ARG E 1 184 ? 22.503  -5.943  105.721 1.00 14.48 ? 412  ARG E NE  1 
ATOM   8458  C CZ  . ARG E 1 184 ? 22.869  -6.045  106.993 1.00 12.91 ? 412  ARG E CZ  1 
ATOM   8459  N NH1 . ARG E 1 184 ? 24.142  -5.905  107.342 1.00 12.64 ? 412  ARG E NH1 1 
ATOM   8460  N NH2 . ARG E 1 184 ? 21.951  -6.283  107.909 1.00 11.89 ? 412  ARG E NH2 1 
ATOM   8461  N N   . ARG E 1 185 ? 21.749  0.050   103.547 1.00 15.00 ? 413  ARG E N   1 
ATOM   8462  C CA  . ARG E 1 185 ? 20.913  0.786   102.596 1.00 14.49 ? 413  ARG E CA  1 
ATOM   8463  C C   . ARG E 1 185 ? 21.669  1.233   101.360 1.00 14.05 ? 413  ARG E C   1 
ATOM   8464  O O   . ARG E 1 185 ? 21.132  1.179   100.267 1.00 13.55 ? 413  ARG E O   1 
ATOM   8465  C CB  . ARG E 1 185 ? 20.293  2.008   103.252 1.00 14.61 ? 413  ARG E CB  1 
ATOM   8466  C CG  . ARG E 1 185 ? 19.244  2.660   102.400 1.00 13.70 ? 413  ARG E CG  1 
ATOM   8467  C CD  . ARG E 1 185 ? 18.496  3.647   103.199 1.00 13.64 ? 413  ARG E CD  1 
ATOM   8468  N NE  . ARG E 1 185 ? 17.618  4.453   102.365 1.00 13.80 ? 413  ARG E NE  1 
ATOM   8469  C CZ  . ARG E 1 185 ? 16.373  4.119   102.041 1.00 13.48 ? 413  ARG E CZ  1 
ATOM   8470  N NH1 . ARG E 1 185 ? 15.823  2.991   102.480 1.00 14.08 ? 413  ARG E NH1 1 
ATOM   8471  N NH2 . ARG E 1 185 ? 15.673  4.931   101.271 1.00 13.67 ? 413  ARG E NH2 1 
ATOM   8472  N N   . ALA E 1 186 ? 22.904  1.692   101.537 1.00 14.07 ? 414  ALA E N   1 
ATOM   8473  C CA  . ALA E 1 186 ? 23.724  2.130   100.391 1.00 14.07 ? 414  ALA E CA  1 
ATOM   8474  C C   . ALA E 1 186 ? 23.898  0.983   99.434  1.00 13.97 ? 414  ALA E C   1 
ATOM   8475  O O   . ALA E 1 186 ? 23.673  1.133   98.249  1.00 14.43 ? 414  ALA E O   1 
ATOM   8476  C CB  . ALA E 1 186 ? 25.084  2.661   100.821 1.00 13.64 ? 414  ALA E CB  1 
ATOM   8477  N N   . GLY E 1 187 ? 24.281  -0.174  99.948  1.00 14.09 ? 415  GLY E N   1 
ATOM   8478  C CA  . GLY E 1 187 ? 24.426  -1.352  99.095  1.00 14.11 ? 415  GLY E CA  1 
ATOM   8479  C C   . GLY E 1 187 ? 23.117  -1.729  98.422  1.00 13.92 ? 415  GLY E C   1 
ATOM   8480  O O   . GLY E 1 187 ? 23.102  -2.070  97.250  1.00 13.95 ? 415  GLY E O   1 
ATOM   8481  N N   . LYS E 1 188 ? 22.013  -1.657  99.153  1.00 13.92 ? 416  LYS E N   1 
ATOM   8482  C CA  . LYS E 1 188 ? 20.701  -1.891  98.552  1.00 14.28 ? 416  LYS E CA  1 
ATOM   8483  C C   . LYS E 1 188 ? 20.493  -1.015  97.309  1.00 14.37 ? 416  LYS E C   1 
ATOM   8484  O O   . LYS E 1 188 ? 19.969  -1.484  96.284  1.00 15.01 ? 416  LYS E O   1 
ATOM   8485  C CB  . LYS E 1 188 ? 19.576  -1.673  99.567  1.00 13.92 ? 416  LYS E CB  1 
ATOM   8486  C CG  . LYS E 1 188 ? 19.214  -2.910  100.347 1.00 14.40 ? 416  LYS E CG  1 
ATOM   8487  C CD  . LYS E 1 188 ? 18.139  -2.602  101.395 1.00 15.13 ? 416  LYS E CD  1 
ATOM   8488  C CE  . LYS E 1 188 ? 17.933  -3.773  102.359 1.00 15.87 ? 416  LYS E CE  1 
ATOM   8489  N NZ  . LYS E 1 188 ? 17.868  -3.327  103.783 1.00 16.02 ? 416  LYS E NZ  1 
ATOM   8490  N N   . MET E 1 189 ? 20.934  0.238   97.400  1.00 14.15 ? 417  MET E N   1 
ATOM   8491  C CA  . MET E 1 189 ? 20.703  1.217   96.356  1.00 13.81 ? 417  MET E CA  1 
ATOM   8492  C C   . MET E 1 189 ? 21.481  0.873   95.117  1.00 13.64 ? 417  MET E C   1 
ATOM   8493  O O   . MET E 1 189 ? 20.936  0.874   94.017  1.00 13.64 ? 417  MET E O   1 
ATOM   8494  C CB  . MET E 1 189 ? 21.097  2.602   96.852  1.00 13.88 ? 417  MET E CB  1 
ATOM   8495  C CG  . MET E 1 189 ? 20.132  3.157   97.889  1.00 14.40 ? 417  MET E CG  1 
ATOM   8496  S SD  . MET E 1 189 ? 18.498  3.492   97.185  1.00 15.27 ? 417  MET E SD  1 
ATOM   8497  C CE  . MET E 1 189 ? 17.451  3.482   98.631  1.00 14.34 ? 417  MET E CE  1 
ATOM   8498  N N   . LEU E 1 190 ? 22.757  0.558   95.315  1.00 13.57 ? 418  LEU E N   1 
ATOM   8499  C CA  . LEU E 1 190 ? 23.650  0.142   94.241  1.00 13.28 ? 418  LEU E CA  1 
ATOM   8500  C C   . LEU E 1 190 ? 23.185  -1.135  93.533  1.00 14.02 ? 418  LEU E C   1 
ATOM   8501  O O   . LEU E 1 190 ? 23.651  -1.422  92.422  1.00 14.48 ? 418  LEU E O   1 
ATOM   8502  C CB  . LEU E 1 190 ? 25.051  -0.094  94.789  1.00 12.83 ? 418  LEU E CB  1 
ATOM   8503  C CG  . LEU E 1 190 ? 25.818  1.081   95.397  1.00 12.64 ? 418  LEU E CG  1 
ATOM   8504  C CD1 . LEU E 1 190 ? 27.050  0.581   96.137  1.00 12.45 ? 418  LEU E CD1 1 
ATOM   8505  C CD2 . LEU E 1 190 ? 26.226  2.120   94.344  1.00 12.40 ? 418  LEU E CD2 1 
ATOM   8506  N N   . MET E 1 191 ? 22.291  -1.908  94.171  1.00 14.41 ? 419  MET E N   1 
ATOM   8507  C CA  . MET E 1 191 ? 21.834  -3.196  93.637  1.00 14.27 ? 419  MET E CA  1 
ATOM   8508  C C   . MET E 1 191 ? 20.635  -3.028  92.712  1.00 14.16 ? 419  MET E C   1 
ATOM   8509  O O   . MET E 1 191 ? 20.230  -3.976  92.008  1.00 14.37 ? 419  MET E O   1 
ATOM   8510  C CB  . MET E 1 191 ? 21.529  -4.170  94.777  1.00 14.40 ? 419  MET E CB  1 
ATOM   8511  C CG  . MET E 1 191 ? 22.744  -5.047  95.176  1.00 15.04 ? 419  MET E CG  1 
ATOM   8512  S SD  . MET E 1 191 ? 22.599  -5.976  96.736  1.00 15.14 ? 419  MET E SD  1 
ATOM   8513  C CE  . MET E 1 191 ? 21.345  -7.187  96.278  1.00 16.49 ? 419  MET E CE  1 
ATOM   8514  N N   . THR E 1 192 ? 20.083  -1.818  92.684  1.00 13.68 ? 420  THR E N   1 
ATOM   8515  C CA  . THR E 1 192 ? 19.007  -1.515  91.751  1.00 13.73 ? 420  THR E CA  1 
ATOM   8516  C C   . THR E 1 192 ? 19.549  -1.138  90.380  1.00 13.70 ? 420  THR E C   1 
ATOM   8517  O O   . THR E 1 192 ? 18.777  -1.032  89.421  1.00 14.09 ? 420  THR E O   1 
ATOM   8518  C CB  . THR E 1 192 ? 18.168  -0.335  92.205  1.00 13.64 ? 420  THR E CB  1 
ATOM   8519  O OG1 . THR E 1 192 ? 18.917  0.869   92.001  1.00 13.68 ? 420  THR E OG1 1 
ATOM   8520  C CG2 . THR E 1 192 ? 17.800  -0.473  93.668  1.00 13.99 ? 420  THR E CG2 1 
ATOM   8521  N N   . LEU E 1 193 ? 20.858  -0.906  90.288  1.00 13.40 ? 421  LEU E N   1 
ATOM   8522  C CA  . LEU E 1 193 ? 21.459  -0.415  89.042  1.00 13.03 ? 421  LEU E CA  1 
ATOM   8523  C C   . LEU E 1 193 ? 21.444  -1.429  87.899  1.00 13.01 ? 421  LEU E C   1 
ATOM   8524  O O   . LEU E 1 193 ? 21.255  -1.035  86.750  1.00 13.34 ? 421  LEU E O   1 
ATOM   8525  C CB  . LEU E 1 193 ? 22.890  0.086   89.273  1.00 12.70 ? 421  LEU E CB  1 
ATOM   8526  C CG  . LEU E 1 193 ? 23.040  1.277   90.215  1.00 11.75 ? 421  LEU E CG  1 
ATOM   8527  C CD1 . LEU E 1 193 ? 24.519  1.582   90.412  1.00 11.32 ? 421  LEU E CD1 1 
ATOM   8528  C CD2 . LEU E 1 193 ? 22.296  2.487   89.692  1.00 9.97  ? 421  LEU E CD2 1 
ATOM   8529  N N   . PRO E 1 194 ? 21.679  -2.720  88.193  1.00 12.80 ? 422  PRO E N   1 
ATOM   8530  C CA  . PRO E 1 194 ? 21.604  -3.717  87.128  1.00 12.93 ? 422  PRO E CA  1 
ATOM   8531  C C   . PRO E 1 194 ? 20.276  -3.719  86.372  1.00 12.87 ? 422  PRO E C   1 
ATOM   8532  O O   . PRO E 1 194 ? 20.275  -3.774  85.147  1.00 13.08 ? 422  PRO E O   1 
ATOM   8533  C CB  . PRO E 1 194 ? 21.841  -5.036  87.876  1.00 12.87 ? 422  PRO E CB  1 
ATOM   8534  C CG  . PRO E 1 194 ? 22.711  -4.631  89.011  1.00 12.63 ? 422  PRO E CG  1 
ATOM   8535  C CD  . PRO E 1 194 ? 22.093  -3.342  89.459  1.00 12.83 ? 422  PRO E CD  1 
ATOM   8536  N N   . LEU E 1 195 ? 19.166  -3.641  87.091  1.00 12.84 ? 423  LEU E N   1 
ATOM   8537  C CA  . LEU E 1 195 ? 17.852  -3.544  86.462  1.00 13.03 ? 423  LEU E CA  1 
ATOM   8538  C C   . LEU E 1 195 ? 17.722  -2.293  85.608  1.00 13.09 ? 423  LEU E C   1 
ATOM   8539  O O   . LEU E 1 195 ? 17.012  -2.314  84.595  1.00 13.48 ? 423  LEU E O   1 
ATOM   8540  C CB  . LEU E 1 195 ? 16.744  -3.511  87.520  1.00 13.20 ? 423  LEU E CB  1 
ATOM   8541  C CG  . LEU E 1 195 ? 15.316  -3.531  86.983  1.00 13.02 ? 423  LEU E CG  1 
ATOM   8542  C CD1 . LEU E 1 195 ? 15.115  -4.715  86.071  1.00 12.63 ? 423  LEU E CD1 1 
ATOM   8543  C CD2 . LEU E 1 195 ? 14.330  -3.578  88.125  1.00 13.51 ? 423  LEU E CD2 1 
ATOM   8544  N N   . LEU E 1 196 ? 18.368  -1.201  86.038  1.00 12.74 ? 424  LEU E N   1 
ATOM   8545  C CA  . LEU E 1 196 ? 18.398  0.042   85.255  1.00 12.23 ? 424  LEU E CA  1 
ATOM   8546  C C   . LEU E 1 196 ? 19.091  -0.191  83.925  1.00 11.91 ? 424  LEU E C   1 
ATOM   8547  O O   . LEU E 1 196 ? 18.545  0.127   82.887  1.00 11.73 ? 424  LEU E O   1 
ATOM   8548  C CB  . LEU E 1 196 ? 19.112  1.163   86.017  1.00 12.23 ? 424  LEU E CB  1 
ATOM   8549  C CG  . LEU E 1 196 ? 19.078  2.575   85.403  1.00 12.41 ? 424  LEU E CG  1 
ATOM   8550  C CD1 . LEU E 1 196 ? 17.666  2.952   84.949  1.00 11.74 ? 424  LEU E CD1 1 
ATOM   8551  C CD2 . LEU E 1 196 ? 19.651  3.632   86.385  1.00 11.37 ? 424  LEU E CD2 1 
ATOM   8552  N N   . ARG E 1 197 ? 20.285  -0.773  83.982  1.00 11.81 ? 425  ARG E N   1 
ATOM   8553  C CA  . ARG E 1 197 ? 21.133  -0.993  82.807  1.00 11.70 ? 425  ARG E CA  1 
ATOM   8554  C C   . ARG E 1 197 ? 20.488  -2.010  81.876  1.00 11.94 ? 425  ARG E C   1 
ATOM   8555  O O   . ARG E 1 197 ? 20.510  -1.848  80.657  1.00 12.22 ? 425  ARG E O   1 
ATOM   8556  C CB  . ARG E 1 197 ? 22.522  -1.453  83.266  1.00 11.60 ? 425  ARG E CB  1 
ATOM   8557  C CG  . ARG E 1 197 ? 23.464  -2.000  82.191  1.00 11.34 ? 425  ARG E CG  1 
ATOM   8558  C CD  . ARG E 1 197 ? 24.453  -0.987  81.654  1.00 10.65 ? 425  ARG E CD  1 
ATOM   8559  N NE  . ARG E 1 197 ? 25.190  -0.214  82.670  1.00 9.92  ? 425  ARG E NE  1 
ATOM   8560  C CZ  . ARG E 1 197 ? 26.393  -0.506  83.164  1.00 9.69  ? 425  ARG E CZ  1 
ATOM   8561  N NH1 . ARG E 1 197 ? 27.058  -1.598  82.803  1.00 10.39 ? 425  ARG E NH1 1 
ATOM   8562  N NH2 . ARG E 1 197 ? 26.936  0.310   84.051  1.00 9.62  ? 425  ARG E NH2 1 
ATOM   8563  N N   . GLN E 1 198 ? 19.917  -3.060  82.466  1.00 12.16 ? 426  GLN E N   1 
ATOM   8564  C CA  . GLN E 1 198 ? 19.069  -4.032  81.759  1.00 11.98 ? 426  GLN E CA  1 
ATOM   8565  C C   . GLN E 1 198 ? 17.933  -3.364  80.991  1.00 11.99 ? 426  GLN E C   1 
ATOM   8566  O O   . GLN E 1 198 ? 17.739  -3.647  79.810  1.00 11.99 ? 426  GLN E O   1 
ATOM   8567  C CB  . GLN E 1 198 ? 18.492  -5.020  82.780  1.00 12.03 ? 426  GLN E CB  1 
ATOM   8568  C CG  . GLN E 1 198 ? 17.349  -5.921  82.305  1.00 12.28 ? 426  GLN E CG  1 
ATOM   8569  C CD  . GLN E 1 198 ? 17.040  -7.027  83.312  1.00 11.75 ? 426  GLN E CD  1 
ATOM   8570  O OE1 . GLN E 1 198 ? 17.748  -8.008  83.380  1.00 12.05 ? 426  GLN E OE1 1 
ATOM   8571  N NE2 . GLN E 1 198 ? 15.987  -6.860  84.090  1.00 11.24 ? 426  GLN E NE2 1 
ATOM   8572  N N   . THR E 1 199 ? 17.196  -2.487  81.679  1.00 12.01 ? 427  THR E N   1 
ATOM   8573  C CA  . THR E 1 199 ? 16.006  -1.827  81.127  1.00 12.13 ? 427  THR E CA  1 
ATOM   8574  C C   . THR E 1 199 ? 16.402  -0.717  80.163  1.00 12.49 ? 427  THR E C   1 
ATOM   8575  O O   . THR E 1 199 ? 15.705  -0.446  79.184  1.00 12.52 ? 427  THR E O   1 
ATOM   8576  C CB  . THR E 1 199 ? 15.082  -1.246  82.255  1.00 11.93 ? 427  THR E CB  1 
ATOM   8577  O OG1 . THR E 1 199 ? 14.503  -2.322  83.010  1.00 11.95 ? 427  THR E OG1 1 
ATOM   8578  C CG2 . THR E 1 199 ? 13.954  -0.393  81.672  1.00 10.69 ? 427  THR E CG2 1 
ATOM   8579  N N   . SER E 1 200 ? 17.523  -0.073  80.453  1.00 12.82 ? 428  SER E N   1 
ATOM   8580  C CA  . SER E 1 200 ? 18.038  0.975   79.606  1.00 13.07 ? 428  SER E CA  1 
ATOM   8581  C C   . SER E 1 200 ? 18.441  0.398   78.268  1.00 13.54 ? 428  SER E C   1 
ATOM   8582  O O   . SER E 1 200 ? 18.147  0.995   77.229  1.00 13.74 ? 428  SER E O   1 
ATOM   8583  C CB  . SER E 1 200 ? 19.229  1.639   80.263  1.00 13.06 ? 428  SER E CB  1 
ATOM   8584  O OG  . SER E 1 200 ? 19.861  2.518   79.367  1.00 13.56 ? 428  SER E OG  1 
ATOM   8585  N N   . THR E 1 201 ? 19.100  -0.763  78.288  1.00 13.80 ? 429  THR E N   1 
ATOM   8586  C CA  . THR E 1 201 ? 19.392  -1.491  77.045  1.00 14.06 ? 429  THR E CA  1 
ATOM   8587  C C   . THR E 1 201 ? 18.110  -1.878  76.282  1.00 14.29 ? 429  THR E C   1 
ATOM   8588  O O   . THR E 1 201 ? 18.047  -1.713  75.076  1.00 14.54 ? 429  THR E O   1 
ATOM   8589  C CB  . THR E 1 201 ? 20.285  -2.742  77.273  1.00 14.13 ? 429  THR E CB  1 
ATOM   8590  O OG1 . THR E 1 201 ? 21.543  -2.348  77.838  1.00 13.95 ? 429  THR E OG1 1 
ATOM   8591  C CG2 . THR E 1 201 ? 20.545  -3.469  75.960  1.00 13.51 ? 429  THR E CG2 1 
ATOM   8592  N N   . LYS E 1 202 ? 17.091  -2.378  76.966  1.00 14.74 ? 430  LYS E N   1 
ATOM   8593  C CA  . LYS E 1 202 ? 15.823  -2.680  76.286  1.00 15.37 ? 430  LYS E CA  1 
ATOM   8594  C C   . LYS E 1 202 ? 15.330  -1.493  75.471  1.00 15.44 ? 430  LYS E C   1 
ATOM   8595  O O   . LYS E 1 202 ? 15.028  -1.624  74.287  1.00 15.43 ? 430  LYS E O   1 
ATOM   8596  C CB  . LYS E 1 202 ? 14.730  -3.105  77.277  1.00 15.54 ? 430  LYS E CB  1 
ATOM   8597  C CG  . LYS E 1 202 ? 14.488  -4.605  77.283  1.00 16.66 ? 430  LYS E CG  1 
ATOM   8598  C CD  . LYS E 1 202 ? 13.875  -5.077  78.598  1.00 18.12 ? 430  LYS E CD  1 
ATOM   8599  C CE  . LYS E 1 202 ? 14.250  -6.528  78.905  1.00 18.44 ? 430  LYS E CE  1 
ATOM   8600  N NZ  . LYS E 1 202 ? 14.080  -6.797  80.350  1.00 18.91 ? 430  LYS E NZ  1 
ATOM   8601  N N   . ALA E 1 203 ? 15.267  -0.335  76.120  1.00 15.56 ? 431  ALA E N   1 
ATOM   8602  C CA  . ALA E 1 203 ? 14.735  0.867   75.503  1.00 15.71 ? 431  ALA E CA  1 
ATOM   8603  C C   . ALA E 1 203 ? 15.566  1.299   74.285  1.00 15.89 ? 431  ALA E C   1 
ATOM   8604  O O   . ALA E 1 203 ? 15.004  1.623   73.233  1.00 15.96 ? 431  ALA E O   1 
ATOM   8605  C CB  . ALA E 1 203 ? 14.640  2.000   76.541  1.00 15.68 ? 431  ALA E CB  1 
ATOM   8606  N N   . VAL E 1 204 ? 16.892  1.289   74.419  1.00 16.07 ? 432  VAL E N   1 
ATOM   8607  C CA  . VAL E 1 204 ? 17.764  1.711   73.323  1.00 16.35 ? 432  VAL E CA  1 
ATOM   8608  C C   . VAL E 1 204 ? 17.582  0.773   72.139  1.00 17.07 ? 432  VAL E C   1 
ATOM   8609  O O   . VAL E 1 204 ? 17.413  1.224   71.005  1.00 17.38 ? 432  VAL E O   1 
ATOM   8610  C CB  . VAL E 1 204 ? 19.256  1.746   73.724  1.00 16.28 ? 432  VAL E CB  1 
ATOM   8611  C CG1 . VAL E 1 204 ? 20.118  2.090   72.523  1.00 15.97 ? 432  VAL E CG1 1 
ATOM   8612  C CG2 . VAL E 1 204 ? 19.496  2.747   74.842  1.00 15.68 ? 432  VAL E CG2 1 
ATOM   8613  N N   . GLN E 1 205 ? 17.605  -0.530  72.409  1.00 17.79 ? 433  GLN E N   1 
ATOM   8614  C CA  . GLN E 1 205 ? 17.325  -1.538  71.391  1.00 18.46 ? 433  GLN E CA  1 
ATOM   8615  C C   . GLN E 1 205 ? 15.893  -1.399  70.824  1.00 18.87 ? 433  GLN E C   1 
ATOM   8616  O O   . GLN E 1 205 ? 15.675  -1.568  69.623  1.00 18.86 ? 433  GLN E O   1 
ATOM   8617  C CB  . GLN E 1 205 ? 17.552  -2.938  71.970  1.00 18.53 ? 433  GLN E CB  1 
ATOM   8618  C CG  . GLN E 1 205 ? 17.315  -4.081  70.988  1.00 20.03 ? 433  GLN E CG  1 
ATOM   8619  C CD  . GLN E 1 205 ? 18.082  -3.919  69.668  1.00 21.72 ? 433  GLN E CD  1 
ATOM   8620  O OE1 . GLN E 1 205 ? 17.515  -4.088  68.578  1.00 21.47 ? 433  GLN E OE1 1 
ATOM   8621  N NE2 . GLN E 1 205 ? 19.375  -3.583  69.764  1.00 22.52 ? 433  GLN E NE2 1 
ATOM   8622  N N   . HIS E 1 206 ? 14.922  -1.079  71.676  1.00 19.34 ? 434  HIS E N   1 
ATOM   8623  C CA  . HIS E 1 206 ? 13.556  -0.892  71.209  1.00 19.84 ? 434  HIS E CA  1 
ATOM   8624  C C   . HIS E 1 206 ? 13.426  0.320   70.306  1.00 20.53 ? 434  HIS E C   1 
ATOM   8625  O O   . HIS E 1 206 ? 12.619  0.319   69.372  1.00 20.50 ? 434  HIS E O   1 
ATOM   8626  C CB  . HIS E 1 206 ? 12.591  -0.722  72.368  1.00 19.89 ? 434  HIS E CB  1 
ATOM   8627  C CG  . HIS E 1 206 ? 11.163  -0.673  71.935  1.00 20.28 ? 434  HIS E CG  1 
ATOM   8628  N ND1 . HIS E 1 206 ? 10.354  -1.788  71.919  1.00 21.30 ? 434  HIS E ND1 1 
ATOM   8629  C CD2 . HIS E 1 206 ? 10.411  0.345   71.458  1.00 20.79 ? 434  HIS E CD2 1 
ATOM   8630  C CE1 . HIS E 1 206 ? 9.157   -1.454  71.472  1.00 21.41 ? 434  HIS E CE1 1 
ATOM   8631  N NE2 . HIS E 1 206 ? 9.165   -0.164  71.185  1.00 21.71 ? 434  HIS E NE2 1 
ATOM   8632  N N   . PHE E 1 207 ? 14.197  1.363   70.607  1.00 21.44 ? 435  PHE E N   1 
ATOM   8633  C CA  . PHE E 1 207 ? 14.165  2.594   69.819  1.00 22.11 ? 435  PHE E CA  1 
ATOM   8634  C C   . PHE E 1 207 ? 14.743  2.360   68.418  1.00 23.03 ? 435  PHE E C   1 
ATOM   8635  O O   . PHE E 1 207 ? 14.101  2.688   67.411  1.00 22.92 ? 435  PHE E O   1 
ATOM   8636  C CB  . PHE E 1 207 ? 14.898  3.739   70.536  1.00 21.89 ? 435  PHE E CB  1 
ATOM   8637  C CG  . PHE E 1 207 ? 15.086  4.954   69.683  1.00 21.57 ? 435  PHE E CG  1 
ATOM   8638  C CD1 . PHE E 1 207 ? 13.991  5.647   69.197  1.00 21.35 ? 435  PHE E CD1 1 
ATOM   8639  C CD2 . PHE E 1 207 ? 16.357  5.389   69.338  1.00 21.85 ? 435  PHE E CD2 1 
ATOM   8640  C CE1 . PHE E 1 207 ? 14.159  6.760   68.388  1.00 21.33 ? 435  PHE E CE1 1 
ATOM   8641  C CE2 . PHE E 1 207 ? 16.534  6.504   68.530  1.00 21.79 ? 435  PHE E CE2 1 
ATOM   8642  C CZ  . PHE E 1 207 ? 15.432  7.189   68.055  1.00 21.40 ? 435  PHE E CZ  1 
ATOM   8643  N N   . TYR E 1 208 ? 15.937  1.776   68.345  1.00 24.25 ? 436  TYR E N   1 
ATOM   8644  C CA  . TYR E 1 208 ? 16.527  1.460   67.034  1.00 25.34 ? 436  TYR E CA  1 
ATOM   8645  C C   . TYR E 1 208 ? 15.702  0.394   66.293  1.00 25.50 ? 436  TYR E C   1 
ATOM   8646  O O   . TYR E 1 208 ? 15.676  0.392   65.073  1.00 25.75 ? 436  TYR E O   1 
ATOM   8647  C CB  . TYR E 1 208 ? 18.029  1.090   67.132  1.00 26.05 ? 436  TYR E CB  1 
ATOM   8648  C CG  . TYR E 1 208 ? 18.902  2.179   67.781  1.00 27.08 ? 436  TYR E CG  1 
ATOM   8649  C CD1 . TYR E 1 208 ? 18.670  3.545   67.538  1.00 28.21 ? 436  TYR E CD1 1 
ATOM   8650  C CD2 . TYR E 1 208 ? 19.961  1.843   68.629  1.00 27.54 ? 436  TYR E CD2 1 
ATOM   8651  C CE1 . TYR E 1 208 ? 19.465  4.545   68.144  1.00 28.72 ? 436  TYR E CE1 1 
ATOM   8652  C CE2 . TYR E 1 208 ? 20.761  2.835   69.237  1.00 27.88 ? 436  TYR E CE2 1 
ATOM   8653  C CZ  . TYR E 1 208 ? 20.510  4.181   68.993  1.00 28.14 ? 436  TYR E CZ  1 
ATOM   8654  O OH  . TYR E 1 208 ? 21.292  5.164   69.592  1.00 28.00 ? 436  TYR E OH  1 
ATOM   8655  N N   . ASN E 1 209 ? 14.999  -0.474  67.020  1.00 25.84 ? 437  ASN E N   1 
ATOM   8656  C CA  . ASN E 1 209 ? 14.065  -1.414  66.389  1.00 26.23 ? 437  ASN E CA  1 
ATOM   8657  C C   . ASN E 1 209 ? 12.937  -0.718  65.629  1.00 26.83 ? 437  ASN E C   1 
ATOM   8658  O O   . ASN E 1 209 ? 12.722  -0.992  64.447  1.00 26.90 ? 437  ASN E O   1 
ATOM   8659  C CB  . ASN E 1 209 ? 13.461  -2.380  67.416  1.00 26.22 ? 437  ASN E CB  1 
ATOM   8660  C CG  . ASN E 1 209 ? 14.315  -3.616  67.638  1.00 26.02 ? 437  ASN E CG  1 
ATOM   8661  O OD1 . ASN E 1 209 ? 15.250  -3.889  66.886  1.00 25.59 ? 437  ASN E OD1 1 
ATOM   8662  N ND2 . ASN E 1 209 ? 13.991  -4.373  68.677  1.00 25.63 ? 437  ASN E ND2 1 
ATOM   8663  N N   . ILE E 1 210 ? 12.215  0.181   66.291  1.00 27.59 ? 438  ILE E N   1 
ATOM   8664  C CA  . ILE E 1 210 ? 11.128  0.906   65.603  1.00 28.37 ? 438  ILE E CA  1 
ATOM   8665  C C   . ILE E 1 210 ? 11.602  2.118   64.787  1.00 29.29 ? 438  ILE E C   1 
ATOM   8666  O O   . ILE E 1 210 ? 10.773  2.894   64.304  1.00 29.28 ? 438  ILE E O   1 
ATOM   8667  C CB  . ILE E 1 210 ? 9.930   1.296   66.535  1.00 28.24 ? 438  ILE E CB  1 
ATOM   8668  C CG1 . ILE E 1 210 ? 10.372  2.176   67.715  1.00 28.24 ? 438  ILE E CG1 1 
ATOM   8669  C CG2 . ILE E 1 210 ? 9.200   0.040   66.998  1.00 28.37 ? 438  ILE E CG2 1 
ATOM   8670  C CD1 . ILE E 1 210 ? 10.181  3.668   67.488  1.00 27.50 ? 438  ILE E CD1 1 
ATOM   8671  N N   . LYS E 1 211 ? 12.917  2.284   64.625  1.00 30.63 ? 439  LYS E N   1 
ATOM   8672  C CA  . LYS E 1 211 ? 13.437  3.177   63.580  1.00 31.54 ? 439  LYS E CA  1 
ATOM   8673  C C   . LYS E 1 211 ? 13.230  2.495   62.222  1.00 32.55 ? 439  LYS E C   1 
ATOM   8674  O O   . LYS E 1 211 ? 12.527  3.037   61.357  1.00 32.66 ? 439  LYS E O   1 
ATOM   8675  C CB  . LYS E 1 211 ? 14.912  3.542   63.808  1.00 31.53 ? 439  LYS E CB  1 
ATOM   8676  C CG  . LYS E 1 211 ? 15.113  4.826   64.605  1.00 31.13 ? 439  LYS E CG  1 
ATOM   8677  N N   . LEU E 1 212 ? 13.824  1.308   62.054  1.00 33.65 ? 440  LEU E N   1 
ATOM   8678  C CA  . LEU E 1 212 ? 13.571  0.453   60.875  1.00 34.59 ? 440  LEU E CA  1 
ATOM   8679  C C   . LEU E 1 212 ? 12.060  0.426   60.557  1.00 35.54 ? 440  LEU E C   1 
ATOM   8680  O O   . LEU E 1 212 ? 11.627  0.915   59.497  1.00 35.83 ? 440  LEU E O   1 
ATOM   8681  C CB  . LEU E 1 212 ? 14.086  -0.988  61.095  1.00 34.61 ? 440  LEU E CB  1 
ATOM   8682  C CG  . LEU E 1 212 ? 15.408  -1.240  61.839  1.00 34.59 ? 440  LEU E CG  1 
ATOM   8683  C CD1 . LEU E 1 212 ? 15.682  -2.740  61.913  1.00 34.31 ? 440  LEU E CD1 1 
ATOM   8684  C CD2 . LEU E 1 212 ? 16.585  -0.505  61.184  1.00 34.20 ? 440  LEU E CD2 1 
ATOM   8685  N N   . GLU E 1 213 ? 11.276  -0.119  61.497  1.00 36.27 ? 441  GLU E N   1 
ATOM   8686  C CA  . GLU E 1 213 ? 9.804   -0.075  61.445  1.00 36.93 ? 441  GLU E CA  1 
ATOM   8687  C C   . GLU E 1 213 ? 9.298   1.374   61.565  1.00 36.84 ? 441  GLU E C   1 
ATOM   8688  O O   . GLU E 1 213 ? 8.297   1.760   60.951  1.00 36.76 ? 441  GLU E O   1 
ATOM   8689  C CB  . GLU E 1 213 ? 9.208   -0.957  62.564  1.00 36.97 ? 441  GLU E CB  1 
ATOM   8690  C CG  . GLU E 1 213 ? 7.709   -0.751  62.850  1.00 37.63 ? 441  GLU E CG  1 
ATOM   8691  C CD  . GLU E 1 213 ? 7.181   -1.638  63.983  1.00 38.17 ? 441  GLU E CD  1 
ATOM   8692  O OE1 . GLU E 1 213 ? 7.970   -1.993  64.902  1.00 39.75 ? 441  GLU E OE1 1 
ATOM   8693  O OE2 . GLU E 1 213 ? 5.966   -1.967  63.956  1.00 39.25 ? 441  GLU E OE2 1 
ATOM   8694  N N   . PRO F 1 5   ? 104.369 -17.246 94.671  1.00 29.14 ? 233  PRO F N   1 
ATOM   8695  C CA  . PRO F 1 5   ? 104.991 -18.583 94.715  1.00 29.08 ? 233  PRO F CA  1 
ATOM   8696  C C   . PRO F 1 5   ? 104.760 -19.264 96.067  1.00 28.85 ? 233  PRO F C   1 
ATOM   8697  O O   . PRO F 1 5   ? 104.645 -20.489 96.134  1.00 28.86 ? 233  PRO F O   1 
ATOM   8698  C CB  . PRO F 1 5   ? 106.463 -18.288 94.426  1.00 29.07 ? 233  PRO F CB  1 
ATOM   8699  C CG  . PRO F 1 5   ? 106.388 -17.080 93.522  1.00 29.11 ? 233  PRO F CG  1 
ATOM   8700  C CD  . PRO F 1 5   ? 105.285 -16.237 94.110  1.00 29.11 ? 233  PRO F CD  1 
ATOM   8701  N N   . TYR F 1 6   ? 104.788 -18.459 97.127  1.00 28.46 ? 234  TYR F N   1 
ATOM   8702  C CA  . TYR F 1 6   ? 103.641 -18.365 98.056  1.00 28.18 ? 234  TYR F CA  1 
ATOM   8703  C C   . TYR F 1 6   ? 103.859 -17.575 99.348  1.00 27.00 ? 234  TYR F C   1 
ATOM   8704  O O   . TYR F 1 6   ? 104.986 -17.228 99.720  1.00 27.02 ? 234  TYR F O   1 
ATOM   8705  C CB  . TYR F 1 6   ? 102.844 -19.687 98.274  1.00 29.11 ? 234  TYR F CB  1 
ATOM   8706  C CG  . TYR F 1 6   ? 103.460 -20.823 99.075  1.00 30.24 ? 234  TYR F CG  1 
ATOM   8707  C CD1 . TYR F 1 6   ? 104.198 -20.596 100.240 1.00 31.37 ? 234  TYR F CD1 1 
ATOM   8708  C CD2 . TYR F 1 6   ? 103.215 -22.151 98.699  1.00 31.25 ? 234  TYR F CD2 1 
ATOM   8709  C CE1 . TYR F 1 6   ? 104.728 -21.670 100.978 1.00 32.07 ? 234  TYR F CE1 1 
ATOM   8710  C CE2 . TYR F 1 6   ? 103.734 -23.225 99.424  1.00 31.59 ? 234  TYR F CE2 1 
ATOM   8711  C CZ  . TYR F 1 6   ? 104.491 -22.981 100.560 1.00 31.72 ? 234  TYR F CZ  1 
ATOM   8712  O OH  . TYR F 1 6   ? 105.008 -24.041 101.274 1.00 31.30 ? 234  TYR F OH  1 
ATOM   8713  N N   . ASN F 1 7   ? 102.729 -17.286 99.988  1.00 25.50 ? 235  ASN F N   1 
ATOM   8714  C CA  . ASN F 1 7   ? 102.610 -16.309 101.064 1.00 24.59 ? 235  ASN F CA  1 
ATOM   8715  C C   . ASN F 1 7   ? 103.454 -16.604 102.320 1.00 23.38 ? 235  ASN F C   1 
ATOM   8716  O O   . ASN F 1 7   ? 103.885 -17.737 102.545 1.00 23.31 ? 235  ASN F O   1 
ATOM   8717  C CB  . ASN F 1 7   ? 101.111 -16.137 101.398 1.00 24.72 ? 235  ASN F CB  1 
ATOM   8718  C CG  . ASN F 1 7   ? 100.844 -15.958 102.881 1.00 25.92 ? 235  ASN F CG  1 
ATOM   8719  O OD1 . ASN F 1 7   ? 101.289 -16.764 103.699 1.00 27.57 ? 235  ASN F OD1 1 
ATOM   8720  N ND2 . ASN F 1 7   ? 100.109 -14.904 103.237 1.00 27.08 ? 235  ASN F ND2 1 
ATOM   8721  N N   . LYS F 1 8   ? 103.664 -15.565 103.127 1.00 22.01 ? 236  LYS F N   1 
ATOM   8722  C CA  . LYS F 1 8   ? 104.504 -15.628 104.330 1.00 21.16 ? 236  LYS F CA  1 
ATOM   8723  C C   . LYS F 1 8   ? 103.827 -16.319 105.530 1.00 20.12 ? 236  LYS F C   1 
ATOM   8724  O O   . LYS F 1 8   ? 104.458 -17.098 106.249 1.00 20.00 ? 236  LYS F O   1 
ATOM   8725  C CB  . LYS F 1 8   ? 104.923 -14.199 104.707 1.00 21.31 ? 236  LYS F CB  1 
ATOM   8726  C CG  . LYS F 1 8   ? 105.842 -14.062 105.916 1.00 21.58 ? 236  LYS F CG  1 
ATOM   8727  C CD  . LYS F 1 8   ? 107.301 -13.836 105.534 1.00 21.83 ? 236  LYS F CD  1 
ATOM   8728  C CE  . LYS F 1 8   ? 108.118 -13.436 106.768 1.00 21.32 ? 236  LYS F CE  1 
ATOM   8729  N NZ  . LYS F 1 8   ? 109.469 -12.970 106.408 1.00 21.25 ? 236  LYS F NZ  1 
ATOM   8730  N N   . ILE F 1 9   ? 102.553 -16.023 105.756 1.00 19.06 ? 237  ILE F N   1 
ATOM   8731  C CA  . ILE F 1 9   ? 101.814 -16.630 106.881 1.00 18.35 ? 237  ILE F CA  1 
ATOM   8732  C C   . ILE F 1 9   ? 101.553 -18.135 106.714 1.00 18.00 ? 237  ILE F C   1 
ATOM   8733  O O   . ILE F 1 9   ? 101.530 -18.871 107.701 1.00 17.98 ? 237  ILE F O   1 
ATOM   8734  C CB  . ILE F 1 9   ? 100.489 -15.874 107.171 1.00 18.14 ? 237  ILE F CB  1 
ATOM   8735  C CG1 . ILE F 1 9   ? 100.809 -14.558 107.878 1.00 18.07 ? 237  ILE F CG1 1 
ATOM   8736  C CG2 . ILE F 1 9   ? 99.560  -16.702 108.035 1.00 16.91 ? 237  ILE F CG2 1 
ATOM   8737  C CD1 . ILE F 1 9   ? 99.613  -13.732 108.187 1.00 18.38 ? 237  ILE F CD1 1 
ATOM   8738  N N   . VAL F 1 10  ? 101.371 -18.595 105.479 1.00 17.51 ? 238  VAL F N   1 
ATOM   8739  C CA  . VAL F 1 10  ? 101.229 -20.029 105.214 1.00 17.14 ? 238  VAL F CA  1 
ATOM   8740  C C   . VAL F 1 10  ? 102.542 -20.785 105.479 1.00 16.93 ? 238  VAL F C   1 
ATOM   8741  O O   . VAL F 1 10  ? 102.539 -21.834 106.127 1.00 16.53 ? 238  VAL F O   1 
ATOM   8742  C CB  . VAL F 1 10  ? 100.742 -20.305 103.771 1.00 17.15 ? 238  VAL F CB  1 
ATOM   8743  C CG1 . VAL F 1 10  ? 101.088 -21.731 103.354 1.00 17.25 ? 238  VAL F CG1 1 
ATOM   8744  C CG2 . VAL F 1 10  ? 99.234  -20.064 103.657 1.00 16.89 ? 238  VAL F CG2 1 
ATOM   8745  N N   . SER F 1 11  ? 103.655 -20.244 104.980 1.00 16.86 ? 239  SER F N   1 
ATOM   8746  C CA  . SER F 1 11  ? 104.973 -20.832 105.217 1.00 16.81 ? 239  SER F CA  1 
ATOM   8747  C C   . SER F 1 11  ? 105.192 -21.035 106.702 1.00 16.71 ? 239  SER F C   1 
ATOM   8748  O O   . SER F 1 11  ? 105.594 -22.117 107.128 1.00 16.73 ? 239  SER F O   1 
ATOM   8749  C CB  . SER F 1 11  ? 106.084 -19.938 104.673 1.00 16.88 ? 239  SER F CB  1 
ATOM   8750  O OG  . SER F 1 11  ? 105.902 -19.673 103.295 1.00 17.39 ? 239  SER F OG  1 
ATOM   8751  N N   . HIS F 1 12  ? 104.899 -19.998 107.486 1.00 16.62 ? 240  HIS F N   1 
ATOM   8752  C CA  . HIS F 1 12  ? 105.126 -20.043 108.933 1.00 16.80 ? 240  HIS F CA  1 
ATOM   8753  C C   . HIS F 1 12  ? 104.353 -21.166 109.626 1.00 16.33 ? 240  HIS F C   1 
ATOM   8754  O O   . HIS F 1 12  ? 104.898 -21.855 110.489 1.00 16.24 ? 240  HIS F O   1 
ATOM   8755  C CB  . HIS F 1 12  ? 104.777 -18.702 109.581 1.00 17.39 ? 240  HIS F CB  1 
ATOM   8756  C CG  . HIS F 1 12  ? 105.425 -18.495 110.917 1.00 19.22 ? 240  HIS F CG  1 
ATOM   8757  N ND1 . HIS F 1 12  ? 106.673 -17.916 111.058 1.00 21.21 ? 240  HIS F ND1 1 
ATOM   8758  C CD2 . HIS F 1 12  ? 105.005 -18.801 112.170 1.00 20.70 ? 240  HIS F CD2 1 
ATOM   8759  C CE1 . HIS F 1 12  ? 106.991 -17.874 112.343 1.00 22.08 ? 240  HIS F CE1 1 
ATOM   8760  N NE2 . HIS F 1 12  ? 105.998 -18.405 113.039 1.00 21.80 ? 240  HIS F NE2 1 
ATOM   8761  N N   . LEU F 1 13  ? 103.092 -21.345 109.235 1.00 15.94 ? 241  LEU F N   1 
ATOM   8762  C CA  . LEU F 1 13  ? 102.229 -22.368 109.815 1.00 15.51 ? 241  LEU F CA  1 
ATOM   8763  C C   . LEU F 1 13  ? 102.709 -23.799 109.507 1.00 15.66 ? 241  LEU F C   1 
ATOM   8764  O O   . LEU F 1 13  ? 102.622 -24.681 110.369 1.00 15.67 ? 241  LEU F O   1 
ATOM   8765  C CB  . LEU F 1 13  ? 100.789 -22.180 109.331 1.00 15.37 ? 241  LEU F CB  1 
ATOM   8766  C CG  . LEU F 1 13  ? 100.017 -20.936 109.802 1.00 14.89 ? 241  LEU F CG  1 
ATOM   8767  C CD1 . LEU F 1 13  ? 98.687  -20.796 109.030 1.00 13.92 ? 241  LEU F CD1 1 
ATOM   8768  C CD2 . LEU F 1 13  ? 99.760  -20.945 111.313 1.00 13.15 ? 241  LEU F CD2 1 
ATOM   8769  N N   . LEU F 1 14  ? 103.211 -24.022 108.288 1.00 15.62 ? 242  LEU F N   1 
ATOM   8770  C CA  . LEU F 1 14  ? 103.755 -25.330 107.884 1.00 15.55 ? 242  LEU F CA  1 
ATOM   8771  C C   . LEU F 1 14  ? 104.902 -25.759 108.786 1.00 15.93 ? 242  LEU F C   1 
ATOM   8772  O O   . LEU F 1 14  ? 104.943 -26.900 109.267 1.00 16.03 ? 242  LEU F O   1 
ATOM   8773  C CB  . LEU F 1 14  ? 104.292 -25.288 106.450 1.00 15.27 ? 242  LEU F CB  1 
ATOM   8774  C CG  . LEU F 1 14  ? 103.309 -24.989 105.324 1.00 14.70 ? 242  LEU F CG  1 
ATOM   8775  C CD1 . LEU F 1 14  ? 104.066 -24.841 104.022 1.00 13.58 ? 242  LEU F CD1 1 
ATOM   8776  C CD2 . LEU F 1 14  ? 102.236 -26.057 105.225 1.00 12.79 ? 242  LEU F CD2 1 
ATOM   8777  N N   . VAL F 1 15  ? 105.838 -24.833 108.995 1.00 16.21 ? 243  VAL F N   1 
ATOM   8778  C CA  . VAL F 1 15  ? 107.020 -25.084 109.824 1.00 16.14 ? 243  VAL F CA  1 
ATOM   8779  C C   . VAL F 1 15  ? 106.630 -25.128 111.299 1.00 16.29 ? 243  VAL F C   1 
ATOM   8780  O O   . VAL F 1 15  ? 107.343 -25.721 112.099 1.00 16.45 ? 243  VAL F O   1 
ATOM   8781  C CB  . VAL F 1 15  ? 108.152 -24.025 109.598 1.00 16.06 ? 243  VAL F CB  1 
ATOM   8782  C CG1 . VAL F 1 15  ? 108.169 -23.543 108.144 1.00 15.27 ? 243  VAL F CG1 1 
ATOM   8783  C CG2 . VAL F 1 15  ? 108.010 -22.843 110.555 1.00 15.87 ? 243  VAL F CG2 1 
ATOM   8784  N N   . ALA F 1 16  ? 105.503 -24.501 111.644 1.00 16.40 ? 244  ALA F N   1 
ATOM   8785  C CA  . ALA F 1 16  ? 104.981 -24.499 113.014 1.00 16.73 ? 244  ALA F CA  1 
ATOM   8786  C C   . ALA F 1 16  ? 104.094 -25.712 113.336 1.00 17.02 ? 244  ALA F C   1 
ATOM   8787  O O   . ALA F 1 16  ? 103.607 -25.852 114.457 1.00 16.87 ? 244  ALA F O   1 
ATOM   8788  C CB  . ALA F 1 16  ? 104.201 -23.213 113.266 1.00 16.74 ? 244  ALA F CB  1 
ATOM   8789  N N   . GLU F 1 17  ? 103.877 -26.579 112.354 1.00 17.39 ? 245  GLU F N   1 
ATOM   8790  C CA  . GLU F 1 17  ? 103.008 -27.739 112.522 1.00 17.61 ? 245  GLU F CA  1 
ATOM   8791  C C   . GLU F 1 17  ? 103.672 -28.731 113.479 1.00 17.88 ? 245  GLU F C   1 
ATOM   8792  O O   . GLU F 1 17  ? 104.819 -29.105 113.260 1.00 17.93 ? 245  GLU F O   1 
ATOM   8793  C CB  . GLU F 1 17  ? 102.747 -28.373 111.147 1.00 17.48 ? 245  GLU F CB  1 
ATOM   8794  C CG  . GLU F 1 17  ? 101.710 -29.482 111.102 1.00 17.92 ? 245  GLU F CG  1 
ATOM   8795  C CD  . GLU F 1 17  ? 100.293 -29.043 111.477 1.00 18.82 ? 245  GLU F CD  1 
ATOM   8796  O OE1 . GLU F 1 17  ? 100.038 -27.836 111.700 1.00 19.96 ? 245  GLU F OE1 1 
ATOM   8797  O OE2 . GLU F 1 17  ? 99.422  -29.933 111.551 1.00 18.59 ? 245  GLU F OE2 1 
ATOM   8798  N N   . PRO F 1 18  ? 102.966 -29.155 114.553 1.00 18.34 ? 246  PRO F N   1 
ATOM   8799  C CA  . PRO F 1 18  ? 103.605 -30.066 115.519 1.00 18.49 ? 246  PRO F CA  1 
ATOM   8800  C C   . PRO F 1 18  ? 103.987 -31.395 114.883 1.00 18.84 ? 246  PRO F C   1 
ATOM   8801  O O   . PRO F 1 18  ? 103.448 -31.752 113.834 1.00 18.96 ? 246  PRO F O   1 
ATOM   8802  C CB  . PRO F 1 18  ? 102.527 -30.302 116.586 1.00 18.33 ? 246  PRO F CB  1 
ATOM   8803  C CG  . PRO F 1 18  ? 101.444 -29.353 116.313 1.00 18.41 ? 246  PRO F CG  1 
ATOM   8804  C CD  . PRO F 1 18  ? 101.568 -28.856 114.912 1.00 18.35 ? 246  PRO F CD  1 
ATOM   8805  N N   . GLU F 1 19  ? 104.902 -32.125 115.511 1.00 19.15 ? 247  GLU F N   1 
ATOM   8806  C CA  . GLU F 1 19  ? 105.267 -33.453 115.019 1.00 19.44 ? 247  GLU F CA  1 
ATOM   8807  C C   . GLU F 1 19  ? 104.189 -34.493 115.364 1.00 19.27 ? 247  GLU F C   1 
ATOM   8808  O O   . GLU F 1 19  ? 103.230 -34.201 116.100 1.00 19.44 ? 247  GLU F O   1 
ATOM   8809  C CB  . GLU F 1 19  ? 106.647 -33.885 115.548 1.00 19.71 ? 247  GLU F CB  1 
ATOM   8810  C CG  . GLU F 1 19  ? 107.822 -33.355 114.724 1.00 20.71 ? 247  GLU F CG  1 
ATOM   8811  C CD  . GLU F 1 19  ? 107.997 -34.063 113.367 1.00 22.21 ? 247  GLU F CD  1 
ATOM   8812  O OE1 . GLU F 1 19  ? 106.986 -34.453 112.733 1.00 22.20 ? 247  GLU F OE1 1 
ATOM   8813  O OE2 . GLU F 1 19  ? 109.162 -34.224 112.927 1.00 23.77 ? 247  GLU F OE2 1 
ATOM   8814  N N   . LYS F 1 20  ? 104.344 -35.698 114.812 1.00 18.88 ? 248  LYS F N   1 
ATOM   8815  C CA  . LYS F 1 20  ? 103.399 -36.789 115.051 1.00 18.50 ? 248  LYS F CA  1 
ATOM   8816  C C   . LYS F 1 20  ? 103.367 -37.175 116.522 1.00 18.16 ? 248  LYS F C   1 
ATOM   8817  O O   . LYS F 1 20  ? 104.406 -37.264 117.169 1.00 17.81 ? 248  LYS F O   1 
ATOM   8818  C CB  . LYS F 1 20  ? 103.741 -38.017 114.206 1.00 18.39 ? 248  LYS F CB  1 
ATOM   8819  C CG  . LYS F 1 20  ? 103.654 -37.778 112.726 1.00 18.43 ? 248  LYS F CG  1 
ATOM   8820  C CD  . LYS F 1 20  ? 103.618 -39.075 111.943 1.00 18.83 ? 248  LYS F CD  1 
ATOM   8821  C CE  . LYS F 1 20  ? 103.681 -38.793 110.441 1.00 19.19 ? 248  LYS F CE  1 
ATOM   8822  N NZ  . LYS F 1 20  ? 103.051 -39.858 109.615 1.00 19.42 ? 248  LYS F NZ  1 
ATOM   8823  N N   . ILE F 1 21  ? 102.157 -37.381 117.035 1.00 17.98 ? 249  ILE F N   1 
ATOM   8824  C CA  . ILE F 1 21  ? 101.930 -37.850 118.401 1.00 17.76 ? 249  ILE F CA  1 
ATOM   8825  C C   . ILE F 1 21  ? 101.217 -39.204 118.325 1.00 17.65 ? 249  ILE F C   1 
ATOM   8826  O O   . ILE F 1 21  ? 100.335 -39.408 117.484 1.00 17.64 ? 249  ILE F O   1 
ATOM   8827  C CB  . ILE F 1 21  ? 101.102 -36.817 119.201 1.00 17.77 ? 249  ILE F CB  1 
ATOM   8828  C CG1 . ILE F 1 21  ? 101.979 -35.618 119.564 1.00 17.82 ? 249  ILE F CG1 1 
ATOM   8829  C CG2 . ILE F 1 21  ? 100.525 -37.420 120.467 1.00 17.61 ? 249  ILE F CG2 1 
ATOM   8830  C CD1 . ILE F 1 21  ? 101.191 -34.375 119.919 1.00 17.65 ? 249  ILE F CD1 1 
ATOM   8831  N N   . TYR F 1 22  ? 101.606 -40.126 119.200 1.00 17.58 ? 250  TYR F N   1 
ATOM   8832  C CA  . TYR F 1 22  ? 101.125 -41.507 119.138 1.00 17.50 ? 250  TYR F CA  1 
ATOM   8833  C C   . TYR F 1 22  ? 100.213 -41.846 120.308 1.00 17.08 ? 250  TYR F C   1 
ATOM   8834  O O   . TYR F 1 22  ? 100.455 -41.409 121.424 1.00 17.18 ? 250  TYR F O   1 
ATOM   8835  C CB  . TYR F 1 22  ? 102.316 -42.450 119.122 1.00 17.87 ? 250  TYR F CB  1 
ATOM   8836  C CG  . TYR F 1 22  ? 103.087 -42.410 117.830 1.00 18.35 ? 250  TYR F CG  1 
ATOM   8837  C CD1 . TYR F 1 22  ? 104.094 -41.473 117.621 1.00 18.71 ? 250  TYR F CD1 1 
ATOM   8838  C CD2 . TYR F 1 22  ? 102.812 -43.317 116.816 1.00 19.05 ? 250  TYR F CD2 1 
ATOM   8839  C CE1 . TYR F 1 22  ? 104.806 -41.440 116.426 1.00 19.05 ? 250  TYR F CE1 1 
ATOM   8840  C CE2 . TYR F 1 22  ? 103.517 -43.299 115.621 1.00 19.35 ? 250  TYR F CE2 1 
ATOM   8841  C CZ  . TYR F 1 22  ? 104.510 -42.360 115.428 1.00 19.34 ? 250  TYR F CZ  1 
ATOM   8842  O OH  . TYR F 1 22  ? 105.199 -42.353 114.234 1.00 19.59 ? 250  TYR F OH  1 
ATOM   8843  N N   . ALA F 1 23  ? 99.173  -42.631 120.046 1.00 16.59 ? 251  ALA F N   1 
ATOM   8844  C CA  . ALA F 1 23  ? 98.195  -43.004 121.074 1.00 16.35 ? 251  ALA F CA  1 
ATOM   8845  C C   . ALA F 1 23  ? 98.768  -43.907 122.168 1.00 16.14 ? 251  ALA F C   1 
ATOM   8846  O O   . ALA F 1 23  ? 98.374  -43.802 123.327 1.00 16.09 ? 251  ALA F O   1 
ATOM   8847  C CB  . ALA F 1 23  ? 96.993  -43.676 120.434 1.00 16.27 ? 251  ALA F CB  1 
ATOM   8848  N N   . MET F 1 24  ? 99.691  -44.788 121.781 1.00 16.13 ? 252  MET F N   1 
ATOM   8849  C CA  . MET F 1 24  ? 100.281 -45.814 122.658 1.00 15.97 ? 252  MET F CA  1 
ATOM   8850  C C   . MET F 1 24  ? 99.267  -46.425 123.648 1.00 15.70 ? 252  MET F C   1 
ATOM   8851  O O   . MET F 1 24  ? 99.360  -46.224 124.860 1.00 15.43 ? 252  MET F O   1 
ATOM   8852  C CB  . MET F 1 24  ? 101.550 -45.283 123.348 1.00 15.88 ? 252  MET F CB  1 
ATOM   8853  C CG  . MET F 1 24  ? 102.660 -44.938 122.335 1.00 16.24 ? 252  MET F CG  1 
ATOM   8854  S SD  . MET F 1 24  ? 104.333 -44.550 122.940 1.00 16.61 ? 252  MET F SD  1 
ATOM   8855  C CE  . MET F 1 24  ? 104.949 -46.188 123.320 1.00 16.36 ? 252  MET F CE  1 
ATOM   8856  N N   . PRO F 1 25  ? 98.280  -47.165 123.112 1.00 15.52 ? 253  PRO F N   1 
ATOM   8857  C CA  . PRO F 1 25  ? 97.355  -47.933 123.928 1.00 15.63 ? 253  PRO F CA  1 
ATOM   8858  C C   . PRO F 1 25  ? 98.040  -49.133 124.595 1.00 15.86 ? 253  PRO F C   1 
ATOM   8859  O O   . PRO F 1 25  ? 98.932  -49.743 124.002 1.00 15.99 ? 253  PRO F O   1 
ATOM   8860  C CB  . PRO F 1 25  ? 96.315  -48.405 122.912 1.00 15.62 ? 253  PRO F CB  1 
ATOM   8861  C CG  . PRO F 1 25  ? 97.029  -48.432 121.629 1.00 15.57 ? 253  PRO F CG  1 
ATOM   8862  C CD  . PRO F 1 25  ? 97.979  -47.300 121.675 1.00 15.48 ? 253  PRO F CD  1 
ATOM   8863  N N   . ASP F 1 26  ? 97.623  -49.459 125.820 1.00 15.90 ? 254  ASP F N   1 
ATOM   8864  C CA  . ASP F 1 26  ? 98.234  -50.536 126.610 1.00 15.72 ? 254  ASP F CA  1 
ATOM   8865  C C   . ASP F 1 26  ? 97.810  -51.887 126.044 1.00 15.60 ? 254  ASP F C   1 
ATOM   8866  O O   . ASP F 1 26  ? 96.644  -52.262 126.149 1.00 15.47 ? 254  ASP F O   1 
ATOM   8867  C CB  . ASP F 1 26  ? 97.786  -50.424 128.072 1.00 15.90 ? 254  ASP F CB  1 
ATOM   8868  C CG  . ASP F 1 26  ? 98.614  -51.274 129.023 1.00 16.06 ? 254  ASP F CG  1 
ATOM   8869  O OD1 . ASP F 1 26  ? 99.371  -52.168 128.581 1.00 16.79 ? 254  ASP F OD1 1 
ATOM   8870  O OD2 . ASP F 1 26  ? 98.495  -51.034 130.242 1.00 16.29 ? 254  ASP F OD2 1 
ATOM   8871  N N   . PRO F 1 27  ? 98.753  -52.635 125.448 1.00 15.58 ? 255  PRO F N   1 
ATOM   8872  C CA  . PRO F 1 27  ? 98.334  -53.874 124.790 1.00 15.50 ? 255  PRO F CA  1 
ATOM   8873  C C   . PRO F 1 27  ? 97.705  -54.912 125.738 1.00 15.57 ? 255  PRO F C   1 
ATOM   8874  O O   . PRO F 1 27  ? 96.820  -55.657 125.316 1.00 15.21 ? 255  PRO F O   1 
ATOM   8875  C CB  . PRO F 1 27  ? 99.635  -54.402 124.171 1.00 15.44 ? 255  PRO F CB  1 
ATOM   8876  C CG  . PRO F 1 27  ? 100.581 -53.252 124.171 1.00 15.25 ? 255  PRO F CG  1 
ATOM   8877  C CD  . PRO F 1 27  ? 100.209 -52.423 125.340 1.00 15.65 ? 255  PRO F CD  1 
ATOM   8878  N N   . THR F 1 28  ? 98.148  -54.946 126.998 1.00 15.76 ? 256  THR F N   1 
ATOM   8879  C CA  . THR F 1 28  ? 97.609  -55.885 127.996 1.00 15.69 ? 256  THR F CA  1 
ATOM   8880  C C   . THR F 1 28  ? 96.141  -55.623 128.338 1.00 15.80 ? 256  THR F C   1 
ATOM   8881  O O   . THR F 1 28  ? 95.345  -56.560 128.350 1.00 15.92 ? 256  THR F O   1 
ATOM   8882  C CB  . THR F 1 28  ? 98.425  -55.878 129.305 1.00 15.56 ? 256  THR F CB  1 
ATOM   8883  O OG1 . THR F 1 28  ? 98.804  -54.537 129.634 1.00 15.15 ? 256  THR F OG1 1 
ATOM   8884  C CG2 . THR F 1 28  ? 99.669  -56.733 129.155 1.00 15.53 ? 256  THR F CG2 1 
ATOM   8885  N N   . VAL F 1 29  ? 95.790  -54.365 128.614 1.00 15.83 ? 257  VAL F N   1 
ATOM   8886  C CA  . VAL F 1 29  ? 94.420  -54.011 129.005 1.00 15.83 ? 257  VAL F CA  1 
ATOM   8887  C C   . VAL F 1 29  ? 93.435  -54.507 127.944 1.00 15.95 ? 257  VAL F C   1 
ATOM   8888  O O   . VAL F 1 29  ? 93.480  -54.053 126.801 1.00 16.00 ? 257  VAL F O   1 
ATOM   8889  C CB  . VAL F 1 29  ? 94.221  -52.476 129.201 1.00 15.88 ? 257  VAL F CB  1 
ATOM   8890  C CG1 . VAL F 1 29  ? 92.751  -52.149 129.467 1.00 15.14 ? 257  VAL F CG1 1 
ATOM   8891  C CG2 . VAL F 1 29  ? 95.089  -51.952 130.335 1.00 15.73 ? 257  VAL F CG2 1 
ATOM   8892  N N   . PRO F 1 30  ? 92.552  -55.451 128.310 1.00 16.03 ? 258  PRO F N   1 
ATOM   8893  C CA  . PRO F 1 30  ? 91.598  -55.919 127.316 1.00 16.13 ? 258  PRO F CA  1 
ATOM   8894  C C   . PRO F 1 30  ? 90.839  -54.772 126.659 1.00 16.37 ? 258  PRO F C   1 
ATOM   8895  O O   . PRO F 1 30  ? 90.344  -53.874 127.344 1.00 16.27 ? 258  PRO F O   1 
ATOM   8896  C CB  . PRO F 1 30  ? 90.644  -56.809 128.121 1.00 16.13 ? 258  PRO F CB  1 
ATOM   8897  C CG  . PRO F 1 30  ? 90.958  -56.565 129.548 1.00 16.10 ? 258  PRO F CG  1 
ATOM   8898  C CD  . PRO F 1 30  ? 92.374  -56.140 129.597 1.00 16.01 ? 258  PRO F CD  1 
ATOM   8899  N N   . ASP F 1 31  ? 90.770  -54.815 125.331 1.00 16.65 ? 259  ASP F N   1 
ATOM   8900  C CA  . ASP F 1 31  ? 90.107  -53.782 124.535 1.00 16.76 ? 259  ASP F CA  1 
ATOM   8901  C C   . ASP F 1 31  ? 88.622  -53.673 124.868 1.00 16.73 ? 259  ASP F C   1 
ATOM   8902  O O   . ASP F 1 31  ? 87.886  -54.655 124.800 1.00 16.65 ? 259  ASP F O   1 
ATOM   8903  C CB  . ASP F 1 31  ? 90.289  -54.059 123.036 1.00 16.90 ? 259  ASP F CB  1 
ATOM   8904  C CG  . ASP F 1 31  ? 91.731  -53.867 122.574 1.00 17.10 ? 259  ASP F CG  1 
ATOM   8905  O OD1 . ASP F 1 31  ? 92.118  -52.713 122.291 1.00 16.53 ? 259  ASP F OD1 1 
ATOM   8906  O OD2 . ASP F 1 31  ? 92.475  -54.872 122.482 1.00 18.17 ? 259  ASP F OD2 1 
ATOM   8907  N N   . SER F 1 32  ? 88.198  -52.461 125.210 1.00 16.77 ? 260  SER F N   1 
ATOM   8908  C CA  . SER F 1 32  ? 86.843  -52.208 125.683 1.00 16.73 ? 260  SER F CA  1 
ATOM   8909  C C   . SER F 1 32  ? 86.519  -50.743 125.501 1.00 16.63 ? 260  SER F C   1 
ATOM   8910  O O   . SER F 1 32  ? 87.384  -49.960 125.108 1.00 16.47 ? 260  SER F O   1 
ATOM   8911  C CB  . SER F 1 32  ? 86.732  -52.570 127.166 1.00 16.79 ? 260  SER F CB  1 
ATOM   8912  O OG  . SER F 1 32  ? 87.608  -51.778 127.954 1.00 17.01 ? 260  SER F OG  1 
ATOM   8913  N N   . ASP F 1 33  ? 85.278  -50.367 125.802 1.00 16.75 ? 261  ASP F N   1 
ATOM   8914  C CA  . ASP F 1 33  ? 84.875  -48.955 125.712 1.00 16.77 ? 261  ASP F CA  1 
ATOM   8915  C C   . ASP F 1 33  ? 85.737  -48.065 126.618 1.00 16.37 ? 261  ASP F C   1 
ATOM   8916  O O   . ASP F 1 33  ? 86.151  -46.985 126.206 1.00 16.26 ? 261  ASP F O   1 
ATOM   8917  C CB  . ASP F 1 33  ? 83.351  -48.742 125.956 1.00 16.86 ? 261  ASP F CB  1 
ATOM   8918  C CG  . ASP F 1 33  ? 82.845  -49.268 127.324 1.00 17.80 ? 261  ASP F CG  1 
ATOM   8919  O OD1 . ASP F 1 33  ? 83.646  -49.701 128.190 1.00 18.53 ? 261  ASP F OD1 1 
ATOM   8920  O OD2 . ASP F 1 33  ? 81.605  -49.246 127.523 1.00 18.13 ? 261  ASP F OD2 1 
ATOM   8921  N N   . ILE F 1 34  ? 86.040  -48.546 127.823 1.00 16.07 ? 262  ILE F N   1 
ATOM   8922  C CA  . ILE F 1 34  ? 86.795  -47.758 128.800 1.00 15.98 ? 262  ILE F CA  1 
ATOM   8923  C C   . ILE F 1 34  ? 88.210  -47.473 128.308 1.00 15.78 ? 262  ILE F C   1 
ATOM   8924  O O   . ILE F 1 34  ? 88.693  -46.348 128.442 1.00 15.77 ? 262  ILE F O   1 
ATOM   8925  C CB  . ILE F 1 34  ? 86.876  -48.443 130.199 1.00 16.05 ? 262  ILE F CB  1 
ATOM   8926  C CG1 . ILE F 1 34  ? 85.482  -48.797 130.728 1.00 16.14 ? 262  ILE F CG1 1 
ATOM   8927  C CG2 . ILE F 1 34  ? 87.603  -47.533 131.205 1.00 15.98 ? 262  ILE F CG2 1 
ATOM   8928  C CD1 . ILE F 1 34  ? 84.472  -47.655 130.637 1.00 16.00 ? 262  ILE F CD1 1 
ATOM   8929  N N   . LYS F 1 35  ? 88.862  -48.491 127.743 1.00 15.57 ? 263  LYS F N   1 
ATOM   8930  C CA  . LYS F 1 35  ? 90.208  -48.346 127.168 1.00 15.37 ? 263  LYS F CA  1 
ATOM   8931  C C   . LYS F 1 35  ? 90.236  -47.360 125.985 1.00 14.99 ? 263  LYS F C   1 
ATOM   8932  O O   . LYS F 1 35  ? 91.141  -46.532 125.891 1.00 14.79 ? 263  LYS F O   1 
ATOM   8933  C CB  . LYS F 1 35  ? 90.760  -49.715 126.726 1.00 15.41 ? 263  LYS F CB  1 
ATOM   8934  C CG  . LYS F 1 35  ? 92.177  -49.678 126.126 1.00 15.30 ? 263  LYS F CG  1 
ATOM   8935  C CD  . LYS F 1 35  ? 92.711  -51.076 125.785 1.00 15.50 ? 263  LYS F CD  1 
ATOM   8936  C CE  . LYS F 1 35  ? 94.009  -51.009 124.967 1.00 15.59 ? 263  LYS F CE  1 
ATOM   8937  N NZ  . LYS F 1 35  ? 94.481  -52.330 124.462 1.00 15.14 ? 263  LYS F NZ  1 
ATOM   8938  N N   . ALA F 1 36  ? 89.251  -47.462 125.095 1.00 14.62 ? 264  ALA F N   1 
ATOM   8939  C CA  . ALA F 1 36  ? 89.178  -46.598 123.919 1.00 14.59 ? 264  ALA F CA  1 
ATOM   8940  C C   . ALA F 1 36  ? 89.119  -45.120 124.308 1.00 14.64 ? 264  ALA F C   1 
ATOM   8941  O O   . ALA F 1 36  ? 89.837  -44.286 123.747 1.00 14.77 ? 264  ALA F O   1 
ATOM   8942  C CB  . ALA F 1 36  ? 87.971  -46.968 123.057 1.00 14.46 ? 264  ALA F CB  1 
ATOM   8943  N N   . LEU F 1 37  ? 88.271  -44.804 125.280 1.00 14.56 ? 265  LEU F N   1 
ATOM   8944  C CA  . LEU F 1 37  ? 88.099  -43.425 125.740 1.00 14.43 ? 265  LEU F CA  1 
ATOM   8945  C C   . LEU F 1 37  ? 89.340  -42.947 126.502 1.00 14.22 ? 265  LEU F C   1 
ATOM   8946  O O   . LEU F 1 37  ? 89.877  -41.870 126.234 1.00 14.35 ? 265  LEU F O   1 
ATOM   8947  C CB  . LEU F 1 37  ? 86.862  -43.331 126.625 1.00 14.39 ? 265  LEU F CB  1 
ATOM   8948  C CG  . LEU F 1 37  ? 85.565  -43.749 125.922 1.00 14.58 ? 265  LEU F CG  1 
ATOM   8949  C CD1 . LEU F 1 37  ? 84.497  -44.125 126.956 1.00 13.63 ? 265  LEU F CD1 1 
ATOM   8950  C CD2 . LEU F 1 37  ? 85.080  -42.656 124.952 1.00 13.29 ? 265  LEU F CD2 1 
ATOM   8951  N N   . THR F 1 38  ? 89.788  -43.763 127.447 1.00 13.83 ? 266  THR F N   1 
ATOM   8952  C CA  . THR F 1 38  ? 91.043  -43.534 128.151 1.00 13.64 ? 266  THR F CA  1 
ATOM   8953  C C   . THR F 1 38  ? 92.202  -43.195 127.214 1.00 13.52 ? 266  THR F C   1 
ATOM   8954  O O   . THR F 1 38  ? 92.993  -42.288 127.493 1.00 13.56 ? 266  THR F O   1 
ATOM   8955  C CB  . THR F 1 38  ? 91.438  -44.786 128.935 1.00 13.55 ? 266  THR F CB  1 
ATOM   8956  O OG1 . THR F 1 38  ? 90.395  -45.102 129.863 1.00 14.02 ? 266  THR F OG1 1 
ATOM   8957  C CG2 . THR F 1 38  ? 92.750  -44.576 129.677 1.00 13.46 ? 266  THR F CG2 1 
ATOM   8958  N N   . THR F 1 39  ? 92.321  -43.936 126.116 1.00 13.24 ? 267  THR F N   1 
ATOM   8959  C CA  . THR F 1 39  ? 93.411  -43.695 125.187 1.00 13.02 ? 267  THR F CA  1 
ATOM   8960  C C   . THR F 1 39  ? 93.207  -42.305 124.630 1.00 12.90 ? 267  THR F C   1 
ATOM   8961  O O   . THR F 1 39  ? 94.067  -41.438 124.771 1.00 13.04 ? 267  THR F O   1 
ATOM   8962  C CB  . THR F 1 39  ? 93.487  -44.733 124.028 1.00 13.10 ? 267  THR F CB  1 
ATOM   8963  O OG1 . THR F 1 39  ? 93.576  -46.067 124.554 1.00 12.41 ? 267  THR F OG1 1 
ATOM   8964  C CG2 . THR F 1 39  ? 94.717  -44.462 123.164 1.00 13.07 ? 267  THR F CG2 1 
ATOM   8965  N N   . LEU F 1 40  ? 92.039  -42.081 124.048 1.00 12.81 ? 268  LEU F N   1 
ATOM   8966  C CA  . LEU F 1 40  ? 91.740  -40.802 123.407 1.00 12.86 ? 268  LEU F CA  1 
ATOM   8967  C C   . LEU F 1 40  ? 91.945  -39.651 124.374 1.00 13.22 ? 268  LEU F C   1 
ATOM   8968  O O   . LEU F 1 40  ? 92.656  -38.703 124.056 1.00 13.60 ? 268  LEU F O   1 
ATOM   8969  C CB  . LEU F 1 40  ? 90.323  -40.795 122.835 1.00 12.68 ? 268  LEU F CB  1 
ATOM   8970  C CG  . LEU F 1 40  ? 90.124  -41.841 121.728 1.00 12.06 ? 268  LEU F CG  1 
ATOM   8971  C CD1 . LEU F 1 40  ? 88.675  -42.281 121.621 1.00 11.01 ? 268  LEU F CD1 1 
ATOM   8972  C CD2 . LEU F 1 40  ? 90.664  -41.319 120.405 1.00 11.59 ? 268  LEU F CD2 1 
ATOM   8973  N N   . CYS F 1 41  ? 91.361  -39.743 125.564 1.00 13.63 ? 269  CYS F N   1 
ATOM   8974  C CA  . CYS F 1 41  ? 91.587  -38.727 126.601 1.00 14.22 ? 269  CYS F CA  1 
ATOM   8975  C C   . CYS F 1 41  ? 93.074  -38.410 126.766 1.00 14.31 ? 269  CYS F C   1 
ATOM   8976  O O   . CYS F 1 41  ? 93.481  -37.252 126.700 1.00 14.45 ? 269  CYS F O   1 
ATOM   8977  C CB  . CYS F 1 41  ? 91.010  -39.178 127.946 1.00 14.19 ? 269  CYS F CB  1 
ATOM   8978  S SG  . CYS F 1 41  ? 89.212  -39.068 128.024 1.00 16.09 ? 269  CYS F SG  1 
ATOM   8979  N N   . ASP F 1 42  ? 93.873  -39.450 126.973 1.00 14.50 ? 270  ASP F N   1 
ATOM   8980  C CA  . ASP F 1 42  ? 95.309  -39.298 127.144 1.00 14.78 ? 270  ASP F CA  1 
ATOM   8981  C C   . ASP F 1 42  ? 95.939  -38.694 125.890 1.00 14.59 ? 270  ASP F C   1 
ATOM   8982  O O   . ASP F 1 42  ? 96.768  -37.786 125.984 1.00 14.33 ? 270  ASP F O   1 
ATOM   8983  C CB  . ASP F 1 42  ? 95.940  -40.656 127.462 1.00 15.15 ? 270  ASP F CB  1 
ATOM   8984  C CG  . ASP F 1 42  ? 97.464  -40.625 127.430 1.00 16.41 ? 270  ASP F CG  1 
ATOM   8985  O OD1 . ASP F 1 42  ? 98.073  -39.686 127.993 1.00 17.54 ? 270  ASP F OD1 1 
ATOM   8986  O OD2 . ASP F 1 42  ? 98.053  -41.560 126.847 1.00 18.90 ? 270  ASP F OD2 1 
ATOM   8987  N N   . LEU F 1 43  ? 95.530  -39.199 124.725 1.00 14.41 ? 271  LEU F N   1 
ATOM   8988  C CA  . LEU F 1 43  ? 95.999  -38.677 123.442 1.00 14.11 ? 271  LEU F CA  1 
ATOM   8989  C C   . LEU F 1 43  ? 95.698  -37.200 123.357 1.00 13.98 ? 271  LEU F C   1 
ATOM   8990  O O   . LEU F 1 43  ? 96.591  -36.394 123.113 1.00 13.72 ? 271  LEU F O   1 
ATOM   8991  C CB  . LEU F 1 43  ? 95.337  -39.419 122.266 1.00 14.14 ? 271  LEU F CB  1 
ATOM   8992  C CG  . LEU F 1 43  ? 95.816  -39.051 120.852 1.00 14.13 ? 271  LEU F CG  1 
ATOM   8993  C CD1 . LEU F 1 43  ? 97.334  -39.005 120.765 1.00 13.93 ? 271  LEU F CD1 1 
ATOM   8994  C CD2 . LEU F 1 43  ? 95.277  -40.019 119.836 1.00 13.89 ? 271  LEU F CD2 1 
ATOM   8995  N N   . ALA F 1 44  ? 94.434  -36.861 123.597 1.00 14.02 ? 272  ALA F N   1 
ATOM   8996  C CA  . ALA F 1 44  ? 93.938  -35.489 123.484 1.00 14.15 ? 272  ALA F CA  1 
ATOM   8997  C C   . ALA F 1 44  ? 94.615  -34.485 124.411 1.00 14.34 ? 272  ALA F C   1 
ATOM   8998  O O   . ALA F 1 44  ? 94.840  -33.354 124.012 1.00 14.28 ? 272  ALA F O   1 
ATOM   8999  C CB  . ALA F 1 44  ? 92.449  -35.469 123.719 1.00 14.40 ? 272  ALA F CB  1 
ATOM   9000  N N   . ASP F 1 45  ? 94.906  -34.890 125.646 1.00 14.80 ? 273  ASP F N   1 
ATOM   9001  C CA  . ASP F 1 45  ? 95.645  -34.048 126.605 1.00 15.23 ? 273  ASP F CA  1 
ATOM   9002  C C   . ASP F 1 45  ? 97.053  -33.697 126.116 1.00 15.43 ? 273  ASP F C   1 
ATOM   9003  O O   . ASP F 1 45  ? 97.485  -32.537 126.188 1.00 15.56 ? 273  ASP F O   1 
ATOM   9004  C CB  . ASP F 1 45  ? 95.751  -34.748 127.970 1.00 15.34 ? 273  ASP F CB  1 
ATOM   9005  C CG  . ASP F 1 45  ? 94.419  -34.788 128.721 1.00 16.06 ? 273  ASP F CG  1 
ATOM   9006  O OD1 . ASP F 1 45  ? 93.511  -34.008 128.364 1.00 16.60 ? 273  ASP F OD1 1 
ATOM   9007  O OD2 . ASP F 1 45  ? 94.278  -35.595 129.671 1.00 16.21 ? 273  ASP F OD2 1 
ATOM   9008  N N   . ARG F 1 46  ? 97.760  -34.711 125.630 1.00 15.49 ? 274  ARG F N   1 
ATOM   9009  C CA  . ARG F 1 46  ? 99.090  -34.526 125.088 1.00 15.72 ? 274  ARG F CA  1 
ATOM   9010  C C   . ARG F 1 46  ? 99.042  -33.687 123.815 1.00 15.89 ? 274  ARG F C   1 
ATOM   9011  O O   . ARG F 1 46  ? 99.910  -32.848 123.613 1.00 16.37 ? 274  ARG F O   1 
ATOM   9012  C CB  . ARG F 1 46  ? 99.766  -35.878 124.828 1.00 15.74 ? 274  ARG F CB  1 
ATOM   9013  C CG  . ARG F 1 46  ? 100.001 -36.697 126.109 1.00 16.15 ? 274  ARG F CG  1 
ATOM   9014  C CD  . ARG F 1 46  ? 100.796 -37.997 125.885 1.00 16.08 ? 274  ARG F CD  1 
ATOM   9015  N NE  . ARG F 1 46  ? 99.947  -39.127 125.491 1.00 16.02 ? 274  ARG F NE  1 
ATOM   9016  C CZ  . ARG F 1 46  ? 99.839  -39.611 124.254 1.00 16.01 ? 274  ARG F CZ  1 
ATOM   9017  N NH1 . ARG F 1 46  ? 100.528 -39.086 123.252 1.00 16.82 ? 274  ARG F NH1 1 
ATOM   9018  N NH2 . ARG F 1 46  ? 99.031  -40.634 124.014 1.00 15.83 ? 274  ARG F NH2 1 
ATOM   9019  N N   . GLU F 1 47  ? 98.032  -33.896 122.967 1.00 15.93 ? 275  GLU F N   1 
ATOM   9020  C CA  . GLU F 1 47  ? 97.865  -33.076 121.753 1.00 15.91 ? 275  GLU F CA  1 
ATOM   9021  C C   . GLU F 1 47  ? 97.667  -31.600 122.099 1.00 15.82 ? 275  GLU F C   1 
ATOM   9022  O O   . GLU F 1 47  ? 98.224  -30.729 121.441 1.00 15.58 ? 275  GLU F O   1 
ATOM   9023  C CB  . GLU F 1 47  ? 96.690  -33.576 120.887 1.00 15.99 ? 275  GLU F CB  1 
ATOM   9024  C CG  . GLU F 1 47  ? 96.974  -34.888 120.137 1.00 16.19 ? 275  GLU F CG  1 
ATOM   9025  C CD  . GLU F 1 47  ? 96.154  -35.092 118.858 1.00 16.20 ? 275  GLU F CD  1 
ATOM   9026  O OE1 . GLU F 1 47  ? 95.745  -34.118 118.192 1.00 16.25 ? 275  GLU F OE1 1 
ATOM   9027  O OE2 . GLU F 1 47  ? 95.946  -36.263 118.496 1.00 17.77 ? 275  GLU F OE2 1 
ATOM   9028  N N   . LEU F 1 48  ? 96.871  -31.341 123.139 1.00 15.93 ? 276  LEU F N   1 
ATOM   9029  C CA  . LEU F 1 48  ? 96.570  -29.983 123.616 1.00 15.97 ? 276  LEU F CA  1 
ATOM   9030  C C   . LEU F 1 48  ? 97.810  -29.218 124.063 1.00 15.83 ? 276  LEU F C   1 
ATOM   9031  O O   . LEU F 1 48  ? 97.933  -28.013 123.829 1.00 15.63 ? 276  LEU F O   1 
ATOM   9032  C CB  . LEU F 1 48  ? 95.573  -30.043 124.775 1.00 16.06 ? 276  LEU F CB  1 
ATOM   9033  C CG  . LEU F 1 48  ? 94.114  -30.223 124.344 1.00 16.82 ? 276  LEU F CG  1 
ATOM   9034  C CD1 . LEU F 1 48  ? 93.262  -30.777 125.480 1.00 17.13 ? 276  LEU F CD1 1 
ATOM   9035  C CD2 . LEU F 1 48  ? 93.528  -28.902 123.828 1.00 17.23 ? 276  LEU F CD2 1 
ATOM   9036  N N   . VAL F 1 49  ? 98.725  -29.924 124.713 1.00 15.73 ? 277  VAL F N   1 
ATOM   9037  C CA  . VAL F 1 49  ? 99.982  -29.326 125.138 1.00 15.71 ? 277  VAL F CA  1 
ATOM   9038  C C   . VAL F 1 49  ? 100.774 -28.761 123.947 1.00 15.59 ? 277  VAL F C   1 
ATOM   9039  O O   . VAL F 1 49  ? 101.314 -27.652 124.036 1.00 15.49 ? 277  VAL F O   1 
ATOM   9040  C CB  . VAL F 1 49  ? 100.839 -30.339 125.952 1.00 15.84 ? 277  VAL F CB  1 
ATOM   9041  C CG1 . VAL F 1 49  ? 102.310 -29.892 126.025 1.00 15.50 ? 277  VAL F CG1 1 
ATOM   9042  C CG2 . VAL F 1 49  ? 100.238 -30.523 127.342 1.00 15.44 ? 277  VAL F CG2 1 
ATOM   9043  N N   . VAL F 1 50  ? 100.831 -29.511 122.842 1.00 15.35 ? 278  VAL F N   1 
ATOM   9044  C CA  . VAL F 1 50  ? 101.483 -29.017 121.616 1.00 15.41 ? 278  VAL F CA  1 
ATOM   9045  C C   . VAL F 1 50  ? 100.628 -28.004 120.847 1.00 15.17 ? 278  VAL F C   1 
ATOM   9046  O O   . VAL F 1 50  ? 101.175 -27.175 120.124 1.00 15.20 ? 278  VAL F O   1 
ATOM   9047  C CB  . VAL F 1 50  ? 101.937 -30.151 120.632 1.00 15.30 ? 278  VAL F CB  1 
ATOM   9048  C CG1 . VAL F 1 50  ? 103.103 -30.924 121.201 1.00 15.36 ? 278  VAL F CG1 1 
ATOM   9049  C CG2 . VAL F 1 50  ? 100.801 -31.080 120.299 1.00 15.86 ? 278  VAL F CG2 1 
ATOM   9050  N N   . ILE F 1 51  ? 99.303  -28.080 120.988 1.00 15.10 ? 279  ILE F N   1 
ATOM   9051  C CA  . ILE F 1 51  ? 98.404  -27.103 120.352 1.00 15.14 ? 279  ILE F CA  1 
ATOM   9052  C C   . ILE F 1 51  ? 98.543  -25.695 120.973 1.00 15.11 ? 279  ILE F C   1 
ATOM   9053  O O   . ILE F 1 51  ? 98.467  -24.685 120.250 1.00 15.01 ? 279  ILE F O   1 
ATOM   9054  C CB  . ILE F 1 51  ? 96.922  -27.552 120.390 1.00 15.09 ? 279  ILE F CB  1 
ATOM   9055  C CG1 . ILE F 1 51  ? 96.703  -28.739 119.461 1.00 15.20 ? 279  ILE F CG1 1 
ATOM   9056  C CG2 . ILE F 1 51  ? 95.995  -26.421 119.945 1.00 14.86 ? 279  ILE F CG2 1 
ATOM   9057  C CD1 . ILE F 1 51  ? 95.367  -29.444 119.669 1.00 15.27 ? 279  ILE F CD1 1 
ATOM   9058  N N   . ILE F 1 52  ? 98.753  -25.620 122.291 1.00 14.84 ? 280  ILE F N   1 
ATOM   9059  C CA  . ILE F 1 52  ? 98.970  -24.313 122.925 1.00 14.71 ? 280  ILE F CA  1 
ATOM   9060  C C   . ILE F 1 52  ? 100.330 -23.758 122.473 1.00 14.92 ? 280  ILE F C   1 
ATOM   9061  O O   . ILE F 1 52  ? 100.439 -22.584 122.102 1.00 15.09 ? 280  ILE F O   1 
ATOM   9062  C CB  . ILE F 1 52  ? 98.871  -24.324 124.477 1.00 14.58 ? 280  ILE F CB  1 
ATOM   9063  C CG1 . ILE F 1 52  ? 97.599  -25.028 124.963 1.00 14.41 ? 280  ILE F CG1 1 
ATOM   9064  C CG2 . ILE F 1 52  ? 98.836  -22.894 124.993 1.00 13.63 ? 280  ILE F CG2 1 
ATOM   9065  C CD1 . ILE F 1 52  ? 97.625  -25.441 126.426 1.00 14.10 ? 280  ILE F CD1 1 
ATOM   9066  N N   . GLY F 1 53  ? 101.358 -24.605 122.486 1.00 15.17 ? 281  GLY F N   1 
ATOM   9067  C CA  . GLY F 1 53  ? 102.670 -24.246 121.920 1.00 15.10 ? 281  GLY F CA  1 
ATOM   9068  C C   . GLY F 1 53  ? 102.561 -23.784 120.474 1.00 15.05 ? 281  GLY F C   1 
ATOM   9069  O O   . GLY F 1 53  ? 103.269 -22.885 120.051 1.00 14.94 ? 281  GLY F O   1 
ATOM   9070  N N   . TRP F 1 54  ? 101.653 -24.406 119.728 1.00 15.20 ? 282  TRP F N   1 
ATOM   9071  C CA  . TRP F 1 54  ? 101.369 -24.045 118.341 1.00 15.21 ? 282  TRP F CA  1 
ATOM   9072  C C   . TRP F 1 54  ? 100.699 -22.675 118.239 1.00 15.49 ? 282  TRP F C   1 
ATOM   9073  O O   . TRP F 1 54  ? 101.153 -21.811 117.486 1.00 15.74 ? 282  TRP F O   1 
ATOM   9074  C CB  . TRP F 1 54  ? 100.480 -25.122 117.698 1.00 14.96 ? 282  TRP F CB  1 
ATOM   9075  C CG  . TRP F 1 54  ? 99.879  -24.740 116.383 1.00 14.54 ? 282  TRP F CG  1 
ATOM   9076  C CD1 . TRP F 1 54  ? 100.506 -24.696 115.180 1.00 14.75 ? 282  TRP F CD1 1 
ATOM   9077  C CD2 . TRP F 1 54  ? 98.529  -24.358 116.144 1.00 14.50 ? 282  TRP F CD2 1 
ATOM   9078  N NE1 . TRP F 1 54  ? 99.635  -24.307 114.202 1.00 14.63 ? 282  TRP F NE1 1 
ATOM   9079  C CE2 . TRP F 1 54  ? 98.409  -24.096 114.768 1.00 14.44 ? 282  TRP F CE2 1 
ATOM   9080  C CE3 . TRP F 1 54  ? 97.403  -24.208 116.963 1.00 14.77 ? 282  TRP F CE3 1 
ATOM   9081  C CZ2 . TRP F 1 54  ? 97.213  -23.690 114.190 1.00 14.34 ? 282  TRP F CZ2 1 
ATOM   9082  C CZ3 . TRP F 1 54  ? 96.220  -23.817 116.390 1.00 14.38 ? 282  TRP F CZ3 1 
ATOM   9083  C CH2 . TRP F 1 54  ? 96.135  -23.556 115.018 1.00 14.68 ? 282  TRP F CH2 1 
ATOM   9084  N N   . ALA F 1 55  ? 99.626  -22.480 119.000 1.00 15.67 ? 283  ALA F N   1 
ATOM   9085  C CA  . ALA F 1 55  ? 98.924  -21.187 119.042 1.00 15.83 ? 283  ALA F CA  1 
ATOM   9086  C C   . ALA F 1 55  ? 99.877  -20.003 119.115 1.00 15.87 ? 283  ALA F C   1 
ATOM   9087  O O   . ALA F 1 55  ? 99.680  -19.010 118.433 1.00 15.86 ? 283  ALA F O   1 
ATOM   9088  C CB  . ALA F 1 55  ? 97.960  -21.138 120.221 1.00 15.72 ? 283  ALA F CB  1 
ATOM   9089  N N   . LYS F 1 56  ? 100.913 -20.118 119.939 1.00 16.23 ? 284  LYS F N   1 
ATOM   9090  C CA  . LYS F 1 56  ? 101.872 -19.029 120.134 1.00 16.63 ? 284  LYS F CA  1 
ATOM   9091  C C   . LYS F 1 56  ? 102.618 -18.630 118.865 1.00 16.96 ? 284  LYS F C   1 
ATOM   9092  O O   . LYS F 1 56  ? 103.018 -17.475 118.723 1.00 17.27 ? 284  LYS F O   1 
ATOM   9093  C CB  . LYS F 1 56  ? 102.895 -19.399 121.197 1.00 16.71 ? 284  LYS F CB  1 
ATOM   9094  C CG  . LYS F 1 56  ? 102.360 -19.463 122.620 1.00 16.77 ? 284  LYS F CG  1 
ATOM   9095  C CD  . LYS F 1 56  ? 103.490 -19.931 123.521 1.00 17.53 ? 284  LYS F CD  1 
ATOM   9096  C CE  . LYS F 1 56  ? 103.210 -19.744 124.980 1.00 17.55 ? 284  LYS F CE  1 
ATOM   9097  N NZ  . LYS F 1 56  ? 104.435 -19.984 125.791 1.00 17.34 ? 284  LYS F NZ  1 
ATOM   9098  N N   . HIS F 1 57  ? 102.814 -19.577 117.953 1.00 17.19 ? 285  HIS F N   1 
ATOM   9099  C CA  . HIS F 1 57  ? 103.470 -19.278 116.679 1.00 17.32 ? 285  HIS F CA  1 
ATOM   9100  C C   . HIS F 1 57  ? 102.556 -18.580 115.676 1.00 17.23 ? 285  HIS F C   1 
ATOM   9101  O O   . HIS F 1 57  ? 103.038 -17.943 114.749 1.00 17.38 ? 285  HIS F O   1 
ATOM   9102  C CB  . HIS F 1 57  ? 104.077 -20.546 116.085 1.00 17.56 ? 285  HIS F CB  1 
ATOM   9103  C CG  . HIS F 1 57  ? 105.209 -21.084 116.903 1.00 18.37 ? 285  HIS F CG  1 
ATOM   9104  N ND1 . HIS F 1 57  ? 106.524 -21.020 116.496 1.00 19.47 ? 285  HIS F ND1 1 
ATOM   9105  C CD2 . HIS F 1 57  ? 105.223 -21.644 118.134 1.00 18.95 ? 285  HIS F CD2 1 
ATOM   9106  C CE1 . HIS F 1 57  ? 107.297 -21.542 117.432 1.00 19.43 ? 285  HIS F CE1 1 
ATOM   9107  N NE2 . HIS F 1 57  ? 106.531 -21.928 118.437 1.00 19.27 ? 285  HIS F NE2 1 
ATOM   9108  N N   . ILE F 1 58  ? 101.243 -18.678 115.863 1.00 17.35 ? 286  ILE F N   1 
ATOM   9109  C CA  . ILE F 1 58  ? 100.301 -17.972 114.986 1.00 17.33 ? 286  ILE F CA  1 
ATOM   9110  C C   . ILE F 1 58  ? 100.538 -16.458 115.092 1.00 17.35 ? 286  ILE F C   1 
ATOM   9111  O O   . ILE F 1 58  ? 100.305 -15.871 116.154 1.00 17.49 ? 286  ILE F O   1 
ATOM   9112  C CB  . ILE F 1 58  ? 98.846  -18.257 115.342 1.00 17.34 ? 286  ILE F CB  1 
ATOM   9113  C CG1 . ILE F 1 58  ? 98.529  -19.748 115.181 1.00 17.55 ? 286  ILE F CG1 1 
ATOM   9114  C CG2 . ILE F 1 58  ? 97.926  -17.426 114.459 1.00 17.43 ? 286  ILE F CG2 1 
ATOM   9115  C CD1 . ILE F 1 58  ? 97.113  -20.132 115.643 1.00 17.37 ? 286  ILE F CD1 1 
ATOM   9116  N N   . PRO F 1 59  ? 101.016 -15.828 114.000 1.00 17.28 ? 287  PRO F N   1 
ATOM   9117  C CA  . PRO F 1 59  ? 101.414 -14.420 114.053 1.00 17.20 ? 287  PRO F CA  1 
ATOM   9118  C C   . PRO F 1 59  ? 100.296 -13.502 114.543 1.00 17.10 ? 287  PRO F C   1 
ATOM   9119  O O   . PRO F 1 59  ? 99.177  -13.565 114.033 1.00 17.11 ? 287  PRO F O   1 
ATOM   9120  C CB  . PRO F 1 59  ? 101.765 -14.098 112.595 1.00 17.32 ? 287  PRO F CB  1 
ATOM   9121  C CG  . PRO F 1 59  ? 102.092 -15.397 111.984 1.00 17.42 ? 287  PRO F CG  1 
ATOM   9122  C CD  . PRO F 1 59  ? 101.204 -16.393 112.652 1.00 17.33 ? 287  PRO F CD  1 
ATOM   9123  N N   . GLY F 1 60  ? 100.607 -12.668 115.533 1.00 16.99 ? 288  GLY F N   1 
ATOM   9124  C CA  . GLY F 1 60  ? 99.632  -11.742 116.112 1.00 16.93 ? 288  GLY F CA  1 
ATOM   9125  C C   . GLY F 1 60  ? 98.970  -12.287 117.364 1.00 16.89 ? 288  GLY F C   1 
ATOM   9126  O O   . GLY F 1 60  ? 98.567  -11.516 118.248 1.00 16.84 ? 288  GLY F O   1 
ATOM   9127  N N   . PHE F 1 61  ? 98.868  -13.617 117.437 1.00 16.78 ? 289  PHE F N   1 
ATOM   9128  C CA  . PHE F 1 61  ? 98.206  -14.305 118.539 1.00 16.58 ? 289  PHE F CA  1 
ATOM   9129  C C   . PHE F 1 61  ? 98.804  -13.948 119.881 1.00 16.59 ? 289  PHE F C   1 
ATOM   9130  O O   . PHE F 1 61  ? 98.088  -13.761 120.853 1.00 16.74 ? 289  PHE F O   1 
ATOM   9131  C CB  . PHE F 1 61  ? 98.295  -15.820 118.367 1.00 16.48 ? 289  PHE F CB  1 
ATOM   9132  C CG  . PHE F 1 61  ? 97.585  -16.577 119.437 1.00 16.20 ? 289  PHE F CG  1 
ATOM   9133  C CD1 . PHE F 1 61  ? 96.192  -16.669 119.425 1.00 16.10 ? 289  PHE F CD1 1 
ATOM   9134  C CD2 . PHE F 1 61  ? 98.294  -17.172 120.474 1.00 15.74 ? 289  PHE F CD2 1 
ATOM   9135  C CE1 . PHE F 1 61  ? 95.509  -17.355 120.429 1.00 16.30 ? 289  PHE F CE1 1 
ATOM   9136  C CE2 . PHE F 1 61  ? 97.630  -17.866 121.483 1.00 16.34 ? 289  PHE F CE2 1 
ATOM   9137  C CZ  . PHE F 1 61  ? 96.229  -17.956 121.465 1.00 16.63 ? 289  PHE F CZ  1 
ATOM   9138  N N   . SER F 1 62  ? 100.123 -13.865 119.933 1.00 16.62 ? 290  SER F N   1 
ATOM   9139  C CA  . SER F 1 62  ? 100.812 -13.628 121.193 1.00 16.51 ? 290  SER F CA  1 
ATOM   9140  C C   . SER F 1 62  ? 100.718 -12.179 121.666 1.00 16.17 ? 290  SER F C   1 
ATOM   9141  O O   . SER F 1 62  ? 100.909 -11.908 122.850 1.00 16.20 ? 290  SER F O   1 
ATOM   9142  C CB  . SER F 1 62  ? 102.266 -14.067 121.063 1.00 16.62 ? 290  SER F CB  1 
ATOM   9143  O OG  . SER F 1 62  ? 102.325 -15.396 120.565 1.00 17.04 ? 290  SER F OG  1 
ATOM   9144  N N   . THR F 1 63  ? 100.420 -11.252 120.757 1.00 15.84 ? 291  THR F N   1 
ATOM   9145  C CA  . THR F 1 63  ? 100.294 -9.839  121.131 1.00 15.63 ? 291  THR F CA  1 
ATOM   9146  C C   . THR F 1 63  ? 98.914  -9.544  121.728 1.00 15.27 ? 291  THR F C   1 
ATOM   9147  O O   . THR F 1 63  ? 98.722  -8.495  122.336 1.00 15.40 ? 291  THR F O   1 
ATOM   9148  C CB  . THR F 1 63  ? 100.628 -8.857  119.952 1.00 15.69 ? 291  THR F CB  1 
ATOM   9149  O OG1 . THR F 1 63  ? 99.695  -9.017  118.869 1.00 16.26 ? 291  THR F OG1 1 
ATOM   9150  C CG2 . THR F 1 63  ? 102.054 -9.086  119.451 1.00 15.18 ? 291  THR F CG2 1 
ATOM   9151  N N   . LEU F 1 64  ? 97.967  -10.469 121.572 1.00 14.71 ? 292  LEU F N   1 
ATOM   9152  C CA  . LEU F 1 64  ? 96.681  -10.377 122.263 1.00 14.20 ? 292  LEU F CA  1 
ATOM   9153  C C   . LEU F 1 64  ? 96.859  -10.589 123.761 1.00 14.20 ? 292  LEU F C   1 
ATOM   9154  O O   . LEU F 1 64  ? 97.817  -11.238 124.182 1.00 14.33 ? 292  LEU F O   1 
ATOM   9155  C CB  . LEU F 1 64  ? 95.733  -11.447 121.759 1.00 13.94 ? 292  LEU F CB  1 
ATOM   9156  C CG  . LEU F 1 64  ? 95.313  -11.380 120.308 1.00 13.27 ? 292  LEU F CG  1 
ATOM   9157  C CD1 . LEU F 1 64  ? 94.577  -12.651 120.004 1.00 12.84 ? 292  LEU F CD1 1 
ATOM   9158  C CD2 . LEU F 1 64  ? 94.444  -10.161 120.049 1.00 12.97 ? 292  LEU F CD2 1 
ATOM   9159  N N   . SER F 1 65  ? 95.924  -10.067 124.558 1.00 13.98 ? 293  SER F N   1 
ATOM   9160  C CA  . SER F 1 65  ? 95.942  -10.278 126.009 1.00 14.01 ? 293  SER F CA  1 
ATOM   9161  C C   . SER F 1 65  ? 95.804  -11.761 126.359 1.00 13.99 ? 293  SER F C   1 
ATOM   9162  O O   . SER F 1 65  ? 95.236  -12.536 125.595 1.00 13.91 ? 293  SER F O   1 
ATOM   9163  C CB  . SER F 1 65  ? 94.808  -9.502  126.677 1.00 14.10 ? 293  SER F CB  1 
ATOM   9164  O OG  . SER F 1 65  ? 93.546  -9.904  126.172 1.00 14.39 ? 293  SER F OG  1 
ATOM   9165  N N   . LEU F 1 66  ? 96.319  -12.153 127.518 1.00 14.01 ? 294  LEU F N   1 
ATOM   9166  C CA  . LEU F 1 66  ? 96.148  -13.524 127.981 1.00 14.08 ? 294  LEU F CA  1 
ATOM   9167  C C   . LEU F 1 66  ? 94.672  -13.901 128.000 1.00 13.93 ? 294  LEU F C   1 
ATOM   9168  O O   . LEU F 1 66  ? 94.285  -14.904 127.411 1.00 14.14 ? 294  LEU F O   1 
ATOM   9169  C CB  . LEU F 1 66  ? 96.722  -13.716 129.381 1.00 14.23 ? 294  LEU F CB  1 
ATOM   9170  C CG  . LEU F 1 66  ? 98.233  -13.827 129.520 1.00 14.90 ? 294  LEU F CG  1 
ATOM   9171  C CD1 . LEU F 1 66  ? 98.552  -14.187 130.967 1.00 15.86 ? 294  LEU F CD1 1 
ATOM   9172  C CD2 . LEU F 1 66  ? 98.811  -14.868 128.563 1.00 15.17 ? 294  LEU F CD2 1 
ATOM   9173  N N   . ALA F 1 67  ? 93.857  -13.086 128.667 1.00 13.70 ? 295  ALA F N   1 
ATOM   9174  C CA  . ALA F 1 67  ? 92.415  -13.334 128.776 1.00 13.56 ? 295  ALA F CA  1 
ATOM   9175  C C   . ALA F 1 67  ? 91.777  -13.698 127.435 1.00 13.51 ? 295  ALA F C   1 
ATOM   9176  O O   . ALA F 1 67  ? 90.911  -14.572 127.383 1.00 13.48 ? 295  ALA F O   1 
ATOM   9177  C CB  . ALA F 1 67  ? 91.707  -12.118 129.377 1.00 13.68 ? 295  ALA F CB  1 
ATOM   9178  N N   . ASP F 1 68  ? 92.211  -13.029 126.363 1.00 13.46 ? 296  ASP F N   1 
ATOM   9179  C CA  . ASP F 1 68  ? 91.720  -13.305 125.006 1.00 13.52 ? 296  ASP F CA  1 
ATOM   9180  C C   . ASP F 1 68  ? 92.351  -14.544 124.363 1.00 13.45 ? 296  ASP F C   1 
ATOM   9181  O O   . ASP F 1 68  ? 91.666  -15.301 123.667 1.00 13.28 ? 296  ASP F O   1 
ATOM   9182  C CB  . ASP F 1 68  ? 91.935  -12.089 124.094 1.00 13.67 ? 296  ASP F CB  1 
ATOM   9183  C CG  . ASP F 1 68  ? 90.860  -11.037 124.269 1.00 14.24 ? 296  ASP F CG  1 
ATOM   9184  O OD1 . ASP F 1 68  ? 89.901  -11.323 125.016 1.00 15.33 ? 296  ASP F OD1 1 
ATOM   9185  O OD2 . ASP F 1 68  ? 90.964  -9.937  123.667 1.00 14.35 ? 296  ASP F OD2 1 
ATOM   9186  N N   . GLN F 1 69  ? 93.651  -14.740 124.575 1.00 13.34 ? 297  GLN F N   1 
ATOM   9187  C CA  . GLN F 1 69  ? 94.338  -15.924 124.064 1.00 13.19 ? 297  GLN F CA  1 
ATOM   9188  C C   . GLN F 1 69  ? 93.667  -17.149 124.637 1.00 13.40 ? 297  GLN F C   1 
ATOM   9189  O O   . GLN F 1 69  ? 93.378  -18.114 123.928 1.00 13.65 ? 297  GLN F O   1 
ATOM   9190  C CB  . GLN F 1 69  ? 95.814  -15.920 124.456 1.00 13.24 ? 297  GLN F CB  1 
ATOM   9191  C CG  . GLN F 1 69  ? 96.643  -14.842 123.776 1.00 13.03 ? 297  GLN F CG  1 
ATOM   9192  C CD  . GLN F 1 69  ? 98.083  -14.847 124.232 1.00 12.94 ? 297  GLN F CD  1 
ATOM   9193  O OE1 . GLN F 1 69  ? 98.683  -15.911 124.402 1.00 12.57 ? 297  GLN F OE1 1 
ATOM   9194  N NE2 . GLN F 1 69  ? 98.652  -13.658 124.431 1.00 12.21 ? 297  GLN F NE2 1 
ATOM   9195  N N   . MET F 1 70  ? 93.395  -17.086 125.931 1.00 13.62 ? 298  MET F N   1 
ATOM   9196  C CA  . MET F 1 70  ? 92.685  -18.157 126.612 1.00 14.12 ? 298  MET F CA  1 
ATOM   9197  C C   . MET F 1 70  ? 91.253  -18.300 126.118 1.00 13.51 ? 298  MET F C   1 
ATOM   9198  O O   . MET F 1 70  ? 90.802  -19.407 125.916 1.00 13.62 ? 298  MET F O   1 
ATOM   9199  C CB  . MET F 1 70  ? 92.704  -17.936 128.122 1.00 14.05 ? 298  MET F CB  1 
ATOM   9200  C CG  . MET F 1 70  ? 94.104  -17.748 128.660 1.00 14.65 ? 298  MET F CG  1 
ATOM   9201  S SD  . MET F 1 70  ? 94.255  -18.283 130.351 1.00 16.52 ? 298  MET F SD  1 
ATOM   9202  C CE  . MET F 1 70  ? 93.107  -17.160 131.171 1.00 16.46 ? 298  MET F CE  1 
ATOM   9203  N N   . SER F 1 71  ? 90.548  -17.197 125.908 1.00 13.14 ? 299  SER F N   1 
ATOM   9204  C CA  . SER F 1 71  ? 89.177  -17.278 125.409 1.00 13.26 ? 299  SER F CA  1 
ATOM   9205  C C   . SER F 1 71  ? 89.072  -18.029 124.072 1.00 13.41 ? 299  SER F C   1 
ATOM   9206  O O   . SER F 1 71  ? 88.237  -18.927 123.912 1.00 13.54 ? 299  SER F O   1 
ATOM   9207  C CB  . SER F 1 71  ? 88.562  -15.884 125.265 1.00 13.26 ? 299  SER F CB  1 
ATOM   9208  O OG  . SER F 1 71  ? 88.282  -15.300 126.527 1.00 13.07 ? 299  SER F OG  1 
ATOM   9209  N N   . LEU F 1 72  ? 89.922  -17.668 123.118 1.00 13.51 ? 300  LEU F N   1 
ATOM   9210  C CA  . LEU F 1 72  ? 89.913  -18.324 121.809 1.00 13.60 ? 300  LEU F CA  1 
ATOM   9211  C C   . LEU F 1 72  ? 90.177  -19.819 121.964 1.00 13.51 ? 300  LEU F C   1 
ATOM   9212  O O   . LEU F 1 72  ? 89.412  -20.637 121.465 1.00 13.58 ? 300  LEU F O   1 
ATOM   9213  C CB  . LEU F 1 72  ? 90.954  -17.703 120.860 1.00 13.71 ? 300  LEU F CB  1 
ATOM   9214  C CG  . LEU F 1 72  ? 90.844  -16.193 120.588 1.00 13.81 ? 300  LEU F CG  1 
ATOM   9215  C CD1 . LEU F 1 72  ? 91.937  -15.735 119.623 1.00 13.23 ? 300  LEU F CD1 1 
ATOM   9216  C CD2 . LEU F 1 72  ? 89.457  -15.809 120.072 1.00 13.63 ? 300  LEU F CD2 1 
ATOM   9217  N N   . LEU F 1 73  ? 91.257  -20.161 122.663 1.00 13.33 ? 301  LEU F N   1 
ATOM   9218  C CA  . LEU F 1 73  ? 91.577  -21.557 122.960 1.00 13.32 ? 301  LEU F CA  1 
ATOM   9219  C C   . LEU F 1 73  ? 90.474  -22.265 123.754 1.00 13.36 ? 301  LEU F C   1 
ATOM   9220  O O   . LEU F 1 73  ? 90.114  -23.388 123.430 1.00 13.39 ? 301  LEU F O   1 
ATOM   9221  C CB  . LEU F 1 73  ? 92.905  -21.656 123.710 1.00 13.38 ? 301  LEU F CB  1 
ATOM   9222  C CG  . LEU F 1 73  ? 94.152  -21.415 122.856 1.00 13.35 ? 301  LEU F CG  1 
ATOM   9223  C CD1 . LEU F 1 73  ? 95.386  -21.245 123.721 1.00 13.94 ? 301  LEU F CD1 1 
ATOM   9224  C CD2 . LEU F 1 73  ? 94.356  -22.543 121.869 1.00 12.73 ? 301  LEU F CD2 1 
ATOM   9225  N N   A GLN F 1 74  ? 89.946  -21.601 124.780 0.60 13.47 ? 302  GLN F N   1 
ATOM   9226  N N   B GLN F 1 74  ? 89.953  -21.604 124.786 0.40 13.32 ? 302  GLN F N   1 
ATOM   9227  C CA  A GLN F 1 74  ? 88.837  -22.140 125.572 0.60 13.60 ? 302  GLN F CA  1 
ATOM   9228  C CA  B GLN F 1 74  ? 88.852  -22.154 125.585 0.40 13.30 ? 302  GLN F CA  1 
ATOM   9229  C C   A GLN F 1 74  ? 87.681  -22.518 124.671 0.60 13.51 ? 302  GLN F C   1 
ATOM   9230  C C   B GLN F 1 74  ? 87.644  -22.480 124.711 0.40 13.40 ? 302  GLN F C   1 
ATOM   9231  O O   A GLN F 1 74  ? 87.011  -23.512 124.911 0.60 13.47 ? 302  GLN F O   1 
ATOM   9232  O O   B GLN F 1 74  ? 86.902  -23.407 125.014 0.40 13.39 ? 302  GLN F O   1 
ATOM   9233  C CB  A GLN F 1 74  ? 88.353  -21.121 126.612 0.60 13.78 ? 302  GLN F CB  1 
ATOM   9234  C CB  B GLN F 1 74  ? 88.450  -21.200 126.728 0.40 13.33 ? 302  GLN F CB  1 
ATOM   9235  C CG  A GLN F 1 74  ? 87.348  -21.677 127.635 0.60 14.31 ? 302  GLN F CG  1 
ATOM   9236  C CG  B GLN F 1 74  ? 89.358  -21.275 127.974 0.40 13.10 ? 302  GLN F CG  1 
ATOM   9237  C CD  A GLN F 1 74  ? 86.218  -20.700 127.960 0.60 15.06 ? 302  GLN F CD  1 
ATOM   9238  C CD  B GLN F 1 74  ? 89.143  -20.122 128.964 0.40 13.11 ? 302  GLN F CD  1 
ATOM   9239  O OE1 A GLN F 1 74  ? 85.619  -20.095 127.059 0.60 14.93 ? 302  GLN F OE1 1 
ATOM   9240  O OE1 B GLN F 1 74  ? 88.187  -19.346 128.855 0.40 13.00 ? 302  GLN F OE1 1 
ATOM   9241  N NE2 A GLN F 1 74  ? 85.911  -20.557 129.251 0.60 14.90 ? 302  GLN F NE2 1 
ATOM   9242  N NE2 B GLN F 1 74  ? 90.039  -20.015 129.936 0.40 12.08 ? 302  GLN F NE2 1 
ATOM   9243  N N   . SER F 1 75  ? 87.453  -21.719 123.634 1.00 13.58 ? 303  SER F N   1 
ATOM   9244  C CA  . SER F 1 75  ? 86.370  -21.981 122.676 1.00 13.95 ? 303  SER F CA  1 
ATOM   9245  C C   . SER F 1 75  ? 86.721  -22.998 121.574 1.00 14.15 ? 303  SER F C   1 
ATOM   9246  O O   . SER F 1 75  ? 85.903  -23.854 121.226 1.00 14.31 ? 303  SER F O   1 
ATOM   9247  C CB  . SER F 1 75  ? 85.917  -20.674 122.029 1.00 14.03 ? 303  SER F CB  1 
ATOM   9248  O OG  . SER F 1 75  ? 85.023  -19.976 122.889 1.00 15.51 ? 303  SER F OG  1 
ATOM   9249  N N   . ALA F 1 76  ? 87.938  -22.913 121.042 1.00 14.09 ? 304  ALA F N   1 
ATOM   9250  C CA  . ALA F 1 76  ? 88.283  -23.592 119.809 1.00 13.96 ? 304  ALA F CA  1 
ATOM   9251  C C   . ALA F 1 76  ? 88.998  -24.929 119.999 1.00 14.23 ? 304  ALA F C   1 
ATOM   9252  O O   . ALA F 1 76  ? 89.182  -25.680 119.031 1.00 14.35 ? 304  ALA F O   1 
ATOM   9253  C CB  . ALA F 1 76  ? 89.121  -22.672 118.959 1.00 13.76 ? 304  ALA F CB  1 
ATOM   9254  N N   . TRP F 1 77  ? 89.398  -25.250 121.225 1.00 14.38 ? 305  TRP F N   1 
ATOM   9255  C CA  . TRP F 1 77  ? 90.296  -26.401 121.422 1.00 14.50 ? 305  TRP F CA  1 
ATOM   9256  C C   . TRP F 1 77  ? 89.787  -27.676 120.743 1.00 14.39 ? 305  TRP F C   1 
ATOM   9257  O O   . TRP F 1 77  ? 90.542  -28.335 120.046 1.00 14.41 ? 305  TRP F O   1 
ATOM   9258  C CB  . TRP F 1 77  ? 90.635  -26.642 122.908 1.00 14.52 ? 305  TRP F CB  1 
ATOM   9259  C CG  . TRP F 1 77  ? 89.488  -27.038 123.762 1.00 14.61 ? 305  TRP F CG  1 
ATOM   9260  C CD1 . TRP F 1 77  ? 88.580  -26.214 124.353 1.00 14.83 ? 305  TRP F CD1 1 
ATOM   9261  C CD2 . TRP F 1 77  ? 89.129  -28.363 124.133 1.00 15.30 ? 305  TRP F CD2 1 
ATOM   9262  N NE1 . TRP F 1 77  ? 87.666  -26.942 125.068 1.00 14.77 ? 305  TRP F NE1 1 
ATOM   9263  C CE2 . TRP F 1 77  ? 87.978  -28.269 124.950 1.00 15.17 ? 305  TRP F CE2 1 
ATOM   9264  C CE3 . TRP F 1 77  ? 89.662  -29.628 123.850 1.00 14.83 ? 305  TRP F CE3 1 
ATOM   9265  C CZ2 . TRP F 1 77  ? 87.352  -29.392 125.487 1.00 15.07 ? 305  TRP F CZ2 1 
ATOM   9266  C CZ3 . TRP F 1 77  ? 89.046  -30.736 124.379 1.00 14.66 ? 305  TRP F CZ3 1 
ATOM   9267  C CH2 . TRP F 1 77  ? 87.900  -30.617 125.193 1.00 15.12 ? 305  TRP F CH2 1 
ATOM   9268  N N   . MET F 1 78  ? 88.513  -28.005 120.903 1.00 14.44 ? 306  MET F N   1 
ATOM   9269  C CA  . MET F 1 78  ? 88.014  -29.265 120.367 1.00 14.66 ? 306  MET F CA  1 
ATOM   9270  C C   . MET F 1 78  ? 88.002  -29.288 118.833 1.00 14.83 ? 306  MET F C   1 
ATOM   9271  O O   . MET F 1 78  ? 88.351  -30.306 118.237 1.00 14.82 ? 306  MET F O   1 
ATOM   9272  C CB  . MET F 1 78  ? 86.632  -29.578 120.929 1.00 14.79 ? 306  MET F CB  1 
ATOM   9273  C CG  . MET F 1 78  ? 86.034  -30.903 120.442 1.00 15.15 ? 306  MET F CG  1 
ATOM   9274  S SD  . MET F 1 78  ? 86.901  -32.372 121.023 1.00 16.09 ? 306  MET F SD  1 
ATOM   9275  C CE  . MET F 1 78  ? 86.107  -32.644 122.618 1.00 13.86 ? 306  MET F CE  1 
ATOM   9276  N N   . GLU F 1 79  ? 87.601  -28.175 118.211 1.00 15.08 ? 307  GLU F N   1 
ATOM   9277  C CA  . GLU F 1 79  ? 87.613  -28.018 116.740 1.00 15.08 ? 307  GLU F CA  1 
ATOM   9278  C C   . GLU F 1 79  ? 89.000  -28.217 116.132 1.00 14.99 ? 307  GLU F C   1 
ATOM   9279  O O   . GLU F 1 79  ? 89.124  -28.652 114.995 1.00 14.72 ? 307  GLU F O   1 
ATOM   9280  C CB  . GLU F 1 79  ? 87.149  -26.605 116.326 1.00 15.25 ? 307  GLU F CB  1 
ATOM   9281  C CG  . GLU F 1 79  ? 85.671  -26.285 116.530 1.00 15.05 ? 307  GLU F CG  1 
ATOM   9282  C CD  . GLU F 1 79  ? 85.300  -24.858 116.110 1.00 14.84 ? 307  GLU F CD  1 
ATOM   9283  O OE1 . GLU F 1 79  ? 85.645  -24.418 114.994 1.00 14.30 ? 307  GLU F OE1 1 
ATOM   9284  O OE2 . GLU F 1 79  ? 84.643  -24.174 116.903 1.00 14.70 ? 307  GLU F OE2 1 
ATOM   9285  N N   . ILE F 1 80  ? 90.031  -27.849 116.881 1.00 15.03 ? 308  ILE F N   1 
ATOM   9286  C CA  . ILE F 1 80  ? 91.415  -27.977 116.434 1.00 15.25 ? 308  ILE F CA  1 
ATOM   9287  C C   . ILE F 1 80  ? 91.920  -29.432 116.583 1.00 15.47 ? 308  ILE F C   1 
ATOM   9288  O O   . ILE F 1 80  ? 92.717  -29.920 115.763 1.00 15.51 ? 308  ILE F O   1 
ATOM   9289  C CB  . ILE F 1 80  ? 92.323  -26.963 117.195 1.00 15.15 ? 308  ILE F CB  1 
ATOM   9290  C CG1 . ILE F 1 80  ? 92.063  -25.547 116.680 1.00 15.24 ? 308  ILE F CG1 1 
ATOM   9291  C CG2 . ILE F 1 80  ? 93.796  -27.287 117.028 1.00 15.36 ? 308  ILE F CG2 1 
ATOM   9292  C CD1 . ILE F 1 80  ? 92.461  -24.443 117.647 1.00 15.68 ? 308  ILE F CD1 1 
ATOM   9293  N N   . LEU F 1 81  ? 91.453  -30.118 117.623 1.00 15.49 ? 309  LEU F N   1 
ATOM   9294  C CA  . LEU F 1 81  ? 91.714  -31.544 117.771 1.00 15.61 ? 309  LEU F CA  1 
ATOM   9295  C C   . LEU F 1 81  ? 91.068  -32.311 116.630 1.00 15.72 ? 309  LEU F C   1 
ATOM   9296  O O   . LEU F 1 81  ? 91.704  -33.163 116.003 1.00 15.96 ? 309  LEU F O   1 
ATOM   9297  C CB  . LEU F 1 81  ? 91.166  -32.075 119.099 1.00 15.61 ? 309  LEU F CB  1 
ATOM   9298  C CG  . LEU F 1 81  ? 91.992  -31.851 120.369 1.00 15.68 ? 309  LEU F CG  1 
ATOM   9299  C CD1 . LEU F 1 81  ? 91.129  -32.134 121.610 1.00 14.99 ? 309  LEU F CD1 1 
ATOM   9300  C CD2 . LEU F 1 81  ? 93.272  -32.711 120.362 1.00 14.20 ? 309  LEU F CD2 1 
ATOM   9301  N N   . ILE F 1 82  ? 89.802  -31.992 116.374 1.00 15.78 ? 310  ILE F N   1 
ATOM   9302  C CA  . ILE F 1 82  ? 88.971  -32.733 115.421 1.00 15.70 ? 310  ILE F CA  1 
ATOM   9303  C C   . ILE F 1 82  ? 89.429  -32.536 113.982 1.00 15.83 ? 310  ILE F C   1 
ATOM   9304  O O   . ILE F 1 82  ? 89.547  -33.492 113.224 1.00 16.20 ? 310  ILE F O   1 
ATOM   9305  C CB  . ILE F 1 82  ? 87.482  -32.369 115.583 1.00 15.40 ? 310  ILE F CB  1 
ATOM   9306  C CG1 . ILE F 1 82  ? 86.903  -33.162 116.758 1.00 15.76 ? 310  ILE F CG1 1 
ATOM   9307  C CG2 . ILE F 1 82  ? 86.718  -32.667 114.327 1.00 14.55 ? 310  ILE F CG2 1 
ATOM   9308  C CD1 . ILE F 1 82  ? 85.554  -32.676 117.249 1.00 16.17 ? 310  ILE F CD1 1 
ATOM   9309  N N   . LEU F 1 83  ? 89.702  -31.295 113.613 1.00 15.86 ? 311  LEU F N   1 
ATOM   9310  C CA  . LEU F 1 83  ? 90.285  -30.999 112.308 1.00 15.60 ? 311  LEU F CA  1 
ATOM   9311  C C   . LEU F 1 83  ? 91.612  -31.740 112.148 1.00 15.32 ? 311  LEU F C   1 
ATOM   9312  O O   . LEU F 1 83  ? 91.964  -32.186 111.056 1.00 15.13 ? 311  LEU F O   1 
ATOM   9313  C CB  . LEU F 1 83  ? 90.486  -29.490 112.150 1.00 15.37 ? 311  LEU F CB  1 
ATOM   9314  C CG  . LEU F 1 83  ? 90.857  -29.009 110.756 1.00 15.02 ? 311  LEU F CG  1 
ATOM   9315  C CD1 . LEU F 1 83  ? 89.838  -29.461 109.748 1.00 15.23 ? 311  LEU F CD1 1 
ATOM   9316  C CD2 . LEU F 1 83  ? 90.972  -27.509 110.750 1.00 15.80 ? 311  LEU F CD2 1 
ATOM   9317  N N   . GLY F 1 84  ? 92.336  -31.874 113.252 1.00 15.13 ? 312  GLY F N   1 
ATOM   9318  C CA  . GLY F 1 84  ? 93.561  -32.656 113.277 1.00 15.05 ? 312  GLY F CA  1 
ATOM   9319  C C   . GLY F 1 84  ? 93.326  -34.075 112.809 1.00 14.68 ? 312  GLY F C   1 
ATOM   9320  O O   . GLY F 1 84  ? 93.975  -34.534 111.877 1.00 14.78 ? 312  GLY F O   1 
ATOM   9321  N N   . VAL F 1 85  ? 92.401  -34.771 113.455 1.00 14.35 ? 313  VAL F N   1 
ATOM   9322  C CA  . VAL F 1 85  ? 92.123  -36.159 113.109 1.00 14.29 ? 313  VAL F CA  1 
ATOM   9323  C C   . VAL F 1 85  ? 91.508  -36.275 111.717 1.00 14.28 ? 313  VAL F C   1 
ATOM   9324  O O   . VAL F 1 85  ? 91.800  -37.230 111.001 1.00 14.90 ? 313  VAL F O   1 
ATOM   9325  C CB  . VAL F 1 85  ? 91.223  -36.875 114.156 1.00 14.32 ? 313  VAL F CB  1 
ATOM   9326  C CG1 . VAL F 1 85  ? 89.876  -36.182 114.298 1.00 14.14 ? 313  VAL F CG1 1 
ATOM   9327  C CG2 . VAL F 1 85  ? 91.034  -38.326 113.776 1.00 13.95 ? 313  VAL F CG2 1 
ATOM   9328  N N   . VAL F 1 86  ? 90.673  -35.314 111.326 1.00 13.90 ? 314  VAL F N   1 
ATOM   9329  C CA  . VAL F 1 86  ? 90.124  -35.288 109.959 1.00 13.41 ? 314  VAL F CA  1 
ATOM   9330  C C   . VAL F 1 86  ? 91.251  -35.216 108.911 1.00 13.24 ? 314  VAL F C   1 
ATOM   9331  O O   . VAL F 1 86  ? 91.331  -36.071 108.033 1.00 13.22 ? 314  VAL F O   1 
ATOM   9332  C CB  . VAL F 1 86  ? 89.105  -34.126 109.747 1.00 13.18 ? 314  VAL F CB  1 
ATOM   9333  C CG1 . VAL F 1 86  ? 88.792  -33.952 108.292 1.00 12.71 ? 314  VAL F CG1 1 
ATOM   9334  C CG2 . VAL F 1 86  ? 87.834  -34.380 110.512 1.00 12.15 ? 314  VAL F CG2 1 
ATOM   9335  N N   . TYR F 1 87  ? 92.136  -34.226 109.008 1.00 13.01 ? 315  TYR F N   1 
ATOM   9336  C CA  . TYR F 1 87  ? 93.236  -34.141 108.047 1.00 12.75 ? 315  TYR F CA  1 
ATOM   9337  C C   . TYR F 1 87  ? 94.017  -35.457 107.929 1.00 12.46 ? 315  TYR F C   1 
ATOM   9338  O O   . TYR F 1 87  ? 94.363  -35.884 106.833 1.00 12.45 ? 315  TYR F O   1 
ATOM   9339  C CB  . TYR F 1 87  ? 94.219  -33.008 108.358 1.00 12.53 ? 315  TYR F CB  1 
ATOM   9340  C CG  . TYR F 1 87  ? 95.215  -32.858 107.223 1.00 12.44 ? 315  TYR F CG  1 
ATOM   9341  C CD1 . TYR F 1 87  ? 94.805  -32.345 105.995 1.00 12.13 ? 315  TYR F CD1 1 
ATOM   9342  C CD2 . TYR F 1 87  ? 96.539  -33.280 107.349 1.00 11.38 ? 315  TYR F CD2 1 
ATOM   9343  C CE1 . TYR F 1 87  ? 95.680  -32.221 104.933 1.00 12.09 ? 315  TYR F CE1 1 
ATOM   9344  C CE2 . TYR F 1 87  ? 97.427  -33.158 106.286 1.00 11.63 ? 315  TYR F CE2 1 
ATOM   9345  C CZ  . TYR F 1 87  ? 96.987  -32.625 105.075 1.00 12.13 ? 315  TYR F CZ  1 
ATOM   9346  O OH  . TYR F 1 87  ? 97.827  -32.496 103.991 1.00 11.52 ? 315  TYR F OH  1 
ATOM   9347  N N   . ARG F 1 88  ? 94.288  -36.093 109.059 1.00 12.18 ? 316  ARG F N   1 
ATOM   9348  C CA  . ARG F 1 88  ? 95.032  -37.346 109.068 1.00 11.98 ? 316  ARG F CA  1 
ATOM   9349  C C   . ARG F 1 88  ? 94.285  -38.508 108.432 1.00 11.85 ? 316  ARG F C   1 
ATOM   9350  O O   . ARG F 1 88  ? 94.899  -39.505 108.085 1.00 11.52 ? 316  ARG F O   1 
ATOM   9351  C CB  . ARG F 1 88  ? 95.421  -37.710 110.501 1.00 12.01 ? 316  ARG F CB  1 
ATOM   9352  C CG  . ARG F 1 88  ? 96.516  -36.803 111.067 1.00 12.30 ? 316  ARG F CG  1 
ATOM   9353  C CD  . ARG F 1 88  ? 97.141  -37.362 112.339 1.00 11.93 ? 316  ARG F CD  1 
ATOM   9354  N NE  . ARG F 1 88  ? 96.160  -37.523 113.411 1.00 11.75 ? 316  ARG F NE  1 
ATOM   9355  C CZ  . ARG F 1 88  ? 95.643  -36.519 114.116 1.00 11.44 ? 316  ARG F CZ  1 
ATOM   9356  N NH1 . ARG F 1 88  ? 95.993  -35.256 113.877 1.00 11.67 ? 316  ARG F NH1 1 
ATOM   9357  N NH2 . ARG F 1 88  ? 94.769  -36.778 115.074 1.00 12.00 ? 316  ARG F NH2 1 
ATOM   9358  N N   . SER F 1 89  ? 92.966  -38.380 108.279 1.00 12.03 ? 317  SER F N   1 
ATOM   9359  C CA  . SER F 1 89  ? 92.129  -39.472 107.763 1.00 11.80 ? 317  SER F CA  1 
ATOM   9360  C C   . SER F 1 89  ? 91.727  -39.350 106.281 1.00 12.07 ? 317  SER F C   1 
ATOM   9361  O O   . SER F 1 89  ? 91.078  -40.249 105.753 1.00 12.01 ? 317  SER F O   1 
ATOM   9362  C CB  . SER F 1 89  ? 90.882  -39.597 108.625 1.00 11.44 ? 317  SER F CB  1 
ATOM   9363  O OG  . SER F 1 89  ? 91.226  -39.655 109.991 1.00 10.50 ? 317  SER F OG  1 
ATOM   9364  N N   . LEU F 1 90  ? 92.116  -38.254 105.625 1.00 12.40 ? 318  LEU F N   1 
ATOM   9365  C CA  . LEU F 1 90  ? 91.786  -37.996 104.206 1.00 12.72 ? 318  LEU F CA  1 
ATOM   9366  C C   . LEU F 1 90  ? 92.143  -39.122 103.202 1.00 12.99 ? 318  LEU F C   1 
ATOM   9367  O O   . LEU F 1 90  ? 91.333  -39.466 102.332 1.00 12.88 ? 318  LEU F O   1 
ATOM   9368  C CB  . LEU F 1 90  ? 92.468  -36.707 103.719 1.00 12.67 ? 318  LEU F CB  1 
ATOM   9369  C CG  . LEU F 1 90  ? 92.040  -35.348 104.266 1.00 12.18 ? 318  LEU F CG  1 
ATOM   9370  C CD1 . LEU F 1 90  ? 92.841  -34.258 103.570 1.00 11.07 ? 318  LEU F CD1 1 
ATOM   9371  C CD2 . LEU F 1 90  ? 90.562  -35.116 104.086 1.00 11.88 ? 318  LEU F CD2 1 
ATOM   9372  N N   . SER F 1 91  ? 93.351  -39.674 103.291 1.00 13.11 ? 319  SER F N   1 
ATOM   9373  C CA  . SER F 1 91  ? 93.736  -40.760 102.378 1.00 13.44 ? 319  SER F CA  1 
ATOM   9374  C C   . SER F 1 91  ? 93.281  -42.143 102.888 1.00 13.45 ? 319  SER F C   1 
ATOM   9375  O O   . SER F 1 91  ? 93.866  -43.153 102.536 1.00 13.24 ? 319  SER F O   1 
ATOM   9376  C CB  . SER F 1 91  ? 95.243  -40.733 102.121 1.00 13.39 ? 319  SER F CB  1 
ATOM   9377  O OG  . SER F 1 91  ? 95.961  -40.849 103.336 1.00 14.24 ? 319  SER F OG  1 
ATOM   9378  N N   . PHE F 1 92  ? 92.222  -42.173 103.701 1.00 13.76 ? 320  PHE F N   1 
ATOM   9379  C CA  . PHE F 1 92  ? 91.677  -43.407 104.261 1.00 13.88 ? 320  PHE F CA  1 
ATOM   9380  C C   . PHE F 1 92  ? 90.181  -43.504 103.976 1.00 13.98 ? 320  PHE F C   1 
ATOM   9381  O O   . PHE F 1 92  ? 89.570  -42.575 103.458 1.00 13.55 ? 320  PHE F O   1 
ATOM   9382  C CB  . PHE F 1 92  ? 91.931  -43.470 105.771 1.00 14.16 ? 320  PHE F CB  1 
ATOM   9383  C CG  . PHE F 1 92  ? 93.345  -43.846 106.144 1.00 14.18 ? 320  PHE F CG  1 
ATOM   9384  C CD1 . PHE F 1 92  ? 94.350  -42.890 106.169 1.00 14.51 ? 320  PHE F CD1 1 
ATOM   9385  C CD2 . PHE F 1 92  ? 93.661  -45.151 106.494 1.00 14.50 ? 320  PHE F CD2 1 
ATOM   9386  C CE1 . PHE F 1 92  ? 95.655  -43.232 106.527 1.00 15.01 ? 320  PHE F CE1 1 
ATOM   9387  C CE2 . PHE F 1 92  ? 94.966  -45.507 106.851 1.00 14.78 ? 320  PHE F CE2 1 
ATOM   9388  C CZ  . PHE F 1 92  ? 95.963  -44.548 106.870 1.00 14.67 ? 320  PHE F CZ  1 
ATOM   9389  N N   . GLU F 1 93  ? 89.605  -44.648 104.322 1.00 14.47 ? 321  GLU F N   1 
ATOM   9390  C CA  . GLU F 1 93  ? 88.259  -45.002 103.907 1.00 14.89 ? 321  GLU F CA  1 
ATOM   9391  C C   . GLU F 1 93  ? 87.468  -45.520 105.105 1.00 14.66 ? 321  GLU F C   1 
ATOM   9392  O O   . GLU F 1 93  ? 87.727  -46.617 105.606 1.00 14.51 ? 321  GLU F O   1 
ATOM   9393  C CB  . GLU F 1 93  ? 88.321  -46.082 102.817 1.00 15.26 ? 321  GLU F CB  1 
ATOM   9394  C CG  . GLU F 1 93  ? 87.507  -45.763 101.561 1.00 17.03 ? 321  GLU F CG  1 
ATOM   9395  C CD  . GLU F 1 93  ? 88.369  -45.181 100.434 1.00 19.19 ? 321  GLU F CD  1 
ATOM   9396  O OE1 . GLU F 1 93  ? 89.216  -45.938 99.888  1.00 20.31 ? 321  GLU F OE1 1 
ATOM   9397  O OE2 . GLU F 1 93  ? 88.191  -43.980 100.098 1.00 18.98 ? 321  GLU F OE2 1 
ATOM   9398  N N   . ASP F 1 94  ? 86.521  -44.707 105.567 1.00 14.57 ? 322  ASP F N   1 
ATOM   9399  C CA  . ASP F 1 94  ? 85.632  -45.061 106.686 1.00 14.45 ? 322  ASP F CA  1 
ATOM   9400  C C   . ASP F 1 94  ? 86.407  -45.439 107.940 1.00 14.27 ? 322  ASP F C   1 
ATOM   9401  O O   . ASP F 1 94  ? 85.968  -46.263 108.742 1.00 14.22 ? 322  ASP F O   1 
ATOM   9402  C CB  . ASP F 1 94  ? 84.662  -46.164 106.264 1.00 14.44 ? 322  ASP F CB  1 
ATOM   9403  C CG  . ASP F 1 94  ? 83.898  -45.802 105.002 1.00 14.72 ? 322  ASP F CG  1 
ATOM   9404  O OD1 . ASP F 1 94  ? 83.463  -44.634 104.877 1.00 14.96 ? 322  ASP F OD1 1 
ATOM   9405  O OD2 . ASP F 1 94  ? 83.746  -46.674 104.126 1.00 15.08 ? 322  ASP F OD2 1 
ATOM   9406  N N   . GLU F 1 95  ? 87.565  -44.799 108.087 1.00 14.23 ? 323  GLU F N   1 
ATOM   9407  C CA  . GLU F 1 95  ? 88.466  -45.002 109.207 1.00 14.15 ? 323  GLU F CA  1 
ATOM   9408  C C   . GLU F 1 95  ? 88.980  -43.627 109.618 1.00 13.50 ? 323  GLU F C   1 
ATOM   9409  O O   . GLU F 1 95  ? 89.261  -42.780 108.768 1.00 12.88 ? 323  GLU F O   1 
ATOM   9410  C CB  . GLU F 1 95  ? 89.641  -45.908 108.814 1.00 14.26 ? 323  GLU F CB  1 
ATOM   9411  C CG  . GLU F 1 95  ? 89.294  -47.387 108.616 1.00 14.86 ? 323  GLU F CG  1 
ATOM   9412  C CD  . GLU F 1 95  ? 90.471  -48.197 108.059 1.00 15.25 ? 323  GLU F CD  1 
ATOM   9413  O OE1 . GLU F 1 95  ? 91.064  -47.769 107.041 1.00 17.21 ? 323  GLU F OE1 1 
ATOM   9414  O OE2 . GLU F 1 95  ? 90.805  -49.262 108.630 1.00 16.06 ? 323  GLU F OE2 1 
ATOM   9415  N N   . LEU F 1 96  ? 89.083  -43.419 110.926 1.00 13.28 ? 324  LEU F N   1 
ATOM   9416  C CA  . LEU F 1 96  ? 89.557  -42.166 111.484 1.00 13.08 ? 324  LEU F CA  1 
ATOM   9417  C C   . LEU F 1 96  ? 90.906  -42.394 112.143 1.00 13.04 ? 324  LEU F C   1 
ATOM   9418  O O   . LEU F 1 96  ? 91.028  -43.229 113.033 1.00 13.03 ? 324  LEU F O   1 
ATOM   9419  C CB  . LEU F 1 96  ? 88.548  -41.629 112.497 1.00 12.97 ? 324  LEU F CB  1 
ATOM   9420  C CG  . LEU F 1 96  ? 87.255  -41.067 111.897 1.00 12.62 ? 324  LEU F CG  1 
ATOM   9421  C CD1 . LEU F 1 96  ? 86.277  -40.712 113.005 1.00 11.97 ? 324  LEU F CD1 1 
ATOM   9422  C CD2 . LEU F 1 96  ? 87.532  -39.856 111.006 1.00 11.72 ? 324  LEU F CD2 1 
ATOM   9423  N N   . VAL F 1 97  ? 91.915  -41.653 111.698 1.00 12.99 ? 325  VAL F N   1 
ATOM   9424  C CA  . VAL F 1 97  ? 93.274  -41.823 112.193 1.00 13.07 ? 325  VAL F CA  1 
ATOM   9425  C C   . VAL F 1 97  ? 93.542  -40.875 113.355 1.00 12.99 ? 325  VAL F C   1 
ATOM   9426  O O   . VAL F 1 97  ? 94.038  -39.776 113.165 1.00 13.34 ? 325  VAL F O   1 
ATOM   9427  C CB  . VAL F 1 97  ? 94.318  -41.561 111.081 1.00 13.08 ? 325  VAL F CB  1 
ATOM   9428  C CG1 . VAL F 1 97  ? 95.718  -41.873 111.582 1.00 13.21 ? 325  VAL F CG1 1 
ATOM   9429  C CG2 . VAL F 1 97  ? 94.003  -42.382 109.846 1.00 13.18 ? 325  VAL F CG2 1 
ATOM   9430  N N   . TYR F 1 98  ? 93.210  -41.297 114.563 1.00 13.01 ? 326  TYR F N   1 
ATOM   9431  C CA  . TYR F 1 98  ? 93.551  -40.515 115.743 1.00 13.10 ? 326  TYR F CA  1 
ATOM   9432  C C   . TYR F 1 98  ? 95.069  -40.426 115.935 1.00 13.12 ? 326  TYR F C   1 
ATOM   9433  O O   . TYR F 1 98  ? 95.574  -39.433 116.446 1.00 13.39 ? 326  TYR F O   1 
ATOM   9434  C CB  . TYR F 1 98  ? 92.848  -41.090 116.968 1.00 13.20 ? 326  TYR F CB  1 
ATOM   9435  C CG  . TYR F 1 98  ? 91.384  -40.770 116.945 1.00 13.59 ? 326  TYR F CG  1 
ATOM   9436  C CD1 . TYR F 1 98  ? 90.942  -39.505 117.300 1.00 14.84 ? 326  TYR F CD1 1 
ATOM   9437  C CD2 . TYR F 1 98  ? 90.440  -41.698 116.523 1.00 13.49 ? 326  TYR F CD2 1 
ATOM   9438  C CE1 . TYR F 1 98  ? 89.600  -39.172 117.266 1.00 14.05 ? 326  TYR F CE1 1 
ATOM   9439  C CE2 . TYR F 1 98  ? 89.083  -41.377 116.493 1.00 13.30 ? 326  TYR F CE2 1 
ATOM   9440  C CZ  . TYR F 1 98  ? 88.675  -40.108 116.873 1.00 14.02 ? 326  TYR F CZ  1 
ATOM   9441  O OH  . TYR F 1 98  ? 87.344  -39.749 116.860 1.00 14.60 ? 326  TYR F OH  1 
ATOM   9442  N N   . ALA F 1 99  ? 95.781  -41.470 115.520 1.00 13.16 ? 327  ALA F N   1 
ATOM   9443  C CA  . ALA F 1 99  ? 97.250  -41.475 115.450 1.00 13.23 ? 327  ALA F CA  1 
ATOM   9444  C C   . ALA F 1 99  ? 97.694  -42.679 114.613 1.00 13.30 ? 327  ALA F C   1 
ATOM   9445  O O   . ALA F 1 99  ? 96.917  -43.612 114.408 1.00 13.17 ? 327  ALA F O   1 
ATOM   9446  C CB  . ALA F 1 99  ? 97.863  -41.531 116.839 1.00 13.03 ? 327  ALA F CB  1 
ATOM   9447  N N   . ASP F 1 100 ? 98.929  -42.671 114.125 1.00 13.44 ? 328  ASP F N   1 
ATOM   9448  C CA  . ASP F 1 100 ? 99.402  -43.776 113.282 1.00 13.76 ? 328  ASP F CA  1 
ATOM   9449  C C   . ASP F 1 100 ? 99.115  -45.144 113.928 1.00 13.62 ? 328  ASP F C   1 
ATOM   9450  O O   . ASP F 1 100 ? 98.737  -46.106 113.249 1.00 13.64 ? 328  ASP F O   1 
ATOM   9451  C CB  . ASP F 1 100 ? 100.901 -43.629 112.971 1.00 13.93 ? 328  ASP F CB  1 
ATOM   9452  C CG  . ASP F 1 100 ? 101.199 -42.512 111.958 1.00 14.68 ? 328  ASP F CG  1 
ATOM   9453  O OD1 . ASP F 1 100 ? 100.288 -42.113 111.197 1.00 14.51 ? 328  ASP F OD1 1 
ATOM   9454  O OD2 . ASP F 1 100 ? 102.361 -42.039 111.919 1.00 15.77 ? 328  ASP F OD2 1 
ATOM   9455  N N   . ASP F 1 101 ? 99.262  -45.202 115.246 1.00 13.44 ? 329  ASP F N   1 
ATOM   9456  C CA  . ASP F 1 101 ? 99.031  -46.416 116.020 1.00 13.26 ? 329  ASP F CA  1 
ATOM   9457  C C   . ASP F 1 101 ? 97.634  -46.488 116.638 1.00 13.38 ? 329  ASP F C   1 
ATOM   9458  O O   . ASP F 1 101 ? 97.418  -47.230 117.596 1.00 13.23 ? 329  ASP F O   1 
ATOM   9459  C CB  . ASP F 1 101 ? 100.053 -46.470 117.144 1.00 13.31 ? 329  ASP F CB  1 
ATOM   9460  C CG  . ASP F 1 101 ? 99.923  -45.301 118.098 1.00 12.62 ? 329  ASP F CG  1 
ATOM   9461  O OD1 . ASP F 1 101 ? 99.315  -44.279 117.711 1.00 11.40 ? 329  ASP F OD1 1 
ATOM   9462  O OD2 . ASP F 1 101 ? 100.436 -45.406 119.227 1.00 12.38 ? 329  ASP F OD2 1 
ATOM   9463  N N   . TYR F 1 102 ? 96.694  -45.705 116.118 1.00 13.59 ? 330  TYR F N   1 
ATOM   9464  C CA  . TYR F 1 102 ? 95.329  -45.733 116.623 1.00 13.67 ? 330  TYR F CA  1 
ATOM   9465  C C   . TYR F 1 102 ? 94.322  -45.225 115.588 1.00 13.86 ? 330  TYR F C   1 
ATOM   9466  O O   . TYR F 1 102 ? 93.980  -44.045 115.541 1.00 13.63 ? 330  TYR F O   1 
ATOM   9467  C CB  . TYR F 1 102 ? 95.210  -44.964 117.950 1.00 13.73 ? 330  TYR F CB  1 
ATOM   9468  C CG  . TYR F 1 102 ? 94.044  -45.442 118.766 1.00 13.34 ? 330  TYR F CG  1 
ATOM   9469  C CD1 . TYR F 1 102 ? 94.027  -46.729 119.276 1.00 13.42 ? 330  TYR F CD1 1 
ATOM   9470  C CD2 . TYR F 1 102 ? 92.948  -44.631 118.995 1.00 13.60 ? 330  TYR F CD2 1 
ATOM   9471  C CE1 . TYR F 1 102 ? 92.961  -47.197 120.004 1.00 13.99 ? 330  TYR F CE1 1 
ATOM   9472  C CE2 . TYR F 1 102 ? 91.862  -45.091 119.720 1.00 13.93 ? 330  TYR F CE2 1 
ATOM   9473  C CZ  . TYR F 1 102 ? 91.877  -46.379 120.226 1.00 13.84 ? 330  TYR F CZ  1 
ATOM   9474  O OH  . TYR F 1 102 ? 90.813  -46.863 120.950 1.00 13.56 ? 330  TYR F OH  1 
ATOM   9475  N N   . ILE F 1 103 ? 93.842  -46.162 114.777 1.00 14.22 ? 331  ILE F N   1 
ATOM   9476  C CA  . ILE F 1 103 ? 92.887  -45.895 113.709 1.00 14.41 ? 331  ILE F CA  1 
ATOM   9477  C C   . ILE F 1 103 ? 91.550  -46.594 114.021 1.00 14.84 ? 331  ILE F C   1 
ATOM   9478  O O   . ILE F 1 103 ? 91.536  -47.782 114.338 1.00 14.97 ? 331  ILE F O   1 
ATOM   9479  C CB  . ILE F 1 103 ? 93.455  -46.427 112.380 1.00 14.33 ? 331  ILE F CB  1 
ATOM   9480  C CG1 . ILE F 1 103 ? 94.909  -45.963 112.202 1.00 13.97 ? 331  ILE F CG1 1 
ATOM   9481  C CG2 . ILE F 1 103 ? 92.590  -45.979 111.213 1.00 14.37 ? 331  ILE F CG2 1 
ATOM   9482  C CD1 . ILE F 1 103 ? 95.615  -46.577 111.035 1.00 12.94 ? 331  ILE F CD1 1 
ATOM   9483  N N   . MET F 1 104 ? 90.432  -45.872 113.939 1.00 15.34 ? 332  MET F N   1 
ATOM   9484  C CA  . MET F 1 104 ? 89.114  -46.443 114.294 1.00 15.83 ? 332  MET F CA  1 
ATOM   9485  C C   . MET F 1 104 ? 88.214  -46.755 113.087 1.00 16.10 ? 332  MET F C   1 
ATOM   9486  O O   . MET F 1 104 ? 87.797  -45.845 112.369 1.00 15.88 ? 332  MET F O   1 
ATOM   9487  C CB  . MET F 1 104 ? 88.368  -45.507 115.247 1.00 15.71 ? 332  MET F CB  1 
ATOM   9488  C CG  . MET F 1 104 ? 89.089  -45.281 116.563 1.00 16.00 ? 332  MET F CG  1 
ATOM   9489  S SD  . MET F 1 104 ? 88.113  -44.385 117.787 1.00 16.71 ? 332  MET F SD  1 
ATOM   9490  C CE  . MET F 1 104 ? 86.985  -45.652 118.383 1.00 14.92 ? 332  MET F CE  1 
ATOM   9491  N N   . ASP F 1 105 ? 87.924  -48.046 112.881 1.00 16.68 ? 333  ASP F N   1 
ATOM   9492  C CA  . ASP F 1 105 ? 86.935  -48.495 111.876 1.00 17.03 ? 333  ASP F CA  1 
ATOM   9493  C C   . ASP F 1 105 ? 85.559  -48.621 112.527 1.00 17.13 ? 333  ASP F C   1 
ATOM   9494  O O   . ASP F 1 105 ? 85.440  -48.570 113.757 1.00 17.05 ? 333  ASP F O   1 
ATOM   9495  C CB  . ASP F 1 105 ? 87.356  -49.819 111.188 1.00 17.15 ? 333  ASP F CB  1 
ATOM   9496  C CG  . ASP F 1 105 ? 87.368  -51.028 112.135 1.00 17.65 ? 333  ASP F CG  1 
ATOM   9497  O OD1 . ASP F 1 105 ? 86.753  -50.974 113.226 1.00 18.64 ? 333  ASP F OD1 1 
ATOM   9498  O OD2 . ASP F 1 105 ? 88.000  -52.050 111.778 1.00 17.89 ? 333  ASP F OD2 1 
ATOM   9499  N N   . GLU F 1 106 ? 84.522  -48.794 111.712 1.00 17.49 ? 334  GLU F N   1 
ATOM   9500  C CA  . GLU F 1 106 ? 83.148  -48.725 112.227 1.00 17.80 ? 334  GLU F CA  1 
ATOM   9501  C C   . GLU F 1 106 ? 82.958  -49.610 113.467 1.00 18.07 ? 334  GLU F C   1 
ATOM   9502  O O   . GLU F 1 106 ? 82.326  -49.193 114.441 1.00 18.22 ? 334  GLU F O   1 
ATOM   9503  C CB  . GLU F 1 106 ? 82.113  -49.071 111.150 1.00 17.67 ? 334  GLU F CB  1 
ATOM   9504  C CG  . GLU F 1 106 ? 80.678  -48.785 111.587 1.00 17.75 ? 334  GLU F CG  1 
ATOM   9505  C CD  . GLU F 1 106 ? 79.656  -48.999 110.478 1.00 17.80 ? 334  GLU F CD  1 
ATOM   9506  O OE1 . GLU F 1 106 ? 79.412  -50.166 110.097 1.00 17.49 ? 334  GLU F OE1 1 
ATOM   9507  O OE2 . GLU F 1 106 ? 79.087  -47.995 110.001 1.00 17.15 ? 334  GLU F OE2 1 
ATOM   9508  N N   . ASP F 1 107 ? 83.520  -50.814 113.442 1.00 18.25 ? 335  ASP F N   1 
ATOM   9509  C CA  . ASP F 1 107 ? 83.369  -51.720 114.577 1.00 18.50 ? 335  ASP F CA  1 
ATOM   9510  C C   . ASP F 1 107 ? 84.041  -51.172 115.827 1.00 18.66 ? 335  ASP F C   1 
ATOM   9511  O O   . ASP F 1 107 ? 83.423  -51.165 116.895 1.00 18.83 ? 335  ASP F O   1 
ATOM   9512  C CB  . ASP F 1 107 ? 83.882  -53.121 114.247 1.00 18.47 ? 335  ASP F CB  1 
ATOM   9513  C CG  . ASP F 1 107 ? 82.962  -53.866 113.287 1.00 18.72 ? 335  ASP F CG  1 
ATOM   9514  O OD1 . ASP F 1 107 ? 81.924  -53.311 112.860 1.00 18.87 ? 335  ASP F OD1 1 
ATOM   9515  O OD2 . ASP F 1 107 ? 83.281  -55.019 112.957 1.00 19.36 ? 335  ASP F OD2 1 
ATOM   9516  N N   . GLN F 1 108 ? 85.280  -50.691 115.695 1.00 18.74 ? 336  GLN F N   1 
ATOM   9517  C CA  . GLN F 1 108 ? 85.969  -50.051 116.827 1.00 18.84 ? 336  GLN F CA  1 
ATOM   9518  C C   . GLN F 1 108 ? 85.137  -48.919 117.414 1.00 18.75 ? 336  GLN F C   1 
ATOM   9519  O O   . GLN F 1 108 ? 85.021  -48.798 118.634 1.00 18.61 ? 336  GLN F O   1 
ATOM   9520  C CB  . GLN F 1 108 ? 87.359  -49.525 116.442 1.00 18.96 ? 336  GLN F CB  1 
ATOM   9521  C CG  . GLN F 1 108 ? 88.519  -50.466 116.824 1.00 19.89 ? 336  GLN F CG  1 
ATOM   9522  C CD  . GLN F 1 108 ? 88.967  -51.373 115.688 1.00 20.60 ? 336  GLN F CD  1 
ATOM   9523  O OE1 . GLN F 1 108 ? 89.260  -50.907 114.586 1.00 21.78 ? 336  GLN F OE1 1 
ATOM   9524  N NE2 . GLN F 1 108 ? 89.047  -52.668 115.960 1.00 19.95 ? 336  GLN F NE2 1 
ATOM   9525  N N   . SER F 1 109 ? 84.546  -48.103 116.545 1.00 18.87 ? 337  SER F N   1 
ATOM   9526  C CA  . SER F 1 109 ? 83.697  -47.001 116.999 1.00 19.01 ? 337  SER F CA  1 
ATOM   9527  C C   . SER F 1 109 ? 82.463  -47.498 117.756 1.00 19.22 ? 337  SER F C   1 
ATOM   9528  O O   . SER F 1 109 ? 82.117  -46.948 118.805 1.00 19.29 ? 337  SER F O   1 
ATOM   9529  C CB  . SER F 1 109 ? 83.287  -46.108 115.832 1.00 18.88 ? 337  SER F CB  1 
ATOM   9530  O OG  . SER F 1 109 ? 84.406  -45.392 115.351 1.00 18.96 ? 337  SER F OG  1 
ATOM   9531  N N   . LYS F 1 110 ? 81.813  -48.541 117.242 1.00 19.50 ? 338  LYS F N   1 
ATOM   9532  C CA  . LYS F 1 110 ? 80.620  -49.097 117.903 1.00 19.84 ? 338  LYS F CA  1 
ATOM   9533  C C   . LYS F 1 110 ? 80.921  -49.528 119.345 1.00 19.65 ? 338  LYS F C   1 
ATOM   9534  O O   . LYS F 1 110 ? 80.213  -49.123 120.271 1.00 19.55 ? 338  LYS F O   1 
ATOM   9535  C CB  . LYS F 1 110 ? 80.025  -50.258 117.093 1.00 19.98 ? 338  LYS F CB  1 
ATOM   9536  C CG  . LYS F 1 110 ? 79.129  -49.795 115.946 1.00 20.47 ? 338  LYS F CG  1 
ATOM   9537  C CD  . LYS F 1 110 ? 78.764  -50.940 114.989 1.00 20.74 ? 338  LYS F CD  1 
ATOM   9538  C CE  . LYS F 1 110 ? 77.630  -50.528 114.027 1.00 21.19 ? 338  LYS F CE  1 
ATOM   9539  N NZ  . LYS F 1 110 ? 77.238  -51.611 113.078 1.00 21.21 ? 338  LYS F NZ  1 
ATOM   9540  N N   . LEU F 1 111 ? 81.987  -50.313 119.522 1.00 19.60 ? 339  LEU F N   1 
ATOM   9541  C CA  . LEU F 1 111 ? 82.412  -50.782 120.849 1.00 19.63 ? 339  LEU F CA  1 
ATOM   9542  C C   . LEU F 1 111 ? 82.678  -49.650 121.837 1.00 19.54 ? 339  LEU F C   1 
ATOM   9543  O O   . LEU F 1 111 ? 82.424  -49.802 123.031 1.00 19.55 ? 339  LEU F O   1 
ATOM   9544  C CB  . LEU F 1 111 ? 83.676  -51.638 120.751 1.00 19.73 ? 339  LEU F CB  1 
ATOM   9545  C CG  . LEU F 1 111 ? 83.611  -52.948 119.958 1.00 20.43 ? 339  LEU F CG  1 
ATOM   9546  C CD1 . LEU F 1 111 ? 84.761  -53.867 120.398 1.00 20.82 ? 339  LEU F CD1 1 
ATOM   9547  C CD2 . LEU F 1 111 ? 82.259  -53.671 120.094 1.00 20.64 ? 339  LEU F CD2 1 
ATOM   9548  N N   . ALA F 1 112 ? 83.191  -48.525 121.333 1.00 19.48 ? 340  ALA F N   1 
ATOM   9549  C CA  . ALA F 1 112 ? 83.487  -47.345 122.159 1.00 19.26 ? 340  ALA F CA  1 
ATOM   9550  C C   . ALA F 1 112 ? 82.258  -46.463 122.435 1.00 19.16 ? 340  ALA F C   1 
ATOM   9551  O O   . ALA F 1 112 ? 82.371  -45.432 123.109 1.00 19.00 ? 340  ALA F O   1 
ATOM   9552  C CB  . ALA F 1 112 ? 84.580  -46.514 121.498 1.00 19.14 ? 340  ALA F CB  1 
ATOM   9553  N N   . GLY F 1 113 ? 81.092  -46.865 121.923 1.00 19.04 ? 341  GLY F N   1 
ATOM   9554  C CA  . GLY F 1 113 ? 79.889  -46.036 121.996 1.00 19.01 ? 341  GLY F CA  1 
ATOM   9555  C C   . GLY F 1 113 ? 80.080  -44.692 121.310 1.00 18.91 ? 341  GLY F C   1 
ATOM   9556  O O   . GLY F 1 113 ? 79.518  -43.690 121.750 1.00 18.97 ? 341  GLY F O   1 
ATOM   9557  N N   . LEU F 1 114 ? 80.879  -44.691 120.237 1.00 18.75 ? 342  LEU F N   1 
ATOM   9558  C CA  . LEU F 1 114 ? 81.250  -43.482 119.493 1.00 18.64 ? 342  LEU F CA  1 
ATOM   9559  C C   . LEU F 1 114 ? 80.798  -43.542 118.020 1.00 18.66 ? 342  LEU F C   1 
ATOM   9560  O O   . LEU F 1 114 ? 81.294  -42.781 117.186 1.00 18.78 ? 342  LEU F O   1 
ATOM   9561  C CB  . LEU F 1 114 ? 82.777  -43.261 119.561 1.00 18.46 ? 342  LEU F CB  1 
ATOM   9562  C CG  . LEU F 1 114 ? 83.379  -42.550 120.781 1.00 17.97 ? 342  LEU F CG  1 
ATOM   9563  C CD1 . LEU F 1 114 ? 84.900  -42.577 120.706 1.00 17.57 ? 342  LEU F CD1 1 
ATOM   9564  C CD2 . LEU F 1 114 ? 82.888  -41.112 120.915 1.00 16.82 ? 342  LEU F CD2 1 
ATOM   9565  N N   . LEU F 1 115 ? 79.854  -44.426 117.700 1.00 18.62 ? 343  LEU F N   1 
ATOM   9566  C CA  . LEU F 1 115 ? 79.412  -44.603 116.312 1.00 18.55 ? 343  LEU F CA  1 
ATOM   9567  C C   . LEU F 1 115 ? 78.849  -43.325 115.711 1.00 18.56 ? 343  LEU F C   1 
ATOM   9568  O O   . LEU F 1 115 ? 79.172  -42.989 114.577 1.00 18.95 ? 343  LEU F O   1 
ATOM   9569  C CB  . LEU F 1 115 ? 78.367  -45.720 116.199 1.00 18.59 ? 343  LEU F CB  1 
ATOM   9570  C CG  . LEU F 1 115 ? 77.614  -45.852 114.865 1.00 18.54 ? 343  LEU F CG  1 
ATOM   9571  C CD1 . LEU F 1 115 ? 78.553  -45.909 113.656 1.00 18.23 ? 343  LEU F CD1 1 
ATOM   9572  C CD2 . LEU F 1 115 ? 76.723  -47.081 114.911 1.00 18.55 ? 343  LEU F CD2 1 
ATOM   9573  N N   . ASP F 1 116 ? 78.001  -42.621 116.454 1.00 18.43 ? 344  ASP F N   1 
ATOM   9574  C CA  . ASP F 1 116 ? 77.379  -41.407 115.928 1.00 18.35 ? 344  ASP F CA  1 
ATOM   9575  C C   . ASP F 1 116 ? 78.400  -40.278 115.792 1.00 17.73 ? 344  ASP F C   1 
ATOM   9576  O O   . ASP F 1 116 ? 78.428  -39.575 114.771 1.00 18.04 ? 344  ASP F O   1 
ATOM   9577  C CB  . ASP F 1 116 ? 76.174  -40.987 116.785 1.00 18.70 ? 344  ASP F CB  1 
ATOM   9578  C CG  . ASP F 1 116 ? 74.984  -41.968 116.663 1.00 20.12 ? 344  ASP F CG  1 
ATOM   9579  O OD1 . ASP F 1 116 ? 74.927  -42.728 115.669 1.00 20.88 ? 344  ASP F OD1 1 
ATOM   9580  O OD2 . ASP F 1 116 ? 74.101  -41.979 117.561 1.00 22.07 ? 344  ASP F OD2 1 
ATOM   9581  N N   . LEU F 1 117 ? 79.260  -40.130 116.796 1.00 16.88 ? 345  LEU F N   1 
ATOM   9582  C CA  . LEU F 1 117 ? 80.238  -39.032 116.827 1.00 16.19 ? 345  LEU F CA  1 
ATOM   9583  C C   . LEU F 1 117 ? 81.307  -39.144 115.734 1.00 15.84 ? 345  LEU F C   1 
ATOM   9584  O O   . LEU F 1 117 ? 81.637  -38.160 115.070 1.00 15.57 ? 345  LEU F O   1 
ATOM   9585  C CB  . LEU F 1 117 ? 80.899  -38.972 118.207 1.00 15.96 ? 345  LEU F CB  1 
ATOM   9586  C CG  . LEU F 1 117 ? 81.726  -37.745 118.577 1.00 15.44 ? 345  LEU F CG  1 
ATOM   9587  C CD1 . LEU F 1 117 ? 81.335  -36.491 117.799 1.00 14.99 ? 345  LEU F CD1 1 
ATOM   9588  C CD2 . LEU F 1 117 ? 81.587  -37.524 120.069 1.00 14.65 ? 345  LEU F CD2 1 
ATOM   9589  N N   . ASN F 1 118 ? 81.850  -40.346 115.565 1.00 15.55 ? 346  ASN F N   1 
ATOM   9590  C CA  . ASN F 1 118 ? 82.857  -40.591 114.536 1.00 15.38 ? 346  ASN F CA  1 
ATOM   9591  C C   . ASN F 1 118 ? 82.238  -40.505 113.144 1.00 15.18 ? 346  ASN F C   1 
ATOM   9592  O O   . ASN F 1 118 ? 82.876  -40.023 112.207 1.00 15.22 ? 346  ASN F O   1 
ATOM   9593  C CB  . ASN F 1 118 ? 83.580  -41.936 114.750 1.00 15.33 ? 346  ASN F CB  1 
ATOM   9594  C CG  . ASN F 1 118 ? 84.683  -41.857 115.817 1.00 15.53 ? 346  ASN F CG  1 
ATOM   9595  O OD1 . ASN F 1 118 ? 84.997  -40.783 116.327 1.00 15.67 ? 346  ASN F OD1 1 
ATOM   9596  N ND2 . ASN F 1 118 ? 85.268  -43.002 116.154 1.00 15.50 ? 346  ASN F ND2 1 
ATOM   9597  N N   . ASN F 1 119 ? 80.990  -40.938 113.010 1.00 14.91 ? 347  ASN F N   1 
ATOM   9598  C CA  . ASN F 1 119 ? 80.271  -40.750 111.749 1.00 14.88 ? 347  ASN F CA  1 
ATOM   9599  C C   . ASN F 1 119 ? 80.190  -39.293 111.349 1.00 14.88 ? 347  ASN F C   1 
ATOM   9600  O O   . ASN F 1 119 ? 80.276  -38.962 110.168 1.00 14.74 ? 347  ASN F O   1 
ATOM   9601  C CB  . ASN F 1 119 ? 78.856  -41.300 111.835 1.00 14.85 ? 347  ASN F CB  1 
ATOM   9602  C CG  . ASN F 1 119 ? 78.774  -42.715 111.403 1.00 14.73 ? 347  ASN F CG  1 
ATOM   9603  O OD1 . ASN F 1 119 ? 79.513  -43.140 110.516 1.00 16.22 ? 347  ASN F OD1 1 
ATOM   9604  N ND2 . ASN F 1 119 ? 77.872  -43.469 112.014 1.00 14.18 ? 347  ASN F ND2 1 
ATOM   9605  N N   . ALA F 1 120 ? 80.002  -38.438 112.351 1.00 15.07 ? 348  ALA F N   1 
ATOM   9606  C CA  . ALA F 1 120 ? 79.915  -36.998 112.148 1.00 15.19 ? 348  ALA F CA  1 
ATOM   9607  C C   . ALA F 1 120 ? 81.278  -36.429 111.762 1.00 15.26 ? 348  ALA F C   1 
ATOM   9608  O O   . ALA F 1 120 ? 81.380  -35.423 111.063 1.00 15.40 ? 348  ALA F O   1 
ATOM   9609  C CB  . ALA F 1 120 ? 79.397  -36.332 113.402 1.00 15.12 ? 348  ALA F CB  1 
ATOM   9610  N N   . ILE F 1 121 ? 82.328  -37.080 112.221 1.00 15.22 ? 349  ILE F N   1 
ATOM   9611  C CA  . ILE F 1 121 ? 83.661  -36.656 111.874 1.00 15.26 ? 349  ILE F CA  1 
ATOM   9612  C C   . ILE F 1 121 ? 83.983  -37.130 110.458 1.00 15.39 ? 349  ILE F C   1 
ATOM   9613  O O   . ILE F 1 121 ? 84.649  -36.416 109.697 1.00 15.38 ? 349  ILE F O   1 
ATOM   9614  C CB  . ILE F 1 121 ? 84.668  -37.163 112.922 1.00 15.44 ? 349  ILE F CB  1 
ATOM   9615  C CG1 . ILE F 1 121 ? 84.415  -36.419 114.246 1.00 15.50 ? 349  ILE F CG1 1 
ATOM   9616  C CG2 . ILE F 1 121 ? 86.106  -36.995 112.432 1.00 14.44 ? 349  ILE F CG2 1 
ATOM   9617  C CD1 . ILE F 1 121 ? 85.118  -37.009 115.448 1.00 16.11 ? 349  ILE F CD1 1 
ATOM   9618  N N   . LEU F 1 122 ? 83.482  -38.313 110.096 1.00 15.25 ? 350  LEU F N   1 
ATOM   9619  C CA  . LEU F 1 122 ? 83.684  -38.850 108.749 1.00 15.31 ? 350  LEU F CA  1 
ATOM   9620  C C   . LEU F 1 122 ? 82.962  -38.014 107.689 1.00 15.53 ? 350  LEU F C   1 
ATOM   9621  O O   . LEU F 1 122 ? 83.291  -38.076 106.499 1.00 15.39 ? 350  LEU F O   1 
ATOM   9622  C CB  . LEU F 1 122 ? 83.203  -40.298 108.660 1.00 15.33 ? 350  LEU F CB  1 
ATOM   9623  C CG  . LEU F 1 122 ? 84.070  -41.429 109.221 1.00 15.16 ? 350  LEU F CG  1 
ATOM   9624  C CD1 . LEU F 1 122 ? 83.383  -42.746 108.911 1.00 15.09 ? 350  LEU F CD1 1 
ATOM   9625  C CD2 . LEU F 1 122 ? 85.477  -41.417 108.650 1.00 14.55 ? 350  LEU F CD2 1 
ATOM   9626  N N   . GLN F 1 123 ? 81.968  -37.249 108.129 1.00 15.85 ? 351  GLN F N   1 
ATOM   9627  C CA  . GLN F 1 123 ? 81.220  -36.368 107.249 1.00 16.22 ? 351  GLN F CA  1 
ATOM   9628  C C   . GLN F 1 123 ? 82.140  -35.217 106.819 1.00 16.13 ? 351  GLN F C   1 
ATOM   9629  O O   . GLN F 1 123 ? 82.145  -34.814 105.659 1.00 16.13 ? 351  GLN F O   1 
ATOM   9630  C CB  . GLN F 1 123 ? 79.944  -35.874 107.955 1.00 16.03 ? 351  GLN F CB  1 
ATOM   9631  C CG  . GLN F 1 123 ? 78.735  -35.592 107.039 1.00 16.57 ? 351  GLN F CG  1 
ATOM   9632  C CD  . GLN F 1 123 ? 77.578  -34.898 107.792 1.00 17.36 ? 351  GLN F CD  1 
ATOM   9633  O OE1 . GLN F 1 123 ? 77.351  -35.160 108.978 1.00 19.98 ? 351  GLN F OE1 1 
ATOM   9634  N NE2 . GLN F 1 123 ? 76.857  -34.004 107.107 1.00 17.63 ? 351  GLN F NE2 1 
ATOM   9635  N N   . LEU F 1 124 ? 82.937  -34.716 107.758 1.00 16.29 ? 352  LEU F N   1 
ATOM   9636  C CA  . LEU F 1 124 ? 83.974  -33.737 107.446 1.00 16.46 ? 352  LEU F CA  1 
ATOM   9637  C C   . LEU F 1 124 ? 85.078  -34.351 106.590 1.00 16.18 ? 352  LEU F C   1 
ATOM   9638  O O   . LEU F 1 124 ? 85.562  -33.714 105.671 1.00 16.17 ? 352  LEU F O   1 
ATOM   9639  C CB  . LEU F 1 124 ? 84.590  -33.170 108.725 1.00 16.80 ? 352  LEU F CB  1 
ATOM   9640  C CG  . LEU F 1 124 ? 83.678  -32.281 109.574 1.00 17.35 ? 352  LEU F CG  1 
ATOM   9641  C CD1 . LEU F 1 124 ? 83.935  -32.489 111.067 1.00 18.14 ? 352  LEU F CD1 1 
ATOM   9642  C CD2 . LEU F 1 124 ? 83.842  -30.807 109.182 1.00 18.34 ? 352  LEU F CD2 1 
ATOM   9643  N N   . VAL F 1 125 ? 85.482  -35.581 106.888 1.00 16.01 ? 353  VAL F N   1 
ATOM   9644  C CA  . VAL F 1 125 ? 86.506  -36.244 106.072 1.00 16.01 ? 353  VAL F CA  1 
ATOM   9645  C C   . VAL F 1 125 ? 86.028  -36.327 104.629 1.00 16.45 ? 353  VAL F C   1 
ATOM   9646  O O   . VAL F 1 125 ? 86.761  -35.990 103.703 1.00 16.71 ? 353  VAL F O   1 
ATOM   9647  C CB  . VAL F 1 125 ? 86.855  -37.674 106.567 1.00 15.66 ? 353  VAL F CB  1 
ATOM   9648  C CG1 . VAL F 1 125 ? 87.855  -38.337 105.630 1.00 15.10 ? 353  VAL F CG1 1 
ATOM   9649  C CG2 . VAL F 1 125 ? 87.416  -37.632 107.963 1.00 15.03 ? 353  VAL F CG2 1 
ATOM   9650  N N   . LYS F 1 126 ? 84.788  -36.770 104.453 1.00 16.93 ? 354  LYS F N   1 
ATOM   9651  C CA  . LYS F 1 126 ? 84.219  -36.980 103.128 1.00 17.24 ? 354  LYS F CA  1 
ATOM   9652  C C   . LYS F 1 126 ? 84.203  -35.688 102.337 1.00 17.11 ? 354  LYS F C   1 
ATOM   9653  O O   . LYS F 1 126 ? 84.556  -35.664 101.152 1.00 17.37 ? 354  LYS F O   1 
ATOM   9654  C CB  . LYS F 1 126 ? 82.797  -37.512 103.248 1.00 17.53 ? 354  LYS F CB  1 
ATOM   9655  C CG  . LYS F 1 126 ? 82.208  -37.990 101.935 1.00 18.90 ? 354  LYS F CG  1 
ATOM   9656  C CD  . LYS F 1 126 ? 80.697  -37.939 101.991 1.00 21.02 ? 354  LYS F CD  1 
ATOM   9657  C CE  . LYS F 1 126 ? 80.085  -38.501 100.719 1.00 22.95 ? 354  LYS F CE  1 
ATOM   9658  N NZ  . LYS F 1 126 ? 78.685  -37.990 100.518 1.00 24.22 ? 354  LYS F NZ  1 
ATOM   9659  N N   . LYS F 1 127 ? 83.793  -34.613 102.993 1.00 16.87 ? 355  LYS F N   1 
ATOM   9660  C CA  . LYS F 1 127 ? 83.756  -33.315 102.339 1.00 17.05 ? 355  LYS F CA  1 
ATOM   9661  C C   . LYS F 1 127 ? 85.162  -32.921 101.865 1.00 16.59 ? 355  LYS F C   1 
ATOM   9662  O O   . LYS F 1 127 ? 85.408  -32.828 100.665 1.00 16.90 ? 355  LYS F O   1 
ATOM   9663  C CB  . LYS F 1 127 ? 83.166  -32.245 103.269 1.00 16.98 ? 355  LYS F CB  1 
ATOM   9664  C CG  . LYS F 1 127 ? 82.566  -31.074 102.529 1.00 17.45 ? 355  LYS F CG  1 
ATOM   9665  C CD  . LYS F 1 127 ? 82.206  -29.935 103.468 1.00 18.24 ? 355  LYS F CD  1 
ATOM   9666  C CE  . LYS F 1 127 ? 80.941  -30.186 104.315 1.00 19.02 ? 355  LYS F CE  1 
ATOM   9667  N NZ  . LYS F 1 127 ? 80.637  -28.974 105.166 1.00 19.04 ? 355  LYS F NZ  1 
ATOM   9668  N N   . TYR F 1 128 ? 86.089  -32.735 102.798 1.00 15.99 ? 356  TYR F N   1 
ATOM   9669  C CA  . TYR F 1 128 ? 87.427  -32.269 102.453 1.00 15.57 ? 356  TYR F CA  1 
ATOM   9670  C C   . TYR F 1 128 ? 88.105  -33.142 101.393 1.00 16.16 ? 356  TYR F C   1 
ATOM   9671  O O   . TYR F 1 128 ? 88.971  -32.646 100.666 1.00 16.38 ? 356  TYR F O   1 
ATOM   9672  C CB  . TYR F 1 128 ? 88.320  -32.193 103.692 1.00 14.72 ? 356  TYR F CB  1 
ATOM   9673  C CG  . TYR F 1 128 ? 88.000  -31.080 104.664 1.00 13.42 ? 356  TYR F CG  1 
ATOM   9674  C CD1 . TYR F 1 128 ? 87.797  -29.777 104.232 1.00 12.43 ? 356  TYR F CD1 1 
ATOM   9675  C CD2 . TYR F 1 128 ? 87.947  -31.326 106.017 1.00 12.59 ? 356  TYR F CD2 1 
ATOM   9676  C CE1 . TYR F 1 128 ? 87.529  -28.769 105.111 1.00 11.64 ? 356  TYR F CE1 1 
ATOM   9677  C CE2 . TYR F 1 128 ? 87.675  -30.320 106.906 1.00 13.29 ? 356  TYR F CE2 1 
ATOM   9678  C CZ  . TYR F 1 128 ? 87.470  -29.038 106.450 1.00 12.64 ? 356  TYR F CZ  1 
ATOM   9679  O OH  . TYR F 1 128 ? 87.207  -28.035 107.354 1.00 12.30 ? 356  TYR F OH  1 
ATOM   9680  N N   . LYS F 1 129 ? 87.725  -34.423 101.318 1.00 16.47 ? 357  LYS F N   1 
ATOM   9681  C CA  . LYS F 1 129 ? 88.256  -35.348 100.308 1.00 16.88 ? 357  LYS F CA  1 
ATOM   9682  C C   . LYS F 1 129 ? 87.882  -34.945 98.876  1.00 17.39 ? 357  LYS F C   1 
ATOM   9683  O O   . LYS F 1 129 ? 88.714  -35.011 97.962  1.00 17.44 ? 357  LYS F O   1 
ATOM   9684  C CB  . LYS F 1 129 ? 87.747  -36.774 100.544 1.00 17.11 ? 357  LYS F CB  1 
ATOM   9685  C CG  . LYS F 1 129 ? 88.632  -37.676 101.393 1.00 16.96 ? 357  LYS F CG  1 
ATOM   9686  C CD  . LYS F 1 129 ? 88.383  -39.164 101.063 1.00 16.69 ? 357  LYS F CD  1 
ATOM   9687  C CE  . LYS F 1 129 ? 88.101  -39.991 102.312 1.00 16.69 ? 357  LYS F CE  1 
ATOM   9688  N NZ  . LYS F 1 129 ? 87.638  -41.349 101.968 1.00 16.52 ? 357  LYS F NZ  1 
ATOM   9689  N N   . SER F 1 130 ? 86.624  -34.559 98.675  1.00 17.79 ? 358  SER F N   1 
ATOM   9690  C CA  . SER F 1 130 ? 86.168  -34.074 97.363  1.00 18.21 ? 358  SER F CA  1 
ATOM   9691  C C   . SER F 1 130 ? 86.890  -32.794 96.940  1.00 18.35 ? 358  SER F C   1 
ATOM   9692  O O   . SER F 1 130 ? 86.951  -32.491 95.745  1.00 18.89 ? 358  SER F O   1 
ATOM   9693  C CB  . SER F 1 130 ? 84.664  -33.780 97.381  1.00 18.29 ? 358  SER F CB  1 
ATOM   9694  O OG  . SER F 1 130 ? 83.992  -34.702 98.220  1.00 19.57 ? 358  SER F OG  1 
ATOM   9695  N N   . MET F 1 131 ? 87.404  -32.034 97.910  1.00 18.13 ? 359  MET F N   1 
ATOM   9696  C CA  . MET F 1 131 ? 88.086  -30.771 97.622  1.00 18.29 ? 359  MET F CA  1 
ATOM   9697  C C   . MET F 1 131 ? 89.579  -30.959 97.500  1.00 17.57 ? 359  MET F C   1 
ATOM   9698  O O   . MET F 1 131 ? 90.287  -29.990 97.303  1.00 17.21 ? 359  MET F O   1 
ATOM   9699  C CB  . MET F 1 131 ? 87.828  -29.739 98.720  1.00 18.28 ? 359  MET F CB  1 
ATOM   9700  C CG  . MET F 1 131 ? 86.383  -29.625 99.113  1.00 19.14 ? 359  MET F CG  1 
ATOM   9701  S SD  . MET F 1 131 ? 86.115  -28.343 100.329 1.00 20.12 ? 359  MET F SD  1 
ATOM   9702  C CE  . MET F 1 131 ? 86.571  -26.878 99.390  1.00 20.24 ? 359  MET F CE  1 
ATOM   9703  N N   . LYS F 1 132 ? 90.060  -32.192 97.625  1.00 17.16 ? 360  LYS F N   1 
ATOM   9704  C CA  . LYS F 1 132 ? 91.501  -32.466 97.616  1.00 17.33 ? 360  LYS F CA  1 
ATOM   9705  C C   . LYS F 1 132 ? 92.242  -31.448 98.500  1.00 16.77 ? 360  LYS F C   1 
ATOM   9706  O O   . LYS F 1 132 ? 93.133  -30.722 98.039  1.00 16.64 ? 360  LYS F O   1 
ATOM   9707  C CB  . LYS F 1 132 ? 92.062  -32.480 96.182  1.00 17.34 ? 360  LYS F CB  1 
ATOM   9708  C CG  . LYS F 1 132 ? 91.400  -33.508 95.246  1.00 18.06 ? 360  LYS F CG  1 
ATOM   9709  C CD  . LYS F 1 132 ? 91.512  -33.108 93.750  1.00 18.49 ? 360  LYS F CD  1 
ATOM   9710  C CE  . LYS F 1 132 ? 90.220  -33.422 92.930  1.00 19.11 ? 360  LYS F CE  1 
ATOM   9711  N NZ  . LYS F 1 132 ? 90.354  -34.609 92.023  1.00 17.88 ? 360  LYS F NZ  1 
ATOM   9712  N N   . LEU F 1 133 ? 91.844  -31.407 99.772  1.00 16.19 ? 361  LEU F N   1 
ATOM   9713  C CA  . LEU F 1 133 ? 92.423  -30.496 100.752 1.00 15.78 ? 361  LEU F CA  1 
ATOM   9714  C C   . LEU F 1 133 ? 93.926  -30.709 100.828 1.00 15.77 ? 361  LEU F C   1 
ATOM   9715  O O   . LEU F 1 133 ? 94.415  -31.844 100.782 1.00 16.03 ? 361  LEU F O   1 
ATOM   9716  C CB  . LEU F 1 133 ? 91.796  -30.704 102.139 1.00 15.76 ? 361  LEU F CB  1 
ATOM   9717  C CG  . LEU F 1 133 ? 92.199  -29.726 103.251 1.00 15.44 ? 361  LEU F CG  1 
ATOM   9718  C CD1 . LEU F 1 133 ? 91.543  -28.365 103.031 1.00 14.15 ? 361  LEU F CD1 1 
ATOM   9719  C CD2 . LEU F 1 133 ? 91.854  -30.281 104.627 1.00 14.99 ? 361  LEU F CD2 1 
ATOM   9720  N N   . GLU F 1 134 ? 94.646  -29.600 100.944 1.00 15.52 ? 362  GLU F N   1 
ATOM   9721  C CA  . GLU F 1 134 ? 96.083  -29.604 100.972 1.00 15.33 ? 362  GLU F CA  1 
ATOM   9722  C C   . GLU F 1 134 ? 96.548  -29.113 102.339 1.00 15.52 ? 362  GLU F C   1 
ATOM   9723  O O   . GLU F 1 134 ? 95.791  -28.464 103.066 1.00 15.23 ? 362  GLU F O   1 
ATOM   9724  C CB  . GLU F 1 134 ? 96.597  -28.749 99.825  1.00 15.40 ? 362  GLU F CB  1 
ATOM   9725  C CG  . GLU F 1 134 ? 95.971  -29.176 98.478  1.00 15.33 ? 362  GLU F CG  1 
ATOM   9726  C CD  . GLU F 1 134 ? 96.105  -28.159 97.356  1.00 15.09 ? 362  GLU F CD  1 
ATOM   9727  O OE1 . GLU F 1 134 ? 96.116  -26.939 97.615  1.00 14.04 ? 362  GLU F OE1 1 
ATOM   9728  O OE2 . GLU F 1 134 ? 96.168  -28.596 96.193  1.00 15.33 ? 362  GLU F OE2 1 
ATOM   9729  N N   . LYS F 1 135 ? 97.783  -29.465 102.701 1.00 15.73 ? 363  LYS F N   1 
ATOM   9730  C CA  . LYS F 1 135 ? 98.306  -29.195 104.042 1.00 15.81 ? 363  LYS F CA  1 
ATOM   9731  C C   . LYS F 1 135 ? 98.265  -27.697 104.344 1.00 15.61 ? 363  LYS F C   1 
ATOM   9732  O O   . LYS F 1 135 ? 97.854  -27.267 105.428 1.00 15.46 ? 363  LYS F O   1 
ATOM   9733  C CB  . LYS F 1 135 ? 99.727  -29.741 104.183 1.00 15.90 ? 363  LYS F CB  1 
ATOM   9734  C CG  . LYS F 1 135 ? 100.256 -29.672 105.610 1.00 17.05 ? 363  LYS F CG  1 
ATOM   9735  C CD  . LYS F 1 135 ? 101.031 -30.935 106.026 1.00 18.42 ? 363  LYS F CD  1 
ATOM   9736  C CE  . LYS F 1 135 ? 101.055 -31.102 107.566 1.00 18.49 ? 363  LYS F CE  1 
ATOM   9737  N NZ  . LYS F 1 135 ? 100.872 -32.521 108.010 1.00 18.59 ? 363  LYS F NZ  1 
ATOM   9738  N N   . GLU F 1 136 ? 98.668  -26.920 103.348 1.00 15.39 ? 364  GLU F N   1 
ATOM   9739  C CA  . GLU F 1 136 ? 98.608  -25.465 103.385 1.00 15.47 ? 364  GLU F CA  1 
ATOM   9740  C C   . GLU F 1 136 ? 97.206  -24.903 103.736 1.00 15.41 ? 364  GLU F C   1 
ATOM   9741  O O   . GLU F 1 136 ? 97.074  -23.826 104.328 1.00 15.52 ? 364  GLU F O   1 
ATOM   9742  C CB  . GLU F 1 136 ? 99.076  -24.922 102.026 1.00 15.53 ? 364  GLU F CB  1 
ATOM   9743  C CG  . GLU F 1 136 ? 100.555 -25.245 101.679 1.00 16.33 ? 364  GLU F CG  1 
ATOM   9744  C CD  . GLU F 1 136 ? 100.758 -26.391 100.675 1.00 17.10 ? 364  GLU F CD  1 
ATOM   9745  O OE1 . GLU F 1 136 ? 100.014 -27.401 100.717 1.00 17.49 ? 364  GLU F OE1 1 
ATOM   9746  O OE2 . GLU F 1 136 ? 101.688 -26.273 99.844  1.00 17.41 ? 364  GLU F OE2 1 
ATOM   9747  N N   . GLU F 1 137 ? 96.164  -25.630 103.368 1.00 15.19 ? 365  GLU F N   1 
ATOM   9748  C CA  . GLU F 1 137 ? 94.808  -25.195 103.622 1.00 15.33 ? 365  GLU F CA  1 
ATOM   9749  C C   . GLU F 1 137 ? 94.351  -25.692 104.989 1.00 15.12 ? 365  GLU F C   1 
ATOM   9750  O O   . GLU F 1 137 ? 93.721  -24.953 105.755 1.00 14.96 ? 365  GLU F O   1 
ATOM   9751  C CB  . GLU F 1 137 ? 93.897  -25.703 102.508 1.00 15.46 ? 365  GLU F CB  1 
ATOM   9752  C CG  . GLU F 1 137 ? 94.322  -25.188 101.134 1.00 16.58 ? 365  GLU F CG  1 
ATOM   9753  C CD  . GLU F 1 137 ? 93.667  -25.935 99.992  1.00 18.37 ? 365  GLU F CD  1 
ATOM   9754  O OE1 . GLU F 1 137 ? 94.134  -27.040 99.659  1.00 19.64 ? 365  GLU F OE1 1 
ATOM   9755  O OE2 . GLU F 1 137 ? 92.686  -25.424 99.414  1.00 20.03 ? 365  GLU F OE2 1 
ATOM   9756  N N   . PHE F 1 138 ? 94.688  -26.946 105.286 1.00 14.73 ? 366  PHE F N   1 
ATOM   9757  C CA  . PHE F 1 138 ? 94.481  -27.526 106.613 1.00 14.29 ? 366  PHE F CA  1 
ATOM   9758  C C   . PHE F 1 138 ? 94.993  -26.598 107.709 1.00 14.03 ? 366  PHE F C   1 
ATOM   9759  O O   . PHE F 1 138 ? 94.252  -26.272 108.633 1.00 14.23 ? 366  PHE F O   1 
ATOM   9760  C CB  . PHE F 1 138 ? 95.169  -28.899 106.691 1.00 14.06 ? 366  PHE F CB  1 
ATOM   9761  C CG  . PHE F 1 138 ? 95.341  -29.432 108.089 1.00 13.84 ? 366  PHE F CG  1 
ATOM   9762  C CD1 . PHE F 1 138 ? 94.258  -29.539 108.960 1.00 14.14 ? 366  PHE F CD1 1 
ATOM   9763  C CD2 . PHE F 1 138 ? 96.588  -29.855 108.530 1.00 13.38 ? 366  PHE F CD2 1 
ATOM   9764  C CE1 . PHE F 1 138 ? 94.428  -30.048 110.253 1.00 13.62 ? 366  PHE F CE1 1 
ATOM   9765  C CE2 . PHE F 1 138 ? 96.758  -30.360 109.804 1.00 13.02 ? 366  PHE F CE2 1 
ATOM   9766  C CZ  . PHE F 1 138 ? 95.681  -30.461 110.666 1.00 13.67 ? 366  PHE F CZ  1 
ATOM   9767  N N   . VAL F 1 139 ? 96.242  -26.152 107.588 1.00 13.48 ? 367  VAL F N   1 
ATOM   9768  C CA  . VAL F 1 139 ? 96.869  -25.396 108.659 1.00 13.11 ? 367  VAL F CA  1 
ATOM   9769  C C   . VAL F 1 139 ? 96.399  -23.966 108.730 1.00 12.93 ? 367  VAL F C   1 
ATOM   9770  O O   . VAL F 1 139 ? 96.372  -23.394 109.812 1.00 12.88 ? 367  VAL F O   1 
ATOM   9771  C CB  . VAL F 1 139 ? 98.409  -25.405 108.576 1.00 13.08 ? 367  VAL F CB  1 
ATOM   9772  C CG1 . VAL F 1 139 ? 98.919  -26.829 108.406 1.00 12.73 ? 367  VAL F CG1 1 
ATOM   9773  C CG2 . VAL F 1 139 ? 98.893  -24.503 107.473 1.00 12.74 ? 367  VAL F CG2 1 
ATOM   9774  N N   . THR F 1 140 ? 96.052  -23.371 107.593 1.00 12.93 ? 368  THR F N   1 
ATOM   9775  C CA  . THR F 1 140 ? 95.522  -22.012 107.608 1.00 12.78 ? 368  THR F CA  1 
ATOM   9776  C C   . THR F 1 140 ? 94.146  -22.068 108.233 1.00 13.00 ? 368  THR F C   1 
ATOM   9777  O O   . THR F 1 140 ? 93.764  -21.164 108.960 1.00 12.97 ? 368  THR F O   1 
ATOM   9778  C CB  . THR F 1 140 ? 95.440  -21.361 106.217 1.00 12.72 ? 368  THR F CB  1 
ATOM   9779  O OG1 . THR F 1 140 ? 96.724  -21.385 105.575 1.00 11.71 ? 368  THR F OG1 1 
ATOM   9780  C CG2 . THR F 1 140 ? 94.989  -19.925 106.349 1.00 12.36 ? 368  THR F CG2 1 
ATOM   9781  N N   . LEU F 1 141 ? 93.427  -23.157 107.978 1.00 13.40 ? 369  LEU F N   1 
ATOM   9782  C CA  . LEU F 1 141 ? 92.077  -23.352 108.528 1.00 13.59 ? 369  LEU F CA  1 
ATOM   9783  C C   . LEU F 1 141 ? 92.066  -23.599 110.040 1.00 13.63 ? 369  LEU F C   1 
ATOM   9784  O O   . LEU F 1 141 ? 91.154  -23.113 110.740 1.00 13.93 ? 369  LEU F O   1 
ATOM   9785  C CB  . LEU F 1 141 ? 91.318  -24.490 107.807 1.00 13.78 ? 369  LEU F CB  1 
ATOM   9786  C CG  . LEU F 1 141 ? 90.469  -24.131 106.572 1.00 13.31 ? 369  LEU F CG  1 
ATOM   9787  C CD1 . LEU F 1 141 ? 89.839  -25.367 105.940 1.00 12.26 ? 369  LEU F CD1 1 
ATOM   9788  C CD2 . LEU F 1 141 ? 89.386  -23.143 106.933 1.00 12.97 ? 369  LEU F CD2 1 
ATOM   9789  N N   . LYS F 1 142 ? 93.037  -24.356 110.550 1.00 13.28 ? 370  LYS F N   1 
ATOM   9790  C CA  . LYS F 1 142 ? 93.199  -24.473 112.007 1.00 13.11 ? 370  LYS F CA  1 
ATOM   9791  C C   . LYS F 1 142 ? 93.420  -23.097 112.629 1.00 12.80 ? 370  LYS F C   1 
ATOM   9792  O O   . LYS F 1 142 ? 92.946  -22.826 113.733 1.00 12.55 ? 370  LYS F O   1 
ATOM   9793  C CB  . LYS F 1 142 ? 94.380  -25.357 112.378 1.00 13.14 ? 370  LYS F CB  1 
ATOM   9794  C CG  . LYS F 1 142 ? 94.102  -26.831 112.314 1.00 13.57 ? 370  LYS F CG  1 
ATOM   9795  C CD  . LYS F 1 142 ? 95.179  -27.632 113.050 1.00 13.83 ? 370  LYS F CD  1 
ATOM   9796  C CE  . LYS F 1 142 ? 96.523  -27.559 112.355 1.00 13.22 ? 370  LYS F CE  1 
ATOM   9797  N NZ  . LYS F 1 142 ? 97.452  -28.482 113.030 1.00 13.79 ? 370  LYS F NZ  1 
ATOM   9798  N N   . ALA F 1 143 ? 94.151  -22.243 111.914 1.00 12.53 ? 371  ALA F N   1 
ATOM   9799  C CA  . ALA F 1 143 ? 94.464  -20.906 112.393 1.00 12.33 ? 371  ALA F CA  1 
ATOM   9800  C C   . ALA F 1 143 ? 93.189  -20.122 112.496 1.00 12.18 ? 371  ALA F C   1 
ATOM   9801  O O   . ALA F 1 143 ? 92.876  -19.570 113.544 1.00 12.01 ? 371  ALA F O   1 
ATOM   9802  C CB  . ALA F 1 143 ? 95.429  -20.211 111.450 1.00 12.20 ? 371  ALA F CB  1 
ATOM   9803  N N   . ILE F 1 144 ? 92.454  -20.103 111.386 1.00 12.33 ? 372  ILE F N   1 
ATOM   9804  C CA  . ILE F 1 144 ? 91.198  -19.346 111.248 1.00 12.14 ? 372  ILE F CA  1 
ATOM   9805  C C   . ILE F 1 144 ? 90.109  -19.828 112.186 1.00 12.14 ? 372  ILE F C   1 
ATOM   9806  O O   . ILE F 1 144 ? 89.296  -19.025 112.655 1.00 12.03 ? 372  ILE F O   1 
ATOM   9807  C CB  . ILE F 1 144 ? 90.648  -19.433 109.818 1.00 11.83 ? 372  ILE F CB  1 
ATOM   9808  C CG1 . ILE F 1 144 ? 91.516  -18.621 108.863 1.00 11.20 ? 372  ILE F CG1 1 
ATOM   9809  C CG2 . ILE F 1 144 ? 89.236  -18.906 109.772 1.00 12.87 ? 372  ILE F CG2 1 
ATOM   9810  C CD1 . ILE F 1 144 ? 91.321  -18.987 107.441 1.00 9.91  ? 372  ILE F CD1 1 
ATOM   9811  N N   . ALA F 1 145 ? 90.091  -21.140 112.436 1.00 12.22 ? 373  ALA F N   1 
ATOM   9812  C CA  . ALA F 1 145 ? 89.163  -21.749 113.404 1.00 12.22 ? 373  ALA F CA  1 
ATOM   9813  C C   . ALA F 1 145 ? 89.383  -21.228 114.827 1.00 12.17 ? 373  ALA F C   1 
ATOM   9814  O O   . ALA F 1 145 ? 88.428  -21.004 115.564 1.00 12.39 ? 373  ALA F O   1 
ATOM   9815  C CB  . ALA F 1 145 ? 89.309  -23.248 113.379 1.00 12.38 ? 373  ALA F CB  1 
ATOM   9816  N N   . LEU F 1 146 ? 90.645  -21.050 115.204 1.00 12.12 ? 374  LEU F N   1 
ATOM   9817  C CA  . LEU F 1 146 ? 90.995  -20.446 116.476 1.00 12.05 ? 374  LEU F CA  1 
ATOM   9818  C C   . LEU F 1 146 ? 90.492  -19.012 116.516 1.00 12.56 ? 374  LEU F C   1 
ATOM   9819  O O   . LEU F 1 146 ? 89.770  -18.629 117.440 1.00 12.52 ? 374  LEU F O   1 
ATOM   9820  C CB  . LEU F 1 146 ? 92.515  -20.464 116.683 1.00 11.90 ? 374  LEU F CB  1 
ATOM   9821  C CG  . LEU F 1 146 ? 93.015  -20.024 118.058 1.00 11.16 ? 374  LEU F CG  1 
ATOM   9822  C CD1 . LEU F 1 146 ? 92.401  -20.875 119.161 1.00 9.50  ? 374  LEU F CD1 1 
ATOM   9823  C CD2 . LEU F 1 146 ? 94.531  -20.087 118.096 1.00 11.49 ? 374  LEU F CD2 1 
ATOM   9824  N N   . ALA F 1 147 ? 90.873  -18.238 115.498 1.00 12.99 ? 375  ALA F N   1 
ATOM   9825  C CA  . ALA F 1 147 ? 90.542  -16.805 115.407 1.00 13.29 ? 375  ALA F CA  1 
ATOM   9826  C C   . ALA F 1 147 ? 89.042  -16.518 115.411 1.00 13.66 ? 375  ALA F C   1 
ATOM   9827  O O   . ALA F 1 147 ? 88.594  -15.516 115.984 1.00 13.75 ? 375  ALA F O   1 
ATOM   9828  C CB  . ALA F 1 147 ? 91.173  -16.192 114.151 1.00 13.05 ? 375  ALA F CB  1 
ATOM   9829  N N   . ASN F 1 148 ? 88.276  -17.388 114.760 1.00 13.99 ? 376  ASN F N   1 
ATOM   9830  C CA  . ASN F 1 148 ? 86.858  -17.148 114.536 1.00 14.39 ? 376  ASN F CA  1 
ATOM   9831  C C   . ASN F 1 148 ? 85.987  -17.969 115.491 1.00 14.83 ? 376  ASN F C   1 
ATOM   9832  O O   . ASN F 1 148 ? 84.824  -18.252 115.184 1.00 14.75 ? 376  ASN F O   1 
ATOM   9833  C CB  . ASN F 1 148 ? 86.519  -17.470 113.074 1.00 14.42 ? 376  ASN F CB  1 
ATOM   9834  C CG  . ASN F 1 148 ? 85.188  -16.889 112.632 1.00 14.93 ? 376  ASN F CG  1 
ATOM   9835  O OD1 . ASN F 1 148 ? 84.861  -15.741 112.939 1.00 16.73 ? 376  ASN F OD1 1 
ATOM   9836  N ND2 . ASN F 1 148 ? 84.410  -17.683 111.899 1.00 14.27 ? 376  ASN F ND2 1 
ATOM   9837  N N   . SER F 1 149 ? 86.537  -18.328 116.656 1.00 15.41 ? 377  SER F N   1 
ATOM   9838  C CA  . SER F 1 149 ? 85.866  -19.261 117.582 1.00 15.92 ? 377  SER F CA  1 
ATOM   9839  C C   . SER F 1 149 ? 84.764  -18.626 118.441 1.00 16.22 ? 377  SER F C   1 
ATOM   9840  O O   . SER F 1 149 ? 84.167  -19.304 119.277 1.00 16.35 ? 377  SER F O   1 
ATOM   9841  C CB  . SER F 1 149 ? 86.879  -19.987 118.466 1.00 15.96 ? 377  SER F CB  1 
ATOM   9842  O OG  . SER F 1 149 ? 87.729  -19.072 119.130 1.00 17.40 ? 377  SER F OG  1 
ATOM   9843  N N   . ASP F 1 150 ? 84.489  -17.342 118.223 1.00 16.54 ? 378  ASP F N   1 
ATOM   9844  C CA  . ASP F 1 150 ? 83.229  -16.742 118.643 1.00 17.06 ? 378  ASP F CA  1 
ATOM   9845  C C   . ASP F 1 150 ? 82.975  -16.778 120.148 1.00 17.34 ? 378  ASP F C   1 
ATOM   9846  O O   . ASP F 1 150 ? 81.840  -16.952 120.590 1.00 17.08 ? 378  ASP F O   1 
ATOM   9847  C CB  . ASP F 1 150 ? 82.055  -17.393 117.882 1.00 17.31 ? 378  ASP F CB  1 
ATOM   9848  C CG  . ASP F 1 150 ? 81.877  -16.830 116.470 1.00 18.59 ? 378  ASP F CG  1 
ATOM   9849  O OD1 . ASP F 1 150 ? 82.269  -15.663 116.225 1.00 20.75 ? 378  ASP F OD1 1 
ATOM   9850  O OD2 . ASP F 1 150 ? 81.336  -17.551 115.600 1.00 19.55 ? 378  ASP F OD2 1 
ATOM   9851  N N   . SER F 1 151 ? 84.028  -16.567 120.934 1.00 18.11 ? 379  SER F N   1 
ATOM   9852  C CA  . SER F 1 151 ? 83.884  -16.489 122.388 1.00 18.61 ? 379  SER F CA  1 
ATOM   9853  C C   . SER F 1 151 ? 83.009  -15.328 122.819 1.00 18.87 ? 379  SER F C   1 
ATOM   9854  O O   . SER F 1 151 ? 83.062  -14.250 122.236 1.00 18.49 ? 379  SER F O   1 
ATOM   9855  C CB  . SER F 1 151 ? 85.234  -16.342 123.077 1.00 18.68 ? 379  SER F CB  1 
ATOM   9856  O OG  . SER F 1 151 ? 85.030  -15.959 124.434 1.00 19.53 ? 379  SER F OG  1 
ATOM   9857  N N   . MET F 1 152 ? 82.231  -15.556 123.868 1.00 19.68 ? 380  MET F N   1 
ATOM   9858  C CA  . MET F 1 152 ? 81.344  -14.519 124.398 1.00 20.89 ? 380  MET F CA  1 
ATOM   9859  C C   . MET F 1 152 ? 82.128  -13.354 125.035 1.00 20.62 ? 380  MET F C   1 
ATOM   9860  O O   . MET F 1 152 ? 81.689  -12.199 124.969 1.00 20.63 ? 380  MET F O   1 
ATOM   9861  C CB  . MET F 1 152 ? 80.341  -15.118 125.414 1.00 21.05 ? 380  MET F CB  1 
ATOM   9862  C CG  . MET F 1 152 ? 79.191  -15.972 124.787 1.00 22.43 ? 380  MET F CG  1 
ATOM   9863  S SD  . MET F 1 152 ? 78.314  -17.173 125.887 1.00 23.56 ? 380  MET F SD  1 
ATOM   9864  C CE  . MET F 1 152 ? 79.611  -18.365 126.279 1.00 23.23 ? 380  MET F CE  1 
ATOM   9865  N N   . HIS F 1 153 ? 83.291  -13.642 125.618 1.00 20.75 ? 381  HIS F N   1 
ATOM   9866  C CA  . HIS F 1 153 ? 83.967  -12.665 126.484 1.00 20.97 ? 381  HIS F CA  1 
ATOM   9867  C C   . HIS F 1 153 ? 85.335  -12.187 125.971 1.00 20.33 ? 381  HIS F C   1 
ATOM   9868  O O   . HIS F 1 153 ? 86.351  -12.315 126.669 1.00 20.36 ? 381  HIS F O   1 
ATOM   9869  C CB  . HIS F 1 153 ? 84.129  -13.249 127.891 1.00 21.59 ? 381  HIS F CB  1 
ATOM   9870  C CG  . HIS F 1 153 ? 82.929  -13.998 128.380 1.00 22.90 ? 381  HIS F CG  1 
ATOM   9871  N ND1 . HIS F 1 153 ? 81.934  -13.403 129.128 1.00 23.54 ? 381  HIS F ND1 1 
ATOM   9872  C CD2 . HIS F 1 153 ? 82.570  -15.298 128.235 1.00 23.69 ? 381  HIS F CD2 1 
ATOM   9873  C CE1 . HIS F 1 153 ? 81.013  -14.305 129.421 1.00 24.28 ? 381  HIS F CE1 1 
ATOM   9874  N NE2 . HIS F 1 153 ? 81.373  -15.460 128.887 1.00 24.51 ? 381  HIS F NE2 1 
ATOM   9875  N N   . ILE F 1 154 ? 85.359  -11.619 124.767 1.00 19.45 ? 382  ILE F N   1 
ATOM   9876  C CA  . ILE F 1 154 ? 86.595  -11.046 124.217 1.00 18.81 ? 382  ILE F CA  1 
ATOM   9877  C C   . ILE F 1 154 ? 86.855  -9.636  124.786 1.00 18.50 ? 382  ILE F C   1 
ATOM   9878  O O   . ILE F 1 154 ? 85.991  -8.746  124.707 1.00 18.44 ? 382  ILE F O   1 
ATOM   9879  C CB  . ILE F 1 154 ? 86.563  -10.989 122.667 1.00 18.69 ? 382  ILE F CB  1 
ATOM   9880  C CG1 . ILE F 1 154 ? 86.400  -12.396 122.076 1.00 18.27 ? 382  ILE F CG1 1 
ATOM   9881  C CG2 . ILE F 1 154 ? 87.828  -10.330 122.120 1.00 18.44 ? 382  ILE F CG2 1 
ATOM   9882  C CD1 . ILE F 1 154 ? 87.566  -13.301 122.309 1.00 16.53 ? 382  ILE F CD1 1 
ATOM   9883  N N   . GLU F 1 155 ? 88.039  -9.445  125.363 1.00 18.05 ? 383  GLU F N   1 
ATOM   9884  C CA  . GLU F 1 155 ? 88.448  -8.136  125.877 1.00 18.15 ? 383  GLU F CA  1 
ATOM   9885  C C   . GLU F 1 155 ? 88.693  -7.139  124.741 1.00 17.73 ? 383  GLU F C   1 
ATOM   9886  O O   . GLU F 1 155 ? 88.213  -6.008  124.802 1.00 17.70 ? 383  GLU F O   1 
ATOM   9887  C CB  . GLU F 1 155 ? 89.699  -8.249  126.769 1.00 18.11 ? 383  GLU F CB  1 
ATOM   9888  C CG  . GLU F 1 155 ? 89.430  -8.817  128.176 1.00 18.74 ? 383  GLU F CG  1 
ATOM   9889  C CD  . GLU F 1 155 ? 90.666  -8.815  129.082 1.00 19.50 ? 383  GLU F CD  1 
ATOM   9890  O OE1 . GLU F 1 155 ? 91.778  -8.520  128.589 1.00 21.78 ? 383  GLU F OE1 1 
ATOM   9891  O OE2 . GLU F 1 155 ? 90.529  -9.110  130.294 1.00 21.45 ? 383  GLU F OE2 1 
ATOM   9892  N N   . ASP F 1 156 ? 89.431  -7.565  123.714 1.00 17.49 ? 384  ASP F N   1 
ATOM   9893  C CA  . ASP F 1 156 ? 89.843  -6.680  122.618 1.00 17.16 ? 384  ASP F CA  1 
ATOM   9894  C C   . ASP F 1 156 ? 89.306  -7.181  121.278 1.00 17.00 ? 384  ASP F C   1 
ATOM   9895  O O   . ASP F 1 156 ? 90.015  -7.822  120.504 1.00 16.61 ? 384  ASP F O   1 
ATOM   9896  C CB  . ASP F 1 156 ? 91.373  -6.558  122.600 1.00 17.18 ? 384  ASP F CB  1 
ATOM   9897  C CG  . ASP F 1 156 ? 91.874  -5.440  121.693 1.00 16.75 ? 384  ASP F CG  1 
ATOM   9898  O OD1 . ASP F 1 156 ? 91.071  -4.772  121.004 1.00 16.62 ? 384  ASP F OD1 1 
ATOM   9899  O OD2 . ASP F 1 156 ? 93.100  -5.240  121.667 1.00 15.73 ? 384  ASP F OD2 1 
ATOM   9900  N N   . VAL F 1 157 ? 88.041  -6.861  121.021 1.00 17.16 ? 385  VAL F N   1 
ATOM   9901  C CA  . VAL F 1 157 ? 87.323  -7.339  119.830 1.00 17.41 ? 385  VAL F CA  1 
ATOM   9902  C C   . VAL F 1 157 ? 88.020  -6.947  118.524 1.00 17.77 ? 385  VAL F C   1 
ATOM   9903  O O   . VAL F 1 157 ? 88.169  -7.773  117.613 1.00 17.73 ? 385  VAL F O   1 
ATOM   9904  C CB  . VAL F 1 157 ? 85.849  -6.819  119.809 1.00 17.38 ? 385  VAL F CB  1 
ATOM   9905  C CG1 . VAL F 1 157 ? 85.357  -6.589  118.378 1.00 17.23 ? 385  VAL F CG1 1 
ATOM   9906  C CG2 . VAL F 1 157 ? 84.929  -7.790  120.549 1.00 17.28 ? 385  VAL F CG2 1 
ATOM   9907  N N   . GLU F 1 158 ? 88.444  -5.687  118.437 1.00 18.12 ? 386  GLU F N   1 
ATOM   9908  C CA  . GLU F 1 158 ? 89.101  -5.186  117.231 1.00 18.32 ? 386  GLU F CA  1 
ATOM   9909  C C   . GLU F 1 158 ? 90.274  -6.108  116.896 1.00 18.07 ? 386  GLU F C   1 
ATOM   9910  O O   . GLU F 1 158 ? 90.287  -6.734  115.834 1.00 18.14 ? 386  GLU F O   1 
ATOM   9911  C CB  . GLU F 1 158 ? 89.568  -3.734  117.406 1.00 18.57 ? 386  GLU F CB  1 
ATOM   9912  C CG  . GLU F 1 158 ? 88.466  -2.742  117.838 1.00 20.20 ? 386  GLU F CG  1 
ATOM   9913  C CD  . GLU F 1 158 ? 88.529  -2.359  119.336 1.00 22.36 ? 386  GLU F CD  1 
ATOM   9914  O OE1 . GLU F 1 158 ? 88.639  -3.274  120.191 1.00 23.61 ? 386  GLU F OE1 1 
ATOM   9915  O OE2 . GLU F 1 158 ? 88.461  -1.141  119.656 1.00 23.07 ? 386  GLU F OE2 1 
ATOM   9916  N N   . ALA F 1 159 ? 91.213  -6.232  117.835 1.00 17.77 ? 387  ALA F N   1 
ATOM   9917  C CA  . ALA F 1 159 ? 92.416  -7.053  117.650 1.00 17.63 ? 387  ALA F CA  1 
ATOM   9918  C C   . ALA F 1 159 ? 92.120  -8.438  117.076 1.00 17.53 ? 387  ALA F C   1 
ATOM   9919  O O   . ALA F 1 159 ? 92.758  -8.862  116.119 1.00 17.48 ? 387  ALA F O   1 
ATOM   9920  C CB  . ALA F 1 159 ? 93.160  -7.195  118.966 1.00 17.56 ? 387  ALA F CB  1 
ATOM   9921  N N   . VAL F 1 160 ? 91.150  -9.129  117.668 1.00 17.49 ? 388  VAL F N   1 
ATOM   9922  C CA  . VAL F 1 160 ? 90.775  -10.484 117.251 1.00 17.34 ? 388  VAL F CA  1 
ATOM   9923  C C   . VAL F 1 160 ? 90.202  -10.518 115.836 1.00 17.46 ? 388  VAL F C   1 
ATOM   9924  O O   . VAL F 1 160 ? 90.330  -11.517 115.127 1.00 17.16 ? 388  VAL F O   1 
ATOM   9925  C CB  . VAL F 1 160 ? 89.748  -11.098 118.235 1.00 17.33 ? 388  VAL F CB  1 
ATOM   9926  C CG1 . VAL F 1 160 ? 89.149  -12.381 117.671 1.00 17.16 ? 388  VAL F CG1 1 
ATOM   9927  C CG2 . VAL F 1 160 ? 90.398  -11.349 119.605 1.00 16.80 ? 388  VAL F CG2 1 
ATOM   9928  N N   . GLN F 1 161 ? 89.579  -9.415  115.431 1.00 17.83 ? 389  GLN F N   1 
ATOM   9929  C CA  . GLN F 1 161 ? 88.957  -9.300  114.104 1.00 18.18 ? 389  GLN F CA  1 
ATOM   9930  C C   . GLN F 1 161 ? 90.013  -9.063  113.041 1.00 17.85 ? 389  GLN F C   1 
ATOM   9931  O O   . GLN F 1 161 ? 89.911  -9.556  111.921 1.00 17.86 ? 389  GLN F O   1 
ATOM   9932  C CB  . GLN F 1 161 ? 87.949  -8.143  114.094 1.00 18.45 ? 389  GLN F CB  1 
ATOM   9933  C CG  . GLN F 1 161 ? 86.631  -8.443  113.384 1.00 19.65 ? 389  GLN F CG  1 
ATOM   9934  C CD  . GLN F 1 161 ? 85.398  -8.096  114.238 1.00 21.93 ? 389  GLN F CD  1 
ATOM   9935  O OE1 . GLN F 1 161 ? 85.501  -7.412  115.269 1.00 23.31 ? 389  GLN F OE1 1 
ATOM   9936  N NE2 . GLN F 1 161 ? 84.227  -8.570  113.809 1.00 22.89 ? 389  GLN F NE2 1 
ATOM   9937  N N   . LYS F 1 162 ? 91.015  -8.281  113.411 1.00 17.64 ? 390  LYS F N   1 
ATOM   9938  C CA  . LYS F 1 162 ? 92.189  -8.069  112.589 1.00 17.57 ? 390  LYS F CA  1 
ATOM   9939  C C   . LYS F 1 162 ? 92.956  -9.387  112.431 1.00 17.02 ? 390  LYS F C   1 
ATOM   9940  O O   . LYS F 1 162 ? 93.518  -9.655  111.378 1.00 16.91 ? 390  LYS F O   1 
ATOM   9941  C CB  . LYS F 1 162 ? 93.073  -6.976  113.228 1.00 17.77 ? 390  LYS F CB  1 
ATOM   9942  C CG  . LYS F 1 162 ? 94.373  -6.650  112.486 1.00 18.50 ? 390  LYS F CG  1 
ATOM   9943  C CD  . LYS F 1 162 ? 94.138  -6.303  111.012 1.00 19.31 ? 390  LYS F CD  1 
ATOM   9944  C CE  . LYS F 1 162 ? 95.158  -5.299  110.503 1.00 19.49 ? 390  LYS F CE  1 
ATOM   9945  N NZ  . LYS F 1 162 ? 94.733  -4.700  109.211 1.00 20.48 ? 390  LYS F NZ  1 
ATOM   9946  N N   . LEU F 1 163 ? 92.971  -10.209 113.476 1.00 16.59 ? 391  LEU F N   1 
ATOM   9947  C CA  . LEU F 1 163 ? 93.612  -11.514 113.392 1.00 16.32 ? 391  LEU F CA  1 
ATOM   9948  C C   . LEU F 1 163 ? 92.801  -12.408 112.466 1.00 16.38 ? 391  LEU F C   1 
ATOM   9949  O O   . LEU F 1 163 ? 93.363  -13.067 111.586 1.00 16.70 ? 391  LEU F O   1 
ATOM   9950  C CB  . LEU F 1 163 ? 93.763  -12.165 114.766 1.00 16.16 ? 391  LEU F CB  1 
ATOM   9951  C CG  . LEU F 1 163 ? 94.358  -13.582 114.765 1.00 15.99 ? 391  LEU F CG  1 
ATOM   9952  C CD1 . LEU F 1 163 ? 95.791  -13.602 114.243 1.00 15.32 ? 391  LEU F CD1 1 
ATOM   9953  C CD2 . LEU F 1 163 ? 94.292  -14.185 116.152 1.00 15.99 ? 391  LEU F CD2 1 
ATOM   9954  N N   . GLN F 1 164 ? 91.486  -12.438 112.654 1.00 16.10 ? 392  GLN F N   1 
ATOM   9955  C CA  . GLN F 1 164 ? 90.629  -13.130 111.701 1.00 15.90 ? 392  GLN F CA  1 
ATOM   9956  C C   . GLN F 1 164 ? 90.961  -12.671 110.279 1.00 15.79 ? 392  GLN F C   1 
ATOM   9957  O O   . GLN F 1 164 ? 91.195  -13.483 109.375 1.00 15.23 ? 392  GLN F O   1 
ATOM   9958  C CB  . GLN F 1 164 ? 89.163  -12.865 112.015 1.00 15.89 ? 392  GLN F CB  1 
ATOM   9959  C CG  . GLN F 1 164 ? 88.646  -13.717 113.162 1.00 16.23 ? 392  GLN F CG  1 
ATOM   9960  C CD  . GLN F 1 164 ? 87.265  -13.289 113.671 1.00 15.61 ? 392  GLN F CD  1 
ATOM   9961  O OE1 . GLN F 1 164 ? 86.472  -12.656 112.954 1.00 13.21 ? 392  GLN F OE1 1 
ATOM   9962  N NE2 . GLN F 1 164 ? 86.978  -13.638 114.922 1.00 14.11 ? 392  GLN F NE2 1 
ATOM   9963  N N   . ASP F 1 165 ? 91.021  -11.357 110.112 1.00 15.74 ? 393  ASP F N   1 
ATOM   9964  C CA  . ASP F 1 165 ? 91.213  -10.765 108.809 1.00 15.88 ? 393  ASP F CA  1 
ATOM   9965  C C   . ASP F 1 165 ? 92.544  -11.156 108.181 1.00 15.59 ? 393  ASP F C   1 
ATOM   9966  O O   . ASP F 1 165 ? 92.578  -11.484 106.999 1.00 15.97 ? 393  ASP F O   1 
ATOM   9967  C CB  . ASP F 1 165 ? 91.116  -9.252  108.901 1.00 16.12 ? 393  ASP F CB  1 
ATOM   9968  C CG  . ASP F 1 165 ? 90.982  -8.600  107.544 1.00 17.45 ? 393  ASP F CG  1 
ATOM   9969  O OD1 . ASP F 1 165 ? 89.953  -8.846  106.877 1.00 18.98 ? 393  ASP F OD1 1 
ATOM   9970  O OD2 . ASP F 1 165 ? 91.897  -7.830  107.155 1.00 19.38 ? 393  ASP F OD2 1 
ATOM   9971  N N   . VAL F 1 166 ? 93.630  -11.128 108.954 1.00 14.90 ? 394  VAL F N   1 
ATOM   9972  C CA  . VAL F 1 166 ? 94.953  -11.474 108.419 1.00 14.43 ? 394  VAL F CA  1 
ATOM   9973  C C   . VAL F 1 166 ? 94.986  -12.907 107.864 1.00 14.26 ? 394  VAL F C   1 
ATOM   9974  O O   . VAL F 1 166 ? 95.371  -13.127 106.713 1.00 14.21 ? 394  VAL F O   1 
ATOM   9975  C CB  . VAL F 1 166 ? 96.084  -11.302 109.479 1.00 14.43 ? 394  VAL F CB  1 
ATOM   9976  C CG1 . VAL F 1 166 ? 97.412  -11.842 108.952 1.00 13.17 ? 394  VAL F CG1 1 
ATOM   9977  C CG2 . VAL F 1 166 ? 96.239  -9.834  109.872 1.00 14.23 ? 394  VAL F CG2 1 
ATOM   9978  N N   . LEU F 1 167 ? 94.574  -13.864 108.694 1.00 13.88 ? 395  LEU F N   1 
ATOM   9979  C CA  . LEU F 1 167 ? 94.574  -15.288 108.344 1.00 13.42 ? 395  LEU F CA  1 
ATOM   9980  C C   . LEU F 1 167 ? 93.630  -15.622 107.195 1.00 13.24 ? 395  LEU F C   1 
ATOM   9981  O O   . LEU F 1 167 ? 93.917  -16.494 106.385 1.00 13.22 ? 395  LEU F O   1 
ATOM   9982  C CB  . LEU F 1 167 ? 94.161  -16.130 109.550 1.00 13.36 ? 395  LEU F CB  1 
ATOM   9983  C CG  . LEU F 1 167 ? 95.071  -16.200 110.768 1.00 12.48 ? 395  LEU F CG  1 
ATOM   9984  C CD1 . LEU F 1 167 ? 94.373  -17.037 111.833 1.00 10.94 ? 395  LEU F CD1 1 
ATOM   9985  C CD2 . LEU F 1 167 ? 96.436  -16.776 110.409 1.00 10.93 ? 395  LEU F CD2 1 
ATOM   9986  N N   . HIS F 1 168 ? 92.484  -14.953 107.152 1.00 13.16 ? 396  HIS F N   1 
ATOM   9987  C CA  . HIS F 1 168 ? 91.581  -15.048 106.002 1.00 12.90 ? 396  HIS F CA  1 
ATOM   9988  C C   . HIS F 1 168 ? 92.348  -14.657 104.728 1.00 12.94 ? 396  HIS F C   1 
ATOM   9989  O O   . HIS F 1 168 ? 92.476  -15.456 103.810 1.00 12.59 ? 396  HIS F O   1 
ATOM   9990  C CB  . HIS F 1 168 ? 90.343  -14.166 106.242 1.00 12.60 ? 396  HIS F CB  1 
ATOM   9991  C CG  . HIS F 1 168 ? 89.378  -14.128 105.099 1.00 11.55 ? 396  HIS F CG  1 
ATOM   9992  N ND1 . HIS F 1 168 ? 88.462  -13.111 104.942 1.00 10.63 ? 396  HIS F ND1 1 
ATOM   9993  C CD2 . HIS F 1 168 ? 89.186  -14.969 104.057 1.00 11.25 ? 396  HIS F CD2 1 
ATOM   9994  C CE1 . HIS F 1 168 ? 87.749  -13.327 103.851 1.00 10.61 ? 396  HIS F CE1 1 
ATOM   9995  N NE2 . HIS F 1 168 ? 88.172  -14.444 103.291 1.00 11.17 ? 396  HIS F NE2 1 
ATOM   9996  N N   . GLU F 1 169 ? 92.904  -13.449 104.720 1.00 13.18 ? 397  GLU F N   1 
ATOM   9997  C CA  . GLU F 1 169 ? 93.737  -12.944 103.613 1.00 13.58 ? 397  GLU F CA  1 
ATOM   9998  C C   . GLU F 1 169 ? 94.843  -13.928 103.181 1.00 13.17 ? 397  GLU F C   1 
ATOM   9999  O O   . GLU F 1 169 ? 95.181  -14.001 102.004 1.00 13.33 ? 397  GLU F O   1 
ATOM   10000 C CB  . GLU F 1 169 ? 94.350  -11.599 104.021 1.00 13.57 ? 397  GLU F CB  1 
ATOM   10001 C CG  . GLU F 1 169 ? 95.027  -10.797 102.923 1.00 14.32 ? 397  GLU F CG  1 
ATOM   10002 C CD  . GLU F 1 169 ? 95.896  -9.671  103.497 1.00 15.28 ? 397  GLU F CD  1 
ATOM   10003 O OE1 . GLU F 1 169 ? 96.385  -9.823  104.646 1.00 17.98 ? 397  GLU F OE1 1 
ATOM   10004 O OE2 . GLU F 1 169 ? 96.106  -8.638  102.810 1.00 17.70 ? 397  GLU F OE2 1 
ATOM   10005 N N   . ALA F 1 170 ? 95.400  -14.675 104.129 1.00 12.84 ? 398  ALA F N   1 
ATOM   10006 C CA  . ALA F 1 170 ? 96.403  -15.691 103.827 1.00 12.67 ? 398  ALA F CA  1 
ATOM   10007 C C   . ALA F 1 170 ? 95.811  -16.848 103.018 1.00 12.60 ? 398  ALA F C   1 
ATOM   10008 O O   . ALA F 1 170 ? 96.391  -17.309 102.038 1.00 12.34 ? 398  ALA F O   1 
ATOM   10009 C CB  . ALA F 1 170 ? 97.011  -16.214 105.114 1.00 12.55 ? 398  ALA F CB  1 
ATOM   10010 N N   . LEU F 1 171 ? 94.663  -17.335 103.456 1.00 12.71 ? 399  LEU F N   1 
ATOM   10011 C CA  . LEU F 1 171 ? 93.940  -18.340 102.707 1.00 12.71 ? 399  LEU F CA  1 
ATOM   10012 C C   . LEU F 1 171 ? 93.623  -17.763 101.330 1.00 13.27 ? 399  LEU F C   1 
ATOM   10013 O O   . LEU F 1 171 ? 94.000  -18.307 100.294 1.00 13.28 ? 399  LEU F O   1 
ATOM   10014 C CB  . LEU F 1 171 ? 92.665  -18.691 103.451 1.00 12.53 ? 399  LEU F CB  1 
ATOM   10015 C CG  . LEU F 1 171 ? 91.735  -19.717 102.824 1.00 13.03 ? 399  LEU F CG  1 
ATOM   10016 C CD1 . LEU F 1 171 ? 92.447  -21.073 102.702 1.00 13.43 ? 399  LEU F CD1 1 
ATOM   10017 C CD2 . LEU F 1 171 ? 90.426  -19.826 103.636 1.00 11.64 ? 399  LEU F CD2 1 
ATOM   10018 N N   . GLN F 1 172 ? 92.976  -16.608 101.341 1.00 13.93 ? 400  GLN F N   1 
ATOM   10019 C CA  . GLN F 1 172 ? 92.532  -15.943 100.123 1.00 14.22 ? 400  GLN F CA  1 
ATOM   10020 C C   . GLN F 1 172 ? 93.666  -15.805 99.117  1.00 14.11 ? 400  GLN F C   1 
ATOM   10021 O O   . GLN F 1 172 ? 93.491  -16.075 97.935  1.00 14.15 ? 400  GLN F O   1 
ATOM   10022 C CB  . GLN F 1 172 ? 91.942  -14.567 100.460 1.00 14.48 ? 400  GLN F CB  1 
ATOM   10023 C CG  . GLN F 1 172 ? 90.944  -14.031 99.442  1.00 15.65 ? 400  GLN F CG  1 
ATOM   10024 C CD  . GLN F 1 172 ? 89.715  -14.903 99.341  1.00 17.16 ? 400  GLN F CD  1 
ATOM   10025 O OE1 . GLN F 1 172 ? 89.087  -15.223 100.356 1.00 18.34 ? 400  GLN F OE1 1 
ATOM   10026 N NE2 . GLN F 1 172 ? 89.370  -15.311 98.116  1.00 17.91 ? 400  GLN F NE2 1 
ATOM   10027 N N   . ASP F 1 173 ? 94.834  -15.397 99.587  1.00 14.26 ? 401  ASP F N   1 
ATOM   10028 C CA  . ASP F 1 173 ? 95.979  -15.237 98.697  1.00 14.45 ? 401  ASP F CA  1 
ATOM   10029 C C   . ASP F 1 173 ? 96.601  -16.576 98.316  1.00 13.94 ? 401  ASP F C   1 
ATOM   10030 O O   . ASP F 1 173 ? 97.136  -16.708 97.229  1.00 13.79 ? 401  ASP F O   1 
ATOM   10031 C CB  . ASP F 1 173 ? 97.031  -14.328 99.323  1.00 14.69 ? 401  ASP F CB  1 
ATOM   10032 C CG  . ASP F 1 173 ? 98.110  -13.916 98.330  1.00 16.84 ? 401  ASP F CG  1 
ATOM   10033 O OD1 . ASP F 1 173 ? 97.790  -13.704 97.129  1.00 18.39 ? 401  ASP F OD1 1 
ATOM   10034 O OD2 . ASP F 1 173 ? 99.283  -13.799 98.756  1.00 19.16 ? 401  ASP F OD2 1 
ATOM   10035 N N   . TYR F 1 174 ? 96.536  -17.565 99.206  1.00 13.80 ? 402  TYR F N   1 
ATOM   10036 C CA  . TYR F 1 174 ? 97.012  -18.901 98.874  1.00 13.40 ? 402  TYR F CA  1 
ATOM   10037 C C   . TYR F 1 174 ? 96.243  -19.394 97.689  1.00 13.32 ? 402  TYR F C   1 
ATOM   10038 O O   . TYR F 1 174 ? 96.833  -19.875 96.728  1.00 13.22 ? 402  TYR F O   1 
ATOM   10039 C CB  . TYR F 1 174 ? 96.794  -19.894 100.002 1.00 13.19 ? 402  TYR F CB  1 
ATOM   10040 C CG  . TYR F 1 174 ? 97.107  -21.310 99.577  1.00 13.09 ? 402  TYR F CG  1 
ATOM   10041 C CD1 . TYR F 1 174 ? 98.419  -21.735 99.448  1.00 12.79 ? 402  TYR F CD1 1 
ATOM   10042 C CD2 . TYR F 1 174 ? 96.098  -22.220 99.285  1.00 13.67 ? 402  TYR F CD2 1 
ATOM   10043 C CE1 . TYR F 1 174 ? 98.733  -23.029 99.057  1.00 12.36 ? 402  TYR F CE1 1 
ATOM   10044 C CE2 . TYR F 1 174 ? 96.399  -23.537 98.882  1.00 13.68 ? 402  TYR F CE2 1 
ATOM   10045 C CZ  . TYR F 1 174 ? 97.735  -23.930 98.776  1.00 13.00 ? 402  TYR F CZ  1 
ATOM   10046 O OH  . TYR F 1 174 ? 98.086  -25.212 98.390  1.00 12.45 ? 402  TYR F OH  1 
ATOM   10047 N N   . GLU F 1 175 ? 94.920  -19.259 97.771  1.00 13.17 ? 403  GLU F N   1 
ATOM   10048 C CA  . GLU F 1 175 ? 94.024  -19.770 96.736  1.00 13.18 ? 403  GLU F CA  1 
ATOM   10049 C C   . GLU F 1 175 ? 94.080  -18.930 95.465  1.00 13.42 ? 403  GLU F C   1 
ATOM   10050 O O   . GLU F 1 175 ? 93.991  -19.454 94.358  1.00 13.62 ? 403  GLU F O   1 
ATOM   10051 C CB  . GLU F 1 175 ? 92.581  -19.816 97.231  1.00 12.87 ? 403  GLU F CB  1 
ATOM   10052 C CG  . GLU F 1 175 ? 92.359  -20.592 98.518  1.00 12.81 ? 403  GLU F CG  1 
ATOM   10053 C CD  . GLU F 1 175 ? 92.727  -22.067 98.429  1.00 12.01 ? 403  GLU F CD  1 
ATOM   10054 O OE1 . GLU F 1 175 ? 92.943  -22.574 97.315  1.00 12.43 ? 403  GLU F OE1 1 
ATOM   10055 O OE2 . GLU F 1 175 ? 92.799  -22.720 99.491  1.00 10.62 ? 403  GLU F OE2 1 
ATOM   10056 N N   . ALA F 1 176 ? 94.220  -17.622 95.619  1.00 13.60 ? 404  ALA F N   1 
ATOM   10057 C CA  . ALA F 1 176 ? 94.300  -16.750 94.460  1.00 13.71 ? 404  ALA F CA  1 
ATOM   10058 C C   . ALA F 1 176 ? 95.427  -17.208 93.549  1.00 13.97 ? 404  ALA F C   1 
ATOM   10059 O O   . ALA F 1 176 ? 95.268  -17.218 92.328  1.00 14.11 ? 404  ALA F O   1 
ATOM   10060 C CB  . ALA F 1 176 ? 94.520  -15.319 94.890  1.00 13.61 ? 404  ALA F CB  1 
ATOM   10061 N N   . GLY F 1 177 ? 96.546  -17.608 94.158  1.00 14.07 ? 405  GLY F N   1 
ATOM   10062 C CA  . GLY F 1 177 ? 97.760  -17.943 93.434  1.00 14.32 ? 405  GLY F CA  1 
ATOM   10063 C C   . GLY F 1 177 ? 97.917  -19.410 93.083  1.00 14.56 ? 405  GLY F C   1 
ATOM   10064 O O   . GLY F 1 177 ? 98.412  -19.734 92.003  1.00 14.60 ? 405  GLY F O   1 
ATOM   10065 N N   . GLN F 1 178 ? 97.505  -20.297 93.985  1.00 14.66 ? 406  GLN F N   1 
ATOM   10066 C CA  . GLN F 1 178 ? 97.717  -21.736 93.806  1.00 14.87 ? 406  GLN F CA  1 
ATOM   10067 C C   . GLN F 1 178 ? 96.526  -22.440 93.141  1.00 14.99 ? 406  GLN F C   1 
ATOM   10068 O O   . GLN F 1 178 ? 96.665  -23.543 92.602  1.00 14.79 ? 406  GLN F O   1 
ATOM   10069 C CB  . GLN F 1 178 ? 98.019  -22.376 95.167  1.00 14.99 ? 406  GLN F CB  1 
ATOM   10070 C CG  . GLN F 1 178 ? 98.437  -23.854 95.136  1.00 15.55 ? 406  GLN F CG  1 
ATOM   10071 C CD  . GLN F 1 178 ? 99.725  -24.091 94.377  1.00 15.92 ? 406  GLN F CD  1 
ATOM   10072 O OE1 . GLN F 1 178 ? 100.466 -23.155 94.092  1.00 15.93 ? 406  GLN F OE1 1 
ATOM   10073 N NE2 . GLN F 1 178 ? 99.999  -25.349 94.044  1.00 16.09 ? 406  GLN F NE2 1 
ATOM   10074 N N   . HIS F 1 179 ? 95.361  -21.797 93.194  1.00 15.25 ? 407  HIS F N   1 
ATOM   10075 C CA  . HIS F 1 179 ? 94.109  -22.370 92.705  1.00 15.26 ? 407  HIS F CA  1 
ATOM   10076 C C   . HIS F 1 179 ? 93.259  -21.301 92.027  1.00 15.52 ? 407  HIS F C   1 
ATOM   10077 O O   . HIS F 1 179 ? 92.138  -20.996 92.471  1.00 15.47 ? 407  HIS F O   1 
ATOM   10078 C CB  . HIS F 1 179 ? 93.336  -22.982 93.867  1.00 15.15 ? 407  HIS F CB  1 
ATOM   10079 C CG  . HIS F 1 179 ? 93.972  -24.211 94.424  1.00 14.98 ? 407  HIS F CG  1 
ATOM   10080 N ND1 . HIS F 1 179 ? 93.808  -25.454 93.853  1.00 14.05 ? 407  HIS F ND1 1 
ATOM   10081 C CD2 . HIS F 1 179 ? 94.780  -24.391 95.495  1.00 14.81 ? 407  HIS F CD2 1 
ATOM   10082 C CE1 . HIS F 1 179 ? 94.481  -26.349 94.553  1.00 14.20 ? 407  HIS F CE1 1 
ATOM   10083 N NE2 . HIS F 1 179 ? 95.079  -25.731 95.555  1.00 14.47 ? 407  HIS F NE2 1 
ATOM   10084 N N   . MET F 1 180 ? 93.809  -20.731 90.957  1.00 15.63 ? 408  MET F N   1 
ATOM   10085 C CA  . MET F 1 180 ? 93.115  -19.711 90.174  1.00 15.80 ? 408  MET F CA  1 
ATOM   10086 C C   . MET F 1 180 ? 92.002  -20.335 89.335  1.00 15.92 ? 408  MET F C   1 
ATOM   10087 O O   . MET F 1 180 ? 91.073  -19.645 88.933  1.00 15.81 ? 408  MET F O   1 
ATOM   10088 C CB  . MET F 1 180 ? 94.101  -18.967 89.274  1.00 15.75 ? 408  MET F CB  1 
ATOM   10089 C CG  . MET F 1 180 ? 93.638  -17.584 88.823  1.00 15.74 ? 408  MET F CG  1 
ATOM   10090 S SD  . MET F 1 180 ? 94.805  -16.723 87.723  1.00 15.98 ? 408  MET F SD  1 
ATOM   10091 C CE  . MET F 1 180 ? 96.393  -17.094 88.490  1.00 15.53 ? 408  MET F CE  1 
ATOM   10092 N N   . GLU F 1 181 ? 92.101  -21.640 89.080  1.00 16.18 ? 409  GLU F N   1 
ATOM   10093 C CA  . GLU F 1 181 ? 91.070  -22.375 88.335  1.00 16.27 ? 409  GLU F CA  1 
ATOM   10094 C C   . GLU F 1 181 ? 89.720  -22.421 89.052  1.00 16.10 ? 409  GLU F C   1 
ATOM   10095 O O   . GLU F 1 181 ? 88.706  -22.693 88.410  1.00 16.21 ? 409  GLU F O   1 
ATOM   10096 C CB  . GLU F 1 181 ? 91.533  -23.804 87.987  1.00 16.35 ? 409  GLU F CB  1 
ATOM   10097 C CG  . GLU F 1 181 ? 91.287  -24.873 89.060  1.00 17.01 ? 409  GLU F CG  1 
ATOM   10098 C CD  . GLU F 1 181 ? 92.204  -24.760 90.265  1.00 18.08 ? 409  GLU F CD  1 
ATOM   10099 O OE1 . GLU F 1 181 ? 93.330  -24.232 90.098  1.00 19.20 ? 409  GLU F OE1 1 
ATOM   10100 O OE2 . GLU F 1 181 ? 91.801  -25.216 91.369  1.00 17.10 ? 409  GLU F OE2 1 
ATOM   10101 N N   . ASP F 1 182 ? 89.716  -22.193 90.371  1.00 15.95 ? 410  ASP F N   1 
ATOM   10102 C CA  . ASP F 1 182 ? 88.464  -22.021 91.149  1.00 15.76 ? 410  ASP F CA  1 
ATOM   10103 C C   . ASP F 1 182 ? 88.473  -20.734 91.994  1.00 15.58 ? 410  ASP F C   1 
ATOM   10104 O O   . ASP F 1 182 ? 89.012  -20.726 93.105  1.00 15.37 ? 410  ASP F O   1 
ATOM   10105 C CB  . ASP F 1 182 ? 88.214  -23.209 92.078  1.00 15.64 ? 410  ASP F CB  1 
ATOM   10106 C CG  . ASP F 1 182 ? 86.891  -23.110 92.774  1.00 15.83 ? 410  ASP F CG  1 
ATOM   10107 O OD1 . ASP F 1 182 ? 86.204  -22.083 92.563  1.00 15.65 ? 410  ASP F OD1 1 
ATOM   10108 O OD2 . ASP F 1 182 ? 86.532  -24.051 93.520  1.00 15.15 ? 410  ASP F OD2 1 
ATOM   10109 N N   . PRO F 1 183 ? 87.848  -19.651 91.483  1.00 15.32 ? 411  PRO F N   1 
ATOM   10110 C CA  . PRO F 1 183 ? 87.847  -18.358 92.191  1.00 14.95 ? 411  PRO F CA  1 
ATOM   10111 C C   . PRO F 1 183 ? 87.104  -18.377 93.527  1.00 14.76 ? 411  PRO F C   1 
ATOM   10112 O O   . PRO F 1 183 ? 87.218  -17.433 94.311  1.00 14.23 ? 411  PRO F O   1 
ATOM   10113 C CB  . PRO F 1 183 ? 87.162  -17.399 91.205  1.00 14.91 ? 411  PRO F CB  1 
ATOM   10114 C CG  . PRO F 1 183 ? 86.510  -18.230 90.182  1.00 15.33 ? 411  PRO F CG  1 
ATOM   10115 C CD  . PRO F 1 183 ? 87.109  -19.601 90.207  1.00 15.39 ? 411  PRO F CD  1 
ATOM   10116 N N   . ARG F 1 184 ? 86.363  -19.459 93.766  1.00 14.80 ? 412  ARG F N   1 
ATOM   10117 C CA  . ARG F 1 184 ? 85.587  -19.641 94.979  1.00 14.91 ? 412  ARG F CA  1 
ATOM   10118 C C   . ARG F 1 184 ? 86.146  -20.690 95.938  1.00 14.94 ? 412  ARG F C   1 
ATOM   10119 O O   . ARG F 1 184 ? 85.495  -21.046 96.922  1.00 15.02 ? 412  ARG F O   1 
ATOM   10120 C CB  . ARG F 1 184 ? 84.167  -20.028 94.590  1.00 15.01 ? 412  ARG F CB  1 
ATOM   10121 C CG  . ARG F 1 184 ? 83.339  -18.838 94.188  1.00 15.24 ? 412  ARG F CG  1 
ATOM   10122 C CD  . ARG F 1 184 ? 82.005  -19.276 93.676  1.00 15.74 ? 412  ARG F CD  1 
ATOM   10123 N NE  . ARG F 1 184 ? 82.140  -19.970 92.402  1.00 15.75 ? 412  ARG F NE  1 
ATOM   10124 C CZ  . ARG F 1 184 ? 82.330  -19.369 91.230  1.00 16.19 ? 412  ARG F CZ  1 
ATOM   10125 N NH1 . ARG F 1 184 ? 82.405  -18.039 91.150  1.00 16.72 ? 412  ARG F NH1 1 
ATOM   10126 N NH2 . ARG F 1 184 ? 82.449  -20.105 90.132  1.00 15.57 ? 412  ARG F NH2 1 
ATOM   10127 N N   . ARG F 1 185 ? 87.347  -21.190 95.682  1.00 14.89 ? 413  ARG F N   1 
ATOM   10128 C CA  . ARG F 1 185 ? 87.884  -22.229 96.554  1.00 14.93 ? 413  ARG F CA  1 
ATOM   10129 C C   . ARG F 1 185 ? 87.956  -21.754 98.010  1.00 14.94 ? 413  ARG F C   1 
ATOM   10130 O O   . ARG F 1 185 ? 87.509  -22.471 98.919  1.00 14.94 ? 413  ARG F O   1 
ATOM   10131 C CB  . ARG F 1 185 ? 89.251  -22.691 96.081  1.00 14.89 ? 413  ARG F CB  1 
ATOM   10132 C CG  . ARG F 1 185 ? 89.669  -24.017 96.674  1.00 15.07 ? 413  ARG F CG  1 
ATOM   10133 C CD  . ARG F 1 185 ? 90.847  -24.587 95.912  1.00 15.57 ? 413  ARG F CD  1 
ATOM   10134 N NE  . ARG F 1 185 ? 91.546  -25.636 96.657  1.00 15.86 ? 413  ARG F NE  1 
ATOM   10135 C CZ  . ARG F 1 185 ? 91.140  -26.902 96.757  1.00 15.28 ? 413  ARG F CZ  1 
ATOM   10136 N NH1 . ARG F 1 185 ? 90.014  -27.304 96.159  1.00 14.74 ? 413  ARG F NH1 1 
ATOM   10137 N NH2 . ARG F 1 185 ? 91.871  -27.761 97.463  1.00 14.61 ? 413  ARG F NH2 1 
ATOM   10138 N N   . ALA F 1 186 ? 88.482  -20.539 98.215  1.00 14.62 ? 414  ALA F N   1 
ATOM   10139 C CA  . ALA F 1 186 ? 88.568  -19.928 99.552  1.00 14.20 ? 414  ALA F CA  1 
ATOM   10140 C C   . ALA F 1 186 ? 87.233  -19.963 100.258 1.00 14.14 ? 414  ALA F C   1 
ATOM   10141 O O   . ALA F 1 186 ? 87.136  -20.400 101.405 1.00 14.21 ? 414  ALA F O   1 
ATOM   10142 C CB  . ALA F 1 186 ? 89.049  -18.507 99.463  1.00 14.06 ? 414  ALA F CB  1 
ATOM   10143 N N   . GLY F 1 187 ? 86.195  -19.511 99.572  1.00 14.12 ? 415  GLY F N   1 
ATOM   10144 C CA  . GLY F 1 187 ? 84.859  -19.547 100.150 1.00 14.28 ? 415  GLY F CA  1 
ATOM   10145 C C   . GLY F 1 187 ? 84.445  -20.971 100.483 1.00 14.27 ? 415  GLY F C   1 
ATOM   10146 O O   . GLY F 1 187 ? 83.941  -21.236 101.568 1.00 14.06 ? 415  GLY F O   1 
ATOM   10147 N N   . LYS F 1 188 ? 84.683  -21.895 99.557  1.00 14.44 ? 416  LYS F N   1 
ATOM   10148 C CA  . LYS F 1 188 ? 84.355  -23.293 99.797  1.00 14.82 ? 416  LYS F CA  1 
ATOM   10149 C C   . LYS F 1 188 ? 85.065  -23.817 101.045 1.00 14.95 ? 416  LYS F C   1 
ATOM   10150 O O   . LYS F 1 188 ? 84.523  -24.656 101.770 1.00 15.51 ? 416  LYS F O   1 
ATOM   10151 C CB  . LYS F 1 188 ? 84.709  -24.151 98.589  1.00 14.95 ? 416  LYS F CB  1 
ATOM   10152 C CG  . LYS F 1 188 ? 83.797  -23.925 97.401  1.00 16.61 ? 416  LYS F CG  1 
ATOM   10153 C CD  . LYS F 1 188 ? 84.489  -24.389 96.105  1.00 20.00 ? 416  LYS F CD  1 
ATOM   10154 C CE  . LYS F 1 188 ? 83.549  -24.337 94.900  1.00 21.06 ? 416  LYS F CE  1 
ATOM   10155 N NZ  . LYS F 1 188 ? 84.300  -24.205 93.622  1.00 21.55 ? 416  LYS F NZ  1 
ATOM   10156 N N   . MET F 1 189 ? 86.268  -23.314 101.305 1.00 14.78 ? 417  MET F N   1 
ATOM   10157 C CA  . MET F 1 189 ? 86.998  -23.709 102.490 1.00 14.61 ? 417  MET F CA  1 
ATOM   10158 C C   . MET F 1 189 ? 86.319  -23.180 103.734 1.00 14.49 ? 417  MET F C   1 
ATOM   10159 O O   . MET F 1 189 ? 85.997  -23.943 104.633 1.00 15.04 ? 417  MET F O   1 
ATOM   10160 C CB  . MET F 1 189 ? 88.437  -23.213 102.426 1.00 14.78 ? 417  MET F CB  1 
ATOM   10161 C CG  . MET F 1 189 ? 89.321  -24.015 101.487 1.00 15.02 ? 417  MET F CG  1 
ATOM   10162 S SD  . MET F 1 189 ? 89.364  -25.771 101.905 1.00 16.22 ? 417  MET F SD  1 
ATOM   10163 C CE  . MET F 1 189 ? 89.917  -26.469 100.341 1.00 14.87 ? 417  MET F CE  1 
ATOM   10164 N N   . LEU F 1 190 ? 86.076  -21.877 103.773 1.00 14.21 ? 418  LEU F N   1 
ATOM   10165 C CA  . LEU F 1 190 ? 85.399  -21.246 104.914 1.00 13.77 ? 418  LEU F CA  1 
ATOM   10166 C C   . LEU F 1 190 ? 84.022  -21.856 105.206 1.00 13.76 ? 418  LEU F C   1 
ATOM   10167 O O   . LEU F 1 190 ? 83.557  -21.832 106.351 1.00 13.86 ? 418  LEU F O   1 
ATOM   10168 C CB  . LEU F 1 190 ? 85.247  -19.744 104.674 1.00 13.40 ? 418  LEU F CB  1 
ATOM   10169 C CG  . LEU F 1 190 ? 86.550  -18.944 104.553 1.00 12.96 ? 418  LEU F CG  1 
ATOM   10170 C CD1 . LEU F 1 190 ? 86.324  -17.660 103.765 1.00 12.08 ? 418  LEU F CD1 1 
ATOM   10171 C CD2 . LEU F 1 190 ? 87.169  -18.645 105.925 1.00 12.00 ? 418  LEU F CD2 1 
ATOM   10172 N N   . MET F 1 191 ? 83.377  -22.411 104.180 1.00 13.73 ? 419  MET F N   1 
ATOM   10173 C CA  . MET F 1 191 ? 82.017  -22.962 104.330 1.00 13.59 ? 419  MET F CA  1 
ATOM   10174 C C   . MET F 1 191 ? 81.999  -24.328 104.983 1.00 13.34 ? 419  MET F C   1 
ATOM   10175 O O   . MET F 1 191 ? 80.920  -24.826 105.326 1.00 13.41 ? 419  MET F O   1 
ATOM   10176 C CB  . MET F 1 191 ? 81.287  -23.039 102.989 1.00 13.36 ? 419  MET F CB  1 
ATOM   10177 C CG  . MET F 1 191 ? 80.665  -21.733 102.570 1.00 13.03 ? 419  MET F CG  1 
ATOM   10178 S SD  . MET F 1 191 ? 80.181  -21.792 100.853 1.00 13.77 ? 419  MET F SD  1 
ATOM   10179 C CE  . MET F 1 191 ? 78.405  -22.076 100.985 1.00 13.94 ? 419  MET F CE  1 
ATOM   10180 N N   . THR F 1 192 ? 83.177  -24.931 105.153 1.00 12.72 ? 420  THR F N   1 
ATOM   10181 C CA  . THR F 1 192 ? 83.281  -26.192 105.869 1.00 12.26 ? 420  THR F CA  1 
ATOM   10182 C C   . THR F 1 192 ? 83.319  -25.979 107.381 1.00 12.51 ? 420  THR F C   1 
ATOM   10183 O O   . THR F 1 192 ? 83.338  -26.935 108.158 1.00 12.69 ? 420  THR F O   1 
ATOM   10184 C CB  . THR F 1 192 ? 84.531  -26.931 105.465 1.00 11.97 ? 420  THR F CB  1 
ATOM   10185 O OG1 . THR F 1 192 ? 85.670  -26.137 105.817 1.00 11.05 ? 420  THR F OG1 1 
ATOM   10186 C CG2 . THR F 1 192 ? 84.514  -27.223 103.966 1.00 10.74 ? 420  THR F CG2 1 
ATOM   10187 N N   . LEU F 1 193 ? 83.338  -24.723 107.805 1.00 12.70 ? 421  LEU F N   1 
ATOM   10188 C CA  . LEU F 1 193 ? 83.541  -24.412 109.214 1.00 12.62 ? 421  LEU F CA  1 
ATOM   10189 C C   . LEU F 1 193 ? 82.263  -24.612 110.045 1.00 12.56 ? 421  LEU F C   1 
ATOM   10190 O O   . LEU F 1 193 ? 82.328  -25.107 111.175 1.00 12.66 ? 421  LEU F O   1 
ATOM   10191 C CB  . LEU F 1 193 ? 84.146  -22.999 109.378 1.00 12.30 ? 421  LEU F CB  1 
ATOM   10192 C CG  . LEU F 1 193 ? 85.594  -22.867 108.885 1.00 11.30 ? 421  LEU F CG  1 
ATOM   10193 C CD1 . LEU F 1 193 ? 86.101  -21.447 108.956 1.00 10.52 ? 421  LEU F CD1 1 
ATOM   10194 C CD2 . LEU F 1 193 ? 86.481  -23.735 109.698 1.00 10.63 ? 421  LEU F CD2 1 
ATOM   10195 N N   . PRO F 1 194 ? 81.101  -24.213 109.516 1.00 12.49 ? 422  PRO F N   1 
ATOM   10196 C CA  . PRO F 1 194 ? 79.892  -24.535 110.281 1.00 12.67 ? 422  PRO F CA  1 
ATOM   10197 C C   . PRO F 1 194 ? 79.808  -25.997 110.771 1.00 12.75 ? 422  PRO F C   1 
ATOM   10198 O O   . PRO F 1 194 ? 79.452  -26.232 111.926 1.00 12.76 ? 422  PRO F O   1 
ATOM   10199 C CB  . PRO F 1 194 ? 78.768  -24.176 109.299 1.00 12.35 ? 422  PRO F CB  1 
ATOM   10200 C CG  . PRO F 1 194 ? 79.333  -23.036 108.561 1.00 12.13 ? 422  PRO F CG  1 
ATOM   10201 C CD  . PRO F 1 194 ? 80.778  -23.413 108.324 1.00 12.31 ? 422  PRO F CD  1 
ATOM   10202 N N   . LEU F 1 195 ? 80.163  -26.954 109.920 1.00 12.80 ? 423  LEU F N   1 
ATOM   10203 C CA  . LEU F 1 195 ? 80.158  -28.366 110.312 1.00 13.09 ? 423  LEU F CA  1 
ATOM   10204 C C   . LEU F 1 195 ? 81.258  -28.697 111.329 1.00 12.90 ? 423  LEU F C   1 
ATOM   10205 O O   . LEU F 1 195 ? 81.085  -29.578 112.168 1.00 13.31 ? 423  LEU F O   1 
ATOM   10206 C CB  . LEU F 1 195 ? 80.320  -29.269 109.083 1.00 13.23 ? 423  LEU F CB  1 
ATOM   10207 C CG  . LEU F 1 195 ? 80.302  -30.779 109.340 1.00 13.60 ? 423  LEU F CG  1 
ATOM   10208 C CD1 . LEU F 1 195 ? 79.007  -31.189 110.034 1.00 12.79 ? 423  LEU F CD1 1 
ATOM   10209 C CD2 . LEU F 1 195 ? 80.496  -31.555 108.033 1.00 13.53 ? 423  LEU F CD2 1 
ATOM   10210 N N   . LEU F 1 196 ? 82.394  -28.015 111.241 1.00 12.50 ? 424  LEU F N   1 
ATOM   10211 C CA  . LEU F 1 196 ? 83.471  -28.217 112.204 1.00 12.04 ? 424  LEU F CA  1 
ATOM   10212 C C   . LEU F 1 196 ? 82.994  -27.826 113.606 1.00 11.86 ? 424  LEU F C   1 
ATOM   10213 O O   . LEU F 1 196 ? 83.286  -28.507 114.574 1.00 12.04 ? 424  LEU F O   1 
ATOM   10214 C CB  . LEU F 1 196 ? 84.725  -27.433 111.784 1.00 11.86 ? 424  LEU F CB  1 
ATOM   10215 C CG  . LEU F 1 196 ? 86.030  -27.678 112.552 1.00 11.74 ? 424  LEU F CG  1 
ATOM   10216 C CD1 . LEU F 1 196 ? 86.347  -29.157 112.651 1.00 10.12 ? 424  LEU F CD1 1 
ATOM   10217 C CD2 . LEU F 1 196 ? 87.196  -26.911 111.889 1.00 11.66 ? 424  LEU F CD2 1 
ATOM   10218 N N   . ARG F 1 197 ? 82.233  -26.747 113.700 1.00 11.89 ? 425  ARG F N   1 
ATOM   10219 C CA  . ARG F 1 197 ? 81.705  -26.264 114.972 1.00 12.03 ? 425  ARG F CA  1 
ATOM   10220 C C   . ARG F 1 197 ? 80.570  -27.180 115.476 1.00 12.11 ? 425  ARG F C   1 
ATOM   10221 O O   . ARG F 1 197 ? 80.546  -27.585 116.649 1.00 12.16 ? 425  ARG F O   1 
ATOM   10222 C CB  . ARG F 1 197 ? 81.198  -24.838 114.768 1.00 12.33 ? 425  ARG F CB  1 
ATOM   10223 C CG  . ARG F 1 197 ? 80.575  -24.181 115.975 1.00 12.72 ? 425  ARG F CG  1 
ATOM   10224 C CD  . ARG F 1 197 ? 81.625  -23.669 116.916 1.00 13.38 ? 425  ARG F CD  1 
ATOM   10225 N NE  . ARG F 1 197 ? 82.455  -22.608 116.333 1.00 14.36 ? 425  ARG F NE  1 
ATOM   10226 C CZ  . ARG F 1 197 ? 82.049  -21.358 116.098 1.00 14.72 ? 425  ARG F CZ  1 
ATOM   10227 N NH1 . ARG F 1 197 ? 80.797  -20.980 116.340 1.00 15.90 ? 425  ARG F NH1 1 
ATOM   10228 N NH2 . ARG F 1 197 ? 82.901  -20.473 115.589 1.00 14.24 ? 425  ARG F NH2 1 
ATOM   10229 N N   . GLN F 1 198 ? 79.630  -27.487 114.587 1.00 11.90 ? 426  GLN F N   1 
ATOM   10230 C CA  . GLN F 1 198 ? 78.568  -28.447 114.873 1.00 12.18 ? 426  GLN F CA  1 
ATOM   10231 C C   . GLN F 1 198 ? 79.149  -29.700 115.517 1.00 12.29 ? 426  GLN F C   1 
ATOM   10232 O O   . GLN F 1 198 ? 78.730  -30.105 116.596 1.00 12.28 ? 426  GLN F O   1 
ATOM   10233 C CB  . GLN F 1 198 ? 77.840  -28.815 113.571 1.00 12.23 ? 426  GLN F CB  1 
ATOM   10234 C CG  . GLN F 1 198 ? 76.505  -29.567 113.717 1.00 12.54 ? 426  GLN F CG  1 
ATOM   10235 C CD  . GLN F 1 198 ? 75.852  -29.869 112.350 1.00 13.04 ? 426  GLN F CD  1 
ATOM   10236 O OE1 . GLN F 1 198 ? 74.800  -29.322 112.005 1.00 14.16 ? 426  GLN F OE1 1 
ATOM   10237 N NE2 . GLN F 1 198 ? 76.493  -30.729 111.566 1.00 14.64 ? 426  GLN F NE2 1 
ATOM   10238 N N   . THR F 1 199 ? 80.132  -30.293 114.845 1.00 12.56 ? 427  THR F N   1 
ATOM   10239 C CA  . THR F 1 199 ? 80.728  -31.559 115.260 1.00 12.77 ? 427  THR F CA  1 
ATOM   10240 C C   . THR F 1 199 ? 81.502  -31.398 116.557 1.00 12.95 ? 427  THR F C   1 
ATOM   10241 O O   . THR F 1 199 ? 81.381  -32.220 117.468 1.00 12.60 ? 427  THR F O   1 
ATOM   10242 C CB  . THR F 1 199 ? 81.691  -32.107 114.176 1.00 12.91 ? 427  THR F CB  1 
ATOM   10243 O OG1 . THR F 1 199 ? 81.009  -32.206 112.917 1.00 12.87 ? 427  THR F OG1 1 
ATOM   10244 C CG2 . THR F 1 199 ? 82.209  -33.471 114.571 1.00 12.94 ? 427  THR F CG2 1 
ATOM   10245 N N   . SER F 1 200 ? 82.304  -30.333 116.620 1.00 13.35 ? 428  SER F N   1 
ATOM   10246 C CA  . SER F 1 200 ? 83.082  -30.008 117.813 1.00 13.72 ? 428  SER F CA  1 
ATOM   10247 C C   . SER F 1 200 ? 82.238  -29.851 119.059 1.00 14.03 ? 428  SER F C   1 
ATOM   10248 O O   . SER F 1 200 ? 82.649  -30.269 120.139 1.00 14.37 ? 428  SER F O   1 
ATOM   10249 C CB  . SER F 1 200 ? 83.831  -28.711 117.642 1.00 13.77 ? 428  SER F CB  1 
ATOM   10250 O OG  . SER F 1 200 ? 84.035  -28.127 118.920 1.00 14.64 ? 428  SER F OG  1 
ATOM   10251 N N   . THR F 1 201 ? 81.091  -29.196 118.922 1.00 14.25 ? 429  THR F N   1 
ATOM   10252 C CA  . THR F 1 201 ? 80.157  -29.093 120.029 1.00 14.39 ? 429  THR F CA  1 
ATOM   10253 C C   . THR F 1 201 ? 79.666  -30.464 120.449 1.00 14.77 ? 429  THR F C   1 
ATOM   10254 O O   . THR F 1 201 ? 79.609  -30.761 121.638 1.00 15.01 ? 429  THR F O   1 
ATOM   10255 C CB  . THR F 1 201 ? 78.971  -28.214 119.667 1.00 14.46 ? 429  THR F CB  1 
ATOM   10256 O OG1 . THR F 1 201 ? 79.387  -26.848 119.719 1.00 14.59 ? 429  THR F OG1 1 
ATOM   10257 C CG2 . THR F 1 201 ? 77.810  -28.435 120.636 1.00 14.51 ? 429  THR F CG2 1 
ATOM   10258 N N   . LYS F 1 202 ? 79.326  -31.304 119.472 1.00 15.22 ? 430  LYS F N   1 
ATOM   10259 C CA  . LYS F 1 202 ? 78.782  -32.640 119.754 1.00 15.50 ? 430  LYS F CA  1 
ATOM   10260 C C   . LYS F 1 202 ? 79.732  -33.479 120.608 1.00 15.40 ? 430  LYS F C   1 
ATOM   10261 O O   . LYS F 1 202 ? 79.299  -34.151 121.542 1.00 15.12 ? 430  LYS F O   1 
ATOM   10262 C CB  . LYS F 1 202 ? 78.399  -33.373 118.449 1.00 15.70 ? 430  LYS F CB  1 
ATOM   10263 C CG  . LYS F 1 202 ? 76.898  -33.271 118.122 1.00 16.96 ? 430  LYS F CG  1 
ATOM   10264 C CD  . LYS F 1 202 ? 76.590  -32.899 116.668 1.00 18.44 ? 430  LYS F CD  1 
ATOM   10265 C CE  . LYS F 1 202 ? 75.309  -32.016 116.589 1.00 19.66 ? 430  LYS F CE  1 
ATOM   10266 N NZ  . LYS F 1 202 ? 75.482  -30.588 117.104 1.00 19.69 ? 430  LYS F NZ  1 
ATOM   10267 N N   . ALA F 1 203 ? 81.023  -33.415 120.285 1.00 15.51 ? 431  ALA F N   1 
ATOM   10268 C CA  . ALA F 1 203 ? 82.051  -34.122 121.034 1.00 15.46 ? 431  ALA F CA  1 
ATOM   10269 C C   . ALA F 1 203 ? 82.122  -33.571 122.457 1.00 15.65 ? 431  ALA F C   1 
ATOM   10270 O O   . ALA F 1 203 ? 82.020  -34.322 123.433 1.00 15.72 ? 431  ALA F O   1 
ATOM   10271 C CB  . ALA F 1 203 ? 83.398  -33.988 120.329 1.00 15.29 ? 431  ALA F CB  1 
ATOM   10272 N N   . VAL F 1 204 ? 82.277  -32.256 122.569 1.00 15.84 ? 432  VAL F N   1 
ATOM   10273 C CA  . VAL F 1 204 ? 82.398  -31.600 123.865 1.00 16.03 ? 432  VAL F CA  1 
ATOM   10274 C C   . VAL F 1 204 ? 81.265  -32.025 124.790 1.00 16.78 ? 432  VAL F C   1 
ATOM   10275 O O   . VAL F 1 204 ? 81.511  -32.510 125.895 1.00 16.79 ? 432  VAL F O   1 
ATOM   10276 C CB  . VAL F 1 204 ? 82.397  -30.082 123.717 1.00 15.87 ? 432  VAL F CB  1 
ATOM   10277 C CG1 . VAL F 1 204 ? 82.198  -29.424 125.064 1.00 15.56 ? 432  VAL F CG1 1 
ATOM   10278 C CG2 . VAL F 1 204 ? 83.690  -29.620 123.062 1.00 15.28 ? 432  VAL F CG2 1 
ATOM   10279 N N   . GLN F 1 205 ? 80.030  -31.845 124.321 1.00 17.55 ? 433  GLN F N   1 
ATOM   10280 C CA  . GLN F 1 205 ? 78.842  -32.322 125.022 1.00 18.20 ? 433  GLN F CA  1 
ATOM   10281 C C   . GLN F 1 205 ? 78.958  -33.812 125.379 1.00 18.45 ? 433  GLN F C   1 
ATOM   10282 O O   . GLN F 1 205 ? 78.834  -34.188 126.542 1.00 18.34 ? 433  GLN F O   1 
ATOM   10283 C CB  . GLN F 1 205 ? 77.586  -32.079 124.172 1.00 18.38 ? 433  GLN F CB  1 
ATOM   10284 C CG  . GLN F 1 205 ? 77.096  -30.607 124.133 1.00 18.98 ? 433  GLN F CG  1 
ATOM   10285 C CD  . GLN F 1 205 ? 75.796  -30.416 123.316 1.00 19.09 ? 433  GLN F CD  1 
ATOM   10286 O OE1 . GLN F 1 205 ? 75.159  -31.390 122.903 1.00 20.64 ? 433  GLN F OE1 1 
ATOM   10287 N NE2 . GLN F 1 205 ? 75.412  -29.156 123.082 1.00 19.07 ? 433  GLN F NE2 1 
ATOM   10288 N N   . HIS F 1 206 ? 79.229  -34.644 124.374 1.00 19.15 ? 434  HIS F N   1 
ATOM   10289 C CA  . HIS F 1 206 ? 79.373  -36.101 124.553 1.00 19.39 ? 434  HIS F CA  1 
ATOM   10290 C C   . HIS F 1 206 ? 80.441  -36.482 125.567 1.00 20.09 ? 434  HIS F C   1 
ATOM   10291 O O   . HIS F 1 206 ? 80.336  -37.521 126.202 1.00 20.04 ? 434  HIS F O   1 
ATOM   10292 C CB  . HIS F 1 206 ? 79.678  -36.779 123.220 1.00 19.09 ? 434  HIS F CB  1 
ATOM   10293 C CG  . HIS F 1 206 ? 79.806  -38.262 123.316 1.00 18.56 ? 434  HIS F CG  1 
ATOM   10294 N ND1 . HIS F 1 206 ? 78.739  -39.080 123.610 1.00 19.16 ? 434  HIS F ND1 1 
ATOM   10295 C CD2 . HIS F 1 206 ? 80.874  -39.077 123.159 1.00 18.48 ? 434  HIS F CD2 1 
ATOM   10296 C CE1 . HIS F 1 206 ? 79.145  -40.337 123.637 1.00 19.01 ? 434  HIS F CE1 1 
ATOM   10297 N NE2 . HIS F 1 206 ? 80.437  -40.361 123.366 1.00 19.03 ? 434  HIS F NE2 1 
ATOM   10298 N N   . PHE F 1 207 ? 81.464  -35.648 125.725 1.00 21.24 ? 435  PHE F N   1 
ATOM   10299 C CA  . PHE F 1 207 ? 82.495  -35.911 126.734 1.00 22.29 ? 435  PHE F CA  1 
ATOM   10300 C C   . PHE F 1 207 ? 81.962  -35.678 128.145 1.00 23.18 ? 435  PHE F C   1 
ATOM   10301 O O   . PHE F 1 207 ? 82.108  -36.533 129.018 1.00 23.25 ? 435  PHE F O   1 
ATOM   10302 C CB  . PHE F 1 207 ? 83.747  -35.062 126.495 1.00 22.54 ? 435  PHE F CB  1 
ATOM   10303 C CG  . PHE F 1 207 ? 84.842  -35.316 127.490 1.00 22.46 ? 435  PHE F CG  1 
ATOM   10304 C CD1 . PHE F 1 207 ? 85.412  -36.581 127.599 1.00 22.87 ? 435  PHE F CD1 1 
ATOM   10305 C CD2 . PHE F 1 207 ? 85.296  -34.301 128.322 1.00 22.88 ? 435  PHE F CD2 1 
ATOM   10306 C CE1 . PHE F 1 207 ? 86.424  -36.837 128.517 1.00 23.08 ? 435  PHE F CE1 1 
ATOM   10307 C CE2 . PHE F 1 207 ? 86.305  -34.541 129.244 1.00 23.92 ? 435  PHE F CE2 1 
ATOM   10308 C CZ  . PHE F 1 207 ? 86.875  -35.819 129.342 1.00 23.73 ? 435  PHE F CZ  1 
ATOM   10309 N N   . TYR F 1 208 ? 81.338  -34.523 128.359 1.00 24.39 ? 436  TYR F N   1 
ATOM   10310 C CA  . TYR F 1 208 ? 80.739  -34.209 129.655 1.00 25.21 ? 436  TYR F CA  1 
ATOM   10311 C C   . TYR F 1 208 ? 79.605  -35.189 129.937 1.00 25.54 ? 436  TYR F C   1 
ATOM   10312 O O   . TYR F 1 208 ? 79.468  -35.663 131.061 1.00 25.68 ? 436  TYR F O   1 
ATOM   10313 C CB  . TYR F 1 208 ? 80.283  -32.731 129.728 1.00 25.80 ? 436  TYR F CB  1 
ATOM   10314 C CG  . TYR F 1 208 ? 81.426  -31.743 129.463 1.00 26.52 ? 436  TYR F CG  1 
ATOM   10315 C CD1 . TYR F 1 208 ? 82.678  -31.912 130.070 1.00 27.28 ? 436  TYR F CD1 1 
ATOM   10316 C CD2 . TYR F 1 208 ? 81.263  -30.658 128.602 1.00 27.21 ? 436  TYR F CD2 1 
ATOM   10317 C CE1 . TYR F 1 208 ? 83.743  -31.035 129.825 1.00 27.71 ? 436  TYR F CE1 1 
ATOM   10318 C CE2 . TYR F 1 208 ? 82.323  -29.760 128.351 1.00 28.07 ? 436  TYR F CE2 1 
ATOM   10319 C CZ  . TYR F 1 208 ? 83.569  -29.957 128.962 1.00 28.01 ? 436  TYR F CZ  1 
ATOM   10320 O OH  . TYR F 1 208 ? 84.636  -29.087 128.729 1.00 27.00 ? 436  TYR F OH  1 
ATOM   10321 N N   . ASN F 1 209 ? 78.834  -35.533 128.906 1.00 26.01 ? 437  ASN F N   1 
ATOM   10322 C CA  . ASN F 1 209 ? 77.719  -36.483 129.052 1.00 26.50 ? 437  ASN F CA  1 
ATOM   10323 C C   . ASN F 1 209 ? 78.158  -37.859 129.556 1.00 26.97 ? 437  ASN F C   1 
ATOM   10324 O O   . ASN F 1 209 ? 77.400  -38.525 130.272 1.00 27.20 ? 437  ASN F O   1 
ATOM   10325 C CB  . ASN F 1 209 ? 76.934  -36.642 127.732 1.00 26.54 ? 437  ASN F CB  1 
ATOM   10326 C CG  . ASN F 1 209 ? 75.870  -35.546 127.530 1.00 26.92 ? 437  ASN F CG  1 
ATOM   10327 O OD1 . ASN F 1 209 ? 74.935  -35.412 128.328 1.00 25.31 ? 437  ASN F OD1 1 
ATOM   10328 N ND2 . ASN F 1 209 ? 76.010  -34.768 126.447 1.00 27.72 ? 437  ASN F ND2 1 
ATOM   10329 N N   . ILE F 1 210 ? 79.368  -38.286 129.197 1.00 27.38 ? 438  ILE F N   1 
ATOM   10330 C CA  . ILE F 1 210 ? 79.851  -39.604 129.616 1.00 27.82 ? 438  ILE F CA  1 
ATOM   10331 C C   . ILE F 1 210 ? 80.797  -39.553 130.821 1.00 28.53 ? 438  ILE F C   1 
ATOM   10332 O O   . ILE F 1 210 ? 81.288  -40.593 131.258 1.00 28.70 ? 438  ILE F O   1 
ATOM   10333 C CB  . ILE F 1 210 ? 80.498  -40.392 128.440 1.00 27.89 ? 438  ILE F CB  1 
ATOM   10334 C CG1 . ILE F 1 210 ? 81.890  -39.835 128.071 1.00 27.90 ? 438  ILE F CG1 1 
ATOM   10335 C CG2 . ILE F 1 210 ? 79.551  -40.397 127.237 1.00 27.59 ? 438  ILE F CG2 1 
ATOM   10336 C CD1 . ILE F 1 210 ? 82.534  -40.527 126.881 1.00 27.53 ? 438  ILE F CD1 1 
ATOM   10337 N N   . LYS F 1 211 ? 81.046  -38.360 131.364 1.00 29.32 ? 439  LYS F N   1 
ATOM   10338 C CA  . LYS F 1 211 ? 81.716  -38.231 132.674 1.00 29.90 ? 439  LYS F CA  1 
ATOM   10339 C C   . LYS F 1 211 ? 80.700  -38.470 133.816 1.00 30.23 ? 439  LYS F C   1 
ATOM   10340 O O   . LYS F 1 211 ? 80.650  -37.708 134.787 1.00 30.21 ? 439  LYS F O   1 
ATOM   10341 C CB  . LYS F 1 211 ? 82.397  -36.851 132.811 1.00 29.98 ? 439  LYS F CB  1 
ATOM   10342 C CG  . LYS F 1 211 ? 83.782  -36.737 132.140 1.00 30.54 ? 439  LYS F CG  1 
ATOM   10343 C CD  . LYS F 1 211 ? 84.914  -36.416 133.128 1.00 31.10 ? 439  LYS F CD  1 
ATOM   10344 C CE  . LYS F 1 211 ? 85.028  -34.907 133.370 1.00 31.81 ? 439  LYS F CE  1 
ATOM   10345 N NZ  . LYS F 1 211 ? 85.919  -34.572 134.523 1.00 32.35 ? 439  LYS F NZ  1 
ATOM   10346 N N   . LEU F 1 212 ? 79.888  -39.526 133.694 1.00 30.62 ? 440  LEU F N   1 
ATOM   10347 C CA  . LEU F 1 212 ? 78.825  -39.802 134.672 1.00 30.91 ? 440  LEU F CA  1 
ATOM   10348 C C   . LEU F 1 212 ? 78.619  -41.310 134.885 1.00 30.81 ? 440  LEU F C   1 
ATOM   10349 O O   . LEU F 1 212 ? 78.127  -42.013 134.007 1.00 30.71 ? 440  LEU F O   1 
ATOM   10350 C CB  . LEU F 1 212 ? 77.509  -39.124 134.248 1.00 30.91 ? 440  LEU F CB  1 
ATOM   10351 C CG  . LEU F 1 212 ? 77.565  -37.617 133.922 1.00 31.05 ? 440  LEU F CG  1 
ATOM   10352 C CD1 . LEU F 1 212 ? 76.334  -37.152 133.125 1.00 31.16 ? 440  LEU F CD1 1 
ATOM   10353 C CD2 . LEU F 1 212 ? 77.727  -36.785 135.182 1.00 31.07 ? 440  LEU F CD2 1 
ATOM   10354 N N   . GLY G 2 4   ? 24.962  12.540  49.343  1.00 27.35 ? 1319 GLY G N   1 
ATOM   10355 C CA  . GLY G 2 4   ? 23.853  12.107  48.438  1.00 27.57 ? 1319 GLY G CA  1 
ATOM   10356 C C   . GLY G 2 4   ? 24.145  10.806  47.692  1.00 27.62 ? 1319 GLY G C   1 
ATOM   10357 O O   . GLY G 2 4   ? 23.387  9.836   47.807  1.00 27.75 ? 1319 GLY G O   1 
ATOM   10358 N N   . LEU G 2 5   ? 25.254  10.795  46.946  1.00 27.41 ? 1320 LEU G N   1 
ATOM   10359 C CA  . LEU G 2 5   ? 25.664  9.690   46.042  1.00 27.41 ? 1320 LEU G CA  1 
ATOM   10360 C C   . LEU G 2 5   ? 25.028  9.863   44.670  1.00 27.24 ? 1320 LEU G C   1 
ATOM   10361 O O   . LEU G 2 5   ? 25.724  10.053  43.669  1.00 27.16 ? 1320 LEU G O   1 
ATOM   10362 C CB  . LEU G 2 5   ? 25.360  8.282   46.590  1.00 27.32 ? 1320 LEU G CB  1 
ATOM   10363 C CG  . LEU G 2 5   ? 25.751  7.128   45.645  1.00 27.43 ? 1320 LEU G CG  1 
ATOM   10364 C CD1 . LEU G 2 5   ? 27.256  7.000   45.502  1.00 26.72 ? 1320 LEU G CD1 1 
ATOM   10365 C CD2 . LEU G 2 5   ? 25.153  5.803   46.103  1.00 27.74 ? 1320 LEU G CD2 1 
ATOM   10366 N N   . GLU G 2 6   ? 23.703  9.767   44.630  1.00 27.21 ? 1321 GLU G N   1 
ATOM   10367 C CA  . GLU G 2 6   ? 22.945  10.093  43.428  1.00 27.06 ? 1321 GLU G CA  1 
ATOM   10368 C C   . GLU G 2 6   ? 23.275  11.523  43.030  1.00 26.42 ? 1321 GLU G C   1 
ATOM   10369 O O   . GLU G 2 6   ? 23.655  11.778  41.893  1.00 26.27 ? 1321 GLU G O   1 
ATOM   10370 C CB  . GLU G 2 6   ? 21.436  9.933   43.662  1.00 27.32 ? 1321 GLU G CB  1 
ATOM   10371 C CG  . GLU G 2 6   ? 20.858  8.580   43.209  1.00 29.00 ? 1321 GLU G CG  1 
ATOM   10372 C CD  . GLU G 2 6   ? 21.177  7.417   44.149  1.00 31.34 ? 1321 GLU G CD  1 
ATOM   10373 O OE1 . GLU G 2 6   ? 21.191  7.617   45.392  1.00 32.22 ? 1321 GLU G OE1 1 
ATOM   10374 O OE2 . GLU G 2 6   ? 21.403  6.295   43.631  1.00 32.35 ? 1321 GLU G OE2 1 
ATOM   10375 N N   . ALA G 2 7   ? 23.153  12.438  43.996  1.00 25.87 ? 1322 ALA G N   1 
ATOM   10376 C CA  . ALA G 2 7   ? 23.442  13.869  43.800  1.00 25.23 ? 1322 ALA G CA  1 
ATOM   10377 C C   . ALA G 2 7   ? 24.892  14.153  43.368  1.00 24.75 ? 1322 ALA G C   1 
ATOM   10378 O O   . ALA G 2 7   ? 25.136  15.007  42.513  1.00 24.45 ? 1322 ALA G O   1 
ATOM   10379 C CB  . ALA G 2 7   ? 23.116  14.642  45.074  1.00 24.95 ? 1322 ALA G CB  1 
ATOM   10380 N N   . ILE G 2 8   ? 25.841  13.431  43.957  1.00 24.25 ? 1323 ILE G N   1 
ATOM   10381 C CA  . ILE G 2 8   ? 27.260  13.661  43.698  1.00 24.03 ? 1323 ILE G CA  1 
ATOM   10382 C C   . ILE G 2 8   ? 27.610  13.167  42.295  1.00 24.03 ? 1323 ILE G C   1 
ATOM   10383 O O   . ILE G 2 8   ? 28.201  13.897  41.496  1.00 24.00 ? 1323 ILE G O   1 
ATOM   10384 C CB  . ILE G 2 8   ? 28.146  12.944  44.746  1.00 23.96 ? 1323 ILE G CB  1 
ATOM   10385 C CG1 . ILE G 2 8   ? 27.816  13.431  46.153  1.00 23.94 ? 1323 ILE G CG1 1 
ATOM   10386 C CG2 . ILE G 2 8   ? 29.628  13.180  44.477  1.00 23.63 ? 1323 ILE G CG2 1 
ATOM   10387 C CD1 . ILE G 2 8   ? 28.395  12.566  47.231  1.00 23.98 ? 1323 ILE G CD1 1 
ATOM   10388 N N   . ILE G 2 9   ? 27.232  11.925  42.003  1.00 24.05 ? 1324 ILE G N   1 
ATOM   10389 C CA  . ILE G 2 9   ? 27.459  11.335  40.686  1.00 24.09 ? 1324 ILE G CA  1 
ATOM   10390 C C   . ILE G 2 9   ? 26.847  12.231  39.624  1.00 24.28 ? 1324 ILE G C   1 
ATOM   10391 O O   . ILE G 2 9   ? 27.501  12.606  38.655  1.00 24.11 ? 1324 ILE G O   1 
ATOM   10392 C CB  . ILE G 2 9   ? 26.855  9.912   40.575  1.00 24.02 ? 1324 ILE G CB  1 
ATOM   10393 C CG1 . ILE G 2 9   ? 27.710  8.910   41.345  1.00 23.95 ? 1324 ILE G CG1 1 
ATOM   10394 C CG2 . ILE G 2 9   ? 26.769  9.467   39.121  1.00 24.02 ? 1324 ILE G CG2 1 
ATOM   10395 C CD1 . ILE G 2 9   ? 27.104  7.527   41.423  1.00 23.76 ? 1324 ILE G CD1 1 
ATOM   10396 N N   . ARG G 2 10  ? 25.590  12.586  39.832  1.00 24.64 ? 1325 ARG G N   1 
ATOM   10397 C CA  . ARG G 2 10  ? 24.879  13.431  38.892  1.00 25.28 ? 1325 ARG G CA  1 
ATOM   10398 C C   . ARG G 2 10  ? 25.592  14.772  38.731  1.00 25.24 ? 1325 ARG G C   1 
ATOM   10399 O O   . ARG G 2 10  ? 26.029  15.104  37.633  1.00 25.35 ? 1325 ARG G O   1 
ATOM   10400 C CB  . ARG G 2 10  ? 23.433  13.625  39.339  1.00 25.19 ? 1325 ARG G CB  1 
ATOM   10401 C CG  . ARG G 2 10  ? 22.522  14.151  38.246  1.00 26.21 ? 1325 ARG G CG  1 
ATOM   10402 C CD  . ARG G 2 10  ? 21.044  14.034  38.627  1.00 26.91 ? 1325 ARG G CD  1 
ATOM   10403 N NE  . ARG G 2 10  ? 20.702  12.664  39.004  1.00 28.24 ? 1325 ARG G NE  1 
ATOM   10404 C CZ  . ARG G 2 10  ? 19.541  12.296  39.540  1.00 29.05 ? 1325 ARG G CZ  1 
ATOM   10405 N NH1 . ARG G 2 10  ? 18.574  13.186  39.752  1.00 29.04 ? 1325 ARG G NH1 1 
ATOM   10406 N NH2 . ARG G 2 10  ? 19.346  11.019  39.859  1.00 29.77 ? 1325 ARG G NH2 1 
ATOM   10407 N N   . LYS G 2 11  ? 25.742  15.523  39.822  1.00 25.38 ? 1326 LYS G N   1 
ATOM   10408 C CA  . LYS G 2 11  ? 26.411  16.822  39.758  1.00 25.54 ? 1326 LYS G CA  1 
ATOM   10409 C C   . LYS G 2 11  ? 27.769  16.698  39.074  1.00 25.61 ? 1326 LYS G C   1 
ATOM   10410 O O   . LYS G 2 11  ? 28.121  17.519  38.227  1.00 25.61 ? 1326 LYS G O   1 
ATOM   10411 C CB  . LYS G 2 11  ? 26.586  17.432  41.154  1.00 25.59 ? 1326 LYS G CB  1 
ATOM   10412 C CG  . LYS G 2 11  ? 27.393  18.740  41.170  1.00 25.86 ? 1326 LYS G CG  1 
ATOM   10413 C CD  . LYS G 2 11  ? 27.621  19.265  42.585  1.00 25.85 ? 1326 LYS G CD  1 
ATOM   10414 C CE  . LYS G 2 11  ? 28.801  20.231  42.633  1.00 25.74 ? 1326 LYS G CE  1 
ATOM   10415 N NZ  . LYS G 2 11  ? 28.923  20.884  43.965  1.00 25.73 ? 1326 LYS G NZ  1 
ATOM   10416 N N   . ALA G 2 12  ? 28.525  15.666  39.432  1.00 25.78 ? 1327 ALA G N   1 
ATOM   10417 C CA  . ALA G 2 12  ? 29.889  15.546  38.937  1.00 26.11 ? 1327 ALA G CA  1 
ATOM   10418 C C   . ALA G 2 12  ? 29.970  15.160  37.453  1.00 26.54 ? 1327 ALA G C   1 
ATOM   10419 O O   . ALA G 2 12  ? 30.912  15.559  36.777  1.00 26.77 ? 1327 ALA G O   1 
ATOM   10420 C CB  . ALA G 2 12  ? 30.680  14.588  39.788  1.00 26.15 ? 1327 ALA G CB  1 
ATOM   10421 N N   . LEU G 2 13  ? 29.004  14.392  36.945  1.00 27.06 ? 1328 LEU G N   1 
ATOM   10422 C CA  . LEU G 2 13  ? 28.939  14.095  35.505  1.00 27.35 ? 1328 LEU G CA  1 
ATOM   10423 C C   . LEU G 2 13  ? 28.478  15.329  34.727  1.00 28.14 ? 1328 LEU G C   1 
ATOM   10424 O O   . LEU G 2 13  ? 29.087  15.693  33.722  1.00 28.29 ? 1328 LEU G O   1 
ATOM   10425 C CB  . LEU G 2 13  ? 28.000  12.923  35.217  1.00 27.11 ? 1328 LEU G CB  1 
ATOM   10426 C CG  . LEU G 2 13  ? 28.544  11.531  35.528  1.00 26.85 ? 1328 LEU G CG  1 
ATOM   10427 C CD1 . LEU G 2 13  ? 27.437  10.485  35.541  1.00 26.59 ? 1328 LEU G CD1 1 
ATOM   10428 C CD2 . LEU G 2 13  ? 29.608  11.150  34.530  1.00 26.43 ? 1328 LEU G CD2 1 
ATOM   10429 N N   . MET G 2 14  ? 27.406  15.960  35.206  1.00 28.96 ? 1329 MET G N   1 
ATOM   10430 C CA  . MET G 2 14  ? 26.814  17.145  34.576  1.00 29.73 ? 1329 MET G CA  1 
ATOM   10431 C C   . MET G 2 14  ? 27.856  18.140  34.046  1.00 29.97 ? 1329 MET G C   1 
ATOM   10432 O O   . MET G 2 14  ? 27.971  18.345  32.833  1.00 29.82 ? 1329 MET G O   1 
ATOM   10433 C CB  . MET G 2 14  ? 25.917  17.890  35.585  1.00 30.14 ? 1329 MET G CB  1 
ATOM   10434 C CG  . MET G 2 14  ? 24.625  17.191  35.970  1.00 31.37 ? 1329 MET G CG  1 
ATOM   10435 S SD  . MET G 2 14  ? 23.331  17.317  34.725  1.00 35.53 ? 1329 MET G SD  1 
ATOM   10436 C CE  . MET G 2 14  ? 23.001  19.099  34.673  1.00 33.79 ? 1329 MET G CE  1 
ATOM   10437 N N   . GLY G 2 15  ? 28.600  18.750  34.974  1.00 30.36 ? 1330 GLY G N   1 
ATOM   10438 C CA  . GLY G 2 15  ? 29.515  19.859  34.672  1.00 30.49 ? 1330 GLY G CA  1 
ATOM   10439 C C   . GLY G 2 15  ? 30.890  19.606  35.257  1.00 30.56 ? 1330 GLY G C   1 
ATOM   10440 O O   . GLY G 2 15  ? 31.457  18.527  35.071  1.00 30.51 ? 1330 GLY G O   1 
ATOM   10441 N N   . GLY H 2 4   ? 15.579  -27.174 75.866  1.00 27.32 ? 1319 GLY H N   1 
ATOM   10442 C CA  . GLY H 2 4   ? 14.603  -26.440 76.722  1.00 27.45 ? 1319 GLY H CA  1 
ATOM   10443 C C   . GLY H 2 4   ? 15.260  -25.969 78.003  1.00 27.54 ? 1319 GLY H C   1 
ATOM   10444 O O   . GLY H 2 4   ? 15.525  -26.777 78.892  1.00 27.78 ? 1319 GLY H O   1 
ATOM   10445 N N   . LEU H 2 5   ? 15.533  -24.668 78.102  1.00 27.46 ? 1320 LEU H N   1 
ATOM   10446 C CA  . LEU H 2 5   ? 16.162  -24.106 79.304  1.00 27.30 ? 1320 LEU H CA  1 
ATOM   10447 C C   . LEU H 2 5   ? 15.313  -24.395 80.525  1.00 26.87 ? 1320 LEU H C   1 
ATOM   10448 O O   . LEU H 2 5   ? 15.810  -24.953 81.506  1.00 27.04 ? 1320 LEU H O   1 
ATOM   10449 C CB  . LEU H 2 5   ? 16.371  -22.589 79.188  1.00 27.46 ? 1320 LEU H CB  1 
ATOM   10450 C CG  . LEU H 2 5   ? 16.871  -21.882 80.465  1.00 27.70 ? 1320 LEU H CG  1 
ATOM   10451 C CD1 . LEU H 2 5   ? 18.204  -22.453 80.908  1.00 28.27 ? 1320 LEU H CD1 1 
ATOM   10452 C CD2 . LEU H 2 5   ? 16.992  -20.366 80.282  1.00 27.83 ? 1320 LEU H CD2 1 
ATOM   10453 N N   A GLU H 2 6   ? 14.038  -23.999 80.476  0.50 26.47 ? 1321 GLU H N   1 
ATOM   10454 N N   B GLU H 2 6   ? 14.040  -24.026 80.439  0.50 26.65 ? 1321 GLU H N   1 
ATOM   10455 C CA  A GLU H 2 6   ? 13.105  -24.255 81.582  0.50 26.18 ? 1321 GLU H CA  1 
ATOM   10456 C CA  B GLU H 2 6   ? 13.093  -24.225 81.527  0.50 26.43 ? 1321 GLU H CA  1 
ATOM   10457 C C   A GLU H 2 6   ? 13.111  -25.740 81.896  0.50 26.04 ? 1321 GLU H C   1 
ATOM   10458 C C   B GLU H 2 6   ? 13.045  -25.712 81.887  0.50 26.17 ? 1321 GLU H C   1 
ATOM   10459 O O   A GLU H 2 6   ? 13.317  -26.138 83.044  0.50 25.99 ? 1321 GLU H O   1 
ATOM   10460 O O   B GLU H 2 6   ? 13.155  -26.081 83.057  0.50 26.15 ? 1321 GLU H O   1 
ATOM   10461 C CB  A GLU H 2 6   ? 11.673  -23.814 81.239  0.50 26.25 ? 1321 GLU H CB  1 
ATOM   10462 C CB  B GLU H 2 6   ? 11.700  -23.717 81.125  0.50 26.50 ? 1321 GLU H CB  1 
ATOM   10463 C CG  A GLU H 2 6   ? 10.643  -24.045 82.376  0.50 26.13 ? 1321 GLU H CG  1 
ATOM   10464 C CG  B GLU H 2 6   ? 11.606  -22.192 80.874  0.50 26.48 ? 1321 GLU H CG  1 
ATOM   10465 C CD  A GLU H 2 6   ? 9.192   -23.864 81.941  0.50 25.60 ? 1321 GLU H CD  1 
ATOM   10466 C CD  B GLU H 2 6   ? 12.089  -21.758 79.490  0.50 26.27 ? 1321 GLU H CD  1 
ATOM   10467 O OE1 A GLU H 2 6   ? 8.892   -24.064 80.748  0.50 24.74 ? 1321 GLU H OE1 1 
ATOM   10468 O OE1 B GLU H 2 6   ? 11.682  -22.383 78.483  0.50 26.37 ? 1321 GLU H OE1 1 
ATOM   10469 O OE2 A GLU H 2 6   ? 8.346   -23.537 82.801  0.50 24.04 ? 1321 GLU H OE2 1 
ATOM   10470 O OE2 B GLU H 2 6   ? 12.874  -20.786 79.411  0.50 25.61 ? 1321 GLU H OE2 1 
ATOM   10471 N N   . ALA H 2 7   ? 12.897  -26.548 80.862  1.00 25.85 ? 1322 ALA H N   1 
ATOM   10472 C CA  . ALA H 2 7   ? 12.897  -28.002 81.004  1.00 25.58 ? 1322 ALA H CA  1 
ATOM   10473 C C   . ALA H 2 7   ? 14.026  -28.470 81.913  1.00 25.27 ? 1322 ALA H C   1 
ATOM   10474 O O   . ALA H 2 7   ? 13.779  -29.082 82.953  1.00 25.42 ? 1322 ALA H O   1 
ATOM   10475 C CB  . ALA H 2 7   ? 13.031  -28.659 79.627  1.00 25.48 ? 1322 ALA H CB  1 
ATOM   10476 N N   . ILE H 2 8   ? 15.255  -28.129 81.527  1.00 24.83 ? 1323 ILE H N   1 
ATOM   10477 C CA  . ILE H 2 8   ? 16.461  -28.598 82.207  1.00 24.45 ? 1323 ILE H CA  1 
ATOM   10478 C C   . ILE H 2 8   ? 16.394  -28.301 83.693  1.00 24.20 ? 1323 ILE H C   1 
ATOM   10479 O O   . ILE H 2 8   ? 16.562  -29.188 84.535  1.00 24.05 ? 1323 ILE H O   1 
ATOM   10480 C CB  . ILE H 2 8   ? 17.715  -27.917 81.635  1.00 24.42 ? 1323 ILE H CB  1 
ATOM   10481 C CG1 . ILE H 2 8   ? 17.995  -28.409 80.216  1.00 24.69 ? 1323 ILE H CG1 1 
ATOM   10482 C CG2 . ILE H 2 8   ? 18.923  -28.212 82.499  1.00 24.37 ? 1323 ILE H CG2 1 
ATOM   10483 C CD1 . ILE H 2 8   ? 18.951  -27.523 79.438  1.00 25.33 ? 1323 ILE H CD1 1 
ATOM   10484 N N   . ILE H 2 9   ? 16.127  -27.039 83.993  1.00 24.06 ? 1324 ILE H N   1 
ATOM   10485 C CA  . ILE H 2 9   ? 16.083  -26.550 85.363  1.00 24.10 ? 1324 ILE H CA  1 
ATOM   10486 C C   . ILE H 2 9   ? 15.069  -27.354 86.187  1.00 24.45 ? 1324 ILE H C   1 
ATOM   10487 O O   . ILE H 2 9   ? 15.357  -27.780 87.313  1.00 24.31 ? 1324 ILE H O   1 
ATOM   10488 C CB  . ILE H 2 9   ? 15.735  -25.047 85.382  1.00 23.95 ? 1324 ILE H CB  1 
ATOM   10489 C CG1 . ILE H 2 9   ? 16.866  -24.238 84.732  1.00 23.78 ? 1324 ILE H CG1 1 
ATOM   10490 C CG2 . ILE H 2 9   ? 15.495  -24.573 86.798  1.00 23.99 ? 1324 ILE H CG2 1 
ATOM   10491 C CD1 . ILE H 2 9   ? 16.594  -22.764 84.630  1.00 23.89 ? 1324 ILE H CD1 1 
ATOM   10492 N N   . ARG H 2 10  ? 13.891  -27.571 85.603  1.00 24.84 ? 1325 ARG H N   1 
ATOM   10493 C CA  . ARG H 2 10  ? 12.830  -28.342 86.249  1.00 25.01 ? 1325 ARG H CA  1 
ATOM   10494 C C   . ARG H 2 10  ? 13.342  -29.753 86.500  1.00 25.21 ? 1325 ARG H C   1 
ATOM   10495 O O   . ARG H 2 10  ? 13.326  -30.244 87.631  1.00 25.31 ? 1325 ARG H O   1 
ATOM   10496 C CB  . ARG H 2 10  ? 11.545  -28.363 85.388  1.00 25.04 ? 1325 ARG H CB  1 
ATOM   10497 C CG  . ARG H 2 10  ? 10.259  -28.624 86.195  1.00 25.05 ? 1325 ARG H CG  1 
ATOM   10498 C CD  . ARG H 2 10  ? 8.977   -28.082 85.533  1.00 24.82 ? 1325 ARG H CD  1 
ATOM   10499 N NE  . ARG H 2 10  ? 7.920   -27.833 86.529  1.00 24.67 ? 1325 ARG H NE  1 
ATOM   10500 C CZ  . ARG H 2 10  ? 6.600   -27.886 86.304  1.00 24.27 ? 1325 ARG H CZ  1 
ATOM   10501 N NH1 . ARG H 2 10  ? 6.108   -28.184 85.103  1.00 24.20 ? 1325 ARG H NH1 1 
ATOM   10502 N NH2 . ARG H 2 10  ? 5.754   -27.643 87.301  1.00 23.65 ? 1325 ARG H NH2 1 
ATOM   10503 N N   . LYS H 2 11  ? 13.829  -30.380 85.436  1.00 25.51 ? 1326 LYS H N   1 
ATOM   10504 C CA  . LYS H 2 11  ? 14.361  -31.740 85.502  1.00 25.86 ? 1326 LYS H CA  1 
ATOM   10505 C C   . LYS H 2 11  ? 15.311  -31.891 86.699  1.00 26.08 ? 1326 LYS H C   1 
ATOM   10506 O O   . LYS H 2 11  ? 15.224  -32.881 87.441  1.00 26.02 ? 1326 LYS H O   1 
ATOM   10507 C CB  . LYS H 2 11  ? 15.075  -32.094 84.188  1.00 25.88 ? 1326 LYS H CB  1 
ATOM   10508 C CG  . LYS H 2 11  ? 15.045  -33.578 83.812  1.00 26.32 ? 1326 LYS H CG  1 
ATOM   10509 C CD  . LYS H 2 11  ? 15.041  -33.767 82.286  1.00 26.86 ? 1326 LYS H CD  1 
ATOM   10510 C CE  . LYS H 2 11  ? 16.274  -33.149 81.605  1.00 27.29 ? 1326 LYS H CE  1 
ATOM   10511 N NZ  . LYS H 2 11  ? 15.956  -32.512 80.289  1.00 27.14 ? 1326 LYS H NZ  1 
ATOM   10512 N N   . ALA H 2 12  ? 16.181  -30.891 86.892  1.00 26.24 ? 1327 ALA H N   1 
ATOM   10513 C CA  . ALA H 2 12  ? 17.178  -30.909 87.971  1.00 26.44 ? 1327 ALA H CA  1 
ATOM   10514 C C   . ALA H 2 12  ? 16.538  -30.853 89.349  1.00 26.80 ? 1327 ALA H C   1 
ATOM   10515 O O   . ALA H 2 12  ? 16.677  -31.794 90.129  1.00 26.92 ? 1327 ALA H O   1 
ATOM   10516 C CB  . ALA H 2 12  ? 18.151  -29.772 87.816  1.00 26.36 ? 1327 ALA H CB  1 
ATOM   10517 N N   . LEU H 2 13  ? 15.823  -29.764 89.638  1.00 27.24 ? 1328 LEU H N   1 
ATOM   10518 C CA  . LEU H 2 13  ? 15.155  -29.587 90.942  1.00 27.46 ? 1328 LEU H CA  1 
ATOM   10519 C C   . LEU H 2 13  ? 14.196  -30.753 91.283  1.00 28.00 ? 1328 LEU H C   1 
ATOM   10520 O O   . LEU H 2 13  ? 13.745  -30.877 92.419  1.00 28.17 ? 1328 LEU H O   1 
ATOM   10521 C CB  . LEU H 2 13  ? 14.406  -28.244 90.996  1.00 27.32 ? 1328 LEU H CB  1 
ATOM   10522 C CG  . LEU H 2 13  ? 15.202  -26.928 90.874  1.00 26.95 ? 1328 LEU H CG  1 
ATOM   10523 C CD1 . LEU H 2 13  ? 14.322  -25.769 90.430  1.00 25.94 ? 1328 LEU H CD1 1 
ATOM   10524 C CD2 . LEU H 2 13  ? 15.905  -26.550 92.167  1.00 26.85 ? 1328 LEU H CD2 1 
ATOM   10525 N N   . MET H 2 14  ? 13.879  -31.595 90.302  1.00 28.56 ? 1329 MET H N   1 
ATOM   10526 C CA  . MET H 2 14  ? 13.200  -32.864 90.568  1.00 29.16 ? 1329 MET H CA  1 
ATOM   10527 C C   . MET H 2 14  ? 14.184  -33.922 91.099  1.00 29.59 ? 1329 MET H C   1 
ATOM   10528 O O   . MET H 2 14  ? 13.897  -34.594 92.093  1.00 29.74 ? 1329 MET H O   1 
ATOM   10529 C CB  . MET H 2 14  ? 12.513  -33.387 89.300  1.00 29.22 ? 1329 MET H CB  1 
ATOM   10530 N N   . GLY H 2 15  ? 15.329  -34.072 90.423  1.00 29.89 ? 1330 GLY H N   1 
ATOM   10531 C CA  . GLY H 2 15  ? 16.364  -35.049 90.808  1.00 29.82 ? 1330 GLY H CA  1 
ATOM   10532 C C   . GLY H 2 15  ? 17.501  -34.416 91.595  1.00 29.79 ? 1330 GLY H C   1 
ATOM   10533 O O   . GLY H 2 15  ? 17.323  -33.393 92.266  1.00 29.48 ? 1330 GLY H O   1 
ATOM   10534 N N   . GLY I 2 4   ? 54.517  -32.125 114.308 1.00 26.72 ? 1319 GLY I N   1 
ATOM   10535 C CA  . GLY I 2 4   ? 55.590  -31.137 114.600 1.00 26.98 ? 1319 GLY I CA  1 
ATOM   10536 C C   . GLY I 2 4   ? 56.341  -30.753 113.336 1.00 27.09 ? 1319 GLY I C   1 
ATOM   10537 O O   . GLY I 2 4   ? 55.747  -30.674 112.261 1.00 27.30 ? 1319 GLY I O   1 
ATOM   10538 N N   . LEU I 2 5   ? 57.646  -30.516 113.469 1.00 27.01 ? 1320 LEU I N   1 
ATOM   10539 C CA  . LEU I 2 5   ? 58.516  -30.110 112.345 1.00 26.98 ? 1320 LEU I CA  1 
ATOM   10540 C C   . LEU I 2 5   ? 58.362  -31.023 111.130 1.00 26.75 ? 1320 LEU I C   1 
ATOM   10541 O O   . LEU I 2 5   ? 58.058  -30.568 110.021 1.00 26.65 ? 1320 LEU I O   1 
ATOM   10542 C CB  . LEU I 2 5   ? 59.995  -30.103 112.791 1.00 26.95 ? 1320 LEU I CB  1 
ATOM   10543 C CG  . LEU I 2 5   ? 61.087  -29.885 111.731 1.00 26.73 ? 1320 LEU I CG  1 
ATOM   10544 C CD1 . LEU I 2 5   ? 61.073  -28.455 111.259 1.00 25.79 ? 1320 LEU I CD1 1 
ATOM   10545 C CD2 . LEU I 2 5   ? 62.481  -30.263 112.253 1.00 27.09 ? 1320 LEU I CD2 1 
ATOM   10546 N N   . GLU I 2 6   ? 58.603  -32.309 111.361 1.00 26.62 ? 1321 GLU I N   1 
ATOM   10547 C CA  . GLU I 2 6   ? 58.504  -33.341 110.338 1.00 26.48 ? 1321 GLU I CA  1 
ATOM   10548 C C   . GLU I 2 6   ? 57.231  -33.175 109.510 1.00 25.99 ? 1321 GLU I C   1 
ATOM   10549 O O   . GLU I 2 6   ? 57.279  -33.180 108.280 1.00 25.82 ? 1321 GLU I O   1 
ATOM   10550 C CB  . GLU I 2 6   ? 58.500  -34.709 111.022 1.00 26.66 ? 1321 GLU I CB  1 
ATOM   10551 C CG  . GLU I 2 6   ? 58.363  -35.902 110.085 1.00 27.46 ? 1321 GLU I CG  1 
ATOM   10552 C CD  . GLU I 2 6   ? 57.597  -37.058 110.713 1.00 28.00 ? 1321 GLU I CD  1 
ATOM   10553 O OE1 . GLU I 2 6   ? 57.652  -37.211 111.956 1.00 28.80 ? 1321 GLU I OE1 1 
ATOM   10554 O OE2 . GLU I 2 6   ? 56.937  -37.806 109.957 1.00 27.55 ? 1321 GLU I OE2 1 
ATOM   10555 N N   . ALA I 2 7   ? 56.102  -33.021 110.203 1.00 25.45 ? 1322 ALA I N   1 
ATOM   10556 C CA  . ALA I 2 7   ? 54.792  -32.933 109.560 1.00 24.98 ? 1322 ALA I CA  1 
ATOM   10557 C C   . ALA I 2 7   ? 54.628  -31.646 108.755 1.00 24.63 ? 1322 ALA I C   1 
ATOM   10558 O O   . ALA I 2 7   ? 54.214  -31.696 107.602 1.00 24.84 ? 1322 ALA I O   1 
ATOM   10559 C CB  . ALA I 2 7   ? 53.683  -33.061 110.597 1.00 24.70 ? 1322 ALA I CB  1 
ATOM   10560 N N   . ILE I 2 8   ? 54.958  -30.502 109.352 1.00 24.17 ? 1323 ILE I N   1 
ATOM   10561 C CA  . ILE I 2 8   ? 54.776  -29.207 108.684 1.00 23.88 ? 1323 ILE I CA  1 
ATOM   10562 C C   . ILE I 2 8   ? 55.496  -29.200 107.343 1.00 23.86 ? 1323 ILE I C   1 
ATOM   10563 O O   . ILE I 2 8   ? 54.975  -28.691 106.349 1.00 23.81 ? 1323 ILE I O   1 
ATOM   10564 C CB  . ILE I 2 8   ? 55.299  -28.016 109.533 1.00 23.80 ? 1323 ILE I CB  1 
ATOM   10565 C CG1 . ILE I 2 8   ? 54.499  -27.865 110.825 1.00 23.58 ? 1323 ILE I CG1 1 
ATOM   10566 C CG2 . ILE I 2 8   ? 55.221  -26.703 108.753 1.00 23.13 ? 1323 ILE I CG2 1 
ATOM   10567 C CD1 . ILE I 2 8   ? 55.169  -26.944 111.845 1.00 23.92 ? 1323 ILE I CD1 1 
ATOM   10568 N N   . ILE I 2 9   ? 56.693  -29.773 107.321 1.00 23.84 ? 1324 ILE I N   1 
ATOM   10569 C CA  . ILE I 2 9   ? 57.483  -29.830 106.099 1.00 24.07 ? 1324 ILE I CA  1 
ATOM   10570 C C   . ILE I 2 9   ? 56.832  -30.744 105.064 1.00 24.37 ? 1324 ILE I C   1 
ATOM   10571 O O   . ILE I 2 9   ? 56.565  -30.310 103.941 1.00 24.72 ? 1324 ILE I O   1 
ATOM   10572 C CB  . ILE I 2 9   ? 58.939  -30.253 106.377 1.00 24.00 ? 1324 ILE I CB  1 
ATOM   10573 C CG1 . ILE I 2 9   ? 59.727  -29.047 106.912 1.00 24.36 ? 1324 ILE I CG1 1 
ATOM   10574 C CG2 . ILE I 2 9   ? 59.580  -30.765 105.118 1.00 23.59 ? 1324 ILE I CG2 1 
ATOM   10575 C CD1 . ILE I 2 9   ? 60.979  -29.391 107.692 1.00 24.35 ? 1324 ILE I CD1 1 
ATOM   10576 N N   . ARG I 2 10  ? 56.568  -31.995 105.442 1.00 24.45 ? 1325 ARG I N   1 
ATOM   10577 C CA  . ARG I 2 10  ? 55.884  -32.934 104.557 1.00 24.53 ? 1325 ARG I CA  1 
ATOM   10578 C C   . ARG I 2 10  ? 54.691  -32.248 103.926 1.00 24.65 ? 1325 ARG I C   1 
ATOM   10579 O O   . ARG I 2 10  ? 54.537  -32.247 102.709 1.00 24.90 ? 1325 ARG I O   1 
ATOM   10580 C CB  . ARG I 2 10  ? 55.405  -34.170 105.323 1.00 24.49 ? 1325 ARG I CB  1 
ATOM   10581 C CG  . ARG I 2 10  ? 56.240  -35.435 105.130 1.00 24.69 ? 1325 ARG I CG  1 
ATOM   10582 C CD  . ARG I 2 10  ? 55.978  -36.415 106.274 1.00 25.15 ? 1325 ARG I CD  1 
ATOM   10583 N NE  . ARG I 2 10  ? 56.403  -37.792 106.011 1.00 26.01 ? 1325 ARG I NE  1 
ATOM   10584 C CZ  . ARG I 2 10  ? 55.719  -38.690 105.292 1.00 26.42 ? 1325 ARG I CZ  1 
ATOM   10585 N NH1 . ARG I 2 10  ? 54.567  -38.375 104.703 1.00 26.42 ? 1325 ARG I NH1 1 
ATOM   10586 N NH2 . ARG I 2 10  ? 56.205  -39.920 105.139 1.00 26.33 ? 1325 ARG I NH2 1 
ATOM   10587 N N   . LYS I 2 11  ? 53.868  -31.643 104.773 1.00 24.87 ? 1326 LYS I N   1 
ATOM   10588 C CA  . LYS I 2 11  ? 52.596  -31.061 104.360 1.00 25.01 ? 1326 LYS I CA  1 
ATOM   10589 C C   . LYS I 2 11  ? 52.775  -30.016 103.263 1.00 25.27 ? 1326 LYS I C   1 
ATOM   10590 O O   . LYS I 2 11  ? 52.055  -30.036 102.263 1.00 25.25 ? 1326 LYS I O   1 
ATOM   10591 C CB  . LYS I 2 11  ? 51.891  -30.439 105.576 1.00 25.04 ? 1326 LYS I CB  1 
ATOM   10592 C CG  . LYS I 2 11  ? 50.404  -30.142 105.388 1.00 24.87 ? 1326 LYS I CG  1 
ATOM   10593 C CD  . LYS I 2 11  ? 49.723  -29.943 106.738 1.00 24.73 ? 1326 LYS I CD  1 
ATOM   10594 C CE  . LYS I 2 11  ? 48.215  -29.931 106.634 1.00 24.47 ? 1326 LYS I CE  1 
ATOM   10595 N NZ  . LYS I 2 11  ? 47.589  -30.296 107.938 1.00 23.93 ? 1326 LYS I NZ  1 
ATOM   10596 N N   . ALA I 2 12  ? 53.748  -29.124 103.442 1.00 25.51 ? 1327 ALA I N   1 
ATOM   10597 C CA  . ALA I 2 12  ? 53.888  -27.957 102.569 1.00 25.81 ? 1327 ALA I CA  1 
ATOM   10598 C C   . ALA I 2 12  ? 54.475  -28.291 101.196 1.00 26.24 ? 1327 ALA I C   1 
ATOM   10599 O O   . ALA I 2 12  ? 54.100  -27.672 100.195 1.00 26.14 ? 1327 ALA I O   1 
ATOM   10600 C CB  . ALA I 2 12  ? 54.718  -26.882 103.252 1.00 25.75 ? 1327 ALA I CB  1 
ATOM   10601 N N   . LEU I 2 13  ? 55.390  -29.261 101.147 1.00 26.84 ? 1328 LEU I N   1 
ATOM   10602 C CA  . LEU I 2 13  ? 56.066  -29.632 99.892  1.00 27.29 ? 1328 LEU I CA  1 
ATOM   10603 C C   . LEU I 2 13  ? 55.119  -30.290 98.868  1.00 28.03 ? 1328 LEU I C   1 
ATOM   10604 O O   . LEU I 2 13  ? 55.396  -30.293 97.664  1.00 28.18 ? 1328 LEU I O   1 
ATOM   10605 C CB  . LEU I 2 13  ? 57.289  -30.523 100.169 1.00 27.07 ? 1328 LEU I CB  1 
ATOM   10606 C CG  . LEU I 2 13  ? 58.488  -29.852 100.865 1.00 26.34 ? 1328 LEU I CG  1 
ATOM   10607 C CD1 . LEU I 2 13  ? 59.472  -30.888 101.388 1.00 24.91 ? 1328 LEU I CD1 1 
ATOM   10608 C CD2 . LEU I 2 13  ? 59.207  -28.866 99.945  1.00 25.36 ? 1328 LEU I CD2 1 
ATOM   10609 N N   . MET I 2 14  ? 54.004  -30.837 99.338  1.00 28.80 ? 1329 MET I N   1 
ATOM   10610 C CA  . MET I 2 14  ? 52.944  -31.280 98.434  1.00 29.60 ? 1329 MET I CA  1 
ATOM   10611 C C   . MET I 2 14  ? 52.176  -30.086 97.832  1.00 29.85 ? 1329 MET I C   1 
ATOM   10612 O O   . MET I 2 14  ? 51.773  -30.130 96.668  1.00 29.98 ? 1329 MET I O   1 
ATOM   10613 C CB  . MET I 2 14  ? 51.977  -32.224 99.157  1.00 30.00 ? 1329 MET I CB  1 
ATOM   10614 C CG  . MET I 2 14  ? 52.547  -33.618 99.400  1.00 31.24 ? 1329 MET I CG  1 
ATOM   10615 S SD  . MET I 2 14  ? 52.488  -34.710 97.944  1.00 34.37 ? 1329 MET I SD  1 
ATOM   10616 C CE  . MET I 2 14  ? 50.854  -35.467 98.077  1.00 32.37 ? 1329 MET I CE  1 
ATOM   10617 N N   . GLY I 2 15  ? 51.973  -29.032 98.626  1.00 30.11 ? 1330 GLY I N   1 
ATOM   10618 C CA  . GLY I 2 15  ? 51.298  -27.812 98.163  1.00 30.15 ? 1330 GLY I CA  1 
ATOM   10619 C C   . GLY I 2 15  ? 52.272  -26.749 97.677  1.00 30.29 ? 1330 GLY I C   1 
ATOM   10620 O O   . GLY I 2 15  ? 53.192  -27.026 96.898  1.00 30.21 ? 1330 GLY I O   1 
HETATM 10621 C C10 . OHT J 3 .   ? 35.360  0.987   55.196  1.00 18.64 ? 500  OHT A C10 1 
HETATM 10622 C C9  . OHT J 3 .   ? 35.781  2.426   55.017  1.00 18.47 ? 500  OHT A C9  1 
HETATM 10623 C C8  . OHT J 3 .   ? 34.618  3.264   54.611  1.00 17.03 ? 500  OHT A C8  1 
HETATM 10624 C C11 . OHT J 3 .   ? 33.387  2.975   55.361  1.00 16.70 ? 500  OHT A C11 1 
HETATM 10625 C C16 . OHT J 3 .   ? 33.255  3.301   56.695  1.00 16.68 ? 500  OHT A C16 1 
HETATM 10626 C C15 . OHT J 3 .   ? 32.077  3.009   57.360  1.00 16.31 ? 500  OHT A C15 1 
HETATM 10627 C C14 . OHT J 3 .   ? 31.032  2.390   56.704  1.00 15.82 ? 500  OHT A C14 1 
HETATM 10628 C C13 . OHT J 3 .   ? 31.161  2.058   55.377  1.00 15.26 ? 500  OHT A C13 1 
HETATM 10629 C C12 . OHT J 3 .   ? 32.334  2.350   54.719  1.00 16.31 ? 500  OHT A C12 1 
HETATM 10630 C C7  . OHT J 3 .   ? 34.633  4.218   53.655  1.00 17.78 ? 500  OHT A C7  1 
HETATM 10631 C C1  . OHT J 3 .   ? 35.784  4.565   52.834  1.00 17.37 ? 500  OHT A C1  1 
HETATM 10632 C C2  . OHT J 3 .   ? 36.155  5.890   52.756  1.00 17.01 ? 500  OHT A C2  1 
HETATM 10633 C C3  . OHT J 3 .   ? 37.223  6.260   51.982  1.00 16.92 ? 500  OHT A C3  1 
HETATM 10634 C C4  . OHT J 3 .   ? 37.906  5.294   51.280  1.00 17.19 ? 500  OHT A C4  1 
HETATM 10635 O O4  . OHT J 3 .   ? 38.983  5.656   50.494  1.00 17.11 ? 500  OHT A O4  1 
HETATM 10636 C C5  . OHT J 3 .   ? 37.537  3.973   51.341  1.00 16.72 ? 500  OHT A C5  1 
HETATM 10637 C C6  . OHT J 3 .   ? 36.466  3.607   52.119  1.00 16.53 ? 500  OHT A C6  1 
HETATM 10638 C C17 . OHT J 3 .   ? 33.411  4.932   53.394  1.00 18.13 ? 500  OHT A C17 1 
HETATM 10639 C C18 . OHT J 3 .   ? 32.830  4.842   52.151  1.00 18.45 ? 500  OHT A C18 1 
HETATM 10640 C C19 . OHT J 3 .   ? 31.662  5.514   51.889  1.00 18.55 ? 500  OHT A C19 1 
HETATM 10641 C C20 . OHT J 3 .   ? 31.101  6.280   52.886  1.00 18.82 ? 500  OHT A C20 1 
HETATM 10642 O O20 . OHT J 3 .   ? 29.919  6.993   52.746  1.00 19.11 ? 500  OHT A O20 1 
HETATM 10643 C C23 . OHT J 3 .   ? 29.823  7.614   51.483  1.00 19.39 ? 500  OHT A C23 1 
HETATM 10644 C C24 . OHT J 3 .   ? 28.517  8.357   51.560  1.00 19.44 ? 500  OHT A C24 1 
HETATM 10645 N N24 . OHT J 3 .   ? 28.654  9.559   50.731  1.00 19.72 ? 500  OHT A N24 1 
HETATM 10646 C C25 . OHT J 3 .   ? 27.434  10.390  50.856  1.00 20.21 ? 500  OHT A C25 1 
HETATM 10647 C C26 . OHT J 3 .   ? 28.934  9.162   49.326  1.00 19.24 ? 500  OHT A C26 1 
HETATM 10648 C C21 . OHT J 3 .   ? 31.692  6.367   54.125  1.00 18.78 ? 500  OHT A C21 1 
HETATM 10649 C C22 . OHT J 3 .   ? 32.855  5.695   54.386  1.00 18.09 ? 500  OHT A C22 1 
HETATM 10650 C C10 . OHT K 3 .   ? 30.136  -16.860 76.057  1.00 15.74 ? 501  OHT B C10 1 
HETATM 10651 C C9  . OHT K 3 .   ? 30.327  -18.349 75.928  1.00 16.46 ? 501  OHT B C9  1 
HETATM 10652 C C8  . OHT K 3 .   ? 29.024  -19.073 75.858  1.00 17.41 ? 501  OHT B C8  1 
HETATM 10653 C C11 . OHT K 3 .   ? 28.224  -18.677 74.709  1.00 17.71 ? 501  OHT B C11 1 
HETATM 10654 C C16 . OHT K 3 .   ? 28.618  -18.931 73.415  1.00 18.80 ? 501  OHT B C16 1 
HETATM 10655 C C15 . OHT K 3 .   ? 27.810  -18.518 72.372  1.00 19.04 ? 501  OHT B C15 1 
HETATM 10656 C C14 . OHT K 3 .   ? 26.620  -17.857 72.614  1.00 17.76 ? 501  OHT B C14 1 
HETATM 10657 C C13 . OHT K 3 .   ? 26.240  -17.602 73.906  1.00 16.81 ? 501  OHT B C13 1 
HETATM 10658 C C12 . OHT K 3 .   ? 27.043  -18.006 74.944  1.00 17.13 ? 501  OHT B C12 1 
HETATM 10659 C C7  . OHT K 3 .   ? 28.565  -20.004 76.722  1.00 17.82 ? 501  OHT B C7  1 
HETATM 10660 C C1  . OHT K 3 .   ? 29.297  -20.365 77.919  1.00 18.02 ? 501  OHT B C1  1 
HETATM 10661 C C2  . OHT K 3 .   ? 29.539  -21.685 78.227  1.00 18.52 ? 501  OHT B C2  1 
HETATM 10662 C C3  . OHT K 3 .   ? 30.218  -21.996 79.385  1.00 18.64 ? 501  OHT B C3  1 
HETATM 10663 C C4  . OHT K 3 .   ? 30.628  -20.985 80.227  1.00 17.97 ? 501  OHT B C4  1 
HETATM 10664 O O4  . OHT K 3 .   ? 31.301  -21.275 81.386  1.00 18.43 ? 501  OHT B O4  1 
HETATM 10665 C C5  . OHT K 3 .   ? 30.379  -19.670 79.937  1.00 17.63 ? 501  OHT B C5  1 
HETATM 10666 C C6  . OHT K 3 .   ? 29.705  -19.365 78.778  1.00 17.77 ? 501  OHT B C6  1 
HETATM 10667 C C17 . OHT K 3 .   ? 27.263  -20.618 76.534  1.00 17.39 ? 501  OHT B C17 1 
HETATM 10668 C C18 . OHT K 3 .   ? 26.374  -20.536 77.575  1.00 17.34 ? 501  OHT B C18 1 
HETATM 10669 C C19 . OHT K 3 .   ? 25.126  -21.091 77.466  1.00 17.66 ? 501  OHT B C19 1 
HETATM 10670 C C20 . OHT K 3 .   ? 24.763  -21.743 76.314  1.00 18.41 ? 501  OHT B C20 1 
HETATM 10671 O O20 . OHT K 3 .   ? 23.484  -22.276 76.259  1.00 19.13 ? 501  OHT B O20 1 
HETATM 10672 C C23 . OHT K 3 .   ? 23.527  -23.703 76.240  1.00 21.23 ? 501  OHT B C23 1 
HETATM 10673 C C24 . OHT K 3 .   ? 22.254  -24.152 75.541  1.00 21.70 ? 501  OHT B C24 1 
HETATM 10674 N N24 . OHT K 3 .   ? 21.358  -24.935 76.429  1.00 22.01 ? 501  OHT B N24 1 
HETATM 10675 C C25 . OHT K 3 .   ? 20.059  -25.167 75.740  1.00 22.35 ? 501  OHT B C25 1 
HETATM 10676 C C26 . OHT K 3 .   ? 21.152  -24.260 77.734  1.00 21.48 ? 501  OHT B C26 1 
HETATM 10677 C C21 . OHT K 3 .   ? 25.645  -21.832 75.259  1.00 18.48 ? 501  OHT B C21 1 
HETATM 10678 C C22 . OHT K 3 .   ? 26.902  -21.271 75.375  1.00 18.10 ? 501  OHT B C22 1 
HETATM 10679 C C10 . OHT L 3 .   ? 64.855  -18.319 120.004 1.00 22.11 ? 502  OHT C C10 1 
HETATM 10680 C C9  . OHT L 3 .   ? 63.417  -17.976 119.678 1.00 22.71 ? 502  OHT C C9  1 
HETATM 10681 C C8  . OHT L 3 .   ? 62.622  -19.194 119.353 1.00 21.97 ? 502  OHT C C8  1 
HETATM 10682 C C11 . OHT L 3 .   ? 62.678  -20.181 120.428 1.00 21.56 ? 502  OHT C C11 1 
HETATM 10683 C C16 . OHT L 3 .   ? 61.961  -20.001 121.590 1.00 21.27 ? 502  OHT C C16 1 
HETATM 10684 C C15 . OHT L 3 .   ? 62.024  -20.943 122.595 1.00 20.63 ? 502  OHT C C15 1 
HETATM 10685 C C14 . OHT L 3 .   ? 62.801  -22.065 122.447 1.00 20.25 ? 502  OHT C C14 1 
HETATM 10686 C C13 . OHT L 3 .   ? 63.521  -22.243 121.292 1.00 20.24 ? 502  OHT C C13 1 
HETATM 10687 C C12 . OHT L 3 .   ? 63.462  -21.305 120.288 1.00 20.98 ? 502  OHT C C12 1 
HETATM 10688 C C7  . OHT L 3 .   ? 61.888  -19.432 118.239 1.00 24.87 ? 502  OHT C C7  1 
HETATM 10689 C C1  . OHT L 3 .   ? 61.789  -18.520 117.107 1.00 24.86 ? 502  OHT C C1  1 
HETATM 10690 C C2  . OHT L 3 .   ? 60.546  -18.190 116.605 1.00 25.04 ? 502  OHT C C2  1 
HETATM 10691 C C3  . OHT L 3 .   ? 60.435  -17.346 115.523 1.00 24.95 ? 502  OHT C C3  1 
HETATM 10692 C C4  . OHT L 3 .   ? 61.584  -16.851 114.951 1.00 25.45 ? 502  OHT C C4  1 
HETATM 10693 O O4  . OHT L 3 .   ? 61.512  -16.003 113.865 1.00 25.70 ? 502  OHT C O4  1 
HETATM 10694 C C5  . OHT L 3 .   ? 62.827  -17.181 115.437 1.00 25.31 ? 502  OHT C C5  1 
HETATM 10695 C C6  . OHT L 3 .   ? 62.927  -18.024 116.516 1.00 25.11 ? 502  OHT C C6  1 
HETATM 10696 C C17 . OHT L 3 .   ? 61.163  -20.686 118.112 1.00 25.21 ? 502  OHT C C17 1 
HETATM 10697 C C18 . OHT L 3 .   ? 61.475  -21.559 117.093 1.00 25.61 ? 502  OHT C C18 1 
HETATM 10698 C C19 . OHT L 3 .   ? 60.789  -22.743 116.966 1.00 25.55 ? 502  OHT C C19 1 
HETATM 10699 C C20 . OHT L 3 .   ? 59.782  -23.032 117.862 1.00 25.66 ? 502  OHT C C20 1 
HETATM 10700 O O20 . OHT L 3 .   ? 59.020  -24.185 117.853 1.00 26.74 ? 502  OHT C O20 1 
HETATM 10701 C C23 . OHT L 3 .   ? 58.863  -24.786 116.570 1.00 28.38 ? 502  OHT C C23 1 
HETATM 10702 C C24 . OHT L 3 .   ? 58.160  -26.088 116.864 1.00 29.38 ? 502  OHT C C24 1 
HETATM 10703 N N24 . OHT L 3 .   ? 57.402  -26.547 115.689 1.00 30.10 ? 502  OHT C N24 1 
HETATM 10704 C C25 . OHT L 3 .   ? 56.692  -27.806 116.027 1.00 30.38 ? 502  OHT C C25 1 
HETATM 10705 C C26 . OHT L 3 .   ? 58.309  -26.720 114.532 1.00 30.12 ? 502  OHT C C26 1 
HETATM 10706 C C21 . OHT L 3 .   ? 59.468  -22.162 118.875 1.00 25.07 ? 502  OHT C C21 1 
HETATM 10707 C C22 . OHT L 3 .   ? 60.154  -20.984 118.997 1.00 25.06 ? 502  OHT C C22 1 
HETATM 10708 C C10 . OHT M 3 .   ? 16.209  -18.641 45.468  1.00 29.14 ? 503  OHT D C10 1 
HETATM 10709 C C9  . OHT M 3 .   ? 15.929  -20.122 45.496  1.00 30.14 ? 503  OHT D C9  1 
HETATM 10710 C C8  . OHT M 3 .   ? 16.296  -20.670 46.829  1.00 31.53 ? 503  OHT D C8  1 
HETATM 10711 C C11 . OHT M 3 .   ? 15.880  -19.793 47.918  1.00 31.91 ? 503  OHT D C11 1 
HETATM 10712 C C16 . OHT M 3 .   ? 14.549  -19.583 48.188  1.00 31.78 ? 503  OHT D C16 1 
HETATM 10713 C C15 . OHT M 3 .   ? 14.168  -18.749 49.217  1.00 31.63 ? 503  OHT D C15 1 
HETATM 10714 C C14 . OHT M 3 .   ? 15.115  -18.114 49.980  1.00 31.72 ? 503  OHT D C14 1 
HETATM 10715 C C13 . OHT M 3 .   ? 16.446  -18.318 49.705  1.00 32.24 ? 503  OHT D C13 1 
HETATM 10716 C C12 . OHT M 3 .   ? 16.830  -19.152 48.680  1.00 32.29 ? 503  OHT D C12 1 
HETATM 10717 C C7  . OHT M 3 .   ? 16.937  -21.831 47.080  1.00 33.04 ? 503  OHT D C7  1 
HETATM 10718 C C1  . OHT M 3 .   ? 17.393  -22.711 46.010  1.00 33.58 ? 503  OHT D C1  1 
HETATM 10719 C C2  . OHT M 3 .   ? 16.988  -24.026 46.023  1.00 34.40 ? 503  OHT D C2  1 
HETATM 10720 C C3  . OHT M 3 .   ? 17.414  -24.896 45.046  1.00 34.49 ? 503  OHT D C3  1 
HETATM 10721 C C4  . OHT M 3 .   ? 18.254  -24.435 44.063  1.00 33.96 ? 503  OHT D C4  1 
HETATM 10722 O O4  . OHT M 3 .   ? 18.685  -25.306 43.083  1.00 34.19 ? 503  OHT D O4  1 
HETATM 10723 C C5  . OHT M 3 .   ? 18.672  -23.126 44.043  1.00 33.37 ? 503  OHT D C5  1 
HETATM 10724 C C6  . OHT M 3 .   ? 18.243  -22.265 45.025  1.00 33.28 ? 503  OHT D C6  1 
HETATM 10725 C C17 . OHT M 3 .   ? 17.229  -22.230 48.464  1.00 32.59 ? 503  OHT D C17 1 
HETATM 10726 C C18 . OHT M 3 .   ? 18.528  -22.499 48.828  1.00 32.41 ? 503  OHT D C18 1 
HETATM 10727 C C19 . OHT M 3 .   ? 18.825  -22.875 50.116  1.00 32.16 ? 503  OHT D C19 1 
HETATM 10728 C C20 . OHT M 3 .   ? 17.823  -23.001 51.045  1.00 32.48 ? 503  OHT D C20 1 
HETATM 10729 O O20 . OHT M 3 .   ? 18.055  -23.360 52.366  1.00 32.78 ? 503  OHT D O20 1 
HETATM 10730 C C23 . OHT M 3 .   ? 18.763  -24.591 52.499  1.00 33.40 ? 503  OHT D C23 1 
HETATM 10731 C C24 . OHT M 3 .   ? 19.347  -24.602 53.900  1.00 33.15 ? 503  OHT D C24 1 
HETATM 10732 N N24 . OHT M 3 .   ? 18.761  -25.685 54.723  1.00 33.44 ? 503  OHT D N24 1 
HETATM 10733 C C25 . OHT M 3 .   ? 17.279  -25.602 54.781  1.00 33.61 ? 503  OHT D C25 1 
HETATM 10734 C C26 . OHT M 3 .   ? 19.311  -25.629 56.099  1.00 33.31 ? 503  OHT D C26 1 
HETATM 10735 C C21 . OHT M 3 .   ? 16.525  -22.740 50.687  1.00 32.46 ? 503  OHT D C21 1 
HETATM 10736 C C22 . OHT M 3 .   ? 16.230  -22.360 49.401  1.00 32.23 ? 503  OHT D C22 1 
HETATM 10737 C C10 . OHT N 3 .   ? 10.647  4.816   77.750  1.00 20.09 ? 504  OHT E C10 1 
HETATM 10738 C C9  . OHT N 3 .   ? 10.075  5.958   76.961  1.00 20.36 ? 504  OHT E C9  1 
HETATM 10739 C C8  . OHT N 3 .   ? 11.016  6.411   75.901  1.00 21.03 ? 504  OHT E C8  1 
HETATM 10740 C C11 . OHT N 3 .   ? 11.066  5.567   74.716  1.00 20.73 ? 504  OHT E C11 1 
HETATM 10741 C C16 . OHT N 3 .   ? 9.944   5.260   73.982  1.00 20.77 ? 504  OHT E C16 1 
HETATM 10742 C C15 . OHT N 3 .   ? 10.052  4.461   72.865  1.00 20.23 ? 504  OHT E C15 1 
HETATM 10743 C C14 . OHT N 3 .   ? 11.278  3.973   72.484  1.00 20.09 ? 504  OHT E C14 1 
HETATM 10744 C C13 . OHT N 3 .   ? 12.397  4.276   73.219  1.00 20.02 ? 504  OHT E C13 1 
HETATM 10745 C C12 . OHT N 3 .   ? 12.292  5.066   74.333  1.00 20.31 ? 504  OHT E C12 1 
HETATM 10746 C C7  . OHT N 3 .   ? 11.797  7.516   75.946  1.00 23.54 ? 504  OHT E C7  1 
HETATM 10747 C C1  . OHT N 3 .   ? 11.868  8.394   77.113  1.00 23.98 ? 504  OHT E C1  1 
HETATM 10748 C C2  . OHT N 3 .   ? 11.502  9.720   77.036  1.00 24.25 ? 504  OHT E C2  1 
HETATM 10749 C C3  . OHT N 3 .   ? 11.608  10.526  78.146  1.00 24.12 ? 504  OHT E C3  1 
HETATM 10750 C C4  . OHT N 3 .   ? 12.096  9.999   79.319  1.00 24.30 ? 504  OHT E C4  1 
HETATM 10751 O O4  . OHT N 3 .   ? 12.206  10.797  80.447  1.00 24.26 ? 504  OHT E O4  1 
HETATM 10752 C C5  . OHT N 3 .   ? 12.475  8.680   79.397  1.00 24.02 ? 504  OHT E C5  1 
HETATM 10753 C C6  . OHT N 3 .   ? 12.362  7.880   78.289  1.00 23.45 ? 504  OHT E C6  1 
HETATM 10754 C C17 . OHT N 3 .   ? 12.680  7.838   74.823  1.00 23.08 ? 504  OHT E C17 1 
HETATM 10755 C C18 . OHT N 3 .   ? 13.998  8.120   75.095  1.00 23.25 ? 504  OHT E C18 1 
HETATM 10756 C C19 . OHT N 3 .   ? 14.863  8.429   74.075  1.00 23.18 ? 504  OHT E C19 1 
HETATM 10757 C C20 . OHT N 3 .   ? 14.397  8.464   72.785  1.00 23.28 ? 504  OHT E C20 1 
HETATM 10758 O O20 . OHT N 3 .   ? 15.233  8.765   71.741  1.00 23.73 ? 504  OHT E O20 1 
HETATM 10759 C C23 . OHT N 3 .   ? 15.659  10.109  71.897  1.00 26.23 ? 504  OHT E C23 1 
HETATM 10760 C C24 . OHT N 3 .   ? 16.929  10.228  71.090  1.00 27.55 ? 504  OHT E C24 1 
HETATM 10761 N N24 . OHT N 3 .   ? 16.669  10.949  69.822  1.00 28.44 ? 504  OHT E N24 1 
HETATM 10762 C C25 . OHT N 3 .   ? 15.450  10.452  69.127  1.00 28.12 ? 504  OHT E C25 1 
HETATM 10763 C C26 . OHT N 3 .   ? 17.867  10.819  68.957  1.00 27.77 ? 504  OHT E C26 1 
HETATM 10764 C C21 . OHT N 3 .   ? 13.085  8.188   72.498  1.00 23.22 ? 504  OHT E C21 1 
HETATM 10765 C C22 . OHT N 3 .   ? 12.225  7.878   73.522  1.00 22.93 ? 504  OHT E C22 1 
HETATM 10766 C C10 . OHT O 3 .   ? 85.888  -37.815 119.176 1.00 20.99 ? 505  OHT F C10 1 
HETATM 10767 C C9  . OHT O 3 .   ? 87.192  -38.314 119.738 1.00 21.35 ? 505  OHT F C9  1 
HETATM 10768 C C8  . OHT O 3 .   ? 87.460  -37.663 121.043 1.00 21.42 ? 505  OHT F C8  1 
HETATM 10769 C C11 . OHT O 3 .   ? 86.372  -37.843 121.976 1.00 22.00 ? 505  OHT F C11 1 
HETATM 10770 C C16 . OHT O 3 .   ? 86.104  -39.076 122.518 1.00 21.86 ? 505  OHT F C16 1 
HETATM 10771 C C15 . OHT O 3 .   ? 85.055  -39.207 123.400 1.00 22.06 ? 505  OHT F C15 1 
HETATM 10772 C C14 . OHT O 3 .   ? 84.279  -38.118 123.732 1.00 21.65 ? 505  OHT F C14 1 
HETATM 10773 C C13 . OHT O 3 .   ? 84.548  -36.886 123.181 1.00 21.91 ? 505  OHT F C13 1 
HETATM 10774 C C12 . OHT O 3 .   ? 85.597  -36.750 122.300 1.00 22.60 ? 505  OHT F C12 1 
HETATM 10775 C C7  . OHT O 3 .   ? 88.555  -36.970 121.402 1.00 21.31 ? 505  OHT F C7  1 
HETATM 10776 C C1  . OHT O 3 .   ? 89.664  -36.733 120.488 1.00 20.52 ? 505  OHT F C1  1 
HETATM 10777 C C2  . OHT O 3 .   ? 90.929  -37.159 120.815 1.00 20.13 ? 505  OHT F C2  1 
HETATM 10778 C C3  . OHT O 3 .   ? 91.975  -36.911 119.956 1.00 20.19 ? 505  OHT F C3  1 
HETATM 10779 C C4  . OHT O 3 .   ? 91.739  -36.229 118.784 1.00 20.64 ? 505  OHT F C4  1 
HETATM 10780 O O4  . OHT O 3 .   ? 92.771  -35.963 117.896 1.00 21.33 ? 505  OHT F O4  1 
HETATM 10781 C C5  . OHT O 3 .   ? 90.481  -35.791 118.459 1.00 19.76 ? 505  OHT F C5  1 
HETATM 10782 C C6  . OHT O 3 .   ? 89.445  -36.043 119.319 1.00 20.01 ? 505  OHT F C6  1 
HETATM 10783 C C17 . OHT O 3 .   ? 88.654  -36.398 122.737 1.00 21.74 ? 505  OHT F C17 1 
HETATM 10784 C C18 . OHT O 3 .   ? 88.847  -35.042 122.868 1.00 21.55 ? 505  OHT F C18 1 
HETATM 10785 C C19 . OHT O 3 .   ? 88.956  -34.483 124.117 1.00 21.31 ? 505  OHT F C19 1 
HETATM 10786 C C20 . OHT O 3 .   ? 88.888  -35.285 125.231 1.00 21.97 ? 505  OHT F C20 1 
HETATM 10787 O O20 . OHT O 3 .   ? 88.988  -34.755 126.506 1.00 22.66 ? 505  OHT F O20 1 
HETATM 10788 C C23 . OHT O 3 .   ? 90.280  -34.159 126.631 1.00 24.46 ? 505  OHT F C23 1 
HETATM 10789 C C24 . OHT O 3 .   ? 90.114  -32.911 127.475 1.00 24.97 ? 505  OHT F C24 1 
HETATM 10790 N N24 . OHT O 3 .   ? 90.740  -33.123 128.801 1.00 25.20 ? 505  OHT F N24 1 
HETATM 10791 C C25 . OHT O 3 .   ? 90.254  -34.377 129.429 1.00 25.01 ? 505  OHT F C25 1 
HETATM 10792 C C26 . OHT O 3 .   ? 90.470  -31.960 129.675 1.00 25.20 ? 505  OHT F C26 1 
HETATM 10793 C C21 . OHT O 3 .   ? 88.705  -36.642 125.105 1.00 21.99 ? 505  OHT F C21 1 
HETATM 10794 C C22 . OHT O 3 .   ? 88.589  -37.199 123.855 1.00 21.61 ? 505  OHT F C22 1 
HETATM 10795 O O   . HOH P 4 .   ? 55.273  -5.021  29.249  1.00 2.00  ? 1    HOH A O   1 
HETATM 10796 O O   . HOH P 4 .   ? 24.161  -6.301  33.490  1.00 2.00  ? 5    HOH A O   1 
HETATM 10797 O O   . HOH P 4 .   ? 47.139  10.503  51.162  1.00 2.00  ? 7    HOH A O   1 
HETATM 10798 O O   . HOH P 4 .   ? 56.408  -5.452  24.269  1.00 2.00  ? 12   HOH A O   1 
HETATM 10799 O O   . HOH P 4 .   ? 33.726  -7.363  38.547  1.00 2.00  ? 18   HOH A O   1 
HETATM 10800 O O   . HOH P 4 .   ? 51.524  0.097   50.518  1.00 2.00  ? 19   HOH A O   1 
HETATM 10801 O O   . HOH P 4 .   ? 44.486  4.992   36.988  1.00 12.19 ? 24   HOH A O   1 
HETATM 10802 O O   . HOH P 4 .   ? 48.084  -14.133 32.143  1.00 2.00  ? 27   HOH A O   1 
HETATM 10803 O O   . HOH P 4 .   ? 45.389  -15.384 32.914  1.00 8.59  ? 29   HOH A O   1 
HETATM 10804 O O   . HOH P 4 .   ? 47.169  -4.933  23.746  1.00 2.00  ? 34   HOH A O   1 
HETATM 10805 O O   . HOH P 4 .   ? 30.406  -0.484  44.912  1.00 6.38  ? 36   HOH A O   1 
HETATM 10806 O O   . HOH P 4 .   ? 44.722  -16.054 29.384  1.00 2.99  ? 37   HOH A O   1 
HETATM 10807 O O   . HOH P 4 .   ? 32.729  -3.643  61.165  1.00 16.12 ? 39   HOH A O   1 
HETATM 10808 O O   . HOH P 4 .   ? 30.823  3.448   23.943  1.00 2.00  ? 41   HOH A O   1 
HETATM 10809 O O   . HOH P 4 .   ? 40.887  10.642  27.939  1.00 10.49 ? 51   HOH A O   1 
HETATM 10810 O O   . HOH P 4 .   ? 27.173  -11.844 53.757  1.00 8.92  ? 52   HOH A O   1 
HETATM 10811 O O   . HOH P 4 .   ? 41.579  -10.982 62.633  1.00 4.44  ? 55   HOH A O   1 
HETATM 10812 O O   . HOH P 4 .   ? 58.060  -1.464  29.646  1.00 11.44 ? 58   HOH A O   1 
HETATM 10813 O O   . HOH Q 4 .   ? 34.761  -25.058 84.484  1.00 5.77  ? 3    HOH B O   1 
HETATM 10814 O O   . HOH Q 4 .   ? 21.159  -14.914 82.554  1.00 17.27 ? 4    HOH B O   1 
HETATM 10815 O O   . HOH Q 4 .   ? 23.724  -8.712  87.335  1.00 2.00  ? 11   HOH B O   1 
HETATM 10816 O O   . HOH Q 4 .   ? 32.728  -7.035  65.157  1.00 6.30  ? 23   HOH B O   1 
HETATM 10817 O O   . HOH Q 4 .   ? 30.698  -12.462 69.294  1.00 5.73  ? 33   HOH B O   1 
HETATM 10818 O O   . HOH Q 4 .   ? 24.018  -5.823  76.638  1.00 2.68  ? 46   HOH B O   1 
HETATM 10819 O O   . HOH Q 4 .   ? 24.973  -10.390 71.622  1.00 2.00  ? 47   HOH B O   1 
HETATM 10820 O O   . HOH Q 4 .   ? 42.773  -25.536 76.684  1.00 4.63  ? 57   HOH B O   1 
HETATM 10821 O O   . HOH Q 4 .   ? 15.421  -13.008 89.974  1.00 12.70 ? 60   HOH B O   1 
HETATM 10822 O O   . HOH R 4 .   ? 75.633  -22.291 109.558 1.00 2.00  ? 10   HOH C O   1 
HETATM 10823 O O   . HOH R 4 .   ? 76.059  -26.619 116.358 1.00 16.65 ? 21   HOH C O   1 
HETATM 10824 O O   . HOH R 4 .   ? 80.749  -14.159 88.359  0.50 2.00  ? 42   HOH C O   1 
HETATM 10825 O O   . HOH R 4 .   ? 77.354  -15.342 87.661  1.00 2.00  ? 45   HOH C O   1 
HETATM 10826 O O   . HOH R 4 .   ? 74.398  -10.979 124.519 1.00 18.45 ? 54   HOH C O   1 
HETATM 10827 O O   . HOH R 4 .   ? 49.230  -9.855  124.332 1.00 2.00  ? 61   HOH C O   1 
HETATM 10828 O O   . HOH S 4 .   ? 45.016  -19.508 39.906  1.00 20.19 ? 6    HOH D O   1 
HETATM 10829 O O   . HOH S 4 .   ? 32.316  -11.866 31.622  1.00 2.00  ? 13   HOH D O   1 
HETATM 10830 O O   . HOH S 4 .   ? 33.364  -17.946 20.666  1.00 2.00  ? 14   HOH D O   1 
HETATM 10831 O O   . HOH S 4 .   ? 38.133  -13.213 45.543  1.00 2.00  ? 15   HOH D O   1 
HETATM 10832 O O   . HOH S 4 .   ? 40.644  -15.566 28.840  1.00 2.00  ? 16   HOH D O   1 
HETATM 10833 O O   . HOH S 4 .   ? 37.106  -20.437 49.637  1.00 9.49  ? 17   HOH D O   1 
HETATM 10834 O O   . HOH S 4 .   ? 28.863  -36.732 42.499  1.00 6.08  ? 32   HOH D O   1 
HETATM 10835 O O   . HOH S 4 .   ? 24.129  -31.503 39.748  1.00 5.52  ? 38   HOH D O   1 
HETATM 10836 O O   . HOH S 4 .   ? 43.266  -17.848 20.491  1.00 2.00  ? 40   HOH D O   1 
HETATM 10837 O O   . HOH S 4 .   ? 39.905  -37.868 36.796  1.00 14.08 ? 43   HOH D O   1 
HETATM 10838 O O   . HOH S 4 .   ? 44.691  -32.929 31.270  1.00 12.35 ? 50   HOH D O   1 
HETATM 10839 O O   . HOH S 4 .   ? 43.781  -28.070 53.565  1.00 10.22 ? 56   HOH D O   1 
HETATM 10840 O O   . HOH S 4 .   ? 11.423  -32.846 50.012  1.00 17.11 ? 59   HOH D O   1 
HETATM 10841 O O   . HOH T 4 .   ? 10.951  10.619  96.625  1.00 2.00  ? 8    HOH E O   1 
HETATM 10842 O O   . HOH T 4 .   ? 26.288  1.670   87.038  1.00 2.00  ? 20   HOH E O   1 
HETATM 10843 O O   . HOH T 4 .   ? 6.876   -2.707  75.178  1.00 12.93 ? 25   HOH E O   1 
HETATM 10844 O O   . HOH T 4 .   ? 14.309  11.761  82.895  1.00 2.00  ? 26   HOH E O   1 
HETATM 10845 O O   . HOH T 4 .   ? 38.829  -0.483  72.635  1.00 12.81 ? 30   HOH E O   1 
HETATM 10846 O O   . HOH T 4 .   ? 23.405  2.799   106.685 1.00 2.00  ? 48   HOH E O   1 
HETATM 10847 O O   . HOH T 4 .   ? 13.746  -3.644  73.605  1.00 12.45 ? 53   HOH E O   1 
HETATM 10848 O O   . HOH U 4 .   ? 86.418  -17.760 97.318  1.00 4.63  ? 2    HOH F O   1 
HETATM 10849 O O   . HOH U 4 .   ? 84.499  -23.155 112.787 1.00 10.16 ? 9    HOH F O   1 
HETATM 10850 O O   . HOH U 4 .   ? 97.139  -19.908 88.821  1.00 24.73 ? 22   HOH F O   1 
HETATM 10851 O O   . HOH U 4 .   ? 97.603  -27.580 115.421 1.00 8.70  ? 28   HOH F O   1 
HETATM 10852 O O   . HOH U 4 .   ? 84.994  -40.062 101.222 1.00 3.15  ? 31   HOH F O   1 
HETATM 10853 O O   . HOH U 4 .   ? 76.333  -52.132 116.398 1.00 25.81 ? 35   HOH F O   1 
HETATM 10854 O O   . HOH U 4 .   ? 88.200  -25.695 93.903  1.00 10.94 ? 49   HOH F O   1 
HETATM 10855 O O   . HOH V 4 .   ? 28.658  19.952  38.533  1.00 15.79 ? 44   HOH G O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   PRO 1   229  ?    ?   ?   A . n 
A 1 2   ALA 2   230  ?    ?   ?   A . n 
A 1 3   LYS 3   231  ?    ?   ?   A . n 
A 1 4   LYS 4   232  232  LYS LYS A . n 
A 1 5   PRO 5   233  233  PRO PRO A . n 
A 1 6   TYR 6   234  234  TYR TYR A . n 
A 1 7   ASN 7   235  235  ASN ASN A . n 
A 1 8   LYS 8   236  236  LYS LYS A . n 
A 1 9   ILE 9   237  237  ILE ILE A . n 
A 1 10  VAL 10  238  238  VAL VAL A . n 
A 1 11  SER 11  239  239  SER SER A . n 
A 1 12  HIS 12  240  240  HIS HIS A . n 
A 1 13  LEU 13  241  241  LEU LEU A . n 
A 1 14  LEU 14  242  242  LEU LEU A . n 
A 1 15  VAL 15  243  243  VAL VAL A . n 
A 1 16  ALA 16  244  244  ALA ALA A . n 
A 1 17  GLU 17  245  245  GLU GLU A . n 
A 1 18  PRO 18  246  246  PRO PRO A . n 
A 1 19  GLU 19  247  247  GLU GLU A . n 
A 1 20  LYS 20  248  248  LYS LYS A . n 
A 1 21  ILE 21  249  249  ILE ILE A . n 
A 1 22  TYR 22  250  250  TYR TYR A . n 
A 1 23  ALA 23  251  251  ALA ALA A . n 
A 1 24  MET 24  252  252  MET MET A . n 
A 1 25  PRO 25  253  253  PRO PRO A . n 
A 1 26  ASP 26  254  254  ASP ASP A . n 
A 1 27  PRO 27  255  255  PRO PRO A . n 
A 1 28  THR 28  256  256  THR THR A . n 
A 1 29  VAL 29  257  257  VAL VAL A . n 
A 1 30  PRO 30  258  258  PRO PRO A . n 
A 1 31  ASP 31  259  259  ASP ASP A . n 
A 1 32  SER 32  260  260  SER SER A . n 
A 1 33  ASP 33  261  261  ASP ASP A . n 
A 1 34  ILE 34  262  262  ILE ILE A . n 
A 1 35  LYS 35  263  263  LYS LYS A . n 
A 1 36  ALA 36  264  264  ALA ALA A . n 
A 1 37  LEU 37  265  265  LEU LEU A . n 
A 1 38  THR 38  266  266  THR THR A . n 
A 1 39  THR 39  267  267  THR THR A . n 
A 1 40  LEU 40  268  268  LEU LEU A . n 
A 1 41  CYS 41  269  269  CYS CYS A . n 
A 1 42  ASP 42  270  270  ASP ASP A . n 
A 1 43  LEU 43  271  271  LEU LEU A . n 
A 1 44  ALA 44  272  272  ALA ALA A . n 
A 1 45  ASP 45  273  273  ASP ASP A . n 
A 1 46  ARG 46  274  274  ARG ARG A . n 
A 1 47  GLU 47  275  275  GLU GLU A . n 
A 1 48  LEU 48  276  276  LEU LEU A . n 
A 1 49  VAL 49  277  277  VAL VAL A . n 
A 1 50  VAL 50  278  278  VAL VAL A . n 
A 1 51  ILE 51  279  279  ILE ILE A . n 
A 1 52  ILE 52  280  280  ILE ILE A . n 
A 1 53  GLY 53  281  281  GLY GLY A . n 
A 1 54  TRP 54  282  282  TRP TRP A . n 
A 1 55  ALA 55  283  283  ALA ALA A . n 
A 1 56  LYS 56  284  284  LYS LYS A . n 
A 1 57  HIS 57  285  285  HIS HIS A . n 
A 1 58  ILE 58  286  286  ILE ILE A . n 
A 1 59  PRO 59  287  287  PRO PRO A . n 
A 1 60  GLY 60  288  288  GLY GLY A . n 
A 1 61  PHE 61  289  289  PHE PHE A . n 
A 1 62  SER 62  290  290  SER SER A . n 
A 1 63  THR 63  291  291  THR THR A . n 
A 1 64  LEU 64  292  292  LEU LEU A . n 
A 1 65  SER 65  293  293  SER SER A . n 
A 1 66  LEU 66  294  294  LEU LEU A . n 
A 1 67  ALA 67  295  295  ALA ALA A . n 
A 1 68  ASP 68  296  296  ASP ASP A . n 
A 1 69  GLN 69  297  297  GLN GLN A . n 
A 1 70  MET 70  298  298  MET MET A . n 
A 1 71  SER 71  299  299  SER SER A . n 
A 1 72  LEU 72  300  300  LEU LEU A . n 
A 1 73  LEU 73  301  301  LEU LEU A . n 
A 1 74  GLN 74  302  302  GLN GLN A . n 
A 1 75  SER 75  303  303  SER SER A . n 
A 1 76  ALA 76  304  304  ALA ALA A . n 
A 1 77  TRP 77  305  305  TRP TRP A . n 
A 1 78  MET 78  306  306  MET MET A . n 
A 1 79  GLU 79  307  307  GLU GLU A . n 
A 1 80  ILE 80  308  308  ILE ILE A . n 
A 1 81  LEU 81  309  309  LEU LEU A . n 
A 1 82  ILE 82  310  310  ILE ILE A . n 
A 1 83  LEU 83  311  311  LEU LEU A . n 
A 1 84  GLY 84  312  312  GLY GLY A . n 
A 1 85  VAL 85  313  313  VAL VAL A . n 
A 1 86  VAL 86  314  314  VAL VAL A . n 
A 1 87  TYR 87  315  315  TYR TYR A . n 
A 1 88  ARG 88  316  316  ARG ARG A . n 
A 1 89  SER 89  317  317  SER SER A . n 
A 1 90  LEU 90  318  318  LEU LEU A . n 
A 1 91  SER 91  319  319  SER SER A . n 
A 1 92  PHE 92  320  320  PHE PHE A . n 
A 1 93  GLU 93  321  321  GLU GLU A . n 
A 1 94  ASP 94  322  322  ASP ASP A . n 
A 1 95  GLU 95  323  323  GLU GLU A . n 
A 1 96  LEU 96  324  324  LEU LEU A . n 
A 1 97  VAL 97  325  325  VAL VAL A . n 
A 1 98  TYR 98  326  326  TYR TYR A . n 
A 1 99  ALA 99  327  327  ALA ALA A . n 
A 1 100 ASP 100 328  328  ASP ASP A . n 
A 1 101 ASP 101 329  329  ASP ASP A . n 
A 1 102 TYR 102 330  330  TYR TYR A . n 
A 1 103 ILE 103 331  331  ILE ILE A . n 
A 1 104 MET 104 332  332  MET MET A . n 
A 1 105 ASP 105 333  333  ASP ASP A . n 
A 1 106 GLU 106 334  334  GLU GLU A . n 
A 1 107 ASP 107 335  335  ASP ASP A . n 
A 1 108 GLN 108 336  336  GLN GLN A . n 
A 1 109 SER 109 337  337  SER SER A . n 
A 1 110 LYS 110 338  338  LYS LYS A . n 
A 1 111 LEU 111 339  339  LEU LEU A . n 
A 1 112 ALA 112 340  340  ALA ALA A . n 
A 1 113 GLY 113 341  341  GLY GLY A . n 
A 1 114 LEU 114 342  342  LEU LEU A . n 
A 1 115 LEU 115 343  343  LEU LEU A . n 
A 1 116 ASP 116 344  344  ASP ASP A . n 
A 1 117 LEU 117 345  345  LEU LEU A . n 
A 1 118 ASN 118 346  346  ASN ASN A . n 
A 1 119 ASN 119 347  347  ASN ASN A . n 
A 1 120 ALA 120 348  348  ALA ALA A . n 
A 1 121 ILE 121 349  349  ILE ILE A . n 
A 1 122 LEU 122 350  350  LEU LEU A . n 
A 1 123 GLN 123 351  351  GLN GLN A . n 
A 1 124 LEU 124 352  352  LEU LEU A . n 
A 1 125 VAL 125 353  353  VAL VAL A . n 
A 1 126 LYS 126 354  354  LYS LYS A . n 
A 1 127 LYS 127 355  355  LYS LYS A . n 
A 1 128 TYR 128 356  356  TYR TYR A . n 
A 1 129 LYS 129 357  357  LYS LYS A . n 
A 1 130 SER 130 358  358  SER SER A . n 
A 1 131 MET 131 359  359  MET MET A . n 
A 1 132 LYS 132 360  360  LYS LYS A . n 
A 1 133 LEU 133 361  361  LEU LEU A . n 
A 1 134 GLU 134 362  362  GLU GLU A . n 
A 1 135 LYS 135 363  363  LYS LYS A . n 
A 1 136 GLU 136 364  364  GLU GLU A . n 
A 1 137 GLU 137 365  365  GLU GLU A . n 
A 1 138 PHE 138 366  366  PHE PHE A . n 
A 1 139 VAL 139 367  367  VAL VAL A . n 
A 1 140 THR 140 368  368  THR THR A . n 
A 1 141 LEU 141 369  369  LEU LEU A . n 
A 1 142 LYS 142 370  370  LYS LYS A . n 
A 1 143 ALA 143 371  371  ALA ALA A . n 
A 1 144 ILE 144 372  372  ILE ILE A . n 
A 1 145 ALA 145 373  373  ALA ALA A . n 
A 1 146 LEU 146 374  374  LEU LEU A . n 
A 1 147 ALA 147 375  375  ALA ALA A . n 
A 1 148 ASN 148 376  376  ASN ASN A . n 
A 1 149 SER 149 377  377  SER SER A . n 
A 1 150 ASP 150 378  378  ASP ASP A . n 
A 1 151 SER 151 379  379  SER SER A . n 
A 1 152 MET 152 380  380  MET MET A . n 
A 1 153 HIS 153 381  381  HIS HIS A . n 
A 1 154 ILE 154 382  382  ILE ILE A . n 
A 1 155 GLU 155 383  383  GLU GLU A . n 
A 1 156 ASP 156 384  384  ASP ASP A . n 
A 1 157 VAL 157 385  385  VAL VAL A . n 
A 1 158 GLU 158 386  386  GLU GLU A . n 
A 1 159 ALA 159 387  387  ALA ALA A . n 
A 1 160 VAL 160 388  388  VAL VAL A . n 
A 1 161 GLN 161 389  389  GLN GLN A . n 
A 1 162 LYS 162 390  390  LYS LYS A . n 
A 1 163 LEU 163 391  391  LEU LEU A . n 
A 1 164 GLN 164 392  392  GLN GLN A . n 
A 1 165 ASP 165 393  393  ASP ASP A . n 
A 1 166 VAL 166 394  394  VAL VAL A . n 
A 1 167 LEU 167 395  395  LEU LEU A . n 
A 1 168 HIS 168 396  396  HIS HIS A . n 
A 1 169 GLU 169 397  397  GLU GLU A . n 
A 1 170 ALA 170 398  398  ALA ALA A . n 
A 1 171 LEU 171 399  399  LEU LEU A . n 
A 1 172 GLN 172 400  400  GLN GLN A . n 
A 1 173 ASP 173 401  401  ASP ASP A . n 
A 1 174 TYR 174 402  402  TYR TYR A . n 
A 1 175 GLU 175 403  403  GLU GLU A . n 
A 1 176 ALA 176 404  404  ALA ALA A . n 
A 1 177 GLY 177 405  405  GLY GLY A . n 
A 1 178 GLN 178 406  406  GLN GLN A . n 
A 1 179 HIS 179 407  407  HIS HIS A . n 
A 1 180 MET 180 408  408  MET MET A . n 
A 1 181 GLU 181 409  409  GLU GLU A . n 
A 1 182 ASP 182 410  410  ASP ASP A . n 
A 1 183 PRO 183 411  411  PRO PRO A . n 
A 1 184 ARG 184 412  412  ARG ARG A . n 
A 1 185 ARG 185 413  413  ARG ARG A . n 
A 1 186 ALA 186 414  414  ALA ALA A . n 
A 1 187 GLY 187 415  415  GLY GLY A . n 
A 1 188 LYS 188 416  416  LYS LYS A . n 
A 1 189 MET 189 417  417  MET MET A . n 
A 1 190 LEU 190 418  418  LEU LEU A . n 
A 1 191 MET 191 419  419  MET MET A . n 
A 1 192 THR 192 420  420  THR THR A . n 
A 1 193 LEU 193 421  421  LEU LEU A . n 
A 1 194 PRO 194 422  422  PRO PRO A . n 
A 1 195 LEU 195 423  423  LEU LEU A . n 
A 1 196 LEU 196 424  424  LEU LEU A . n 
A 1 197 ARG 197 425  425  ARG ARG A . n 
A 1 198 GLN 198 426  426  GLN GLN A . n 
A 1 199 THR 199 427  427  THR THR A . n 
A 1 200 SER 200 428  428  SER SER A . n 
A 1 201 THR 201 429  429  THR THR A . n 
A 1 202 LYS 202 430  430  LYS LYS A . n 
A 1 203 ALA 203 431  431  ALA ALA A . n 
A 1 204 VAL 204 432  432  VAL VAL A . n 
A 1 205 GLN 205 433  433  GLN GLN A . n 
A 1 206 HIS 206 434  434  HIS HIS A . n 
A 1 207 PHE 207 435  435  PHE PHE A . n 
A 1 208 TYR 208 436  436  TYR TYR A . n 
A 1 209 ASN 209 437  437  ASN ASN A . n 
A 1 210 ILE 210 438  438  ILE ILE A . n 
A 1 211 LYS 211 439  439  LYS LYS A . n 
A 1 212 LEU 212 440  440  LEU LEU A . n 
A 1 213 GLU 213 441  441  GLU GLU A . n 
A 1 214 GLY 214 442  442  GLY GLY A . n 
A 1 215 LYS 215 443  443  LYS LYS A . n 
A 1 216 VAL 216 444  444  VAL VAL A . n 
A 1 217 PRO 217 445  445  PRO PRO A . n 
A 1 218 MET 218 446  446  MET MET A . n 
A 1 219 HIS 219 447  447  HIS HIS A . n 
A 1 220 LYS 220 448  448  LYS LYS A . n 
A 1 221 LEU 221 449  449  LEU LEU A . n 
A 1 222 PHE 222 450  450  PHE PHE A . n 
A 1 223 LEU 223 451  451  LEU LEU A . n 
A 1 224 GLU 224 452  452  GLU GLU A . n 
A 1 225 MET 225 453  453  MET MET A . n 
A 1 226 LEU 226 454  454  LEU LEU A . n 
A 1 227 GLU 227 455  455  GLU GLU A . n 
A 1 228 ALA 228 456  ?    ?   ?   A . n 
A 1 229 LYS 229 457  ?    ?   ?   A . n 
A 1 230 VAL 230 458  ?    ?   ?   A . n 
B 1 1   PRO 1   229  ?    ?   ?   B . n 
B 1 2   ALA 2   230  ?    ?   ?   B . n 
B 1 3   LYS 3   231  ?    ?   ?   B . n 
B 1 4   LYS 4   232  ?    ?   ?   B . n 
B 1 5   PRO 5   233  233  PRO PRO B . n 
B 1 6   TYR 6   234  234  TYR TYR B . n 
B 1 7   ASN 7   235  235  ASN ASN B . n 
B 1 8   LYS 8   236  236  LYS LYS B . n 
B 1 9   ILE 9   237  237  ILE ILE B . n 
B 1 10  VAL 10  238  238  VAL VAL B . n 
B 1 11  SER 11  239  239  SER SER B . n 
B 1 12  HIS 12  240  240  HIS HIS B . n 
B 1 13  LEU 13  241  241  LEU LEU B . n 
B 1 14  LEU 14  242  242  LEU LEU B . n 
B 1 15  VAL 15  243  243  VAL VAL B . n 
B 1 16  ALA 16  244  244  ALA ALA B . n 
B 1 17  GLU 17  245  245  GLU GLU B . n 
B 1 18  PRO 18  246  246  PRO PRO B . n 
B 1 19  GLU 19  247  247  GLU GLU B . n 
B 1 20  LYS 20  248  248  LYS LYS B . n 
B 1 21  ILE 21  249  249  ILE ILE B . n 
B 1 22  TYR 22  250  250  TYR TYR B . n 
B 1 23  ALA 23  251  251  ALA ALA B . n 
B 1 24  MET 24  252  252  MET MET B . n 
B 1 25  PRO 25  253  253  PRO PRO B . n 
B 1 26  ASP 26  254  254  ASP ASP B . n 
B 1 27  PRO 27  255  255  PRO PRO B . n 
B 1 28  THR 28  256  256  THR THR B . n 
B 1 29  VAL 29  257  257  VAL VAL B . n 
B 1 30  PRO 30  258  258  PRO PRO B . n 
B 1 31  ASP 31  259  259  ASP ASP B . n 
B 1 32  SER 32  260  260  SER SER B . n 
B 1 33  ASP 33  261  261  ASP ASP B . n 
B 1 34  ILE 34  262  262  ILE ILE B . n 
B 1 35  LYS 35  263  263  LYS LYS B . n 
B 1 36  ALA 36  264  264  ALA ALA B . n 
B 1 37  LEU 37  265  265  LEU LEU B . n 
B 1 38  THR 38  266  266  THR THR B . n 
B 1 39  THR 39  267  267  THR THR B . n 
B 1 40  LEU 40  268  268  LEU LEU B . n 
B 1 41  CYS 41  269  269  CYS CYS B . n 
B 1 42  ASP 42  270  270  ASP ASP B . n 
B 1 43  LEU 43  271  271  LEU LEU B . n 
B 1 44  ALA 44  272  272  ALA ALA B . n 
B 1 45  ASP 45  273  273  ASP ASP B . n 
B 1 46  ARG 46  274  274  ARG ARG B . n 
B 1 47  GLU 47  275  275  GLU GLU B . n 
B 1 48  LEU 48  276  276  LEU LEU B . n 
B 1 49  VAL 49  277  277  VAL VAL B . n 
B 1 50  VAL 50  278  278  VAL VAL B . n 
B 1 51  ILE 51  279  279  ILE ILE B . n 
B 1 52  ILE 52  280  280  ILE ILE B . n 
B 1 53  GLY 53  281  281  GLY GLY B . n 
B 1 54  TRP 54  282  282  TRP TRP B . n 
B 1 55  ALA 55  283  283  ALA ALA B . n 
B 1 56  LYS 56  284  284  LYS LYS B . n 
B 1 57  HIS 57  285  285  HIS HIS B . n 
B 1 58  ILE 58  286  286  ILE ILE B . n 
B 1 59  PRO 59  287  287  PRO PRO B . n 
B 1 60  GLY 60  288  288  GLY GLY B . n 
B 1 61  PHE 61  289  289  PHE PHE B . n 
B 1 62  SER 62  290  290  SER SER B . n 
B 1 63  THR 63  291  291  THR THR B . n 
B 1 64  LEU 64  292  292  LEU LEU B . n 
B 1 65  SER 65  293  293  SER SER B . n 
B 1 66  LEU 66  294  294  LEU LEU B . n 
B 1 67  ALA 67  295  295  ALA ALA B . n 
B 1 68  ASP 68  296  296  ASP ASP B . n 
B 1 69  GLN 69  297  297  GLN GLN B . n 
B 1 70  MET 70  298  298  MET MET B . n 
B 1 71  SER 71  299  299  SER SER B . n 
B 1 72  LEU 72  300  300  LEU LEU B . n 
B 1 73  LEU 73  301  301  LEU LEU B . n 
B 1 74  GLN 74  302  302  GLN GLN B . n 
B 1 75  SER 75  303  303  SER SER B . n 
B 1 76  ALA 76  304  304  ALA ALA B . n 
B 1 77  TRP 77  305  305  TRP TRP B . n 
B 1 78  MET 78  306  306  MET MET B . n 
B 1 79  GLU 79  307  307  GLU GLU B . n 
B 1 80  ILE 80  308  308  ILE ILE B . n 
B 1 81  LEU 81  309  309  LEU LEU B . n 
B 1 82  ILE 82  310  310  ILE ILE B . n 
B 1 83  LEU 83  311  311  LEU LEU B . n 
B 1 84  GLY 84  312  312  GLY GLY B . n 
B 1 85  VAL 85  313  313  VAL VAL B . n 
B 1 86  VAL 86  314  314  VAL VAL B . n 
B 1 87  TYR 87  315  315  TYR TYR B . n 
B 1 88  ARG 88  316  316  ARG ARG B . n 
B 1 89  SER 89  317  317  SER SER B . n 
B 1 90  LEU 90  318  318  LEU LEU B . n 
B 1 91  SER 91  319  319  SER SER B . n 
B 1 92  PHE 92  320  320  PHE PHE B . n 
B 1 93  GLU 93  321  321  GLU GLU B . n 
B 1 94  ASP 94  322  322  ASP ASP B . n 
B 1 95  GLU 95  323  323  GLU GLU B . n 
B 1 96  LEU 96  324  324  LEU LEU B . n 
B 1 97  VAL 97  325  325  VAL VAL B . n 
B 1 98  TYR 98  326  326  TYR TYR B . n 
B 1 99  ALA 99  327  327  ALA ALA B . n 
B 1 100 ASP 100 328  328  ASP ASP B . n 
B 1 101 ASP 101 329  329  ASP ASP B . n 
B 1 102 TYR 102 330  330  TYR TYR B . n 
B 1 103 ILE 103 331  331  ILE ILE B . n 
B 1 104 MET 104 332  332  MET MET B . n 
B 1 105 ASP 105 333  333  ASP ASP B . n 
B 1 106 GLU 106 334  334  GLU GLU B . n 
B 1 107 ASP 107 335  335  ASP ASP B . n 
B 1 108 GLN 108 336  336  GLN GLN B . n 
B 1 109 SER 109 337  337  SER SER B . n 
B 1 110 LYS 110 338  338  LYS LYS B . n 
B 1 111 LEU 111 339  339  LEU LEU B . n 
B 1 112 ALA 112 340  340  ALA ALA B . n 
B 1 113 GLY 113 341  341  GLY GLY B . n 
B 1 114 LEU 114 342  342  LEU LEU B . n 
B 1 115 LEU 115 343  343  LEU LEU B . n 
B 1 116 ASP 116 344  344  ASP ASP B . n 
B 1 117 LEU 117 345  345  LEU LEU B . n 
B 1 118 ASN 118 346  346  ASN ASN B . n 
B 1 119 ASN 119 347  347  ASN ASN B . n 
B 1 120 ALA 120 348  348  ALA ALA B . n 
B 1 121 ILE 121 349  349  ILE ILE B . n 
B 1 122 LEU 122 350  350  LEU LEU B . n 
B 1 123 GLN 123 351  351  GLN GLN B . n 
B 1 124 LEU 124 352  352  LEU LEU B . n 
B 1 125 VAL 125 353  353  VAL VAL B . n 
B 1 126 LYS 126 354  354  LYS LYS B . n 
B 1 127 LYS 127 355  355  LYS LYS B . n 
B 1 128 TYR 128 356  356  TYR TYR B . n 
B 1 129 LYS 129 357  357  LYS LYS B . n 
B 1 130 SER 130 358  358  SER SER B . n 
B 1 131 MET 131 359  359  MET MET B . n 
B 1 132 LYS 132 360  360  LYS LYS B . n 
B 1 133 LEU 133 361  361  LEU LEU B . n 
B 1 134 GLU 134 362  362  GLU GLU B . n 
B 1 135 LYS 135 363  363  LYS LYS B . n 
B 1 136 GLU 136 364  364  GLU GLU B . n 
B 1 137 GLU 137 365  365  GLU GLU B . n 
B 1 138 PHE 138 366  366  PHE PHE B . n 
B 1 139 VAL 139 367  367  VAL VAL B . n 
B 1 140 THR 140 368  368  THR THR B . n 
B 1 141 LEU 141 369  369  LEU LEU B . n 
B 1 142 LYS 142 370  370  LYS LYS B . n 
B 1 143 ALA 143 371  371  ALA ALA B . n 
B 1 144 ILE 144 372  372  ILE ILE B . n 
B 1 145 ALA 145 373  373  ALA ALA B . n 
B 1 146 LEU 146 374  374  LEU LEU B . n 
B 1 147 ALA 147 375  375  ALA ALA B . n 
B 1 148 ASN 148 376  376  ASN ASN B . n 
B 1 149 SER 149 377  377  SER SER B . n 
B 1 150 ASP 150 378  378  ASP ASP B . n 
B 1 151 SER 151 379  379  SER SER B . n 
B 1 152 MET 152 380  380  MET MET B . n 
B 1 153 HIS 153 381  381  HIS HIS B . n 
B 1 154 ILE 154 382  382  ILE ILE B . n 
B 1 155 GLU 155 383  383  GLU GLU B . n 
B 1 156 ASP 156 384  384  ASP ASP B . n 
B 1 157 VAL 157 385  385  VAL VAL B . n 
B 1 158 GLU 158 386  386  GLU GLU B . n 
B 1 159 ALA 159 387  387  ALA ALA B . n 
B 1 160 VAL 160 388  388  VAL VAL B . n 
B 1 161 GLN 161 389  389  GLN GLN B . n 
B 1 162 LYS 162 390  390  LYS LYS B . n 
B 1 163 LEU 163 391  391  LEU LEU B . n 
B 1 164 GLN 164 392  392  GLN GLN B . n 
B 1 165 ASP 165 393  393  ASP ASP B . n 
B 1 166 VAL 166 394  394  VAL VAL B . n 
B 1 167 LEU 167 395  395  LEU LEU B . n 
B 1 168 HIS 168 396  396  HIS HIS B . n 
B 1 169 GLU 169 397  397  GLU GLU B . n 
B 1 170 ALA 170 398  398  ALA ALA B . n 
B 1 171 LEU 171 399  399  LEU LEU B . n 
B 1 172 GLN 172 400  400  GLN GLN B . n 
B 1 173 ASP 173 401  401  ASP ASP B . n 
B 1 174 TYR 174 402  402  TYR TYR B . n 
B 1 175 GLU 175 403  403  GLU GLU B . n 
B 1 176 ALA 176 404  404  ALA ALA B . n 
B 1 177 GLY 177 405  405  GLY GLY B . n 
B 1 178 GLN 178 406  406  GLN GLN B . n 
B 1 179 HIS 179 407  407  HIS HIS B . n 
B 1 180 MET 180 408  408  MET MET B . n 
B 1 181 GLU 181 409  409  GLU GLU B . n 
B 1 182 ASP 182 410  410  ASP ASP B . n 
B 1 183 PRO 183 411  411  PRO PRO B . n 
B 1 184 ARG 184 412  412  ARG ARG B . n 
B 1 185 ARG 185 413  413  ARG ARG B . n 
B 1 186 ALA 186 414  414  ALA ALA B . n 
B 1 187 GLY 187 415  415  GLY GLY B . n 
B 1 188 LYS 188 416  416  LYS LYS B . n 
B 1 189 MET 189 417  417  MET MET B . n 
B 1 190 LEU 190 418  418  LEU LEU B . n 
B 1 191 MET 191 419  419  MET MET B . n 
B 1 192 THR 192 420  420  THR THR B . n 
B 1 193 LEU 193 421  421  LEU LEU B . n 
B 1 194 PRO 194 422  422  PRO PRO B . n 
B 1 195 LEU 195 423  423  LEU LEU B . n 
B 1 196 LEU 196 424  424  LEU LEU B . n 
B 1 197 ARG 197 425  425  ARG ARG B . n 
B 1 198 GLN 198 426  426  GLN GLN B . n 
B 1 199 THR 199 427  427  THR THR B . n 
B 1 200 SER 200 428  428  SER SER B . n 
B 1 201 THR 201 429  429  THR THR B . n 
B 1 202 LYS 202 430  430  LYS LYS B . n 
B 1 203 ALA 203 431  431  ALA ALA B . n 
B 1 204 VAL 204 432  432  VAL VAL B . n 
B 1 205 GLN 205 433  433  GLN GLN B . n 
B 1 206 HIS 206 434  434  HIS HIS B . n 
B 1 207 PHE 207 435  435  PHE PHE B . n 
B 1 208 TYR 208 436  436  TYR TYR B . n 
B 1 209 ASN 209 437  437  ASN ASN B . n 
B 1 210 ILE 210 438  438  ILE ILE B . n 
B 1 211 LYS 211 439  439  LYS LYS B . n 
B 1 212 LEU 212 440  440  LEU LEU B . n 
B 1 213 GLU 213 441  441  GLU GLU B . n 
B 1 214 GLY 214 442  442  GLY GLY B . n 
B 1 215 LYS 215 443  443  LYS LYS B . n 
B 1 216 VAL 216 444  444  VAL VAL B . n 
B 1 217 PRO 217 445  445  PRO PRO B . n 
B 1 218 MET 218 446  446  MET MET B . n 
B 1 219 HIS 219 447  447  HIS HIS B . n 
B 1 220 LYS 220 448  448  LYS LYS B . n 
B 1 221 LEU 221 449  449  LEU LEU B . n 
B 1 222 PHE 222 450  450  PHE PHE B . n 
B 1 223 LEU 223 451  451  LEU LEU B . n 
B 1 224 GLU 224 452  452  GLU GLU B . n 
B 1 225 MET 225 453  453  MET MET B . n 
B 1 226 LEU 226 454  454  LEU LEU B . n 
B 1 227 GLU 227 455  455  GLU GLU B . n 
B 1 228 ALA 228 456  ?    ?   ?   B . n 
B 1 229 LYS 229 457  ?    ?   ?   B . n 
B 1 230 VAL 230 458  ?    ?   ?   B . n 
C 1 1   PRO 1   229  ?    ?   ?   C . n 
C 1 2   ALA 2   230  ?    ?   ?   C . n 
C 1 3   LYS 3   231  ?    ?   ?   C . n 
C 1 4   LYS 4   232  ?    ?   ?   C . n 
C 1 5   PRO 5   233  233  PRO PRO C . n 
C 1 6   TYR 6   234  234  TYR TYR C . n 
C 1 7   ASN 7   235  235  ASN ASN C . n 
C 1 8   LYS 8   236  236  LYS LYS C . n 
C 1 9   ILE 9   237  237  ILE ILE C . n 
C 1 10  VAL 10  238  238  VAL VAL C . n 
C 1 11  SER 11  239  239  SER SER C . n 
C 1 12  HIS 12  240  240  HIS HIS C . n 
C 1 13  LEU 13  241  241  LEU LEU C . n 
C 1 14  LEU 14  242  242  LEU LEU C . n 
C 1 15  VAL 15  243  243  VAL VAL C . n 
C 1 16  ALA 16  244  244  ALA ALA C . n 
C 1 17  GLU 17  245  245  GLU GLU C . n 
C 1 18  PRO 18  246  246  PRO PRO C . n 
C 1 19  GLU 19  247  247  GLU GLU C . n 
C 1 20  LYS 20  248  248  LYS LYS C . n 
C 1 21  ILE 21  249  249  ILE ILE C . n 
C 1 22  TYR 22  250  250  TYR TYR C . n 
C 1 23  ALA 23  251  251  ALA ALA C . n 
C 1 24  MET 24  252  252  MET MET C . n 
C 1 25  PRO 25  253  253  PRO PRO C . n 
C 1 26  ASP 26  254  254  ASP ASP C . n 
C 1 27  PRO 27  255  255  PRO PRO C . n 
C 1 28  THR 28  256  256  THR THR C . n 
C 1 29  VAL 29  257  257  VAL VAL C . n 
C 1 30  PRO 30  258  258  PRO PRO C . n 
C 1 31  ASP 31  259  259  ASP ASP C . n 
C 1 32  SER 32  260  260  SER SER C . n 
C 1 33  ASP 33  261  261  ASP ASP C . n 
C 1 34  ILE 34  262  262  ILE ILE C . n 
C 1 35  LYS 35  263  263  LYS LYS C . n 
C 1 36  ALA 36  264  264  ALA ALA C . n 
C 1 37  LEU 37  265  265  LEU LEU C . n 
C 1 38  THR 38  266  266  THR THR C . n 
C 1 39  THR 39  267  267  THR THR C . n 
C 1 40  LEU 40  268  268  LEU LEU C . n 
C 1 41  CYS 41  269  269  CYS CYS C . n 
C 1 42  ASP 42  270  270  ASP ASP C . n 
C 1 43  LEU 43  271  271  LEU LEU C . n 
C 1 44  ALA 44  272  272  ALA ALA C . n 
C 1 45  ASP 45  273  273  ASP ASP C . n 
C 1 46  ARG 46  274  274  ARG ARG C . n 
C 1 47  GLU 47  275  275  GLU GLU C . n 
C 1 48  LEU 48  276  276  LEU LEU C . n 
C 1 49  VAL 49  277  277  VAL VAL C . n 
C 1 50  VAL 50  278  278  VAL VAL C . n 
C 1 51  ILE 51  279  279  ILE ILE C . n 
C 1 52  ILE 52  280  280  ILE ILE C . n 
C 1 53  GLY 53  281  281  GLY GLY C . n 
C 1 54  TRP 54  282  282  TRP TRP C . n 
C 1 55  ALA 55  283  283  ALA ALA C . n 
C 1 56  LYS 56  284  284  LYS LYS C . n 
C 1 57  HIS 57  285  285  HIS HIS C . n 
C 1 58  ILE 58  286  286  ILE ILE C . n 
C 1 59  PRO 59  287  287  PRO PRO C . n 
C 1 60  GLY 60  288  288  GLY GLY C . n 
C 1 61  PHE 61  289  289  PHE PHE C . n 
C 1 62  SER 62  290  290  SER SER C . n 
C 1 63  THR 63  291  291  THR THR C . n 
C 1 64  LEU 64  292  292  LEU LEU C . n 
C 1 65  SER 65  293  293  SER SER C . n 
C 1 66  LEU 66  294  294  LEU LEU C . n 
C 1 67  ALA 67  295  295  ALA ALA C . n 
C 1 68  ASP 68  296  296  ASP ASP C . n 
C 1 69  GLN 69  297  297  GLN GLN C . n 
C 1 70  MET 70  298  298  MET MET C . n 
C 1 71  SER 71  299  299  SER SER C . n 
C 1 72  LEU 72  300  300  LEU LEU C . n 
C 1 73  LEU 73  301  301  LEU LEU C . n 
C 1 74  GLN 74  302  302  GLN GLN C . n 
C 1 75  SER 75  303  303  SER SER C . n 
C 1 76  ALA 76  304  304  ALA ALA C . n 
C 1 77  TRP 77  305  305  TRP TRP C . n 
C 1 78  MET 78  306  306  MET MET C . n 
C 1 79  GLU 79  307  307  GLU GLU C . n 
C 1 80  ILE 80  308  308  ILE ILE C . n 
C 1 81  LEU 81  309  309  LEU LEU C . n 
C 1 82  ILE 82  310  310  ILE ILE C . n 
C 1 83  LEU 83  311  311  LEU LEU C . n 
C 1 84  GLY 84  312  312  GLY GLY C . n 
C 1 85  VAL 85  313  313  VAL VAL C . n 
C 1 86  VAL 86  314  314  VAL VAL C . n 
C 1 87  TYR 87  315  315  TYR TYR C . n 
C 1 88  ARG 88  316  316  ARG ARG C . n 
C 1 89  SER 89  317  317  SER SER C . n 
C 1 90  LEU 90  318  318  LEU LEU C . n 
C 1 91  SER 91  319  319  SER SER C . n 
C 1 92  PHE 92  320  320  PHE PHE C . n 
C 1 93  GLU 93  321  321  GLU GLU C . n 
C 1 94  ASP 94  322  322  ASP ASP C . n 
C 1 95  GLU 95  323  323  GLU GLU C . n 
C 1 96  LEU 96  324  324  LEU LEU C . n 
C 1 97  VAL 97  325  325  VAL VAL C . n 
C 1 98  TYR 98  326  326  TYR TYR C . n 
C 1 99  ALA 99  327  327  ALA ALA C . n 
C 1 100 ASP 100 328  328  ASP ASP C . n 
C 1 101 ASP 101 329  329  ASP ASP C . n 
C 1 102 TYR 102 330  330  TYR TYR C . n 
C 1 103 ILE 103 331  331  ILE ILE C . n 
C 1 104 MET 104 332  332  MET MET C . n 
C 1 105 ASP 105 333  333  ASP ASP C . n 
C 1 106 GLU 106 334  334  GLU GLU C . n 
C 1 107 ASP 107 335  335  ASP ASP C . n 
C 1 108 GLN 108 336  336  GLN GLN C . n 
C 1 109 SER 109 337  337  SER SER C . n 
C 1 110 LYS 110 338  338  LYS LYS C . n 
C 1 111 LEU 111 339  339  LEU LEU C . n 
C 1 112 ALA 112 340  340  ALA ALA C . n 
C 1 113 GLY 113 341  341  GLY GLY C . n 
C 1 114 LEU 114 342  342  LEU LEU C . n 
C 1 115 LEU 115 343  343  LEU LEU C . n 
C 1 116 ASP 116 344  344  ASP ASP C . n 
C 1 117 LEU 117 345  345  LEU LEU C . n 
C 1 118 ASN 118 346  346  ASN ASN C . n 
C 1 119 ASN 119 347  347  ASN ASN C . n 
C 1 120 ALA 120 348  348  ALA ALA C . n 
C 1 121 ILE 121 349  349  ILE ILE C . n 
C 1 122 LEU 122 350  350  LEU LEU C . n 
C 1 123 GLN 123 351  351  GLN GLN C . n 
C 1 124 LEU 124 352  352  LEU LEU C . n 
C 1 125 VAL 125 353  353  VAL VAL C . n 
C 1 126 LYS 126 354  354  LYS LYS C . n 
C 1 127 LYS 127 355  355  LYS LYS C . n 
C 1 128 TYR 128 356  356  TYR TYR C . n 
C 1 129 LYS 129 357  357  LYS LYS C . n 
C 1 130 SER 130 358  358  SER SER C . n 
C 1 131 MET 131 359  359  MET MET C . n 
C 1 132 LYS 132 360  360  LYS LYS C . n 
C 1 133 LEU 133 361  361  LEU LEU C . n 
C 1 134 GLU 134 362  362  GLU GLU C . n 
C 1 135 LYS 135 363  363  LYS LYS C . n 
C 1 136 GLU 136 364  364  GLU GLU C . n 
C 1 137 GLU 137 365  365  GLU GLU C . n 
C 1 138 PHE 138 366  366  PHE PHE C . n 
C 1 139 VAL 139 367  367  VAL VAL C . n 
C 1 140 THR 140 368  368  THR THR C . n 
C 1 141 LEU 141 369  369  LEU LEU C . n 
C 1 142 LYS 142 370  370  LYS LYS C . n 
C 1 143 ALA 143 371  371  ALA ALA C . n 
C 1 144 ILE 144 372  372  ILE ILE C . n 
C