data_2GRA
# 
_entry.id   2GRA 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2GRA         
RCSB  RCSB037458   
WWPDB D_1000037458 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          2GR9 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2GRA 
_pdbx_database_status.recvd_initial_deposition_date   2006-04-23 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Meng, Z.' 1 
'Lou, Z.'  2 
'Liu, Z.'  3 
'Rao, Z.'  4 
# 
_citation.id                        primary 
_citation.title                     'Crystal structure of human pyrroline-5-carboxylate reductase' 
_citation.journal_abbrev            J.Mol.Biol. 
_citation.journal_volume            359 
_citation.page_first                1364 
_citation.page_last                 1377 
_citation.year                      2006 
_citation.journal_id_ASTM           JMOBAK 
_citation.country                   UK 
_citation.journal_id_ISSN           0022-2836 
_citation.journal_id_CSD            0070 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   16730026 
_citation.pdbx_database_id_DOI      10.1016/j.jmb.2006.04.053 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Meng, Z.'    1 
primary 'Lou, Z.'     2 
primary 'Liu, Z.'     3 
primary 'Li, M.'      4 
primary 'Zhao, X.'    5 
primary 'Bartlam, M.' 6 
primary 'Rao, Z.'     7 
# 
_cell.entry_id           2GRA 
_cell.length_a           207.868 
_cell.length_b           123.502 
_cell.length_c           120.826 
_cell.angle_alpha        90.00 
_cell.angle_beta         121.97 
_cell.angle_gamma        90.00 
_cell.Z_PDB              20 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         2GRA 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Pyrroline-5-carboxylate reductase 1'              29147.648 5   1.5.1.2 ? ? ? 
2 non-polymer syn 'NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE' 743.405   5   ?       ? ? ? 
3 non-polymer syn 'GLUTAMIC ACID'                                    147.129   5   ?       ? ? ? 
4 water       nat water                                              18.015    620 ?       ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'P5CR 1, P5C reductase 1' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;RGMSVGFIGAGQLAFALAKGFTAAGVLAAHKIMASSPDMDLATVSALRKMGVKLTPHNKETVQHSDVLFLAVKPHIIPFI
LDEIGADIEDRHIVVSCAAGVTISSIEKKLSAFRPAPRVIRCMTNTPVVVREGATVYATGTHAQVEDGRLMEQLLSSVGF
CTEVEEDLIDAVTGLSGSGPAYAFTALDALADGGVKMGLPRRLAVRLGAQALLGAAKMLLHSEQHPGQLKDNVSSPGGAT
IHALHVLESGGFRSLLINAVEASCIRTRELQSMADQE
;
_entity_poly.pdbx_seq_one_letter_code_can   
;RGMSVGFIGAGQLAFALAKGFTAAGVLAAHKIMASSPDMDLATVSALRKMGVKLTPHNKETVQHSDVLFLAVKPHIIPFI
LDEIGADIEDRHIVVSCAAGVTISSIEKKLSAFRPAPRVIRCMTNTPVVVREGATVYATGTHAQVEDGRLMEQLLSSVGF
CTEVEEDLIDAVTGLSGSGPAYAFTALDALADGGVKMGLPRRLAVRLGAQALLGAAKMLLHSEQHPGQLKDNVSSPGGAT
IHALHVLESGGFRSLLINAVEASCIRTRELQSMADQE
;
_entity_poly.pdbx_strand_id                 A,B,C,D,E 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ARG n 
1 2   GLY n 
1 3   MET n 
1 4   SER n 
1 5   VAL n 
1 6   GLY n 
1 7   PHE n 
1 8   ILE n 
1 9   GLY n 
1 10  ALA n 
1 11  GLY n 
1 12  GLN n 
1 13  LEU n 
1 14  ALA n 
1 15  PHE n 
1 16  ALA n 
1 17  LEU n 
1 18  ALA n 
1 19  LYS n 
1 20  GLY n 
1 21  PHE n 
1 22  THR n 
1 23  ALA n 
1 24  ALA n 
1 25  GLY n 
1 26  VAL n 
1 27  LEU n 
1 28  ALA n 
1 29  ALA n 
1 30  HIS n 
1 31  LYS n 
1 32  ILE n 
1 33  MET n 
1 34  ALA n 
1 35  SER n 
1 36  SER n 
1 37  PRO n 
1 38  ASP n 
1 39  MET n 
1 40  ASP n 
1 41  LEU n 
1 42  ALA n 
1 43  THR n 
1 44  VAL n 
1 45  SER n 
1 46  ALA n 
1 47  LEU n 
1 48  ARG n 
1 49  LYS n 
1 50  MET n 
1 51  GLY n 
1 52  VAL n 
1 53  LYS n 
1 54  LEU n 
1 55  THR n 
1 56  PRO n 
1 57  HIS n 
1 58  ASN n 
1 59  LYS n 
1 60  GLU n 
1 61  THR n 
1 62  VAL n 
1 63  GLN n 
1 64  HIS n 
1 65  SER n 
1 66  ASP n 
1 67  VAL n 
1 68  LEU n 
1 69  PHE n 
1 70  LEU n 
1 71  ALA n 
1 72  VAL n 
1 73  LYS n 
1 74  PRO n 
1 75  HIS n 
1 76  ILE n 
1 77  ILE n 
1 78  PRO n 
1 79  PHE n 
1 80  ILE n 
1 81  LEU n 
1 82  ASP n 
1 83  GLU n 
1 84  ILE n 
1 85  GLY n 
1 86  ALA n 
1 87  ASP n 
1 88  ILE n 
1 89  GLU n 
1 90  ASP n 
1 91  ARG n 
1 92  HIS n 
1 93  ILE n 
1 94  VAL n 
1 95  VAL n 
1 96  SER n 
1 97  CYS n 
1 98  ALA n 
1 99  ALA n 
1 100 GLY n 
1 101 VAL n 
1 102 THR n 
1 103 ILE n 
1 104 SER n 
1 105 SER n 
1 106 ILE n 
1 107 GLU n 
1 108 LYS n 
1 109 LYS n 
1 110 LEU n 
1 111 SER n 
1 112 ALA n 
1 113 PHE n 
1 114 ARG n 
1 115 PRO n 
1 116 ALA n 
1 117 PRO n 
1 118 ARG n 
1 119 VAL n 
1 120 ILE n 
1 121 ARG n 
1 122 CYS n 
1 123 MET n 
1 124 THR n 
1 125 ASN n 
1 126 THR n 
1 127 PRO n 
1 128 VAL n 
1 129 VAL n 
1 130 VAL n 
1 131 ARG n 
1 132 GLU n 
1 133 GLY n 
1 134 ALA n 
1 135 THR n 
1 136 VAL n 
1 137 TYR n 
1 138 ALA n 
1 139 THR n 
1 140 GLY n 
1 141 THR n 
1 142 HIS n 
1 143 ALA n 
1 144 GLN n 
1 145 VAL n 
1 146 GLU n 
1 147 ASP n 
1 148 GLY n 
1 149 ARG n 
1 150 LEU n 
1 151 MET n 
1 152 GLU n 
1 153 GLN n 
1 154 LEU n 
1 155 LEU n 
1 156 SER n 
1 157 SER n 
1 158 VAL n 
1 159 GLY n 
1 160 PHE n 
1 161 CYS n 
1 162 THR n 
1 163 GLU n 
1 164 VAL n 
1 165 GLU n 
1 166 GLU n 
1 167 ASP n 
1 168 LEU n 
1 169 ILE n 
1 170 ASP n 
1 171 ALA n 
1 172 VAL n 
1 173 THR n 
1 174 GLY n 
1 175 LEU n 
1 176 SER n 
1 177 GLY n 
1 178 SER n 
1 179 GLY n 
1 180 PRO n 
1 181 ALA n 
1 182 TYR n 
1 183 ALA n 
1 184 PHE n 
1 185 THR n 
1 186 ALA n 
1 187 LEU n 
1 188 ASP n 
1 189 ALA n 
1 190 LEU n 
1 191 ALA n 
1 192 ASP n 
1 193 GLY n 
1 194 GLY n 
1 195 VAL n 
1 196 LYS n 
1 197 MET n 
1 198 GLY n 
1 199 LEU n 
1 200 PRO n 
1 201 ARG n 
1 202 ARG n 
1 203 LEU n 
1 204 ALA n 
1 205 VAL n 
1 206 ARG n 
1 207 LEU n 
1 208 GLY n 
1 209 ALA n 
1 210 GLN n 
1 211 ALA n 
1 212 LEU n 
1 213 LEU n 
1 214 GLY n 
1 215 ALA n 
1 216 ALA n 
1 217 LYS n 
1 218 MET n 
1 219 LEU n 
1 220 LEU n 
1 221 HIS n 
1 222 SER n 
1 223 GLU n 
1 224 GLN n 
1 225 HIS n 
1 226 PRO n 
1 227 GLY n 
1 228 GLN n 
1 229 LEU n 
1 230 LYS n 
1 231 ASP n 
1 232 ASN n 
1 233 VAL n 
1 234 SER n 
1 235 SER n 
1 236 PRO n 
1 237 GLY n 
1 238 GLY n 
1 239 ALA n 
1 240 THR n 
1 241 ILE n 
1 242 HIS n 
1 243 ALA n 
1 244 LEU n 
1 245 HIS n 
1 246 VAL n 
1 247 LEU n 
1 248 GLU n 
1 249 SER n 
1 250 GLY n 
1 251 GLY n 
1 252 PHE n 
1 253 ARG n 
1 254 SER n 
1 255 LEU n 
1 256 LEU n 
1 257 ILE n 
1 258 ASN n 
1 259 ALA n 
1 260 VAL n 
1 261 GLU n 
1 262 ALA n 
1 263 SER n 
1 264 CYS n 
1 265 ILE n 
1 266 ARG n 
1 267 THR n 
1 268 ARG n 
1 269 GLU n 
1 270 LEU n 
1 271 GLN n 
1 272 SER n 
1 273 MET n 
1 274 ALA n 
1 275 ASP n 
1 276 GLN n 
1 277 GLU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    P5CR1_HUMAN 
_struct_ref.pdbx_db_accession          P32322 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.pdbx_seq_one_letter_code   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2GRA A 3 ? 277 ? P32322 1 ? 275 ? 1 275 
2 1 2GRA B 3 ? 277 ? P32322 1 ? 275 ? 1 275 
3 1 2GRA C 3 ? 277 ? P32322 1 ? 275 ? 1 275 
4 1 2GRA D 3 ? 277 ? P32322 1 ? 275 ? 1 275 
5 1 2GRA E 3 ? 277 ? P32322 1 ? 275 ? 1 275 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2GRA ARG A 1 ? UNP P32322 ? ? 'CLONING ARTIFACT' -1 1  
1 2GRA GLY A 2 ? UNP P32322 ? ? 'CLONING ARTIFACT' 0  2  
2 2GRA ARG B 1 ? UNP P32322 ? ? 'CLONING ARTIFACT' -1 3  
2 2GRA GLY B 2 ? UNP P32322 ? ? 'CLONING ARTIFACT' 0  4  
3 2GRA ARG C 1 ? UNP P32322 ? ? 'CLONING ARTIFACT' -1 5  
3 2GRA GLY C 2 ? UNP P32322 ? ? 'CLONING ARTIFACT' 0  6  
4 2GRA ARG D 1 ? UNP P32322 ? ? 'CLONING ARTIFACT' -1 7  
4 2GRA GLY D 2 ? UNP P32322 ? ? 'CLONING ARTIFACT' 0  8  
5 2GRA ARG E 1 ? UNP P32322 ? ? 'CLONING ARTIFACT' -1 9  
5 2GRA GLY E 2 ? UNP P32322 ? ? 'CLONING ARTIFACT' 0  10 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                            ?                                            
'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                                           ?                                            
'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                                         ?                                            
'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                    ?                                            
'C4 H7 N O4'        133.103 
CYS 'L-peptide linking' y CYSTEINE                                           ?                                            
'C3 H7 N O2 S'      121.158 
GLN 'L-peptide linking' y GLUTAMINE                                          ?                                            
'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                    ?                                            
'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                                            ?                                            
'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                                          ?                                            
'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                                              ?                                            'H2 O' 
18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                         ?                                            
'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                                            ?                                            
'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                                             ?                                            
'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                                         ?                                            
'C5 H11 N O2 S'     149.211 
NAP non-polymer         . 'NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE' 
;2'-MONOPHOSPHOADENOSINE 5'-DIPHOSPHORIBOSE
;
'C21 H28 N7 O17 P3' 743.405 
PHE 'L-peptide linking' y PHENYLALANINE                                      ?                                            
'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                                            ?                                            
'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                                             ?                                            
'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                                          ?                                            
'C4 H9 N O3'        119.119 
TYR 'L-peptide linking' y TYROSINE                                           ?                                            
'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                                             ?                                            
'C5 H11 N O2'       117.146 
# 
_exptl.entry_id          2GRA 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      4.51 
_exptl_crystal.density_percent_sol   72.74 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            291 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pdbx_details    
'0.8-1M sodium acetate, 30-40mM imidazole (pH 6.5), 50-60mM Tris-HCl (pH 7.5), VAPOR DIFFUSION, HANGING DROP, temperature 291K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU RAXIS IV' 
_diffrn_detector.pdbx_collection_date   2005-06-27 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'osmic mirror' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU MICROMAX-007' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.5418 
# 
_reflns.entry_id                     2GRA 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             50.0 
_reflns.d_resolution_high            3.1 
_reflns.number_obs                   535337 
_reflns.number_all                   535608 
_reflns.percent_possible_obs         99.0 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             3.1 
_reflns_shell.d_res_low              3.2 
_reflns_shell.percent_possible_all   99.0 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 2GRA 
_refine.ls_number_reflns_obs                     45647 
_refine.ls_number_reflns_all                     47093 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             50.0 
_refine.ls_d_res_high                            3.1 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          0.23 
_refine.ls_R_factor_all                          0.232 
_refine.ls_R_factor_R_work                       0.228 
_refine.ls_R_factor_R_free                       0.249 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  2279 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      2GER 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            random 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        10169 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         290 
_refine_hist.number_atoms_solvent             620 
_refine_hist.number_atoms_total               11079 
_refine_hist.d_res_high                       3.1 
_refine_hist.d_res_low                        50.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_angle_deg 0.012 ? ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d    2.01  ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  2GRA 
_struct.title                     'crystal structure of Human Pyrroline-5-carboxylate Reductase complexed with nadp' 
_struct.pdbx_descriptor           'Pyrroline-5-carboxylate reductase 1 (E.C.1.5.1.2)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2GRA 
_struct_keywords.pdbx_keywords   OXIDOREDUCTASE 
_struct_keywords.text            'Human Pyrroline-5-carboxylate Reductase, NADPH, OXIDOREDUCTASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 1 ? 
F N N 2 ? 
G N N 3 ? 
H N N 2 ? 
I N N 3 ? 
J N N 2 ? 
K N N 3 ? 
L N N 2 ? 
M N N 3 ? 
N N N 2 ? 
O N N 3 ? 
P N N 4 ? 
Q N N 4 ? 
R N N 4 ? 
S N N 4 ? 
T N N 4 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ALA A 10  ? ALA A 24  ? ALA A 8   ALA A 22  1 ? 15 
HELX_P HELX_P2  2  ALA A 28  ? HIS A 30  ? ALA A 26  HIS A 28  5 ? 3  
HELX_P HELX_P3  3  LEU A 41  ? GLY A 51  ? LEU A 39  GLY A 49  1 ? 11 
HELX_P HELX_P4  4  LYS A 59  ? SER A 65  ? LYS A 57  SER A 63  1 ? 7  
HELX_P HELX_P5  5  ILE A 77  ? GLY A 85  ? ILE A 75  GLY A 83  1 ? 9  
HELX_P HELX_P6  6  ALA A 86  ? ILE A 88  ? ALA A 84  ILE A 86  5 ? 3  
HELX_P HELX_P7  7  THR A 102 ? SER A 111 ? THR A 100 SER A 109 1 ? 10 
HELX_P HELX_P8  8  ASN A 125 ? VAL A 129 ? ASN A 123 VAL A 127 5 ? 5  
HELX_P HELX_P9  9  GLU A 146 ? SER A 156 ? GLU A 144 SER A 154 1 ? 11 
HELX_P HELX_P10 10 GLU A 165 ? ASP A 167 ? GLU A 163 ASP A 165 5 ? 3  
HELX_P HELX_P11 11 LEU A 168 ? GLY A 174 ? LEU A 166 GLY A 172 1 ? 7  
HELX_P HELX_P12 12 SER A 178 ? LYS A 196 ? SER A 176 LYS A 194 1 ? 19 
HELX_P HELX_P13 13 PRO A 200 ? HIS A 221 ? PRO A 198 HIS A 219 1 ? 22 
HELX_P HELX_P14 14 HIS A 225 ? ASN A 232 ? HIS A 223 ASN A 230 1 ? 8  
HELX_P HELX_P15 15 THR A 240 ? GLY A 250 ? THR A 238 GLY A 248 1 ? 11 
HELX_P HELX_P16 16 GLY A 251 ? ASP A 275 ? GLY A 249 ASP A 273 1 ? 25 
HELX_P HELX_P17 17 GLY B 11  ? GLY B 20  ? GLY B 9   GLY B 18  1 ? 10 
HELX_P HELX_P18 18 THR B 43  ? GLY B 51  ? THR B 41  GLY B 49  5 ? 9  
HELX_P HELX_P19 19 LYS B 59  ? GLN B 63  ? LYS B 57  GLN B 61  5 ? 5  
HELX_P HELX_P20 20 ILE B 77  ? ASP B 82  ? ILE B 75  ASP B 80  1 ? 6  
HELX_P HELX_P21 21 GLU B 83  ? ILE B 88  ? GLU B 81  ILE B 86  5 ? 6  
HELX_P HELX_P22 22 THR B 102 ? GLU B 107 ? THR B 100 GLU B 105 1 ? 6  
HELX_P HELX_P23 23 THR B 126 ? VAL B 130 ? THR B 124 VAL B 128 5 ? 5  
HELX_P HELX_P24 24 GLN B 144 ? GLU B 146 ? GLN B 142 GLU B 144 5 ? 3  
HELX_P HELX_P25 25 ASP B 147 ? LEU B 155 ? ASP B 145 LEU B 153 1 ? 9  
HELX_P HELX_P26 26 GLU B 165 ? ASP B 167 ? GLU B 163 ASP B 165 5 ? 3  
HELX_P HELX_P27 27 LEU B 168 ? LEU B 175 ? LEU B 166 LEU B 173 1 ? 8  
HELX_P HELX_P28 28 SER B 178 ? MET B 197 ? SER B 176 MET B 195 1 ? 20 
HELX_P HELX_P29 29 PRO B 200 ? SER B 222 ? PRO B 198 SER B 220 1 ? 23 
HELX_P HELX_P30 30 HIS B 225 ? ASN B 232 ? HIS B 223 ASN B 230 1 ? 8  
HELX_P HELX_P31 31 ALA B 239 ? SER B 249 ? ALA B 237 SER B 247 1 ? 11 
HELX_P HELX_P32 32 GLY B 251 ? ASP B 275 ? GLY B 249 ASP B 273 1 ? 25 
HELX_P HELX_P33 33 GLN C 12  ? ALA C 24  ? GLN C 10  ALA C 22  1 ? 13 
HELX_P HELX_P34 34 SER C 45  ? VAL C 52  ? SER C 43  VAL C 50  1 ? 8  
HELX_P HELX_P35 35 LYS C 59  ? GLN C 63  ? LYS C 57  GLN C 61  5 ? 5  
HELX_P HELX_P36 36 ILE C 76  ? ALA C 86  ? ILE C 74  ALA C 84  1 ? 11 
HELX_P HELX_P37 37 THR C 102 ? LYS C 108 ? THR C 100 LYS C 106 1 ? 7  
HELX_P HELX_P38 38 THR C 126 ? VAL C 130 ? THR C 124 VAL C 128 5 ? 5  
HELX_P HELX_P39 39 LEU C 150 ? LEU C 155 ? LEU C 148 LEU C 153 1 ? 6  
HELX_P HELX_P40 40 GLU C 165 ? LEU C 175 ? GLU C 163 LEU C 173 1 ? 11 
HELX_P HELX_P41 41 SER C 178 ? MET C 197 ? SER C 176 MET C 195 1 ? 20 
HELX_P HELX_P42 42 PRO C 200 ? SER C 222 ? PRO C 198 SER C 220 1 ? 23 
HELX_P HELX_P43 43 HIS C 225 ? VAL C 233 ? HIS C 223 VAL C 231 1 ? 9  
HELX_P HELX_P44 44 ALA C 239 ? SER C 249 ? ALA C 237 SER C 247 1 ? 11 
HELX_P HELX_P45 45 PHE C 252 ? SER C 272 ? PHE C 250 SER C 270 1 ? 21 
HELX_P HELX_P46 46 GLY D 11  ? ALA D 24  ? GLY D 9   ALA D 22  1 ? 14 
HELX_P HELX_P47 47 ALA D 28  ? HIS D 30  ? ALA D 26  HIS D 28  5 ? 3  
HELX_P HELX_P48 48 ALA D 42  ? GLY D 51  ? ALA D 40  GLY D 49  1 ? 10 
HELX_P HELX_P49 49 HIS D 57  ? SER D 65  ? HIS D 55  SER D 63  1 ? 9  
HELX_P HELX_P50 50 HIS D 75  ? ALA D 86  ? HIS D 73  ALA D 84  1 ? 12 
HELX_P HELX_P51 51 THR D 102 ? SER D 111 ? THR D 100 SER D 109 1 ? 10 
HELX_P HELX_P52 52 ASN D 125 ? ARG D 131 ? ASN D 123 ARG D 129 5 ? 7  
HELX_P HELX_P53 53 GLN D 144 ? SER D 157 ? GLN D 142 SER D 155 1 ? 14 
HELX_P HELX_P54 54 GLU D 165 ? ILE D 169 ? GLU D 163 ILE D 167 5 ? 5  
HELX_P HELX_P55 55 ASP D 170 ? MET D 197 ? ASP D 168 MET D 195 1 ? 28 
HELX_P HELX_P56 56 PRO D 200 ? VAL D 205 ? PRO D 198 VAL D 203 1 ? 6  
HELX_P HELX_P57 57 LEU D 207 ? HIS D 221 ? LEU D 205 HIS D 219 1 ? 15 
HELX_P HELX_P58 58 HIS D 225 ? ASN D 232 ? HIS D 223 ASN D 230 1 ? 8  
HELX_P HELX_P59 59 ALA D 239 ? GLY D 250 ? ALA D 237 GLY D 248 1 ? 12 
HELX_P HELX_P60 60 GLY D 251 ? SER D 272 ? GLY D 249 SER D 270 1 ? 22 
HELX_P HELX_P61 61 GLY E 11  ? ALA E 24  ? GLY E 9   ALA E 22  1 ? 14 
HELX_P HELX_P62 62 ALA E 28  ? HIS E 30  ? ALA E 26  HIS E 28  5 ? 3  
HELX_P HELX_P63 63 THR E 43  ? MET E 50  ? THR E 41  MET E 48  1 ? 8  
HELX_P HELX_P64 64 HIS E 57  ? SER E 65  ? HIS E 55  SER E 63  1 ? 9  
HELX_P HELX_P65 65 ILE E 76  ? ASP E 82  ? ILE E 74  ASP E 80  1 ? 7  
HELX_P HELX_P66 66 ILE E 103 ? ALA E 112 ? ILE E 101 ALA E 110 1 ? 10 
HELX_P HELX_P67 67 ASN E 125 ? ARG E 131 ? ASN E 123 ARG E 129 5 ? 7  
HELX_P HELX_P68 68 GLN E 144 ? SER E 157 ? GLN E 142 SER E 155 1 ? 14 
HELX_P HELX_P69 69 GLU E 165 ? ILE E 169 ? GLU E 163 ILE E 167 5 ? 5  
HELX_P HELX_P70 70 ASP E 170 ? LEU E 175 ? ASP E 168 LEU E 173 1 ? 6  
HELX_P HELX_P71 71 SER E 178 ? MET E 197 ? SER E 176 MET E 195 1 ? 20 
HELX_P HELX_P72 72 PRO E 200 ? GLU E 223 ? PRO E 198 GLU E 221 1 ? 24 
HELX_P HELX_P73 73 HIS E 225 ? SER E 234 ? HIS E 223 SER E 232 1 ? 10 
HELX_P HELX_P74 74 ALA E 239 ? GLY E 250 ? ALA E 237 GLY E 248 1 ? 12 
HELX_P HELX_P75 75 GLY E 251 ? SER E 272 ? GLY E 249 SER E 270 1 ? 22 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 97  SG ? ? ? 1_555 A CYS 122 SG  ? ? A CYS 95  A CYS 120  1_555 ? ? ? ? ? ? ? 2.045 ? 
disulf2 disulf ? ? B CYS 97  SG ? ? ? 1_555 B CYS 122 SG  ? ? B CYS 95  B CYS 120  1_555 ? ? ? ? ? ? ? 2.036 ? 
disulf3 disulf ? ? C CYS 97  SG ? ? ? 1_555 C CYS 122 SG  ? ? C CYS 95  C CYS 120  1_555 ? ? ? ? ? ? ? 2.035 ? 
disulf4 disulf ? ? D CYS 97  SG ? ? ? 1_555 D CYS 122 SG  ? ? D CYS 95  D CYS 120  1_555 ? ? ? ? ? ? ? 2.043 ? 
disulf5 disulf ? ? E CYS 97  SG ? ? ? 1_555 E CYS 122 SG  ? ? E CYS 95  E CYS 120  1_555 ? ? ? ? ? ? ? 2.036 ? 
covale1 covale ? ? D SER 156 O  ? ? ? 1_555 L NAP .   N7N ? ? D SER 154 D NAP 4300 1_555 ? ? ? ? ? ? ? 1.845 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 7 ? 
B ? 2 ? 
C ? 2 ? 
D ? 3 ? 
E ? 2 ? 
F ? 2 ? 
G ? 3 ? 
H ? 8 ? 
I ? 8 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? parallel      
A 3 4 ? parallel      
A 4 5 ? parallel      
A 5 6 ? parallel      
A 6 7 ? anti-parallel 
B 1 2 ? parallel      
C 1 2 ? parallel      
D 1 2 ? parallel      
D 2 3 ? parallel      
E 1 2 ? anti-parallel 
F 1 2 ? parallel      
G 1 2 ? anti-parallel 
G 2 3 ? parallel      
H 1 2 ? parallel      
H 2 3 ? parallel      
H 3 4 ? parallel      
H 4 5 ? parallel      
H 5 6 ? parallel      
H 6 7 ? anti-parallel 
H 7 8 ? parallel      
I 1 2 ? parallel      
I 2 3 ? parallel      
I 3 4 ? parallel      
I 4 5 ? parallel      
I 5 6 ? parallel      
I 6 7 ? anti-parallel 
I 7 8 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LYS A 53  ? THR A 55  ? LYS A 51  THR A 53  
A 2 ILE A 32  ? SER A 35  ? ILE A 30  SER A 33  
A 3 VAL A 5   ? PHE A 7   ? VAL A 3   PHE A 5   
A 4 VAL A 67  ? LEU A 70  ? VAL A 65  LEU A 68  
A 5 ILE A 93  ? SER A 96  ? ILE A 91  SER A 94  
A 6 VAL A 119 ? MET A 123 ? VAL A 117 MET A 121 
A 7 VAL A 136 ? THR A 139 ? VAL A 134 THR A 137 
B 1 GLY A 133 ? ALA A 134 ? GLY A 131 ALA A 132 
B 2 GLY A 159 ? PHE A 160 ? GLY A 157 PHE A 158 
C 1 GLY B 6   ? PHE B 7   ? GLY B 4   PHE B 5   
C 2 MET B 33  ? ALA B 34  ? MET B 31  ALA B 32  
D 1 VAL B 67  ? PHE B 69  ? VAL B 65  PHE B 67  
D 2 ILE B 93  ? VAL B 95  ? ILE B 91  VAL B 93  
D 3 VAL B 119 ? ILE B 120 ? VAL B 117 ILE B 118 
E 1 CYS B 122 ? MET B 123 ? CYS B 120 MET B 121 
E 2 VAL B 136 ? TYR B 137 ? VAL B 134 TYR B 135 
F 1 VAL C 5   ? PHE C 7   ? VAL C 3   PHE C 5   
F 2 ILE C 32  ? ALA C 34  ? ILE C 30  ALA C 32  
G 1 CYS C 122 ? THR C 124 ? CYS C 120 THR C 122 
G 2 THR C 135 ? TYR C 137 ? THR C 133 TYR C 135 
G 3 CYS C 161 ? GLU C 163 ? CYS C 159 GLU C 161 
H 1 LYS D 53  ? THR D 55  ? LYS D 51  THR D 53  
H 2 ILE D 32  ? SER D 35  ? ILE D 30  SER D 33  
H 3 VAL D 5   ? PHE D 7   ? VAL D 3   PHE D 5   
H 4 VAL D 67  ? LEU D 70  ? VAL D 65  LEU D 68  
H 5 ILE D 93  ? SER D 96  ? ILE D 91  SER D 94  
H 6 VAL D 119 ? MET D 123 ? VAL D 117 MET D 121 
H 7 GLY D 133 ? THR D 139 ? GLY D 131 THR D 137 
H 8 GLY D 159 ? GLU D 163 ? GLY D 157 GLU D 161 
I 1 LYS E 53  ? THR E 55  ? LYS E 51  THR E 53  
I 2 ILE E 32  ? SER E 35  ? ILE E 30  SER E 33  
I 3 VAL E 5   ? ILE E 8   ? VAL E 3   ILE E 6   
I 4 VAL E 67  ? LEU E 70  ? VAL E 65  LEU E 68  
I 5 ILE E 93  ? SER E 96  ? ILE E 91  SER E 94  
I 6 ARG E 118 ? MET E 123 ? ARG E 116 MET E 121 
I 7 ALA E 134 ? THR E 139 ? ALA E 132 THR E 137 
I 8 PHE E 160 ? GLU E 163 ? PHE E 158 GLU E 161 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O LYS A 53  ? O LYS A 51  N ILE A 32  ? N ILE A 30  
A 2 3 O MET A 33  ? O MET A 31  N PHE A 7   ? N PHE A 5   
A 3 4 N GLY A 6   ? N GLY A 4   O PHE A 69  ? O PHE A 67  
A 4 5 N LEU A 68  ? N LEU A 66  O VAL A 95  ? O VAL A 93  
A 5 6 N SER A 96  ? N SER A 94  O CYS A 122 ? O CYS A 120 
A 6 7 N ARG A 121 ? N ARG A 119 O ALA A 138 ? O ALA A 136 
B 1 2 N GLY A 133 ? N GLY A 131 O PHE A 160 ? O PHE A 158 
C 1 2 N PHE B 7   ? N PHE B 5   O MET B 33  ? O MET B 31  
D 1 2 N LEU B 68  ? N LEU B 66  O ILE B 93  ? O ILE B 91  
D 2 3 N VAL B 94  ? N VAL B 92  O ILE B 120 ? O ILE B 118 
E 1 2 N MET B 123 ? N MET B 121 O VAL B 136 ? O VAL B 134 
F 1 2 N PHE C 7   ? N PHE C 5   O MET C 33  ? O MET C 31  
G 1 2 N MET C 123 ? N MET C 121 O VAL C 136 ? O VAL C 134 
G 2 3 N TYR C 137 ? N TYR C 135 O THR C 162 ? O THR C 160 
H 1 2 O THR D 55  ? O THR D 53  N ALA D 34  ? N ALA D 32  
H 2 3 O MET D 33  ? O MET D 31  N PHE D 7   ? N PHE D 5   
H 3 4 N GLY D 6   ? N GLY D 4   O PHE D 69  ? O PHE D 67  
H 4 5 N LEU D 68  ? N LEU D 66  O ILE D 93  ? O ILE D 91  
H 5 6 N VAL D 94  ? N VAL D 92  O ILE D 120 ? O ILE D 118 
H 6 7 N ARG D 121 ? N ARG D 119 O ALA D 138 ? O ALA D 136 
H 7 8 N THR D 135 ? N THR D 133 O THR D 162 ? O THR D 160 
I 1 2 O LYS E 53  ? O LYS E 51  N ILE E 32  ? N ILE E 30  
I 2 3 O MET E 33  ? O MET E 31  N PHE E 7   ? N PHE E 5   
I 3 4 N GLY E 6   ? N GLY E 4   O PHE E 69  ? O PHE E 67  
I 4 5 N LEU E 68  ? N LEU E 66  O VAL E 95  ? O VAL E 93  
I 5 6 N VAL E 94  ? N VAL E 92  O ILE E 120 ? O ILE E 118 
I 6 7 N ARG E 121 ? N ARG E 119 O ALA E 138 ? O ALA E 136 
I 7 8 N THR E 135 ? N THR E 133 O PHE E 160 ? O PHE E 158 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE NAP A 1300' 
AC2 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE GLU A 1301' 
AC3 Software ? ? ? ? 22 'BINDING SITE FOR RESIDUE NAP B 2300' 
AC4 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE GLU B 2301' 
AC5 Software ? ? ? ? 16 'BINDING SITE FOR RESIDUE NAP C 3300' 
AC6 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE GLU C 3301' 
AC7 Software ? ? ? ? 17 'BINDING SITE FOR RESIDUE NAP D 4300' 
AC8 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE GLU D 4301' 
AC9 Software ? ? ? ? 16 'BINDING SITE FOR RESIDUE NAP E 5300' 
BC1 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE GLU E 5301' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 14 ARG A 131 ? ARG A 129  . ? 1_555 ? 
2  AC1 14 GLU A 132 ? GLU A 130  . ? 1_555 ? 
3  AC1 14 SER A 156 ? SER A 154  . ? 1_555 ? 
4  AC1 14 SER A 157 ? SER A 155  . ? 1_555 ? 
5  AC1 14 GLY A 159 ? GLY A 157  . ? 1_555 ? 
6  AC1 14 PHE A 160 ? PHE A 158  . ? 1_555 ? 
7  AC1 14 LEU A 219 ? LEU A 217  . ? 1_555 ? 
8  AC1 14 LEU A 220 ? LEU A 218  . ? 1_555 ? 
9  AC1 14 HIS A 221 ? HIS A 219  . ? 1_555 ? 
10 AC1 14 SER A 222 ? SER A 220  . ? 1_555 ? 
11 AC1 14 GLU G .   ? GLU A 1301 . ? 1_555 ? 
12 AC1 14 LEU C 203 ? LEU C 201  . ? 2_555 ? 
13 AC1 14 ARG C 206 ? ARG C 204  . ? 2_555 ? 
14 AC1 14 GLN C 210 ? GLN C 208  . ? 2_555 ? 
15 AC2 1  NAP F .   ? NAP A 1300 . ? 1_555 ? 
16 AC3 22 ARG B 131 ? ARG B 129  . ? 1_555 ? 
17 AC3 22 GLU B 132 ? GLU B 130  . ? 1_555 ? 
18 AC3 22 SER B 156 ? SER B 154  . ? 1_555 ? 
19 AC3 22 SER B 157 ? SER B 155  . ? 1_555 ? 
20 AC3 22 VAL B 158 ? VAL B 156  . ? 1_555 ? 
21 AC3 22 GLY B 159 ? GLY B 157  . ? 1_555 ? 
22 AC3 22 PHE B 160 ? PHE B 158  . ? 1_555 ? 
23 AC3 22 ARG B 202 ? ARG B 200  . ? 2_555 ? 
24 AC3 22 LEU B 203 ? LEU B 201  . ? 2_555 ? 
25 AC3 22 ARG B 206 ? ARG B 204  . ? 2_555 ? 
26 AC3 22 GLN B 210 ? GLN B 208  . ? 2_555 ? 
27 AC3 22 LEU B 219 ? LEU B 217  . ? 1_555 ? 
28 AC3 22 LEU B 220 ? LEU B 218  . ? 1_555 ? 
29 AC3 22 HIS B 221 ? HIS B 219  . ? 1_555 ? 
30 AC3 22 GLU B 223 ? GLU B 221  . ? 1_555 ? 
31 AC3 22 GLU I .   ? GLU B 2301 . ? 1_555 ? 
32 AC3 22 HOH Q .   ? HOH B 2319 . ? 1_555 ? 
33 AC3 22 HOH Q .   ? HOH B 2338 . ? 1_555 ? 
34 AC3 22 HOH Q .   ? HOH B 2345 . ? 1_555 ? 
35 AC3 22 HOH Q .   ? HOH B 2362 . ? 1_555 ? 
36 AC3 22 HOH Q .   ? HOH B 2364 . ? 1_555 ? 
37 AC3 22 HOH Q .   ? HOH B 2395 . ? 1_555 ? 
38 AC4 2  ARG B 131 ? ARG B 129  . ? 1_555 ? 
39 AC4 2  NAP H .   ? NAP B 2300 . ? 1_555 ? 
40 AC5 16 ARG A 202 ? ARG A 200  . ? 2_555 ? 
41 AC5 16 LEU A 203 ? LEU A 201  . ? 2_555 ? 
42 AC5 16 ARG A 206 ? ARG A 204  . ? 2_555 ? 
43 AC5 16 GLN A 210 ? GLN A 208  . ? 2_555 ? 
44 AC5 16 ARG C 131 ? ARG C 129  . ? 1_555 ? 
45 AC5 16 GLU C 132 ? GLU C 130  . ? 1_555 ? 
46 AC5 16 SER C 156 ? SER C 154  . ? 1_555 ? 
47 AC5 16 SER C 157 ? SER C 155  . ? 1_555 ? 
48 AC5 16 VAL C 158 ? VAL C 156  . ? 1_555 ? 
49 AC5 16 GLY C 159 ? GLY C 157  . ? 1_555 ? 
50 AC5 16 PHE C 160 ? PHE C 158  . ? 1_555 ? 
51 AC5 16 LEU C 220 ? LEU C 218  . ? 1_555 ? 
52 AC5 16 SER C 222 ? SER C 220  . ? 1_555 ? 
53 AC5 16 GLU K .   ? GLU C 3301 . ? 1_555 ? 
54 AC5 16 HOH R .   ? HOH C 3320 . ? 1_555 ? 
55 AC5 16 HOH R .   ? HOH C 3394 . ? 1_555 ? 
56 AC6 1  NAP J .   ? NAP C 3300 . ? 1_555 ? 
57 AC7 17 GLU D 132 ? GLU D 130  . ? 1_555 ? 
58 AC7 17 SER D 156 ? SER D 154  . ? 1_555 ? 
59 AC7 17 SER D 157 ? SER D 155  . ? 1_555 ? 
60 AC7 17 GLY D 159 ? GLY D 157  . ? 1_555 ? 
61 AC7 17 PHE D 160 ? PHE D 158  . ? 1_555 ? 
62 AC7 17 LEU D 219 ? LEU D 217  . ? 1_555 ? 
63 AC7 17 LEU D 220 ? LEU D 218  . ? 1_555 ? 
64 AC7 17 HIS D 221 ? HIS D 219  . ? 1_555 ? 
65 AC7 17 SER D 222 ? SER D 220  . ? 1_555 ? 
66 AC7 17 GLU D 223 ? GLU D 221  . ? 1_555 ? 
67 AC7 17 GLU M .   ? GLU D 4301 . ? 1_555 ? 
68 AC7 17 HOH S .   ? HOH D 4315 . ? 1_555 ? 
69 AC7 17 ARG E 202 ? ARG E 200  . ? 2_555 ? 
70 AC7 17 LEU E 203 ? LEU E 201  . ? 2_555 ? 
71 AC7 17 ARG E 206 ? ARG E 204  . ? 2_555 ? 
72 AC7 17 GLN E 210 ? GLN E 208  . ? 2_555 ? 
73 AC7 17 HOH T .   ? HOH E 5318 . ? 2_555 ? 
74 AC8 1  NAP L .   ? NAP D 4300 . ? 1_555 ? 
75 AC9 16 ARG D 202 ? ARG D 200  . ? 2_555 ? 
76 AC9 16 LEU D 203 ? LEU D 201  . ? 2_555 ? 
77 AC9 16 ARG D 206 ? ARG D 204  . ? 2_555 ? 
78 AC9 16 GLN D 210 ? GLN D 208  . ? 2_555 ? 
79 AC9 16 ARG E 131 ? ARG E 129  . ? 1_555 ? 
80 AC9 16 GLU E 132 ? GLU E 130  . ? 1_555 ? 
81 AC9 16 SER E 156 ? SER E 154  . ? 1_555 ? 
82 AC9 16 GLY E 159 ? GLY E 157  . ? 1_555 ? 
83 AC9 16 PHE E 160 ? PHE E 158  . ? 1_555 ? 
84 AC9 16 LEU E 219 ? LEU E 217  . ? 1_555 ? 
85 AC9 16 LEU E 220 ? LEU E 218  . ? 1_555 ? 
86 AC9 16 HIS E 221 ? HIS E 219  . ? 1_555 ? 
87 AC9 16 GLU E 223 ? GLU E 221  . ? 1_555 ? 
88 AC9 16 GLU O .   ? GLU E 5301 . ? 1_555 ? 
89 AC9 16 HOH T .   ? HOH E 5448 . ? 1_555 ? 
90 AC9 16 HOH T .   ? HOH E 5451 . ? 1_555 ? 
91 BC1 1  NAP N .   ? NAP E 5300 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2GRA 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2GRA 
_atom_sites.fract_transf_matrix[1][1]   0.004811 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.003003 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008097 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.009756 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N N   . ARG A 1 1   ? 42.737  84.996  0.262   1.00 70.59  ? -1   ARG A N   1 
ATOM   2     C CA  . ARG A 1 1   ? 43.459  85.476  -0.957  1.00 72.49  ? -1   ARG A CA  1 
ATOM   3     C C   . ARG A 1 1   ? 44.848  84.851  -1.053  1.00 70.95  ? -1   ARG A C   1 
ATOM   4     O O   . ARG A 1 1   ? 45.349  84.578  -2.145  1.00 70.04  ? -1   ARG A O   1 
ATOM   5     C CB  . ARG A 1 1   ? 43.563  86.995  -0.926  1.00 124.13 ? -1   ARG A CB  1 
ATOM   6     C CG  . ARG A 1 1   ? 42.209  87.651  -0.887  1.00 130.88 ? -1   ARG A CG  1 
ATOM   7     C CD  . ARG A 1 1   ? 42.309  89.128  -0.632  1.00 137.54 ? -1   ARG A CD  1 
ATOM   8     N NE  . ARG A 1 1   ? 40.983  89.694  -0.427  1.00 144.74 ? -1   ARG A NE  1 
ATOM   9     C CZ  . ARG A 1 1   ? 40.724  90.995  -0.378  1.00 148.08 ? -1   ARG A CZ  1 
ATOM   10    N NH1 . ARG A 1 1   ? 41.706  91.877  -0.522  1.00 148.88 ? -1   ARG A NH1 1 
ATOM   11    N NH2 . ARG A 1 1   ? 39.481  91.415  -0.187  1.00 150.48 ? -1   ARG A NH2 1 
ATOM   12    N N   . GLY A 1 2   ? 45.471  84.647  0.101   1.00 84.76  ? 0    GLY A N   1 
ATOM   13    C CA  . GLY A 1 2   ? 46.771  84.010  0.145   1.00 81.04  ? 0    GLY A CA  1 
ATOM   14    C C   . GLY A 1 2   ? 46.473  82.644  0.729   1.00 79.16  ? 0    GLY A C   1 
ATOM   15    O O   . GLY A 1 2   ? 47.368  81.844  1.012   1.00 77.87  ? 0    GLY A O   1 
ATOM   16    N N   . MET A 1 3   ? 45.175  82.392  0.890   1.00 86.92  ? 1    MET A N   1 
ATOM   17    C CA  . MET A 1 3   ? 44.646  81.159  1.463   1.00 85.11  ? 1    MET A CA  1 
ATOM   18    C C   . MET A 1 3   ? 44.776  79.897  0.607   1.00 83.27  ? 1    MET A C   1 
ATOM   19    O O   . MET A 1 3   ? 44.464  79.902  -0.586  1.00 82.14  ? 1    MET A O   1 
ATOM   20    C CB  . MET A 1 3   ? 43.177  81.361  1.812   1.00 77.69  ? 1    MET A CB  1 
ATOM   21    C CG  . MET A 1 3   ? 42.533  80.132  2.409   1.00 81.45  ? 1    MET A CG  1 
ATOM   22    S SD  . MET A 1 3   ? 40.741  80.192  2.318   1.00 84.63  ? 1    MET A SD  1 
ATOM   23    C CE  . MET A 1 3   ? 40.498  79.506  0.678   1.00 85.30  ? 1    MET A CE  1 
ATOM   24    N N   . SER A 1 4   ? 45.216  78.814  1.248   1.00 65.48  ? 2    SER A N   1 
ATOM   25    C CA  . SER A 1 4   ? 45.399  77.517  0.599   1.00 62.20  ? 2    SER A CA  1 
ATOM   26    C C   . SER A 1 4   ? 44.427  76.533  1.235   1.00 61.60  ? 2    SER A C   1 
ATOM   27    O O   . SER A 1 4   ? 44.068  76.692  2.402   1.00 61.38  ? 2    SER A O   1 
ATOM   28    C CB  . SER A 1 4   ? 46.824  77.025  0.822   1.00 88.81  ? 2    SER A CB  1 
ATOM   29    O OG  . SER A 1 4   ? 47.744  78.099  0.752   1.00 91.14  ? 2    SER A OG  1 
ATOM   30    N N   . VAL A 1 5   ? 44.006  75.515  0.485   1.00 66.44  ? 3    VAL A N   1 
ATOM   31    C CA  . VAL A 1 5   ? 43.067  74.534  1.027   1.00 65.09  ? 3    VAL A CA  1 
ATOM   32    C C   . VAL A 1 5   ? 43.443  73.080  0.782   1.00 64.64  ? 3    VAL A C   1 
ATOM   33    O O   . VAL A 1 5   ? 44.029  72.727  -0.247  1.00 63.41  ? 3    VAL A O   1 
ATOM   34    C CB  . VAL A 1 5   ? 41.649  74.736  0.473   1.00 59.18  ? 3    VAL A CB  1 
ATOM   35    C CG1 . VAL A 1 5   ? 40.667  73.914  1.291   1.00 61.13  ? 3    VAL A CG1 1 
ATOM   36    C CG2 . VAL A 1 5   ? 41.274  76.203  0.507   1.00 59.27  ? 3    VAL A CG2 1 
ATOM   37    N N   . GLY A 1 6   ? 43.078  72.238  1.741   1.00 64.56  ? 4    GLY A N   1 
ATOM   38    C CA  . GLY A 1 6   ? 43.380  70.829  1.633   1.00 67.09  ? 4    GLY A CA  1 
ATOM   39    C C   . GLY A 1 6   ? 42.273  69.917  2.124   1.00 69.39  ? 4    GLY A C   1 
ATOM   40    O O   . GLY A 1 6   ? 41.440  70.310  2.950   1.00 69.17  ? 4    GLY A O   1 
ATOM   41    N N   . PHE A 1 7   ? 42.271  68.691  1.600   1.00 63.26  ? 5    PHE A N   1 
ATOM   42    C CA  . PHE A 1 7   ? 41.288  67.672  1.958   1.00 62.56  ? 5    PHE A CA  1 
ATOM   43    C C   . PHE A 1 7   ? 42.051  66.463  2.446   1.00 62.12  ? 5    PHE A C   1 
ATOM   44    O O   . PHE A 1 7   ? 42.738  65.810  1.658   1.00 59.60  ? 5    PHE A O   1 
ATOM   45    C CB  . PHE A 1 7   ? 40.463  67.234  0.742   1.00 69.45  ? 5    PHE A CB  1 
ATOM   46    C CG  . PHE A 1 7   ? 39.739  68.354  0.049   1.00 70.96  ? 5    PHE A CG  1 
ATOM   47    C CD1 . PHE A 1 7   ? 40.410  69.203  -0.827  1.00 71.49  ? 5    PHE A CD1 1 
ATOM   48    C CD2 . PHE A 1 7   ? 38.379  68.554  0.264   1.00 71.17  ? 5    PHE A CD2 1 
ATOM   49    C CE1 . PHE A 1 7   ? 39.735  70.233  -1.479  1.00 72.00  ? 5    PHE A CE1 1 
ATOM   50    C CE2 . PHE A 1 7   ? 37.697  69.581  -0.383  1.00 71.52  ? 5    PHE A CE2 1 
ATOM   51    C CZ  . PHE A 1 7   ? 38.376  70.420  -1.256  1.00 72.30  ? 5    PHE A CZ  1 
ATOM   52    N N   . ILE A 1 8   ? 41.938  66.160  3.734   1.00 85.75  ? 6    ILE A N   1 
ATOM   53    C CA  . ILE A 1 8   ? 42.629  65.001  4.283   1.00 88.45  ? 6    ILE A CA  1 
ATOM   54    C C   . ILE A 1 8   ? 41.983  63.759  3.722   1.00 90.06  ? 6    ILE A C   1 
ATOM   55    O O   . ILE A 1 8   ? 42.574  62.676  3.701   1.00 90.32  ? 6    ILE A O   1 
ATOM   56    C CB  . ILE A 1 8   ? 42.553  64.969  5.807   1.00 79.96  ? 6    ILE A CB  1 
ATOM   57    C CG1 . ILE A 1 8   ? 43.556  65.975  6.369   1.00 79.77  ? 6    ILE A CG1 1 
ATOM   58    C CG2 . ILE A 1 8   ? 42.840  63.561  6.324   1.00 78.00  ? 6    ILE A CG2 1 
ATOM   59    C CD1 . ILE A 1 8   ? 44.976  65.750  5.874   1.00 78.85  ? 6    ILE A CD1 1 
ATOM   60    N N   . GLY A 1 9   ? 40.750  63.926  3.270   1.00 76.25  ? 7    GLY A N   1 
ATOM   61    C CA  . GLY A 1 9   ? 40.055  62.811  2.677   1.00 78.22  ? 7    GLY A CA  1 
ATOM   62    C C   . GLY A 1 9   ? 40.431  62.723  1.210   1.00 79.20  ? 7    GLY A C   1 
ATOM   63    O O   . GLY A 1 9   ? 41.611  62.673  0.850   1.00 78.08  ? 7    GLY A O   1 
ATOM   64    N N   . ALA A 1 10  ? 39.399  62.719  0.374   1.00 125.10 ? 8    ALA A N   1 
ATOM   65    C CA  . ALA A 1 10  ? 39.501  62.633  -1.077  1.00 125.07 ? 8    ALA A CA  1 
ATOM   66    C C   . ALA A 1 10  ? 38.195  61.970  -1.497  1.00 124.74 ? 8    ALA A C   1 
ATOM   67    O O   . ALA A 1 10  ? 37.204  62.046  -0.772  1.00 124.35 ? 8    ALA A O   1 
ATOM   68    C CB  . ALA A 1 10  ? 40.698  61.778  -1.498  1.00 53.90  ? 8    ALA A CB  1 
ATOM   69    N N   . GLY A 1 11  ? 38.187  61.312  -2.648  1.00 79.10  ? 9    GLY A N   1 
ATOM   70    C CA  . GLY A 1 11  ? 36.964  60.672  -3.089  1.00 75.37  ? 9    GLY A CA  1 
ATOM   71    C C   . GLY A 1 11  ? 36.106  61.636  -3.885  1.00 72.23  ? 9    GLY A C   1 
ATOM   72    O O   . GLY A 1 11  ? 36.613  62.525  -4.570  1.00 70.46  ? 9    GLY A O   1 
ATOM   73    N N   . GLN A 1 12  ? 34.795  61.468  -3.788  1.00 74.47  ? 10   GLN A N   1 
ATOM   74    C CA  . GLN A 1 12  ? 33.880  62.324  -4.522  1.00 71.37  ? 10   GLN A CA  1 
ATOM   75    C C   . GLN A 1 12  ? 33.875  63.719  -3.934  1.00 68.10  ? 10   GLN A C   1 
ATOM   76    O O   . GLN A 1 12  ? 34.533  64.621  -4.444  1.00 68.46  ? 10   GLN A O   1 
ATOM   77    C CB  . GLN A 1 12  ? 32.462  61.751  -4.478  1.00 89.33  ? 10   GLN A CB  1 
ATOM   78    C CG  . GLN A 1 12  ? 32.364  60.293  -4.902  1.00 91.95  ? 10   GLN A CG  1 
ATOM   79    C CD  . GLN A 1 12  ? 32.912  60.048  -6.297  1.00 93.81  ? 10   GLN A CD  1 
ATOM   80    O OE1 . GLN A 1 12  ? 32.535  60.731  -7.252  1.00 94.75  ? 10   GLN A OE1 1 
ATOM   81    N NE2 . GLN A 1 12  ? 33.804  59.065  -6.423  1.00 93.82  ? 10   GLN A NE2 1 
ATOM   82    N N   . LEU A 1 13  ? 33.122  63.870  -2.849  1.00 52.80  ? 11   LEU A N   1 
ATOM   83    C CA  . LEU A 1 13  ? 32.969  65.135  -2.148  1.00 48.58  ? 11   LEU A CA  1 
ATOM   84    C C   . LEU A 1 13  ? 34.226  66.000  -2.224  1.00 46.05  ? 11   LEU A C   1 
ATOM   85    O O   . LEU A 1 13  ? 34.137  67.215  -2.415  1.00 45.01  ? 11   LEU A O   1 
ATOM   86    C CB  . LEU A 1 13  ? 32.583  64.859  -0.695  1.00 84.51  ? 11   LEU A CB  1 
ATOM   87    C CG  . LEU A 1 13  ? 31.992  66.032  0.088   1.00 87.76  ? 11   LEU A CG  1 
ATOM   88    C CD1 . LEU A 1 13  ? 31.189  65.526  1.288   1.00 88.66  ? 11   LEU A CD1 1 
ATOM   89    C CD2 . LEU A 1 13  ? 33.114  66.950  0.527   1.00 88.19  ? 11   LEU A CD2 1 
ATOM   90    N N   . ALA A 1 14  ? 35.393  65.376  -2.076  1.00 38.22  ? 12   ALA A N   1 
ATOM   91    C CA  . ALA A 1 14  ? 36.649  66.111  -2.158  1.00 36.08  ? 12   ALA A CA  1 
ATOM   92    C C   . ALA A 1 14  ? 36.699  66.695  -3.551  1.00 36.66  ? 12   ALA A C   1 
ATOM   93    O O   . ALA A 1 14  ? 36.628  67.909  -3.742  1.00 36.19  ? 12   ALA A O   1 
ATOM   94    C CB  . ALA A 1 14  ? 37.809  65.180  -1.959  1.00 34.84  ? 12   ALA A CB  1 
ATOM   95    N N   . PHE A 1 15  ? 36.826  65.799  -4.521  1.00 53.19  ? 13   PHE A N   1 
ATOM   96    C CA  . PHE A 1 15  ? 36.853  66.159  -5.927  1.00 53.69  ? 13   PHE A CA  1 
ATOM   97    C C   . PHE A 1 15  ? 35.702  67.109  -6.227  1.00 51.33  ? 13   PHE A C   1 
ATOM   98    O O   . PHE A 1 15  ? 35.892  68.133  -6.878  1.00 49.05  ? 13   PHE A O   1 
ATOM   99    C CB  . PHE A 1 15  ? 36.709  64.900  -6.773  1.00 62.81  ? 13   PHE A CB  1 
ATOM   100   C CG  . PHE A 1 15  ? 36.193  65.158  -8.148  1.00 68.78  ? 13   PHE A CG  1 
ATOM   101   C CD1 . PHE A 1 15  ? 36.971  65.832  -9.080  1.00 70.99  ? 13   PHE A CD1 1 
ATOM   102   C CD2 . PHE A 1 15  ? 34.914  64.744  -8.509  1.00 71.28  ? 13   PHE A CD2 1 
ATOM   103   C CE1 . PHE A 1 15  ? 36.485  66.092  -10.354 1.00 73.37  ? 13   PHE A CE1 1 
ATOM   104   C CE2 . PHE A 1 15  ? 34.417  64.999  -9.782  1.00 73.30  ? 13   PHE A CE2 1 
ATOM   105   C CZ  . PHE A 1 15  ? 35.205  65.675  -10.707 1.00 73.95  ? 13   PHE A CZ  1 
ATOM   106   N N   . ALA A 1 16  ? 34.508  66.754  -5.753  1.00 52.79  ? 14   ALA A N   1 
ATOM   107   C CA  . ALA A 1 16  ? 33.321  67.578  -5.958  1.00 51.86  ? 14   ALA A CA  1 
ATOM   108   C C   . ALA A 1 16  ? 33.633  69.023  -5.573  1.00 51.50  ? 14   ALA A C   1 
ATOM   109   O O   . ALA A 1 16  ? 33.562  69.919  -6.411  1.00 51.62  ? 14   ALA A O   1 
ATOM   110   C CB  . ALA A 1 16  ? 32.160  67.045  -5.132  1.00 33.44  ? 14   ALA A CB  1 
ATOM   111   N N   . LEU A 1 17  ? 33.990  69.243  -4.308  1.00 44.82  ? 15   LEU A N   1 
ATOM   112   C CA  . LEU A 1 17  ? 34.338  70.581  -3.829  1.00 42.11  ? 15   LEU A CA  1 
ATOM   113   C C   . LEU A 1 17  ? 35.497  71.116  -4.645  1.00 42.23  ? 15   LEU A C   1 
ATOM   114   O O   . LEU A 1 17  ? 35.413  72.189  -5.239  1.00 43.00  ? 15   LEU A O   1 
ATOM   115   C CB  . LEU A 1 17  ? 34.749  70.536  -2.363  1.00 34.71  ? 15   LEU A CB  1 
ATOM   116   C CG  . LEU A 1 17  ? 33.615  70.289  -1.376  1.00 33.77  ? 15   LEU A CG  1 
ATOM   117   C CD1 . LEU A 1 17  ? 34.194  70.111  0.017   1.00 33.11  ? 15   LEU A CD1 1 
ATOM   118   C CD2 . LEU A 1 17  ? 32.637  71.455  -1.420  1.00 31.25  ? 15   LEU A CD2 1 
ATOM   119   N N   . ALA A 1 18  ? 36.587  70.359  -4.649  1.00 35.11  ? 16   ALA A N   1 
ATOM   120   C CA  . ALA A 1 18  ? 37.773  70.724  -5.402  1.00 39.29  ? 16   ALA A CA  1 
ATOM   121   C C   . ALA A 1 18  ? 37.279  71.397  -6.669  1.00 42.80  ? 16   ALA A C   1 
ATOM   122   O O   . ALA A 1 18  ? 37.562  72.564  -6.932  1.00 45.37  ? 16   ALA A O   1 
ATOM   123   C CB  . ALA A 1 18  ? 38.567  69.464  -5.752  1.00 29.61  ? 16   ALA A CB  1 
ATOM   124   N N   . LYS A 1 19  ? 36.493  70.634  -7.419  1.00 61.84  ? 17   LYS A N   1 
ATOM   125   C CA  . LYS A 1 19  ? 35.903  71.047  -8.686  1.00 62.84  ? 17   LYS A CA  1 
ATOM   126   C C   . LYS A 1 19  ? 35.128  72.371  -8.655  1.00 60.72  ? 17   LYS A C   1 
ATOM   127   O O   . LYS A 1 19  ? 35.444  73.296  -9.401  1.00 59.36  ? 17   LYS A O   1 
ATOM   128   C CB  . LYS A 1 19  ? 34.985  69.929  -9.184  1.00 86.20  ? 17   LYS A CB  1 
ATOM   129   C CG  . LYS A 1 19  ? 34.630  70.023  -10.643 1.00 90.64  ? 17   LYS A CG  1 
ATOM   130   C CD  . LYS A 1 19  ? 35.858  69.823  -11.504 1.00 94.74  ? 17   LYS A CD  1 
ATOM   131   C CE  . LYS A 1 19  ? 35.504  69.868  -12.981 1.00 99.01  ? 17   LYS A CE  1 
ATOM   132   N NZ  . LYS A 1 19  ? 36.681  69.613  -13.864 1.00 100.20 ? 17   LYS A NZ  1 
ATOM   133   N N   . GLY A 1 20  ? 34.112  72.456  -7.803  1.00 57.57  ? 18   GLY A N   1 
ATOM   134   C CA  . GLY A 1 20  ? 33.322  73.672  -7.729  1.00 59.46  ? 18   GLY A CA  1 
ATOM   135   C C   . GLY A 1 20  ? 34.093  74.844  -7.163  1.00 61.12  ? 18   GLY A C   1 
ATOM   136   O O   . GLY A 1 20  ? 33.706  76.003  -7.332  1.00 59.85  ? 18   GLY A O   1 
ATOM   137   N N   . PHE A 1 21  ? 35.188  74.545  -6.475  1.00 64.03  ? 19   PHE A N   1 
ATOM   138   C CA  . PHE A 1 21  ? 36.007  75.590  -5.899  1.00 62.63  ? 19   PHE A CA  1 
ATOM   139   C C   . PHE A 1 21  ? 36.793  76.263  -7.013  1.00 64.91  ? 19   PHE A C   1 
ATOM   140   O O   . PHE A 1 21  ? 36.705  77.474  -7.198  1.00 65.19  ? 19   PHE A O   1 
ATOM   141   C CB  . PHE A 1 21  ? 36.932  74.995  -4.839  1.00 50.25  ? 19   PHE A CB  1 
ATOM   142   C CG  . PHE A 1 21  ? 36.295  74.880  -3.471  1.00 47.77  ? 19   PHE A CG  1 
ATOM   143   C CD1 . PHE A 1 21  ? 36.839  74.040  -2.503  1.00 45.53  ? 19   PHE A CD1 1 
ATOM   144   C CD2 . PHE A 1 21  ? 35.177  75.645  -3.133  1.00 45.94  ? 19   PHE A CD2 1 
ATOM   145   C CE1 . PHE A 1 21  ? 36.283  73.964  -1.216  1.00 42.80  ? 19   PHE A CE1 1 
ATOM   146   C CE2 . PHE A 1 21  ? 34.614  75.576  -1.845  1.00 42.80  ? 19   PHE A CE2 1 
ATOM   147   C CZ  . PHE A 1 21  ? 35.171  74.735  -0.890  1.00 41.24  ? 19   PHE A CZ  1 
ATOM   148   N N   . THR A 1 22  ? 37.550  75.477  -7.767  1.00 54.79  ? 20   THR A N   1 
ATOM   149   C CA  . THR A 1 22  ? 38.320  76.025  -8.877  1.00 60.41  ? 20   THR A CA  1 
ATOM   150   C C   . THR A 1 22  ? 37.314  76.632  -9.836  1.00 63.98  ? 20   THR A C   1 
ATOM   151   O O   . THR A 1 22  ? 37.551  77.680  -10.443 1.00 63.09  ? 20   THR A O   1 
ATOM   152   C CB  . THR A 1 22  ? 39.063  74.930  -9.635  1.00 77.34  ? 20   THR A CB  1 
ATOM   153   O OG1 . THR A 1 22  ? 38.113  74.011  -10.189 1.00 78.94  ? 20   THR A OG1 1 
ATOM   154   C CG2 . THR A 1 22  ? 39.991  74.185  -8.707  1.00 80.83  ? 20   THR A CG2 1 
ATOM   155   N N   . ALA A 1 23  ? 36.191  75.931  -9.963  1.00 78.36  ? 21   ALA A N   1 
ATOM   156   C CA  . ALA A 1 23  ? 35.094  76.328  -10.826 1.00 79.64  ? 21   ALA A CA  1 
ATOM   157   C C   . ALA A 1 23  ? 34.641  77.716  -10.436 1.00 81.08  ? 21   ALA A C   1 
ATOM   158   O O   . ALA A 1 23  ? 34.463  78.583  -11.287 1.00 80.59  ? 21   ALA A O   1 
ATOM   159   C CB  . ALA A 1 23  ? 33.959  75.355  -10.671 1.00 86.81  ? 21   ALA A CB  1 
ATOM   160   N N   . ALA A 1 24  ? 34.454  77.914  -9.137  1.00 89.08  ? 22   ALA A N   1 
ATOM   161   C CA  . ALA A 1 24  ? 34.036  79.203  -8.607  1.00 91.07  ? 22   ALA A CA  1 
ATOM   162   C C   . ALA A 1 24  ? 35.128  80.221  -8.900  1.00 93.36  ? 22   ALA A C   1 
ATOM   163   O O   . ALA A 1 24  ? 34.961  81.421  -8.657  1.00 93.85  ? 22   ALA A O   1 
ATOM   164   C CB  . ALA A 1 24  ? 33.809  79.102  -7.107  1.00 106.54 ? 22   ALA A CB  1 
ATOM   165   N N   . GLY A 1 25  ? 36.246  79.726  -9.429  1.00 100.30 ? 23   GLY A N   1 
ATOM   166   C CA  . GLY A 1 25  ? 37.366  80.592  -9.741  1.00 100.95 ? 23   GLY A CA  1 
ATOM   167   C C   . GLY A 1 25  ? 37.777  81.314  -8.479  1.00 102.26 ? 23   GLY A C   1 
ATOM   168   O O   . GLY A 1 25  ? 38.312  82.420  -8.524  1.00 103.22 ? 23   GLY A O   1 
ATOM   169   N N   . VAL A 1 26  ? 37.500  80.677  -7.346  1.00 111.48 ? 24   VAL A N   1 
ATOM   170   C CA  . VAL A 1 26  ? 37.825  81.230  -6.040  1.00 112.01 ? 24   VAL A CA  1 
ATOM   171   C C   . VAL A 1 26  ? 39.230  80.806  -5.638  1.00 111.22 ? 24   VAL A C   1 
ATOM   172   O O   . VAL A 1 26  ? 39.954  81.557  -4.988  1.00 111.83 ? 24   VAL A O   1 
ATOM   173   C CB  . VAL A 1 26  ? 36.821  80.747  -4.968  1.00 130.80 ? 24   VAL A CB  1 
ATOM   174   C CG1 . VAL A 1 26  ? 37.249  81.235  -3.594  1.00 132.37 ? 24   VAL A CG1 1 
ATOM   175   C CG2 . VAL A 1 26  ? 35.425  81.263  -5.295  1.00 130.86 ? 24   VAL A CG2 1 
ATOM   176   N N   . LEU A 1 27  ? 39.613  79.597  -6.027  1.00 80.85  ? 25   LEU A N   1 
ATOM   177   C CA  . LEU A 1 27  ? 40.939  79.095  -5.711  1.00 80.50  ? 25   LEU A CA  1 
ATOM   178   C C   . LEU A 1 27  ? 41.605  78.560  -6.968  1.00 79.77  ? 25   LEU A C   1 
ATOM   179   O O   . LEU A 1 27  ? 40.961  78.412  -8.009  1.00 80.22  ? 25   LEU A O   1 
ATOM   180   C CB  . LEU A 1 27  ? 40.856  77.988  -4.653  1.00 127.71 ? 25   LEU A CB  1 
ATOM   181   C CG  . LEU A 1 27  ? 42.175  77.362  -4.174  1.00 129.70 ? 25   LEU A CG  1 
ATOM   182   C CD1 . LEU A 1 27  ? 43.136  78.454  -3.737  1.00 132.10 ? 25   LEU A CD1 1 
ATOM   183   C CD2 . LEU A 1 27  ? 41.910  76.409  -3.021  1.00 130.19 ? 25   LEU A CD2 1 
ATOM   184   N N   . ALA A 1 28  ? 42.899  78.281  -6.865  1.00 82.39  ? 26   ALA A N   1 
ATOM   185   C CA  . ALA A 1 28  ? 43.665  77.749  -7.979  1.00 81.62  ? 26   ALA A CA  1 
ATOM   186   C C   . ALA A 1 28  ? 43.747  76.244  -7.809  1.00 80.81  ? 26   ALA A C   1 
ATOM   187   O O   . ALA A 1 28  ? 43.996  75.750  -6.710  1.00 80.22  ? 26   ALA A O   1 
ATOM   188   C CB  . ALA A 1 28  ? 45.055  78.351  -7.988  1.00 93.15  ? 26   ALA A CB  1 
ATOM   189   N N   . ALA A 1 29  ? 43.528  75.520  -8.899  1.00 73.92  ? 27   ALA A N   1 
ATOM   190   C CA  . ALA A 1 29  ? 43.570  74.064  -8.864  1.00 76.24  ? 27   ALA A CA  1 
ATOM   191   C C   . ALA A 1 29  ? 44.782  73.557  -8.089  1.00 76.88  ? 27   ALA A C   1 
ATOM   192   O O   . ALA A 1 29  ? 44.652  72.741  -7.172  1.00 76.43  ? 27   ALA A O   1 
ATOM   193   C CB  . ALA A 1 29  ? 43.593  73.512  -10.284 1.00 114.35 ? 27   ALA A CB  1 
ATOM   194   N N   . HIS A 1 30  ? 45.959  74.054  -8.459  1.00 104.52 ? 28   HIS A N   1 
ATOM   195   C CA  . HIS A 1 30  ? 47.204  73.649  -7.815  1.00 104.48 ? 28   HIS A CA  1 
ATOM   196   C C   . HIS A 1 30  ? 47.317  74.201  -6.400  1.00 103.33 ? 28   HIS A C   1 
ATOM   197   O O   . HIS A 1 30  ? 48.168  73.773  -5.622  1.00 102.57 ? 28   HIS A O   1 
ATOM   198   C CB  . HIS A 1 30  ? 48.406  74.103  -8.660  1.00 92.84  ? 28   HIS A CB  1 
ATOM   199   C CG  . HIS A 1 30  ? 48.582  75.591  -8.731  1.00 92.89  ? 28   HIS A CG  1 
ATOM   200   N ND1 . HIS A 1 30  ? 47.532  76.459  -8.944  1.00 92.84  ? 28   HIS A ND1 1 
ATOM   201   C CD2 . HIS A 1 30  ? 49.692  76.360  -8.637  1.00 92.85  ? 28   HIS A CD2 1 
ATOM   202   C CE1 . HIS A 1 30  ? 47.990  77.698  -8.975  1.00 93.64  ? 28   HIS A CE1 1 
ATOM   203   N NE2 . HIS A 1 30  ? 49.297  77.666  -8.791  1.00 93.17  ? 28   HIS A NE2 1 
ATOM   204   N N   . LYS A 1 31  ? 46.445  75.145  -6.068  1.00 72.53  ? 29   LYS A N   1 
ATOM   205   C CA  . LYS A 1 31  ? 46.456  75.755  -4.750  1.00 71.48  ? 29   LYS A CA  1 
ATOM   206   C C   . LYS A 1 31  ? 45.610  74.924  -3.802  1.00 69.09  ? 29   LYS A C   1 
ATOM   207   O O   . LYS A 1 31  ? 45.169  75.395  -2.751  1.00 67.97  ? 29   LYS A O   1 
ATOM   208   C CB  . LYS A 1 31  ? 45.922  77.184  -4.837  1.00 123.82 ? 29   LYS A CB  1 
ATOM   209   C CG  . LYS A 1 31  ? 46.699  78.169  -3.984  1.00 128.12 ? 29   LYS A CG  1 
ATOM   210   C CD  . LYS A 1 31  ? 46.223  79.597  -4.187  1.00 129.97 ? 29   LYS A CD  1 
ATOM   211   C CE  . LYS A 1 31  ? 46.493  80.088  -5.597  1.00 132.54 ? 29   LYS A CE  1 
ATOM   212   N NZ  . LYS A 1 31  ? 45.864  81.417  -5.825  1.00 132.37 ? 29   LYS A NZ  1 
ATOM   213   N N   . ILE A 1 32  ? 45.403  73.672  -4.188  1.00 72.29  ? 30   ILE A N   1 
ATOM   214   C CA  . ILE A 1 32  ? 44.613  72.738  -3.403  1.00 70.32  ? 30   ILE A CA  1 
ATOM   215   C C   . ILE A 1 32  ? 45.436  71.486  -3.188  1.00 69.95  ? 30   ILE A C   1 
ATOM   216   O O   . ILE A 1 32  ? 46.297  71.161  -4.003  1.00 69.00  ? 30   ILE A O   1 
ATOM   217   C CB  . ILE A 1 32  ? 43.344  72.326  -4.159  1.00 66.73  ? 30   ILE A CB  1 
ATOM   218   C CG1 . ILE A 1 32  ? 42.602  73.570  -4.642  1.00 67.45  ? 30   ILE A CG1 1 
ATOM   219   C CG2 . ILE A 1 32  ? 42.459  71.477  -3.265  1.00 65.07  ? 30   ILE A CG2 1 
ATOM   220   C CD1 . ILE A 1 32  ? 41.418  73.264  -5.525  1.00 65.36  ? 30   ILE A CD1 1 
ATOM   221   N N   . MET A 1 33  ? 45.173  70.780  -2.096  1.00 74.20  ? 31   MET A N   1 
ATOM   222   C CA  . MET A 1 33  ? 45.891  69.544  -1.830  1.00 75.04  ? 31   MET A CA  1 
ATOM   223   C C   . MET A 1 33  ? 45.059  68.551  -1.026  1.00 75.00  ? 31   MET A C   1 
ATOM   224   O O   . MET A 1 33  ? 44.396  68.922  -0.057  1.00 73.01  ? 31   MET A O   1 
ATOM   225   C CB  . MET A 1 33  ? 47.200  69.823  -1.093  1.00 80.64  ? 31   MET A CB  1 
ATOM   226   C CG  . MET A 1 33  ? 48.006  68.559  -0.816  1.00 82.78  ? 31   MET A CG  1 
ATOM   227   S SD  . MET A 1 33  ? 49.556  68.838  0.053   1.00 81.49  ? 31   MET A SD  1 
ATOM   228   C CE  . MET A 1 33  ? 50.637  69.210  -1.329  1.00 81.12  ? 31   MET A CE  1 
ATOM   229   N N   . ALA A 1 34  ? 45.098  67.285  -1.434  1.00 82.28  ? 32   ALA A N   1 
ATOM   230   C CA  . ALA A 1 34  ? 44.357  66.240  -0.738  1.00 83.85  ? 32   ALA A CA  1 
ATOM   231   C C   . ALA A 1 34  ? 45.157  64.937  -0.693  1.00 85.26  ? 32   ALA A C   1 
ATOM   232   O O   . ALA A 1 34  ? 45.837  64.581  -1.661  1.00 83.82  ? 32   ALA A O   1 
ATOM   233   C CB  . ALA A 1 34  ? 43.012  66.014  -1.415  1.00 87.78  ? 32   ALA A CB  1 
ATOM   234   N N   . SER A 1 35  ? 45.073  64.237  0.439   1.00 96.31  ? 33   SER A N   1 
ATOM   235   C CA  . SER A 1 35  ? 45.786  62.974  0.629   1.00 98.10  ? 33   SER A CA  1 
ATOM   236   C C   . SER A 1 35  ? 45.096  61.785  -0.043  1.00 100.24 ? 33   SER A C   1 
ATOM   237   O O   . SER A 1 35  ? 43.890  61.573  0.111   1.00 99.27  ? 33   SER A O   1 
ATOM   238   C CB  . SER A 1 35  ? 45.997  62.699  2.127   1.00 76.37  ? 33   SER A CB  1 
ATOM   239   O OG  . SER A 1 35  ? 44.855  63.022  2.904   1.00 73.88  ? 33   SER A OG  1 
ATOM   240   N N   . SER A 1 36  ? 45.884  61.006  -0.780  1.00 132.71 ? 34   SER A N   1 
ATOM   241   C CA  . SER A 1 36  ? 45.371  59.860  -1.517  1.00 135.65 ? 34   SER A CA  1 
ATOM   242   C C   . SER A 1 36  ? 45.607  58.498  -0.886  1.00 138.56 ? 34   SER A C   1 
ATOM   243   O O   . SER A 1 36  ? 46.459  57.739  -1.347  1.00 140.16 ? 34   SER A O   1 
ATOM   244   C CB  . SER A 1 36  ? 45.963  59.846  -2.932  1.00 83.82  ? 34   SER A CB  1 
ATOM   245   O OG  . SER A 1 36  ? 47.368  59.635  -2.911  1.00 80.08  ? 34   SER A OG  1 
ATOM   246   N N   . PRO A 1 37  ? 44.872  58.162  0.182   1.00 87.24  ? 35   PRO A N   1 
ATOM   247   C CA  . PRO A 1 37  ? 45.178  56.828  0.691   1.00 89.44  ? 35   PRO A CA  1 
ATOM   248   C C   . PRO A 1 37  ? 44.858  55.852  -0.444  1.00 93.54  ? 35   PRO A C   1 
ATOM   249   O O   . PRO A 1 37  ? 43.733  55.826  -0.952  1.00 93.95  ? 35   PRO A O   1 
ATOM   250   C CB  . PRO A 1 37  ? 44.228  56.689  1.878   1.00 81.52  ? 35   PRO A CB  1 
ATOM   251   C CG  . PRO A 1 37  ? 44.093  58.107  2.366   1.00 80.85  ? 35   PRO A CG  1 
ATOM   252   C CD  . PRO A 1 37  ? 43.935  58.871  1.069   1.00 80.90  ? 35   PRO A CD  1 
ATOM   253   N N   . ASP A 1 38  ? 45.864  55.093  -0.870  1.00 115.48 ? 36   ASP A N   1 
ATOM   254   C CA  . ASP A 1 38  ? 45.710  54.106  -1.941  1.00 119.89 ? 36   ASP A CA  1 
ATOM   255   C C   . ASP A 1 38  ? 45.449  54.638  -3.348  1.00 120.79 ? 36   ASP A C   1 
ATOM   256   O O   . ASP A 1 38  ? 45.985  54.099  -4.319  1.00 120.61 ? 36   ASP A O   1 
ATOM   257   C CB  . ASP A 1 38  ? 44.605  53.107  -1.586  1.00 173.75 ? 36   ASP A CB  1 
ATOM   258   C CG  . ASP A 1 38  ? 45.090  52.002  -0.674  1.00 176.58 ? 36   ASP A CG  1 
ATOM   259   O OD1 . ASP A 1 38  ? 46.025  51.276  -1.076  1.00 177.67 ? 36   ASP A OD1 1 
ATOM   260   O OD2 . ASP A 1 38  ? 44.535  51.858  0.438   1.00 177.66 ? 36   ASP A OD2 1 
ATOM   261   N N   . MET A 1 39  ? 44.620  55.674  -3.457  1.00 131.73 ? 37   MET A N   1 
ATOM   262   C CA  . MET A 1 39  ? 44.269  56.277  -4.748  1.00 134.13 ? 37   MET A CA  1 
ATOM   263   C C   . MET A 1 39  ? 43.144  55.512  -5.442  1.00 133.58 ? 37   MET A C   1 
ATOM   264   O O   . MET A 1 39  ? 43.312  54.344  -5.804  1.00 134.09 ? 37   MET A O   1 
ATOM   265   C CB  . MET A 1 39  ? 45.451  56.291  -5.715  1.00 157.30 ? 37   MET A CB  1 
ATOM   266   C CG  . MET A 1 39  ? 46.791  56.661  -5.147  1.00 159.87 ? 37   MET A CG  1 
ATOM   267   S SD  . MET A 1 39  ? 48.019  56.301  -6.412  1.00 164.47 ? 37   MET A SD  1 
ATOM   268   C CE  . MET A 1 39  ? 47.995  54.500  -6.424  1.00 162.26 ? 37   MET A CE  1 
ATOM   269   N N   . ASP A 1 40  ? 42.013  56.181  -5.646  1.00 94.65  ? 38   ASP A N   1 
ATOM   270   C CA  . ASP A 1 40  ? 40.869  55.574  -6.314  1.00 91.35  ? 38   ASP A CA  1 
ATOM   271   C C   . ASP A 1 40  ? 40.822  56.119  -7.728  1.00 89.30  ? 38   ASP A C   1 
ATOM   272   O O   . ASP A 1 40  ? 40.085  57.066  -8.000  1.00 87.49  ? 38   ASP A O   1 
ATOM   273   C CB  . ASP A 1 40  ? 39.567  55.942  -5.606  1.00 128.32 ? 38   ASP A CB  1 
ATOM   274   C CG  . ASP A 1 40  ? 39.783  56.360  -4.172  1.00 129.83 ? 38   ASP A CG  1 
ATOM   275   O OD1 . ASP A 1 40  ? 40.285  55.541  -3.372  1.00 131.52 ? 38   ASP A OD1 1 
ATOM   276   O OD2 . ASP A 1 40  ? 39.450  57.517  -3.847  1.00 131.24 ? 38   ASP A OD2 1 
ATOM   277   N N   . LEU A 1 41  ? 41.626  55.525  -8.607  1.00 112.25 ? 39   LEU A N   1 
ATOM   278   C CA  . LEU A 1 41  ? 41.704  55.916  -10.012 1.00 109.85 ? 39   LEU A CA  1 
ATOM   279   C C   . LEU A 1 41  ? 40.772  57.077  -10.317 1.00 108.43 ? 39   LEU A C   1 
ATOM   280   O O   . LEU A 1 41  ? 41.199  58.226  -10.378 1.00 107.63 ? 39   LEU A O   1 
ATOM   281   C CB  . LEU A 1 41  ? 41.341  54.726  -10.904 1.00 88.44  ? 39   LEU A CB  1 
ATOM   282   C CG  . LEU A 1 41  ? 42.235  53.487  -10.815 1.00 86.79  ? 39   LEU A CG  1 
ATOM   283   C CD1 . LEU A 1 41  ? 41.593  52.331  -11.567 1.00 85.99  ? 39   LEU A CD1 1 
ATOM   284   C CD2 . LEU A 1 41  ? 43.615  53.812  -11.370 1.00 85.00  ? 39   LEU A CD2 1 
ATOM   285   N N   . ALA A 1 42  ? 39.492  56.760  -10.489 1.00 104.50 ? 40   ALA A N   1 
ATOM   286   C CA  . ALA A 1 42  ? 38.469  57.756  -10.787 1.00 101.21 ? 40   ALA A CA  1 
ATOM   287   C C   . ALA A 1 42  ? 38.716  59.047  -10.014 1.00 99.34  ? 40   ALA A C   1 
ATOM   288   O O   . ALA A 1 42  ? 39.246  60.014  -10.562 1.00 99.15  ? 40   ALA A O   1 
ATOM   289   C CB  . ALA A 1 42  ? 37.084  57.193  -10.453 1.00 113.01 ? 40   ALA A CB  1 
ATOM   290   N N   . THR A 1 43  ? 38.337  59.055  -8.740  1.00 95.98  ? 41   THR A N   1 
ATOM   291   C CA  . THR A 1 43  ? 38.524  60.233  -7.907  1.00 91.92  ? 41   THR A CA  1 
ATOM   292   C C   . THR A 1 43  ? 39.920  60.809  -8.083  1.00 89.42  ? 41   THR A C   1 
ATOM   293   O O   . THR A 1 43  ? 40.124  61.757  -8.839  1.00 87.78  ? 41   THR A O   1 
ATOM   294   C CB  . THR A 1 43  ? 38.359  59.913  -6.419  1.00 87.05  ? 41   THR A CB  1 
ATOM   295   O OG1 . THR A 1 43  ? 37.015  59.498  -6.155  1.00 86.13  ? 41   THR A OG1 1 
ATOM   296   C CG2 . THR A 1 43  ? 38.700  61.142  -5.590  1.00 87.65  ? 41   THR A CG2 1 
ATOM   297   N N   . VAL A 1 44  ? 40.875  60.214  -7.374  1.00 73.87  ? 42   VAL A N   1 
ATOM   298   C CA  . VAL A 1 44  ? 42.262  60.655  -7.401  1.00 70.21  ? 42   VAL A CA  1 
ATOM   299   C C   . VAL A 1 44  ? 42.723  61.073  -8.790  1.00 69.78  ? 42   VAL A C   1 
ATOM   300   O O   . VAL A 1 44  ? 42.983  62.252  -9.027  1.00 69.29  ? 42   VAL A O   1 
ATOM   301   C CB  . VAL A 1 44  ? 43.203  59.558  -6.853  1.00 64.76  ? 42   VAL A CB  1 
ATOM   302   C CG1 . VAL A 1 44  ? 44.621  60.089  -6.751  1.00 63.93  ? 42   VAL A CG1 1 
ATOM   303   C CG2 . VAL A 1 44  ? 42.723  59.102  -5.486  1.00 62.77  ? 42   VAL A CG2 1 
ATOM   304   N N   . SER A 1 45  ? 42.822  60.120  -9.710  1.00 76.16  ? 43   SER A N   1 
ATOM   305   C CA  . SER A 1 45  ? 43.260  60.444  -11.062 1.00 77.09  ? 43   SER A CA  1 
ATOM   306   C C   . SER A 1 45  ? 42.581  61.719  -11.544 1.00 77.43  ? 43   SER A C   1 
ATOM   307   O O   . SER A 1 45  ? 43.242  62.629  -12.042 1.00 76.17  ? 43   SER A O   1 
ATOM   308   C CB  . SER A 1 45  ? 42.945  59.299  -12.022 1.00 104.08 ? 43   SER A CB  1 
ATOM   309   O OG  . SER A 1 45  ? 43.277  59.660  -13.348 1.00 107.11 ? 43   SER A OG  1 
ATOM   310   N N   . ALA A 1 46  ? 41.261  61.780  -11.382 1.00 83.04  ? 44   ALA A N   1 
ATOM   311   C CA  . ALA A 1 46  ? 40.484  62.947  -11.792 1.00 85.42  ? 44   ALA A CA  1 
ATOM   312   C C   . ALA A 1 46  ? 41.164  64.210  -11.296 1.00 86.86  ? 44   ALA A C   1 
ATOM   313   O O   . ALA A 1 46  ? 41.551  65.081  -12.076 1.00 86.56  ? 44   ALA A O   1 
ATOM   314   C CB  . ALA A 1 46  ? 39.077  62.865  -11.218 1.00 45.43  ? 44   ALA A CB  1 
ATOM   315   N N   . LEU A 1 47  ? 41.300  64.291  -9.979  1.00 100.02 ? 45   LEU A N   1 
ATOM   316   C CA  . LEU A 1 47  ? 41.933  65.423  -9.323  1.00 101.07 ? 45   LEU A CA  1 
ATOM   317   C C   . LEU A 1 47  ? 43.309  65.646  -9.923  1.00 101.58 ? 45   LEU A C   1 
ATOM   318   O O   . LEU A 1 47  ? 43.702  66.779  -10.184 1.00 101.29 ? 45   LEU A O   1 
ATOM   319   C CB  . LEU A 1 47  ? 42.042  65.138  -7.829  1.00 95.97  ? 45   LEU A CB  1 
ATOM   320   C CG  . LEU A 1 47  ? 40.672  64.778  -7.247  1.00 96.70  ? 45   LEU A CG  1 
ATOM   321   C CD1 . LEU A 1 47  ? 40.810  64.064  -5.910  1.00 96.25  ? 45   LEU A CD1 1 
ATOM   322   C CD2 . LEU A 1 47  ? 39.847  66.053  -7.125  1.00 97.94  ? 45   LEU A CD2 1 
ATOM   323   N N   . ARG A 1 48  ? 44.042  64.561  -10.143 1.00 79.37  ? 46   ARG A N   1 
ATOM   324   C CA  . ARG A 1 48  ? 45.363  64.683  -10.730 1.00 81.43  ? 46   ARG A CA  1 
ATOM   325   C C   . ARG A 1 48  ? 45.245  65.416  -12.049 1.00 81.75  ? 46   ARG A C   1 
ATOM   326   O O   . ARG A 1 48  ? 45.820  66.488  -12.228 1.00 82.80  ? 46   ARG A O   1 
ATOM   327   C CB  . ARG A 1 48  ? 45.990  63.314  -10.963 1.00 131.36 ? 46   ARG A CB  1 
ATOM   328   C CG  . ARG A 1 48  ? 46.587  62.711  -9.717  1.00 136.71 ? 46   ARG A CG  1 
ATOM   329   C CD  . ARG A 1 48  ? 47.681  61.728  -10.072 1.00 141.08 ? 46   ARG A CD  1 
ATOM   330   N NE  . ARG A 1 48  ? 48.324  61.181  -8.884  1.00 145.36 ? 46   ARG A NE  1 
ATOM   331   C CZ  . ARG A 1 48  ? 49.400  60.402  -8.910  1.00 148.02 ? 46   ARG A CZ  1 
ATOM   332   N NH1 . ARG A 1 48  ? 49.958  60.075  -10.069 1.00 148.98 ? 46   ARG A NH1 1 
ATOM   333   N NH2 . ARG A 1 48  ? 49.916  59.947  -7.776  1.00 148.84 ? 46   ARG A NH2 1 
ATOM   334   N N   . LYS A 1 49  ? 44.490  64.841  -12.976 1.00 120.75 ? 47   LYS A N   1 
ATOM   335   C CA  . LYS A 1 49  ? 44.315  65.475  -14.269 1.00 120.60 ? 47   LYS A CA  1 
ATOM   336   C C   . LYS A 1 49  ? 43.575  66.796  -14.096 1.00 119.46 ? 47   LYS A C   1 
ATOM   337   O O   . LYS A 1 49  ? 43.394  67.545  -15.056 1.00 119.22 ? 47   LYS A O   1 
ATOM   338   C CB  . LYS A 1 49  ? 43.545  64.556  -15.219 1.00 143.81 ? 47   LYS A CB  1 
ATOM   339   C CG  . LYS A 1 49  ? 44.333  64.189  -16.472 1.00 145.98 ? 47   LYS A CG  1 
ATOM   340   C CD  . LYS A 1 49  ? 43.445  63.553  -17.533 1.00 146.94 ? 47   LYS A CD  1 
ATOM   341   C CE  . LYS A 1 49  ? 44.204  63.354  -18.838 1.00 146.93 ? 47   LYS A CE  1 
ATOM   342   N NZ  . LYS A 1 49  ? 43.324  62.872  -19.939 1.00 146.91 ? 47   LYS A NZ  1 
ATOM   343   N N   . MET A 1 50  ? 43.151  67.083  -12.868 1.00 92.11  ? 48   MET A N   1 
ATOM   344   C CA  . MET A 1 50  ? 42.444  68.326  -12.594 1.00 90.86  ? 48   MET A CA  1 
ATOM   345   C C   . MET A 1 50  ? 43.455  69.441  -12.355 1.00 90.81  ? 48   MET A C   1 
ATOM   346   O O   . MET A 1 50  ? 43.232  70.588  -12.737 1.00 91.40  ? 48   MET A O   1 
ATOM   347   C CB  . MET A 1 50  ? 41.532  68.172  -11.371 1.00 85.98  ? 48   MET A CB  1 
ATOM   348   C CG  . MET A 1 50  ? 40.604  69.362  -11.132 1.00 84.70  ? 48   MET A CG  1 
ATOM   349   S SD  . MET A 1 50  ? 39.399  69.087  -9.804  1.00 86.60  ? 48   MET A SD  1 
ATOM   350   C CE  . MET A 1 50  ? 39.197  70.758  -9.140  1.00 84.84  ? 48   MET A CE  1 
ATOM   351   N N   . GLY A 1 51  ? 44.575  69.098  -11.730 1.00 96.60  ? 49   GLY A N   1 
ATOM   352   C CA  . GLY A 1 51  ? 45.596  70.091  -11.460 1.00 97.00  ? 49   GLY A CA  1 
ATOM   353   C C   . GLY A 1 51  ? 45.803  70.349  -9.979  1.00 96.92  ? 49   GLY A C   1 
ATOM   354   O O   . GLY A 1 51  ? 46.503  71.287  -9.601  1.00 98.09  ? 49   GLY A O   1 
ATOM   355   N N   . VAL A 1 52  ? 45.203  69.516  -9.135  1.00 93.55  ? 50   VAL A N   1 
ATOM   356   C CA  . VAL A 1 52  ? 45.334  69.671  -7.690  1.00 92.76  ? 50   VAL A CA  1 
ATOM   357   C C   . VAL A 1 52  ? 46.460  68.806  -7.123  1.00 93.04  ? 50   VAL A C   1 
ATOM   358   O O   . VAL A 1 52  ? 46.694  67.686  -7.583  1.00 91.81  ? 50   VAL A O   1 
ATOM   359   C CB  . VAL A 1 52  ? 44.017  69.299  -6.971  1.00 84.30  ? 50   VAL A CB  1 
ATOM   360   C CG1 . VAL A 1 52  ? 44.176  69.462  -5.472  1.00 84.71  ? 50   VAL A CG1 1 
ATOM   361   C CG2 . VAL A 1 52  ? 42.888  70.177  -7.473  1.00 83.86  ? 50   VAL A CG2 1 
ATOM   362   N N   . LYS A 1 53  ? 47.156  69.338  -6.122  1.00 88.10  ? 51   LYS A N   1 
ATOM   363   C CA  . LYS A 1 53  ? 48.251  68.623  -5.477  1.00 88.09  ? 51   LYS A CA  1 
ATOM   364   C C   . LYS A 1 53  ? 47.722  67.447  -4.653  1.00 86.41  ? 51   LYS A C   1 
ATOM   365   O O   . LYS A 1 53  ? 47.046  67.642  -3.641  1.00 85.77  ? 51   LYS A O   1 
ATOM   366   C CB  . LYS A 1 53  ? 49.038  69.574  -4.571  1.00 126.30 ? 51   LYS A CB  1 
ATOM   367   C CG  . LYS A 1 53  ? 49.817  70.657  -5.311  1.00 129.90 ? 51   LYS A CG  1 
ATOM   368   C CD  . LYS A 1 53  ? 50.606  71.531  -4.334  1.00 133.08 ? 51   LYS A CD  1 
ATOM   369   C CE  . LYS A 1 53  ? 51.504  72.538  -5.050  1.00 134.49 ? 51   LYS A CE  1 
ATOM   370   N NZ  . LYS A 1 53  ? 52.283  73.381  -4.091  1.00 131.89 ? 51   LYS A NZ  1 
ATOM   371   N N   . LEU A 1 54  ? 48.030  66.229  -5.093  1.00 83.48  ? 52   LEU A N   1 
ATOM   372   C CA  . LEU A 1 54  ? 47.590  65.018  -4.397  1.00 82.02  ? 52   LEU A CA  1 
ATOM   373   C C   . LEU A 1 54  ? 48.774  64.264  -3.817  1.00 80.02  ? 52   LEU A C   1 
ATOM   374   O O   . LEU A 1 54  ? 49.643  63.803  -4.553  1.00 79.25  ? 52   LEU A O   1 
ATOM   375   C CB  . LEU A 1 54  ? 46.838  64.093  -5.352  1.00 87.50  ? 52   LEU A CB  1 
ATOM   376   C CG  . LEU A 1 54  ? 45.666  64.726  -6.095  1.00 88.32  ? 52   LEU A CG  1 
ATOM   377   C CD1 . LEU A 1 54  ? 44.920  63.655  -6.871  1.00 88.60  ? 52   LEU A CD1 1 
ATOM   378   C CD2 . LEU A 1 54  ? 44.748  65.407  -5.097  1.00 89.73  ? 52   LEU A CD2 1 
ATOM   379   N N   . THR A 1 55  ? 48.802  64.131  -2.498  1.00 87.37  ? 53   THR A N   1 
ATOM   380   C CA  . THR A 1 55  ? 49.894  63.435  -1.837  1.00 87.08  ? 53   THR A CA  1 
ATOM   381   C C   . THR A 1 55  ? 49.397  62.272  -0.988  1.00 87.26  ? 53   THR A C   1 
ATOM   382   O O   . THR A 1 55  ? 48.307  62.325  -0.427  1.00 87.83  ? 53   THR A O   1 
ATOM   383   C CB  . THR A 1 55  ? 50.681  64.385  -0.931  1.00 89.27  ? 53   THR A CB  1 
ATOM   384   O OG1 . THR A 1 55  ? 51.709  63.653  -0.258  1.00 91.73  ? 53   THR A OG1 1 
ATOM   385   C CG2 . THR A 1 55  ? 49.761  65.021  0.099   1.00 88.28  ? 53   THR A CG2 1 
ATOM   386   N N   . PRO A 1 56  ? 50.197  61.201  -0.884  1.00 92.43  ? 54   PRO A N   1 
ATOM   387   C CA  . PRO A 1 56  ? 49.794  60.042  -0.086  1.00 91.58  ? 54   PRO A CA  1 
ATOM   388   C C   . PRO A 1 56  ? 49.864  60.372  1.397   1.00 91.23  ? 54   PRO A C   1 
ATOM   389   O O   . PRO A 1 56  ? 49.347  59.635  2.236   1.00 91.66  ? 54   PRO A O   1 
ATOM   390   C CB  . PRO A 1 56  ? 50.818  58.988  -0.484  1.00 74.53  ? 54   PRO A CB  1 
ATOM   391   C CG  . PRO A 1 56  ? 52.053  59.808  -0.685  1.00 74.65  ? 54   PRO A CG  1 
ATOM   392   C CD  . PRO A 1 56  ? 51.528  60.986  -1.481  1.00 75.47  ? 54   PRO A CD  1 
ATOM   393   N N   . HIS A 1 57  ? 50.500  61.496  1.706   1.00 73.22  ? 55   HIS A N   1 
ATOM   394   C CA  . HIS A 1 57  ? 50.674  61.929  3.085   1.00 74.04  ? 55   HIS A CA  1 
ATOM   395   C C   . HIS A 1 57  ? 49.691  62.980  3.550   1.00 75.25  ? 55   HIS A C   1 
ATOM   396   O O   . HIS A 1 57  ? 49.862  64.167  3.273   1.00 75.67  ? 55   HIS A O   1 
ATOM   397   C CB  . HIS A 1 57  ? 52.090  62.459  3.290   1.00 92.62  ? 55   HIS A CB  1 
ATOM   398   C CG  . HIS A 1 57  ? 53.143  61.412  3.134   1.00 91.54  ? 55   HIS A CG  1 
ATOM   399   N ND1 . HIS A 1 57  ? 53.150  60.255  3.882   1.00 91.28  ? 55   HIS A ND1 1 
ATOM   400   C CD2 . HIS A 1 57  ? 54.207  61.332  2.301   1.00 90.65  ? 55   HIS A CD2 1 
ATOM   401   C CE1 . HIS A 1 57  ? 54.173  59.505  3.515   1.00 92.06  ? 55   HIS A CE1 1 
ATOM   402   N NE2 . HIS A 1 57  ? 54.830  60.135  2.557   1.00 91.49  ? 55   HIS A NE2 1 
ATOM   403   N N   . ASN A 1 58  ? 48.671  62.540  4.277   1.00 104.80 ? 56   ASN A N   1 
ATOM   404   C CA  . ASN A 1 58  ? 47.667  63.451  4.801   1.00 105.82 ? 56   ASN A CA  1 
ATOM   405   C C   . ASN A 1 58  ? 48.289  64.287  5.909   1.00 105.56 ? 56   ASN A C   1 
ATOM   406   O O   . ASN A 1 58  ? 47.639  64.623  6.896   1.00 107.11 ? 56   ASN A O   1 
ATOM   407   C CB  . ASN A 1 58  ? 46.467  62.665  5.327   1.00 90.34  ? 56   ASN A CB  1 
ATOM   408   C CG  . ASN A 1 58  ? 46.878  61.466  6.141   1.00 89.88  ? 56   ASN A CG  1 
ATOM   409   O OD1 . ASN A 1 58  ? 47.569  60.574  5.647   1.00 90.15  ? 56   ASN A OD1 1 
ATOM   410   N ND2 . ASN A 1 58  ? 46.457  61.433  7.396   1.00 89.88  ? 56   ASN A ND2 1 
ATOM   411   N N   . LYS A 1 59  ? 49.565  64.604  5.734   1.00 74.61  ? 57   LYS A N   1 
ATOM   412   C CA  . LYS A 1 59  ? 50.302  65.416  6.687   1.00 74.54  ? 57   LYS A CA  1 
ATOM   413   C C   . LYS A 1 59  ? 50.775  66.636  5.915   1.00 73.17  ? 57   LYS A C   1 
ATOM   414   O O   . LYS A 1 59  ? 50.584  67.769  6.351   1.00 71.21  ? 57   LYS A O   1 
ATOM   415   C CB  . LYS A 1 59  ? 51.514  64.658  7.236   1.00 108.96 ? 57   LYS A CB  1 
ATOM   416   C CG  . LYS A 1 59  ? 51.228  63.247  7.729   1.00 111.19 ? 57   LYS A CG  1 
ATOM   417   C CD  . LYS A 1 59  ? 51.096  62.273  6.568   1.00 113.04 ? 57   LYS A CD  1 
ATOM   418   C CE  . LYS A 1 59  ? 50.978  60.835  7.050   1.00 114.13 ? 57   LYS A CE  1 
ATOM   419   N NZ  . LYS A 1 59  ? 50.914  59.871  5.911   1.00 114.76 ? 57   LYS A NZ  1 
ATOM   420   N N   . GLU A 1 60  ? 51.393  66.387  4.762   1.00 79.22  ? 58   GLU A N   1 
ATOM   421   C CA  . GLU A 1 60  ? 51.886  67.457  3.904   1.00 78.96  ? 58   GLU A CA  1 
ATOM   422   C C   . GLU A 1 60  ? 50.677  68.297  3.564   1.00 77.10  ? 58   GLU A C   1 
ATOM   423   O O   . GLU A 1 60  ? 50.768  69.509  3.366   1.00 76.35  ? 58   GLU A O   1 
ATOM   424   C CB  . GLU A 1 60  ? 52.481  66.891  2.620   1.00 98.33  ? 58   GLU A CB  1 
ATOM   425   C CG  . GLU A 1 60  ? 53.459  65.764  2.837   1.00 104.05 ? 58   GLU A CG  1 
ATOM   426   C CD  . GLU A 1 60  ? 54.262  65.456  1.593   1.00 108.20 ? 58   GLU A CD  1 
ATOM   427   O OE1 . GLU A 1 60  ? 53.654  65.195  0.533   1.00 110.26 ? 58   GLU A OE1 1 
ATOM   428   O OE2 . GLU A 1 60  ? 55.508  65.475  1.674   1.00 112.73 ? 58   GLU A OE2 1 
ATOM   429   N N   . THR A 1 61  ? 49.539  67.619  3.483   1.00 88.08  ? 59   THR A N   1 
ATOM   430   C CA  . THR A 1 61  ? 48.277  68.273  3.201   1.00 87.16  ? 59   THR A CA  1 
ATOM   431   C C   . THR A 1 61  ? 48.091  69.268  4.339   1.00 86.41  ? 59   THR A C   1 
ATOM   432   O O   . THR A 1 61  ? 47.911  70.470  4.122   1.00 86.10  ? 59   THR A O   1 
ATOM   433   C CB  . THR A 1 61  ? 47.107  67.248  3.218   1.00 71.18  ? 59   THR A CB  1 
ATOM   434   O OG1 . THR A 1 61  ? 47.253  66.331  2.126   1.00 70.26  ? 59   THR A OG1 1 
ATOM   435   C CG2 . THR A 1 61  ? 45.764  67.952  3.102   1.00 70.35  ? 59   THR A CG2 1 
ATOM   436   N N   . VAL A 1 62  ? 48.176  68.744  5.557   1.00 78.93  ? 60   VAL A N   1 
ATOM   437   C CA  . VAL A 1 62  ? 48.005  69.534  6.767   1.00 77.53  ? 60   VAL A CA  1 
ATOM   438   C C   . VAL A 1 62  ? 48.825  70.811  6.787   1.00 76.76  ? 60   VAL A C   1 
ATOM   439   O O   . VAL A 1 62  ? 48.401  71.815  7.353   1.00 76.95  ? 60   VAL A O   1 
ATOM   440   C CB  . VAL A 1 62  ? 48.364  68.711  8.003   1.00 64.07  ? 60   VAL A CB  1 
ATOM   441   C CG1 . VAL A 1 62  ? 47.902  69.436  9.258   1.00 62.55  ? 60   VAL A CG1 1 
ATOM   442   C CG2 . VAL A 1 62  ? 47.736  67.333  7.893   1.00 64.85  ? 60   VAL A CG2 1 
ATOM   443   N N   . GLN A 1 63  ? 50.001  70.766  6.174   1.00 75.74  ? 61   GLN A N   1 
ATOM   444   C CA  . GLN A 1 63  ? 50.875  71.929  6.128   1.00 75.64  ? 61   GLN A CA  1 
ATOM   445   C C   . GLN A 1 63  ? 50.486  72.831  4.969   1.00 75.70  ? 61   GLN A C   1 
ATOM   446   O O   . GLN A 1 63  ? 50.341  74.040  5.130   1.00 76.57  ? 61   GLN A O   1 
ATOM   447   C CB  . GLN A 1 63  ? 52.325  71.494  5.956   1.00 75.26  ? 61   GLN A CB  1 
ATOM   448   C CG  . GLN A 1 63  ? 52.760  70.406  6.911   1.00 76.97  ? 61   GLN A CG  1 
ATOM   449   C CD  . GLN A 1 63  ? 54.250  70.163  6.845   1.00 78.92  ? 61   GLN A CD  1 
ATOM   450   O OE1 . GLN A 1 63  ? 54.828  70.071  5.759   1.00 78.92  ? 61   GLN A OE1 1 
ATOM   451   N NE2 . GLN A 1 63  ? 54.884  70.052  8.010   1.00 79.65  ? 61   GLN A NE2 1 
ATOM   452   N N   . HIS A 1 64  ? 50.327  72.236  3.795   1.00 83.39  ? 62   HIS A N   1 
ATOM   453   C CA  . HIS A 1 64  ? 49.956  72.987  2.607   1.00 83.41  ? 62   HIS A CA  1 
ATOM   454   C C   . HIS A 1 64  ? 48.643  73.739  2.760   1.00 82.75  ? 62   HIS A C   1 
ATOM   455   O O   . HIS A 1 64  ? 48.417  74.738  2.083   1.00 83.38  ? 62   HIS A O   1 
ATOM   456   C CB  . HIS A 1 64  ? 49.847  72.041  1.406   1.00 84.68  ? 62   HIS A CB  1 
ATOM   457   C CG  . HIS A 1 64  ? 48.967  72.552  0.304   1.00 86.45  ? 62   HIS A CG  1 
ATOM   458   N ND1 . HIS A 1 64  ? 47.616  72.776  0.472   1.00 86.71  ? 62   HIS A ND1 1 
ATOM   459   C CD2 . HIS A 1 64  ? 49.241  72.870  -0.984  1.00 86.33  ? 62   HIS A CD2 1 
ATOM   460   C CE1 . HIS A 1 64  ? 47.097  73.210  -0.663  1.00 87.89  ? 62   HIS A CE1 1 
ATOM   461   N NE2 . HIS A 1 64  ? 48.062  73.275  -1.563  1.00 87.11  ? 62   HIS A NE2 1 
ATOM   462   N N   . SER A 1 65  ? 47.784  73.279  3.661   1.00 51.90  ? 63   SER A N   1 
ATOM   463   C CA  . SER A 1 65  ? 46.478  73.899  3.800   1.00 52.52  ? 63   SER A CA  1 
ATOM   464   C C   . SER A 1 65  ? 46.224  74.970  4.845   1.00 51.75  ? 63   SER A C   1 
ATOM   465   O O   . SER A 1 65  ? 46.345  74.739  6.044   1.00 49.14  ? 63   SER A O   1 
ATOM   466   C CB  . SER A 1 65  ? 45.424  72.807  3.966   1.00 91.22  ? 63   SER A CB  1 
ATOM   467   O OG  . SER A 1 65  ? 45.698  72.021  5.109   1.00 94.47  ? 63   SER A OG  1 
ATOM   468   N N   . ASP A 1 66  ? 45.829  76.142  4.366   1.00 68.99  ? 64   ASP A N   1 
ATOM   469   C CA  . ASP A 1 66  ? 45.482  77.250  5.238   1.00 71.11  ? 64   ASP A CA  1 
ATOM   470   C C   . ASP A 1 66  ? 44.118  76.914  5.851   1.00 71.53  ? 64   ASP A C   1 
ATOM   471   O O   . ASP A 1 66  ? 43.774  77.400  6.923   1.00 71.96  ? 64   ASP A O   1 
ATOM   472   C CB  . ASP A 1 66  ? 45.396  78.544  4.425   1.00 94.53  ? 64   ASP A CB  1 
ATOM   473   C CG  . ASP A 1 66  ? 46.693  79.320  4.429   1.00 95.51  ? 64   ASP A CG  1 
ATOM   474   O OD1 . ASP A 1 66  ? 46.869  80.157  5.339   1.00 98.41  ? 64   ASP A OD1 1 
ATOM   475   O OD2 . ASP A 1 66  ? 47.537  79.086  3.536   1.00 94.16  ? 64   ASP A OD2 1 
ATOM   476   N N   . VAL A 1 67  ? 43.345  76.087  5.147   1.00 84.72  ? 65   VAL A N   1 
ATOM   477   C CA  . VAL A 1 67  ? 42.024  75.640  5.604   1.00 83.71  ? 65   VAL A CA  1 
ATOM   478   C C   . VAL A 1 67  ? 41.966  74.140  5.387   1.00 83.21  ? 65   VAL A C   1 
ATOM   479   O O   . VAL A 1 67  ? 42.243  73.655  4.286   1.00 82.89  ? 65   VAL A O   1 
ATOM   480   C CB  . VAL A 1 67  ? 40.874  76.249  4.792   1.00 59.41  ? 65   VAL A CB  1 
ATOM   481   C CG1 . VAL A 1 67  ? 39.550  75.743  5.337   1.00 57.98  ? 65   VAL A CG1 1 
ATOM   482   C CG2 . VAL A 1 67  ? 40.933  77.759  4.848   1.00 60.09  ? 65   VAL A CG2 1 
ATOM   483   N N   . LEU A 1 68  ? 41.591  73.397  6.418   1.00 68.21  ? 66   LEU A N   1 
ATOM   484   C CA  . LEU A 1 68  ? 41.561  71.959  6.260   1.00 67.69  ? 66   LEU A CA  1 
ATOM   485   C C   . LEU A 1 68  ? 40.197  71.318  6.192   1.00 68.18  ? 66   LEU A C   1 
ATOM   486   O O   . LEU A 1 68  ? 39.311  71.594  7.000   1.00 69.43  ? 66   LEU A O   1 
ATOM   487   C CB  . LEU A 1 68  ? 42.359  71.281  7.363   1.00 69.81  ? 66   LEU A CB  1 
ATOM   488   C CG  . LEU A 1 68  ? 42.606  69.811  7.020   1.00 68.89  ? 66   LEU A CG  1 
ATOM   489   C CD1 . LEU A 1 68  ? 43.402  69.725  5.722   1.00 68.26  ? 66   LEU A CD1 1 
ATOM   490   C CD2 . LEU A 1 68  ? 43.354  69.133  8.143   1.00 68.25  ? 66   LEU A CD2 1 
ATOM   491   N N   . PHE A 1 69  ? 40.055  70.430  5.217   1.00 67.40  ? 67   PHE A N   1 
ATOM   492   C CA  . PHE A 1 69  ? 38.821  69.705  5.000   1.00 65.01  ? 67   PHE A CA  1 
ATOM   493   C C   . PHE A 1 69  ? 38.988  68.236  5.319   1.00 64.78  ? 67   PHE A C   1 
ATOM   494   O O   . PHE A 1 69  ? 39.879  67.565  4.789   1.00 62.77  ? 67   PHE A O   1 
ATOM   495   C CB  . PHE A 1 69  ? 38.376  69.863  3.553   1.00 59.90  ? 67   PHE A CB  1 
ATOM   496   C CG  . PHE A 1 69  ? 37.611  71.118  3.298   1.00 59.49  ? 67   PHE A CG  1 
ATOM   497   C CD1 . PHE A 1 69  ? 37.996  71.991  2.290   1.00 59.35  ? 67   PHE A CD1 1 
ATOM   498   C CD2 . PHE A 1 69  ? 36.486  71.421  4.056   1.00 59.43  ? 67   PHE A CD2 1 
ATOM   499   C CE1 . PHE A 1 69  ? 37.267  73.152  2.037   1.00 59.49  ? 67   PHE A CE1 1 
ATOM   500   C CE2 . PHE A 1 69  ? 35.747  72.580  3.813   1.00 59.29  ? 67   PHE A CE2 1 
ATOM   501   C CZ  . PHE A 1 69  ? 36.138  73.447  2.801   1.00 59.65  ? 67   PHE A CZ  1 
ATOM   502   N N   . LEU A 1 70  ? 38.124  67.747  6.197   1.00 76.75  ? 68   LEU A N   1 
ATOM   503   C CA  . LEU A 1 70  ? 38.140  66.348  6.588   1.00 79.69  ? 68   LEU A CA  1 
ATOM   504   C C   . LEU A 1 70  ? 37.176  65.623  5.671   1.00 81.22  ? 68   LEU A C   1 
ATOM   505   O O   . LEU A 1 70  ? 35.966  65.672  5.889   1.00 82.50  ? 68   LEU A O   1 
ATOM   506   C CB  . LEU A 1 70  ? 37.673  66.204  8.030   1.00 67.06  ? 68   LEU A CB  1 
ATOM   507   C CG  . LEU A 1 70  ? 38.405  67.133  8.989   1.00 64.35  ? 68   LEU A CG  1 
ATOM   508   C CD1 . LEU A 1 70  ? 38.084  66.742  10.417  1.00 62.69  ? 68   LEU A CD1 1 
ATOM   509   C CD2 . LEU A 1 70  ? 39.901  67.046  8.728   1.00 61.11  ? 68   LEU A CD2 1 
ATOM   510   N N   . ALA A 1 71  ? 37.710  64.950  4.654   1.00 77.85  ? 69   ALA A N   1 
ATOM   511   C CA  . ALA A 1 71  ? 36.872  64.244  3.693   1.00 79.28  ? 69   ALA A CA  1 
ATOM   512   C C   . ALA A 1 71  ? 36.963  62.726  3.795   1.00 81.16  ? 69   ALA A C   1 
ATOM   513   O O   . ALA A 1 71  ? 36.903  62.027  2.782   1.00 82.04  ? 69   ALA A O   1 
ATOM   514   C CB  . ALA A 1 71  ? 37.225  64.693  2.275   1.00 54.20  ? 69   ALA A CB  1 
ATOM   515   N N   . VAL A 1 72  ? 37.089  62.213  5.014   1.00 79.31  ? 70   VAL A N   1 
ATOM   516   C CA  . VAL A 1 72  ? 37.196  60.774  5.211   1.00 80.14  ? 70   VAL A CA  1 
ATOM   517   C C   . VAL A 1 72  ? 35.948  60.171  5.831   1.00 80.91  ? 70   VAL A C   1 
ATOM   518   O O   . VAL A 1 72  ? 35.065  60.881  6.302   1.00 80.65  ? 70   VAL A O   1 
ATOM   519   C CB  . VAL A 1 72  ? 38.384  60.416  6.128   1.00 70.58  ? 70   VAL A CB  1 
ATOM   520   C CG1 . VAL A 1 72  ? 39.648  61.100  5.633   1.00 70.74  ? 70   VAL A CG1 1 
ATOM   521   C CG2 . VAL A 1 72  ? 38.070  60.808  7.567   1.00 67.94  ? 70   VAL A CG2 1 
ATOM   522   N N   . LYS A 1 73  ? 35.897  58.844  5.831   1.00 73.51  ? 71   LYS A N   1 
ATOM   523   C CA  . LYS A 1 73  ? 34.786  58.111  6.410   1.00 73.33  ? 71   LYS A CA  1 
ATOM   524   C C   . LYS A 1 73  ? 34.679  58.532  7.868   1.00 72.63  ? 71   LYS A C   1 
ATOM   525   O O   . LYS A 1 73  ? 35.678  58.865  8.507   1.00 73.33  ? 71   LYS A O   1 
ATOM   526   C CB  . LYS A 1 73  ? 35.060  56.611  6.348   1.00 107.00 ? 71   LYS A CB  1 
ATOM   527   C CG  . LYS A 1 73  ? 35.763  56.156  5.081   1.00 111.16 ? 71   LYS A CG  1 
ATOM   528   C CD  . LYS A 1 73  ? 36.091  54.667  5.139   1.00 115.47 ? 71   LYS A CD  1 
ATOM   529   C CE  . LYS A 1 73  ? 36.837  54.207  3.896   1.00 116.44 ? 71   LYS A CE  1 
ATOM   530   N NZ  . LYS A 1 73  ? 37.001  52.728  3.855   1.00 117.93 ? 71   LYS A NZ  1 
ATOM   531   N N   . PRO A 1 74  ? 33.463  58.528  8.416   1.00 89.44  ? 72   PRO A N   1 
ATOM   532   C CA  . PRO A 1 74  ? 33.297  58.921  9.814   1.00 90.08  ? 72   PRO A CA  1 
ATOM   533   C C   . PRO A 1 74  ? 34.146  58.093  10.768  1.00 90.00  ? 72   PRO A C   1 
ATOM   534   O O   . PRO A 1 74  ? 34.793  58.644  11.652  1.00 91.57  ? 72   PRO A O   1 
ATOM   535   C CB  . PRO A 1 74  ? 31.803  58.738  10.040  1.00 113.55 ? 72   PRO A CB  1 
ATOM   536   C CG  . PRO A 1 74  ? 31.242  59.143  8.715   1.00 113.34 ? 72   PRO A CG  1 
ATOM   537   C CD  . PRO A 1 74  ? 32.156  58.409  7.750   1.00 113.75 ? 72   PRO A CD  1 
ATOM   538   N N   . HIS A 1 75  ? 34.164  56.776  10.593  1.00 96.91  ? 73   HIS A N   1 
ATOM   539   C CA  . HIS A 1 75  ? 34.958  55.950  11.492  1.00 96.89  ? 73   HIS A CA  1 
ATOM   540   C C   . HIS A 1 75  ? 36.460  56.213  11.347  1.00 95.14  ? 73   HIS A C   1 
ATOM   541   O O   . HIS A 1 75  ? 37.233  55.943  12.268  1.00 96.10  ? 73   HIS A O   1 
ATOM   542   C CB  . HIS A 1 75  ? 34.658  54.460  11.274  1.00 110.21 ? 73   HIS A CB  1 
ATOM   543   C CG  . HIS A 1 75  ? 35.124  53.926  9.955   1.00 113.33 ? 73   HIS A CG  1 
ATOM   544   N ND1 . HIS A 1 75  ? 35.285  52.577  9.717   1.00 115.19 ? 73   HIS A ND1 1 
ATOM   545   C CD2 . HIS A 1 75  ? 35.456  54.553  8.802   1.00 114.43 ? 73   HIS A CD2 1 
ATOM   546   C CE1 . HIS A 1 75  ? 35.697  52.398  8.475   1.00 116.04 ? 73   HIS A CE1 1 
ATOM   547   N NE2 . HIS A 1 75  ? 35.809  53.580  7.898   1.00 115.20 ? 73   HIS A NE2 1 
ATOM   548   N N   . ILE A 1 76  ? 36.871  56.751  10.201  1.00 61.53  ? 74   ILE A N   1 
ATOM   549   C CA  . ILE A 1 76  ? 38.284  57.035  9.959   1.00 59.52  ? 74   ILE A CA  1 
ATOM   550   C C   . ILE A 1 76  ? 38.769  58.215  10.774  1.00 58.33  ? 74   ILE A C   1 
ATOM   551   O O   . ILE A 1 76  ? 39.840  58.173  11.380  1.00 55.51  ? 74   ILE A O   1 
ATOM   552   C CB  . ILE A 1 76  ? 38.548  57.347  8.481   1.00 74.75  ? 74   ILE A CB  1 
ATOM   553   C CG1 . ILE A 1 76  ? 38.287  56.102  7.645   1.00 75.41  ? 74   ILE A CG1 1 
ATOM   554   C CG2 . ILE A 1 76  ? 39.988  57.785  8.286   1.00 74.41  ? 74   ILE A CG2 1 
ATOM   555   C CD1 . ILE A 1 76  ? 39.184  54.941  8.023   1.00 81.04  ? 74   ILE A CD1 1 
ATOM   556   N N   . ILE A 1 77  ? 37.963  59.269  10.767  1.00 70.99  ? 75   ILE A N   1 
ATOM   557   C CA  . ILE A 1 77  ? 38.254  60.496  11.486  1.00 71.33  ? 75   ILE A CA  1 
ATOM   558   C C   . ILE A 1 77  ? 39.199  60.359  12.683  1.00 71.56  ? 75   ILE A C   1 
ATOM   559   O O   . ILE A 1 77  ? 40.235  61.023  12.732  1.00 71.18  ? 75   ILE A O   1 
ATOM   560   C CB  . ILE A 1 77  ? 36.935  61.169  11.931  1.00 73.57  ? 75   ILE A CB  1 
ATOM   561   C CG1 . ILE A 1 77  ? 36.518  62.198  10.885  1.00 72.40  ? 75   ILE A CG1 1 
ATOM   562   C CG2 . ILE A 1 77  ? 37.090  61.824  13.299  1.00 73.47  ? 75   ILE A CG2 1 
ATOM   563   C CD1 . ILE A 1 77  ? 37.517  63.314  10.740  1.00 73.98  ? 75   ILE A CD1 1 
ATOM   564   N N   . PRO A 1 78  ? 38.863  59.495  13.658  1.00 55.97  ? 76   PRO A N   1 
ATOM   565   C CA  . PRO A 1 78  ? 39.732  59.333  14.827  1.00 56.59  ? 76   PRO A CA  1 
ATOM   566   C C   . PRO A 1 78  ? 41.174  59.041  14.439  1.00 58.73  ? 76   PRO A C   1 
ATOM   567   O O   . PRO A 1 78  ? 42.093  59.783  14.785  1.00 59.77  ? 76   PRO A O   1 
ATOM   568   C CB  . PRO A 1 78  ? 39.100  58.159  15.568  1.00 67.81  ? 76   PRO A CB  1 
ATOM   569   C CG  . PRO A 1 78  ? 37.662  58.264  15.203  1.00 67.72  ? 76   PRO A CG  1 
ATOM   570   C CD  . PRO A 1 78  ? 37.723  58.567  13.730  1.00 67.41  ? 76   PRO A CD  1 
ATOM   571   N N   . PHE A 1 79  ? 41.357  57.952  13.706  1.00 78.95  ? 77   PHE A N   1 
ATOM   572   C CA  . PHE A 1 79  ? 42.673  57.516  13.268  1.00 81.79  ? 77   PHE A CA  1 
ATOM   573   C C   . PHE A 1 79  ? 43.421  58.588  12.501  1.00 82.56  ? 77   PHE A C   1 
ATOM   574   O O   . PHE A 1 79  ? 44.477  58.332  11.924  1.00 83.53  ? 77   PHE A O   1 
ATOM   575   C CB  . PHE A 1 79  ? 42.524  56.257  12.416  1.00 112.23 ? 77   PHE A CB  1 
ATOM   576   C CG  . PHE A 1 79  ? 41.955  55.092  13.172  1.00 115.95 ? 77   PHE A CG  1 
ATOM   577   C CD1 . PHE A 1 79  ? 40.856  55.265  14.015  1.00 116.72 ? 77   PHE A CD1 1 
ATOM   578   C CD2 . PHE A 1 79  ? 42.521  53.829  13.060  1.00 117.31 ? 77   PHE A CD2 1 
ATOM   579   C CE1 . PHE A 1 79  ? 40.333  54.202  14.736  1.00 118.38 ? 77   PHE A CE1 1 
ATOM   580   C CE2 . PHE A 1 79  ? 42.005  52.752  13.778  1.00 117.86 ? 77   PHE A CE2 1 
ATOM   581   C CZ  . PHE A 1 79  ? 40.909  52.939  14.618  1.00 118.96 ? 77   PHE A CZ  1 
ATOM   582   N N   . ILE A 1 80  ? 42.873  59.795  12.503  1.00 90.29  ? 78   ILE A N   1 
ATOM   583   C CA  . ILE A 1 80  ? 43.490  60.904  11.804  1.00 90.93  ? 78   ILE A CA  1 
ATOM   584   C C   . ILE A 1 80  ? 43.842  62.018  12.771  1.00 90.66  ? 78   ILE A C   1 
ATOM   585   O O   . ILE A 1 80  ? 45.008  62.388  12.909  1.00 91.81  ? 78   ILE A O   1 
ATOM   586   C CB  . ILE A 1 80  ? 42.551  61.465  10.734  1.00 90.11  ? 78   ILE A CB  1 
ATOM   587   C CG1 . ILE A 1 80  ? 42.138  60.349  9.777   1.00 91.13  ? 78   ILE A CG1 1 
ATOM   588   C CG2 . ILE A 1 80  ? 43.242  62.576  9.971   1.00 89.13  ? 78   ILE A CG2 1 
ATOM   589   C CD1 . ILE A 1 80  ? 41.199  60.802  8.689   1.00 94.16  ? 78   ILE A CD1 1 
ATOM   590   N N   . LEU A 1 81  ? 42.826  62.552  13.437  1.00 75.09  ? 79   LEU A N   1 
ATOM   591   C CA  . LEU A 1 81  ? 43.028  63.633  14.388  1.00 75.07  ? 79   LEU A CA  1 
ATOM   592   C C   . LEU A 1 81  ? 44.254  63.396  15.268  1.00 76.20  ? 79   LEU A C   1 
ATOM   593   O O   . LEU A 1 81  ? 45.003  64.325  15.579  1.00 76.07  ? 79   LEU A O   1 
ATOM   594   C CB  . LEU A 1 81  ? 41.790  63.795  15.271  1.00 68.27  ? 79   LEU A CB  1 
ATOM   595   C CG  . LEU A 1 81  ? 40.487  64.262  14.614  1.00 67.65  ? 79   LEU A CG  1 
ATOM   596   C CD1 . LEU A 1 81  ? 39.382  64.396  15.662  1.00 68.31  ? 79   LEU A CD1 1 
ATOM   597   C CD2 . LEU A 1 81  ? 40.717  65.598  13.941  1.00 66.49  ? 79   LEU A CD2 1 
ATOM   598   N N   . ASP A 1 82  ? 44.464  62.145  15.653  1.00 79.59  ? 80   ASP A N   1 
ATOM   599   C CA  . ASP A 1 82  ? 45.584  61.798  16.515  1.00 80.12  ? 80   ASP A CA  1 
ATOM   600   C C   . ASP A 1 82  ? 46.796  61.372  15.709  1.00 79.37  ? 80   ASP A C   1 
ATOM   601   O O   . ASP A 1 82  ? 47.681  60.682  16.210  1.00 79.25  ? 80   ASP A O   1 
ATOM   602   C CB  . ASP A 1 82  ? 45.159  60.680  17.450  1.00 112.64 ? 80   ASP A CB  1 
ATOM   603   C CG  . ASP A 1 82  ? 43.768  60.890  17.982  1.00 116.39 ? 80   ASP A CG  1 
ATOM   604   O OD1 . ASP A 1 82  ? 43.594  61.692  18.923  1.00 118.71 ? 80   ASP A OD1 1 
ATOM   605   O OD2 . ASP A 1 82  ? 42.842  60.264  17.434  1.00 119.34 ? 80   ASP A OD2 1 
ATOM   606   N N   . GLU A 1 83  ? 46.827  61.788  14.452  1.00 92.86  ? 81   GLU A N   1 
ATOM   607   C CA  . GLU A 1 83  ? 47.931  61.466  13.564  1.00 93.02  ? 81   GLU A CA  1 
ATOM   608   C C   . GLU A 1 83  ? 48.361  62.759  12.883  1.00 92.00  ? 81   GLU A C   1 
ATOM   609   O O   . GLU A 1 83  ? 49.401  62.829  12.224  1.00 91.99  ? 81   GLU A O   1 
ATOM   610   C CB  . GLU A 1 83  ? 47.479  60.435  12.528  1.00 73.77  ? 81   GLU A CB  1 
ATOM   611   C CG  . GLU A 1 83  ? 48.496  60.162  11.434  1.00 75.67  ? 81   GLU A CG  1 
ATOM   612   C CD  . GLU A 1 83  ? 48.026  60.639  10.071  1.00 76.39  ? 81   GLU A CD  1 
ATOM   613   O OE1 . GLU A 1 83  ? 48.827  60.587  9.111   1.00 75.78  ? 81   GLU A OE1 1 
ATOM   614   O OE2 . GLU A 1 83  ? 46.855  61.059  9.960   1.00 75.81  ? 81   GLU A OE2 1 
ATOM   615   N N   . ILE A 1 84  ? 47.550  63.790  13.074  1.00 93.75  ? 82   ILE A N   1 
ATOM   616   C CA  . ILE A 1 84  ? 47.814  65.084  12.480  1.00 94.10  ? 82   ILE A CA  1 
ATOM   617   C C   . ILE A 1 84  ? 47.648  66.223  13.476  1.00 94.29  ? 82   ILE A C   1 
ATOM   618   O O   . ILE A 1 84  ? 48.224  67.295  13.297  1.00 96.07  ? 82   ILE A O   1 
ATOM   619   C CB  . ILE A 1 84  ? 46.886  65.306  11.274  1.00 89.60  ? 82   ILE A CB  1 
ATOM   620   C CG1 . ILE A 1 84  ? 47.383  64.473  10.093  1.00 89.45  ? 82   ILE A CG1 1 
ATOM   621   C CG2 . ILE A 1 84  ? 46.830  66.769  10.909  1.00 89.16  ? 82   ILE A CG2 1 
ATOM   622   C CD1 . ILE A 1 84  ? 48.835  64.746  9.725   1.00 88.75  ? 82   ILE A CD1 1 
ATOM   623   N N   . GLY A 1 85  ? 46.866  65.985  14.526  1.00 77.67  ? 83   GLY A N   1 
ATOM   624   C CA  . GLY A 1 85  ? 46.643  67.007  15.536  1.00 77.22  ? 83   GLY A CA  1 
ATOM   625   C C   . GLY A 1 85  ? 47.908  67.728  15.966  1.00 77.18  ? 83   GLY A C   1 
ATOM   626   O O   . GLY A 1 85  ? 47.879  68.911  16.313  1.00 75.72  ? 83   GLY A O   1 
ATOM   627   N N   . ALA A 1 86  ? 49.024  67.006  15.940  1.00 99.75  ? 84   ALA A N   1 
ATOM   628   C CA  . ALA A 1 86  ? 50.318  67.554  16.323  1.00 99.65  ? 84   ALA A CA  1 
ATOM   629   C C   . ALA A 1 86  ? 50.793  68.568  15.296  1.00 100.58 ? 84   ALA A C   1 
ATOM   630   O O   . ALA A 1 86  ? 51.738  69.322  15.537  1.00 103.00 ? 84   ALA A O   1 
ATOM   631   C CB  . ALA A 1 86  ? 51.328  66.432  16.443  1.00 65.47  ? 84   ALA A CB  1 
ATOM   632   N N   . ASP A 1 87  ? 50.123  68.576  14.148  1.00 77.49  ? 85   ASP A N   1 
ATOM   633   C CA  . ASP A 1 87  ? 50.464  69.470  13.051  1.00 76.42  ? 85   ASP A CA  1 
ATOM   634   C C   . ASP A 1 87  ? 49.446  70.590  12.910  1.00 75.78  ? 85   ASP A C   1 
ATOM   635   O O   . ASP A 1 87  ? 49.502  71.373  11.966  1.00 75.88  ? 85   ASP A O   1 
ATOM   636   C CB  . ASP A 1 87  ? 50.536  68.681  11.743  1.00 90.38  ? 85   ASP A CB  1 
ATOM   637   C CG  . ASP A 1 87  ? 51.415  67.451  11.851  1.00 92.20  ? 85   ASP A CG  1 
ATOM   638   O OD1 . ASP A 1 87  ? 51.477  66.673  10.876  1.00 93.58  ? 85   ASP A OD1 1 
ATOM   639   O OD2 . ASP A 1 87  ? 52.047  67.258  12.911  1.00 95.38  ? 85   ASP A OD2 1 
ATOM   640   N N   . ILE A 1 88  ? 48.516  70.670  13.851  1.00 81.90  ? 86   ILE A N   1 
ATOM   641   C CA  . ILE A 1 88  ? 47.505  71.709  13.790  1.00 83.41  ? 86   ILE A CA  1 
ATOM   642   C C   . ILE A 1 88  ? 48.053  73.047  14.270  1.00 85.32  ? 86   ILE A C   1 
ATOM   643   O O   . ILE A 1 88  ? 48.135  73.297  15.474  1.00 87.52  ? 86   ILE A O   1 
ATOM   644   C CB  . ILE A 1 88  ? 46.276  71.348  14.647  1.00 85.26  ? 86   ILE A CB  1 
ATOM   645   C CG1 . ILE A 1 88  ? 45.868  69.907  14.371  1.00 86.00  ? 86   ILE A CG1 1 
ATOM   646   C CG2 . ILE A 1 88  ? 45.110  72.272  14.309  1.00 83.12  ? 86   ILE A CG2 1 
ATOM   647   C CD1 . ILE A 1 88  ? 45.640  69.624  12.908  1.00 89.67  ? 86   ILE A CD1 1 
ATOM   648   N N   . GLU A 1 89  ? 48.440  73.895  13.322  1.00 80.03  ? 87   GLU A N   1 
ATOM   649   C CA  . GLU A 1 89  ? 48.952  75.225  13.627  1.00 80.83  ? 87   GLU A CA  1 
ATOM   650   C C   . GLU A 1 89  ? 47.770  76.152  13.897  1.00 81.12  ? 87   GLU A C   1 
ATOM   651   O O   . GLU A 1 89  ? 46.660  75.909  13.425  1.00 79.76  ? 87   GLU A O   1 
ATOM   652   C CB  . GLU A 1 89  ? 49.772  75.751  12.457  1.00 94.87  ? 87   GLU A CB  1 
ATOM   653   C CG  . GLU A 1 89  ? 51.060  75.000  12.247  1.00 98.95  ? 87   GLU A CG  1 
ATOM   654   C CD  . GLU A 1 89  ? 52.260  75.897  12.403  1.00 101.94 ? 87   GLU A CD  1 
ATOM   655   O OE1 . GLU A 1 89  ? 52.419  76.496  13.488  1.00 103.12 ? 87   GLU A OE1 1 
ATOM   656   O OE2 . GLU A 1 89  ? 53.042  76.010  11.439  1.00 104.99 ? 87   GLU A OE2 1 
ATOM   657   N N   . ASP A 1 90  ? 48.008  77.216  14.654  1.00 111.30 ? 88   ASP A N   1 
ATOM   658   C CA  . ASP A 1 90  ? 46.943  78.149  15.000  1.00 112.85 ? 88   ASP A CA  1 
ATOM   659   C C   . ASP A 1 90  ? 46.372  78.913  13.805  1.00 111.58 ? 88   ASP A C   1 
ATOM   660   O O   . ASP A 1 90  ? 45.419  79.675  13.958  1.00 112.25 ? 88   ASP A O   1 
ATOM   661   C CB  . ASP A 1 90  ? 47.445  79.142  16.054  1.00 156.73 ? 88   ASP A CB  1 
ATOM   662   C CG  . ASP A 1 90  ? 46.318  79.923  16.710  1.00 160.49 ? 88   ASP A CG  1 
ATOM   663   O OD1 . ASP A 1 90  ? 46.613  80.878  17.461  1.00 161.70 ? 88   ASP A OD1 1 
ATOM   664   O OD2 . ASP A 1 90  ? 45.137  79.576  16.482  1.00 162.20 ? 88   ASP A OD2 1 
ATOM   665   N N   . ARG A 1 91  ? 46.937  78.703  12.618  1.00 96.77  ? 89   ARG A N   1 
ATOM   666   C CA  . ARG A 1 91  ? 46.477  79.408  11.419  1.00 92.14  ? 89   ARG A CA  1 
ATOM   667   C C   . ARG A 1 91  ? 45.207  78.864  10.786  1.00 90.70  ? 89   ARG A C   1 
ATOM   668   O O   . ARG A 1 91  ? 44.220  79.581  10.634  1.00 92.21  ? 89   ARG A O   1 
ATOM   669   C CB  . ARG A 1 91  ? 47.560  79.409  10.340  1.00 66.32  ? 89   ARG A CB  1 
ATOM   670   C CG  . ARG A 1 91  ? 47.973  78.023  9.909   1.00 62.21  ? 89   ARG A CG  1 
ATOM   671   C CD  . ARG A 1 91  ? 48.586  78.019  8.537   1.00 59.01  ? 89   ARG A CD  1 
ATOM   672   N NE  . ARG A 1 91  ? 49.364  76.804  8.335   1.00 59.38  ? 89   ARG A NE  1 
ATOM   673   C CZ  . ARG A 1 91  ? 50.066  76.536  7.238   1.00 61.06  ? 89   ARG A CZ  1 
ATOM   674   N NH1 . ARG A 1 91  ? 50.084  77.396  6.224   1.00 61.85  ? 89   ARG A NH1 1 
ATOM   675   N NH2 . ARG A 1 91  ? 50.776  75.416  7.165   1.00 61.91  ? 89   ARG A NH2 1 
ATOM   676   N N   . HIS A 1 92  ? 45.243  77.594  10.406  1.00 63.99  ? 90   HIS A N   1 
ATOM   677   C CA  . HIS A 1 92  ? 44.108  76.980  9.741   1.00 61.31  ? 90   HIS A CA  1 
ATOM   678   C C   . HIS A 1 92  ? 42.899  76.618  10.563  1.00 58.84  ? 90   HIS A C   1 
ATOM   679   O O   . HIS A 1 92  ? 42.934  76.519  11.791  1.00 55.99  ? 90   HIS A O   1 
ATOM   680   C CB  . HIS A 1 92  ? 44.542  75.744  8.944   1.00 73.32  ? 90   HIS A CB  1 
ATOM   681   C CG  . HIS A 1 92  ? 45.578  74.914  9.627   1.00 74.36  ? 90   HIS A CG  1 
ATOM   682   N ND1 . HIS A 1 92  ? 45.526  74.619  10.972  1.00 73.45  ? 90   HIS A ND1 1 
ATOM   683   C CD2 . HIS A 1 92  ? 46.691  74.310  9.148   1.00 73.34  ? 90   HIS A CD2 1 
ATOM   684   C CE1 . HIS A 1 92  ? 46.566  73.870  11.292  1.00 74.90  ? 90   HIS A CE1 1 
ATOM   685   N NE2 . HIS A 1 92  ? 47.288  73.668  10.204  1.00 74.34  ? 90   HIS A NE2 1 
ATOM   686   N N   . ILE A 1 93  ? 41.818  76.423  9.819   1.00 72.34  ? 91   ILE A N   1 
ATOM   687   C CA  . ILE A 1 93  ? 40.528  76.061  10.355  1.00 68.96  ? 91   ILE A CA  1 
ATOM   688   C C   . ILE A 1 93  ? 40.267  74.646  9.886   1.00 67.77  ? 91   ILE A C   1 
ATOM   689   O O   . ILE A 1 93  ? 40.567  74.289  8.740   1.00 66.47  ? 91   ILE A O   1 
ATOM   690   C CB  . ILE A 1 93  ? 39.430  76.952  9.780   1.00 44.35  ? 91   ILE A CB  1 
ATOM   691   C CG1 . ILE A 1 93  ? 39.959  78.377  9.610   1.00 42.20  ? 91   ILE A CG1 1 
ATOM   692   C CG2 . ILE A 1 93  ? 38.223  76.918  10.689  1.00 45.10  ? 91   ILE A CG2 1 
ATOM   693   C CD1 . ILE A 1 93  ? 39.025  79.306  8.863   1.00 42.07  ? 91   ILE A CD1 1 
ATOM   694   N N   . VAL A 1 94  ? 39.720  73.839  10.782  1.00 53.38  ? 92   VAL A N   1 
ATOM   695   C CA  . VAL A 1 94  ? 39.402  72.470  10.440  1.00 52.65  ? 92   VAL A CA  1 
ATOM   696   C C   . VAL A 1 94  ? 37.910  72.377  10.185  1.00 51.69  ? 92   VAL A C   1 
ATOM   697   O O   . VAL A 1 94  ? 37.090  72.627  11.076  1.00 48.93  ? 92   VAL A O   1 
ATOM   698   C CB  . VAL A 1 94  ? 39.780  71.497  11.559  1.00 70.22  ? 92   VAL A CB  1 
ATOM   699   C CG1 . VAL A 1 94  ? 39.265  70.104  11.224  1.00 68.85  ? 92   VAL A CG1 1 
ATOM   700   C CG2 . VAL A 1 94  ? 41.290  71.474  11.729  1.00 69.46  ? 92   VAL A CG2 1 
ATOM   701   N N   . VAL A 1 95  ? 37.572  72.040  8.946   1.00 47.82  ? 93   VAL A N   1 
ATOM   702   C CA  . VAL A 1 95  ? 36.192  71.897  8.542   1.00 46.82  ? 93   VAL A CA  1 
ATOM   703   C C   . VAL A 1 95  ? 35.961  70.420  8.338   1.00 47.84  ? 93   VAL A C   1 
ATOM   704   O O   . VAL A 1 95  ? 36.508  69.810  7.418   1.00 47.03  ? 93   VAL A O   1 
ATOM   705   C CB  . VAL A 1 95  ? 35.921  72.632  7.231   1.00 73.92  ? 93   VAL A CB  1 
ATOM   706   C CG1 . VAL A 1 95  ? 34.437  72.600  6.915   1.00 72.49  ? 93   VAL A CG1 1 
ATOM   707   C CG2 . VAL A 1 95  ? 36.419  74.061  7.334   1.00 74.10  ? 93   VAL A CG2 1 
ATOM   708   N N   . SER A 1 96  ? 35.172  69.838  9.225   1.00 57.05  ? 94   SER A N   1 
ATOM   709   C CA  . SER A 1 96  ? 34.868  68.427  9.132   1.00 60.09  ? 94   SER A CA  1 
ATOM   710   C C   . SER A 1 96  ? 33.521  68.254  8.471   1.00 61.22  ? 94   SER A C   1 
ATOM   711   O O   . SER A 1 96  ? 32.521  68.789  8.952   1.00 60.76  ? 94   SER A O   1 
ATOM   712   C CB  . SER A 1 96  ? 34.809  67.802  10.516  1.00 83.09  ? 94   SER A CB  1 
ATOM   713   O OG  . SER A 1 96  ? 34.101  66.575  10.459  1.00 83.14  ? 94   SER A OG  1 
ATOM   714   N N   . CYS A 1 97  ? 33.481  67.515  7.371   1.00 87.88  ? 95   CYS A N   1 
ATOM   715   C CA  . CYS A 1 97  ? 32.209  67.297  6.716   1.00 89.72  ? 95   CYS A CA  1 
ATOM   716   C C   . CYS A 1 97  ? 31.780  65.849  6.839   1.00 90.79  ? 95   CYS A C   1 
ATOM   717   O O   . CYS A 1 97  ? 30.697  65.480  6.381   1.00 92.77  ? 95   CYS A O   1 
ATOM   718   C CB  . CYS A 1 97  ? 32.276  67.676  5.253   1.00 78.48  ? 95   CYS A CB  1 
ATOM   719   S SG  . CYS A 1 97  ? 32.916  69.340  4.919   1.00 82.77  ? 95   CYS A SG  1 
ATOM   720   N N   . ALA A 1 98  ? 32.633  65.019  7.437   1.00 60.89  ? 96   ALA A N   1 
ATOM   721   C CA  . ALA A 1 98  ? 32.276  63.621  7.630   1.00 59.31  ? 96   ALA A CA  1 
ATOM   722   C C   . ALA A 1 98  ? 30.941  63.676  8.358   1.00 58.93  ? 96   ALA A C   1 
ATOM   723   O O   . ALA A 1 98  ? 30.802  64.381  9.359   1.00 60.32  ? 96   ALA A O   1 
ATOM   724   C CB  . ALA A 1 98  ? 33.314  62.915  8.486   1.00 58.21  ? 96   ALA A CB  1 
ATOM   725   N N   . ALA A 1 99  ? 29.954  62.955  7.847   1.00 69.11  ? 97   ALA A N   1 
ATOM   726   C CA  . ALA A 1 99  ? 28.635  62.971  8.457   1.00 67.21  ? 97   ALA A CA  1 
ATOM   727   C C   . ALA A 1 99  ? 28.605  62.292  9.818   1.00 64.27  ? 97   ALA A C   1 
ATOM   728   O O   . ALA A 1 99  ? 29.472  61.474  10.140  1.00 62.79  ? 97   ALA A O   1 
ATOM   729   C CB  . ALA A 1 99  ? 27.628  62.318  7.522   1.00 135.74 ? 97   ALA A CB  1 
ATOM   730   N N   . GLY A 1 100 ? 27.600  62.647  10.614  1.00 67.78  ? 98   GLY A N   1 
ATOM   731   C CA  . GLY A 1 100 ? 27.444  62.057  11.931  1.00 68.37  ? 98   GLY A CA  1 
ATOM   732   C C   . GLY A 1 100 ? 28.439  62.534  12.969  1.00 68.50  ? 98   GLY A C   1 
ATOM   733   O O   . GLY A 1 100 ? 28.066  62.798  14.109  1.00 69.22  ? 98   GLY A O   1 
ATOM   734   N N   . VAL A 1 101 ? 29.704  62.637  12.577  1.00 51.22  ? 99   VAL A N   1 
ATOM   735   C CA  . VAL A 1 101 ? 30.762  63.091  13.473  1.00 51.65  ? 99   VAL A CA  1 
ATOM   736   C C   . VAL A 1 101 ? 30.415  64.444  14.107  1.00 52.83  ? 99   VAL A C   1 
ATOM   737   O O   . VAL A 1 101 ? 30.034  65.383  13.406  1.00 53.34  ? 99   VAL A O   1 
ATOM   738   C CB  . VAL A 1 101 ? 32.081  63.225  12.707  1.00 66.25  ? 99   VAL A CB  1 
ATOM   739   C CG1 . VAL A 1 101 ? 33.219  63.460  13.678  1.00 66.29  ? 99   VAL A CG1 1 
ATOM   740   C CG2 . VAL A 1 101 ? 32.318  61.977  11.867  1.00 66.89  ? 99   VAL A CG2 1 
ATOM   741   N N   . THR A 1 102 ? 30.557  64.535  15.431  1.00 75.75  ? 100  THR A N   1 
ATOM   742   C CA  . THR A 1 102 ? 30.248  65.756  16.180  1.00 76.54  ? 100  THR A CA  1 
ATOM   743   C C   . THR A 1 102 ? 31.444  66.686  16.309  1.00 77.94  ? 100  THR A C   1 
ATOM   744   O O   . THR A 1 102 ? 32.590  66.240  16.279  1.00 77.65  ? 100  THR A O   1 
ATOM   745   C CB  . THR A 1 102 ? 29.780  65.424  17.602  1.00 63.82  ? 100  THR A CB  1 
ATOM   746   O OG1 . THR A 1 102 ? 28.679  64.518  17.532  1.00 66.70  ? 100  THR A OG1 1 
ATOM   747   C CG2 . THR A 1 102 ? 29.341  66.682  18.335  1.00 63.46  ? 100  THR A CG2 1 
ATOM   748   N N   . ILE A 1 103 ? 31.177  67.981  16.454  1.00 73.48  ? 101  ILE A N   1 
ATOM   749   C CA  . ILE A 1 103 ? 32.256  68.947  16.614  1.00 74.42  ? 101  ILE A CA  1 
ATOM   750   C C   . ILE A 1 103 ? 32.954  68.563  17.909  1.00 75.90  ? 101  ILE A C   1 
ATOM   751   O O   . ILE A 1 103 ? 34.155  68.278  17.929  1.00 75.95  ? 101  ILE A O   1 
ATOM   752   C CB  . ILE A 1 103 ? 31.718  70.382  16.745  1.00 66.32  ? 101  ILE A CB  1 
ATOM   753   C CG1 . ILE A 1 103 ? 30.787  70.695  15.573  1.00 67.63  ? 101  ILE A CG1 1 
ATOM   754   C CG2 . ILE A 1 103 ? 32.876  71.369  16.761  1.00 64.91  ? 101  ILE A CG2 1 
ATOM   755   C CD1 . ILE A 1 103 ? 30.162  72.068  15.634  1.00 67.34  ? 101  ILE A CD1 1 
ATOM   756   N N   . SER A 1 104 ? 32.177  68.546  18.987  1.00 62.20  ? 102  SER A N   1 
ATOM   757   C CA  . SER A 1 104 ? 32.682  68.176  20.297  1.00 64.24  ? 102  SER A CA  1 
ATOM   758   C C   . SER A 1 104 ? 33.729  67.080  20.176  1.00 64.26  ? 102  SER A C   1 
ATOM   759   O O   . SER A 1 104 ? 34.911  67.293  20.448  1.00 64.27  ? 102  SER A O   1 
ATOM   760   C CB  . SER A 1 104 ? 31.537  67.671  21.166  1.00 96.95  ? 102  SER A CB  1 
ATOM   761   O OG  . SER A 1 104 ? 32.043  66.891  22.230  1.00 101.97 ? 102  SER A OG  1 
ATOM   762   N N   . SER A 1 105 ? 33.275  65.908  19.754  1.00 75.65  ? 103  SER A N   1 
ATOM   763   C CA  . SER A 1 105 ? 34.139  64.749  19.593  1.00 78.24  ? 103  SER A CA  1 
ATOM   764   C C   . SER A 1 105 ? 35.509  65.106  19.039  1.00 77.27  ? 103  SER A C   1 
ATOM   765   O O   . SER A 1 105 ? 36.510  64.500  19.412  1.00 77.59  ? 103  SER A O   1 
ATOM   766   C CB  . SER A 1 105 ? 33.472  63.724  18.674  1.00 148.74 ? 103  SER A CB  1 
ATOM   767   O OG  . SER A 1 105 ? 33.272  64.253  17.376  1.00 150.29 ? 103  SER A OG  1 
ATOM   768   N N   . ILE A 1 106 ? 35.553  66.089  18.150  1.00 66.77  ? 104  ILE A N   1 
ATOM   769   C CA  . ILE A 1 106 ? 36.815  66.494  17.555  1.00 67.49  ? 104  ILE A CA  1 
ATOM   770   C C   . ILE A 1 106 ? 37.554  67.496  18.415  1.00 68.40  ? 104  ILE A C   1 
ATOM   771   O O   . ILE A 1 106 ? 38.705  67.263  18.777  1.00 70.27  ? 104  ILE A O   1 
ATOM   772   C CB  . ILE A 1 106 ? 36.604  67.093  16.167  1.00 74.76  ? 104  ILE A CB  1 
ATOM   773   C CG1 . ILE A 1 106 ? 35.941  66.053  15.268  1.00 75.15  ? 104  ILE A CG1 1 
ATOM   774   C CG2 . ILE A 1 106 ? 37.937  67.529  15.578  1.00 72.03  ? 104  ILE A CG2 1 
ATOM   775   C CD1 . ILE A 1 106 ? 35.533  66.595  13.934  1.00 76.51  ? 104  ILE A CD1 1 
ATOM   776   N N   . GLU A 1 107 ? 36.908  68.612  18.738  1.00 82.05  ? 105  GLU A N   1 
ATOM   777   C CA  . GLU A 1 107 ? 37.551  69.616  19.578  1.00 82.48  ? 105  GLU A CA  1 
ATOM   778   C C   . GLU A 1 107 ? 38.121  68.907  20.789  1.00 83.69  ? 105  GLU A C   1 
ATOM   779   O O   . GLU A 1 107 ? 39.329  68.910  21.021  1.00 85.32  ? 105  GLU A O   1 
ATOM   780   C CB  . GLU A 1 107 ? 36.553  70.665  20.068  1.00 70.67  ? 105  GLU A CB  1 
ATOM   781   C CG  . GLU A 1 107 ? 35.961  71.531  18.985  1.00 70.96  ? 105  GLU A CG  1 
ATOM   782   C CD  . GLU A 1 107 ? 35.264  72.765  19.535  1.00 71.06  ? 105  GLU A CD  1 
ATOM   783   O OE1 . GLU A 1 107 ? 34.517  72.638  20.537  1.00 70.43  ? 105  GLU A OE1 1 
ATOM   784   O OE2 . GLU A 1 107 ? 35.461  73.857  18.952  1.00 69.61  ? 105  GLU A OE2 1 
ATOM   785   N N   . LYS A 1 108 ? 37.226  68.292  21.551  1.00 78.85  ? 106  LYS A N   1 
ATOM   786   C CA  . LYS A 1 108 ? 37.589  67.569  22.760  1.00 80.25  ? 106  LYS A CA  1 
ATOM   787   C C   . LYS A 1 108 ? 38.253  66.239  22.439  1.00 78.60  ? 106  LYS A C   1 
ATOM   788   O O   . LYS A 1 108 ? 37.711  65.170  22.728  1.00 79.25  ? 106  LYS A O   1 
ATOM   789   C CB  . LYS A 1 108 ? 36.338  67.341  23.590  1.00 121.18 ? 106  LYS A CB  1 
ATOM   790   C CG  . LYS A 1 108 ? 35.517  68.594  23.719  1.00 124.57 ? 106  LYS A CG  1 
ATOM   791   C CD  . LYS A 1 108 ? 34.188  68.309  24.354  1.00 127.44 ? 106  LYS A CD  1 
ATOM   792   C CE  . LYS A 1 108 ? 33.370  69.577  24.435  1.00 129.17 ? 106  LYS A CE  1 
ATOM   793   N NZ  . LYS A 1 108 ? 32.067  69.348  25.111  1.00 130.84 ? 106  LYS A NZ  1 
ATOM   794   N N   . LYS A 1 109 ? 39.437  66.327  21.847  1.00 52.24  ? 107  LYS A N   1 
ATOM   795   C CA  . LYS A 1 109 ? 40.218  65.167  21.461  1.00 53.57  ? 107  LYS A CA  1 
ATOM   796   C C   . LYS A 1 109 ? 41.389  65.753  20.700  1.00 54.72  ? 107  LYS A C   1 
ATOM   797   O O   . LYS A 1 109 ? 42.498  65.225  20.733  1.00 55.38  ? 107  LYS A O   1 
ATOM   798   C CB  . LYS A 1 109 ? 39.395  64.257  20.549  1.00 111.11 ? 107  LYS A CB  1 
ATOM   799   C CG  . LYS A 1 109 ? 39.545  62.774  20.838  1.00 115.94 ? 107  LYS A CG  1 
ATOM   800   C CD  . LYS A 1 109 ? 40.599  62.104  19.976  1.00 117.37 ? 107  LYS A CD  1 
ATOM   801   C CE  . LYS A 1 109 ? 40.568  60.601  20.205  1.00 119.77 ? 107  LYS A CE  1 
ATOM   802   N NZ  . LYS A 1 109 ? 41.256  59.837  19.135  1.00 119.62 ? 107  LYS A NZ  1 
ATOM   803   N N   . LEU A 1 110 ? 41.114  66.867  20.025  1.00 100.68 ? 108  LEU A N   1 
ATOM   804   C CA  . LEU A 1 110 ? 42.099  67.601  19.232  1.00 101.83 ? 108  LEU A CA  1 
ATOM   805   C C   . LEU A 1 110 ? 42.699  68.704  20.102  1.00 104.09 ? 108  LEU A C   1 
ATOM   806   O O   . LEU A 1 110 ? 43.647  69.391  19.713  1.00 104.10 ? 108  LEU A O   1 
ATOM   807   C CB  . LEU A 1 110 ? 41.419  68.205  18.000  1.00 55.92  ? 108  LEU A CB  1 
ATOM   808   C CG  . LEU A 1 110 ? 42.281  68.681  16.831  1.00 53.44  ? 108  LEU A CG  1 
ATOM   809   C CD1 . LEU A 1 110 ? 43.211  67.574  16.374  1.00 53.41  ? 108  LEU A CD1 1 
ATOM   810   C CD2 . LEU A 1 110 ? 41.378  69.098  15.694  1.00 52.25  ? 108  LEU A CD2 1 
ATOM   811   N N   . SER A 1 111 ? 42.112  68.864  21.283  1.00 94.89  ? 109  SER A N   1 
ATOM   812   C CA  . SER A 1 111 ? 42.556  69.837  22.269  1.00 96.03  ? 109  SER A CA  1 
ATOM   813   C C   . SER A 1 111 ? 43.838  69.263  22.848  1.00 97.25  ? 109  SER A C   1 
ATOM   814   O O   . SER A 1 111 ? 44.713  69.987  23.322  1.00 98.00  ? 109  SER A O   1 
ATOM   815   C CB  . SER A 1 111 ? 41.509  69.959  23.370  1.00 86.16  ? 109  SER A CB  1 
ATOM   816   O OG  . SER A 1 111 ? 41.222  68.678  23.910  1.00 85.44  ? 109  SER A OG  1 
ATOM   817   N N   . ALA A 1 112 ? 43.929  67.939  22.799  1.00 70.84  ? 110  ALA A N   1 
ATOM   818   C CA  . ALA A 1 112 ? 45.088  67.221  23.297  1.00 71.64  ? 110  ALA A CA  1 
ATOM   819   C C   . ALA A 1 112 ? 46.299  67.440  22.387  1.00 73.26  ? 110  ALA A C   1 
ATOM   820   O O   . ALA A 1 112 ? 47.144  66.560  22.242  1.00 73.33  ? 110  ALA A O   1 
ATOM   821   C CB  . ALA A 1 112 ? 44.768  65.737  23.402  1.00 51.98  ? 110  ALA A CB  1 
ATOM   822   N N   . PHE A 1 113 ? 46.367  68.609  21.761  1.00 94.25  ? 111  PHE A N   1 
ATOM   823   C CA  . PHE A 1 113 ? 47.482  68.961  20.886  1.00 97.05  ? 111  PHE A CA  1 
ATOM   824   C C   . PHE A 1 113 ? 47.609  70.474  20.874  1.00 99.37  ? 111  PHE A C   1 
ATOM   825   O O   . PHE A 1 113 ? 48.696  71.030  21.034  1.00 100.07 ? 111  PHE A O   1 
ATOM   826   C CB  . PHE A 1 113 ? 47.255  68.459  19.454  1.00 102.25 ? 111  PHE A CB  1 
ATOM   827   C CG  . PHE A 1 113 ? 47.412  66.977  19.298  1.00 102.74 ? 111  PHE A CG  1 
ATOM   828   C CD1 . PHE A 1 113 ? 46.364  66.119  19.591  1.00 103.97 ? 111  PHE A CD1 1 
ATOM   829   C CD2 . PHE A 1 113 ? 48.623  66.434  18.888  1.00 103.13 ? 111  PHE A CD2 1 
ATOM   830   C CE1 . PHE A 1 113 ? 46.517  64.740  19.481  1.00 104.23 ? 111  PHE A CE1 1 
ATOM   831   C CE2 . PHE A 1 113 ? 48.788  65.057  18.775  1.00 103.13 ? 111  PHE A CE2 1 
ATOM   832   C CZ  . PHE A 1 113 ? 47.732  64.208  19.073  1.00 103.36 ? 111  PHE A CZ  1 
ATOM   833   N N   . ARG A 1 114 ? 46.476  71.134  20.683  1.00 99.77  ? 112  ARG A N   1 
ATOM   834   C CA  . ARG A 1 114 ? 46.434  72.582  20.652  1.00 102.19 ? 112  ARG A CA  1 
ATOM   835   C C   . ARG A 1 114 ? 45.459  72.973  21.752  1.00 102.37 ? 112  ARG A C   1 
ATOM   836   O O   . ARG A 1 114 ? 44.459  72.291  21.967  1.00 102.41 ? 112  ARG A O   1 
ATOM   837   C CB  . ARG A 1 114 ? 45.920  73.052  19.290  1.00 138.09 ? 112  ARG A CB  1 
ATOM   838   C CG  . ARG A 1 114 ? 46.393  74.430  18.875  1.00 140.14 ? 112  ARG A CG  1 
ATOM   839   C CD  . ARG A 1 114 ? 47.869  74.435  18.516  1.00 142.12 ? 112  ARG A CD  1 
ATOM   840   N NE  . ARG A 1 114 ? 48.297  75.722  17.970  1.00 144.78 ? 112  ARG A NE  1 
ATOM   841   C CZ  . ARG A 1 114 ? 49.486  75.937  17.415  1.00 145.95 ? 112  ARG A CZ  1 
ATOM   842   N NH1 . ARG A 1 114 ? 50.363  74.947  17.335  1.00 146.21 ? 112  ARG A NH1 1 
ATOM   843   N NH2 . ARG A 1 114 ? 49.801  77.136  16.939  1.00 145.56 ? 112  ARG A NH2 1 
ATOM   844   N N   . PRO A 1 115 ? 45.743  74.062  22.478  1.00 110.16 ? 113  PRO A N   1 
ATOM   845   C CA  . PRO A 1 115 ? 44.834  74.476  23.548  1.00 109.99 ? 113  PRO A CA  1 
ATOM   846   C C   . PRO A 1 115 ? 43.417  74.731  23.038  1.00 109.53 ? 113  PRO A C   1 
ATOM   847   O O   . PRO A 1 115 ? 42.453  74.165  23.553  1.00 111.02 ? 113  PRO A O   1 
ATOM   848   C CB  . PRO A 1 115 ? 45.494  75.740  24.087  1.00 179.91 ? 113  PRO A CB  1 
ATOM   849   C CG  . PRO A 1 115 ? 46.954  75.461  23.875  1.00 181.46 ? 113  PRO A CG  1 
ATOM   850   C CD  . PRO A 1 115 ? 46.963  74.888  22.477  1.00 180.60 ? 113  PRO A CD  1 
ATOM   851   N N   . ALA A 1 116 ? 43.302  75.577  22.020  1.00 93.38  ? 114  ALA A N   1 
ATOM   852   C CA  . ALA A 1 116 ? 42.005  75.910  21.446  1.00 91.19  ? 114  ALA A CA  1 
ATOM   853   C C   . ALA A 1 116 ? 41.955  75.669  19.942  1.00 89.77  ? 114  ALA A C   1 
ATOM   854   O O   . ALA A 1 116 ? 42.335  76.530  19.146  1.00 90.29  ? 114  ALA A O   1 
ATOM   855   C CB  . ALA A 1 116 ? 41.658  77.359  21.749  1.00 51.33  ? 114  ALA A CB  1 
ATOM   856   N N   . PRO A 1 117 ? 41.491  74.482  19.534  1.00 91.59  ? 115  PRO A N   1 
ATOM   857   C CA  . PRO A 1 117 ? 41.407  74.180  18.106  1.00 89.18  ? 115  PRO A CA  1 
ATOM   858   C C   . PRO A 1 117 ? 40.206  74.878  17.451  1.00 87.70  ? 115  PRO A C   1 
ATOM   859   O O   . PRO A 1 117 ? 39.093  74.859  17.981  1.00 86.66  ? 115  PRO A O   1 
ATOM   860   C CB  . PRO A 1 117 ? 41.298  72.657  18.091  1.00 68.54  ? 115  PRO A CB  1 
ATOM   861   C CG  . PRO A 1 117 ? 40.539  72.364  19.357  1.00 67.80  ? 115  PRO A CG  1 
ATOM   862   C CD  . PRO A 1 117 ? 41.211  73.283  20.348  1.00 69.79  ? 115  PRO A CD  1 
ATOM   863   N N   . ARG A 1 118 ? 40.445  75.501  16.302  1.00 91.36  ? 116  ARG A N   1 
ATOM   864   C CA  . ARG A 1 118 ? 39.401  76.209  15.566  1.00 89.71  ? 116  ARG A CA  1 
ATOM   865   C C   . ARG A 1 118 ? 38.736  75.248  14.580  1.00 87.95  ? 116  ARG A C   1 
ATOM   866   O O   . ARG A 1 118 ? 39.344  74.865  13.579  1.00 86.99  ? 116  ARG A O   1 
ATOM   867   C CB  . ARG A 1 118 ? 40.031  77.380  14.822  1.00 86.64  ? 116  ARG A CB  1 
ATOM   868   C CG  . ARG A 1 118 ? 40.877  78.267  15.720  1.00 88.65  ? 116  ARG A CG  1 
ATOM   869   C CD  . ARG A 1 118 ? 41.789  79.143  14.896  1.00 91.55  ? 116  ARG A CD  1 
ATOM   870   N NE  . ARG A 1 118 ? 41.041  80.035  14.016  1.00 93.86  ? 116  ARG A NE  1 
ATOM   871   C CZ  . ARG A 1 118 ? 41.548  80.598  12.923  1.00 94.50  ? 116  ARG A CZ  1 
ATOM   872   N NH1 . ARG A 1 118 ? 42.804  80.357  12.575  1.00 94.31  ? 116  ARG A NH1 1 
ATOM   873   N NH2 . ARG A 1 118 ? 40.804  81.405  12.180  1.00 94.44  ? 116  ARG A NH2 1 
ATOM   874   N N   . VAL A 1 119 ? 37.485  74.876  14.853  1.00 83.09  ? 117  VAL A N   1 
ATOM   875   C CA  . VAL A 1 119 ? 36.777  73.920  13.997  1.00 80.18  ? 117  VAL A CA  1 
ATOM   876   C C   . VAL A 1 119 ? 35.293  74.191  13.746  1.00 78.64  ? 117  VAL A C   1 
ATOM   877   O O   . VAL A 1 119 ? 34.594  74.755  14.590  1.00 77.41  ? 117  VAL A O   1 
ATOM   878   C CB  . VAL A 1 119 ? 36.881  72.506  14.587  1.00 77.58  ? 117  VAL A CB  1 
ATOM   879   C CG1 . VAL A 1 119 ? 36.173  72.468  15.927  1.00 77.67  ? 117  VAL A CG1 1 
ATOM   880   C CG2 . VAL A 1 119 ? 36.275  71.488  13.642  1.00 77.47  ? 117  VAL A CG2 1 
ATOM   881   N N   . ILE A 1 120 ? 34.828  73.750  12.577  1.00 77.80  ? 118  ILE A N   1 
ATOM   882   C CA  . ILE A 1 120 ? 33.434  73.890  12.157  1.00 75.99  ? 118  ILE A CA  1 
ATOM   883   C C   . ILE A 1 120 ? 32.944  72.631  11.458  1.00 73.97  ? 118  ILE A C   1 
ATOM   884   O O   . ILE A 1 120 ? 33.644  72.050  10.624  1.00 72.19  ? 118  ILE A O   1 
ATOM   885   C CB  . ILE A 1 120 ? 33.242  75.047  11.173  1.00 73.01  ? 118  ILE A CB  1 
ATOM   886   C CG1 . ILE A 1 120 ? 34.293  74.952  10.070  1.00 72.29  ? 118  ILE A CG1 1 
ATOM   887   C CG2 . ILE A 1 120 ? 33.302  76.369  11.907  1.00 74.38  ? 118  ILE A CG2 1 
ATOM   888   C CD1 . ILE A 1 120 ? 34.238  76.085  9.087   1.00 70.50  ? 118  ILE A CD1 1 
ATOM   889   N N   . ARG A 1 121 ? 31.732  72.218  11.804  1.00 76.38  ? 119  ARG A N   1 
ATOM   890   C CA  . ARG A 1 121 ? 31.146  71.033  11.206  1.00 75.04  ? 119  ARG A CA  1 
ATOM   891   C C   . ARG A 1 121 ? 30.510  71.449  9.899   1.00 73.23  ? 119  ARG A C   1 
ATOM   892   O O   . ARG A 1 121 ? 29.847  72.480  9.811   1.00 71.94  ? 119  ARG A O   1 
ATOM   893   C CB  . ARG A 1 121 ? 30.095  70.420  12.132  1.00 66.91  ? 119  ARG A CB  1 
ATOM   894   C CG  . ARG A 1 121 ? 29.579  69.067  11.665  1.00 66.00  ? 119  ARG A CG  1 
ATOM   895   C CD  . ARG A 1 121 ? 28.743  68.407  12.739  1.00 66.12  ? 119  ARG A CD  1 
ATOM   896   N NE  . ARG A 1 121 ? 28.101  67.197  12.246  1.00 68.26  ? 119  ARG A NE  1 
ATOM   897   C CZ  . ARG A 1 121 ? 27.367  66.387  12.998  1.00 71.21  ? 119  ARG A CZ  1 
ATOM   898   N NH1 . ARG A 1 121 ? 27.184  66.656  14.285  1.00 72.30  ? 119  ARG A NH1 1 
ATOM   899   N NH2 . ARG A 1 121 ? 26.799  65.314  12.459  1.00 73.82  ? 119  ARG A NH2 1 
ATOM   900   N N   . CYS A 1 122 ? 30.710  70.639  8.876   1.00 61.97  ? 120  CYS A N   1 
ATOM   901   C CA  . CYS A 1 122 ? 30.170  70.970  7.584   1.00 60.06  ? 120  CYS A CA  1 
ATOM   902   C C   . CYS A 1 122 ? 29.295  69.870  7.015   1.00 58.94  ? 120  CYS A C   1 
ATOM   903   O O   . CYS A 1 122 ? 29.366  68.714  7.442   1.00 60.96  ? 120  CYS A O   1 
ATOM   904   C CB  . CYS A 1 122 ? 31.332  71.303  6.663   1.00 72.02  ? 120  CYS A CB  1 
ATOM   905   S SG  . CYS A 1 122 ? 31.294  70.583  5.000   1.00 76.76  ? 120  CYS A SG  1 
ATOM   906   N N   . MET A 1 123 ? 28.448  70.252  6.065   1.00 62.86  ? 121  MET A N   1 
ATOM   907   C CA  . MET A 1 123 ? 27.528  69.325  5.407   1.00 59.28  ? 121  MET A CA  1 
ATOM   908   C C   . MET A 1 123 ? 27.143  69.880  4.034   1.00 55.55  ? 121  MET A C   1 
ATOM   909   O O   . MET A 1 123 ? 26.624  70.989  3.929   1.00 53.04  ? 121  MET A O   1 
ATOM   910   C CB  . MET A 1 123 ? 26.282  69.142  6.264   1.00 64.97  ? 121  MET A CB  1 
ATOM   911   C CG  . MET A 1 123 ? 25.813  67.710  6.357   1.00 65.80  ? 121  MET A CG  1 
ATOM   912   S SD  . MET A 1 123 ? 25.739  66.880  4.757   1.00 62.63  ? 121  MET A SD  1 
ATOM   913   C CE  . MET A 1 123 ? 27.101  65.738  4.926   1.00 62.17  ? 121  MET A CE  1 
ATOM   914   N N   . THR A 1 124 ? 27.386  69.101  2.986   1.00 62.57  ? 122  THR A N   1 
ATOM   915   C CA  . THR A 1 124 ? 27.106  69.552  1.631   1.00 60.93  ? 122  THR A CA  1 
ATOM   916   C C   . THR A 1 124 ? 26.464  68.454  0.798   1.00 60.34  ? 122  THR A C   1 
ATOM   917   O O   . THR A 1 124 ? 25.564  67.758  1.269   1.00 63.01  ? 122  THR A O   1 
ATOM   918   C CB  . THR A 1 124 ? 28.419  69.984  0.970   1.00 56.15  ? 122  THR A CB  1 
ATOM   919   O OG1 . THR A 1 124 ? 29.132  70.813  1.891   1.00 58.02  ? 122  THR A OG1 1 
ATOM   920   C CG2 . THR A 1 124 ? 28.174  70.762  -0.326  1.00 57.55  ? 122  THR A CG2 1 
ATOM   921   N N   . ASN A 1 125 ? 26.932  68.326  -0.446  1.00 46.85  ? 123  ASN A N   1 
ATOM   922   C CA  . ASN A 1 125 ? 26.474  67.320  -1.404  1.00 42.62  ? 123  ASN A CA  1 
ATOM   923   C C   . ASN A 1 125 ? 27.101  67.530  -2.768  1.00 41.25  ? 123  ASN A C   1 
ATOM   924   O O   . ASN A 1 125 ? 27.298  68.654  -3.211  1.00 39.86  ? 123  ASN A O   1 
ATOM   925   C CB  . ASN A 1 125 ? 24.947  67.307  -1.534  1.00 39.22  ? 123  ASN A CB  1 
ATOM   926   C CG  . ASN A 1 125 ? 24.367  68.670  -1.811  1.00 36.35  ? 123  ASN A CG  1 
ATOM   927   O OD1 . ASN A 1 125 ? 23.149  68.817  -1.877  1.00 33.84  ? 123  ASN A OD1 1 
ATOM   928   N ND2 . ASN A 1 125 ? 25.224  69.676  -1.972  1.00 33.62  ? 123  ASN A ND2 1 
ATOM   929   N N   . THR A 1 126 ? 27.409  66.424  -3.427  1.00 42.33  ? 124  THR A N   1 
ATOM   930   C CA  . THR A 1 126 ? 28.030  66.428  -4.740  1.00 44.01  ? 124  THR A CA  1 
ATOM   931   C C   . THR A 1 126 ? 27.633  67.547  -5.706  1.00 42.36  ? 124  THR A C   1 
ATOM   932   O O   . THR A 1 126 ? 28.503  68.112  -6.368  1.00 40.47  ? 124  THR A O   1 
ATOM   933   C CB  . THR A 1 126 ? 27.813  65.073  -5.424  1.00 61.44  ? 124  THR A CB  1 
ATOM   934   O OG1 . THR A 1 126 ? 26.457  64.653  -5.227  1.00 64.56  ? 124  THR A OG1 1 
ATOM   935   C CG2 . THR A 1 126 ? 28.770  64.030  -4.843  1.00 60.79  ? 124  THR A CG2 1 
ATOM   936   N N   . PRO A 1 127 ? 26.327  67.886  -5.806  1.00 45.77  ? 125  PRO A N   1 
ATOM   937   C CA  . PRO A 1 127 ? 25.899  68.959  -6.722  1.00 45.70  ? 125  PRO A CA  1 
ATOM   938   C C   . PRO A 1 127 ? 26.716  70.245  -6.593  1.00 46.10  ? 125  PRO A C   1 
ATOM   939   O O   . PRO A 1 127 ? 26.619  71.159  -7.408  1.00 44.64  ? 125  PRO A O   1 
ATOM   940   C CB  . PRO A 1 127 ? 24.428  69.165  -6.358  1.00 40.64  ? 125  PRO A CB  1 
ATOM   941   C CG  . PRO A 1 127 ? 24.365  68.719  -4.928  1.00 40.42  ? 125  PRO A CG  1 
ATOM   942   C CD  . PRO A 1 127 ? 25.199  67.463  -4.963  1.00 42.23  ? 125  PRO A CD  1 
ATOM   943   N N   . VAL A 1 128 ? 27.524  70.310  -5.549  1.00 54.19  ? 126  VAL A N   1 
ATOM   944   C CA  . VAL A 1 128 ? 28.368  71.461  -5.340  1.00 54.93  ? 126  VAL A CA  1 
ATOM   945   C C   . VAL A 1 128 ? 29.236  71.551  -6.613  1.00 57.68  ? 126  VAL A C   1 
ATOM   946   O O   . VAL A 1 128 ? 29.527  72.641  -7.096  1.00 57.91  ? 126  VAL A O   1 
ATOM   947   C CB  . VAL A 1 128 ? 29.190  71.262  -4.016  1.00 45.97  ? 126  VAL A CB  1 
ATOM   948   C CG1 . VAL A 1 128 ? 30.514  70.550  -4.277  1.00 43.79  ? 126  VAL A CG1 1 
ATOM   949   C CG2 . VAL A 1 128 ? 29.357  72.588  -3.304  1.00 42.56  ? 126  VAL A CG2 1 
ATOM   950   N N   . VAL A 1 129 ? 29.580  70.388  -7.177  1.00 49.96  ? 127  VAL A N   1 
ATOM   951   C CA  . VAL A 1 129 ? 30.395  70.280  -8.398  1.00 52.45  ? 127  VAL A CA  1 
ATOM   952   C C   . VAL A 1 129 ? 30.008  71.316  -9.449  1.00 54.33  ? 127  VAL A C   1 
ATOM   953   O O   . VAL A 1 129 ? 30.858  71.879  -10.142 1.00 53.02  ? 127  VAL A O   1 
ATOM   954   C CB  . VAL A 1 129 ? 30.269  68.872  -9.043  1.00 43.20  ? 127  VAL A CB  1 
ATOM   955   C CG1 . VAL A 1 129 ? 31.136  68.789  -10.297 1.00 43.48  ? 127  VAL A CG1 1 
ATOM   956   C CG2 . VAL A 1 129 ? 30.687  67.808  -8.050  1.00 44.91  ? 127  VAL A CG2 1 
ATOM   957   N N   . VAL A 1 130 ? 28.717  71.551  -9.596  1.00 83.70  ? 128  VAL A N   1 
ATOM   958   C CA  . VAL A 1 130 ? 28.314  72.550  -10.550 1.00 86.37  ? 128  VAL A CA  1 
ATOM   959   C C   . VAL A 1 130 ? 28.402  73.864  -9.796  1.00 89.24  ? 128  VAL A C   1 
ATOM   960   O O   . VAL A 1 130 ? 29.205  74.727  -10.139 1.00 91.29  ? 128  VAL A O   1 
ATOM   961   C CB  . VAL A 1 130 ? 26.892  72.313  -11.052 1.00 62.25  ? 128  VAL A CB  1 
ATOM   962   C CG1 . VAL A 1 130 ? 26.473  73.459  -11.942 1.00 62.98  ? 128  VAL A CG1 1 
ATOM   963   C CG2 . VAL A 1 130 ? 26.829  70.998  -11.818 1.00 60.83  ? 128  VAL A CG2 1 
ATOM   964   N N   . ARG A 1 131 ? 27.605  73.989  -8.742  1.00 54.24  ? 129  ARG A N   1 
ATOM   965   C CA  . ARG A 1 131 ? 27.588  75.191  -7.929  1.00 55.15  ? 129  ARG A CA  1 
ATOM   966   C C   . ARG A 1 131 ? 26.250  75.224  -7.226  1.00 53.91  ? 129  ARG A C   1 
ATOM   967   O O   . ARG A 1 131 ? 25.889  76.219  -6.613  1.00 56.27  ? 129  ARG A O   1 
ATOM   968   C CB  . ARG A 1 131 ? 27.906  76.419  -8.783  1.00 108.30 ? 129  ARG A CB  1 
ATOM   969   C CG  . ARG A 1 131 ? 28.495  77.581  -8.002  1.00 118.69 ? 129  ARG A CG  1 
ATOM   970   C CD  . ARG A 1 131 ? 28.559  78.840  -8.850  1.00 125.93 ? 129  ARG A CD  1 
ATOM   971   N NE  . ARG A 1 131 ? 29.124  79.967  -8.114  1.00 131.90 ? 129  ARG A NE  1 
ATOM   972   C CZ  . ARG A 1 131 ? 29.290  81.183  -8.623  1.00 133.64 ? 129  ARG A CZ  1 
ATOM   973   N NH1 . ARG A 1 131 ? 28.934  81.431  -9.875  1.00 135.52 ? 129  ARG A NH1 1 
ATOM   974   N NH2 . ARG A 1 131 ? 29.812  82.147  -7.879  1.00 133.66 ? 129  ARG A NH2 1 
ATOM   975   N N   . GLU A 1 132 ? 25.495  74.139  -7.318  1.00 56.66  ? 130  GLU A N   1 
ATOM   976   C CA  . GLU A 1 132 ? 24.199  74.120  -6.663  1.00 55.55  ? 130  GLU A CA  1 
ATOM   977   C C   . GLU A 1 132 ? 24.214  73.313  -5.387  1.00 53.51  ? 130  GLU A C   1 
ATOM   978   O O   . GLU A 1 132 ? 23.171  73.114  -4.774  1.00 53.86  ? 130  GLU A O   1 
ATOM   979   C CB  . GLU A 1 132 ? 23.119  73.559  -7.580  1.00 72.68  ? 130  GLU A CB  1 
ATOM   980   C CG  . GLU A 1 132 ? 22.897  74.327  -8.872  1.00 74.20  ? 130  GLU A CG  1 
ATOM   981   C CD  . GLU A 1 132 ? 22.711  75.819  -8.661  1.00 73.38  ? 130  GLU A CD  1 
ATOM   982   O OE1 . GLU A 1 132 ? 22.022  76.205  -7.692  1.00 71.67  ? 130  GLU A OE1 1 
ATOM   983   O OE2 . GLU A 1 132 ? 23.242  76.602  -9.480  1.00 70.94  ? 130  GLU A OE2 1 
ATOM   984   N N   . GLY A 1 133 ? 25.388  72.835  -4.988  1.00 61.78  ? 131  GLY A N   1 
ATOM   985   C CA  . GLY A 1 133 ? 25.462  72.070  -3.759  1.00 58.53  ? 131  GLY A CA  1 
ATOM   986   C C   . GLY A 1 133 ? 24.702  72.812  -2.675  1.00 56.18  ? 131  GLY A C   1 
ATOM   987   O O   . GLY A 1 133 ? 24.693  74.042  -2.651  1.00 56.19  ? 131  GLY A O   1 
ATOM   988   N N   . ALA A 1 134 ? 24.034  72.077  -1.798  1.00 41.56  ? 132  ALA A N   1 
ATOM   989   C CA  . ALA A 1 134 ? 23.294  72.706  -0.715  1.00 42.32  ? 132  ALA A CA  1 
ATOM   990   C C   . ALA A 1 134 ? 24.107  72.475  0.546   1.00 43.66  ? 132  ALA A C   1 
ATOM   991   O O   . ALA A 1 134 ? 24.292  71.328  0.977   1.00 41.88  ? 132  ALA A O   1 
ATOM   992   C CB  . ALA A 1 134 ? 21.922  72.083  -0.574  1.00 52.24  ? 132  ALA A CB  1 
ATOM   993   N N   . THR A 1 135 ? 24.600  73.563  1.133   1.00 58.82  ? 133  THR A N   1 
ATOM   994   C CA  . THR A 1 135 ? 25.414  73.449  2.329   1.00 61.08  ? 133  THR A CA  1 
ATOM   995   C C   . THR A 1 135 ? 24.862  74.155  3.548   1.00 62.93  ? 133  THR A C   1 
ATOM   996   O O   . THR A 1 135 ? 24.071  75.092  3.455   1.00 64.20  ? 133  THR A O   1 
ATOM   997   C CB  . THR A 1 135 ? 26.829  73.968  2.080   1.00 46.74  ? 133  THR A CB  1 
ATOM   998   O OG1 . THR A 1 135 ? 27.362  73.339  0.907   1.00 44.17  ? 133  THR A OG1 1 
ATOM   999   C CG2 . THR A 1 135 ? 27.727  73.661  3.284   1.00 45.22  ? 133  THR A CG2 1 
ATOM   1000  N N   . VAL A 1 136 ? 25.309  73.673  4.694   1.00 55.39  ? 134  VAL A N   1 
ATOM   1001  C CA  . VAL A 1 136 ? 24.923  74.181  5.990   1.00 57.62  ? 134  VAL A CA  1 
ATOM   1002  C C   . VAL A 1 136 ? 26.122  73.838  6.860   1.00 60.32  ? 134  VAL A C   1 
ATOM   1003  O O   . VAL A 1 136 ? 26.842  72.886  6.556   1.00 62.48  ? 134  VAL A O   1 
ATOM   1004  C CB  . VAL A 1 136 ? 23.666  73.453  6.495   1.00 44.12  ? 134  VAL A CB  1 
ATOM   1005  C CG1 . VAL A 1 136 ? 23.816  73.086  7.947   1.00 44.30  ? 134  VAL A CG1 1 
ATOM   1006  C CG2 . VAL A 1 136 ? 22.450  74.330  6.286   1.00 44.63  ? 134  VAL A CG2 1 
ATOM   1007  N N   . TYR A 1 137 ? 26.358  74.614  7.915   1.00 60.76  ? 135  TYR A N   1 
ATOM   1008  C CA  . TYR A 1 137 ? 27.488  74.351  8.807   1.00 63.42  ? 135  TYR A CA  1 
ATOM   1009  C C   . TYR A 1 137 ? 27.188  74.842  10.222  1.00 63.63  ? 135  TYR A C   1 
ATOM   1010  O O   . TYR A 1 137 ? 26.126  75.419  10.486  1.00 62.64  ? 135  TYR A O   1 
ATOM   1011  C CB  . TYR A 1 137 ? 28.754  75.043  8.287   1.00 81.86  ? 135  TYR A CB  1 
ATOM   1012  C CG  . TYR A 1 137 ? 28.660  76.548  8.348   1.00 86.43  ? 135  TYR A CG  1 
ATOM   1013  C CD1 . TYR A 1 137 ? 28.507  77.200  9.569   1.00 89.09  ? 135  TYR A CD1 1 
ATOM   1014  C CD2 . TYR A 1 137 ? 28.649  77.316  7.189   1.00 88.23  ? 135  TYR A CD2 1 
ATOM   1015  C CE1 . TYR A 1 137 ? 28.336  78.562  9.637   1.00 88.99  ? 135  TYR A CE1 1 
ATOM   1016  C CE2 . TYR A 1 137 ? 28.478  78.691  7.249   1.00 88.45  ? 135  TYR A CE2 1 
ATOM   1017  C CZ  . TYR A 1 137 ? 28.319  79.305  8.482   1.00 88.55  ? 135  TYR A CZ  1 
ATOM   1018  O OH  . TYR A 1 137 ? 28.129  80.661  8.578   1.00 88.60  ? 135  TYR A OH  1 
ATOM   1019  N N   . ALA A 1 138 ? 28.140  74.612  11.122  1.00 81.92  ? 136  ALA A N   1 
ATOM   1020  C CA  . ALA A 1 138 ? 28.028  75.035  12.513  1.00 83.74  ? 136  ALA A CA  1 
ATOM   1021  C C   . ALA A 1 138 ? 29.429  75.399  12.988  1.00 84.77  ? 136  ALA A C   1 
ATOM   1022  O O   . ALA A 1 138 ? 30.407  74.726  12.654  1.00 83.94  ? 136  ALA A O   1 
ATOM   1023  C CB  . ALA A 1 138 ? 27.448  73.916  13.371  1.00 98.34  ? 136  ALA A CB  1 
ATOM   1024  N N   . THR A 1 139 ? 29.519  76.473  13.763  1.00 102.61 ? 137  THR A N   1 
ATOM   1025  C CA  . THR A 1 139 ? 30.799  76.944  14.271  1.00 102.16 ? 137  THR A CA  1 
ATOM   1026  C C   . THR A 1 139 ? 31.168  76.334  15.614  1.00 102.67 ? 137  THR A C   1 
ATOM   1027  O O   . THR A 1 139 ? 30.350  76.281  16.534  1.00 103.21 ? 137  THR A O   1 
ATOM   1028  C CB  . THR A 1 139 ? 30.790  78.469  14.416  1.00 77.27  ? 137  THR A CB  1 
ATOM   1029  O OG1 . THR A 1 139 ? 29.647  78.870  15.184  1.00 76.65  ? 137  THR A OG1 1 
ATOM   1030  C CG2 . THR A 1 139 ? 30.734  79.128  13.047  1.00 75.56  ? 137  THR A CG2 1 
ATOM   1031  N N   . GLY A 1 140 ? 32.409  75.874  15.722  1.00 73.30  ? 138  GLY A N   1 
ATOM   1032  C CA  . GLY A 1 140 ? 32.864  75.288  16.967  1.00 74.64  ? 138  GLY A CA  1 
ATOM   1033  C C   . GLY A 1 140 ? 32.839  76.302  18.098  1.00 75.37  ? 138  GLY A C   1 
ATOM   1034  O O   . GLY A 1 140 ? 32.279  77.393  17.971  1.00 75.24  ? 138  GLY A O   1 
ATOM   1035  N N   . THR A 1 141 ? 33.446  75.942  19.219  1.00 82.92  ? 139  THR A N   1 
ATOM   1036  C CA  . THR A 1 141 ? 33.489  76.834  20.365  1.00 84.76  ? 139  THR A CA  1 
ATOM   1037  C C   . THR A 1 141 ? 34.657  77.800  20.207  1.00 85.70  ? 139  THR A C   1 
ATOM   1038  O O   . THR A 1 141 ? 34.593  78.953  20.639  1.00 85.19  ? 139  THR A O   1 
ATOM   1039  C CB  . THR A 1 141 ? 33.626  76.034  21.675  1.00 99.62  ? 139  THR A CB  1 
ATOM   1040  O OG1 . THR A 1 141 ? 34.739  75.136  21.583  1.00 99.82  ? 139  THR A OG1 1 
ATOM   1041  C CG2 . THR A 1 141 ? 32.360  75.228  21.927  1.00 99.64  ? 139  THR A CG2 1 
ATOM   1042  N N   . HIS A 1 142 ? 35.724  77.320  19.580  1.00 73.87  ? 140  HIS A N   1 
ATOM   1043  C CA  . HIS A 1 142 ? 36.892  78.148  19.338  1.00 75.22  ? 140  HIS A CA  1 
ATOM   1044  C C   . HIS A 1 142 ? 36.664  78.773  17.978  1.00 76.06  ? 140  HIS A C   1 
ATOM   1045  O O   . HIS A 1 142 ? 37.574  78.887  17.157  1.00 75.12  ? 140  HIS A O   1 
ATOM   1046  C CB  . HIS A 1 142 ? 38.157  77.293  19.346  1.00 100.96 ? 140  HIS A CB  1 
ATOM   1047  C CG  . HIS A 1 142 ? 38.335  76.519  20.613  1.00 102.23 ? 140  HIS A CG  1 
ATOM   1048  N ND1 . HIS A 1 142 ? 38.084  77.063  21.854  1.00 102.33 ? 140  HIS A ND1 1 
ATOM   1049  C CD2 . HIS A 1 142 ? 38.720  75.240  20.834  1.00 103.71 ? 140  HIS A CD2 1 
ATOM   1050  C CE1 . HIS A 1 142 ? 38.304  76.153  22.785  1.00 102.60 ? 140  HIS A CE1 1 
ATOM   1051  N NE2 . HIS A 1 142 ? 38.691  75.038  22.193  1.00 104.31 ? 140  HIS A NE2 1 
ATOM   1052  N N   . ALA A 1 143 ? 35.416  79.176  17.767  1.00 108.92 ? 141  ALA A N   1 
ATOM   1053  C CA  . ALA A 1 143 ? 34.985  79.784  16.523  1.00 109.91 ? 141  ALA A CA  1 
ATOM   1054  C C   . ALA A 1 143 ? 34.988  81.304  16.562  1.00 109.92 ? 141  ALA A C   1 
ATOM   1055  O O   . ALA A 1 143 ? 34.095  81.931  17.139  1.00 110.74 ? 141  ALA A O   1 
ATOM   1056  C CB  . ALA A 1 143 ? 33.600  79.282  16.171  1.00 134.47 ? 141  ALA A CB  1 
ATOM   1057  N N   . GLN A 1 144 ? 36.000  81.892  15.940  1.00 85.60  ? 142  GLN A N   1 
ATOM   1058  C CA  . GLN A 1 144 ? 36.111  83.337  15.877  1.00 84.64  ? 142  GLN A CA  1 
ATOM   1059  C C   . GLN A 1 144 ? 35.284  83.816  14.693  1.00 83.78  ? 142  GLN A C   1 
ATOM   1060  O O   . GLN A 1 144 ? 35.497  83.386  13.562  1.00 83.96  ? 142  GLN A O   1 
ATOM   1061  C CB  . GLN A 1 144 ? 37.568  83.749  15.694  1.00 107.19 ? 142  GLN A CB  1 
ATOM   1062  C CG  . GLN A 1 144 ? 38.461  83.404  16.862  1.00 107.54 ? 142  GLN A CG  1 
ATOM   1063  C CD  . GLN A 1 144 ? 39.874  83.900  16.658  1.00 109.64 ? 142  GLN A CD  1 
ATOM   1064  O OE1 . GLN A 1 144 ? 40.543  83.519  15.694  1.00 108.58 ? 142  GLN A OE1 1 
ATOM   1065  N NE2 . GLN A 1 144 ? 40.338  84.760  17.562  1.00 110.90 ? 142  GLN A NE2 1 
ATOM   1066  N N   . VAL A 1 145 ? 34.344  84.710  14.974  1.00 91.24  ? 143  VAL A N   1 
ATOM   1067  C CA  . VAL A 1 145 ? 33.431  85.283  13.987  1.00 90.82  ? 143  VAL A CA  1 
ATOM   1068  C C   . VAL A 1 145 ? 33.961  85.592  12.575  1.00 91.43  ? 143  VAL A C   1 
ATOM   1069  O O   . VAL A 1 145 ? 33.176  85.823  11.655  1.00 92.24  ? 143  VAL A O   1 
ATOM   1070  C CB  . VAL A 1 145 ? 32.809  86.566  14.559  1.00 89.02  ? 143  VAL A CB  1 
ATOM   1071  C CG1 . VAL A 1 145 ? 31.720  87.082  13.640  1.00 88.87  ? 143  VAL A CG1 1 
ATOM   1072  C CG2 . VAL A 1 145 ? 32.256  86.284  15.944  1.00 89.35  ? 143  VAL A CG2 1 
ATOM   1073  N N   . GLU A 1 146 ? 35.276  85.593  12.393  1.00 86.66  ? 144  GLU A N   1 
ATOM   1074  C CA  . GLU A 1 146 ? 35.853  85.890  11.083  1.00 85.61  ? 144  GLU A CA  1 
ATOM   1075  C C   . GLU A 1 146 ? 35.971  84.639  10.222  1.00 83.80  ? 144  GLU A C   1 
ATOM   1076  O O   . GLU A 1 146 ? 36.217  84.719  9.018   1.00 82.14  ? 144  GLU A O   1 
ATOM   1077  C CB  . GLU A 1 146 ? 37.240  86.518  11.242  1.00 125.78 ? 144  GLU A CB  1 
ATOM   1078  C CG  . GLU A 1 146 ? 37.345  87.508  12.388  1.00 129.11 ? 144  GLU A CG  1 
ATOM   1079  C CD  . GLU A 1 146 ? 37.363  86.822  13.741  1.00 130.92 ? 144  GLU A CD  1 
ATOM   1080  O OE1 . GLU A 1 146 ? 38.325  86.070  14.008  1.00 130.33 ? 144  GLU A OE1 1 
ATOM   1081  O OE2 . GLU A 1 146 ? 36.415  87.030  14.531  1.00 131.20 ? 144  GLU A OE2 1 
ATOM   1082  N N   . ASP A 1 147 ? 35.800  83.482  10.849  1.00 84.49  ? 145  ASP A N   1 
ATOM   1083  C CA  . ASP A 1 147 ? 35.890  82.212  10.148  1.00 84.58  ? 145  ASP A CA  1 
ATOM   1084  C C   . ASP A 1 147 ? 34.511  81.830  9.635   1.00 86.18  ? 145  ASP A C   1 
ATOM   1085  O O   . ASP A 1 147 ? 34.360  81.411  8.484   1.00 86.55  ? 145  ASP A O   1 
ATOM   1086  C CB  . ASP A 1 147 ? 36.417  81.156  11.105  1.00 93.47  ? 145  ASP A CB  1 
ATOM   1087  C CG  . ASP A 1 147 ? 37.567  81.669  11.932  1.00 95.27  ? 145  ASP A CG  1 
ATOM   1088  O OD1 . ASP A 1 147 ? 38.571  82.100  11.331  1.00 94.98  ? 145  ASP A OD1 1 
ATOM   1089  O OD2 . ASP A 1 147 ? 37.462  81.660  13.176  1.00 96.02  ? 145  ASP A OD2 1 
ATOM   1090  N N   . GLY A 1 148 ? 33.507  81.984  10.495  1.00 97.29  ? 146  GLY A N   1 
ATOM   1091  C CA  . GLY A 1 148 ? 32.146  81.674  10.104  1.00 98.42  ? 146  GLY A CA  1 
ATOM   1092  C C   . GLY A 1 148 ? 31.837  82.473  8.857   1.00 99.52  ? 146  GLY A C   1 
ATOM   1093  O O   . GLY A 1 148 ? 30.972  82.122  8.057   1.00 100.77 ? 146  GLY A O   1 
ATOM   1094  N N   . ARG A 1 149 ? 32.567  83.565  8.695   1.00 93.65  ? 147  ARG A N   1 
ATOM   1095  C CA  . ARG A 1 149 ? 32.405  84.428  7.544   1.00 93.80  ? 147  ARG A CA  1 
ATOM   1096  C C   . ARG A 1 149 ? 33.126  83.793  6.356   1.00 92.31  ? 147  ARG A C   1 
ATOM   1097  O O   . ARG A 1 149 ? 32.501  83.489  5.341   1.00 93.31  ? 147  ARG A O   1 
ATOM   1098  C CB  . ARG A 1 149 ? 33.001  85.795  7.849   1.00 128.82 ? 147  ARG A CB  1 
ATOM   1099  C CG  . ARG A 1 149 ? 32.800  86.831  6.769   1.00 132.83 ? 147  ARG A CG  1 
ATOM   1100  C CD  . ARG A 1 149 ? 33.750  87.976  7.019   1.00 135.59 ? 147  ARG A CD  1 
ATOM   1101  N NE  . ARG A 1 149 ? 33.648  88.432  8.400   1.00 138.29 ? 147  ARG A NE  1 
ATOM   1102  C CZ  . ARG A 1 149 ? 34.584  89.134  9.027   1.00 139.97 ? 147  ARG A CZ  1 
ATOM   1103  N NH1 . ARG A 1 149 ? 35.705  89.466  8.398   1.00 140.55 ? 147  ARG A NH1 1 
ATOM   1104  N NH2 . ARG A 1 149 ? 34.397  89.503  10.286  1.00 140.75 ? 147  ARG A NH2 1 
ATOM   1105  N N   . LEU A 1 150 ? 34.436  83.587  6.488   1.00 72.01  ? 148  LEU A N   1 
ATOM   1106  C CA  . LEU A 1 150 ? 35.228  82.985  5.416   1.00 69.33  ? 148  LEU A CA  1 
ATOM   1107  C C   . LEU A 1 150 ? 34.510  81.727  4.951   1.00 68.68  ? 148  LEU A C   1 
ATOM   1108  O O   . LEU A 1 150 ? 34.303  81.519  3.755   1.00 68.64  ? 148  LEU A O   1 
ATOM   1109  C CB  . LEU A 1 150 ? 36.627  82.610  5.916   1.00 74.91  ? 148  LEU A CB  1 
ATOM   1110  C CG  . LEU A 1 150 ? 37.786  82.546  4.902   1.00 74.88  ? 148  LEU A CG  1 
ATOM   1111  C CD1 . LEU A 1 150 ? 38.924  81.735  5.513   1.00 73.46  ? 148  LEU A CD1 1 
ATOM   1112  C CD2 . LEU A 1 150 ? 37.351  81.908  3.587   1.00 75.36  ? 148  LEU A CD2 1 
ATOM   1113  N N   . MET A 1 151 ? 34.134  80.886  5.909   1.00 70.56  ? 149  MET A N   1 
ATOM   1114  C CA  . MET A 1 151 ? 33.425  79.664  5.585   1.00 68.72  ? 149  MET A CA  1 
ATOM   1115  C C   . MET A 1 151 ? 32.216  80.036  4.744   1.00 66.22  ? 149  MET A C   1 
ATOM   1116  O O   . MET A 1 151 ? 32.202  79.851  3.524   1.00 64.04  ? 149  MET A O   1 
ATOM   1117  C CB  . MET A 1 151 ? 32.954  78.963  6.853   1.00 98.25  ? 149  MET A CB  1 
ATOM   1118  C CG  . MET A 1 151 ? 32.114  77.727  6.574   1.00 104.07 ? 149  MET A CG  1 
ATOM   1119  S SD  . MET A 1 151 ? 33.075  76.288  6.035   1.00 111.49 ? 149  MET A SD  1 
ATOM   1120  C CE  . MET A 1 151 ? 33.780  76.853  4.483   1.00 109.37 ? 149  MET A CE  1 
ATOM   1121  N N   . GLU A 1 152 ? 31.208  80.578  5.416   1.00 75.09  ? 150  GLU A N   1 
ATOM   1122  C CA  . GLU A 1 152 ? 29.972  81.000  4.769   1.00 73.79  ? 150  GLU A CA  1 
ATOM   1123  C C   . GLU A 1 152 ? 30.224  81.640  3.411   1.00 72.91  ? 150  GLU A C   1 
ATOM   1124  O O   . GLU A 1 152 ? 29.399  81.542  2.514   1.00 74.73  ? 150  GLU A O   1 
ATOM   1125  C CB  . GLU A 1 152 ? 29.226  81.992  5.668   1.00 70.92  ? 150  GLU A CB  1 
ATOM   1126  C CG  . GLU A 1 152 ? 27.859  81.518  6.124   1.00 70.66  ? 150  GLU A CG  1 
ATOM   1127  C CD  . GLU A 1 152 ? 26.730  81.983  5.234   1.00 72.09  ? 150  GLU A CD  1 
ATOM   1128  O OE1 . GLU A 1 152 ? 26.987  82.254  4.040   1.00 72.66  ? 150  GLU A OE1 1 
ATOM   1129  O OE2 . GLU A 1 152 ? 25.581  82.067  5.731   1.00 72.77  ? 150  GLU A OE2 1 
ATOM   1130  N N   . GLN A 1 153 ? 31.365  82.297  3.259   1.00 68.97  ? 151  GLN A N   1 
ATOM   1131  C CA  . GLN A 1 153 ? 31.683  82.953  2.001   1.00 68.90  ? 151  GLN A CA  1 
ATOM   1132  C C   . GLN A 1 153 ? 32.272  81.940  1.032   1.00 65.84  ? 151  GLN A C   1 
ATOM   1133  O O   . GLN A 1 153 ? 31.867  81.853  -0.132  1.00 63.92  ? 151  GLN A O   1 
ATOM   1134  C CB  . GLN A 1 153 ? 32.676  84.097  2.247   1.00 110.47 ? 151  GLN A CB  1 
ATOM   1135  C CG  . GLN A 1 153 ? 32.937  84.992  1.039   1.00 117.07 ? 151  GLN A CG  1 
ATOM   1136  C CD  . GLN A 1 153 ? 33.822  86.189  1.366   1.00 120.57 ? 151  GLN A CD  1 
ATOM   1137  O OE1 . GLN A 1 153 ? 34.992  86.036  1.730   1.00 121.78 ? 151  GLN A OE1 1 
ATOM   1138  N NE2 . GLN A 1 153 ? 33.263  87.391  1.238   1.00 122.15 ? 151  GLN A NE2 1 
ATOM   1139  N N   . LEU A 1 154 ? 33.221  81.161  1.531   1.00 65.08  ? 152  LEU A N   1 
ATOM   1140  C CA  . LEU A 1 154 ? 33.891  80.159  0.724   1.00 62.85  ? 152  LEU A CA  1 
ATOM   1141  C C   . LEU A 1 154 ? 32.934  79.154  0.100   1.00 64.09  ? 152  LEU A C   1 
ATOM   1142  O O   . LEU A 1 154 ? 33.019  78.852  -1.092  1.00 65.56  ? 152  LEU A O   1 
ATOM   1143  C CB  . LEU A 1 154 ? 34.922  79.423  1.571   1.00 43.71  ? 152  LEU A CB  1 
ATOM   1144  C CG  . LEU A 1 154 ? 35.659  78.292  0.851   1.00 42.69  ? 152  LEU A CG  1 
ATOM   1145  C CD1 . LEU A 1 154 ? 36.210  78.774  -0.484  1.00 40.37  ? 152  LEU A CD1 1 
ATOM   1146  C CD2 . LEU A 1 154 ? 36.777  77.789  1.745   1.00 43.52  ? 152  LEU A CD2 1 
ATOM   1147  N N   . LEU A 1 155 ? 32.020  78.631  0.905   1.00 66.87  ? 153  LEU A N   1 
ATOM   1148  C CA  . LEU A 1 155 ? 31.075  77.652  0.396   1.00 66.44  ? 153  LEU A CA  1 
ATOM   1149  C C   . LEU A 1 155 ? 29.918  78.282  -0.353  1.00 64.51  ? 153  LEU A C   1 
ATOM   1150  O O   . LEU A 1 155 ? 29.532  77.797  -1.419  1.00 64.47  ? 153  LEU A O   1 
ATOM   1151  C CB  . LEU A 1 155 ? 30.545  76.781  1.535   1.00 69.95  ? 153  LEU A CB  1 
ATOM   1152  C CG  . LEU A 1 155 ? 31.594  75.876  2.194   1.00 71.37  ? 153  LEU A CG  1 
ATOM   1153  C CD1 . LEU A 1 155 ? 30.882  74.894  3.107   1.00 73.57  ? 153  LEU A CD1 1 
ATOM   1154  C CD2 . LEU A 1 155 ? 32.410  75.123  1.140   1.00 69.34  ? 153  LEU A CD2 1 
ATOM   1155  N N   . SER A 1 156 ? 29.611  79.308  -0.018  1.00 51.89  ? 154  SER A N   1 
ATOM   1156  C CA  . SER A 1 156 ? 28.424  80.010  -0.489  1.00 51.22  ? 154  SER A CA  1 
ATOM   1157  C C   . SER A 1 156 ? 28.650  80.590  -1.879  1.00 49.92  ? 154  SER A C   1 
ATOM   1158  O O   . SER A 1 156 ? 27.806  81.308  -2.415  1.00 48.78  ? 154  SER A O   1 
ATOM   1159  C CB  . SER A 1 156 ? 28.040  81.133  0.472   1.00 66.73  ? 154  SER A CB  1 
ATOM   1160  O OG  . SER A 1 156 ? 26.769  81.667  0.140   1.00 72.75  ? 154  SER A OG  1 
ATOM   1161  N N   . SER A 1 157 ? 29.779  80.046  -2.317  1.00 71.65  ? 155  SER A N   1 
ATOM   1162  C CA  . SER A 1 157 ? 30.207  80.361  -3.663  1.00 71.65  ? 155  SER A CA  1 
ATOM   1163  C C   . SER A 1 157 ? 29.852  79.197  -4.565  1.00 71.76  ? 155  SER A C   1 
ATOM   1164  O O   . SER A 1 157 ? 29.417  79.388  -5.690  1.00 71.77  ? 155  SER A O   1 
ATOM   1165  C CB  . SER A 1 157 ? 31.716  80.576  -3.705  1.00 67.00  ? 155  SER A CB  1 
ATOM   1166  O OG  . SER A 1 157 ? 32.390  79.358  -3.456  1.00 63.35  ? 155  SER A OG  1 
ATOM   1167  N N   . VAL A 1 158 ? 30.030  77.986  -4.055  1.00 61.66  ? 156  VAL A N   1 
ATOM   1168  C CA  . VAL A 1 158 ? 29.761  76.790  -4.831  1.00 59.76  ? 156  VAL A CA  1 
ATOM   1169  C C   . VAL A 1 158 ? 28.354  76.226  -4.607  1.00 58.91  ? 156  VAL A C   1 
ATOM   1170  O O   . VAL A 1 158 ? 28.063  75.087  -4.983  1.00 60.74  ? 156  VAL A O   1 
ATOM   1171  C CB  . VAL A 1 158 ? 30.829  75.733  -4.510  1.00 66.44  ? 156  VAL A CB  1 
ATOM   1172  C CG1 . VAL A 1 158 ? 30.643  74.508  -5.360  1.00 68.73  ? 156  VAL A CG1 1 
ATOM   1173  C CG2 . VAL A 1 158 ? 32.204  76.323  -4.754  1.00 64.64  ? 156  VAL A CG2 1 
ATOM   1174  N N   . GLY A 1 159 ? 27.454  77.121  -4.226  1.00 40.63  ? 157  GLY A N   1 
ATOM   1175  C CA  . GLY A 1 159 ? 26.178  76.635  -3.729  1.00 39.73  ? 157  GLY A CA  1 
ATOM   1176  C C   . GLY A 1 159 ? 25.521  77.641  -2.811  1.00 41.35  ? 157  GLY A C   1 
ATOM   1177  O O   . GLY A 1 159 ? 25.843  78.817  -2.854  1.00 43.73  ? 157  GLY A O   1 
ATOM   1178  N N   . PHE A 1 160 ? 24.415  76.846  -2.054  1.00 48.67  ? 158  PHE A N   1 
ATOM   1179  C CA  . PHE A 1 160 ? 23.738  77.533  -0.960  1.00 49.88  ? 158  PHE A CA  1 
ATOM   1180  C C   . PHE A 1 160 ? 24.511  77.297  0.331   1.00 50.88  ? 158  PHE A C   1 
ATOM   1181  O O   . PHE A 1 160 ? 25.170  76.264  0.487   1.00 48.09  ? 158  PHE A O   1 
ATOM   1182  C CB  . PHE A 1 160 ? 22.323  76.992  -0.804  1.00 57.78  ? 158  PHE A CB  1 
ATOM   1183  C CG  . PHE A 1 160 ? 21.645  77.408  0.475   1.00 57.86  ? 158  PHE A CG  1 
ATOM   1184  C CD1 . PHE A 1 160 ? 21.210  78.711  0.658   1.00 56.99  ? 158  PHE A CD1 1 
ATOM   1185  C CD2 . PHE A 1 160 ? 21.387  76.469  1.476   1.00 58.62  ? 158  PHE A CD2 1 
ATOM   1186  C CE1 . PHE A 1 160 ? 20.514  79.071  1.815   1.00 57.76  ? 158  PHE A CE1 1 
ATOM   1187  C CE2 . PHE A 1 160 ? 20.693  76.819  2.637   1.00 56.65  ? 158  PHE A CE2 1 
ATOM   1188  C CZ  . PHE A 1 160 ? 20.254  78.118  2.804   1.00 57.13  ? 158  PHE A CZ  1 
ATOM   1189  N N   . CYS A 1 161 ? 24.409  78.244  1.260   1.00 49.32  ? 159  CYS A N   1 
ATOM   1190  C CA  . CYS A 1 161 ? 25.116  78.139  2.532   1.00 51.71  ? 159  CYS A CA  1 
ATOM   1191  C C   . CYS A 1 161 ? 24.330  78.824  3.651   1.00 52.91  ? 159  CYS A C   1 
ATOM   1192  O O   . CYS A 1 161 ? 23.603  79.778  3.394   1.00 54.43  ? 159  CYS A O   1 
ATOM   1193  C CB  . CYS A 1 161 ? 26.494  78.790  2.389   1.00 61.82  ? 159  CYS A CB  1 
ATOM   1194  S SG  . CYS A 1 161 ? 27.853  77.961  3.252   1.00 69.71  ? 159  CYS A SG  1 
ATOM   1195  N N   . THR A 1 162 ? 24.477  78.332  4.883   1.00 44.77  ? 160  THR A N   1 
ATOM   1196  C CA  . THR A 1 162 ? 23.800  78.900  6.057   1.00 47.80  ? 160  THR A CA  1 
ATOM   1197  C C   . THR A 1 162 ? 24.222  78.288  7.392   1.00 50.30  ? 160  THR A C   1 
ATOM   1198  O O   . THR A 1 162 ? 24.482  77.091  7.490   1.00 49.85  ? 160  THR A O   1 
ATOM   1199  C CB  . THR A 1 162 ? 22.285  78.711  5.976   1.00 58.35  ? 160  THR A CB  1 
ATOM   1200  O OG1 . THR A 1 162 ? 21.655  79.418  7.050   1.00 60.82  ? 160  THR A OG1 1 
ATOM   1201  C CG2 . THR A 1 162 ? 21.926  77.237  6.078   1.00 58.85  ? 160  THR A CG2 1 
ATOM   1202  N N   . GLU A 1 163 ? 24.284  79.131  8.419   1.00 70.28  ? 161  GLU A N   1 
ATOM   1203  C CA  . GLU A 1 163 ? 24.644  78.687  9.757   1.00 73.39  ? 161  GLU A CA  1 
ATOM   1204  C C   . GLU A 1 163 ? 23.528  77.796  10.257  1.00 72.65  ? 161  GLU A C   1 
ATOM   1205  O O   . GLU A 1 163 ? 22.360  78.031  9.958   1.00 74.24  ? 161  GLU A O   1 
ATOM   1206  C CB  . GLU A 1 163 ? 24.769  79.874  10.711  1.00 102.06 ? 161  GLU A CB  1 
ATOM   1207  C CG  . GLU A 1 163 ? 26.182  80.296  11.029  1.00 107.02 ? 161  GLU A CG  1 
ATOM   1208  C CD  . GLU A 1 163 ? 26.245  81.254  12.199  1.00 111.88 ? 161  GLU A CD  1 
ATOM   1209  O OE1 . GLU A 1 163 ? 25.763  82.399  12.064  1.00 115.29 ? 161  GLU A OE1 1 
ATOM   1210  O OE2 . GLU A 1 163 ? 26.770  80.854  13.259  1.00 113.66 ? 161  GLU A OE2 1 
ATOM   1211  N N   . VAL A 1 164 ? 23.892  76.783  11.029  1.00 61.23  ? 162  VAL A N   1 
ATOM   1212  C CA  . VAL A 1 164 ? 22.918  75.859  11.583  1.00 59.72  ? 162  VAL A CA  1 
ATOM   1213  C C   . VAL A 1 164 ? 23.404  75.314  12.912  1.00 59.97  ? 162  VAL A C   1 
ATOM   1214  O O   . VAL A 1 164 ? 24.565  74.916  13.042  1.00 60.82  ? 162  VAL A O   1 
ATOM   1215  C CB  . VAL A 1 164 ? 22.667  74.685  10.630  1.00 72.98  ? 162  VAL A CB  1 
ATOM   1216  C CG1 . VAL A 1 164 ? 21.909  73.573  11.356  1.00 73.70  ? 162  VAL A CG1 1 
ATOM   1217  C CG2 . VAL A 1 164 ? 21.878  75.169  9.427   1.00 72.60  ? 162  VAL A CG2 1 
ATOM   1218  N N   . GLU A 1 165 ? 22.516  75.288  13.899  1.00 75.69  ? 163  GLU A N   1 
ATOM   1219  C CA  . GLU A 1 165 ? 22.895  74.786  15.209  1.00 76.69  ? 163  GLU A CA  1 
ATOM   1220  C C   . GLU A 1 165 ? 23.057  73.271  15.196  1.00 74.66  ? 163  GLU A C   1 
ATOM   1221  O O   . GLU A 1 165 ? 22.093  72.527  15.342  1.00 74.81  ? 163  GLU A O   1 
ATOM   1222  C CB  . GLU A 1 165 ? 21.871  75.195  16.262  1.00 115.25 ? 163  GLU A CB  1 
ATOM   1223  C CG  . GLU A 1 165 ? 22.394  75.039  17.671  1.00 122.45 ? 163  GLU A CG  1 
ATOM   1224  C CD  . GLU A 1 165 ? 21.459  75.627  18.690  1.00 128.71 ? 163  GLU A CD  1 
ATOM   1225  O OE1 . GLU A 1 165 ? 20.311  75.145  18.772  1.00 131.84 ? 163  GLU A OE1 1 
ATOM   1226  O OE2 . GLU A 1 165 ? 21.870  76.571  19.402  1.00 132.28 ? 163  GLU A OE2 1 
ATOM   1227  N N   . GLU A 1 166 ? 24.299  72.841  15.017  1.00 68.61  ? 164  GLU A N   1 
ATOM   1228  C CA  . GLU A 1 166 ? 24.682  71.439  14.969  1.00 65.72  ? 164  GLU A CA  1 
ATOM   1229  C C   . GLU A 1 166 ? 23.585  70.392  15.190  1.00 64.52  ? 164  GLU A C   1 
ATOM   1230  O O   . GLU A 1 166 ? 23.443  69.476  14.379  1.00 65.30  ? 164  GLU A O   1 
ATOM   1231  C CB  . GLU A 1 166 ? 25.827  71.191  15.953  1.00 68.00  ? 164  GLU A CB  1 
ATOM   1232  C CG  . GLU A 1 166 ? 26.668  69.974  15.612  1.00 69.34  ? 164  GLU A CG  1 
ATOM   1233  C CD  . GLU A 1 166 ? 27.830  69.775  16.561  1.00 69.98  ? 164  GLU A CD  1 
ATOM   1234  O OE1 . GLU A 1 166 ? 28.659  68.879  16.304  1.00 71.59  ? 164  GLU A OE1 1 
ATOM   1235  O OE2 . GLU A 1 166 ? 27.915  70.508  17.566  1.00 70.34  ? 164  GLU A OE2 1 
ATOM   1236  N N   . ASP A 1 167 ? 22.808  70.498  16.264  1.00 60.65  ? 165  ASP A N   1 
ATOM   1237  C CA  . ASP A 1 167 ? 21.772  69.490  16.492  1.00 59.85  ? 165  ASP A CA  1 
ATOM   1238  C C   . ASP A 1 167 ? 20.726  69.375  15.365  1.00 58.06  ? 165  ASP A C   1 
ATOM   1239  O O   . ASP A 1 167 ? 19.689  68.724  15.529  1.00 59.40  ? 165  ASP A O   1 
ATOM   1240  C CB  . ASP A 1 167 ? 21.075  69.719  17.840  1.00 60.22  ? 165  ASP A CB  1 
ATOM   1241  C CG  . ASP A 1 167 ? 20.248  70.978  17.865  1.00 62.08  ? 165  ASP A CG  1 
ATOM   1242  O OD1 . ASP A 1 167 ? 19.410  71.110  18.780  1.00 62.55  ? 165  ASP A OD1 1 
ATOM   1243  O OD2 . ASP A 1 167 ? 20.435  71.834  16.980  1.00 64.34  ? 165  ASP A OD2 1 
ATOM   1244  N N   . LEU A 1 168 ? 21.011  69.995  14.220  1.00 49.89  ? 166  LEU A N   1 
ATOM   1245  C CA  . LEU A 1 168 ? 20.128  69.935  13.060  1.00 43.32  ? 166  LEU A CA  1 
ATOM   1246  C C   . LEU A 1 168 ? 20.802  69.145  11.944  1.00 41.14  ? 166  LEU A C   1 
ATOM   1247  O O   . LEU A 1 168 ? 20.157  68.360  11.244  1.00 41.75  ? 166  LEU A O   1 
ATOM   1248  C CB  . LEU A 1 168 ? 19.815  71.334  12.525  1.00 42.12  ? 166  LEU A CB  1 
ATOM   1249  C CG  . LEU A 1 168 ? 18.989  72.330  13.342  1.00 40.95  ? 166  LEU A CG  1 
ATOM   1250  C CD1 . LEU A 1 168 ? 18.700  73.546  12.460  1.00 38.51  ? 166  LEU A CD1 1 
ATOM   1251  C CD2 . LEU A 1 168 ? 17.686  71.704  13.812  1.00 37.50  ? 166  LEU A CD2 1 
ATOM   1252  N N   . ILE A 1 169 ? 22.105  69.359  11.792  1.00 38.80  ? 167  ILE A N   1 
ATOM   1253  C CA  . ILE A 1 169 ? 22.894  68.709  10.750  1.00 40.11  ? 167  ILE A CA  1 
ATOM   1254  C C   . ILE A 1 169 ? 22.520  67.258  10.445  1.00 40.04  ? 167  ILE A C   1 
ATOM   1255  O O   . ILE A 1 169 ? 22.662  66.804  9.306   1.00 40.55  ? 167  ILE A O   1 
ATOM   1256  C CB  . ILE A 1 169 ? 24.407  68.742  11.076  1.00 60.55  ? 167  ILE A CB  1 
ATOM   1257  C CG1 . ILE A 1 169 ? 24.817  70.120  11.617  1.00 61.38  ? 167  ILE A CG1 1 
ATOM   1258  C CG2 . ILE A 1 169 ? 25.209  68.372  9.827   1.00 60.63  ? 167  ILE A CG2 1 
ATOM   1259  C CD1 . ILE A 1 169 ? 24.603  71.260  10.672  1.00 57.91  ? 167  ILE A CD1 1 
ATOM   1260  N N   . ASP A 1 170 ? 22.056  66.521  11.448  1.00 52.30  ? 168  ASP A N   1 
ATOM   1261  C CA  . ASP A 1 170 ? 21.684  65.133  11.206  1.00 53.50  ? 168  ASP A CA  1 
ATOM   1262  C C   . ASP A 1 170 ? 20.421  65.027  10.358  1.00 51.54  ? 168  ASP A C   1 
ATOM   1263  O O   . ASP A 1 170 ? 20.325  64.183  9.468   1.00 48.12  ? 168  ASP A O   1 
ATOM   1264  C CB  . ASP A 1 170 ? 21.496  64.388  12.527  1.00 71.78  ? 168  ASP A CB  1 
ATOM   1265  C CG  . ASP A 1 170 ? 22.810  64.104  13.224  1.00 75.22  ? 168  ASP A CG  1 
ATOM   1266  O OD1 . ASP A 1 170 ? 23.880  64.314  12.608  1.00 75.43  ? 168  ASP A OD1 1 
ATOM   1267  O OD2 . ASP A 1 170 ? 22.769  63.658  14.388  1.00 77.76  ? 168  ASP A OD2 1 
ATOM   1268  N N   . ALA A 1 171 ? 19.444  65.874  10.644  1.00 43.18  ? 169  ALA A N   1 
ATOM   1269  C CA  . ALA A 1 171 ? 18.220  65.856  9.871   1.00 40.29  ? 169  ALA A CA  1 
ATOM   1270  C C   . ALA A 1 171 ? 18.643  66.337  8.501   1.00 40.87  ? 169  ALA A C   1 
ATOM   1271  O O   . ALA A 1 171 ? 18.438  65.679  7.485   1.00 42.89  ? 169  ALA A O   1 
ATOM   1272  C CB  . ALA A 1 171 ? 17.231  66.806  10.463  1.00 14.69  ? 169  ALA A CB  1 
ATOM   1273  N N   . VAL A 1 172 ? 19.269  67.498  8.501   1.00 40.16  ? 170  VAL A N   1 
ATOM   1274  C CA  . VAL A 1 172 ? 19.744  68.123  7.288   1.00 39.60  ? 170  VAL A CA  1 
ATOM   1275  C C   . VAL A 1 172 ? 20.420  67.177  6.315   1.00 39.55  ? 170  VAL A C   1 
ATOM   1276  O O   . VAL A 1 172 ? 20.284  67.321  5.104   1.00 44.19  ? 170  VAL A O   1 
ATOM   1277  C CB  . VAL A 1 172 ? 20.732  69.216  7.625   1.00 41.13  ? 170  VAL A CB  1 
ATOM   1278  C CG1 . VAL A 1 172 ? 21.048  70.023  6.382   1.00 41.74  ? 170  VAL A CG1 1 
ATOM   1279  C CG2 . VAL A 1 172 ? 20.158  70.087  8.737   1.00 40.83  ? 170  VAL A CG2 1 
ATOM   1280  N N   . THR A 1 173 ? 21.167  66.217  6.836   1.00 33.59  ? 171  THR A N   1 
ATOM   1281  C CA  . THR A 1 173 ? 21.866  65.278  5.967   1.00 33.60  ? 171  THR A CA  1 
ATOM   1282  C C   . THR A 1 173 ? 20.900  64.400  5.190   1.00 34.41  ? 171  THR A C   1 
ATOM   1283  O O   . THR A 1 173 ? 21.008  64.285  3.974   1.00 32.75  ? 171  THR A O   1 
ATOM   1284  C CB  . THR A 1 173 ? 22.831  64.385  6.775   1.00 42.56  ? 171  THR A CB  1 
ATOM   1285  O OG1 . THR A 1 173 ? 22.411  64.351  8.144   1.00 43.68  ? 171  THR A OG1 1 
ATOM   1286  C CG2 . THR A 1 173 ? 24.251  64.922  6.705   1.00 39.91  ? 171  THR A CG2 1 
ATOM   1287  N N   . GLY A 1 174 ? 19.949  63.797  5.896   1.00 42.18  ? 172  GLY A N   1 
ATOM   1288  C CA  . GLY A 1 174 ? 18.982  62.922  5.255   1.00 44.30  ? 172  GLY A CA  1 
ATOM   1289  C C   . GLY A 1 174 ? 18.067  63.667  4.310   1.00 46.35  ? 172  GLY A C   1 
ATOM   1290  O O   . GLY A 1 174 ? 17.033  63.149  3.876   1.00 47.23  ? 172  GLY A O   1 
ATOM   1291  N N   . LEU A 1 175 ? 18.460  64.896  3.996   1.00 42.58  ? 173  LEU A N   1 
ATOM   1292  C CA  . LEU A 1 175 ? 17.698  65.757  3.110   1.00 43.09  ? 173  LEU A CA  1 
ATOM   1293  C C   . LEU A 1 175 ? 18.613  66.276  2.008   1.00 44.60  ? 173  LEU A C   1 
ATOM   1294  O O   . LEU A 1 175 ? 18.693  65.683  0.938   1.00 46.73  ? 173  LEU A O   1 
ATOM   1295  C CB  . LEU A 1 175 ? 17.112  66.930  3.906   1.00 40.99  ? 173  LEU A CB  1 
ATOM   1296  C CG  . LEU A 1 175 ? 16.087  67.864  3.251   1.00 41.69  ? 173  LEU A CG  1 
ATOM   1297  C CD1 . LEU A 1 175 ? 14.788  67.121  2.973   1.00 43.75  ? 173  LEU A CD1 1 
ATOM   1298  C CD2 . LEU A 1 175 ? 15.811  69.026  4.187   1.00 40.65  ? 173  LEU A CD2 1 
ATOM   1299  N N   . SER A 1 176 ? 19.317  67.373  2.271   1.00 51.07  ? 174  SER A N   1 
ATOM   1300  C CA  . SER A 1 176 ? 20.207  67.947  1.267   1.00 51.14  ? 174  SER A CA  1 
ATOM   1301  C C   . SER A 1 176 ? 21.404  67.041  1.092   1.00 48.68  ? 174  SER A C   1 
ATOM   1302  O O   . SER A 1 176 ? 22.044  67.022  0.036   1.00 50.27  ? 174  SER A O   1 
ATOM   1303  C CB  . SER A 1 176 ? 20.688  69.338  1.692   1.00 91.30  ? 174  SER A CB  1 
ATOM   1304  O OG  . SER A 1 176 ? 21.808  69.256  2.559   1.00 95.10  ? 174  SER A OG  1 
ATOM   1305  N N   . GLY A 1 177 ? 21.706  66.291  2.144   1.00 33.72  ? 175  GLY A N   1 
ATOM   1306  C CA  . GLY A 1 177 ? 22.836  65.393  2.087   1.00 32.03  ? 175  GLY A CA  1 
ATOM   1307  C C   . GLY A 1 177 ? 22.624  64.264  1.103   1.00 32.10  ? 175  GLY A C   1 
ATOM   1308  O O   . GLY A 1 177 ? 23.405  64.105  0.159   1.00 31.72  ? 175  GLY A O   1 
ATOM   1309  N N   . SER A 1 178 ? 21.563  63.488  1.334   1.00 42.67  ? 176  SER A N   1 
ATOM   1310  C CA  . SER A 1 178 ? 21.206  62.339  0.500   1.00 43.85  ? 176  SER A CA  1 
ATOM   1311  C C   . SER A 1 178 ? 20.313  62.721  -0.679  1.00 44.63  ? 176  SER A C   1 
ATOM   1312  O O   . SER A 1 178 ? 20.473  62.196  -1.784  1.00 45.63  ? 176  SER A O   1 
ATOM   1313  C CB  . SER A 1 178 ? 20.485  61.272  1.342   1.00 39.74  ? 176  SER A CB  1 
ATOM   1314  O OG  . SER A 1 178 ? 21.374  60.570  2.198   1.00 38.50  ? 176  SER A OG  1 
ATOM   1315  N N   . GLY A 1 179 ? 19.371  63.624  -0.420  1.00 45.83  ? 177  GLY A N   1 
ATOM   1316  C CA  . GLY A 1 179 ? 18.442  64.089  -1.436  1.00 45.67  ? 177  GLY A CA  1 
ATOM   1317  C C   . GLY A 1 179 ? 18.869  63.906  -2.878  1.00 45.90  ? 177  GLY A C   1 
ATOM   1318  O O   . GLY A 1 179 ? 18.177  63.226  -3.635  1.00 48.65  ? 177  GLY A O   1 
ATOM   1319  N N   . PRO A 1 180 ? 19.993  64.504  -3.300  1.00 42.06  ? 178  PRO A N   1 
ATOM   1320  C CA  . PRO A 1 180 ? 20.431  64.343  -4.686  1.00 43.99  ? 178  PRO A CA  1 
ATOM   1321  C C   . PRO A 1 180 ? 20.180  62.916  -5.170  1.00 44.87  ? 178  PRO A C   1 
ATOM   1322  O O   . PRO A 1 180 ? 19.474  62.706  -6.155  1.00 46.20  ? 178  PRO A O   1 
ATOM   1323  C CB  . PRO A 1 180 ? 21.908  64.708  -4.611  1.00 30.75  ? 178  PRO A CB  1 
ATOM   1324  C CG  . PRO A 1 180 ? 21.891  65.822  -3.627  1.00 30.73  ? 178  PRO A CG  1 
ATOM   1325  C CD  . PRO A 1 180 ? 20.973  65.291  -2.535  1.00 30.40  ? 178  PRO A CD  1 
ATOM   1326  N N   . ALA A 1 181 ? 20.737  61.944  -4.454  1.00 42.61  ? 179  ALA A N   1 
ATOM   1327  C CA  . ALA A 1 181 ? 20.578  60.526  -4.778  1.00 40.53  ? 179  ALA A CA  1 
ATOM   1328  C C   . ALA A 1 181 ? 19.124  60.156  -5.090  1.00 40.32  ? 179  ALA A C   1 
ATOM   1329  O O   . ALA A 1 181 ? 18.848  59.434  -6.056  1.00 39.86  ? 179  ALA A O   1 
ATOM   1330  C CB  . ALA A 1 181 ? 21.083  59.689  -3.622  1.00 14.88  ? 179  ALA A CB  1 
ATOM   1331  N N   . TYR A 1 182 ? 18.209  60.646  -4.255  1.00 36.07  ? 180  TYR A N   1 
ATOM   1332  C CA  . TYR A 1 182 ? 16.781  60.404  -4.422  1.00 35.35  ? 180  TYR A CA  1 
ATOM   1333  C C   . TYR A 1 182 ? 16.429  60.892  -5.810  1.00 36.55  ? 180  TYR A C   1 
ATOM   1334  O O   . TYR A 1 182 ? 15.740  60.218  -6.570  1.00 38.51  ? 180  TYR A O   1 
ATOM   1335  C CB  . TYR A 1 182 ? 15.966  61.228  -3.429  1.00 41.19  ? 180  TYR A CB  1 
ATOM   1336  C CG  . TYR A 1 182 ? 16.378  61.140  -1.968  1.00 43.86  ? 180  TYR A CG  1 
ATOM   1337  C CD1 . TYR A 1 182 ? 15.749  61.940  -1.010  1.00 43.08  ? 180  TYR A CD1 1 
ATOM   1338  C CD2 . TYR A 1 182 ? 17.357  60.241  -1.534  1.00 44.46  ? 180  TYR A CD2 1 
ATOM   1339  C CE1 . TYR A 1 182 ? 16.072  61.849  0.334   1.00 46.11  ? 180  TYR A CE1 1 
ATOM   1340  C CE2 . TYR A 1 182 ? 17.690  60.141  -0.181  1.00 45.18  ? 180  TYR A CE2 1 
ATOM   1341  C CZ  . TYR A 1 182 ? 17.037  60.948  0.747   1.00 47.44  ? 180  TYR A CZ  1 
ATOM   1342  O OH  . TYR A 1 182 ? 17.306  60.841  2.095   1.00 48.36  ? 180  TYR A OH  1 
ATOM   1343  N N   . ALA A 1 183 ? 16.907  62.090  -6.122  1.00 38.62  ? 181  ALA A N   1 
ATOM   1344  C CA  . ALA A 1 183 ? 16.666  62.703  -7.414  1.00 39.20  ? 181  ALA A CA  1 
ATOM   1345  C C   . ALA A 1 183 ? 17.242  61.840  -8.529  1.00 37.74  ? 181  ALA A C   1 
ATOM   1346  O O   . ALA A 1 183 ? 16.507  61.372  -9.390  1.00 38.46  ? 181  ALA A O   1 
ATOM   1347  C CB  . ALA A 1 183 ? 17.283  64.087  -7.447  1.00 47.46  ? 181  ALA A CB  1 
ATOM   1348  N N   . PHE A 1 184 ? 18.552  61.623  -8.516  1.00 34.49  ? 182  PHE A N   1 
ATOM   1349  C CA  . PHE A 1 184 ? 19.165  60.812  -9.549  1.00 35.42  ? 182  PHE A CA  1 
ATOM   1350  C C   . PHE A 1 184 ? 18.344  59.558  -9.745  1.00 37.55  ? 182  PHE A C   1 
ATOM   1351  O O   . PHE A 1 184 ? 18.222  59.042  -10.858 1.00 38.72  ? 182  PHE A O   1 
ATOM   1352  C CB  . PHE A 1 184 ? 20.575  60.411  -9.163  1.00 40.33  ? 182  PHE A CB  1 
ATOM   1353  C CG  . PHE A 1 184 ? 21.501  61.567  -8.994  1.00 46.45  ? 182  PHE A CG  1 
ATOM   1354  C CD1 . PHE A 1 184 ? 21.724  62.116  -7.740  1.00 47.31  ? 182  PHE A CD1 1 
ATOM   1355  C CD2 . PHE A 1 184 ? 22.172  62.104  -10.087 1.00 49.11  ? 182  PHE A CD2 1 
ATOM   1356  C CE1 . PHE A 1 184 ? 22.606  63.181  -7.574  1.00 48.30  ? 182  PHE A CE1 1 
ATOM   1357  C CE2 . PHE A 1 184 ? 23.058  63.173  -9.931  1.00 48.46  ? 182  PHE A CE2 1 
ATOM   1358  C CZ  . PHE A 1 184 ? 23.275  63.709  -8.675  1.00 49.19  ? 182  PHE A CZ  1 
ATOM   1359  N N   . THR A 1 185 ? 17.777  59.066  -8.655  1.00 33.43  ? 183  THR A N   1 
ATOM   1360  C CA  . THR A 1 185 ? 16.967  57.862  -8.726  1.00 34.73  ? 183  THR A CA  1 
ATOM   1361  C C   . THR A 1 185 ? 15.625  58.113  -9.418  1.00 35.33  ? 183  THR A C   1 
ATOM   1362  O O   . THR A 1 185 ? 15.223  57.365  -10.313 1.00 33.54  ? 183  THR A O   1 
ATOM   1363  C CB  . THR A 1 185 ? 16.720  57.290  -7.311  1.00 38.06  ? 183  THR A CB  1 
ATOM   1364  O OG1 . THR A 1 185 ? 17.915  56.644  -6.853  1.00 42.33  ? 183  THR A OG1 1 
ATOM   1365  C CG2 . THR A 1 185 ? 15.558  56.300  -7.312  1.00 34.92  ? 183  THR A CG2 1 
ATOM   1366  N N   . ALA A 1 186 ? 14.932  59.166  -8.997  1.00 45.06  ? 184  ALA A N   1 
ATOM   1367  C CA  . ALA A 1 186 ? 13.638  59.501  -9.569  1.00 42.88  ? 184  ALA A CA  1 
ATOM   1368  C C   . ALA A 1 186 ? 13.778  59.743  -11.064 1.00 42.96  ? 184  ALA A C   1 
ATOM   1369  O O   . ALA A 1 186 ? 12.961  59.275  -11.859 1.00 42.57  ? 184  ALA A O   1 
ATOM   1370  C CB  . ALA A 1 186 ? 13.080  60.723  -8.888  1.00 22.98  ? 184  ALA A CB  1 
ATOM   1371  N N   . LEU A 1 187 ? 14.820  60.474  -11.441 1.00 35.97  ? 185  LEU A N   1 
ATOM   1372  C CA  . LEU A 1 187 ? 15.075  60.760  -12.842 1.00 39.85  ? 185  LEU A CA  1 
ATOM   1373  C C   . LEU A 1 187 ? 15.220  59.458  -13.624 1.00 42.96  ? 185  LEU A C   1 
ATOM   1374  O O   . LEU A 1 187 ? 14.453  59.189  -14.553 1.00 46.31  ? 185  LEU A O   1 
ATOM   1375  C CB  . LEU A 1 187 ? 16.340  61.604  -12.984 1.00 34.47  ? 185  LEU A CB  1 
ATOM   1376  C CG  . LEU A 1 187 ? 16.261  62.957  -12.272 1.00 35.94  ? 185  LEU A CG  1 
ATOM   1377  C CD1 . LEU A 1 187 ? 17.345  63.871  -12.796 1.00 35.44  ? 185  LEU A CD1 1 
ATOM   1378  C CD2 . LEU A 1 187 ? 14.900  63.591  -12.520 1.00 36.99  ? 185  LEU A CD2 1 
ATOM   1379  N N   . ASP A 1 188 ? 16.206  58.648  -13.249 1.00 41.39  ? 186  ASP A N   1 
ATOM   1380  C CA  . ASP A 1 188 ? 16.416  57.366  -13.912 1.00 39.34  ? 186  ASP A CA  1 
ATOM   1381  C C   . ASP A 1 188 ? 15.067  56.690  -14.150 1.00 36.29  ? 186  ASP A C   1 
ATOM   1382  O O   . ASP A 1 188 ? 14.842  56.101  -15.205 1.00 35.44  ? 186  ASP A O   1 
ATOM   1383  C CB  . ASP A 1 188 ? 17.308  56.463  -13.050 1.00 51.01  ? 186  ASP A CB  1 
ATOM   1384  C CG  . ASP A 1 188 ? 17.426  55.054  -13.607 1.00 54.77  ? 186  ASP A CG  1 
ATOM   1385  O OD1 . ASP A 1 188 ? 17.780  54.909  -14.795 1.00 58.10  ? 186  ASP A OD1 1 
ATOM   1386  O OD2 . ASP A 1 188 ? 17.169  54.089  -12.855 1.00 58.08  ? 186  ASP A OD2 1 
ATOM   1387  N N   . ALA A 1 189 ? 14.171  56.784  -13.167 1.00 37.07  ? 187  ALA A N   1 
ATOM   1388  C CA  . ALA A 1 189 ? 12.847  56.180  -13.285 1.00 35.65  ? 187  ALA A CA  1 
ATOM   1389  C C   . ALA A 1 189 ? 12.091  56.899  -14.385 1.00 37.42  ? 187  ALA A C   1 
ATOM   1390  O O   . ALA A 1 189 ? 11.802  56.294  -15.423 1.00 39.98  ? 187  ALA A O   1 
ATOM   1391  C CB  . ALA A 1 189 ? 12.086  56.277  -11.968 1.00 33.11  ? 187  ALA A CB  1 
ATOM   1392  N N   . LEU A 1 190 ? 11.776  58.179  -14.163 1.00 38.26  ? 188  LEU A N   1 
ATOM   1393  C CA  . LEU A 1 190 ? 11.069  58.991  -15.161 1.00 38.21  ? 188  LEU A CA  1 
ATOM   1394  C C   . LEU A 1 190 ? 11.544  58.610  -16.567 1.00 41.08  ? 188  LEU A C   1 
ATOM   1395  O O   . LEU A 1 190 ? 10.751  58.193  -17.423 1.00 41.27  ? 188  LEU A O   1 
ATOM   1396  C CB  . LEU A 1 190 ? 11.334  60.470  -14.903 1.00 37.45  ? 188  LEU A CB  1 
ATOM   1397  C CG  . LEU A 1 190 ? 10.737  60.973  -13.587 1.00 39.74  ? 188  LEU A CG  1 
ATOM   1398  C CD1 . LEU A 1 190 ? 11.533  62.162  -13.037 1.00 35.76  ? 188  LEU A CD1 1 
ATOM   1399  C CD2 . LEU A 1 190 ? 9.271   61.331  -13.826 1.00 35.09  ? 188  LEU A CD2 1 
ATOM   1400  N N   . ALA A 1 191 ? 12.847  58.742  -16.792 1.00 36.69  ? 189  ALA A N   1 
ATOM   1401  C CA  . ALA A 1 191 ? 13.450  58.387  -18.068 1.00 37.02  ? 189  ALA A CA  1 
ATOM   1402  C C   . ALA A 1 191 ? 12.851  57.080  -18.589 1.00 37.66  ? 189  ALA A C   1 
ATOM   1403  O O   . ALA A 1 191 ? 12.342  57.022  -19.709 1.00 42.20  ? 189  ALA A O   1 
ATOM   1404  C CB  . ALA A 1 191 ? 14.940  58.238  -17.892 1.00 52.00  ? 189  ALA A CB  1 
ATOM   1405  N N   . ASP A 1 192 ? 12.919  56.036  -17.765 1.00 31.49  ? 190  ASP A N   1 
ATOM   1406  C CA  . ASP A 1 192 ? 12.373  54.735  -18.120 1.00 29.85  ? 190  ASP A CA  1 
ATOM   1407  C C   . ASP A 1 192 ? 10.942  54.933  -18.574 1.00 27.09  ? 190  ASP A C   1 
ATOM   1408  O O   . ASP A 1 192 ? 10.515  54.392  -19.592 1.00 28.01  ? 190  ASP A O   1 
ATOM   1409  C CB  . ASP A 1 192 ? 12.405  53.799  -16.908 1.00 46.20  ? 190  ASP A CB  1 
ATOM   1410  C CG  . ASP A 1 192 ? 13.749  53.101  -16.736 1.00 50.01  ? 190  ASP A CG  1 
ATOM   1411  O OD1 . ASP A 1 192 ? 14.784  53.720  -17.055 1.00 52.25  ? 190  ASP A OD1 1 
ATOM   1412  O OD2 . ASP A 1 192 ? 13.772  51.939  -16.269 1.00 49.20  ? 190  ASP A OD2 1 
ATOM   1413  N N   . GLY A 1 193 ? 10.206  55.729  -17.814 1.00 18.89  ? 191  GLY A N   1 
ATOM   1414  C CA  . GLY A 1 193 ? 8.827   55.987  -18.160 1.00 21.77  ? 191  GLY A CA  1 
ATOM   1415  C C   . GLY A 1 193 ? 8.686   56.646  -19.515 1.00 22.03  ? 191  GLY A C   1 
ATOM   1416  O O   . GLY A 1 193 ? 7.909   56.210  -20.363 1.00 19.09  ? 191  GLY A O   1 
ATOM   1417  N N   . GLY A 1 194 ? 9.434   57.716  -19.723 1.00 43.14  ? 192  GLY A N   1 
ATOM   1418  C CA  . GLY A 1 194 ? 9.358   58.391  -20.999 1.00 43.98  ? 192  GLY A CA  1 
ATOM   1419  C C   . GLY A 1 194 ? 9.586   57.374  -22.090 1.00 40.97  ? 192  GLY A C   1 
ATOM   1420  O O   . GLY A 1 194 ? 8.885   57.360  -23.098 1.00 47.46  ? 192  GLY A O   1 
ATOM   1421  N N   . VAL A 1 195 ? 10.571  56.512  -21.893 1.00 19.03  ? 193  VAL A N   1 
ATOM   1422  C CA  . VAL A 1 195 ? 10.846  55.492  -22.883 1.00 18.03  ? 193  VAL A CA  1 
ATOM   1423  C C   . VAL A 1 195 ? 9.634   54.574  -23.009 1.00 19.68  ? 193  VAL A C   1 
ATOM   1424  O O   . VAL A 1 195 ? 9.210   54.238  -24.113 1.00 22.97  ? 193  VAL A O   1 
ATOM   1425  C CB  . VAL A 1 195 ? 12.062  54.634  -22.498 1.00 32.14  ? 193  VAL A CB  1 
ATOM   1426  C CG1 . VAL A 1 195 ? 12.094  53.374  -23.349 1.00 32.13  ? 193  VAL A CG1 1 
ATOM   1427  C CG2 . VAL A 1 195 ? 13.332  55.419  -22.710 1.00 29.35  ? 193  VAL A CG2 1 
ATOM   1428  N N   . LYS A 1 196 ? 9.074   54.169  -21.876 1.00 32.09  ? 194  LYS A N   1 
ATOM   1429  C CA  . LYS A 1 196 ? 7.923   53.281  -21.897 1.00 32.06  ? 194  LYS A CA  1 
ATOM   1430  C C   . LYS A 1 196 ? 6.737   53.934  -22.597 1.00 33.01  ? 194  LYS A C   1 
ATOM   1431  O O   . LYS A 1 196 ? 5.616   53.417  -22.575 1.00 34.53  ? 194  LYS A O   1 
ATOM   1432  C CB  . LYS A 1 196 ? 7.541   52.873  -20.473 1.00 21.52  ? 194  LYS A CB  1 
ATOM   1433  C CG  . LYS A 1 196 ? 7.189   51.392  -20.368 1.00 19.06  ? 194  LYS A CG  1 
ATOM   1434  C CD  . LYS A 1 196 ? 5.697   51.099  -20.508 1.00 8.30   ? 194  LYS A CD  1 
ATOM   1435  C CE  . LYS A 1 196 ? 5.028   51.106  -19.146 1.00 2.59   ? 194  LYS A CE  1 
ATOM   1436  N NZ  . LYS A 1 196 ? 3.643   50.552  -19.137 1.00 1.00   ? 194  LYS A NZ  1 
ATOM   1437  N N   . MET A 1 197 ? 6.992   55.071  -23.230 1.00 32.60  ? 195  MET A N   1 
ATOM   1438  C CA  . MET A 1 197 ? 5.956   55.776  -23.948 1.00 35.29  ? 195  MET A CA  1 
ATOM   1439  C C   . MET A 1 197 ? 6.474   56.151  -25.326 1.00 39.16  ? 195  MET A C   1 
ATOM   1440  O O   . MET A 1 197 ? 5.781   56.799  -26.104 1.00 45.99  ? 195  MET A O   1 
ATOM   1441  C CB  . MET A 1 197 ? 5.525   57.010  -23.165 1.00 36.12  ? 195  MET A CB  1 
ATOM   1442  C CG  . MET A 1 197 ? 5.053   56.667  -21.767 1.00 36.57  ? 195  MET A CG  1 
ATOM   1443  S SD  . MET A 1 197 ? 3.824   55.339  -21.799 1.00 39.10  ? 195  MET A SD  1 
ATOM   1444  C CE  . MET A 1 197 ? 2.324   56.242  -21.391 1.00 37.81  ? 195  MET A CE  1 
ATOM   1445  N N   . GLY A 1 198 ? 7.697   55.738  -25.632 1.00 36.30  ? 196  GLY A N   1 
ATOM   1446  C CA  . GLY A 1 198 ? 8.248   56.022  -26.940 1.00 39.33  ? 196  GLY A CA  1 
ATOM   1447  C C   . GLY A 1 198 ? 9.459   56.923  -26.952 1.00 44.01  ? 196  GLY A C   1 
ATOM   1448  O O   . GLY A 1 198 ? 10.398  56.684  -27.706 1.00 48.11  ? 196  GLY A O   1 
ATOM   1449  N N   . LEU A 1 199 ? 9.450   57.964  -26.127 1.00 40.76  ? 197  LEU A N   1 
ATOM   1450  C CA  . LEU A 1 199 ? 10.573  58.893  -26.090 1.00 41.09  ? 197  LEU A CA  1 
ATOM   1451  C C   . LEU A 1 199 ? 11.901  58.159  -26.043 1.00 40.49  ? 197  LEU A C   1 
ATOM   1452  O O   . LEU A 1 199 ? 12.014  57.086  -25.447 1.00 39.94  ? 197  LEU A O   1 
ATOM   1453  C CB  . LEU A 1 199 ? 10.475  59.800  -24.871 1.00 56.58  ? 197  LEU A CB  1 
ATOM   1454  C CG  . LEU A 1 199 ? 9.178   60.570  -24.635 1.00 59.63  ? 197  LEU A CG  1 
ATOM   1455  C CD1 . LEU A 1 199 ? 9.309   61.331  -23.325 1.00 59.26  ? 197  LEU A CD1 1 
ATOM   1456  C CD2 . LEU A 1 199 ? 8.902   61.526  -25.783 1.00 59.35  ? 197  LEU A CD2 1 
ATOM   1457  N N   . PRO A 1 200 ? 12.923  58.711  -26.703 1.00 39.55  ? 198  PRO A N   1 
ATOM   1458  C CA  . PRO A 1 200 ? 14.224  58.051  -26.679 1.00 42.24  ? 198  PRO A CA  1 
ATOM   1459  C C   . PRO A 1 200 ? 14.893  58.364  -25.344 1.00 44.72  ? 198  PRO A C   1 
ATOM   1460  O O   . PRO A 1 200 ? 14.509  59.305  -24.636 1.00 45.03  ? 198  PRO A O   1 
ATOM   1461  C CB  . PRO A 1 200 ? 14.951  58.670  -27.866 1.00 49.22  ? 198  PRO A CB  1 
ATOM   1462  C CG  . PRO A 1 200 ? 14.410  60.046  -27.894 1.00 50.22  ? 198  PRO A CG  1 
ATOM   1463  C CD  . PRO A 1 200 ? 12.928  59.848  -27.636 1.00 48.33  ? 198  PRO A CD  1 
ATOM   1464  N N   . ARG A 1 201 ? 15.890  57.568  -25.000 1.00 50.90  ? 199  ARG A N   1 
ATOM   1465  C CA  . ARG A 1 201 ? 16.575  57.752  -23.745 1.00 52.00  ? 199  ARG A CA  1 
ATOM   1466  C C   . ARG A 1 201 ? 17.174  59.137  -23.627 1.00 52.93  ? 199  ARG A C   1 
ATOM   1467  O O   . ARG A 1 201 ? 16.608  60.002  -22.964 1.00 51.73  ? 199  ARG A O   1 
ATOM   1468  C CB  . ARG A 1 201 ? 17.659  56.699  -23.587 1.00 53.32  ? 199  ARG A CB  1 
ATOM   1469  C CG  . ARG A 1 201 ? 18.177  56.605  -22.186 1.00 55.16  ? 199  ARG A CG  1 
ATOM   1470  C CD  . ARG A 1 201 ? 17.044  56.378  -21.216 1.00 56.10  ? 199  ARG A CD  1 
ATOM   1471  N NE  . ARG A 1 201 ? 17.559  56.170  -19.871 1.00 61.68  ? 199  ARG A NE  1 
ATOM   1472  C CZ  . ARG A 1 201 ? 16.815  55.840  -18.825 1.00 62.45  ? 199  ARG A CZ  1 
ATOM   1473  N NH1 . ARG A 1 201 ? 15.508  55.674  -18.964 1.00 61.51  ? 199  ARG A NH1 1 
ATOM   1474  N NH2 . ARG A 1 201 ? 17.381  55.686  -17.638 1.00 64.43  ? 199  ARG A NH2 1 
ATOM   1475  N N   . ARG A 1 202 ? 18.313  59.341  -24.282 1.00 51.25  ? 200  ARG A N   1 
ATOM   1476  C CA  . ARG A 1 202 ? 18.994  60.620  -24.231 1.00 51.77  ? 200  ARG A CA  1 
ATOM   1477  C C   . ARG A 1 202 ? 18.035  61.788  -24.314 1.00 50.01  ? 200  ARG A C   1 
ATOM   1478  O O   . ARG A 1 202 ? 18.355  62.879  -23.864 1.00 50.62  ? 200  ARG A O   1 
ATOM   1479  C CB  . ARG A 1 202 ? 20.050  60.721  -25.333 1.00 87.97  ? 200  ARG A CB  1 
ATOM   1480  C CG  . ARG A 1 202 ? 21.448  60.441  -24.820 1.00 99.11  ? 200  ARG A CG  1 
ATOM   1481  C CD  . ARG A 1 202 ? 22.517  60.650  -25.873 1.00 110.71 ? 200  ARG A CD  1 
ATOM   1482  N NE  . ARG A 1 202 ? 22.401  59.720  -26.995 1.00 121.47 ? 200  ARG A NE  1 
ATOM   1483  C CZ  . ARG A 1 202 ? 23.293  59.637  -27.980 1.00 125.67 ? 200  ARG A CZ  1 
ATOM   1484  N NH1 . ARG A 1 202 ? 24.356  60.428  -27.967 1.00 127.37 ? 200  ARG A NH1 1 
ATOM   1485  N NH2 . ARG A 1 202 ? 23.125  58.771  -28.974 1.00 126.20 ? 200  ARG A NH2 1 
ATOM   1486  N N   . LEU A 1 203 ? 16.851  61.576  -24.871 1.00 45.03  ? 201  LEU A N   1 
ATOM   1487  C CA  . LEU A 1 203 ? 15.900  62.670  -24.946 1.00 43.04  ? 201  LEU A CA  1 
ATOM   1488  C C   . LEU A 1 203 ? 15.080  62.761  -23.672 1.00 43.25  ? 201  LEU A C   1 
ATOM   1489  O O   . LEU A 1 203 ? 15.082  63.801  -23.004 1.00 43.37  ? 201  LEU A O   1 
ATOM   1490  C CB  . LEU A 1 203 ? 14.961  62.499  -26.133 1.00 50.32  ? 201  LEU A CB  1 
ATOM   1491  C CG  . LEU A 1 203 ? 13.795  63.491  -26.103 1.00 51.32  ? 201  LEU A CG  1 
ATOM   1492  C CD1 . LEU A 1 203 ? 14.336  64.904  -26.181 1.00 52.76  ? 201  LEU A CD1 1 
ATOM   1493  C CD2 . LEU A 1 203 ? 12.842  63.219  -27.245 1.00 50.18  ? 201  LEU A CD2 1 
ATOM   1494  N N   . ALA A 1 204 ? 14.410  61.656  -23.329 1.00 35.78  ? 202  ALA A N   1 
ATOM   1495  C CA  . ALA A 1 204 ? 13.541  61.569  -22.147 1.00 34.80  ? 202  ALA A CA  1 
ATOM   1496  C C   . ALA A 1 204 ? 14.211  61.911  -20.821 1.00 34.37  ? 202  ALA A C   1 
ATOM   1497  O O   . ALA A 1 204 ? 13.776  62.817  -20.105 1.00 30.24  ? 202  ALA A O   1 
ATOM   1498  C CB  . ALA A 1 204 ? 12.925  60.189  -22.068 1.00 34.35  ? 202  ALA A CB  1 
ATOM   1499  N N   . VAL A 1 205 ? 15.245  61.153  -20.485 1.00 73.10  ? 203  VAL A N   1 
ATOM   1500  C CA  . VAL A 1 205 ? 16.019  61.376  -19.269 1.00 77.40  ? 203  VAL A CA  1 
ATOM   1501  C C   . VAL A 1 205 ? 16.143  62.880  -19.004 1.00 77.48  ? 203  VAL A C   1 
ATOM   1502  O O   . VAL A 1 205 ? 15.725  63.417  -17.972 1.00 79.47  ? 203  VAL A O   1 
ATOM   1503  C CB  . VAL A 1 205 ? 17.450  60.831  -19.456 1.00 65.20  ? 203  VAL A CB  1 
ATOM   1504  C CG1 . VAL A 1 205 ? 18.360  61.444  -18.438 1.00 64.22  ? 203  VAL A CG1 1 
ATOM   1505  C CG2 . VAL A 1 205 ? 17.465  59.316  -19.361 1.00 67.23  ? 203  VAL A CG2 1 
ATOM   1506  N N   . ARG A 1 206 ? 16.743  63.518  -19.992 1.00 46.79  ? 204  ARG A N   1 
ATOM   1507  C CA  . ARG A 1 206 ? 17.044  64.924  -20.053 1.00 46.72  ? 204  ARG A CA  1 
ATOM   1508  C C   . ARG A 1 206 ? 15.859  65.862  -19.929 1.00 44.46  ? 204  ARG A C   1 
ATOM   1509  O O   . ARG A 1 206 ? 15.981  66.976  -19.412 1.00 43.31  ? 204  ARG A O   1 
ATOM   1510  C CB  . ARG A 1 206 ? 17.743  65.135  -21.362 1.00 84.31  ? 204  ARG A CB  1 
ATOM   1511  C CG  . ARG A 1 206 ? 18.772  64.039  -21.656 1.00 97.75  ? 204  ARG A CG  1 
ATOM   1512  C CD  . ARG A 1 206 ? 19.780  63.756  -20.531 1.00 109.31 ? 204  ARG A CD  1 
ATOM   1513  N NE  . ARG A 1 206 ? 20.678  62.646  -20.877 1.00 118.48 ? 204  ARG A NE  1 
ATOM   1514  C CZ  . ARG A 1 206 ? 21.715  62.239  -20.142 1.00 122.80 ? 204  ARG A CZ  1 
ATOM   1515  N NH1 . ARG A 1 206 ? 22.015  62.840  -18.996 1.00 125.23 ? 204  ARG A NH1 1 
ATOM   1516  N NH2 . ARG A 1 206 ? 22.462  61.223  -20.559 1.00 123.77 ? 204  ARG A NH2 1 
ATOM   1517  N N   . LEU A 1 207 ? 14.714  65.425  -20.431 1.00 49.48  ? 205  LEU A N   1 
ATOM   1518  C CA  . LEU A 1 207 ? 13.514  66.237  -20.336 1.00 46.14  ? 205  LEU A CA  1 
ATOM   1519  C C   . LEU A 1 207 ? 13.083  66.218  -18.876 1.00 42.80  ? 205  LEU A C   1 
ATOM   1520  O O   . LEU A 1 207 ? 12.615  67.224  -18.337 1.00 38.89  ? 205  LEU A O   1 
ATOM   1521  C CB  . LEU A 1 207 ? 12.422  65.654  -21.227 1.00 48.44  ? 205  LEU A CB  1 
ATOM   1522  C CG  . LEU A 1 207 ? 12.772  65.704  -22.713 1.00 50.17  ? 205  LEU A CG  1 
ATOM   1523  C CD1 . LEU A 1 207 ? 11.758  64.919  -23.521 1.00 49.33  ? 205  LEU A CD1 1 
ATOM   1524  C CD2 . LEU A 1 207 ? 12.822  67.155  -23.158 1.00 52.66  ? 205  LEU A CD2 1 
ATOM   1525  N N   . GLY A 1 208 ? 13.262  65.058  -18.247 1.00 38.37  ? 206  GLY A N   1 
ATOM   1526  C CA  . GLY A 1 208 ? 12.908  64.896  -16.848 1.00 39.85  ? 206  GLY A CA  1 
ATOM   1527  C C   . GLY A 1 208 ? 13.781  65.774  -15.977 1.00 39.26  ? 206  GLY A C   1 
ATOM   1528  O O   . GLY A 1 208 ? 13.309  66.451  -15.059 1.00 35.52  ? 206  GLY A O   1 
ATOM   1529  N N   . ALA A 1 209 ? 15.074  65.757  -16.268 1.00 40.40  ? 207  ALA A N   1 
ATOM   1530  C CA  . ALA A 1 209 ? 16.007  66.574  -15.526 1.00 40.14  ? 207  ALA A CA  1 
ATOM   1531  C C   . ALA A 1 209 ? 15.522  68.017  -15.635 1.00 40.55  ? 207  ALA A C   1 
ATOM   1532  O O   . ALA A 1 209 ? 15.242  68.667  -14.627 1.00 41.19  ? 207  ALA A O   1 
ATOM   1533  C CB  . ALA A 1 209 ? 17.394  66.431  -16.118 1.00 29.71  ? 207  ALA A CB  1 
ATOM   1534  N N   . GLN A 1 210 ? 15.394  68.503  -16.867 1.00 38.61  ? 208  GLN A N   1 
ATOM   1535  C CA  . GLN A 1 210 ? 14.947  69.871  -17.108 1.00 39.82  ? 208  GLN A CA  1 
ATOM   1536  C C   . GLN A 1 210 ? 13.659  70.225  -16.385 1.00 40.22  ? 208  GLN A C   1 
ATOM   1537  O O   . GLN A 1 210 ? 13.417  71.383  -16.067 1.00 39.44  ? 208  GLN A O   1 
ATOM   1538  C CB  . GLN A 1 210 ? 14.745  70.123  -18.603 1.00 53.10  ? 208  GLN A CB  1 
ATOM   1539  C CG  . GLN A 1 210 ? 14.245  71.543  -18.899 1.00 55.94  ? 208  GLN A CG  1 
ATOM   1540  C CD  . GLN A 1 210 ? 15.266  72.596  -18.518 1.00 56.70  ? 208  GLN A CD  1 
ATOM   1541  O OE1 . GLN A 1 210 ? 14.935  73.741  -18.198 1.00 57.20  ? 208  GLN A OE1 1 
ATOM   1542  N NE2 . GLN A 1 210 ? 16.520  72.209  -18.560 1.00 54.16  ? 208  GLN A NE2 1 
ATOM   1543  N N   . ALA A 1 211 ? 12.821  69.233  -16.139 1.00 49.95  ? 209  ALA A N   1 
ATOM   1544  C CA  . ALA A 1 211 ? 11.572  69.504  -15.461 1.00 52.44  ? 209  ALA A CA  1 
ATOM   1545  C C   . ALA A 1 211 ? 11.817  69.672  -13.967 1.00 54.18  ? 209  ALA A C   1 
ATOM   1546  O O   . ALA A 1 211 ? 11.200  70.513  -13.323 1.00 55.43  ? 209  ALA A O   1 
ATOM   1547  C CB  . ALA A 1 211 ? 10.585  68.381  -15.723 1.00 47.53  ? 209  ALA A CB  1 
ATOM   1548  N N   . LEU A 1 212 ? 12.725  68.875  -13.417 1.00 44.85  ? 210  LEU A N   1 
ATOM   1549  C CA  . LEU A 1 212 ? 13.042  68.955  -11.995 1.00 44.53  ? 210  LEU A CA  1 
ATOM   1550  C C   . LEU A 1 212 ? 13.683  70.294  -11.701 1.00 43.61  ? 210  LEU A C   1 
ATOM   1551  O O   . LEU A 1 212 ? 13.228  71.053  -10.847 1.00 43.52  ? 210  LEU A O   1 
ATOM   1552  C CB  . LEU A 1 212 ? 14.007  67.836  -11.620 1.00 72.58  ? 210  LEU A CB  1 
ATOM   1553  C CG  . LEU A 1 212 ? 13.407  66.728  -10.761 1.00 74.50  ? 210  LEU A CG  1 
ATOM   1554  C CD1 . LEU A 1 212 ? 13.364  67.193  -9.310  1.00 73.84  ? 210  LEU A CD1 1 
ATOM   1555  C CD2 . LEU A 1 212 ? 12.014  66.365  -11.284 1.00 72.42  ? 210  LEU A CD2 1 
ATOM   1556  N N   . LEU A 1 213 ? 14.756  70.566  -12.425 1.00 54.51  ? 211  LEU A N   1 
ATOM   1557  C CA  . LEU A 1 213 ? 15.484  71.807  -12.285 1.00 54.82  ? 211  LEU A CA  1 
ATOM   1558  C C   . LEU A 1 213 ? 14.501  72.980  -12.322 1.00 55.09  ? 211  LEU A C   1 
ATOM   1559  O O   . LEU A 1 213 ? 14.595  73.915  -11.522 1.00 55.44  ? 211  LEU A O   1 
ATOM   1560  C CB  . LEU A 1 213 ? 16.511  71.903  -13.421 1.00 49.19  ? 211  LEU A CB  1 
ATOM   1561  C CG  . LEU A 1 213 ? 17.373  73.154  -13.598 1.00 50.53  ? 211  LEU A CG  1 
ATOM   1562  C CD1 . LEU A 1 213 ? 17.722  73.734  -12.248 1.00 49.80  ? 211  LEU A CD1 1 
ATOM   1563  C CD2 . LEU A 1 213 ? 18.637  72.795  -14.385 1.00 46.82  ? 211  LEU A CD2 1 
ATOM   1564  N N   . GLY A 1 214 ? 13.541  72.908  -13.239 1.00 45.98  ? 212  GLY A N   1 
ATOM   1565  C CA  . GLY A 1 214 ? 12.556  73.966  -13.371 1.00 43.50  ? 212  GLY A CA  1 
ATOM   1566  C C   . GLY A 1 214 ? 11.663  74.105  -12.156 1.00 43.38  ? 212  GLY A C   1 
ATOM   1567  O O   . GLY A 1 214 ? 11.480  75.201  -11.626 1.00 44.30  ? 212  GLY A O   1 
ATOM   1568  N N   . ALA A 1 215 ? 11.096  72.991  -11.712 1.00 39.88  ? 213  ALA A N   1 
ATOM   1569  C CA  . ALA A 1 215 ? 10.223  73.009  -10.549 1.00 41.42  ? 213  ALA A CA  1 
ATOM   1570  C C   . ALA A 1 215 ? 11.003  73.568  -9.362  1.00 42.96  ? 213  ALA A C   1 
ATOM   1571  O O   . ALA A 1 215 ? 10.474  74.360  -8.570  1.00 43.54  ? 213  ALA A O   1 
ATOM   1572  C CB  . ALA A 1 215 ? 9.729   71.601  -10.244 1.00 70.91  ? 213  ALA A CB  1 
ATOM   1573  N N   . ALA A 1 216 ? 12.266  73.156  -9.248  1.00 41.71  ? 214  ALA A N   1 
ATOM   1574  C CA  . ALA A 1 216 ? 13.120  73.624  -8.167  1.00 42.44  ? 214  ALA A CA  1 
ATOM   1575  C C   . ALA A 1 216 ? 13.062  75.148  -8.161  1.00 42.48  ? 214  ALA A C   1 
ATOM   1576  O O   . ALA A 1 216 ? 12.475  75.762  -7.261  1.00 40.77  ? 214  ALA A O   1 
ATOM   1577  C CB  . ALA A 1 216 ? 14.546  73.140  -8.382  1.00 44.50  ? 214  ALA A CB  1 
ATOM   1578  N N   . LYS A 1 217 ? 13.621  75.742  -9.316  1.00 47.03  ? 215  LYS A N   1 
ATOM   1579  C CA  . LYS A 1 217 ? 13.664  77.194  -9.332  1.00 50.15  ? 215  LYS A CA  1 
ATOM   1580  C C   . LYS A 1 217 ? 12.352  77.828  -8.916  1.00 50.63  ? 215  LYS A C   1 
ATOM   1581  O O   . LYS A 1 217 ? 12.234  78.396  -7.832  1.00 52.75  ? 215  LYS A O   1 
ATOM   1582  C CB  . LYS A 1 217 ? 14.035  77.703  -10.725 1.00 65.25  ? 215  LYS A CB  1 
ATOM   1583  C CG  . LYS A 1 217 ? 15.264  78.595  -10.753 1.00 71.56  ? 215  LYS A CG  1 
ATOM   1584  C CD  . LYS A 1 217 ? 15.475  79.202  -12.129 1.00 74.08  ? 215  LYS A CD  1 
ATOM   1585  C CE  . LYS A 1 217 ? 16.704  80.094  -12.157 1.00 74.40  ? 215  LYS A CE  1 
ATOM   1586  N NZ  . LYS A 1 217 ? 16.923  80.696  -13.500 1.00 72.98  ? 215  LYS A NZ  1 
ATOM   1587  N N   . MET A 1 218 ? 11.316  77.657  -9.576  1.00 42.13  ? 216  MET A N   1 
ATOM   1588  C CA  . MET A 1 218 ? 10.046  78.243  -9.205  1.00 44.15  ? 216  MET A CA  1 
ATOM   1589  C C   . MET A 1 218 ? 9.778   78.267  -7.710  1.00 43.28  ? 216  MET A C   1 
ATOM   1590  O O   . MET A 1 218 ? 9.494   79.322  -7.143  1.00 44.52  ? 216  MET A O   1 
ATOM   1591  C CB  . MET A 1 218 ? 8.910   77.518  -9.915  1.00 84.36  ? 216  MET A CB  1 
ATOM   1592  C CG  . MET A 1 218 ? 8.824   77.852  -11.384 1.00 90.36  ? 216  MET A CG  1 
ATOM   1593  S SD  . MET A 1 218 ? 7.372   77.137  -12.134 1.00 98.87  ? 216  MET A SD  1 
ATOM   1594  C CE  . MET A 1 218 ? 6.070   78.089  -11.324 1.00 96.79  ? 216  MET A CE  1 
ATOM   1595  N N   . LEU A 1 219 ? 9.873   77.113  -7.063  1.00 49.77  ? 217  LEU A N   1 
ATOM   1596  C CA  . LEU A 1 219 ? 9.599   77.054  -5.637  1.00 49.99  ? 217  LEU A CA  1 
ATOM   1597  C C   . LEU A 1 219 ? 10.512  77.973  -4.842  1.00 48.30  ? 217  LEU A C   1 
ATOM   1598  O O   . LEU A 1 219 ? 10.084  78.622  -3.887  1.00 48.18  ? 217  LEU A O   1 
ATOM   1599  C CB  . LEU A 1 219 ? 9.735   75.620  -5.124  1.00 72.40  ? 217  LEU A CB  1 
ATOM   1600  C CG  . LEU A 1 219 ? 9.501   75.415  -3.621  1.00 75.43  ? 217  LEU A CG  1 
ATOM   1601  C CD1 . LEU A 1 219 ? 8.102   75.822  -3.268  1.00 77.24  ? 217  LEU A CD1 1 
ATOM   1602  C CD2 . LEU A 1 219 ? 9.715   73.965  -3.237  1.00 74.29  ? 217  LEU A CD2 1 
ATOM   1603  N N   . LEU A 1 220 ? 11.770  78.038  -5.244  1.00 43.56  ? 218  LEU A N   1 
ATOM   1604  C CA  . LEU A 1 220 ? 12.729  78.865  -4.534  1.00 45.17  ? 218  LEU A CA  1 
ATOM   1605  C C   . LEU A 1 220 ? 12.491  80.348  -4.755  1.00 46.84  ? 218  LEU A C   1 
ATOM   1606  O O   . LEU A 1 220 ? 12.585  81.155  -3.823  1.00 46.25  ? 218  LEU A O   1 
ATOM   1607  C CB  . LEU A 1 220 ? 14.145  78.482  -4.966  1.00 50.08  ? 218  LEU A CB  1 
ATOM   1608  C CG  . LEU A 1 220 ? 14.405  77.001  -4.687  1.00 47.49  ? 218  LEU A CG  1 
ATOM   1609  C CD1 . LEU A 1 220 ? 15.613  76.469  -5.457  1.00 43.94  ? 218  LEU A CD1 1 
ATOM   1610  C CD2 . LEU A 1 220 ? 14.566  76.832  -3.192  1.00 46.36  ? 218  LEU A CD2 1 
ATOM   1611  N N   . HIS A 1 221 ? 12.752  80.626  -6.113  1.00 65.77  ? 219  HIS A N   1 
ATOM   1612  C CA  . HIS A 1 221 ? 12.517  82.015  -6.456  1.00 70.58  ? 219  HIS A CA  1 
ATOM   1613  C C   . HIS A 1 221 ? 11.062  82.399  -6.241  1.00 70.34  ? 219  HIS A C   1 
ATOM   1614  O O   . HIS A 1 221 ? 10.428  82.972  -7.122  1.00 71.61  ? 219  HIS A O   1 
ATOM   1615  C CB  . HIS A 1 221 ? 12.941  82.251  -7.904  1.00 77.83  ? 219  HIS A CB  1 
ATOM   1616  C CG  . HIS A 1 221 ? 14.390  81.965  -8.148  1.00 83.84  ? 219  HIS A CG  1 
ATOM   1617  N ND1 . HIS A 1 221 ? 15.154  82.705  -9.026  1.00 85.94  ? 219  HIS A ND1 1 
ATOM   1618  C CD2 . HIS A 1 221 ? 15.208  81.005  -7.656  1.00 85.91  ? 219  HIS A CD2 1 
ATOM   1619  C CE1 . HIS A 1 221 ? 16.378  82.210  -9.068  1.00 86.62  ? 219  HIS A CE1 1 
ATOM   1620  N NE2 . HIS A 1 221 ? 16.437  81.179  -8.246  1.00 87.56  ? 219  HIS A NE2 1 
ATOM   1621  N N   . SER A 1 222 ? 9.965   82.161  -4.938  1.00 58.20  ? 220  SER A N   1 
ATOM   1622  C CA  . SER A 1 222 ? 8.581   82.473  -4.596  1.00 58.68  ? 220  SER A CA  1 
ATOM   1623  C C   . SER A 1 222 ? 8.257   81.805  -3.283  1.00 61.75  ? 220  SER A C   1 
ATOM   1624  O O   . SER A 1 222 ? 8.959   80.894  -2.868  1.00 62.36  ? 220  SER A O   1 
ATOM   1625  C CB  . SER A 1 222 ? 7.625   81.900  -5.635  1.00 55.36  ? 220  SER A CB  1 
ATOM   1626  O OG  . SER A 1 222 ? 7.286   80.562  -5.297  1.00 51.20  ? 220  SER A OG  1 
ATOM   1627  N N   . GLU A 1 223 ? 7.196   82.250  -2.626  1.00 83.44  ? 221  GLU A N   1 
ATOM   1628  C CA  . GLU A 1 223 ? 6.798   81.595  -1.395  1.00 88.66  ? 221  GLU A CA  1 
ATOM   1629  C C   . GLU A 1 223 ? 5.872   80.499  -1.880  1.00 90.11  ? 221  GLU A C   1 
ATOM   1630  O O   . GLU A 1 223 ? 6.177   79.308  -1.784  1.00 90.81  ? 221  GLU A O   1 
ATOM   1631  C CB  . GLU A 1 223 ? 6.032   82.542  -0.469  1.00 129.31 ? 221  GLU A CB  1 
ATOM   1632  C CG  . GLU A 1 223 ? 4.907   81.857  0.334   1.00 136.04 ? 221  GLU A CG  1 
ATOM   1633  C CD  . GLU A 1 223 ? 5.369   80.631  1.120   1.00 139.30 ? 221  GLU A CD  1 
ATOM   1634  O OE1 . GLU A 1 223 ? 6.288   80.767  1.953   1.00 142.57 ? 221  GLU A OE1 1 
ATOM   1635  O OE2 . GLU A 1 223 ? 4.802   79.534  0.915   1.00 139.40 ? 221  GLU A OE2 1 
ATOM   1636  N N   . GLN A 1 224 ? 4.738   80.931  -2.417  1.00 85.09  ? 222  GLN A N   1 
ATOM   1637  C CA  . GLN A 1 224 ? 3.736   80.030  -2.952  1.00 84.50  ? 222  GLN A CA  1 
ATOM   1638  C C   . GLN A 1 224 ? 3.371   78.860  -2.036  1.00 82.02  ? 222  GLN A C   1 
ATOM   1639  O O   . GLN A 1 224 ? 2.339   78.890  -1.361  1.00 79.90  ? 222  GLN A O   1 
ATOM   1640  C CB  . GLN A 1 224 ? 4.215   79.500  -4.305  1.00 101.68 ? 222  GLN A CB  1 
ATOM   1641  C CG  . GLN A 1 224 ? 4.302   80.562  -5.389  1.00 106.16 ? 222  GLN A CG  1 
ATOM   1642  C CD  . GLN A 1 224 ? 2.933   80.980  -5.906  1.00 110.16 ? 222  GLN A CD  1 
ATOM   1643  O OE1 . GLN A 1 224 ? 2.054   81.359  -5.133  1.00 110.87 ? 222  GLN A OE1 1 
ATOM   1644  N NE2 . GLN A 1 224 ? 2.749   80.914  -7.222  1.00 112.78 ? 222  GLN A NE2 1 
ATOM   1645  N N   . HIS A 1 225 ? 4.237   77.849  -2.033  1.00 76.72  ? 223  HIS A N   1 
ATOM   1646  C CA  . HIS A 1 225 ? 4.083   76.612  -1.276  1.00 74.58  ? 223  HIS A CA  1 
ATOM   1647  C C   . HIS A 1 225 ? 3.984   75.544  -2.358  1.00 73.27  ? 223  HIS A C   1 
ATOM   1648  O O   . HIS A 1 225 ? 3.354   75.769  -3.391  1.00 73.55  ? 223  HIS A O   1 
ATOM   1649  C CB  . HIS A 1 225 ? 2.802   76.629  -0.451  1.00 71.28  ? 223  HIS A CB  1 
ATOM   1650  C CG  . HIS A 1 225 ? 2.556   75.369  0.311   1.00 72.67  ? 223  HIS A CG  1 
ATOM   1651  N ND1 . HIS A 1 225 ? 2.677   74.121  -0.260  1.00 74.32  ? 223  HIS A ND1 1 
ATOM   1652  C CD2 . HIS A 1 225 ? 2.140   75.163  1.583   1.00 73.31  ? 223  HIS A CD2 1 
ATOM   1653  C CE1 . HIS A 1 225 ? 2.344   73.201  0.627   1.00 75.25  ? 223  HIS A CE1 1 
ATOM   1654  N NE2 . HIS A 1 225 ? 2.013   73.806  1.753   1.00 73.67  ? 223  HIS A NE2 1 
ATOM   1655  N N   . PRO A 1 226 ? 4.604   74.371  -2.147  1.00 69.41  ? 224  PRO A N   1 
ATOM   1656  C CA  . PRO A 1 226 ? 4.544   73.311  -3.163  1.00 67.69  ? 224  PRO A CA  1 
ATOM   1657  C C   . PRO A 1 226 ? 3.122   72.956  -3.595  1.00 65.75  ? 224  PRO A C   1 
ATOM   1658  O O   . PRO A 1 226 ? 2.838   72.831  -4.788  1.00 64.99  ? 224  PRO A O   1 
ATOM   1659  C CB  . PRO A 1 226 ? 5.256   72.146  -2.485  1.00 59.83  ? 224  PRO A CB  1 
ATOM   1660  C CG  . PRO A 1 226 ? 6.247   72.840  -1.601  1.00 59.72  ? 224  PRO A CG  1 
ATOM   1661  C CD  . PRO A 1 226 ? 5.422   73.950  -0.999  1.00 59.42  ? 224  PRO A CD  1 
ATOM   1662  N N   . GLY A 1 227 ? 2.235   72.793  -2.619  1.00 57.87  ? 225  GLY A N   1 
ATOM   1663  C CA  . GLY A 1 227 ? 0.856   72.464  -2.924  1.00 56.13  ? 225  GLY A CA  1 
ATOM   1664  C C   . GLY A 1 227 ? 0.249   73.518  -3.823  1.00 54.51  ? 225  GLY A C   1 
ATOM   1665  O O   . GLY A 1 227 ? -0.605  73.226  -4.655  1.00 54.03  ? 225  GLY A O   1 
ATOM   1666  N N   . GLN A 1 228 ? 0.694   74.757  -3.656  1.00 54.23  ? 226  GLN A N   1 
ATOM   1667  C CA  . GLN A 1 228 ? 0.188   75.845  -4.472  1.00 52.10  ? 226  GLN A CA  1 
ATOM   1668  C C   . GLN A 1 228 ? 0.580   75.568  -5.903  1.00 48.04  ? 226  GLN A C   1 
ATOM   1669  O O   . GLN A 1 228 ? -0.262  75.326  -6.763  1.00 48.41  ? 226  GLN A O   1 
ATOM   1670  C CB  . GLN A 1 228 ? 0.797   77.166  -4.041  1.00 82.44  ? 226  GLN A CB  1 
ATOM   1671  C CG  . GLN A 1 228 ? 0.031   78.341  -4.572  1.00 89.38  ? 226  GLN A CG  1 
ATOM   1672  C CD  . GLN A 1 228 ? -1.423  78.289  -4.154  1.00 93.83  ? 226  GLN A CD  1 
ATOM   1673  O OE1 . GLN A 1 228 ? -2.181  77.425  -4.601  1.00 95.68  ? 226  GLN A OE1 1 
ATOM   1674  N NE2 . GLN A 1 228 ? -1.819  79.208  -3.279  1.00 97.89  ? 226  GLN A NE2 1 
ATOM   1675  N N   . LEU A 1 229 ? 1.878   75.605  -6.148  1.00 34.52  ? 227  LEU A N   1 
ATOM   1676  C CA  . LEU A 1 229 ? 2.391   75.338  -7.471  1.00 36.26  ? 227  LEU A CA  1 
ATOM   1677  C C   . LEU A 1 229 ? 1.773   74.045  -7.999  1.00 36.01  ? 227  LEU A C   1 
ATOM   1678  O O   . LEU A 1 229 ? 1.765   73.800  -9.204  1.00 36.77  ? 227  LEU A O   1 
ATOM   1679  C CB  . LEU A 1 229 ? 3.915   75.209  -7.423  1.00 44.03  ? 227  LEU A CB  1 
ATOM   1680  C CG  . LEU A 1 229 ? 4.691   76.402  -6.867  1.00 43.23  ? 227  LEU A CG  1 
ATOM   1681  C CD1 . LEU A 1 229 ? 6.164   76.224  -7.163  1.00 43.22  ? 227  LEU A CD1 1 
ATOM   1682  C CD2 . LEU A 1 229 ? 4.195   77.678  -7.506  1.00 43.68  ? 227  LEU A CD2 1 
ATOM   1683  N N   . LYS A 1 230 ? 1.255   73.214  -7.100  1.00 46.60  ? 228  LYS A N   1 
ATOM   1684  C CA  . LYS A 1 230 ? 0.645   71.960  -7.522  1.00 47.28  ? 228  LYS A CA  1 
ATOM   1685  C C   . LYS A 1 230 ? -0.617  72.278  -8.316  1.00 47.68  ? 228  LYS A C   1 
ATOM   1686  O O   . LYS A 1 230 ? -0.710  71.974  -9.503  1.00 47.68  ? 228  LYS A O   1 
ATOM   1687  C CB  . LYS A 1 230 ? 0.287   71.092  -6.310  1.00 55.33  ? 228  LYS A CB  1 
ATOM   1688  C CG  . LYS A 1 230 ? -0.074  69.649  -6.652  1.00 52.63  ? 228  LYS A CG  1 
ATOM   1689  C CD  . LYS A 1 230 ? -0.848  69.000  -5.521  1.00 50.87  ? 228  LYS A CD  1 
ATOM   1690  C CE  . LYS A 1 230 ? -2.227  69.629  -5.393  1.00 51.79  ? 228  LYS A CE  1 
ATOM   1691  N NZ  . LYS A 1 230 ? -2.937  69.208  -4.155  1.00 50.76  ? 228  LYS A NZ  1 
ATOM   1692  N N   . ASP A 1 231 ? -1.579  72.907  -7.654  1.00 57.69  ? 229  ASP A N   1 
ATOM   1693  C CA  . ASP A 1 231 ? -2.844  73.273  -8.285  1.00 60.55  ? 229  ASP A CA  1 
ATOM   1694  C C   . ASP A 1 231 ? -2.605  74.123  -9.522  1.00 61.35  ? 229  ASP A C   1 
ATOM   1695  O O   . ASP A 1 231 ? -3.260  73.956  -10.551 1.00 62.47  ? 229  ASP A O   1 
ATOM   1696  C CB  . ASP A 1 231 ? -3.696  74.058  -7.296  1.00 67.00  ? 229  ASP A CB  1 
ATOM   1697  C CG  . ASP A 1 231 ? -3.483  73.600  -5.876  1.00 69.13  ? 229  ASP A CG  1 
ATOM   1698  O OD1 . ASP A 1 231 ? -3.126  72.418  -5.710  1.00 70.52  ? 229  ASP A OD1 1 
ATOM   1699  O OD2 . ASP A 1 231 ? -3.672  74.404  -4.936  1.00 71.12  ? 229  ASP A OD2 1 
ATOM   1700  N N   . ASN A 1 232 ? -1.658  75.041  -9.403  1.00 57.39  ? 230  ASN A N   1 
ATOM   1701  C CA  . ASN A 1 232 ? -1.304  75.942  -10.485 1.00 58.28  ? 230  ASN A CA  1 
ATOM   1702  C C   . ASN A 1 232 ? -0.855  75.238  -11.752 1.00 58.26  ? 230  ASN A C   1 
ATOM   1703  O O   . ASN A 1 232 ? -0.581  75.892  -12.749 1.00 59.65  ? 230  ASN A O   1 
ATOM   1704  C CB  . ASN A 1 232 ? -0.184  76.870  -10.032 1.00 70.73  ? 230  ASN A CB  1 
ATOM   1705  C CG  . ASN A 1 232 ? -0.604  77.770  -8.906  1.00 73.96  ? 230  ASN A CG  1 
ATOM   1706  O OD1 . ASN A 1 232 ? -1.570  77.484  -8.189  1.00 73.59  ? 230  ASN A OD1 1 
ATOM   1707  N ND2 . ASN A 1 232 ? 0.127   78.866  -8.727  1.00 75.21  ? 230  ASN A ND2 1 
ATOM   1708  N N   . VAL A 1 233 ? -0.769  73.917  -11.738 1.00 52.05  ? 231  VAL A N   1 
ATOM   1709  C CA  . VAL A 1 233 ? -0.305  73.239  -12.936 1.00 52.51  ? 231  VAL A CA  1 
ATOM   1710  C C   . VAL A 1 233 ? -1.147  72.039  -13.358 1.00 52.02  ? 231  VAL A C   1 
ATOM   1711  O O   . VAL A 1 233 ? -0.862  71.384  -14.364 1.00 52.21  ? 231  VAL A O   1 
ATOM   1712  C CB  . VAL A 1 233 ? 1.165   72.824  -12.761 1.00 66.29  ? 231  VAL A CB  1 
ATOM   1713  C CG1 . VAL A 1 233 ? 1.725   72.269  -14.062 1.00 68.57  ? 231  VAL A CG1 1 
ATOM   1714  C CG2 . VAL A 1 233 ? 1.975   74.026  -12.307 1.00 66.75  ? 231  VAL A CG2 1 
ATOM   1715  N N   . SER A 1 234 ? -2.189  71.752  -12.592 1.00 67.80  ? 232  SER A N   1 
ATOM   1716  C CA  . SER A 1 234 ? -3.068  70.646  -12.926 1.00 66.68  ? 232  SER A CA  1 
ATOM   1717  C C   . SER A 1 234 ? -4.441  71.196  -13.296 1.00 65.98  ? 232  SER A C   1 
ATOM   1718  O O   . SER A 1 234 ? -5.211  71.621  -12.431 1.00 66.64  ? 232  SER A O   1 
ATOM   1719  C CB  . SER A 1 234 ? -3.162  69.655  -11.753 1.00 54.98  ? 232  SER A CB  1 
ATOM   1720  O OG  . SER A 1 234 ? -3.235  70.316  -10.498 1.00 53.92  ? 232  SER A OG  1 
ATOM   1721  N N   . SER A 1 235 ? -4.721  71.217  -14.598 1.00 54.23  ? 233  SER A N   1 
ATOM   1722  C CA  . SER A 1 235 ? -6.000  71.696  -15.110 1.00 51.29  ? 233  SER A CA  1 
ATOM   1723  C C   . SER A 1 235 ? -7.056  70.655  -14.761 1.00 49.68  ? 233  SER A C   1 
ATOM   1724  O O   . SER A 1 235 ? -6.828  69.446  -14.917 1.00 47.49  ? 233  SER A O   1 
ATOM   1725  C CB  . SER A 1 235 ? -5.938  71.869  -16.627 1.00 55.98  ? 233  SER A CB  1 
ATOM   1726  O OG  . SER A 1 235 ? -5.710  70.624  -17.268 1.00 56.56  ? 233  SER A OG  1 
ATOM   1727  N N   . PRO A 1 236 ? -8.223  71.109  -14.276 1.00 35.13  ? 234  PRO A N   1 
ATOM   1728  C CA  . PRO A 1 236 ? -9.351  70.264  -13.885 1.00 34.95  ? 234  PRO A CA  1 
ATOM   1729  C C   . PRO A 1 236 ? -9.545  69.113  -14.851 1.00 36.07  ? 234  PRO A C   1 
ATOM   1730  O O   . PRO A 1 236 ? -10.268 68.158  -14.567 1.00 36.60  ? 234  PRO A O   1 
ATOM   1731  C CB  . PRO A 1 236 ? -10.510 71.244  -13.886 1.00 54.60  ? 234  PRO A CB  1 
ATOM   1732  C CG  . PRO A 1 236 ? -9.870  72.450  -13.311 1.00 56.60  ? 234  PRO A CG  1 
ATOM   1733  C CD  . PRO A 1 236 ? -8.573  72.528  -14.109 1.00 55.48  ? 234  PRO A CD  1 
ATOM   1734  N N   . GLY A 1 237 ? -8.889  69.212  -16.000 1.00 60.85  ? 235  GLY A N   1 
ATOM   1735  C CA  . GLY A 1 237 ? -8.984  68.163  -16.990 1.00 61.02  ? 235  GLY A CA  1 
ATOM   1736  C C   . GLY A 1 237 ? -8.306  66.907  -16.499 1.00 59.07  ? 235  GLY A C   1 
ATOM   1737  O O   . GLY A 1 237 ? -8.969  65.965  -16.082 1.00 57.18  ? 235  GLY A O   1 
ATOM   1738  N N   . GLY A 1 238 ? -6.981  66.890  -16.556 1.00 46.68  ? 236  GLY A N   1 
ATOM   1739  C CA  . GLY A 1 238 ? -6.252  65.720  -16.112 1.00 48.10  ? 236  GLY A CA  1 
ATOM   1740  C C   . GLY A 1 238 ? -4.866  65.617  -16.706 1.00 48.57  ? 236  GLY A C   1 
ATOM   1741  O O   . GLY A 1 238 ? -4.199  66.628  -16.942 1.00 48.91  ? 236  GLY A O   1 
ATOM   1742  N N   . ALA A 1 239 ? -4.442  64.382  -16.956 1.00 74.97  ? 237  ALA A N   1 
ATOM   1743  C CA  . ALA A 1 239 ? -3.124  64.105  -17.515 1.00 74.68  ? 237  ALA A CA  1 
ATOM   1744  C C   . ALA A 1 239 ? -2.103  64.347  -16.414 1.00 73.37  ? 237  ALA A C   1 
ATOM   1745  O O   . ALA A 1 239 ? -1.104  63.646  -16.305 1.00 74.46  ? 237  ALA A O   1 
ATOM   1746  C CB  . ALA A 1 239 ? -2.843  65.015  -18.725 1.00 47.45  ? 237  ALA A CB  1 
ATOM   1747  N N   . THR A 1 240 ? -2.368  65.349  -15.590 1.00 33.21  ? 238  THR A N   1 
ATOM   1748  C CA  . THR A 1 240 ? -1.480  65.665  -14.493 1.00 27.83  ? 238  THR A CA  1 
ATOM   1749  C C   . THR A 1 240 ? -2.177  65.229  -13.234 1.00 26.11  ? 238  THR A C   1 
ATOM   1750  O O   . THR A 1 240 ? -1.761  64.270  -12.595 1.00 25.75  ? 238  THR A O   1 
ATOM   1751  C CB  . THR A 1 240 ? -1.176  67.168  -14.426 1.00 33.47  ? 238  THR A CB  1 
ATOM   1752  O OG1 . THR A 1 240 ? -0.168  67.489  -15.396 1.00 29.36  ? 238  THR A OG1 1 
ATOM   1753  C CG2 . THR A 1 240 ? -0.689  67.555  -13.039 1.00 31.21  ? 238  THR A CG2 1 
ATOM   1754  N N   . ILE A 1 241 ? -3.244  65.931  -12.879 1.00 32.20  ? 239  ILE A N   1 
ATOM   1755  C CA  . ILE A 1 241 ? -3.998  65.577  -11.688 1.00 36.04  ? 239  ILE A CA  1 
ATOM   1756  C C   . ILE A 1 241 ? -4.177  64.063  -11.718 1.00 38.79  ? 239  ILE A C   1 
ATOM   1757  O O   . ILE A 1 241 ? -4.345  63.416  -10.686 1.00 43.09  ? 239  ILE A O   1 
ATOM   1758  C CB  . ILE A 1 241 ? -5.365  66.251  -11.702 1.00 32.12  ? 239  ILE A CB  1 
ATOM   1759  C CG1 . ILE A 1 241 ? -6.260  65.696  -10.588 1.00 29.95  ? 239  ILE A CG1 1 
ATOM   1760  C CG2 . ILE A 1 241 ? -5.990  66.042  -13.045 1.00 31.83  ? 239  ILE A CG2 1 
ATOM   1761  C CD1 . ILE A 1 241 ? -5.809  66.063  -9.206  1.00 28.26  ? 239  ILE A CD1 1 
ATOM   1762  N N   . HIS A 1 242 ? -4.134  63.497  -12.915 1.00 41.32  ? 240  HIS A N   1 
ATOM   1763  C CA  . HIS A 1 242 ? -4.272  62.064  -13.041 1.00 40.33  ? 240  HIS A CA  1 
ATOM   1764  C C   . HIS A 1 242 ? -2.994  61.368  -12.661 1.00 39.40  ? 240  HIS A C   1 
ATOM   1765  O O   . HIS A 1 242 ? -3.021  60.406  -11.899 1.00 41.74  ? 240  HIS A O   1 
ATOM   1766  C CB  . HIS A 1 242 ? -4.660  61.690  -14.458 1.00 49.15  ? 240  HIS A CB  1 
ATOM   1767  C CG  . HIS A 1 242 ? -6.129  61.746  -14.693 1.00 50.70  ? 240  HIS A CG  1 
ATOM   1768  N ND1 . HIS A 1 242 ? -6.733  61.185  -15.794 1.00 53.39  ? 240  HIS A ND1 1 
ATOM   1769  C CD2 . HIS A 1 242 ? -7.125  62.263  -13.938 1.00 53.77  ? 240  HIS A CD2 1 
ATOM   1770  C CE1 . HIS A 1 242 ? -8.041  61.347  -15.705 1.00 54.68  ? 240  HIS A CE1 1 
ATOM   1771  N NE2 . HIS A 1 242 ? -8.305  61.998  -14.587 1.00 54.08  ? 240  HIS A NE2 1 
ATOM   1772  N N   . ALA A 1 243 ? -1.876  61.849  -13.198 1.00 44.37  ? 241  ALA A N   1 
ATOM   1773  C CA  . ALA A 1 243 ? -0.568  61.271  -12.891 1.00 43.40  ? 241  ALA A CA  1 
ATOM   1774  C C   . ALA A 1 243 ? -0.347  61.401  -11.390 1.00 41.57  ? 241  ALA A C   1 
ATOM   1775  O O   . ALA A 1 243 ? 0.246   60.532  -10.752 1.00 42.22  ? 241  ALA A O   1 
ATOM   1776  C CB  . ALA A 1 243 ? 0.532   62.009  -13.651 1.00 60.82  ? 241  ALA A CB  1 
ATOM   1777  N N   . LEU A 1 244 ? -0.830  62.501  -10.829 1.00 28.59  ? 242  LEU A N   1 
ATOM   1778  C CA  . LEU A 1 244 ? -0.695  62.704  -9.406  1.00 27.32  ? 242  LEU A CA  1 
ATOM   1779  C C   . LEU A 1 244 ? -1.431  61.572  -8.745  1.00 26.61  ? 242  LEU A C   1 
ATOM   1780  O O   . LEU A 1 244 ? -0.822  60.725  -8.095  1.00 29.34  ? 242  LEU A O   1 
ATOM   1781  C CB  . LEU A 1 244 ? -1.314  64.033  -8.978  1.00 36.14  ? 242  LEU A CB  1 
ATOM   1782  C CG  . LEU A 1 244 ? -0.687  65.266  -9.626  1.00 36.46  ? 242  LEU A CG  1 
ATOM   1783  C CD1 . LEU A 1 244 ? -1.158  66.501  -8.878  1.00 34.96  ? 242  LEU A CD1 1 
ATOM   1784  C CD2 . LEU A 1 244 ? 0.840   65.165  -9.594  1.00 34.65  ? 242  LEU A CD2 1 
ATOM   1785  N N   . HIS A 1 245 ? -2.745  61.550  -8.926  1.00 28.16  ? 243  HIS A N   1 
ATOM   1786  C CA  . HIS A 1 245 ? -3.553  60.504  -8.328  1.00 30.02  ? 243  HIS A CA  1 
ATOM   1787  C C   . HIS A 1 245 ? -2.785  59.185  -8.223  1.00 29.32  ? 243  HIS A C   1 
ATOM   1788  O O   . HIS A 1 245 ? -2.766  58.576  -7.155  1.00 31.93  ? 243  HIS A O   1 
ATOM   1789  C CB  . HIS A 1 245 ? -4.847  60.284  -9.122  1.00 40.44  ? 243  HIS A CB  1 
ATOM   1790  C CG  . HIS A 1 245 ? -5.807  59.347  -8.450  1.00 45.46  ? 243  HIS A CG  1 
ATOM   1791  N ND1 . HIS A 1 245 ? -5.676  58.977  -7.128  1.00 47.93  ? 243  HIS A ND1 1 
ATOM   1792  C CD2 . HIS A 1 245 ? -6.926  58.733  -8.900  1.00 46.12  ? 243  HIS A CD2 1 
ATOM   1793  C CE1 . HIS A 1 245 ? -6.673  58.177  -6.793  1.00 45.82  ? 243  HIS A CE1 1 
ATOM   1794  N NE2 . HIS A 1 245 ? -7.446  58.013  -7.850  1.00 45.13  ? 243  HIS A NE2 1 
ATOM   1795  N N   . VAL A 1 246 ? -2.128  58.759  -9.305  1.00 25.78  ? 244  VAL A N   1 
ATOM   1796  C CA  . VAL A 1 246 ? -1.396  57.493  -9.268  1.00 23.79  ? 244  VAL A CA  1 
ATOM   1797  C C   . VAL A 1 246 ? -0.289  57.519  -8.239  1.00 24.93  ? 244  VAL A C   1 
ATOM   1798  O O   . VAL A 1 246 ? -0.205  56.620  -7.405  1.00 24.84  ? 244  VAL A O   1 
ATOM   1799  C CB  . VAL A 1 246 ? -0.788  57.089  -10.657 1.00 22.90  ? 244  VAL A CB  1 
ATOM   1800  C CG1 . VAL A 1 246 ? -1.695  57.556  -11.759 1.00 23.25  ? 244  VAL A CG1 1 
ATOM   1801  C CG2 . VAL A 1 246 ? 0.633   57.621  -10.835 1.00 18.86  ? 244  VAL A CG2 1 
ATOM   1802  N N   . LEU A 1 247 ? 0.562   58.542  -8.304  1.00 33.93  ? 245  LEU A N   1 
ATOM   1803  C CA  . LEU A 1 247 ? 1.659   58.674  -7.354  1.00 32.80  ? 245  LEU A CA  1 
ATOM   1804  C C   . LEU A 1 247 ? 1.005   58.623  -5.990  1.00 35.23  ? 245  LEU A C   1 
ATOM   1805  O O   . LEU A 1 247 ? 1.343   57.798  -5.137  1.00 35.63  ? 245  LEU A O   1 
ATOM   1806  C CB  . LEU A 1 247 ? 2.365   60.022  -7.514  1.00 17.91  ? 245  LEU A CB  1 
ATOM   1807  C CG  . LEU A 1 247 ? 3.100   60.347  -8.814  1.00 19.82  ? 245  LEU A CG  1 
ATOM   1808  C CD1 . LEU A 1 247 ? 3.774   61.707  -8.679  1.00 18.01  ? 245  LEU A CD1 1 
ATOM   1809  C CD2 . LEU A 1 247 ? 4.139   59.272  -9.112  1.00 23.41  ? 245  LEU A CD2 1 
ATOM   1810  N N   . GLU A 1 248 ? 0.038   59.510  -5.813  1.00 33.75  ? 246  GLU A N   1 
ATOM   1811  C CA  . GLU A 1 248 ? -0.691  59.606  -4.569  1.00 37.80  ? 246  GLU A CA  1 
ATOM   1812  C C   . GLU A 1 248 ? -1.194  58.244  -4.117  1.00 37.57  ? 246  GLU A C   1 
ATOM   1813  O O   . GLU A 1 248 ? -1.218  57.938  -2.923  1.00 34.72  ? 246  GLU A O   1 
ATOM   1814  C CB  . GLU A 1 248 ? -1.877  60.539  -4.744  1.00 49.96  ? 246  GLU A CB  1 
ATOM   1815  C CG  . GLU A 1 248 ? -2.221  61.278  -3.480  1.00 57.40  ? 246  GLU A CG  1 
ATOM   1816  C CD  . GLU A 1 248 ? -1.123  62.243  -3.071  1.00 58.35  ? 246  GLU A CD  1 
ATOM   1817  O OE1 . GLU A 1 248 ? -1.295  62.918  -2.037  1.00 61.38  ? 246  GLU A OE1 1 
ATOM   1818  O OE2 . GLU A 1 248 ? -0.093  62.328  -3.780  1.00 53.55  ? 246  GLU A OE2 1 
ATOM   1819  N N   . SER A 1 249 ? -1.601  57.432  -5.086  1.00 33.28  ? 247  SER A N   1 
ATOM   1820  C CA  . SER A 1 249 ? -2.132  56.117  -4.792  1.00 32.22  ? 247  SER A CA  1 
ATOM   1821  C C   . SER A 1 249 ? -1.119  55.219  -4.148  1.00 33.48  ? 247  SER A C   1 
ATOM   1822  O O   . SER A 1 249 ? -1.444  54.515  -3.204  1.00 37.95  ? 247  SER A O   1 
ATOM   1823  C CB  . SER A 1 249 ? -2.641  55.462  -6.060  1.00 34.90  ? 247  SER A CB  1 
ATOM   1824  O OG  . SER A 1 249 ? -3.759  56.164  -6.550  1.00 38.20  ? 247  SER A OG  1 
ATOM   1825  N N   . GLY A 1 250 ? 0.106   55.249  -4.655  1.00 27.40  ? 248  GLY A N   1 
ATOM   1826  C CA  . GLY A 1 250 ? 1.139   54.393  -4.111  1.00 29.53  ? 248  GLY A CA  1 
ATOM   1827  C C   . GLY A 1 250 ? 2.053   55.025  -3.079  1.00 32.06  ? 248  GLY A C   1 
ATOM   1828  O O   . GLY A 1 250 ? 3.253   54.758  -3.085  1.00 32.68  ? 248  GLY A O   1 
ATOM   1829  N N   . GLY A 1 251 ? 1.499   55.860  -2.201  1.00 40.50  ? 249  GLY A N   1 
ATOM   1830  C CA  . GLY A 1 251 ? 2.285   56.503  -1.154  1.00 40.62  ? 249  GLY A CA  1 
ATOM   1831  C C   . GLY A 1 251 ? 3.634   57.119  -1.505  1.00 40.86  ? 249  GLY A C   1 
ATOM   1832  O O   . GLY A 1 251 ? 4.573   57.059  -0.709  1.00 43.96  ? 249  GLY A O   1 
ATOM   1833  N N   . PHE A 1 252 ? 3.721   57.710  -2.692  1.00 47.46  ? 250  PHE A N   1 
ATOM   1834  C CA  . PHE A 1 252 ? 4.932   58.370  -3.203  1.00 45.68  ? 250  PHE A CA  1 
ATOM   1835  C C   . PHE A 1 252 ? 5.600   59.286  -2.162  1.00 45.84  ? 250  PHE A C   1 
ATOM   1836  O O   . PHE A 1 252 ? 6.820   59.251  -1.965  1.00 43.26  ? 250  PHE A O   1 
ATOM   1837  C CB  . PHE A 1 252 ? 4.545   59.177  -4.463  1.00 35.83  ? 250  PHE A CB  1 
ATOM   1838  C CG  . PHE A 1 252 ? 5.631   60.090  -4.994  1.00 24.87  ? 250  PHE A CG  1 
ATOM   1839  C CD1 . PHE A 1 252 ? 6.782   59.571  -5.578  1.00 21.30  ? 250  PHE A CD1 1 
ATOM   1840  C CD2 . PHE A 1 252 ? 5.468   61.478  -4.944  1.00 18.47  ? 250  PHE A CD2 1 
ATOM   1841  C CE1 . PHE A 1 252 ? 7.761   60.426  -6.115  1.00 21.52  ? 250  PHE A CE1 1 
ATOM   1842  C CE2 . PHE A 1 252 ? 6.433   62.342  -5.472  1.00 15.14  ? 250  PHE A CE2 1 
ATOM   1843  C CZ  . PHE A 1 252 ? 7.582   61.817  -6.060  1.00 17.31  ? 250  PHE A CZ  1 
ATOM   1844  N N   . ARG A 1 253 ? 4.787   60.109  -1.508  1.00 47.25  ? 251  ARG A N   1 
ATOM   1845  C CA  . ARG A 1 253 ? 5.276   61.035  -0.495  1.00 46.02  ? 251  ARG A CA  1 
ATOM   1846  C C   . ARG A 1 253 ? 5.817   60.198  0.651   1.00 44.81  ? 251  ARG A C   1 
ATOM   1847  O O   . ARG A 1 253 ? 6.987   60.292  1.007   1.00 47.64  ? 251  ARG A O   1 
ATOM   1848  C CB  . ARG A 1 253 ? 4.122   61.919  -0.016  1.00 34.51  ? 251  ARG A CB  1 
ATOM   1849  C CG  . ARG A 1 253 ? 3.020   62.012  -1.051  1.00 35.31  ? 251  ARG A CG  1 
ATOM   1850  C CD  . ARG A 1 253 ? 1.912   62.993  -0.712  1.00 39.36  ? 251  ARG A CD  1 
ATOM   1851  N NE  . ARG A 1 253 ? 2.278   64.398  -0.892  1.00 44.53  ? 251  ARG A NE  1 
ATOM   1852  C CZ  . ARG A 1 253 ? 1.389   65.371  -1.077  1.00 43.85  ? 251  ARG A CZ  1 
ATOM   1853  N NH1 . ARG A 1 253 ? 0.100   65.085  -1.115  1.00 46.99  ? 251  ARG A NH1 1 
ATOM   1854  N NH2 . ARG A 1 253 ? 1.772   66.631  -1.199  1.00 45.36  ? 251  ARG A NH2 1 
ATOM   1855  N N   . SER A 1 254 ? 4.946   59.369  1.212   1.00 30.49  ? 252  SER A N   1 
ATOM   1856  C CA  . SER A 1 254 ? 5.300   58.487  2.306   1.00 28.94  ? 252  SER A CA  1 
ATOM   1857  C C   . SER A 1 254 ? 6.704   57.927  2.098   1.00 26.29  ? 252  SER A C   1 
ATOM   1858  O O   . SER A 1 254 ? 7.522   57.916  3.010   1.00 28.85  ? 252  SER A O   1 
ATOM   1859  C CB  . SER A 1 254 ? 4.286   57.342  2.385   1.00 32.40  ? 252  SER A CB  1 
ATOM   1860  O OG  . SER A 1 254 ? 4.579   56.464  3.452   1.00 36.51  ? 252  SER A OG  1 
ATOM   1861  N N   . LEU A 1 255 ? 6.990   57.479  0.886   1.00 23.26  ? 253  LEU A N   1 
ATOM   1862  C CA  . LEU A 1 255 ? 8.294   56.913  0.589   1.00 21.87  ? 253  LEU A CA  1 
ATOM   1863  C C   . LEU A 1 255 ? 9.405   57.909  0.706   1.00 23.48  ? 253  LEU A C   1 
ATOM   1864  O O   . LEU A 1 255 ? 10.539  57.530  0.927   1.00 26.01  ? 253  LEU A O   1 
ATOM   1865  C CB  . LEU A 1 255 ? 8.335   56.339  -0.820  1.00 31.23  ? 253  LEU A CB  1 
ATOM   1866  C CG  . LEU A 1 255 ? 7.240   55.337  -1.145  1.00 32.37  ? 253  LEU A CG  1 
ATOM   1867  C CD1 . LEU A 1 255 ? 7.685   54.514  -2.356  1.00 32.66  ? 253  LEU A CD1 1 
ATOM   1868  C CD2 . LEU A 1 255 ? 6.975   54.454  0.074   1.00 32.53  ? 253  LEU A CD2 1 
ATOM   1869  N N   . LEU A 1 256 ? 9.102   59.184  0.519   1.00 30.61  ? 254  LEU A N   1 
ATOM   1870  C CA  . LEU A 1 256 ? 10.143  60.203  0.618   1.00 29.89  ? 254  LEU A CA  1 
ATOM   1871  C C   . LEU A 1 256 ? 10.436  60.514  2.080   1.00 29.59  ? 254  LEU A C   1 
ATOM   1872  O O   . LEU A 1 256 ? 11.588  60.700  2.458   1.00 27.67  ? 254  LEU A O   1 
ATOM   1873  C CB  . LEU A 1 256 ? 9.730   61.461  -0.150  1.00 26.09  ? 254  LEU A CB  1 
ATOM   1874  C CG  . LEU A 1 256 ? 9.781   61.259  -1.673  1.00 24.04  ? 254  LEU A CG  1 
ATOM   1875  C CD1 . LEU A 1 256 ? 9.030   62.391  -2.367  1.00 21.30  ? 254  LEU A CD1 1 
ATOM   1876  C CD2 . LEU A 1 256 ? 11.236  61.168  -2.140  1.00 14.85  ? 254  LEU A CD2 1 
ATOM   1877  N N   . ILE A 1 257 ? 9.397   60.563  2.903   1.00 22.95  ? 255  ILE A N   1 
ATOM   1878  C CA  . ILE A 1 257 ? 9.600   60.802  4.314   1.00 24.92  ? 255  ILE A CA  1 
ATOM   1879  C C   . ILE A 1 257 ? 10.495  59.666  4.741   1.00 26.29  ? 255  ILE A C   1 
ATOM   1880  O O   . ILE A 1 257 ? 11.622  59.875  5.176   1.00 31.36  ? 255  ILE A O   1 
ATOM   1881  C CB  . ILE A 1 257 ? 8.320   60.661  5.103   1.00 35.99  ? 255  ILE A CB  1 
ATOM   1882  C CG1 . ILE A 1 257 ? 7.233   61.542  4.499   1.00 39.32  ? 255  ILE A CG1 1 
ATOM   1883  C CG2 . ILE A 1 257 ? 8.578   61.041  6.536   1.00 36.31  ? 255  ILE A CG2 1 
ATOM   1884  C CD1 . ILE A 1 257 ? 7.572   63.005  4.529   1.00 46.54  ? 255  ILE A CD1 1 
ATOM   1885  N N   . ASN A 1 258 ? 9.981   58.451  4.592   1.00 29.45  ? 256  ASN A N   1 
ATOM   1886  C CA  . ASN A 1 258 ? 10.715  57.254  4.952   1.00 27.02  ? 256  ASN A CA  1 
ATOM   1887  C C   . ASN A 1 258 ? 12.198  57.337  4.663   1.00 27.02  ? 256  ASN A C   1 
ATOM   1888  O O   . ASN A 1 258 ? 13.005  56.871  5.459   1.00 29.28  ? 256  ASN A O   1 
ATOM   1889  C CB  . ASN A 1 258 ? 10.140  56.045  4.231   1.00 23.31  ? 256  ASN A CB  1 
ATOM   1890  C CG  . ASN A 1 258 ? 8.771   55.677  4.737   1.00 26.39  ? 256  ASN A CG  1 
ATOM   1891  O OD1 . ASN A 1 258 ? 8.370   56.092  5.827   1.00 28.33  ? 256  ASN A OD1 1 
ATOM   1892  N ND2 . ASN A 1 258 ? 8.042   54.885  3.958   1.00 26.75  ? 256  ASN A ND2 1 
ATOM   1893  N N   . ALA A 1 259 ? 12.562  57.934  3.535   1.00 21.37  ? 257  ALA A N   1 
ATOM   1894  C CA  . ALA A 1 259 ? 13.971  58.046  3.164   1.00 24.14  ? 257  ALA A CA  1 
ATOM   1895  C C   . ALA A 1 259 ? 14.704  59.134  3.940   1.00 25.17  ? 257  ALA A C   1 
ATOM   1896  O O   . ALA A 1 259 ? 15.840  58.941  4.363   1.00 28.01  ? 257  ALA A O   1 
ATOM   1897  C CB  . ALA A 1 259 ? 14.109  58.285  1.661   1.00 31.33  ? 257  ALA A CB  1 
ATOM   1898  N N   . VAL A 1 260 ? 14.067  60.284  4.106   1.00 43.59  ? 258  VAL A N   1 
ATOM   1899  C CA  . VAL A 1 260 ? 14.670  61.368  4.866   1.00 42.52  ? 258  VAL A CA  1 
ATOM   1900  C C   . VAL A 1 260 ? 14.988  60.750  6.215   1.00 43.23  ? 258  VAL A C   1 
ATOM   1901  O O   . VAL A 1 260 ? 16.121  60.789  6.691   1.00 47.51  ? 258  VAL A O   1 
ATOM   1902  C CB  . VAL A 1 260 ? 13.662  62.533  5.067   1.00 28.26  ? 258  VAL A CB  1 
ATOM   1903  C CG1 . VAL A 1 260 ? 13.785  63.116  6.461   1.00 24.14  ? 258  VAL A CG1 1 
ATOM   1904  C CG2 . VAL A 1 260 ? 13.904  63.610  4.032   1.00 23.49  ? 258  VAL A CG2 1 
ATOM   1905  N N   . GLU A 1 261 ? 13.956  60.157  6.804   1.00 29.61  ? 259  GLU A N   1 
ATOM   1906  C CA  . GLU A 1 261 ? 14.052  59.516  8.102   1.00 26.56  ? 259  GLU A CA  1 
ATOM   1907  C C   . GLU A 1 261 ? 15.191  58.523  8.116   1.00 26.83  ? 259  GLU A C   1 
ATOM   1908  O O   . GLU A 1 261 ? 16.145  58.667  8.870   1.00 25.96  ? 259  GLU A O   1 
ATOM   1909  C CB  . GLU A 1 261 ? 12.744  58.799  8.416   1.00 19.59  ? 259  GLU A CB  1 
ATOM   1910  C CG  . GLU A 1 261 ? 12.631  58.354  9.840   1.00 18.66  ? 259  GLU A CG  1 
ATOM   1911  C CD  . GLU A 1 261 ? 11.198  58.042  10.240  1.00 22.29  ? 259  GLU A CD  1 
ATOM   1912  O OE1 . GLU A 1 261 ? 10.593  57.120  9.659   1.00 26.64  ? 259  GLU A OE1 1 
ATOM   1913  O OE2 . GLU A 1 261 ? 10.669  58.722  11.142  1.00 25.55  ? 259  GLU A OE2 1 
ATOM   1914  N N   . ALA A 1 262 ? 15.087  57.510  7.269   1.00 22.22  ? 260  ALA A N   1 
ATOM   1915  C CA  . ALA A 1 262 ? 16.115  56.488  7.193   1.00 25.83  ? 260  ALA A CA  1 
ATOM   1916  C C   . ALA A 1 262 ? 17.481  57.143  7.232   1.00 26.60  ? 260  ALA A C   1 
ATOM   1917  O O   . ALA A 1 262 ? 18.260  56.914  8.150   1.00 26.75  ? 260  ALA A O   1 
ATOM   1918  C CB  . ALA A 1 262 ? 15.963  55.687  5.913   1.00 86.33  ? 260  ALA A CB  1 
ATOM   1919  N N   . SER A 1 263 ? 17.759  57.972  6.235   1.00 35.78  ? 261  SER A N   1 
ATOM   1920  C CA  . SER A 1 263 ? 19.043  58.646  6.154   1.00 40.19  ? 261  SER A CA  1 
ATOM   1921  C C   . SER A 1 263 ? 19.397  59.342  7.459   1.00 42.58  ? 261  SER A C   1 
ATOM   1922  O O   . SER A 1 263 ? 20.514  59.209  7.944   1.00 43.95  ? 261  SER A O   1 
ATOM   1923  C CB  . SER A 1 263 ? 19.040  59.662  5.015   1.00 41.02  ? 261  SER A CB  1 
ATOM   1924  O OG  . SER A 1 263 ? 20.286  60.328  4.929   1.00 42.57  ? 261  SER A OG  1 
ATOM   1925  N N   . CYS A 1 264 ? 18.458  60.079  8.038   1.00 49.98  ? 262  CYS A N   1 
ATOM   1926  C CA  . CYS A 1 264 ? 18.754  60.770  9.289   1.00 50.37  ? 262  CYS A CA  1 
ATOM   1927  C C   . CYS A 1 264 ? 19.123  59.773  10.384  1.00 48.72  ? 262  CYS A C   1 
ATOM   1928  O O   . CYS A 1 264 ? 20.252  59.760  10.872  1.00 48.99  ? 262  CYS A O   1 
ATOM   1929  C CB  . CYS A 1 264 ? 17.555  61.600  9.735   1.00 50.36  ? 262  CYS A CB  1 
ATOM   1930  S SG  . CYS A 1 264 ? 17.915  62.607  11.163  1.00 52.95  ? 262  CYS A SG  1 
ATOM   1931  N N   . ILE A 1 265 ? 18.155  58.941  10.753  1.00 35.02  ? 263  ILE A N   1 
ATOM   1932  C CA  . ILE A 1 265 ? 18.316  57.913  11.779  1.00 34.13  ? 263  ILE A CA  1 
ATOM   1933  C C   . ILE A 1 265 ? 19.636  57.168  11.640  1.00 33.39  ? 263  ILE A C   1 
ATOM   1934  O O   . ILE A 1 265 ? 20.321  56.884  12.619  1.00 32.59  ? 263  ILE A O   1 
ATOM   1935  C CB  . ILE A 1 265 ? 17.188  56.891  11.692  1.00 33.50  ? 263  ILE A CB  1 
ATOM   1936  C CG1 . ILE A 1 265 ? 15.842  57.593  11.841  1.00 32.90  ? 263  ILE A CG1 1 
ATOM   1937  C CG2 . ILE A 1 265 ? 17.366  55.841  12.762  1.00 36.18  ? 263  ILE A CG2 1 
ATOM   1938  C CD1 . ILE A 1 265 ? 14.660  56.684  11.616  1.00 41.27  ? 263  ILE A CD1 1 
ATOM   1939  N N   . ARG A 1 266 ? 19.979  56.834  10.411  1.00 41.35  ? 264  ARG A N   1 
ATOM   1940  C CA  . ARG A 1 266 ? 21.219  56.136  10.154  1.00 43.31  ? 264  ARG A CA  1 
ATOM   1941  C C   . ARG A 1 266 ? 22.386  56.990  10.634  1.00 46.32  ? 264  ARG A C   1 
ATOM   1942  O O   . ARG A 1 266 ? 23.270  56.507  11.340  1.00 48.18  ? 264  ARG A O   1 
ATOM   1943  C CB  . ARG A 1 266 ? 21.349  55.864  8.660   1.00 45.49  ? 264  ARG A CB  1 
ATOM   1944  C CG  . ARG A 1 266 ? 22.707  55.384  8.237   1.00 43.86  ? 264  ARG A CG  1 
ATOM   1945  C CD  . ARG A 1 266 ? 23.071  54.111  8.947   1.00 42.85  ? 264  ARG A CD  1 
ATOM   1946  N NE  . ARG A 1 266 ? 24.348  53.613  8.455   1.00 45.41  ? 264  ARG A NE  1 
ATOM   1947  C CZ  . ARG A 1 266 ? 25.004  52.587  8.980   1.00 43.15  ? 264  ARG A CZ  1 
ATOM   1948  N NH1 . ARG A 1 266 ? 24.503  51.937  10.024  1.00 39.79  ? 264  ARG A NH1 1 
ATOM   1949  N NH2 . ARG A 1 266 ? 26.167  52.221  8.461   1.00 43.48  ? 264  ARG A NH2 1 
ATOM   1950  N N   . THR A 1 267 ? 22.383  58.265  10.253  1.00 52.76  ? 265  THR A N   1 
ATOM   1951  C CA  . THR A 1 267 ? 23.455  59.173  10.644  1.00 53.60  ? 265  THR A CA  1 
ATOM   1952  C C   . THR A 1 267 ? 23.532  59.293  12.151  1.00 55.43  ? 265  THR A C   1 
ATOM   1953  O O   . THR A 1 267 ? 24.621  59.374  12.718  1.00 56.05  ? 265  THR A O   1 
ATOM   1954  C CB  . THR A 1 267 ? 23.271  60.578  10.030  1.00 43.11  ? 265  THR A CB  1 
ATOM   1955  O OG1 . THR A 1 267 ? 23.688  60.559  8.659   1.00 42.04  ? 265  THR A OG1 1 
ATOM   1956  C CG2 . THR A 1 267 ? 24.109  61.607  10.779  1.00 43.27  ? 265  THR A CG2 1 
ATOM   1957  N N   . ARG A 1 268 ? 22.378  59.316  12.805  1.00 48.59  ? 266  ARG A N   1 
ATOM   1958  C CA  . ARG A 1 268 ? 22.379  59.398  14.251  1.00 49.16  ? 266  ARG A CA  1 
ATOM   1959  C C   . ARG A 1 268 ? 23.262  58.239  14.704  1.00 51.03  ? 266  ARG A C   1 
ATOM   1960  O O   . ARG A 1 268 ? 24.301  58.447  15.330  1.00 50.74  ? 266  ARG A O   1 
ATOM   1961  C CB  . ARG A 1 268 ? 20.962  59.234  14.809  1.00 53.86  ? 266  ARG A CB  1 
ATOM   1962  C CG  . ARG A 1 268 ? 19.961  60.300  14.371  1.00 52.27  ? 266  ARG A CG  1 
ATOM   1963  C CD  . ARG A 1 268 ? 18.659  60.161  15.177  1.00 56.18  ? 266  ARG A CD  1 
ATOM   1964  N NE  . ARG A 1 268 ? 17.637  61.166  14.858  1.00 57.54  ? 266  ARG A NE  1 
ATOM   1965  C CZ  . ARG A 1 268 ? 17.856  62.479  14.762  1.00 58.70  ? 266  ARG A CZ  1 
ATOM   1966  N NH1 . ARG A 1 268 ? 19.075  62.980  14.952  1.00 59.39  ? 266  ARG A NH1 1 
ATOM   1967  N NH2 . ARG A 1 268 ? 16.850  63.301  14.488  1.00 55.87  ? 266  ARG A NH2 1 
ATOM   1968  N N   . GLU A 1 269 ? 22.854  57.027  14.332  1.00 57.51  ? 267  GLU A N   1 
ATOM   1969  C CA  . GLU A 1 269 ? 23.558  55.789  14.672  1.00 60.59  ? 267  GLU A CA  1 
ATOM   1970  C C   . GLU A 1 269 ? 25.059  55.759  14.378  1.00 61.18  ? 267  GLU A C   1 
ATOM   1971  O O   . GLU A 1 269 ? 25.854  55.373  15.232  1.00 61.06  ? 267  GLU A O   1 
ATOM   1972  C CB  . GLU A 1 269 ? 22.891  54.606  13.964  1.00 95.25  ? 267  GLU A CB  1 
ATOM   1973  C CG  . GLU A 1 269 ? 21.619  54.098  14.635  1.00 101.06 ? 267  GLU A CG  1 
ATOM   1974  C CD  . GLU A 1 269 ? 20.908  53.029  13.814  1.00 103.27 ? 267  GLU A CD  1 
ATOM   1975  O OE1 . GLU A 1 269 ? 21.585  52.328  13.026  1.00 102.68 ? 267  GLU A OE1 1 
ATOM   1976  O OE2 . GLU A 1 269 ? 19.674  52.883  13.969  1.00 103.58 ? 267  GLU A OE2 1 
ATOM   1977  N N   . LEU A 1 270 ? 25.450  56.146  13.173  1.00 66.94  ? 268  LEU A N   1 
ATOM   1978  C CA  . LEU A 1 270 ? 26.862  56.136  12.820  1.00 70.73  ? 268  LEU A CA  1 
ATOM   1979  C C   . LEU A 1 270 ? 27.718  56.828  13.874  1.00 74.45  ? 268  LEU A C   1 
ATOM   1980  O O   . LEU A 1 270 ? 28.719  56.271  14.333  1.00 75.85  ? 268  LEU A O   1 
ATOM   1981  C CB  . LEU A 1 270 ? 27.080  56.817  11.469  1.00 60.16  ? 268  LEU A CB  1 
ATOM   1982  C CG  . LEU A 1 270 ? 26.512  56.120  10.235  1.00 59.83  ? 268  LEU A CG  1 
ATOM   1983  C CD1 . LEU A 1 270 ? 26.875  56.914  8.985   1.00 60.50  ? 268  LEU A CD1 1 
ATOM   1984  C CD2 . LEU A 1 270 ? 27.074  54.710  10.152  1.00 58.53  ? 268  LEU A CD2 1 
ATOM   1985  N N   . GLN A 1 271 ? 27.317  58.038  14.255  1.00 64.33  ? 269  GLN A N   1 
ATOM   1986  C CA  . GLN A 1 271 ? 28.060  58.814  15.238  1.00 67.89  ? 269  GLN A CA  1 
ATOM   1987  C C   . GLN A 1 271 ? 27.868  58.277  16.648  1.00 69.35  ? 269  GLN A C   1 
ATOM   1988  O O   . GLN A 1 271 ? 28.838  58.034  17.369  1.00 68.54  ? 269  GLN A O   1 
ATOM   1989  C CB  . GLN A 1 271 ? 27.652  60.284  15.149  1.00 102.94 ? 269  GLN A CB  1 
ATOM   1990  C CG  . GLN A 1 271 ? 26.891  60.831  16.335  1.00 108.19 ? 269  GLN A CG  1 
ATOM   1991  C CD  . GLN A 1 271 ? 25.712  61.681  15.909  1.00 111.03 ? 269  GLN A CD  1 
ATOM   1992  O OE1 . GLN A 1 271 ? 25.827  62.530  15.022  1.00 110.24 ? 269  GLN A OE1 1 
ATOM   1993  N NE2 . GLN A 1 271 ? 24.566  61.460  16.546  1.00 111.87 ? 269  GLN A NE2 1 
ATOM   1994  N N   . SER A 1 272 ? 26.611  58.077  17.029  1.00 80.64  ? 270  SER A N   1 
ATOM   1995  C CA  . SER A 1 272 ? 26.283  57.559  18.350  1.00 85.75  ? 270  SER A CA  1 
ATOM   1996  C C   . SER A 1 272 ? 26.717  56.098  18.440  1.00 88.53  ? 270  SER A C   1 
ATOM   1997  O O   . SER A 1 272 ? 26.232  55.331  19.272  1.00 88.83  ? 270  SER A O   1 
ATOM   1998  C CB  . SER A 1 272 ? 24.778  57.699  18.605  1.00 102.70 ? 270  SER A CB  1 
ATOM   1999  O OG  . SER A 1 272 ? 24.375  59.058  18.503  1.00 104.04 ? 270  SER A OG  1 
ATOM   2000  N N   . MET A 1 273 ? 27.646  55.732  17.563  1.00 97.75  ? 271  MET A N   1 
ATOM   2001  C CA  . MET A 1 273 ? 28.185  54.386  17.500  1.00 101.56 ? 271  MET A CA  1 
ATOM   2002  C C   . MET A 1 273 ? 29.690  54.426  17.750  1.00 104.04 ? 271  MET A C   1 
ATOM   2003  O O   . MET A 1 273 ? 30.269  53.455  18.239  1.00 104.35 ? 271  MET A O   1 
ATOM   2004  C CB  . MET A 1 273 ? 27.873  53.771  16.131  1.00 125.35 ? 271  MET A CB  1 
ATOM   2005  C CG  . MET A 1 273 ? 28.851  52.720  15.645  1.00 128.98 ? 271  MET A CG  1 
ATOM   2006  S SD  . MET A 1 273 ? 29.590  53.215  14.070  1.00 131.08 ? 271  MET A SD  1 
ATOM   2007  C CE  . MET A 1 273 ? 31.064  54.055  14.632  1.00 128.83 ? 271  MET A CE  1 
ATOM   2008  N N   . ALA A 1 274 ? 30.332  55.541  17.416  1.00 92.27  ? 272  ALA A N   1 
ATOM   2009  C CA  . ALA A 1 274 ? 31.763  55.647  17.654  1.00 96.15  ? 272  ALA A CA  1 
ATOM   2010  C C   . ALA A 1 274 ? 32.005  56.432  18.937  1.00 100.09 ? 272  ALA A C   1 
ATOM   2011  O O   . ALA A 1 274 ? 33.145  56.765  19.266  1.00 100.94 ? 272  ALA A O   1 
ATOM   2012  C CB  . ALA A 1 274 ? 32.463  56.316  16.479  1.00 51.95  ? 272  ALA A CB  1 
ATOM   2013  N N   . ASP A 1 275 ? 30.924  56.732  19.657  1.00 114.13 ? 273  ASP A N   1 
ATOM   2014  C CA  . ASP A 1 275 ? 31.035  57.452  20.923  1.00 117.96 ? 273  ASP A CA  1 
ATOM   2015  C C   . ASP A 1 275 ? 31.565  56.471  21.956  1.00 120.96 ? 273  ASP A C   1 
ATOM   2016  O O   . ASP A 1 275 ? 32.147  56.865  22.966  1.00 121.40 ? 273  ASP A O   1 
ATOM   2017  C CB  . ASP A 1 275 ? 29.676  57.983  21.381  1.00 122.49 ? 273  ASP A CB  1 
ATOM   2018  C CG  . ASP A 1 275 ? 29.134  59.064  20.471  1.00 123.57 ? 273  ASP A CG  1 
ATOM   2019  O OD1 . ASP A 1 275 ? 29.892  59.998  20.126  1.00 123.91 ? 273  ASP A OD1 1 
ATOM   2020  O OD2 . ASP A 1 275 ? 27.943  58.985  20.112  1.00 124.59 ? 273  ASP A OD2 1 
ATOM   2021  N N   . GLN A 1 276 ? 31.347  55.187  21.686  1.00 152.11 ? 274  GLN A N   1 
ATOM   2022  C CA  . GLN A 1 276 ? 31.803  54.108  22.553  1.00 155.37 ? 274  GLN A CA  1 
ATOM   2023  C C   . GLN A 1 276 ? 32.896  53.332  21.835  1.00 156.01 ? 274  GLN A C   1 
ATOM   2024  O O   . GLN A 1 276 ? 34.081  53.668  21.909  1.00 156.00 ? 274  GLN A O   1 
ATOM   2025  C CB  . GLN A 1 276 ? 30.658  53.145  22.868  1.00 184.94 ? 274  GLN A CB  1 
ATOM   2026  C CG  . GLN A 1 276 ? 29.581  53.690  23.774  1.00 187.05 ? 274  GLN A CG  1 
ATOM   2027  C CD  . GLN A 1 276 ? 28.556  52.631  24.128  1.00 188.24 ? 274  GLN A CD  1 
ATOM   2028  O OE1 . GLN A 1 276 ? 27.828  52.141  23.263  1.00 188.52 ? 274  GLN A OE1 1 
ATOM   2029  N NE2 . GLN A 1 276 ? 28.500  52.264  25.404  1.00 189.17 ? 274  GLN A NE2 1 
ATOM   2030  N N   . GLU A 1 277 ? 32.472  52.282  21.139  1.00 176.45 ? 275  GLU A N   1 
ATOM   2031  C CA  . GLU A 1 277 ? 33.373  51.428  20.383  1.00 176.31 ? 275  GLU A CA  1 
ATOM   2032  C C   . GLU A 1 277 ? 33.894  52.147  19.142  1.00 175.94 ? 275  GLU A C   1 
ATOM   2033  O O   . GLU A 1 277 ? 34.614  53.141  19.247  1.00 174.58 ? 275  GLU A O   1 
ATOM   2034  C CB  . GLU A 1 277 ? 32.645  50.141  19.986  1.00 163.27 ? 275  GLU A CB  1 
ATOM   2035  C CG  . GLU A 1 277 ? 32.694  49.059  21.052  1.00 164.15 ? 275  GLU A CG  1 
ATOM   2036  C CD  . GLU A 1 277 ? 31.604  48.020  20.887  1.00 165.15 ? 275  GLU A CD  1 
ATOM   2037  O OE1 . GLU A 1 277 ? 30.452  48.305  21.274  1.00 164.71 ? 275  GLU A OE1 1 
ATOM   2038  O OE2 . GLU A 1 277 ? 31.897  46.923  20.366  1.00 166.68 ? 275  GLU A OE2 1 
ATOM   2039  N N   . ARG B 1 1   ? 11.120  -10.479 21.579  1.00 143.83 ? -1   ARG B N   1 
ATOM   2040  C CA  . ARG B 1 1   ? 10.219  -10.291 20.405  1.00 144.79 ? -1   ARG B CA  1 
ATOM   2041  C C   . ARG B 1 1   ? 8.751   -10.400 20.813  1.00 145.77 ? -1   ARG B C   1 
ATOM   2042  O O   . ARG B 1 1   ? 7.859   -10.373 19.964  1.00 145.92 ? -1   ARG B O   1 
ATOM   2043  C CB  . ARG B 1 1   ? 10.542  -11.324 19.332  1.00 105.21 ? -1   ARG B CB  1 
ATOM   2044  N N   . GLY B 1 2   ? 8.512   -10.527 22.116  1.00 168.30 ? 0    GLY B N   1 
ATOM   2045  C CA  . GLY B 1 2   ? 7.157   -10.633 22.657  1.00 169.19 ? 0    GLY B CA  1 
ATOM   2046  C C   . GLY B 1 2   ? 7.057   -9.800  23.935  1.00 169.47 ? 0    GLY B C   1 
ATOM   2047  O O   . GLY B 1 2   ? 7.703   -10.114 24.938  1.00 169.47 ? 0    GLY B O   1 
ATOM   2048  N N   . MET B 1 3   ? 6.243   -8.746  23.900  1.00 139.70 ? 1    MET B N   1 
ATOM   2049  C CA  . MET B 1 3   ? 6.090   -7.863  25.054  1.00 139.30 ? 1    MET B CA  1 
ATOM   2050  C C   . MET B 1 3   ? 4.736   -7.165  25.141  1.00 139.12 ? 1    MET B C   1 
ATOM   2051  O O   . MET B 1 3   ? 3.738   -7.616  24.579  1.00 138.76 ? 1    MET B O   1 
ATOM   2052  C CB  . MET B 1 3   ? 7.169   -6.783  25.024  1.00 170.78 ? 1    MET B CB  1 
ATOM   2053  C CG  . MET B 1 3   ? 6.992   -5.808  23.873  1.00 169.92 ? 1    MET B CG  1 
ATOM   2054  S SD  . MET B 1 3   ? 8.025   -4.360  24.031  1.00 170.20 ? 1    MET B SD  1 
ATOM   2055  C CE  . MET B 1 3   ? 9.428   -4.833  23.018  1.00 168.66 ? 1    MET B CE  1 
ATOM   2056  N N   . SER B 1 4   ? 4.737   -6.046  25.861  1.00 187.02 ? 2    SER B N   1 
ATOM   2057  C CA  . SER B 1 4   ? 3.558   -5.213  26.065  1.00 187.02 ? 2    SER B CA  1 
ATOM   2058  C C   . SER B 1 4   ? 4.032   -3.761  26.103  1.00 187.02 ? 2    SER B C   1 
ATOM   2059  O O   . SER B 1 4   ? 5.219   -3.490  25.913  1.00 187.02 ? 2    SER B O   1 
ATOM   2060  C CB  . SER B 1 4   ? 2.878   -5.575  27.388  1.00 123.45 ? 2    SER B CB  1 
ATOM   2061  O OG  . SER B 1 4   ? 1.750   -4.751  27.627  1.00 121.68 ? 2    SER B OG  1 
ATOM   2062  N N   . VAL B 1 5   ? 3.114   -2.830  26.347  1.00 149.64 ? 3    VAL B N   1 
ATOM   2063  C CA  . VAL B 1 5   ? 3.469   -1.414  26.402  1.00 148.61 ? 3    VAL B CA  1 
ATOM   2064  C C   . VAL B 1 5   ? 2.646   -0.627  27.414  1.00 148.21 ? 3    VAL B C   1 
ATOM   2065  O O   . VAL B 1 5   ? 1.449   -0.864  27.583  1.00 147.87 ? 3    VAL B O   1 
ATOM   2066  C CB  . VAL B 1 5   ? 3.313   -0.746  25.017  1.00 129.92 ? 3    VAL B CB  1 
ATOM   2067  C CG1 . VAL B 1 5   ? 3.428   0.766   25.148  1.00 129.77 ? 3    VAL B CG1 1 
ATOM   2068  C CG2 . VAL B 1 5   ? 4.381   -1.268  24.070  1.00 129.25 ? 3    VAL B CG2 1 
ATOM   2069  N N   . GLY B 1 6   ? 3.304   0.315   28.082  1.00 133.05 ? 4    GLY B N   1 
ATOM   2070  C CA  . GLY B 1 6   ? 2.631   1.137   29.069  1.00 133.52 ? 4    GLY B CA  1 
ATOM   2071  C C   . GLY B 1 6   ? 2.182   2.463   28.488  1.00 133.64 ? 4    GLY B C   1 
ATOM   2072  O O   . GLY B 1 6   ? 2.825   3.492   28.690  1.00 133.67 ? 4    GLY B O   1 
ATOM   2073  N N   . PHE B 1 7   ? 1.073   2.436   27.758  1.00 142.83 ? 5    PHE B N   1 
ATOM   2074  C CA  . PHE B 1 7   ? 0.528   3.640   27.145  1.00 144.31 ? 5    PHE B CA  1 
ATOM   2075  C C   . PHE B 1 7   ? -0.163  4.514   28.195  1.00 145.64 ? 5    PHE B C   1 
ATOM   2076  O O   . PHE B 1 7   ? -1.389  4.634   28.209  1.00 146.29 ? 5    PHE B O   1 
ATOM   2077  C CB  . PHE B 1 7   ? -0.470  3.250   26.054  1.00 147.06 ? 5    PHE B CB  1 
ATOM   2078  C CG  . PHE B 1 7   ? -0.076  3.697   24.674  1.00 147.25 ? 5    PHE B CG  1 
ATOM   2079  C CD1 . PHE B 1 7   ? 0.056   5.048   24.378  1.00 147.26 ? 5    PHE B CD1 1 
ATOM   2080  C CD2 . PHE B 1 7   ? 0.127   2.766   23.657  1.00 147.38 ? 5    PHE B CD2 1 
ATOM   2081  C CE1 . PHE B 1 7   ? 0.379   5.466   23.091  1.00 147.19 ? 5    PHE B CE1 1 
ATOM   2082  C CE2 . PHE B 1 7   ? 0.450   3.176   22.364  1.00 146.51 ? 5    PHE B CE2 1 
ATOM   2083  C CZ  . PHE B 1 7   ? 0.575   4.528   22.083  1.00 146.85 ? 5    PHE B CZ  1 
ATOM   2084  N N   . ILE B 1 8   ? 0.634   5.126   29.068  1.00 152.52 ? 6    ILE B N   1 
ATOM   2085  C CA  . ILE B 1 8   ? 0.120   5.986   30.134  1.00 152.62 ? 6    ILE B CA  1 
ATOM   2086  C C   . ILE B 1 8   ? -0.642  7.183   29.576  1.00 152.91 ? 6    ILE B C   1 
ATOM   2087  O O   . ILE B 1 8   ? -1.316  7.910   30.308  1.00 152.34 ? 6    ILE B O   1 
ATOM   2088  C CB  . ILE B 1 8   ? 1.273   6.482   31.023  1.00 155.86 ? 6    ILE B CB  1 
ATOM   2089  C CG1 . ILE B 1 8   ? 2.046   5.274   31.558  1.00 155.73 ? 6    ILE B CG1 1 
ATOM   2090  C CG2 . ILE B 1 8   ? 0.733   7.318   32.179  1.00 155.70 ? 6    ILE B CG2 1 
ATOM   2091  C CD1 . ILE B 1 8   ? 3.319   5.627   32.280  1.00 155.93 ? 6    ILE B CD1 1 
ATOM   2092  N N   . GLY B 1 9   ? -0.523  7.382   28.271  1.00 174.36 ? 7    GLY B N   1 
ATOM   2093  C CA  . GLY B 1 9   ? -1.223  8.472   27.627  1.00 175.88 ? 7    GLY B CA  1 
ATOM   2094  C C   . GLY B 1 9   ? -2.302  7.881   26.746  1.00 177.32 ? 7    GLY B C   1 
ATOM   2095  O O   . GLY B 1 9   ? -2.074  6.873   26.078  1.00 177.86 ? 7    GLY B O   1 
ATOM   2096  N N   . ALA B 1 10  ? -3.480  8.494   26.746  1.00 200.00 ? 8    ALA B N   1 
ATOM   2097  C CA  . ALA B 1 10  ? -4.585  7.997   25.938  1.00 200.00 ? 8    ALA B CA  1 
ATOM   2098  C C   . ALA B 1 10  ? -5.289  9.117   25.188  1.00 200.00 ? 8    ALA B C   1 
ATOM   2099  O O   . ALA B 1 10  ? -5.334  10.256  25.650  1.00 200.00 ? 8    ALA B O   1 
ATOM   2100  C CB  . ALA B 1 10  ? -5.582  7.257   26.821  1.00 175.57 ? 8    ALA B CB  1 
ATOM   2101  N N   . GLY B 1 11  ? -5.836  8.779   24.025  1.00 184.88 ? 9    GLY B N   1 
ATOM   2102  C CA  . GLY B 1 11  ? -6.541  9.756   23.220  1.00 182.97 ? 9    GLY B CA  1 
ATOM   2103  C C   . GLY B 1 11  ? -5.911  9.944   21.859  1.00 181.30 ? 9    GLY B C   1 
ATOM   2104  O O   . GLY B 1 11  ? -6.195  9.204   20.918  1.00 181.35 ? 9    GLY B O   1 
ATOM   2105  N N   . GLN B 1 12  ? -5.046  10.945  21.761  1.00 189.37 ? 10   GLN B N   1 
ATOM   2106  C CA  . GLN B 1 12  ? -4.363  11.256  20.517  1.00 189.37 ? 10   GLN B CA  1 
ATOM   2107  C C   . GLN B 1 12  ? -3.385  10.158  20.101  1.00 188.26 ? 10   GLN B C   1 
ATOM   2108  O O   . GLN B 1 12  ? -3.796  9.049   19.758  1.00 188.94 ? 10   GLN B O   1 
ATOM   2109  C CB  . GLN B 1 12  ? -3.631  12.597  20.650  1.00 200.00 ? 10   GLN B CB  1 
ATOM   2110  C CG  . GLN B 1 12  ? -4.498  13.835  20.385  1.00 200.00 ? 10   GLN B CG  1 
ATOM   2111  C CD  . GLN B 1 12  ? -5.695  13.960  21.317  1.00 200.00 ? 10   GLN B CD  1 
ATOM   2112  O OE1 . GLN B 1 12  ? -6.558  13.084  21.359  1.00 200.00 ? 10   GLN B OE1 1 
ATOM   2113  N NE2 . GLN B 1 12  ? -5.754  15.060  22.061  1.00 200.00 ? 10   GLN B NE2 1 
ATOM   2114  N N   . LEU B 1 13  ? -2.094  10.476  20.141  1.00 127.71 ? 11   LEU B N   1 
ATOM   2115  C CA  . LEU B 1 13  ? -1.038  9.544   19.753  1.00 122.66 ? 11   LEU B CA  1 
ATOM   2116  C C   . LEU B 1 13  ? -1.205  8.146   20.329  1.00 119.46 ? 11   LEU B C   1 
ATOM   2117  O O   . LEU B 1 13  ? -0.578  7.198   19.863  1.00 118.80 ? 11   LEU B O   1 
ATOM   2118  C CB  . LEU B 1 13  ? 0.325   10.108  20.153  1.00 128.84 ? 11   LEU B CB  1 
ATOM   2119  C CG  . LEU B 1 13  ? 0.616   11.491  19.565  1.00 127.46 ? 11   LEU B CG  1 
ATOM   2120  C CD1 . LEU B 1 13  ? 1.970   11.981  20.041  1.00 127.29 ? 11   LEU B CD1 1 
ATOM   2121  C CD2 . LEU B 1 13  ? 0.574   11.420  18.046  1.00 127.03 ? 11   LEU B CD2 1 
ATOM   2122  N N   . ALA B 1 14  ? -2.041  8.017   21.350  1.00 105.55 ? 12   ALA B N   1 
ATOM   2123  C CA  . ALA B 1 14  ? -2.274  6.711   21.936  1.00 103.22 ? 12   ALA B CA  1 
ATOM   2124  C C   . ALA B 1 14  ? -3.118  5.931   20.934  1.00 102.24 ? 12   ALA B C   1 
ATOM   2125  O O   . ALA B 1 14  ? -2.726  4.857   20.479  1.00 100.99 ? 12   ALA B O   1 
ATOM   2126  C CB  . ALA B 1 14  ? -2.996  6.858   23.255  1.00 112.45 ? 12   ALA B CB  1 
ATOM   2127  N N   . PHE B 1 15  ? -4.268  6.501   20.583  1.00 170.26 ? 13   PHE B N   1 
ATOM   2128  C CA  . PHE B 1 15  ? -5.194  5.917   19.616  1.00 170.66 ? 13   PHE B CA  1 
ATOM   2129  C C   . PHE B 1 15  ? -4.410  5.497   18.369  1.00 170.25 ? 13   PHE B C   1 
ATOM   2130  O O   . PHE B 1 15  ? -4.624  4.416   17.818  1.00 171.18 ? 13   PHE B O   1 
ATOM   2131  C CB  . PHE B 1 15  ? -6.250  6.971   19.252  1.00 134.07 ? 13   PHE B CB  1 
ATOM   2132  C CG  . PHE B 1 15  ? -7.349  6.481   18.342  1.00 134.91 ? 13   PHE B CG  1 
ATOM   2133  C CD1 . PHE B 1 15  ? -8.228  7.396   17.766  1.00 134.77 ? 13   PHE B CD1 1 
ATOM   2134  C CD2 . PHE B 1 15  ? -7.525  5.126   18.073  1.00 135.48 ? 13   PHE B CD2 1 
ATOM   2135  C CE1 . PHE B 1 15  ? -9.263  6.976   16.937  1.00 135.10 ? 13   PHE B CE1 1 
ATOM   2136  C CE2 . PHE B 1 15  ? -8.562  4.694   17.243  1.00 135.35 ? 13   PHE B CE2 1 
ATOM   2137  C CZ  . PHE B 1 15  ? -9.432  5.622   16.675  1.00 135.37 ? 13   PHE B CZ  1 
ATOM   2138  N N   . ALA B 1 16  ? -3.496  6.365   17.941  1.00 139.78 ? 14   ALA B N   1 
ATOM   2139  C CA  . ALA B 1 16  ? -2.667  6.120   16.763  1.00 137.37 ? 14   ALA B CA  1 
ATOM   2140  C C   . ALA B 1 16  ? -1.882  4.823   16.888  1.00 135.88 ? 14   ALA B C   1 
ATOM   2141  O O   . ALA B 1 16  ? -2.244  3.811   16.290  1.00 136.80 ? 14   ALA B O   1 
ATOM   2142  C CB  . ALA B 1 16  ? -1.710  7.290   16.551  1.00 112.32 ? 14   ALA B CB  1 
ATOM   2143  N N   . LEU B 1 17  ? -0.798  4.863   17.657  1.00 116.35 ? 15   LEU B N   1 
ATOM   2144  C CA  . LEU B 1 17  ? 0.033   3.686   17.866  1.00 112.97 ? 15   LEU B CA  1 
ATOM   2145  C C   . LEU B 1 17  ? -0.869  2.531   18.239  1.00 113.12 ? 15   LEU B C   1 
ATOM   2146  O O   . LEU B 1 17  ? -0.622  1.391   17.856  1.00 111.82 ? 15   LEU B O   1 
ATOM   2147  C CB  . LEU B 1 17  ? 1.043   3.942   18.978  1.00 84.18  ? 15   LEU B CB  1 
ATOM   2148  C CG  . LEU B 1 17  ? 2.094   4.984   18.606  1.00 80.32  ? 15   LEU B CG  1 
ATOM   2149  C CD1 . LEU B 1 17  ? 1.973   6.188   19.528  1.00 77.48  ? 15   LEU B CD1 1 
ATOM   2150  C CD2 . LEU B 1 17  ? 3.482   4.357   18.688  1.00 78.94  ? 15   LEU B CD2 1 
ATOM   2151  N N   . ALA B 1 18  ? -1.919  2.839   18.992  1.00 135.95 ? 16   ALA B N   1 
ATOM   2152  C CA  . ALA B 1 18  ? -2.879  1.823   19.380  1.00 137.74 ? 16   ALA B CA  1 
ATOM   2153  C C   . ALA B 1 18  ? -3.276  1.138   18.081  1.00 139.91 ? 16   ALA B C   1 
ATOM   2154  O O   . ALA B 1 18  ? -2.745  0.082   17.742  1.00 140.91 ? 16   ALA B O   1 
ATOM   2155  C CB  . ALA B 1 18  ? -4.094  2.462   20.028  1.00 66.81  ? 16   ALA B CB  1 
ATOM   2156  N N   . LYS B 1 19  ? -4.188  1.764   17.344  1.00 153.15 ? 17   LYS B N   1 
ATOM   2157  C CA  . LYS B 1 19  ? -4.652  1.231   16.069  1.00 154.12 ? 17   LYS B CA  1 
ATOM   2158  C C   . LYS B 1 19  ? -3.444  0.848   15.213  1.00 153.94 ? 17   LYS B C   1 
ATOM   2159  O O   . LYS B 1 19  ? -3.544  0.014   14.312  1.00 154.40 ? 17   LYS B O   1 
ATOM   2160  C CB  . LYS B 1 19  ? -5.491  2.283   15.344  1.00 196.93 ? 17   LYS B CB  1 
ATOM   2161  C CG  . LYS B 1 19  ? -6.277  1.751   14.161  1.00 198.59 ? 17   LYS B CG  1 
ATOM   2162  C CD  . LYS B 1 19  ? -6.862  2.888   13.329  1.00 200.00 ? 17   LYS B CD  1 
ATOM   2163  C CE  . LYS B 1 19  ? -7.796  3.788   14.135  1.00 200.00 ? 17   LYS B CE  1 
ATOM   2164  N NZ  . LYS B 1 19  ? -9.053  3.107   14.555  1.00 199.97 ? 17   LYS B NZ  1 
ATOM   2165  N N   . GLY B 1 20  ? -2.307  1.473   15.512  1.00 117.80 ? 18   GLY B N   1 
ATOM   2166  C CA  . GLY B 1 20  ? -1.073  1.199   14.797  1.00 115.66 ? 18   GLY B CA  1 
ATOM   2167  C C   . GLY B 1 20  ? -0.484  -0.137  15.216  1.00 114.81 ? 18   GLY B C   1 
ATOM   2168  O O   . GLY B 1 20  ? -0.938  -0.742  16.188  1.00 114.59 ? 18   GLY B O   1 
ATOM   2169  N N   . PHE B 1 21  ? 0.536   -0.585  14.484  1.00 137.58 ? 19   PHE B N   1 
ATOM   2170  C CA  . PHE B 1 21  ? 1.202   -1.868  14.722  1.00 135.94 ? 19   PHE B CA  1 
ATOM   2171  C C   . PHE B 1 21  ? 0.383   -2.906  15.485  1.00 137.69 ? 19   PHE B C   1 
ATOM   2172  O O   . PHE B 1 21  ? 0.923   -3.668  16.286  1.00 137.84 ? 19   PHE B O   1 
ATOM   2173  C CB  . PHE B 1 21  ? 2.562   -1.666  15.409  1.00 87.48  ? 19   PHE B CB  1 
ATOM   2174  C CG  . PHE B 1 21  ? 2.545   -0.654  16.516  1.00 82.33  ? 19   PHE B CG  1 
ATOM   2175  C CD1 . PHE B 1 21  ? 1.615   -0.743  17.543  1.00 80.03  ? 19   PHE B CD1 1 
ATOM   2176  C CD2 . PHE B 1 21  ? 3.471   0.387   16.538  1.00 79.45  ? 19   PHE B CD2 1 
ATOM   2177  C CE1 . PHE B 1 21  ? 1.606   0.187   18.573  1.00 77.71  ? 19   PHE B CE1 1 
ATOM   2178  C CE2 . PHE B 1 21  ? 3.468   1.321   17.566  1.00 76.33  ? 19   PHE B CE2 1 
ATOM   2179  C CZ  . PHE B 1 21  ? 2.534   1.219   18.583  1.00 76.53  ? 19   PHE B CZ  1 
ATOM   2180  N N   . THR B 1 22  ? -0.923  -2.925  15.231  1.00 133.02 ? 20   THR B N   1 
ATOM   2181  C CA  . THR B 1 22  ? -1.817  -3.891  15.855  1.00 136.12 ? 20   THR B CA  1 
ATOM   2182  C C   . THR B 1 22  ? -1.693  -5.137  14.994  1.00 138.95 ? 20   THR B C   1 
ATOM   2183  O O   . THR B 1 22  ? -0.696  -5.852  15.067  1.00 139.38 ? 20   THR B O   1 
ATOM   2184  C CB  . THR B 1 22  ? -3.288  -3.427  15.829  1.00 85.24  ? 20   THR B CB  1 
ATOM   2185  O OG1 . THR B 1 22  ? -3.637  -3.011  14.504  1.00 86.26  ? 20   THR B OG1 1 
ATOM   2186  C CG2 . THR B 1 22  ? -3.507  -2.291  16.787  1.00 84.69  ? 20   THR B CG2 1 
ATOM   2187  N N   . ALA B 1 23  ? -2.699  -5.389  14.165  1.00 200.00 ? 21   ALA B N   1 
ATOM   2188  C CA  . ALA B 1 23  ? -2.656  -6.542  13.280  1.00 200.00 ? 21   ALA B CA  1 
ATOM   2189  C C   . ALA B 1 23  ? -1.552  -6.288  12.261  1.00 200.00 ? 21   ALA B C   1 
ATOM   2190  O O   . ALA B 1 23  ? -1.145  -7.191  11.531  1.00 200.00 ? 21   ALA B O   1 
ATOM   2191  C CB  . ALA B 1 23  ? -3.997  -6.727  12.577  1.00 106.10 ? 21   ALA B CB  1 
ATOM   2192  N N   . ALA B 1 24  ? -1.067  -5.052  12.213  1.00 123.37 ? 22   ALA B N   1 
ATOM   2193  C CA  . ALA B 1 24  ? -0.003  -4.710  11.284  1.00 122.90 ? 22   ALA B CA  1 
ATOM   2194  C C   . ALA B 1 24  ? 1.297   -5.306  11.801  1.00 123.10 ? 22   ALA B C   1 
ATOM   2195  O O   . ALA B 1 24  ? 1.911   -6.137  11.134  1.00 123.22 ? 22   ALA B O   1 
ATOM   2196  C CB  . ALA B 1 24  ? 0.121   -3.203  11.151  1.00 74.76  ? 22   ALA B CB  1 
ATOM   2197  N N   . GLY B 1 25  ? 1.701   -4.890  12.999  1.00 139.73 ? 23   GLY B N   1 
ATOM   2198  C CA  . GLY B 1 25  ? 2.932   -5.392  13.588  1.00 140.30 ? 23   GLY B CA  1 
ATOM   2199  C C   . GLY B 1 25  ? 2.712   -6.347  14.749  1.00 141.05 ? 23   GLY B C   1 
ATOM   2200  O O   . GLY B 1 25  ? 1.754   -6.195  15.504  1.00 140.30 ? 23   GLY B O   1 
ATOM   2201  N N   . VAL B 1 26  ? 3.611   -7.324  14.880  1.00 199.72 ? 24   VAL B N   1 
ATOM   2202  C CA  . VAL B 1 26  ? 3.585   -8.357  15.926  1.00 200.00 ? 24   VAL B CA  1 
ATOM   2203  C C   . VAL B 1 26  ? 2.686   -8.098  17.144  1.00 200.00 ? 24   VAL B C   1 
ATOM   2204  O O   . VAL B 1 26  ? 2.088   -9.031  17.690  1.00 200.00 ? 24   VAL B O   1 
ATOM   2205  C CB  . VAL B 1 26  ? 5.027   -8.647  16.439  1.00 126.16 ? 24   VAL B CB  1 
ATOM   2206  C CG1 . VAL B 1 26  ? 5.001   -9.724  17.516  1.00 124.63 ? 24   VAL B CG1 1 
ATOM   2207  C CG2 . VAL B 1 26  ? 5.916   -9.079  15.280  1.00 124.59 ? 24   VAL B CG2 1 
ATOM   2208  N N   . LEU B 1 27  ? 2.602   -6.839  17.567  1.00 146.39 ? 25   LEU B N   1 
ATOM   2209  C CA  . LEU B 1 27  ? 1.793   -6.450  18.721  1.00 147.74 ? 25   LEU B CA  1 
ATOM   2210  C C   . LEU B 1 27  ? 0.352   -6.960  18.717  1.00 148.13 ? 25   LEU B C   1 
ATOM   2211  O O   . LEU B 1 27  ? -0.298  -7.025  17.673  1.00 147.57 ? 25   LEU B O   1 
ATOM   2212  C CB  . LEU B 1 27  ? 1.799   -4.926  18.863  1.00 161.31 ? 25   LEU B CB  1 
ATOM   2213  C CG  . LEU B 1 27  ? 3.150   -4.329  19.264  1.00 162.82 ? 25   LEU B CG  1 
ATOM   2214  C CD1 . LEU B 1 27  ? 3.064   -2.821  19.304  1.00 163.38 ? 25   LEU B CD1 1 
ATOM   2215  C CD2 . LEU B 1 27  ? 3.557   -4.867  20.628  1.00 163.82 ? 25   LEU B CD2 1 
ATOM   2216  N N   . ALA B 1 28  ? -0.137  -7.316  19.903  1.00 129.45 ? 26   ALA B N   1 
ATOM   2217  C CA  . ALA B 1 28  ? -1.496  -7.820  20.074  1.00 130.90 ? 26   ALA B CA  1 
ATOM   2218  C C   . ALA B 1 28  ? -2.354  -6.789  20.806  1.00 132.44 ? 26   ALA B C   1 
ATOM   2219  O O   . ALA B 1 28  ? -1.893  -6.158  21.757  1.00 131.94 ? 26   ALA B O   1 
ATOM   2220  C CB  . ALA B 1 28  ? -1.467  -9.124  20.851  1.00 99.37  ? 26   ALA B CB  1 
ATOM   2221  N N   . ALA B 1 29  ? -3.601  -6.635  20.362  1.00 147.29 ? 27   ALA B N   1 
ATOM   2222  C CA  . ALA B 1 29  ? -4.539  -5.674  20.946  1.00 149.63 ? 27   ALA B CA  1 
ATOM   2223  C C   . ALA B 1 29  ? -4.647  -5.753  22.464  1.00 151.56 ? 27   ALA B C   1 
ATOM   2224  O O   . ALA B 1 29  ? -4.558  -4.738  23.157  1.00 151.57 ? 27   ALA B O   1 
ATOM   2225  C CB  . ALA B 1 29  ? -5.925  -5.853  20.325  1.00 99.09  ? 27   ALA B CB  1 
ATOM   2226  N N   . HIS B 1 30  ? -4.845  -6.961  22.976  1.00 200.00 ? 28   HIS B N   1 
ATOM   2227  C CA  . HIS B 1 30  ? -4.977  -7.160  24.412  1.00 200.00 ? 28   HIS B CA  1 
ATOM   2228  C C   . HIS B 1 30  ? -3.648  -7.281  25.152  1.00 200.00 ? 28   HIS B C   1 
ATOM   2229  O O   . HIS B 1 30  ? -3.580  -7.015  26.353  1.00 200.00 ? 28   HIS B O   1 
ATOM   2230  C CB  . HIS B 1 30  ? -5.840  -8.393  24.689  1.00 191.06 ? 28   HIS B CB  1 
ATOM   2231  C CG  . HIS B 1 30  ? -7.298  -8.180  24.424  1.00 191.83 ? 28   HIS B CG  1 
ATOM   2232  N ND1 . HIS B 1 30  ? -8.237  -9.178  24.576  1.00 192.50 ? 28   HIS B ND1 1 
ATOM   2233  C CD2 . HIS B 1 30  ? -7.981  -7.079  24.036  1.00 191.87 ? 28   HIS B CD2 1 
ATOM   2234  C CE1 . HIS B 1 30  ? -9.436  -8.699  24.292  1.00 192.24 ? 28   HIS B CE1 1 
ATOM   2235  N NE2 . HIS B 1 30  ? -9.308  -7.427  23.961  1.00 192.20 ? 28   HIS B NE2 1 
ATOM   2236  N N   . LYS B 1 31  ? -2.593  -7.675  24.445  1.00 167.52 ? 29   LYS B N   1 
ATOM   2237  C CA  . LYS B 1 31  ? -1.280  -7.825  25.068  1.00 168.08 ? 29   LYS B CA  1 
ATOM   2238  C C   . LYS B 1 31  ? -0.690  -6.508  25.557  1.00 169.24 ? 29   LYS B C   1 
ATOM   2239  O O   . LYS B 1 31  ? 0.515   -6.419  25.794  1.00 168.68 ? 29   LYS B O   1 
ATOM   2240  C CB  . LYS B 1 31  ? -0.298  -8.479  24.098  1.00 142.83 ? 29   LYS B CB  1 
ATOM   2241  C CG  . LYS B 1 31  ? -0.508  -9.968  23.910  1.00 141.97 ? 29   LYS B CG  1 
ATOM   2242  C CD  . LYS B 1 31  ? 0.622   -10.577 23.092  1.00 142.10 ? 29   LYS B CD  1 
ATOM   2243  C CE  . LYS B 1 31  ? 1.969   -10.423 23.795  1.00 141.73 ? 29   LYS B CE  1 
ATOM   2244  N NZ  . LYS B 1 31  ? 3.098   -10.995 23.005  1.00 141.12 ? 29   LYS B NZ  1 
ATOM   2245  N N   . ILE B 1 32  ? -1.536  -5.492  25.712  1.00 200.00 ? 30   ILE B N   1 
ATOM   2246  C CA  . ILE B 1 32  ? -1.087  -4.178  26.171  1.00 200.00 ? 30   ILE B CA  1 
ATOM   2247  C C   . ILE B 1 32  ? -2.202  -3.386  26.857  1.00 200.00 ? 30   ILE B C   1 
ATOM   2248  O O   . ILE B 1 32  ? -3.339  -3.352  26.382  1.00 200.00 ? 30   ILE B O   1 
ATOM   2249  C CB  . ILE B 1 32  ? -0.543  -3.340  24.993  1.00 191.37 ? 30   ILE B CB  1 
ATOM   2250  C CG1 . ILE B 1 32  ? 0.696   -4.016  24.405  1.00 192.16 ? 30   ILE B CG1 1 
ATOM   2251  C CG2 . ILE B 1 32  ? -0.206  -1.933  25.463  1.00 191.10 ? 30   ILE B CG2 1 
ATOM   2252  C CD1 . ILE B 1 32  ? 1.165   -3.417  23.106  1.00 193.92 ? 30   ILE B CD1 1 
ATOM   2253  N N   . MET B 1 33  ? -1.863  -2.751  27.976  1.00 174.86 ? 31   MET B N   1 
ATOM   2254  C CA  . MET B 1 33  ? -2.818  -1.948  28.730  1.00 174.50 ? 31   MET B CA  1 
ATOM   2255  C C   . MET B 1 33  ? -2.478  -0.468  28.585  1.00 174.82 ? 31   MET B C   1 
ATOM   2256  O O   . MET B 1 33  ? -1.317  -0.108  28.386  1.00 174.74 ? 31   MET B O   1 
ATOM   2257  C CB  . MET B 1 33  ? -2.799  -2.342  30.211  1.00 154.92 ? 31   MET B CB  1 
ATOM   2258  C CG  . MET B 1 33  ? -3.727  -1.508  31.085  1.00 153.73 ? 31   MET B CG  1 
ATOM   2259  S SD  . MET B 1 33  ? -3.876  -2.113  32.778  1.00 152.46 ? 31   MET B SD  1 
ATOM   2260  C CE  . MET B 1 33  ? -5.172  -3.357  32.573  1.00 151.31 ? 31   MET B CE  1 
ATOM   2261  N N   . ALA B 1 34  ? -3.496  0.382   28.681  1.00 174.90 ? 32   ALA B N   1 
ATOM   2262  C CA  . ALA B 1 34  ? -3.306  1.823   28.557  1.00 175.37 ? 32   ALA B CA  1 
ATOM   2263  C C   . ALA B 1 34  ? -3.907  2.573   29.738  1.00 176.01 ? 32   ALA B C   1 
ATOM   2264  O O   . ALA B 1 34  ? -4.672  2.010   30.522  1.00 175.99 ? 32   ALA B O   1 
ATOM   2265  C CB  . ALA B 1 34  ? -3.928  2.319   27.260  1.00 148.20 ? 32   ALA B CB  1 
ATOM   2266  N N   . SER B 1 35  ? -3.552  3.850   29.856  1.00 198.94 ? 33   SER B N   1 
ATOM   2267  C CA  . SER B 1 35  ? -4.047  4.694   30.935  1.00 198.94 ? 33   SER B CA  1 
ATOM   2268  C C   . SER B 1 35  ? -4.597  6.000   30.376  1.00 198.94 ? 33   SER B C   1 
ATOM   2269  O O   . SER B 1 35  ? -4.161  6.467   29.323  1.00 198.94 ? 33   SER B O   1 
ATOM   2270  C CB  . SER B 1 35  ? -2.925  4.992   31.930  1.00 144.54 ? 33   SER B CB  1 
ATOM   2271  O OG  . SER B 1 35  ? -3.421  5.711   33.043  1.00 144.75 ? 33   SER B OG  1 
ATOM   2272  N N   . SER B 1 36  ? -5.546  6.590   31.093  1.00 171.96 ? 34   SER B N   1 
ATOM   2273  C CA  . SER B 1 36  ? -6.170  7.833   30.659  1.00 172.60 ? 34   SER B CA  1 
ATOM   2274  C C   . SER B 1 36  ? -6.127  8.920   31.726  1.00 173.60 ? 34   SER B C   1 
ATOM   2275  O O   . SER B 1 36  ? -6.810  8.820   32.747  1.00 173.02 ? 34   SER B O   1 
ATOM   2276  C CB  . SER B 1 36  ? -7.628  7.573   30.296  1.00 159.60 ? 34   SER B CB  1 
ATOM   2277  O OG  . SER B 1 36  ? -8.342  7.160   31.449  1.00 159.40 ? 34   SER B OG  1 
ATOM   2278  N N   . PRO B 1 37  ? -5.322  9.974   31.507  1.00 194.64 ? 35   PRO B N   1 
ATOM   2279  C CA  . PRO B 1 37  ? -5.238  11.059  32.488  1.00 196.24 ? 35   PRO B CA  1 
ATOM   2280  C C   . PRO B 1 37  ? -6.510  11.915  32.484  1.00 198.08 ? 35   PRO B C   1 
ATOM   2281  O O   . PRO B 1 37  ? -6.447  13.147  32.498  1.00 197.88 ? 35   PRO B O   1 
ATOM   2282  C CB  . PRO B 1 37  ? -3.995  11.830  32.042  1.00 157.07 ? 35   PRO B CB  1 
ATOM   2283  C CG  . PRO B 1 37  ? -3.985  11.622  30.564  1.00 156.75 ? 35   PRO B CG  1 
ATOM   2284  C CD  . PRO B 1 37  ? -4.335  10.160  30.429  1.00 156.44 ? 35   PRO B CD  1 
ATOM   2285  N N   . ASP B 1 38  ? -7.657  11.235  32.458  1.00 198.37 ? 36   ASP B N   1 
ATOM   2286  C CA  . ASP B 1 38  ? -8.980  11.864  32.464  1.00 198.37 ? 36   ASP B CA  1 
ATOM   2287  C C   . ASP B 1 38  ? -10.061 10.783  32.285  1.00 198.37 ? 36   ASP B C   1 
ATOM   2288  O O   . ASP B 1 38  ? -10.126 9.829   33.065  1.00 198.37 ? 36   ASP B O   1 
ATOM   2289  C CB  . ASP B 1 38  ? -9.085  12.912  31.346  1.00 200.00 ? 36   ASP B CB  1 
ATOM   2290  C CG  . ASP B 1 38  ? -10.211 13.910  31.581  1.00 200.00 ? 36   ASP B CG  1 
ATOM   2291  O OD1 . ASP B 1 38  ? -11.381 13.483  31.687  1.00 200.00 ? 36   ASP B OD1 1 
ATOM   2292  O OD2 . ASP B 1 38  ? -9.924  15.125  31.660  1.00 200.00 ? 36   ASP B OD2 1 
ATOM   2293  N N   . MET B 1 39  ? -10.902 10.930  31.263  1.00 200.00 ? 37   MET B N   1 
ATOM   2294  C CA  . MET B 1 39  ? -11.969 9.964   30.992  1.00 200.00 ? 37   MET B CA  1 
ATOM   2295  C C   . MET B 1 39  ? -12.729 10.387  29.730  1.00 200.00 ? 37   MET B C   1 
ATOM   2296  O O   . MET B 1 39  ? -13.956 10.279  29.659  1.00 200.00 ? 37   MET B O   1 
ATOM   2297  C CB  . MET B 1 39  ? -12.923 9.893   32.193  1.00 160.77 ? 37   MET B CB  1 
ATOM   2298  C CG  . MET B 1 39  ? -13.810 8.657   32.243  1.00 159.52 ? 37   MET B CG  1 
ATOM   2299  S SD  . MET B 1 39  ? -12.893 7.103   32.169  1.00 159.16 ? 37   MET B SD  1 
ATOM   2300  C CE  . MET B 1 39  ? -11.637 7.332   33.480  1.00 158.11 ? 37   MET B CE  1 
ATOM   2301  N N   . ASP B 1 40  ? -11.974 10.861  28.739  1.00 200.00 ? 38   ASP B N   1 
ATOM   2302  C CA  . ASP B 1 40  ? -12.519 11.331  27.464  1.00 200.00 ? 38   ASP B CA  1 
ATOM   2303  C C   . ASP B 1 40  ? -13.513 10.355  26.844  1.00 200.00 ? 38   ASP B C   1 
ATOM   2304  O O   . ASP B 1 40  ? -13.430 9.143   27.046  1.00 200.00 ? 38   ASP B O   1 
ATOM   2305  C CB  . ASP B 1 40  ? -11.375 11.595  26.472  1.00 200.00 ? 38   ASP B CB  1 
ATOM   2306  C CG  . ASP B 1 40  ? -11.844 12.279  25.191  1.00 200.00 ? 38   ASP B CG  1 
ATOM   2307  O OD1 . ASP B 1 40  ? -11.047 12.350  24.230  1.00 200.00 ? 38   ASP B OD1 1 
ATOM   2308  O OD2 . ASP B 1 40  ? -12.999 12.754  25.143  1.00 200.00 ? 38   ASP B OD2 1 
ATOM   2309  N N   . LEU B 1 41  ? -14.455 10.902  26.085  1.00 199.98 ? 39   LEU B N   1 
ATOM   2310  C CA  . LEU B 1 41  ? -15.467 10.102  25.420  1.00 199.57 ? 39   LEU B CA  1 
ATOM   2311  C C   . LEU B 1 41  ? -15.287 10.206  23.908  1.00 198.78 ? 39   LEU B C   1 
ATOM   2312  O O   . LEU B 1 41  ? -16.033 9.599   23.140  1.00 198.93 ? 39   LEU B O   1 
ATOM   2313  C CB  . LEU B 1 41  ? -16.858 10.591  25.820  1.00 153.66 ? 39   LEU B CB  1 
ATOM   2314  C CG  . LEU B 1 41  ? -18.048 9.856   25.208  1.00 151.83 ? 39   LEU B CG  1 
ATOM   2315  C CD1 . LEU B 1 41  ? -17.988 8.381   25.564  1.00 150.77 ? 39   LEU B CD1 1 
ATOM   2316  C CD2 . LEU B 1 41  ? -19.334 10.481  25.716  1.00 151.49 ? 39   LEU B CD2 1 
ATOM   2317  N N   . ALA B 1 42  ? -14.283 10.972  23.490  1.00 200.00 ? 40   ALA B N   1 
ATOM   2318  C CA  . ALA B 1 42  ? -13.994 11.160  22.072  1.00 200.00 ? 40   ALA B CA  1 
ATOM   2319  C C   . ALA B 1 42  ? -13.148 10.013  21.525  1.00 200.00 ? 40   ALA B C   1 
ATOM   2320  O O   . ALA B 1 42  ? -13.256 9.650   20.354  1.00 200.00 ? 40   ALA B O   1 
ATOM   2321  C CB  . ALA B 1 42  ? -13.273 12.488  21.858  1.00 149.99 ? 40   ALA B CB  1 
ATOM   2322  N N   . THR B 1 43  ? -12.306 9.443   22.379  1.00 193.23 ? 41   THR B N   1 
ATOM   2323  C CA  . THR B 1 43  ? -11.447 8.343   21.967  1.00 192.24 ? 41   THR B CA  1 
ATOM   2324  C C   . THR B 1 43  ? -11.204 7.364   23.108  1.00 190.83 ? 41   THR B C   1 
ATOM   2325  O O   . THR B 1 43  ? -11.156 6.155   22.892  1.00 190.73 ? 41   THR B O   1 
ATOM   2326  C CB  . THR B 1 43  ? -10.083 8.859   21.469  1.00 194.31 ? 41   THR B CB  1 
ATOM   2327  O OG1 . THR B 1 43  ? -10.280 9.708   20.332  1.00 195.22 ? 41   THR B OG1 1 
ATOM   2328  C CG2 . THR B 1 43  ? -9.181  7.696   21.079  1.00 194.44 ? 41   THR B CG2 1 
ATOM   2329  N N   . VAL B 1 44  ? -11.053 7.887   24.321  1.00 137.35 ? 42   VAL B N   1 
ATOM   2330  C CA  . VAL B 1 44  ? -10.804 7.033   25.479  1.00 136.02 ? 42   VAL B CA  1 
ATOM   2331  C C   . VAL B 1 44  ? -11.883 5.977   25.628  1.00 134.94 ? 42   VAL B C   1 
ATOM   2332  O O   . VAL B 1 44  ? -11.598 4.779   25.618  1.00 134.47 ? 42   VAL B O   1 
ATOM   2333  C CB  . VAL B 1 44  ? -10.746 7.836   26.788  1.00 168.07 ? 42   VAL B CB  1 
ATOM   2334  C CG1 . VAL B 1 44  ? -10.513 6.890   27.941  1.00 168.17 ? 42   VAL B CG1 1 
ATOM   2335  C CG2 . VAL B 1 44  ? -9.637  8.869   26.728  1.00 168.13 ? 42   VAL B CG2 1 
ATOM   2336  N N   . SER B 1 45  ? -13.121 6.431   25.777  1.00 170.19 ? 43   SER B N   1 
ATOM   2337  C CA  . SER B 1 45  ? -14.249 5.525   25.919  1.00 169.07 ? 43   SER B CA  1 
ATOM   2338  C C   . SER B 1 45  ? -14.465 4.797   24.591  1.00 168.06 ? 43   SER B C   1 
ATOM   2339  O O   . SER B 1 45  ? -15.433 4.058   24.421  1.00 167.28 ? 43   SER B O   1 
ATOM   2340  C CB  . SER B 1 45  ? -15.502 6.312   26.318  1.00 153.32 ? 43   SER B CB  1 
ATOM   2341  O OG  . SER B 1 45  ? -15.330 6.950   27.575  1.00 152.45 ? 43   SER B OG  1 
ATOM   2342  N N   . ALA B 1 46  ? -13.543 5.016   23.657  1.00 180.90 ? 44   ALA B N   1 
ATOM   2343  C CA  . ALA B 1 46  ? -13.591 4.388   22.343  1.00 179.64 ? 44   ALA B CA  1 
ATOM   2344  C C   . ALA B 1 46  ? -12.433 3.399   22.230  1.00 179.03 ? 44   ALA B C   1 
ATOM   2345  O O   . ALA B 1 46  ? -12.334 2.652   21.257  1.00 178.73 ? 44   ALA B O   1 
ATOM   2346  C CB  . ALA B 1 46  ? -13.488 5.448   21.244  1.00 85.31  ? 44   ALA B CB  1 
ATOM   2347  N N   . LEU B 1 47  ? -11.556 3.405   23.231  1.00 135.43 ? 45   LEU B N   1 
ATOM   2348  C CA  . LEU B 1 47  ? -10.405 2.506   23.254  1.00 134.46 ? 45   LEU B CA  1 
ATOM   2349  C C   . LEU B 1 47  ? -10.811 1.201   23.906  1.00 133.72 ? 45   LEU B C   1 
ATOM   2350  O O   . LEU B 1 47  ? -10.315 0.131   23.546  1.00 132.26 ? 45   LEU B O   1 
ATOM   2351  C CB  . LEU B 1 47  ? -9.261  3.107   24.060  1.00 198.02 ? 45   LEU B CB  1 
ATOM   2352  C CG  . LEU B 1 47  ? -8.744  4.498   23.718  1.00 198.59 ? 45   LEU B CG  1 
ATOM   2353  C CD1 . LEU B 1 47  ? -7.648  4.815   24.708  1.00 199.99 ? 45   LEU B CD1 1 
ATOM   2354  C CD2 . LEU B 1 47  ? -8.223  4.569   22.289  1.00 198.53 ? 45   LEU B CD2 1 
ATOM   2355  N N   . ARG B 1 48  ? -11.694 1.307   24.895  1.00 178.33 ? 46   ARG B N   1 
ATOM   2356  C CA  . ARG B 1 48  ? -12.193 0.136   25.600  1.00 178.58 ? 46   ARG B CA  1 
ATOM   2357  C C   . ARG B 1 48  ? -12.694 -0.767  24.490  1.00 179.41 ? 46   ARG B C   1 
ATOM   2358  O O   . ARG B 1 48  ? -12.392 -1.960  24.444  1.00 179.19 ? 46   ARG B O   1 
ATOM   2359  C CB  . ARG B 1 48  ? -13.364 0.514   26.514  1.00 149.17 ? 46   ARG B CB  1 
ATOM   2360  C CG  . ARG B 1 48  ? -13.113 1.724   27.404  1.00 148.14 ? 46   ARG B CG  1 
ATOM   2361  C CD  . ARG B 1 48  ? -14.338 2.074   28.245  1.00 147.27 ? 46   ARG B CD  1 
ATOM   2362  N NE  . ARG B 1 48  ? -14.153 3.316   28.998  1.00 146.44 ? 46   ARG B NE  1 
ATOM   2363  C CZ  . ARG B 1 48  ? -15.050 3.833   29.835  1.00 145.17 ? 46   ARG B CZ  1 
ATOM   2364  N NH1 . ARG B 1 48  ? -16.208 3.218   30.037  1.00 144.42 ? 46   ARG B NH1 1 
ATOM   2365  N NH2 . ARG B 1 48  ? -14.790 4.969   30.471  1.00 144.09 ? 46   ARG B NH2 1 
ATOM   2366  N N   . LYS B 1 49  ? -13.449 -0.156  23.583  1.00 188.61 ? 47   LYS B N   1 
ATOM   2367  C CA  . LYS B 1 49  ? -14.025 -0.845  22.440  1.00 189.71 ? 47   LYS B CA  1 
ATOM   2368  C C   . LYS B 1 49  ? -12.983 -1.072  21.348  1.00 189.78 ? 47   LYS B C   1 
ATOM   2369  O O   . LYS B 1 49  ? -13.279 -0.957  20.159  1.00 189.97 ? 47   LYS B O   1 
ATOM   2370  C CB  . LYS B 1 49  ? -15.200 -0.032  21.885  1.00 164.48 ? 47   LYS B CB  1 
ATOM   2371  C CG  . LYS B 1 49  ? -14.829 1.376   21.449  1.00 164.73 ? 47   LYS B CG  1 
ATOM   2372  C CD  . LYS B 1 49  ? -16.039 2.182   20.993  1.00 164.47 ? 47   LYS B CD  1 
ATOM   2373  C CE  . LYS B 1 49  ? -16.948 2.558   22.155  1.00 164.19 ? 47   LYS B CE  1 
ATOM   2374  N NZ  . LYS B 1 49  ? -17.561 1.372   22.813  1.00 164.30 ? 47   LYS B NZ  1 
ATOM   2375  N N   . MET B 1 50  ? -11.761 -1.391  21.761  1.00 153.10 ? 48   MET B N   1 
ATOM   2376  C CA  . MET B 1 50  ? -10.671 -1.650  20.826  1.00 152.62 ? 48   MET B CA  1 
ATOM   2377  C C   . MET B 1 50  ? -9.939  -2.905  21.254  1.00 150.95 ? 48   MET B C   1 
ATOM   2378  O O   . MET B 1 50  ? -8.952  -3.304  20.633  1.00 150.41 ? 48   MET B O   1 
ATOM   2379  C CB  . MET B 1 50  ? -9.663  -0.502  20.826  1.00 200.00 ? 48   MET B CB  1 
ATOM   2380  C CG  . MET B 1 50  ? -10.162 0.819   20.298  1.00 200.00 ? 48   MET B CG  1 
ATOM   2381  S SD  . MET B 1 50  ? -8.826  2.026   20.355  1.00 200.00 ? 48   MET B SD  1 
ATOM   2382  C CE  . MET B 1 50  ? -7.906  1.592   18.870  1.00 200.00 ? 48   MET B CE  1 
ATOM   2383  N N   . GLY B 1 51  ? -10.428 -3.536  22.312  1.00 140.20 ? 49   GLY B N   1 
ATOM   2384  C CA  . GLY B 1 51  ? -9.737  -4.703  22.806  1.00 139.07 ? 49   GLY B CA  1 
ATOM   2385  C C   . GLY B 1 51  ? -8.456  -4.074  23.305  1.00 138.22 ? 49   GLY B C   1 
ATOM   2386  O O   . GLY B 1 51  ? -7.348  -4.542  23.039  1.00 137.89 ? 49   GLY B O   1 
ATOM   2387  N N   . VAL B 1 52  ? -8.635  -2.966  24.016  1.00 186.48 ? 50   VAL B N   1 
ATOM   2388  C CA  . VAL B 1 52  ? -7.536  -2.194  24.566  1.00 185.45 ? 50   VAL B CA  1 
ATOM   2389  C C   . VAL B 1 52  ? -7.912  -1.700  25.961  1.00 185.39 ? 50   VAL B C   1 
ATOM   2390  O O   . VAL B 1 52  ? -8.907  -0.991  26.121  1.00 186.07 ? 50   VAL B O   1 
ATOM   2391  C CB  . VAL B 1 52  ? -7.239  -0.980  23.663  1.00 118.94 ? 50   VAL B CB  1 
ATOM   2392  C CG1 . VAL B 1 52  ? -6.115  -0.150  24.247  1.00 118.67 ? 50   VAL B CG1 1 
ATOM   2393  C CG2 . VAL B 1 52  ? -6.882  -1.455  22.268  1.00 117.92 ? 50   VAL B CG2 1 
ATOM   2394  N N   . LEU B 1 54  ? -10.911 2.033   30.319  1.00 166.79 ? 52   LEU B N   1 
ATOM   2395  C CA  . LEU B 1 54  ? -9.563  2.582   30.395  1.00 166.98 ? 52   LEU B CA  1 
ATOM   2396  C C   . LEU B 1 54  ? -9.097  2.788   31.833  1.00 166.98 ? 52   LEU B C   1 
ATOM   2397  O O   . LEU B 1 54  ? -9.898  3.055   32.730  1.00 166.60 ? 52   LEU B O   1 
ATOM   2398  C CB  . LEU B 1 54  ? -9.488  3.906   29.626  1.00 190.79 ? 52   LEU B CB  1 
ATOM   2399  C CG  . LEU B 1 54  ? -9.154  3.842   28.130  1.00 190.03 ? 52   LEU B CG  1 
ATOM   2400  C CD1 . LEU B 1 54  ? -7.692  3.463   27.953  1.00 189.83 ? 52   LEU B CD1 1 
ATOM   2401  C CD2 . LEU B 1 54  ? -10.057 2.844   27.428  1.00 189.36 ? 52   LEU B CD2 1 
ATOM   2402  N N   . THR B 1 55  ? -7.788  2.658   32.032  1.00 200.00 ? 53   THR B N   1 
ATOM   2403  C CA  . THR B 1 55  ? -7.161  2.814   33.339  1.00 200.00 ? 53   THR B CA  1 
ATOM   2404  C C   . THR B 1 55  ? -6.910  4.285   33.676  1.00 200.00 ? 53   THR B C   1 
ATOM   2405  O O   . THR B 1 55  ? -5.941  4.881   33.208  1.00 200.00 ? 53   THR B O   1 
ATOM   2406  C CB  . THR B 1 55  ? -5.810  2.049   33.386  1.00 139.55 ? 53   THR B CB  1 
ATOM   2407  O OG1 . THR B 1 55  ? -6.054  0.637   33.346  1.00 137.88 ? 53   THR B OG1 1 
ATOM   2408  C CG2 . THR B 1 55  ? -5.031  2.398   34.640  1.00 139.07 ? 53   THR B CG2 1 
ATOM   2409  N N   . PRO B 1 56  ? -7.786  4.891   34.493  1.00 180.31 ? 54   PRO B N   1 
ATOM   2410  C CA  . PRO B 1 56  ? -7.594  6.299   34.854  1.00 180.14 ? 54   PRO B CA  1 
ATOM   2411  C C   . PRO B 1 56  ? -6.378  6.455   35.773  1.00 180.23 ? 54   PRO B C   1 
ATOM   2412  O O   . PRO B 1 56  ? -5.925  7.568   36.051  1.00 179.52 ? 54   PRO B O   1 
ATOM   2413  C CB  . PRO B 1 56  ? -8.912  6.657   35.537  1.00 142.36 ? 54   PRO B CB  1 
ATOM   2414  C CG  . PRO B 1 56  ? -9.291  5.371   36.202  1.00 142.33 ? 54   PRO B CG  1 
ATOM   2415  C CD  . PRO B 1 56  ? -8.992  4.340   35.137  1.00 142.54 ? 54   PRO B CD  1 
ATOM   2416  N N   . HIS B 1 57  ? -5.857  5.319   36.231  1.00 185.96 ? 55   HIS B N   1 
ATOM   2417  C CA  . HIS B 1 57  ? -4.692  5.282   37.108  1.00 185.80 ? 55   HIS B CA  1 
ATOM   2418  C C   . HIS B 1 57  ? -3.431  5.259   36.257  1.00 184.84 ? 55   HIS B C   1 
ATOM   2419  O O   . HIS B 1 57  ? -2.913  4.192   35.922  1.00 184.95 ? 55   HIS B O   1 
ATOM   2420  C CB  . HIS B 1 57  ? -4.739  4.034   37.987  1.00 198.45 ? 55   HIS B CB  1 
ATOM   2421  C CG  . HIS B 1 57  ? -5.963  3.945   38.844  1.00 199.47 ? 55   HIS B CG  1 
ATOM   2422  N ND1 . HIS B 1 57  ? -6.172  4.767   39.930  1.00 199.47 ? 55   HIS B ND1 1 
ATOM   2423  C CD2 . HIS B 1 57  ? -7.049  3.140   38.767  1.00 199.47 ? 55   HIS B CD2 1 
ATOM   2424  C CE1 . HIS B 1 57  ? -7.333  4.471   40.486  1.00 199.47 ? 55   HIS B CE1 1 
ATOM   2425  N NE2 . HIS B 1 57  ? -7.885  3.487   39.799  1.00 199.47 ? 55   HIS B NE2 1 
ATOM   2426  N N   . ASN B 1 58  ? -2.947  6.447   35.910  1.00 176.00 ? 56   ASN B N   1 
ATOM   2427  C CA  . ASN B 1 58  ? -1.757  6.598   35.084  1.00 174.60 ? 56   ASN B CA  1 
ATOM   2428  C C   . ASN B 1 58  ? -0.670  5.569   35.389  1.00 174.37 ? 56   ASN B C   1 
ATOM   2429  O O   . ASN B 1 58  ? -0.070  5.006   34.474  1.00 174.34 ? 56   ASN B O   1 
ATOM   2430  C CB  . ASN B 1 58  ? -1.192  8.013   35.244  1.00 166.00 ? 56   ASN B CB  1 
ATOM   2431  C CG  . ASN B 1 58  ? -2.213  9.091   34.922  1.00 164.79 ? 56   ASN B CG  1 
ATOM   2432  O OD1 . ASN B 1 58  ? -2.669  9.215   33.783  1.00 163.78 ? 56   ASN B OD1 1 
ATOM   2433  N ND2 . ASN B 1 58  ? -2.579  9.876   35.929  1.00 163.94 ? 56   ASN B ND2 1 
ATOM   2434  N N   . LYS B 1 59  ? -0.433  5.311   36.673  1.00 181.62 ? 57   LYS B N   1 
ATOM   2435  C CA  . LYS B 1 59  ? 0.601   4.365   37.092  1.00 181.15 ? 57   LYS B CA  1 
ATOM   2436  C C   . LYS B 1 59  ? 0.303   2.904   36.759  1.00 179.24 ? 57   LYS B C   1 
ATOM   2437  O O   . LYS B 1 59  ? 1.151   2.210   36.195  1.00 178.57 ? 57   LYS B O   1 
ATOM   2438  C CB  . LYS B 1 59  ? 0.850   4.488   38.596  1.00 199.93 ? 57   LYS B CB  1 
ATOM   2439  C CG  . LYS B 1 59  ? -0.304  3.997   39.444  1.00 199.93 ? 57   LYS B CG  1 
ATOM   2440  C CD  . LYS B 1 59  ? 0.011   4.079   40.922  1.00 199.93 ? 57   LYS B CD  1 
ATOM   2441  C CE  . LYS B 1 59  ? -1.116  3.469   41.730  1.00 199.93 ? 57   LYS B CE  1 
ATOM   2442  N NZ  . LYS B 1 59  ? -2.428  4.064   41.352  1.00 199.93 ? 57   LYS B NZ  1 
ATOM   2443  N N   . GLU B 1 60  ? -0.889  2.438   37.123  1.00 148.62 ? 58   GLU B N   1 
ATOM   2444  C CA  . GLU B 1 60  ? -1.286  1.058   36.868  1.00 147.40 ? 58   GLU B CA  1 
ATOM   2445  C C   . GLU B 1 60  ? -0.653  0.516   35.596  1.00 146.34 ? 58   GLU B C   1 
ATOM   2446  O O   . GLU B 1 60  ? 0.257   -0.309  35.644  1.00 145.86 ? 58   GLU B O   1 
ATOM   2447  C CB  . GLU B 1 60  ? -2.808  0.952   36.756  1.00 191.57 ? 58   GLU B CB  1 
ATOM   2448  C CG  . GLU B 1 60  ? -3.535  1.012   38.084  1.00 192.49 ? 58   GLU B CG  1 
ATOM   2449  C CD  . GLU B 1 60  ? -5.031  0.795   37.942  1.00 193.26 ? 58   GLU B CD  1 
ATOM   2450  O OE1 . GLU B 1 60  ? -5.714  0.667   38.979  1.00 193.93 ? 58   GLU B OE1 1 
ATOM   2451  O OE2 . GLU B 1 60  ? -5.528  0.755   36.797  1.00 193.36 ? 58   GLU B OE2 1 
ATOM   2452  N N   . THR B 1 61  ? -1.147  1.003   34.464  1.00 179.18 ? 59   THR B N   1 
ATOM   2453  C CA  . THR B 1 61  ? -0.677  0.609   33.140  1.00 177.40 ? 59   THR B CA  1 
ATOM   2454  C C   . THR B 1 61  ? 0.778   0.134   33.073  1.00 176.70 ? 59   THR B C   1 
ATOM   2455  O O   . THR B 1 61  ? 1.104   -0.763  32.296  1.00 175.63 ? 59   THR B O   1 
ATOM   2456  C CB  . THR B 1 61  ? -0.861  1.773   32.160  1.00 151.16 ? 59   THR B CB  1 
ATOM   2457  O OG1 . THR B 1 61  ? -2.213  2.241   32.236  1.00 149.85 ? 59   THR B OG1 1 
ATOM   2458  C CG2 . THR B 1 61  ? -0.559  1.329   30.741  1.00 150.31 ? 59   THR B CG2 1 
ATOM   2459  N N   . VAL B 1 62  ? 1.645   0.736   33.883  1.00 178.07 ? 60   VAL B N   1 
ATOM   2460  C CA  . VAL B 1 62  ? 3.063   0.379   33.913  1.00 178.13 ? 60   VAL B CA  1 
ATOM   2461  C C   . VAL B 1 62  ? 3.299   -1.085  34.277  1.00 178.49 ? 60   VAL B C   1 
ATOM   2462  O O   . VAL B 1 62  ? 4.237   -1.710  33.782  1.00 179.28 ? 60   VAL B O   1 
ATOM   2463  C CB  . VAL B 1 62  ? 3.835   1.256   34.924  1.00 123.83 ? 60   VAL B CB  1 
ATOM   2464  C CG1 . VAL B 1 62  ? 5.308   0.876   34.931  1.00 123.49 ? 60   VAL B CG1 1 
ATOM   2465  C CG2 . VAL B 1 62  ? 3.670   2.720   34.569  1.00 123.84 ? 60   VAL B CG2 1 
ATOM   2466  N N   . GLN B 1 63  ? 2.446   -1.616  35.147  1.00 126.16 ? 61   GLN B N   1 
ATOM   2467  C CA  . GLN B 1 63  ? 2.531   -3.001  35.609  1.00 126.39 ? 61   GLN B CA  1 
ATOM   2468  C C   . GLN B 1 63  ? 3.031   -3.981  34.541  1.00 126.10 ? 61   GLN B C   1 
ATOM   2469  O O   . GLN B 1 63  ? 4.234   -4.218  34.410  1.00 125.80 ? 61   GLN B O   1 
ATOM   2470  C CB  . GLN B 1 63  ? 1.156   -3.455  36.106  1.00 164.44 ? 61   GLN B CB  1 
ATOM   2471  C CG  . GLN B 1 63  ? 0.545   -2.552  37.166  1.00 166.28 ? 61   GLN B CG  1 
ATOM   2472  C CD  . GLN B 1 63  ? -0.939  -2.806  37.364  1.00 167.38 ? 61   GLN B CD  1 
ATOM   2473  O OE1 . GLN B 1 63  ? -1.723  -2.742  36.417  1.00 168.39 ? 61   GLN B OE1 1 
ATOM   2474  N NE2 . GLN B 1 63  ? -1.331  -3.089  38.599  1.00 167.86 ? 61   GLN B NE2 1 
ATOM   2475  N N   . HIS B 1 64  ? 2.092   -4.554  33.791  1.00 179.92 ? 62   HIS B N   1 
ATOM   2476  C CA  . HIS B 1 64  ? 2.407   -5.513  32.735  1.00 179.07 ? 62   HIS B CA  1 
ATOM   2477  C C   . HIS B 1 64  ? 2.912   -4.769  31.514  1.00 176.99 ? 62   HIS B C   1 
ATOM   2478  O O   . HIS B 1 64  ? 2.243   -4.715  30.480  1.00 175.99 ? 62   HIS B O   1 
ATOM   2479  C CB  . HIS B 1 64  ? 1.160   -6.314  32.359  1.00 200.00 ? 62   HIS B CB  1 
ATOM   2480  C CG  . HIS B 1 64  ? 0.438   -6.889  33.537  1.00 200.00 ? 62   HIS B CG  1 
ATOM   2481  N ND1 . HIS B 1 64  ? 1.036   -7.755  34.426  1.00 200.00 ? 62   HIS B ND1 1 
ATOM   2482  C CD2 . HIS B 1 64  ? -0.829  -6.709  33.980  1.00 200.00 ? 62   HIS B CD2 1 
ATOM   2483  C CE1 . HIS B 1 64  ? 0.169   -8.085  35.367  1.00 200.00 ? 62   HIS B CE1 1 
ATOM   2484  N NE2 . HIS B 1 64  ? -0.970  -7.464  35.120  1.00 200.00 ? 62   HIS B NE2 1 
ATOM   2485  N N   . SER B 1 65  ? 4.098   -4.194  31.641  1.00 164.64 ? 63   SER B N   1 
ATOM   2486  C CA  . SER B 1 65  ? 4.682   -3.440  30.551  1.00 162.92 ? 63   SER B CA  1 
ATOM   2487  C C   . SER B 1 65  ? 6.175   -3.671  30.465  1.00 162.59 ? 63   SER B C   1 
ATOM   2488  O O   . SER B 1 65  ? 6.803   -4.144  31.412  1.00 163.35 ? 63   SER B O   1 
ATOM   2489  C CB  . SER B 1 65  ? 4.409   -1.950  30.745  1.00 137.14 ? 63   SER B CB  1 
ATOM   2490  O OG  . SER B 1 65  ? 3.023   -1.714  30.911  1.00 135.87 ? 63   SER B OG  1 
ATOM   2491  N N   . ASP B 1 66  ? 6.733   -3.333  29.311  1.00 200.00 ? 64   ASP B N   1 
ATOM   2492  C CA  . ASP B 1 66  ? 8.156   -3.475  29.067  1.00 200.00 ? 64   ASP B CA  1 
ATOM   2493  C C   . ASP B 1 66  ? 8.582   -2.303  28.193  1.00 200.00 ? 64   ASP B C   1 
ATOM   2494  O O   . ASP B 1 66  ? 9.746   -2.183  27.818  1.00 200.00 ? 64   ASP B O   1 
ATOM   2495  C CB  . ASP B 1 66  ? 8.446   -4.806  28.364  1.00 165.53 ? 64   ASP B CB  1 
ATOM   2496  C CG  . ASP B 1 66  ? 7.998   -6.008  29.180  1.00 166.35 ? 64   ASP B CG  1 
ATOM   2497  O OD1 . ASP B 1 66  ? 8.444   -6.142  30.341  1.00 166.61 ? 64   ASP B OD1 1 
ATOM   2498  O OD2 . ASP B 1 66  ? 7.200   -6.819  28.662  1.00 166.69 ? 64   ASP B OD2 1 
ATOM   2499  N N   . VAL B 1 67  ? 7.616   -1.440  27.882  1.00 160.39 ? 65   VAL B N   1 
ATOM   2500  C CA  . VAL B 1 67  ? 7.838   -0.252  27.059  1.00 158.27 ? 65   VAL B CA  1 
ATOM   2501  C C   . VAL B 1 67  ? 6.780   0.795   27.377  1.00 157.42 ? 65   VAL B C   1 
ATOM   2502  O O   . VAL B 1 67  ? 5.605   0.606   27.073  1.00 156.81 ? 65   VAL B O   1 
ATOM   2503  C CB  . VAL B 1 67  ? 7.745   -0.569  25.548  1.00 120.72 ? 65   VAL B CB  1 
ATOM   2504  C CG1 . VAL B 1 67  ? 7.721   0.723   24.747  1.00 119.74 ? 65   VAL B CG1 1 
ATOM   2505  C CG2 . VAL B 1 67  ? 8.925   -1.420  25.119  1.00 120.75 ? 65   VAL B CG2 1 
ATOM   2506  N N   . LEU B 1 68  ? 7.197   1.899   27.985  1.00 129.70 ? 66   LEU B N   1 
ATOM   2507  C CA  . LEU B 1 68  ? 6.263   2.963   28.329  1.00 129.64 ? 66   LEU B CA  1 
ATOM   2508  C C   . LEU B 1 68  ? 6.161   4.009   27.229  1.00 129.39 ? 66   LEU B C   1 
ATOM   2509  O O   . LEU B 1 68  ? 7.140   4.313   26.549  1.00 129.13 ? 66   LEU B O   1 
ATOM   2510  C CB  . LEU B 1 68  ? 6.674   3.647   29.638  1.00 138.83 ? 66   LEU B CB  1 
ATOM   2511  C CG  . LEU B 1 68  ? 6.567   2.853   30.944  1.00 137.88 ? 66   LEU B CG  1 
ATOM   2512  C CD1 . LEU B 1 68  ? 6.986   3.742   32.107  1.00 137.00 ? 66   LEU B CD1 1 
ATOM   2513  C CD2 . LEU B 1 68  ? 5.141   2.363   31.148  1.00 137.51 ? 66   LEU B CD2 1 
ATOM   2514  N N   . PHE B 1 69  ? 4.962   4.554   27.069  1.00 126.60 ? 67   PHE B N   1 
ATOM   2515  C CA  . PHE B 1 69  ? 4.698   5.576   26.067  1.00 126.94 ? 67   PHE B CA  1 
ATOM   2516  C C   . PHE B 1 69  ? 4.005   6.765   26.727  1.00 126.97 ? 67   PHE B C   1 
ATOM   2517  O O   . PHE B 1 69  ? 2.807   6.715   27.002  1.00 126.79 ? 67   PHE B O   1 
ATOM   2518  C CB  . PHE B 1 69  ? 3.810   5.003   24.954  1.00 166.79 ? 67   PHE B CB  1 
ATOM   2519  C CG  . PHE B 1 69  ? 4.559   4.193   23.923  1.00 167.51 ? 67   PHE B CG  1 
ATOM   2520  C CD1 . PHE B 1 69  ? 3.868   3.421   22.993  1.00 167.33 ? 67   PHE B CD1 1 
ATOM   2521  C CD2 . PHE B 1 69  ? 5.950   4.221   23.862  1.00 168.15 ? 67   PHE B CD2 1 
ATOM   2522  C CE1 . PHE B 1 69  ? 4.550   2.691   22.019  1.00 167.48 ? 67   PHE B CE1 1 
ATOM   2523  C CE2 . PHE B 1 69  ? 6.640   3.496   22.893  1.00 168.03 ? 67   PHE B CE2 1 
ATOM   2524  C CZ  . PHE B 1 69  ? 5.938   2.730   21.970  1.00 167.55 ? 67   PHE B CZ  1 
ATOM   2525  N N   . LEU B 1 70  ? 4.761   7.828   26.989  1.00 158.82 ? 68   LEU B N   1 
ATOM   2526  C CA  . LEU B 1 70  ? 4.196   9.017   27.621  1.00 159.45 ? 68   LEU B CA  1 
ATOM   2527  C C   . LEU B 1 70  ? 3.293   9.816   26.695  1.00 160.00 ? 68   LEU B C   1 
ATOM   2528  O O   . LEU B 1 70  ? 3.599   10.957  26.349  1.00 160.25 ? 68   LEU B O   1 
ATOM   2529  C CB  . LEU B 1 70  ? 5.303   9.935   28.141  1.00 119.79 ? 68   LEU B CB  1 
ATOM   2530  C CG  . LEU B 1 70  ? 5.918   9.606   29.500  1.00 119.16 ? 68   LEU B CG  1 
ATOM   2531  C CD1 . LEU B 1 70  ? 6.829   10.748  29.911  1.00 119.32 ? 68   LEU B CD1 1 
ATOM   2532  C CD2 . LEU B 1 70  ? 4.825   9.420   30.544  1.00 118.79 ? 68   LEU B CD2 1 
ATOM   2533  N N   . ALA B 1 71  ? 2.173   9.219   26.303  1.00 170.06 ? 69   ALA B N   1 
ATOM   2534  C CA  . ALA B 1 71  ? 1.229   9.890   25.420  1.00 170.33 ? 69   ALA B CA  1 
ATOM   2535  C C   . ALA B 1 71  ? 0.350   10.847  26.217  1.00 170.52 ? 69   ALA B C   1 
ATOM   2536  O O   . ALA B 1 71  ? -0.845  10.975  25.948  1.00 171.06 ? 69   ALA B O   1 
ATOM   2537  C CB  . ALA B 1 71  ? 0.368   8.861   24.699  1.00 135.21 ? 69   ALA B CB  1 
ATOM   2538  N N   . VAL B 1 72  ? 0.947   11.514  27.201  1.00 161.92 ? 70   VAL B N   1 
ATOM   2539  C CA  . VAL B 1 72  ? 0.218   12.462  28.036  1.00 161.61 ? 70   VAL B CA  1 
ATOM   2540  C C   . VAL B 1 72  ? 0.590   13.897  27.659  1.00 161.84 ? 70   VAL B C   1 
ATOM   2541  O O   . VAL B 1 72  ? 1.611   14.132  27.010  1.00 161.64 ? 70   VAL B O   1 
ATOM   2542  C CB  . VAL B 1 72  ? 0.520   12.229  29.535  1.00 139.18 ? 70   VAL B CB  1 
ATOM   2543  C CG1 . VAL B 1 72  ? -0.377  13.110  30.396  1.00 138.78 ? 70   VAL B CG1 1 
ATOM   2544  C CG2 . VAL B 1 72  ? 0.312   10.761  29.883  1.00 138.38 ? 70   VAL B CG2 1 
ATOM   2545  N N   . LYS B 1 73  ? -0.250  14.848  28.064  1.00 185.33 ? 71   LYS B N   1 
ATOM   2546  C CA  . LYS B 1 73  ? -0.035  16.264  27.770  1.00 184.87 ? 71   LYS B CA  1 
ATOM   2547  C C   . LYS B 1 73  ? 1.415   16.681  27.990  1.00 184.31 ? 71   LYS B C   1 
ATOM   2548  O O   . LYS B 1 73  ? 2.182   15.974  28.640  1.00 184.72 ? 71   LYS B O   1 
ATOM   2549  C CB  . LYS B 1 73  ? -0.952  17.134  28.638  1.00 164.56 ? 71   LYS B CB  1 
ATOM   2550  C CG  . LYS B 1 73  ? -2.444  16.902  28.436  1.00 163.80 ? 71   LYS B CG  1 
ATOM   2551  C CD  . LYS B 1 73  ? -2.901  15.569  29.018  1.00 162.97 ? 71   LYS B CD  1 
ATOM   2552  C CE  . LYS B 1 73  ? -4.401  15.381  28.841  1.00 162.27 ? 71   LYS B CE  1 
ATOM   2553  N NZ  . LYS B 1 73  ? -4.882  14.091  29.404  1.00 160.82 ? 71   LYS B NZ  1 
ATOM   2554  N N   . PRO B 1 74  ? 1.805   17.853  27.465  1.00 128.00 ? 72   PRO B N   1 
ATOM   2555  C CA  . PRO B 1 74  ? 3.180   18.335  27.621  1.00 127.49 ? 72   PRO B CA  1 
ATOM   2556  C C   . PRO B 1 74  ? 3.735   18.278  29.045  1.00 127.18 ? 72   PRO B C   1 
ATOM   2557  O O   . PRO B 1 74  ? 4.941   18.098  29.235  1.00 126.65 ? 72   PRO B O   1 
ATOM   2558  C CB  . PRO B 1 74  ? 3.110   19.759  27.069  1.00 134.00 ? 72   PRO B CB  1 
ATOM   2559  C CG  . PRO B 1 74  ? 1.688   20.154  27.327  1.00 134.36 ? 72   PRO B CG  1 
ATOM   2560  C CD  . PRO B 1 74  ? 0.947   18.913  26.912  1.00 134.39 ? 72   PRO B CD  1 
ATOM   2561  N N   . HIS B 1 75  ? 2.862   18.421  30.040  1.00 129.51 ? 73   HIS B N   1 
ATOM   2562  C CA  . HIS B 1 75  ? 3.298   18.387  31.433  1.00 128.92 ? 73   HIS B CA  1 
ATOM   2563  C C   . HIS B 1 75  ? 3.608   16.968  31.904  1.00 128.51 ? 73   HIS B C   1 
ATOM   2564  O O   . HIS B 1 75  ? 3.426   16.634  33.080  1.00 126.87 ? 73   HIS B O   1 
ATOM   2565  C CB  . HIS B 1 75  ? 2.243   19.008  32.350  1.00 134.93 ? 73   HIS B CB  1 
ATOM   2566  C CG  . HIS B 1 75  ? 1.001   18.188  32.478  1.00 135.44 ? 73   HIS B CG  1 
ATOM   2567  N ND1 . HIS B 1 75  ? 0.128   17.993  31.430  1.00 135.94 ? 73   HIS B ND1 1 
ATOM   2568  C CD2 . HIS B 1 75  ? 0.495   17.495  33.525  1.00 135.64 ? 73   HIS B CD2 1 
ATOM   2569  C CE1 . HIS B 1 75  ? -0.863  17.216  31.826  1.00 136.17 ? 73   HIS B CE1 1 
ATOM   2570  N NE2 . HIS B 1 75  ? -0.665  16.900  33.093  1.00 136.22 ? 73   HIS B NE2 1 
ATOM   2571  N N   . ILE B 1 76  ? 4.070   16.131  30.981  1.00 143.27 ? 74   ILE B N   1 
ATOM   2572  C CA  . ILE B 1 76  ? 4.435   14.769  31.333  1.00 143.31 ? 74   ILE B CA  1 
ATOM   2573  C C   . ILE B 1 76  ? 5.638   14.904  32.242  1.00 145.08 ? 74   ILE B C   1 
ATOM   2574  O O   . ILE B 1 76  ? 6.209   13.917  32.688  1.00 144.91 ? 74   ILE B O   1 
ATOM   2575  C CB  . ILE B 1 76  ? 4.836   13.922  30.098  1.00 93.36  ? 74   ILE B CB  1 
ATOM   2576  C CG1 . ILE B 1 76  ? 5.924   14.636  29.292  1.00 92.13  ? 74   ILE B CG1 1 
ATOM   2577  C CG2 . ILE B 1 76  ? 3.619   13.626  29.247  1.00 92.25  ? 74   ILE B CG2 1 
ATOM   2578  C CD1 . ILE B 1 76  ? 7.322   14.368  29.789  1.00 92.39  ? 74   ILE B CD1 1 
ATOM   2579  N N   . ILE B 1 77  ? 6.022   16.149  32.500  1.00 170.93 ? 75   ILE B N   1 
ATOM   2580  C CA  . ILE B 1 77  ? 7.160   16.432  33.352  1.00 173.34 ? 75   ILE B CA  1 
ATOM   2581  C C   . ILE B 1 77  ? 6.764   16.453  34.830  1.00 175.09 ? 75   ILE B C   1 
ATOM   2582  O O   . ILE B 1 77  ? 7.260   15.650  35.619  1.00 175.52 ? 75   ILE B O   1 
ATOM   2583  C CB  . ILE B 1 77  ? 7.824   17.792  32.979  1.00 174.13 ? 75   ILE B CB  1 
ATOM   2584  C CG1 . ILE B 1 77  ? 8.349   17.755  31.542  1.00 173.55 ? 75   ILE B CG1 1 
ATOM   2585  C CG2 . ILE B 1 77  ? 8.958   18.099  33.941  1.00 174.99 ? 75   ILE B CG2 1 
ATOM   2586  C CD1 . ILE B 1 77  ? 7.567   18.624  30.581  1.00 172.76 ? 75   ILE B CD1 1 
ATOM   2587  N N   . PRO B 1 78  ? 5.852   17.360  35.222  1.00 184.66 ? 76   PRO B N   1 
ATOM   2588  C CA  . PRO B 1 78  ? 5.433   17.442  36.625  1.00 185.76 ? 76   PRO B CA  1 
ATOM   2589  C C   . PRO B 1 78  ? 4.616   16.266  37.142  1.00 186.02 ? 76   PRO B C   1 
ATOM   2590  O O   . PRO B 1 78  ? 5.161   15.238  37.545  1.00 186.44 ? 76   PRO B O   1 
ATOM   2591  C CB  . PRO B 1 78  ? 4.629   18.744  36.674  1.00 200.00 ? 76   PRO B CB  1 
ATOM   2592  C CG  . PRO B 1 78  ? 5.155   19.531  35.510  1.00 200.00 ? 76   PRO B CG  1 
ATOM   2593  C CD  . PRO B 1 78  ? 5.273   18.474  34.454  1.00 200.00 ? 76   PRO B CD  1 
ATOM   2594  N N   . PHE B 1 79  ? 3.299   16.443  37.128  1.00 185.18 ? 77   PHE B N   1 
ATOM   2595  C CA  . PHE B 1 79  ? 2.355   15.444  37.610  1.00 184.32 ? 77   PHE B CA  1 
ATOM   2596  C C   . PHE B 1 79  ? 2.391   14.161  36.799  1.00 183.87 ? 77   PHE B C   1 
ATOM   2597  O O   . PHE B 1 79  ? 1.374   13.485  36.653  1.00 184.10 ? 77   PHE B O   1 
ATOM   2598  C CB  . PHE B 1 79  ? 0.936   16.015  37.586  1.00 168.73 ? 77   PHE B CB  1 
ATOM   2599  C CG  . PHE B 1 79  ? 0.849   17.440  38.049  1.00 169.00 ? 77   PHE B CG  1 
ATOM   2600  C CD1 . PHE B 1 79  ? 1.303   18.478  37.238  1.00 168.68 ? 77   PHE B CD1 1 
ATOM   2601  C CD2 . PHE B 1 79  ? 0.327   17.748  39.300  1.00 169.41 ? 77   PHE B CD2 1 
ATOM   2602  C CE1 . PHE B 1 79  ? 1.238   19.800  37.667  1.00 168.54 ? 77   PHE B CE1 1 
ATOM   2603  C CE2 . PHE B 1 79  ? 0.257   19.068  39.740  1.00 169.35 ? 77   PHE B CE2 1 
ATOM   2604  C CZ  . PHE B 1 79  ? 0.714   20.096  38.920  1.00 168.76 ? 77   PHE B CZ  1 
ATOM   2605  N N   . ILE B 1 80  ? 3.562   13.824  36.273  1.00 154.71 ? 78   ILE B N   1 
ATOM   2606  C CA  . ILE B 1 80  ? 3.713   12.613  35.485  1.00 153.73 ? 78   ILE B CA  1 
ATOM   2607  C C   . ILE B 1 80  ? 4.925   11.797  35.924  1.00 153.83 ? 78   ILE B C   1 
ATOM   2608  O O   . ILE B 1 80  ? 4.780   10.700  36.458  1.00 153.64 ? 78   ILE B O   1 
ATOM   2609  C CB  . ILE B 1 80  ? 3.826   12.950  33.979  1.00 152.87 ? 78   ILE B CB  1 
ATOM   2610  C CG1 . ILE B 1 80  ? 2.466   13.410  33.452  1.00 151.82 ? 78   ILE B CG1 1 
ATOM   2611  C CG2 . ILE B 1 80  ? 4.303   11.732  33.192  1.00 152.86 ? 78   ILE B CG2 1 
ATOM   2612  C CD1 . ILE B 1 80  ? 1.414   12.319  33.467  1.00 151.33 ? 78   ILE B CD1 1 
ATOM   2613  N N   . LEU B 1 81  ? 6.116   12.343  35.718  1.00 162.53 ? 79   LEU B N   1 
ATOM   2614  C CA  . LEU B 1 81  ? 7.344   11.644  36.074  1.00 162.47 ? 79   LEU B CA  1 
ATOM   2615  C C   . LEU B 1 81  ? 7.554   11.463  37.572  1.00 162.79 ? 79   LEU B C   1 
ATOM   2616  O O   . LEU B 1 81  ? 8.262   10.550  37.995  1.00 163.21 ? 79   LEU B O   1 
ATOM   2617  C CB  . LEU B 1 81  ? 8.542   12.380  35.484  1.00 126.50 ? 79   LEU B CB  1 
ATOM   2618  C CG  . LEU B 1 81  ? 8.378   12.775  34.019  1.00 125.93 ? 79   LEU B CG  1 
ATOM   2619  C CD1 . LEU B 1 81  ? 9.615   13.509  33.587  1.00 125.51 ? 79   LEU B CD1 1 
ATOM   2620  C CD2 . LEU B 1 81  ? 8.133   11.551  33.150  1.00 125.61 ? 79   LEU B CD2 1 
ATOM   2621  N N   . ASP B 1 82  ? 6.949   12.327  38.377  1.00 165.19 ? 80   ASP B N   1 
ATOM   2622  C CA  . ASP B 1 82  ? 7.109   12.222  39.821  1.00 165.16 ? 80   ASP B CA  1 
ATOM   2623  C C   . ASP B 1 82  ? 6.270   11.105  40.422  1.00 165.43 ? 80   ASP B C   1 
ATOM   2624  O O   . ASP B 1 82  ? 6.173   10.983  41.642  1.00 166.09 ? 80   ASP B O   1 
ATOM   2625  C CB  . ASP B 1 82  ? 6.767   13.551  40.498  1.00 148.71 ? 80   ASP B CB  1 
ATOM   2626  C CG  . ASP B 1 82  ? 7.829   14.607  40.272  1.00 148.62 ? 80   ASP B CG  1 
ATOM   2627  O OD1 . ASP B 1 82  ? 9.003   14.348  40.614  1.00 148.57 ? 80   ASP B OD1 1 
ATOM   2628  O OD2 . ASP B 1 82  ? 7.490   15.693  39.757  1.00 148.19 ? 80   ASP B OD2 1 
ATOM   2629  N N   . GLU B 1 83  ? 5.664   10.290  39.564  1.00 137.41 ? 81   GLU B N   1 
ATOM   2630  C CA  . GLU B 1 83  ? 4.844   9.177   40.024  1.00 136.90 ? 81   GLU B CA  1 
ATOM   2631  C C   . GLU B 1 83  ? 5.191   7.923   39.234  1.00 136.54 ? 81   GLU B C   1 
ATOM   2632  O O   . GLU B 1 83  ? 4.578   6.871   39.414  1.00 135.80 ? 81   GLU B O   1 
ATOM   2633  C CB  . GLU B 1 83  ? 3.356   9.494   39.854  1.00 140.82 ? 81   GLU B CB  1 
ATOM   2634  C CG  . GLU B 1 83  ? 2.937   10.855  40.391  1.00 141.31 ? 81   GLU B CG  1 
ATOM   2635  C CD  . GLU B 1 83  ? 3.226   11.979  39.413  1.00 141.29 ? 81   GLU B CD  1 
ATOM   2636  O OE1 . GLU B 1 83  ? 2.674   11.943  38.295  1.00 141.91 ? 81   GLU B OE1 1 
ATOM   2637  O OE2 . GLU B 1 83  ? 3.999   12.897  39.757  1.00 140.40 ? 81   GLU B OE2 1 
ATOM   2638  N N   . ILE B 1 84  ? 6.191   8.046   38.367  1.00 200.00 ? 82   ILE B N   1 
ATOM   2639  C CA  . ILE B 1 84  ? 6.636   6.933   37.539  1.00 200.00 ? 82   ILE B CA  1 
ATOM   2640  C C   . ILE B 1 84  ? 7.981   6.411   38.025  1.00 200.00 ? 82   ILE B C   1 
ATOM   2641  O O   . ILE B 1 84  ? 8.179   5.204   38.153  1.00 200.00 ? 82   ILE B O   1 
ATOM   2642  C CB  . ILE B 1 84  ? 6.805   7.361   36.074  1.00 172.34 ? 82   ILE B CB  1 
ATOM   2643  C CG1 . ILE B 1 84  ? 5.548   8.087   35.595  1.00 172.19 ? 82   ILE B CG1 1 
ATOM   2644  C CG2 . ILE B 1 84  ? 7.068   6.137   35.208  1.00 171.64 ? 82   ILE B CG2 1 
ATOM   2645  C CD1 . ILE B 1 84  ? 5.730   8.818   34.282  1.00 173.14 ? 82   ILE B CD1 1 
ATOM   2646  N N   . GLY B 1 85  ? 8.900   7.334   38.291  1.00 169.53 ? 83   GLY B N   1 
ATOM   2647  C CA  . GLY B 1 85  ? 10.224  6.965   38.752  1.00 169.57 ? 83   GLY B CA  1 
ATOM   2648  C C   . GLY B 1 85  ? 10.217  5.939   39.864  1.00 169.87 ? 83   GLY B C   1 
ATOM   2649  O O   . GLY B 1 85  ? 10.873  4.900   39.761  1.00 170.37 ? 83   GLY B O   1 
ATOM   2650  N N   . ALA B 1 86  ? 9.482   6.236   40.933  1.00 175.51 ? 84   ALA B N   1 
ATOM   2651  C CA  . ALA B 1 86  ? 9.373   5.335   42.077  1.00 174.73 ? 84   ALA B CA  1 
ATOM   2652  C C   . ALA B 1 86  ? 8.978   3.940   41.595  1.00 174.12 ? 84   ALA B C   1 
ATOM   2653  O O   . ALA B 1 86  ? 9.234   2.941   42.269  1.00 173.44 ? 84   ALA B O   1 
ATOM   2654  C CB  . ALA B 1 86  ? 8.333   5.868   43.076  1.00 76.42  ? 84   ALA B CB  1 
ATOM   2655  N N   . ASP B 1 87  ? 8.359   3.887   40.418  1.00 200.00 ? 85   ASP B N   1 
ATOM   2656  C CA  . ASP B 1 87  ? 7.923   2.631   39.812  1.00 199.87 ? 85   ASP B CA  1 
ATOM   2657  C C   . ASP B 1 87  ? 8.707   2.408   38.523  1.00 198.22 ? 85   ASP B C   1 
ATOM   2658  O O   . ASP B 1 87  ? 8.126   2.293   37.442  1.00 197.54 ? 85   ASP B O   1 
ATOM   2659  C CB  . ASP B 1 87  ? 6.430   2.691   39.485  1.00 200.00 ? 85   ASP B CB  1 
ATOM   2660  C CG  . ASP B 1 87  ? 5.606   3.252   40.624  1.00 200.00 ? 85   ASP B CG  1 
ATOM   2661  O OD1 . ASP B 1 87  ? 5.589   2.634   41.709  1.00 200.00 ? 85   ASP B OD1 1 
ATOM   2662  O OD2 . ASP B 1 87  ? 4.976   4.314   40.432  1.00 200.00 ? 85   ASP B OD2 1 
ATOM   2663  N N   . ILE B 1 88  ? 10.029  2.352   38.641  1.00 141.68 ? 86   ILE B N   1 
ATOM   2664  C CA  . ILE B 1 88  ? 10.879  2.162   37.480  1.00 140.78 ? 86   ILE B CA  1 
ATOM   2665  C C   . ILE B 1 88  ? 12.123  1.335   37.777  1.00 140.58 ? 86   ILE B C   1 
ATOM   2666  O O   . ILE B 1 88  ? 12.841  1.581   38.751  1.00 140.34 ? 86   ILE B O   1 
ATOM   2667  C CB  . ILE B 1 88  ? 11.310  3.523   36.895  1.00 159.60 ? 86   ILE B CB  1 
ATOM   2668  C CG1 . ILE B 1 88  ? 10.087  4.247   36.336  1.00 158.83 ? 86   ILE B CG1 1 
ATOM   2669  C CG2 . ILE B 1 88  ? 12.352  3.326   35.803  1.00 160.42 ? 86   ILE B CG2 1 
ATOM   2670  C CD1 . ILE B 1 88  ? 10.380  5.624   35.812  1.00 158.33 ? 86   ILE B CD1 1 
ATOM   2671  N N   . GLU B 1 89  ? 12.362  0.349   36.919  1.00 130.77 ? 87   GLU B N   1 
ATOM   2672  C CA  . GLU B 1 89  ? 13.516  -0.525  37.037  1.00 130.45 ? 87   GLU B CA  1 
ATOM   2673  C C   . GLU B 1 89  ? 14.215  -0.586  35.693  1.00 129.38 ? 87   GLU B C   1 
ATOM   2674  O O   . GLU B 1 89  ? 14.314  0.412   34.979  1.00 128.88 ? 87   GLU B O   1 
ATOM   2675  C CB  . GLU B 1 89  ? 13.090  -1.933  37.438  1.00 159.90 ? 87   GLU B CB  1 
ATOM   2676  C CG  . GLU B 1 89  ? 12.433  -2.023  38.787  1.00 162.79 ? 87   GLU B CG  1 
ATOM   2677  C CD  . GLU B 1 89  ? 12.163  -3.453  39.175  1.00 164.64 ? 87   GLU B CD  1 
ATOM   2678  O OE1 . GLU B 1 89  ? 13.139  -4.214  39.342  1.00 165.98 ? 87   GLU B OE1 1 
ATOM   2679  O OE2 . GLU B 1 89  ? 10.977  -3.818  39.305  1.00 165.91 ? 87   GLU B OE2 1 
ATOM   2680  N N   . ASP B 1 90  ? 14.693  -1.773  35.349  1.00 130.26 ? 88   ASP B N   1 
ATOM   2681  C CA  . ASP B 1 90  ? 15.384  -1.969  34.090  1.00 130.52 ? 88   ASP B CA  1 
ATOM   2682  C C   . ASP B 1 90  ? 14.528  -2.863  33.206  1.00 130.76 ? 88   ASP B C   1 
ATOM   2683  O O   . ASP B 1 90  ? 14.988  -3.351  32.173  1.00 130.71 ? 88   ASP B O   1 
ATOM   2684  C CB  . ASP B 1 90  ? 16.746  -2.624  34.341  1.00 157.94 ? 88   ASP B CB  1 
ATOM   2685  C CG  . ASP B 1 90  ? 17.582  -1.866  35.362  1.00 157.85 ? 88   ASP B CG  1 
ATOM   2686  O OD1 . ASP B 1 90  ? 18.694  -2.333  35.684  1.00 157.23 ? 88   ASP B OD1 1 
ATOM   2687  O OD2 . ASP B 1 90  ? 17.129  -0.804  35.844  1.00 158.13 ? 88   ASP B OD2 1 
ATOM   2688  N N   . ARG B 1 91  ? 13.279  -3.072  33.617  1.00 177.03 ? 89   ARG B N   1 
ATOM   2689  C CA  . ARG B 1 91  ? 12.367  -3.921  32.859  1.00 177.61 ? 89   ARG B CA  1 
ATOM   2690  C C   . ARG B 1 91  ? 11.429  -3.136  31.950  1.00 177.98 ? 89   ARG B C   1 
ATOM   2691  O O   . ARG B 1 91  ? 10.440  -3.677  31.452  1.00 178.37 ? 89   ARG B O   1 
ATOM   2692  C CB  . ARG B 1 91  ? 11.553  -4.818  33.810  1.00 148.24 ? 89   ARG B CB  1 
ATOM   2693  C CG  . ARG B 1 91  ? 10.534  -4.116  34.713  1.00 147.38 ? 89   ARG B CG  1 
ATOM   2694  C CD  . ARG B 1 91  ? 9.283   -3.685  33.952  1.00 146.51 ? 89   ARG B CD  1 
ATOM   2695  N NE  . ARG B 1 91  ? 8.159   -3.393  34.837  1.00 146.26 ? 89   ARG B NE  1 
ATOM   2696  C CZ  . ARG B 1 91  ? 7.036   -2.793  34.453  1.00 145.84 ? 89   ARG B CZ  1 
ATOM   2697  N NH1 . ARG B 1 91  ? 6.881   -2.411  33.193  1.00 145.54 ? 89   ARG B NH1 1 
ATOM   2698  N NH2 . ARG B 1 91  ? 6.064   -2.580  35.329  1.00 145.93 ? 89   ARG B NH2 1 
ATOM   2699  N N   . HIS B 1 92  ? 11.744  -1.863  31.727  1.00 199.82 ? 90   HIS B N   1 
ATOM   2700  C CA  . HIS B 1 92  ? 10.916  -1.020  30.872  1.00 199.82 ? 90   HIS B CA  1 
ATOM   2701  C C   . HIS B 1 92  ? 11.594  0.286   30.451  1.00 199.20 ? 90   HIS B C   1 
ATOM   2702  O O   . HIS B 1 92  ? 12.259  0.944   31.255  1.00 199.58 ? 90   HIS B O   1 
ATOM   2703  C CB  . HIS B 1 92  ? 9.576   -0.729  31.565  1.00 142.12 ? 90   HIS B CB  1 
ATOM   2704  C CG  . HIS B 1 92  ? 9.703   -0.360  33.012  1.00 141.18 ? 90   HIS B CG  1 
ATOM   2705  N ND1 . HIS B 1 92  ? 8.613   -0.269  33.852  1.00 140.62 ? 90   HIS B ND1 1 
ATOM   2706  C CD2 . HIS B 1 92  ? 10.786  -0.057  33.768  1.00 140.79 ? 90   HIS B CD2 1 
ATOM   2707  C CE1 . HIS B 1 92  ? 9.020   0.072   35.062  1.00 140.93 ? 90   HIS B CE1 1 
ATOM   2708  N NE2 . HIS B 1 92  ? 10.333  0.207   35.038  1.00 140.46 ? 90   HIS B NE2 1 
ATOM   2709  N N   . ILE B 1 93  ? 11.424  0.639   29.177  1.00 151.65 ? 91   ILE B N   1 
ATOM   2710  C CA  . ILE B 1 93  ? 11.998  1.856   28.604  1.00 149.26 ? 91   ILE B CA  1 
ATOM   2711  C C   . ILE B 1 93  ? 10.877  2.846   28.296  1.00 147.97 ? 91   ILE B C   1 
ATOM   2712  O O   . ILE B 1 93  ? 9.772   2.445   27.925  1.00 147.77 ? 91   ILE B O   1 
ATOM   2713  C CB  . ILE B 1 93  ? 12.743  1.565   27.283  1.00 123.81 ? 91   ILE B CB  1 
ATOM   2714  C CG1 . ILE B 1 93  ? 13.752  0.432   27.483  1.00 122.91 ? 91   ILE B CG1 1 
ATOM   2715  C CG2 . ILE B 1 93  ? 13.460  2.820   26.806  1.00 123.35 ? 91   ILE B CG2 1 
ATOM   2716  C CD1 . ILE B 1 93  ? 14.410  -0.030  26.199  1.00 120.96 ? 91   ILE B CD1 1 
ATOM   2717  N N   . VAL B 1 94  ? 11.166  4.137   28.438  1.00 191.55 ? 92   VAL B N   1 
ATOM   2718  C CA  . VAL B 1 94  ? 10.164  5.166   28.181  1.00 190.15 ? 92   VAL B CA  1 
ATOM   2719  C C   . VAL B 1 94  ? 10.447  6.014   26.954  1.00 188.87 ? 92   VAL B C   1 
ATOM   2720  O O   . VAL B 1 94  ? 11.511  6.622   26.822  1.00 188.61 ? 92   VAL B O   1 
ATOM   2721  C CB  . VAL B 1 94  ? 10.010  6.127   29.371  1.00 132.60 ? 92   VAL B CB  1 
ATOM   2722  C CG1 . VAL B 1 94  ? 8.937   7.161   29.061  1.00 132.57 ? 92   VAL B CG1 1 
ATOM   2723  C CG2 . VAL B 1 94  ? 9.650   5.355   30.621  1.00 132.86 ? 92   VAL B CG2 1 
ATOM   2724  N N   . VAL B 1 95  ? 9.468   6.058   26.062  1.00 94.86  ? 93   VAL B N   1 
ATOM   2725  C CA  . VAL B 1 95  ? 9.579   6.841   24.850  1.00 92.39  ? 93   VAL B CA  1 
ATOM   2726  C C   . VAL B 1 95  ? 8.696   8.072   25.076  1.00 92.28  ? 93   VAL B C   1 
ATOM   2727  O O   . VAL B 1 95  ? 7.467   8.005   24.979  1.00 90.88  ? 93   VAL B O   1 
ATOM   2728  C CB  . VAL B 1 95  ? 9.109   6.013   23.635  1.00 107.97 ? 93   VAL B CB  1 
ATOM   2729  C CG1 . VAL B 1 95  ? 9.575   6.663   22.352  1.00 107.73 ? 93   VAL B CG1 1 
ATOM   2730  C CG2 . VAL B 1 95  ? 9.671   4.595   23.727  1.00 105.81 ? 93   VAL B CG2 1 
ATOM   2731  N N   . SER B 1 96  ? 9.344   9.188   25.404  1.00 153.02 ? 94   SER B N   1 
ATOM   2732  C CA  . SER B 1 96  ? 8.660   10.447  25.692  1.00 153.88 ? 94   SER B CA  1 
ATOM   2733  C C   . SER B 1 96  ? 8.185   11.203  24.464  1.00 153.81 ? 94   SER B C   1 
ATOM   2734  O O   . SER B 1 96  ? 8.222   12.436  24.444  1.00 153.64 ? 94   SER B O   1 
ATOM   2735  C CB  . SER B 1 96  ? 9.576   11.372  26.493  1.00 153.68 ? 94   SER B CB  1 
ATOM   2736  O OG  . SER B 1 96  ? 10.616  11.882  25.675  1.00 154.47 ? 94   SER B OG  1 
ATOM   2737  N N   . CYS B 1 97  ? 7.749   10.483  23.438  1.00 124.31 ? 95   CYS B N   1 
ATOM   2738  C CA  . CYS B 1 97  ? 7.269   11.160  22.248  1.00 124.18 ? 95   CYS B CA  1 
ATOM   2739  C C   . CYS B 1 97  ? 6.063   11.974  22.701  1.00 123.95 ? 95   CYS B C   1 
ATOM   2740  O O   . CYS B 1 97  ? 4.942   11.464  22.757  1.00 123.14 ? 95   CYS B O   1 
ATOM   2741  C CB  . CYS B 1 97  ? 6.832   10.167  21.170  1.00 184.46 ? 95   CYS B CB  1 
ATOM   2742  S SG  . CYS B 1 97  ? 7.862   8.686   20.891  1.00 185.46 ? 95   CYS B SG  1 
ATOM   2743  N N   . ALA B 1 98  ? 6.307   13.233  23.048  1.00 115.30 ? 96   ALA B N   1 
ATOM   2744  C CA  . ALA B 1 98  ? 5.250   14.124  23.500  1.00 114.97 ? 96   ALA B CA  1 
ATOM   2745  C C   . ALA B 1 98  ? 5.787   15.538  23.674  1.00 114.96 ? 96   ALA B C   1 
ATOM   2746  O O   . ALA B 1 98  ? 6.694   15.777  24.474  1.00 115.53 ? 96   ALA B O   1 
ATOM   2747  C CB  . ALA B 1 98  ? 4.666   13.616  24.809  1.00 77.80  ? 96   ALA B CB  1 
ATOM   2748  N N   . ALA B 1 99  ? 5.222   16.465  22.904  1.00 143.37 ? 97   ALA B N   1 
ATOM   2749  C CA  . ALA B 1 99  ? 5.599   17.874  22.937  1.00 142.86 ? 97   ALA B CA  1 
ATOM   2750  C C   . ALA B 1 99  ? 7.107   18.140  22.972  1.00 142.67 ? 97   ALA B C   1 
ATOM   2751  O O   . ALA B 1 99  ? 7.919   17.264  22.658  1.00 142.86 ? 97   ALA B O   1 
ATOM   2752  C CB  . ALA B 1 99  ? 4.920   18.562  24.120  1.00 81.96  ? 97   ALA B CB  1 
ATOM   2753  N N   . GLY B 1 100 ? 7.460   19.366  23.358  1.00 141.53 ? 98   GLY B N   1 
ATOM   2754  C CA  . GLY B 1 100 ? 8.851   19.779  23.427  1.00 138.26 ? 98   GLY B CA  1 
ATOM   2755  C C   . GLY B 1 100 ? 9.545   19.420  24.724  1.00 136.50 ? 98   GLY B C   1 
ATOM   2756  O O   . GLY B 1 100 ? 10.370  20.176  25.245  1.00 135.94 ? 98   GLY B O   1 
ATOM   2757  N N   . VAL B 1 101 ? 9.198   18.254  25.248  1.00 97.01  ? 99   VAL B N   1 
ATOM   2758  C CA  . VAL B 1 101 ? 9.790   17.766  26.475  1.00 95.29  ? 99   VAL B CA  1 
ATOM   2759  C C   . VAL B 1 101 ? 11.132  17.136  26.135  1.00 94.59  ? 99   VAL B C   1 
ATOM   2760  O O   . VAL B 1 101 ? 11.189  16.054  25.546  1.00 94.36  ? 99   VAL B O   1 
ATOM   2761  C CB  . VAL B 1 101 ? 8.890   16.717  27.126  1.00 106.75 ? 99   VAL B CB  1 
ATOM   2762  C CG1 . VAL B 1 101 ? 9.584   16.127  28.332  1.00 107.97 ? 99   VAL B CG1 1 
ATOM   2763  C CG2 . VAL B 1 101 ? 7.566   17.350  27.520  1.00 105.32 ? 99   VAL B CG2 1 
ATOM   2764  N N   . THR B 1 102 ? 12.205  17.827  26.510  1.00 113.58 ? 100  THR B N   1 
ATOM   2765  C CA  . THR B 1 102 ? 13.573  17.382  26.253  1.00 112.39 ? 100  THR B CA  1 
ATOM   2766  C C   . THR B 1 102 ? 13.931  16.095  26.989  1.00 112.44 ? 100  THR B C   1 
ATOM   2767  O O   . THR B 1 102 ? 13.294  15.735  27.978  1.00 111.21 ? 100  THR B O   1 
ATOM   2768  C CB  . THR B 1 102 ? 14.582  18.468  26.672  1.00 100.52 ? 100  THR B CB  1 
ATOM   2769  O OG1 . THR B 1 102 ? 14.229  19.710  26.050  1.00 100.49 ? 100  THR B OG1 1 
ATOM   2770  C CG2 . THR B 1 102 ? 15.996  18.077  26.262  1.00 99.65  ? 100  THR B CG2 1 
ATOM   2771  N N   . ILE B 1 103 ? 14.957  15.405  26.497  1.00 120.21 ? 101  ILE B N   1 
ATOM   2772  C CA  . ILE B 1 103 ? 15.410  14.169  27.116  1.00 121.32 ? 101  ILE B CA  1 
ATOM   2773  C C   . ILE B 1 103 ? 16.112  14.534  28.414  1.00 123.15 ? 101  ILE B C   1 
ATOM   2774  O O   . ILE B 1 103 ? 15.921  13.891  29.446  1.00 124.20 ? 101  ILE B O   1 
ATOM   2775  C CB  . ILE B 1 103 ? 16.388  13.390  26.190  1.00 113.37 ? 101  ILE B CB  1 
ATOM   2776  C CG1 . ILE B 1 103 ? 17.707  14.149  26.024  1.00 112.86 ? 101  ILE B CG1 1 
ATOM   2777  C CG2 . ILE B 1 103 ? 15.740  13.153  24.834  1.00 112.49 ? 101  ILE B CG2 1 
ATOM   2778  C CD1 . ILE B 1 103 ? 18.809  13.679  26.949  1.00 113.72 ? 101  ILE B CD1 1 
ATOM   2779  N N   . SER B 1 104 ? 16.921  15.585  28.352  1.00 120.47 ? 102  SER B N   1 
ATOM   2780  C CA  . SER B 1 104 ? 17.645  16.058  29.518  1.00 122.27 ? 102  SER B CA  1 
ATOM   2781  C C   . SER B 1 104 ? 16.625  16.542  30.546  1.00 123.61 ? 102  SER B C   1 
ATOM   2782  O O   . SER B 1 104 ? 16.900  16.572  31.743  1.00 123.56 ? 102  SER B O   1 
ATOM   2783  C CB  . SER B 1 104 ? 18.584  17.202  29.122  1.00 116.71 ? 102  SER B CB  1 
ATOM   2784  O OG  . SER B 1 104 ? 19.470  16.798  28.090  1.00 117.00 ? 102  SER B OG  1 
ATOM   2785  N N   . SER B 1 105 ? 15.443  16.914  30.062  1.00 159.20 ? 103  SER B N   1 
ATOM   2786  C CA  . SER B 1 105 ? 14.367  17.394  30.925  1.00 160.63 ? 103  SER B CA  1 
ATOM   2787  C C   . SER B 1 105 ? 13.870  16.264  31.822  1.00 161.16 ? 103  SER B C   1 
ATOM   2788  O O   . SER B 1 105 ? 13.443  16.494  32.955  1.00 160.94 ? 103  SER B O   1 
ATOM   2789  C CB  . SER B 1 105 ? 13.203  17.925  30.077  1.00 134.22 ? 103  SER B CB  1 
ATOM   2790  O OG  . SER B 1 105 ? 13.609  18.999  29.244  1.00 133.04 ? 103  SER B OG  1 
ATOM   2791  N N   . ILE B 1 106 ? 13.930  15.043  31.302  1.00 142.15 ? 104  ILE B N   1 
ATOM   2792  C CA  . ILE B 1 106 ? 13.483  13.865  32.036  1.00 142.27 ? 104  ILE B CA  1 
ATOM   2793  C C   . ILE B 1 106 ? 14.692  13.065  32.483  1.00 141.85 ? 104  ILE B C   1 
ATOM   2794  O O   . ILE B 1 106 ? 14.577  12.074  33.200  1.00 141.79 ? 104  ILE B O   1 
ATOM   2795  C CB  . ILE B 1 106 ? 12.597  12.964  31.150  1.00 161.88 ? 104  ILE B CB  1 
ATOM   2796  C CG1 . ILE B 1 106 ? 11.544  13.812  30.426  1.00 163.05 ? 104  ILE B CG1 1 
ATOM   2797  C CG2 . ILE B 1 106 ? 11.955  11.876  31.991  1.00 161.79 ? 104  ILE B CG2 1 
ATOM   2798  C CD1 . ILE B 1 106 ? 10.987  14.973  31.243  1.00 164.80 ? 104  ILE B CD1 1 
ATOM   2799  N N   . GLU B 1 107 ? 15.860  13.513  32.048  1.00 181.04 ? 105  GLU B N   1 
ATOM   2800  C CA  . GLU B 1 107 ? 17.100  12.846  32.387  1.00 181.42 ? 105  GLU B CA  1 
ATOM   2801  C C   . GLU B 1 107 ? 17.525  13.209  33.802  1.00 184.10 ? 105  GLU B C   1 
ATOM   2802  O O   . GLU B 1 107 ? 18.586  12.790  34.267  1.00 185.69 ? 105  GLU B O   1 
ATOM   2803  C CB  . GLU B 1 107 ? 18.183  13.264  31.405  1.00 103.80 ? 105  GLU B CB  1 
ATOM   2804  C CG  . GLU B 1 107 ? 19.104  12.149  31.038  1.00 99.30  ? 105  GLU B CG  1 
ATOM   2805  C CD  . GLU B 1 107 ? 18.366  10.993  30.399  1.00 96.77  ? 105  GLU B CD  1 
ATOM   2806  O OE1 . GLU B 1 107 ? 17.600  10.305  31.108  1.00 94.62  ? 105  GLU B OE1 1 
ATOM   2807  O OE2 . GLU B 1 107 ? 18.554  10.776  29.184  1.00 95.17  ? 105  GLU B OE2 1 
ATOM   2808  N N   . LYS B 1 108 ? 16.687  13.989  34.479  1.00 137.99 ? 106  LYS B N   1 
ATOM   2809  C CA  . LYS B 1 108 ? 16.966  14.437  35.839  1.00 139.13 ? 106  LYS B CA  1 
ATOM   2810  C C   . LYS B 1 108 ? 15.691  14.407  36.672  1.00 139.66 ? 106  LYS B C   1 
ATOM   2811  O O   . LYS B 1 108 ? 15.529  15.178  37.619  1.00 139.20 ? 106  LYS B O   1 
ATOM   2812  C CB  . LYS B 1 108 ? 17.541  15.855  35.799  1.00 165.51 ? 106  LYS B CB  1 
ATOM   2813  C CG  . LYS B 1 108 ? 18.765  15.969  34.899  1.00 166.81 ? 106  LYS B CG  1 
ATOM   2814  C CD  . LYS B 1 108 ? 18.847  17.325  34.223  1.00 168.10 ? 106  LYS B CD  1 
ATOM   2815  C CE  . LYS B 1 108 ? 19.853  17.302  33.080  1.00 168.57 ? 106  LYS B CE  1 
ATOM   2816  N NZ  . LYS B 1 108 ? 19.821  18.563  32.283  1.00 169.06 ? 106  LYS B NZ  1 
ATOM   2817  N N   . LYS B 1 109 ? 14.788  13.508  36.297  1.00 152.91 ? 107  LYS B N   1 
ATOM   2818  C CA  . LYS B 1 109 ? 13.519  13.335  36.988  1.00 154.52 ? 107  LYS B CA  1 
ATOM   2819  C C   . LYS B 1 109 ? 13.395  11.873  37.397  1.00 155.78 ? 107  LYS B C   1 
ATOM   2820  O O   . LYS B 1 109 ? 13.311  11.549  38.582  1.00 156.03 ? 107  LYS B O   1 
ATOM   2821  C CB  . LYS B 1 109 ? 12.357  13.714  36.065  1.00 136.88 ? 107  LYS B CB  1 
ATOM   2822  C CG  . LYS B 1 109 ? 12.298  15.191  35.711  1.00 135.02 ? 107  LYS B CG  1 
ATOM   2823  C CD  . LYS B 1 109 ? 11.031  15.836  36.258  1.00 132.75 ? 107  LYS B CD  1 
ATOM   2824  C CE  . LYS B 1 109 ? 10.954  15.722  37.774  1.00 132.04 ? 107  LYS B CE  1 
ATOM   2825  N NZ  . LYS B 1 109 ? 9.697   16.306  38.316  1.00 131.99 ? 107  LYS B NZ  1 
ATOM   2826  N N   . LEU B 1 110 ? 13.389  10.994  36.399  1.00 144.50 ? 108  LEU B N   1 
ATOM   2827  C CA  . LEU B 1 110 ? 13.289  9.562   36.634  1.00 145.26 ? 108  LEU B CA  1 
ATOM   2828  C C   . LEU B 1 110 ? 14.688  8.981   36.768  1.00 145.97 ? 108  LEU B C   1 
ATOM   2829  O O   . LEU B 1 110 ? 14.860  7.783   37.007  1.00 145.67 ? 108  LEU B O   1 
ATOM   2830  C CB  . LEU B 1 110 ? 12.538  8.889   35.486  1.00 133.58 ? 108  LEU B CB  1 
ATOM   2831  C CG  . LEU B 1 110 ? 11.116  9.414   35.272  1.00 133.26 ? 108  LEU B CG  1 
ATOM   2832  C CD1 . LEU B 1 110 ? 10.431  8.620   34.179  1.00 133.51 ? 108  LEU B CD1 1 
ATOM   2833  C CD2 . LEU B 1 110 ? 10.335  9.306   36.565  1.00 132.49 ? 108  LEU B CD2 1 
ATOM   2834  N N   . SER B 1 111 ? 15.684  9.844   36.590  1.00 187.52 ? 109  SER B N   1 
ATOM   2835  C CA  . SER B 1 111 ? 17.078  9.452   36.735  1.00 188.25 ? 109  SER B CA  1 
ATOM   2836  C C   . SER B 1 111 ? 17.459  9.852   38.155  1.00 188.32 ? 109  SER B C   1 
ATOM   2837  O O   . SER B 1 111 ? 18.635  9.914   38.514  1.00 189.17 ? 109  SER B O   1 
ATOM   2838  C CB  . SER B 1 111 ? 17.964  10.171  35.713  1.00 116.62 ? 109  SER B CB  1 
ATOM   2839  O OG  . SER B 1 111 ? 17.777  9.642   34.409  1.00 116.40 ? 109  SER B OG  1 
ATOM   2840  N N   . ALA B 1 112 ? 16.427  10.134  38.946  1.00 135.22 ? 110  ALA B N   1 
ATOM   2841  C CA  . ALA B 1 112 ? 16.563  10.508  40.349  1.00 133.31 ? 110  ALA B CA  1 
ATOM   2842  C C   . ALA B 1 112 ? 15.828  9.425   41.136  1.00 132.40 ? 110  ALA B C   1 
ATOM   2843  O O   . ALA B 1 112 ? 16.200  9.089   42.260  1.00 132.03 ? 110  ALA B O   1 
ATOM   2844  C CB  . ALA B 1 112 ? 15.922  11.873  40.597  1.00 94.69  ? 110  ALA B CB  1 
ATOM   2845  N N   . PHE B 1 113 ? 14.782  8.885   40.513  1.00 136.18 ? 111  PHE B N   1 
ATOM   2846  C CA  . PHE B 1 113 ? 13.953  7.826   41.088  1.00 135.51 ? 111  PHE B CA  1 
ATOM   2847  C C   . PHE B 1 113 ? 14.518  6.463   40.680  1.00 136.01 ? 111  PHE B C   1 
ATOM   2848  O O   . PHE B 1 113 ? 13.822  5.445   40.726  1.00 135.24 ? 111  PHE B O   1 
ATOM   2849  C CB  . PHE B 1 113 ? 12.521  7.943   40.562  1.00 133.10 ? 111  PHE B CB  1 
ATOM   2850  C CG  . PHE B 1 113 ? 11.747  9.111   41.115  1.00 132.14 ? 111  PHE B CG  1 
ATOM   2851  C CD1 . PHE B 1 113 ? 12.297  10.390  41.145  1.00 132.35 ? 111  PHE B CD1 1 
ATOM   2852  C CD2 . PHE B 1 113 ? 10.447  8.932   41.578  1.00 131.03 ? 111  PHE B CD2 1 
ATOM   2853  C CE1 . PHE B 1 113 ? 11.561  11.474  41.629  1.00 131.72 ? 111  PHE B CE1 1 
ATOM   2854  C CE2 . PHE B 1 113 ? 9.703   10.004  42.061  1.00 130.63 ? 111  PHE B CE2 1 
ATOM   2855  C CZ  . PHE B 1 113 ? 10.260  11.278  42.087  1.00 131.16 ? 111  PHE B CZ  1 
ATOM   2856  N N   . ARG B 1 114 ? 15.785  6.461   40.278  1.00 142.41 ? 112  ARG B N   1 
ATOM   2857  C CA  . ARG B 1 114 ? 16.471  5.253   39.830  1.00 143.06 ? 112  ARG B CA  1 
ATOM   2858  C C   . ARG B 1 114 ? 17.844  5.725   39.352  1.00 142.29 ? 112  ARG B C   1 
ATOM   2859  O O   . ARG B 1 114 ? 17.998  6.885   38.973  1.00 141.78 ? 112  ARG B O   1 
ATOM   2860  C CB  . ARG B 1 114 ? 15.694  4.626   38.664  1.00 172.56 ? 112  ARG B CB  1 
ATOM   2861  C CG  . ARG B 1 114 ? 16.222  3.291   38.166  1.00 174.12 ? 112  ARG B CG  1 
ATOM   2862  C CD  . ARG B 1 114 ? 15.945  2.174   39.156  1.00 174.52 ? 112  ARG B CD  1 
ATOM   2863  N NE  . ARG B 1 114 ? 16.492  0.902   38.695  1.00 174.84 ? 112  ARG B NE  1 
ATOM   2864  C CZ  . ARG B 1 114 ? 16.308  -0.259  39.314  1.00 174.75 ? 112  ARG B CZ  1 
ATOM   2865  N NH1 . ARG B 1 114 ? 15.587  -0.312  40.425  1.00 174.56 ? 112  ARG B NH1 1 
ATOM   2866  N NH2 . ARG B 1 114 ? 16.843  -1.367  38.821  1.00 174.93 ? 112  ARG B NH2 1 
ATOM   2867  N N   . PRO B 1 115 ? 18.862  4.848   39.380  1.00 152.86 ? 113  PRO B N   1 
ATOM   2868  C CA  . PRO B 1 115 ? 20.185  5.280   38.923  1.00 152.75 ? 113  PRO B CA  1 
ATOM   2869  C C   . PRO B 1 115 ? 20.108  6.100   37.633  1.00 153.06 ? 113  PRO B C   1 
ATOM   2870  O O   . PRO B 1 115 ? 20.002  7.326   37.673  1.00 152.69 ? 113  PRO B O   1 
ATOM   2871  C CB  . PRO B 1 115 ? 20.923  3.960   38.746  1.00 148.69 ? 113  PRO B CB  1 
ATOM   2872  C CG  . PRO B 1 115 ? 20.399  3.162   39.897  1.00 148.36 ? 113  PRO B CG  1 
ATOM   2873  C CD  . PRO B 1 115 ? 18.906  3.452   39.856  1.00 148.83 ? 113  PRO B CD  1 
ATOM   2874  N N   . ALA B 1 116 ? 20.159  5.421   36.493  1.00 146.16 ? 114  ALA B N   1 
ATOM   2875  C CA  . ALA B 1 116 ? 20.081  6.097   35.203  1.00 147.07 ? 114  ALA B CA  1 
ATOM   2876  C C   . ALA B 1 116 ? 19.195  5.286   34.274  1.00 147.25 ? 114  ALA B C   1 
ATOM   2877  O O   . ALA B 1 116 ? 19.646  4.341   33.629  1.00 147.39 ? 114  ALA B O   1 
ATOM   2878  C CB  . ALA B 1 116 ? 21.466  6.255   34.600  1.00 161.99 ? 114  ALA B CB  1 
ATOM   2879  N N   . PRO B 1 117 ? 17.911  5.647   34.202  1.00 160.98 ? 115  PRO B N   1 
ATOM   2880  C CA  . PRO B 1 117 ? 16.935  4.962   33.354  1.00 161.17 ? 115  PRO B CA  1 
ATOM   2881  C C   . PRO B 1 117 ? 17.235  5.077   31.859  1.00 161.54 ? 115  PRO B C   1 
ATOM   2882  O O   . PRO B 1 117 ? 18.208  5.718   31.455  1.00 161.01 ? 115  PRO B O   1 
ATOM   2883  C CB  . PRO B 1 117 ? 15.621  5.634   33.743  1.00 102.04 ? 115  PRO B CB  1 
ATOM   2884  C CG  . PRO B 1 117 ? 16.058  7.028   34.092  1.00 101.25 ? 115  PRO B CG  1 
ATOM   2885  C CD  . PRO B 1 117 ? 17.286  6.771   34.919  1.00 101.69 ? 115  PRO B CD  1 
ATOM   2886  N N   . ARG B 1 118 ? 16.393  4.438   31.051  1.00 182.33 ? 116  ARG B N   1 
ATOM   2887  C CA  . ARG B 1 118 ? 16.528  4.455   29.597  1.00 182.05 ? 116  ARG B CA  1 
ATOM   2888  C C   . ARG B 1 118 ? 15.496  5.416   29.012  1.00 181.57 ? 116  ARG B C   1 
ATOM   2889  O O   . ARG B 1 118 ? 14.371  5.012   28.720  1.00 181.61 ? 116  ARG B O   1 
ATOM   2890  C CB  . ARG B 1 118 ? 16.285  3.059   29.023  1.00 151.22 ? 116  ARG B CB  1 
ATOM   2891  C CG  . ARG B 1 118 ? 17.271  2.002   29.471  1.00 152.31 ? 116  ARG B CG  1 
ATOM   2892  C CD  . ARG B 1 118 ? 16.878  0.645   28.913  1.00 153.77 ? 116  ARG B CD  1 
ATOM   2893  N NE  . ARG B 1 118 ? 17.832  -0.401  29.268  1.00 154.40 ? 116  ARG B NE  1 
ATOM   2894  C CZ  . ARG B 1 118 ? 17.674  -1.688  28.973  1.00 155.27 ? 116  ARG B CZ  1 
ATOM   2895  N NH1 . ARG B 1 118 ? 16.596  -2.094  28.316  1.00 155.73 ? 116  ARG B NH1 1 
ATOM   2896  N NH2 . ARG B 1 118 ? 18.596  -2.570  29.333  1.00 155.62 ? 116  ARG B NH2 1 
ATOM   2897  N N   . VAL B 1 119 ? 15.878  6.679   28.839  1.00 173.45 ? 117  VAL B N   1 
ATOM   2898  C CA  . VAL B 1 119 ? 14.967  7.689   28.298  1.00 171.35 ? 117  VAL B CA  1 
ATOM   2899  C C   . VAL B 1 119 ? 15.142  7.881   26.792  1.00 170.37 ? 117  VAL B C   1 
ATOM   2900  O O   . VAL B 1 119 ? 16.259  8.073   26.309  1.00 169.99 ? 117  VAL B O   1 
ATOM   2901  C CB  . VAL B 1 119 ? 15.173  9.055   28.993  1.00 126.45 ? 117  VAL B CB  1 
ATOM   2902  C CG1 . VAL B 1 119 ? 14.127  10.047  28.511  1.00 125.48 ? 117  VAL B CG1 1 
ATOM   2903  C CG2 . VAL B 1 119 ? 15.095  8.890   30.500  1.00 126.06 ? 117  VAL B CG2 1 
ATOM   2904  N N   . ILE B 1 120 ? 14.032  7.832   26.058  1.00 166.38 ? 118  ILE B N   1 
ATOM   2905  C CA  . ILE B 1 120 ? 14.055  7.998   24.605  1.00 165.27 ? 118  ILE B CA  1 
ATOM   2906  C C   . ILE B 1 120 ? 12.958  8.937   24.110  1.00 163.18 ? 118  ILE B C   1 
ATOM   2907  O O   . ILE B 1 120 ? 11.779  8.585   24.125  1.00 162.85 ? 118  ILE B O   1 
ATOM   2908  C CB  . ILE B 1 120 ? 13.892  6.636   23.881  1.00 177.68 ? 118  ILE B CB  1 
ATOM   2909  C CG1 . ILE B 1 120 ? 15.115  5.752   24.140  1.00 177.83 ? 118  ILE B CG1 1 
ATOM   2910  C CG2 . ILE B 1 120 ? 13.714  6.855   22.383  1.00 177.82 ? 118  ILE B CG2 1 
ATOM   2911  C CD1 . ILE B 1 120 ? 16.414  6.313   23.585  1.00 177.83 ? 118  ILE B CD1 1 
ATOM   2912  N N   . ARG B 1 121 ? 13.347  10.131  23.669  1.00 162.85 ? 119  ARG B N   1 
ATOM   2913  C CA  . ARG B 1 121 ? 12.377  11.091  23.159  1.00 158.44 ? 119  ARG B CA  1 
ATOM   2914  C C   . ARG B 1 121 ? 12.159  10.797  21.684  1.00 156.45 ? 119  ARG B C   1 
ATOM   2915  O O   . ARG B 1 121 ? 12.994  10.157  21.043  1.00 155.91 ? 119  ARG B O   1 
ATOM   2916  C CB  . ARG B 1 121 ? 12.883  12.523  23.320  1.00 102.83 ? 119  ARG B CB  1 
ATOM   2917  C CG  . ARG B 1 121 ? 11.817  13.570  23.047  1.00 99.69  ? 119  ARG B CG  1 
ATOM   2918  C CD  . ARG B 1 121 ? 12.426  14.948  22.940  1.00 97.86  ? 119  ARG B CD  1 
ATOM   2919  N NE  . ARG B 1 121 ? 11.498  15.930  22.393  1.00 95.93  ? 119  ARG B NE  1 
ATOM   2920  C CZ  . ARG B 1 121 ? 11.806  17.203  22.173  1.00 94.88  ? 119  ARG B CZ  1 
ATOM   2921  N NH1 . ARG B 1 121 ? 13.021  17.653  22.456  1.00 93.07  ? 119  ARG B NH1 1 
ATOM   2922  N NH2 . ARG B 1 121 ? 10.900  18.027  21.666  1.00 93.74  ? 119  ARG B NH2 1 
ATOM   2923  N N   . CYS B 1 122 ? 11.040  11.269  21.145  1.00 92.85  ? 120  CYS B N   1 
ATOM   2924  C CA  . CYS B 1 122 ? 10.739  11.026  19.745  1.00 89.89  ? 120  CYS B CA  1 
ATOM   2925  C C   . CYS B 1 122 ? 9.553   11.839  19.235  1.00 86.29  ? 120  CYS B C   1 
ATOM   2926  O O   . CYS B 1 122 ? 8.627   12.152  19.983  1.00 85.92  ? 120  CYS B O   1 
ATOM   2927  C CB  . CYS B 1 122 ? 10.500  9.531   19.544  1.00 146.65 ? 120  CYS B CB  1 
ATOM   2928  S SG  . CYS B 1 122 ? 8.816   8.984   19.117  1.00 153.68 ? 120  CYS B SG  1 
ATOM   2929  N N   . MET B 1 123 ? 9.604   12.197  17.956  1.00 99.80  ? 121  MET B N   1 
ATOM   2930  C CA  . MET B 1 123 ? 8.550   12.982  17.325  1.00 95.10  ? 121  MET B CA  1 
ATOM   2931  C C   . MET B 1 123 ? 7.852   12.142  16.273  1.00 91.16  ? 121  MET B C   1 
ATOM   2932  O O   . MET B 1 123 ? 8.480   11.318  15.610  1.00 89.56  ? 121  MET B O   1 
ATOM   2933  C CB  . MET B 1 123 ? 9.151   14.239  16.681  1.00 125.10 ? 121  MET B CB  1 
ATOM   2934  C CG  . MET B 1 123 ? 8.252   14.956  15.675  1.00 126.02 ? 121  MET B CG  1 
ATOM   2935  S SD  . MET B 1 123 ? 6.605   15.314  16.302  1.00 126.75 ? 121  MET B SD  1 
ATOM   2936  C CE  . MET B 1 123 ? 6.994   16.343  17.692  1.00 127.59 ? 121  MET B CE  1 
ATOM   2937  N N   . THR B 1 124 ? 6.548   12.347  16.130  1.00 105.34 ? 122  THR B N   1 
ATOM   2938  C CA  . THR B 1 124 ? 5.773   11.606  15.147  1.00 101.48 ? 122  THR B CA  1 
ATOM   2939  C C   . THR B 1 124 ? 4.614   12.461  14.666  1.00 98.68  ? 122  THR B C   1 
ATOM   2940  O O   . THR B 1 124 ? 4.693   13.689  14.648  1.00 99.69  ? 122  THR B O   1 
ATOM   2941  C CB  . THR B 1 124 ? 5.171   10.344  15.746  1.00 91.94  ? 122  THR B CB  1 
ATOM   2942  O OG1 . THR B 1 124 ? 3.976   10.695  16.453  1.00 92.89  ? 122  THR B OG1 1 
ATOM   2943  C CG2 . THR B 1 124 ? 6.140   9.696   16.716  1.00 92.07  ? 122  THR B CG2 1 
ATOM   2944  N N   . ASN B 1 125 ? 3.529   11.794  14.290  1.00 74.11  ? 123  ASN B N   1 
ATOM   2945  C CA  . ASN B 1 125 ? 2.341   12.477  13.813  1.00 69.22  ? 123  ASN B CA  1 
ATOM   2946  C C   . ASN B 1 125 ? 1.103   11.635  13.971  1.00 67.09  ? 123  ASN B C   1 
ATOM   2947  O O   . ASN B 1 125 ? 1.133   10.562  14.563  1.00 65.34  ? 123  ASN B O   1 
ATOM   2948  C CB  . ASN B 1 125 ? 2.494   12.826  12.349  1.00 67.84  ? 123  ASN B CB  1 
ATOM   2949  C CG  . ASN B 1 125 ? 3.460   11.929  11.652  1.00 67.25  ? 123  ASN B CG  1 
ATOM   2950  O OD1 . ASN B 1 125 ? 3.478   10.725  11.885  1.00 69.25  ? 123  ASN B OD1 1 
ATOM   2951  N ND2 . ASN B 1 125 ? 4.277   12.504  10.788  1.00 67.56  ? 123  ASN B ND2 1 
ATOM   2952  N N   . THR B 1 126 ? 0.011   12.138  13.416  1.00 61.72  ? 124  THR B N   1 
ATOM   2953  C CA  . THR B 1 126 ? -1.259  11.447  13.479  1.00 62.78  ? 124  THR B CA  1 
ATOM   2954  C C   . THR B 1 126 ? -1.356  10.319  12.458  1.00 63.93  ? 124  THR B C   1 
ATOM   2955  O O   . THR B 1 126 ? -1.823  9.233   12.790  1.00 64.06  ? 124  THR B O   1 
ATOM   2956  C CB  . THR B 1 126 ? -2.426  12.407  13.239  1.00 62.51  ? 124  THR B CB  1 
ATOM   2957  O OG1 . THR B 1 126 ? -2.110  13.695  13.784  1.00 63.69  ? 124  THR B OG1 1 
ATOM   2958  C CG2 . THR B 1 126 ? -3.680  11.876  13.916  1.00 62.23  ? 124  THR B CG2 1 
ATOM   2959  N N   . PRO B 1 127 ? -0.906  10.552  11.206  1.00 77.75  ? 125  PRO B N   1 
ATOM   2960  C CA  . PRO B 1 127 ? -0.962  9.529   10.151  1.00 78.50  ? 125  PRO B CA  1 
ATOM   2961  C C   . PRO B 1 127 ? -0.452  8.146   10.560  1.00 79.21  ? 125  PRO B C   1 
ATOM   2962  O O   . PRO B 1 127 ? -0.601  7.165   9.821   1.00 79.01  ? 125  PRO B O   1 
ATOM   2963  C CB  . PRO B 1 127 ? -0.141  10.152  9.019   1.00 84.44  ? 125  PRO B CB  1 
ATOM   2964  C CG  . PRO B 1 127 ? 0.790   11.088  9.733   1.00 84.30  ? 125  PRO B CG  1 
ATOM   2965  C CD  . PRO B 1 127 ? -0.121  11.711  10.749  1.00 85.10  ? 125  PRO B CD  1 
ATOM   2966  N N   . VAL B 1 128 ? 0.157   8.077   11.737  1.00 65.66  ? 126  VAL B N   1 
ATOM   2967  C CA  . VAL B 1 128 ? 0.659   6.819   12.253  1.00 66.25  ? 126  VAL B CA  1 
ATOM   2968  C C   . VAL B 1 128 ? -0.565  5.939   12.421  1.00 67.18  ? 126  VAL B C   1 
ATOM   2969  O O   . VAL B 1 128 ? -0.500  4.717   12.287  1.00 66.70  ? 126  VAL B O   1 
ATOM   2970  C CB  . VAL B 1 128 ? 1.352   7.014   13.606  1.00 68.03  ? 126  VAL B CB  1 
ATOM   2971  C CG1 . VAL B 1 128 ? 1.923   5.697   14.083  1.00 67.71  ? 126  VAL B CG1 1 
ATOM   2972  C CG2 . VAL B 1 128 ? 2.456   8.060   13.474  1.00 66.98  ? 126  VAL B CG2 1 
ATOM   2973  N N   . VAL B 1 129 ? -1.689  6.591   12.702  1.00 91.55  ? 127  VAL B N   1 
ATOM   2974  C CA  . VAL B 1 129 ? -2.960  5.908   12.876  1.00 92.47  ? 127  VAL B CA  1 
ATOM   2975  C C   . VAL B 1 129 ? -3.198  5.052   11.646  1.00 91.59  ? 127  VAL B C   1 
ATOM   2976  O O   . VAL B 1 129 ? -3.983  4.109   11.671  1.00 92.53  ? 127  VAL B O   1 
ATOM   2977  C CB  . VAL B 1 129 ? -4.129  6.908   13.013  1.00 113.97 ? 127  VAL B CB  1 
ATOM   2978  C CG1 . VAL B 1 129 ? -5.437  6.156   13.171  1.00 114.22 ? 127  VAL B CG1 1 
ATOM   2979  C CG2 . VAL B 1 129 ? -3.903  7.821   14.207  1.00 114.49 ? 127  VAL B CG2 1 
ATOM   2980  N N   . VAL B 1 130 ? -2.520  5.395   10.560  1.00 83.22  ? 128  VAL B N   1 
ATOM   2981  C CA  . VAL B 1 130 ? -2.659  4.627   9.344   1.00 83.46  ? 128  VAL B CA  1 
ATOM   2982  C C   . VAL B 1 130 ? -1.455  3.732   9.173   1.00 85.04  ? 128  VAL B C   1 
ATOM   2983  O O   . VAL B 1 130 ? -1.460  2.598   9.627   1.00 87.29  ? 128  VAL B O   1 
ATOM   2984  C CB  . VAL B 1 130 ? -2.781  5.512   8.116   1.00 63.85  ? 128  VAL B CB  1 
ATOM   2985  C CG1 . VAL B 1 130 ? -2.646  4.666   6.886   1.00 62.90  ? 128  VAL B CG1 1 
ATOM   2986  C CG2 . VAL B 1 130 ? -4.126  6.203   8.110   1.00 63.21  ? 128  VAL B CG2 1 
ATOM   2987  N N   . ARG B 1 131 ? -0.419  4.248   8.531   1.00 55.59  ? 129  ARG B N   1 
ATOM   2988  C CA  . ARG B 1 131 ? 0.787   3.473   8.298   1.00 59.16  ? 129  ARG B CA  1 
ATOM   2989  C C   . ARG B 1 131 ? 1.730   4.415   7.594   1.00 58.08  ? 129  ARG B C   1 
ATOM   2990  O O   . ARG B 1 131 ? 2.819   4.032   7.164   1.00 58.39  ? 129  ARG B O   1 
ATOM   2991  C CB  . ARG B 1 131 ? 0.478   2.293   7.387   1.00 167.89 ? 129  ARG B CB  1 
ATOM   2992  C CG  . ARG B 1 131 ? 1.615   1.321   7.220   1.00 178.53 ? 129  ARG B CG  1 
ATOM   2993  C CD  . ARG B 1 131 ? 1.222   0.256   6.229   1.00 186.43 ? 129  ARG B CD  1 
ATOM   2994  N NE  . ARG B 1 131 ? 2.236   -0.780  6.092   1.00 195.00 ? 129  ARG B NE  1 
ATOM   2995  C CZ  . ARG B 1 131 ? 2.177   -1.752  5.190   1.00 199.11 ? 129  ARG B CZ  1 
ATOM   2996  N NH1 . ARG B 1 131 ? 1.152   -1.811  4.351   1.00 200.00 ? 129  ARG B NH1 1 
ATOM   2997  N NH2 . ARG B 1 131 ? 3.137   -2.664  5.125   1.00 200.00 ? 129  ARG B NH2 1 
ATOM   2998  N N   . GLU B 1 132 ? 1.290   5.663   7.495   1.00 85.05  ? 130  GLU B N   1 
ATOM   2999  C CA  . GLU B 1 132 ? 2.050   6.697   6.818   1.00 84.09  ? 130  GLU B CA  1 
ATOM   3000  C C   . GLU B 1 132 ? 2.626   7.740   7.760   1.00 83.34  ? 130  GLU B C   1 
ATOM   3001  O O   . GLU B 1 132 ? 3.311   8.663   7.333   1.00 84.01  ? 130  GLU B O   1 
ATOM   3002  C CB  . GLU B 1 132 ? 1.158   7.363   5.772   1.00 81.75  ? 130  GLU B CB  1 
ATOM   3003  C CG  . GLU B 1 132 ? 0.434   6.360   4.884   1.00 80.80  ? 130  GLU B CG  1 
ATOM   3004  C CD  . GLU B 1 132 ? 1.376   5.359   4.230   1.00 79.40  ? 130  GLU B CD  1 
ATOM   3005  O OE1 . GLU B 1 132 ? 0.889   4.401   3.589   1.00 76.74  ? 130  GLU B OE1 1 
ATOM   3006  O OE2 . GLU B 1 132 ? 2.606   5.531   4.356   1.00 78.12  ? 130  GLU B OE2 1 
ATOM   3007  N N   . GLY B 1 133 ? 2.346   7.604   9.047   1.00 66.71  ? 131  GLY B N   1 
ATOM   3008  C CA  . GLY B 1 133 ? 2.888   8.563   9.987   1.00 65.16  ? 131  GLY B CA  1 
ATOM   3009  C C   . GLY B 1 133 ? 4.385   8.648   9.778   1.00 64.89  ? 131  GLY B C   1 
ATOM   3010  O O   . GLY B 1 133 ? 4.986   7.712   9.268   1.00 65.07  ? 131  GLY B O   1 
ATOM   3011  N N   . ALA B 1 134 ? 4.988   9.772   10.144  1.00 77.33  ? 132  ALA B N   1 
ATOM   3012  C CA  . ALA B 1 134 ? 6.428   9.940   9.998   1.00 78.24  ? 132  ALA B CA  1 
ATOM   3013  C C   . ALA B 1 134 ? 6.982   10.316  11.350  1.00 78.45  ? 132  ALA B C   1 
ATOM   3014  O O   . ALA B 1 134 ? 6.515   11.272  11.973  1.00 78.59  ? 132  ALA B O   1 
ATOM   3015  C CB  . ALA B 1 134 ? 6.736   11.024  8.993   1.00 90.64  ? 132  ALA B CB  1 
ATOM   3016  N N   . THR B 1 135 ? 7.978   9.570   11.811  1.00 71.09  ? 133  THR B N   1 
ATOM   3017  C CA  . THR B 1 135 ? 8.540   9.854   13.119  1.00 71.49  ? 133  THR B CA  1 
ATOM   3018  C C   . THR B 1 135 ? 10.037  9.627   13.248  1.00 73.38  ? 133  THR B C   1 
ATOM   3019  O O   . THR B 1 135 ? 10.655  8.935   12.437  1.00 71.86  ? 133  THR B O   1 
ATOM   3020  C CB  . THR B 1 135 ? 7.832   9.035   14.202  1.00 75.01  ? 133  THR B CB  1 
ATOM   3021  O OG1 . THR B 1 135 ? 8.784   8.191   14.849  1.00 75.49  ? 133  THR B OG1 1 
ATOM   3022  C CG2 . THR B 1 135 ? 6.727   8.184   13.601  1.00 73.71  ? 133  THR B CG2 1 
ATOM   3023  N N   . VAL B 1 136 ? 10.607  10.222  14.291  1.00 94.49  ? 134  VAL B N   1 
ATOM   3024  C CA  . VAL B 1 136 ? 12.030  10.117  14.560  1.00 98.89  ? 134  VAL B CA  1 
ATOM   3025  C C   . VAL B 1 136 ? 12.271  9.958   16.059  1.00 103.26 ? 134  VAL B C   1 
ATOM   3026  O O   . VAL B 1 136 ? 11.446  10.367  16.875  1.00 103.61 ? 134  VAL B O   1 
ATOM   3027  C CB  . VAL B 1 136 ? 12.760  11.365  14.052  1.00 73.79  ? 134  VAL B CB  1 
ATOM   3028  C CG1 . VAL B 1 136 ? 14.253  11.184  14.189  1.00 75.86  ? 134  VAL B CG1 1 
ATOM   3029  C CG2 . VAL B 1 136 ? 12.393  11.616  12.608  1.00 72.85  ? 134  VAL B CG2 1 
ATOM   3030  N N   . TYR B 1 137 ? 13.409  9.369   16.413  1.00 143.06 ? 135  TYR B N   1 
ATOM   3031  C CA  . TYR B 1 137 ? 13.759  9.129   17.811  1.00 148.07 ? 135  TYR B CA  1 
ATOM   3032  C C   . TYR B 1 137 ? 15.173  9.607   18.159  1.00 150.84 ? 135  TYR B C   1 
ATOM   3033  O O   . TYR B 1 137 ? 16.013  9.789   17.274  1.00 150.93 ? 135  TYR B O   1 
ATOM   3034  C CB  . TYR B 1 137 ? 13.613  7.632   18.106  1.00 134.65 ? 135  TYR B CB  1 
ATOM   3035  C CG  . TYR B 1 137 ? 14.309  6.739   17.092  1.00 135.74 ? 135  TYR B CG  1 
ATOM   3036  C CD1 . TYR B 1 137 ? 15.676  6.483   17.179  1.00 136.45 ? 135  TYR B CD1 1 
ATOM   3037  C CD2 . TYR B 1 137 ? 13.603  6.174   16.028  1.00 136.21 ? 135  TYR B CD2 1 
ATOM   3038  C CE1 . TYR B 1 137 ? 16.325  5.686   16.231  1.00 136.28 ? 135  TYR B CE1 1 
ATOM   3039  C CE2 . TYR B 1 137 ? 14.246  5.379   15.072  1.00 136.01 ? 135  TYR B CE2 1 
ATOM   3040  C CZ  . TYR B 1 137 ? 15.607  5.141   15.182  1.00 135.77 ? 135  TYR B CZ  1 
ATOM   3041  O OH  . TYR B 1 137 ? 16.256  4.370   14.242  1.00 133.35 ? 135  TYR B OH  1 
ATOM   3042  N N   . ALA B 1 138 ? 15.428  9.814   19.451  1.00 157.48 ? 136  ALA B N   1 
ATOM   3043  C CA  . ALA B 1 138 ? 16.739  10.269  19.918  1.00 160.53 ? 136  ALA B CA  1 
ATOM   3044  C C   . ALA B 1 138 ? 17.226  9.450   21.115  1.00 162.94 ? 136  ALA B C   1 
ATOM   3045  O O   . ALA B 1 138 ? 16.424  8.999   21.931  1.00 163.47 ? 136  ALA B O   1 
ATOM   3046  C CB  . ALA B 1 138 ? 16.675  11.742  20.289  1.00 96.75  ? 136  ALA B CB  1 
ATOM   3047  N N   . THR B 1 139 ? 18.544  9.275   21.213  1.00 152.25 ? 137  THR B N   1 
ATOM   3048  C CA  . THR B 1 139 ? 19.173  8.507   22.293  1.00 153.39 ? 137  THR B CA  1 
ATOM   3049  C C   . THR B 1 139 ? 18.851  9.066   23.681  1.00 156.41 ? 137  THR B C   1 
ATOM   3050  O O   . THR B 1 139 ? 17.696  9.069   24.104  1.00 157.02 ? 137  THR B O   1 
ATOM   3051  C CB  . THR B 1 139 ? 20.712  8.481   22.134  1.00 113.14 ? 137  THR B CB  1 
ATOM   3052  O OG1 . THR B 1 139 ? 21.054  8.183   20.776  1.00 111.56 ? 137  THR B OG1 1 
ATOM   3053  C CG2 . THR B 1 139 ? 21.321  7.422   23.040  1.00 112.14 ? 137  THR B CG2 1 
ATOM   3054  N N   . GLY B 1 140 ? 19.880  9.526   24.391  1.00 153.66 ? 138  GLY B N   1 
ATOM   3055  C CA  . GLY B 1 140 ? 19.684  10.087  25.718  1.00 156.33 ? 138  GLY B CA  1 
ATOM   3056  C C   . GLY B 1 140 ? 20.165  9.221   26.870  1.00 158.52 ? 138  GLY B C   1 
ATOM   3057  O O   . GLY B 1 140 ? 19.546  8.209   27.203  1.00 159.12 ? 138  GLY B O   1 
ATOM   3058  N N   . THR B 1 141 ? 21.266  9.640   27.492  1.00 165.17 ? 139  THR B N   1 
ATOM   3059  C CA  . THR B 1 141 ? 21.871  8.916   28.608  1.00 166.60 ? 139  THR B CA  1 
ATOM   3060  C C   . THR B 1 141 ? 22.109  7.473   28.189  1.00 167.76 ? 139  THR B C   1 
ATOM   3061  O O   . THR B 1 141 ? 22.150  6.555   29.008  1.00 168.07 ? 139  THR B O   1 
ATOM   3062  C CB  . THR B 1 141 ? 20.983  8.996   29.871  1.00 135.20 ? 139  THR B CB  1 
ATOM   3063  O OG1 . THR B 1 141 ? 20.786  10.373  30.194  1.00 134.44 ? 139  THR B OG1 1 
ATOM   3064  C CG2 . THR B 1 141 ? 21.656  8.334   31.072  1.00 134.65 ? 139  THR B CG2 1 
ATOM   3065  N N   . HIS B 1 142 ? 22.263  7.305   26.879  1.00 142.75 ? 140  HIS B N   1 
ATOM   3066  C CA  . HIS B 1 142 ? 22.529  6.021   26.248  1.00 143.72 ? 140  HIS B CA  1 
ATOM   3067  C C   . HIS B 1 142 ? 21.557  4.894   26.599  1.00 143.44 ? 140  HIS B C   1 
ATOM   3068  O O   . HIS B 1 142 ? 20.705  5.022   27.484  1.00 142.78 ? 140  HIS B O   1 
ATOM   3069  C CB  . HIS B 1 142 ? 23.960  5.582   26.571  1.00 173.94 ? 140  HIS B CB  1 
ATOM   3070  C CG  . HIS B 1 142 ? 24.663  4.917   25.429  1.00 174.47 ? 140  HIS B CG  1 
ATOM   3071  N ND1 . HIS B 1 142 ? 24.927  5.563   24.241  1.00 174.68 ? 140  HIS B ND1 1 
ATOM   3072  C CD2 . HIS B 1 142 ? 25.184  3.673   25.306  1.00 174.47 ? 140  HIS B CD2 1 
ATOM   3073  C CE1 . HIS B 1 142 ? 25.583  4.747   23.436  1.00 175.20 ? 140  HIS B CE1 1 
ATOM   3074  N NE2 . HIS B 1 142 ? 25.752  3.594   24.058  1.00 175.39 ? 140  HIS B NE2 1 
ATOM   3075  N N   . ALA B 1 143 ? 21.717  3.789   25.876  1.00 173.24 ? 141  ALA B N   1 
ATOM   3076  C CA  . ALA B 1 143 ? 20.915  2.574   26.011  1.00 171.43 ? 141  ALA B CA  1 
ATOM   3077  C C   . ALA B 1 143 ? 21.136  1.836   24.695  1.00 170.07 ? 141  ALA B C   1 
ATOM   3078  O O   . ALA B 1 143 ? 20.612  0.746   24.473  1.00 169.33 ? 141  ALA B O   1 
ATOM   3079  C CB  . ALA B 1 143 ? 19.436  2.918   26.188  1.00 119.42 ? 141  ALA B CB  1 
ATOM   3080  N N   . GLN B 1 144 ? 21.937  2.476   23.844  1.00 116.23 ? 142  GLN B N   1 
ATOM   3081  C CA  . GLN B 1 144 ? 22.315  2.018   22.510  1.00 115.45 ? 142  GLN B CA  1 
ATOM   3082  C C   . GLN B 1 144 ? 22.273  0.508   22.258  1.00 115.94 ? 142  GLN B C   1 
ATOM   3083  O O   . GLN B 1 144 ? 21.231  -0.129  22.410  1.00 114.51 ? 142  GLN B O   1 
ATOM   3084  C CB  . GLN B 1 144 ? 23.709  2.562   22.193  1.00 136.15 ? 142  GLN B CB  1 
ATOM   3085  C CG  . GLN B 1 144 ? 24.141  2.477   20.746  1.00 134.50 ? 142  GLN B CG  1 
ATOM   3086  C CD  . GLN B 1 144 ? 25.512  3.088   20.532  1.00 133.83 ? 142  GLN B CD  1 
ATOM   3087  O OE1 . GLN B 1 144 ? 26.495  2.667   21.148  1.00 133.94 ? 142  GLN B OE1 1 
ATOM   3088  N NE2 . GLN B 1 144 ? 25.587  4.089   19.661  1.00 132.57 ? 142  GLN B NE2 1 
ATOM   3089  N N   . VAL B 1 145 ? 23.407  -0.060  21.860  1.00 157.31 ? 143  VAL B N   1 
ATOM   3090  C CA  . VAL B 1 145 ? 23.473  -1.487  21.568  1.00 159.30 ? 143  VAL B CA  1 
ATOM   3091  C C   . VAL B 1 145 ? 22.401  -1.752  20.510  1.00 160.24 ? 143  VAL B C   1 
ATOM   3092  O O   . VAL B 1 145 ? 22.212  -0.946  19.599  1.00 160.01 ? 143  VAL B O   1 
ATOM   3093  C CB  . VAL B 1 145 ? 23.177  -2.332  22.840  1.00 163.41 ? 143  VAL B CB  1 
ATOM   3094  C CG1 . VAL B 1 145 ? 23.480  -3.801  22.583  1.00 163.15 ? 143  VAL B CG1 1 
ATOM   3095  C CG2 . VAL B 1 145 ? 24.007  -1.820  24.006  1.00 163.12 ? 143  VAL B CG2 1 
ATOM   3096  N N   . GLU B 1 146 ? 21.704  -2.876  20.630  1.00 183.42 ? 144  GLU B N   1 
ATOM   3097  C CA  . GLU B 1 146 ? 20.638  -3.213  19.697  1.00 183.52 ? 144  GLU B CA  1 
ATOM   3098  C C   . GLU B 1 146 ? 19.320  -2.825  20.342  1.00 183.69 ? 144  GLU B C   1 
ATOM   3099  O O   . GLU B 1 146 ? 18.287  -3.462  20.126  1.00 183.53 ? 144  GLU B O   1 
ATOM   3100  C CB  . GLU B 1 146 ? 20.647  -4.708  19.380  1.00 154.16 ? 144  GLU B CB  1 
ATOM   3101  C CG  . GLU B 1 146 ? 21.804  -5.127  18.499  1.00 152.79 ? 144  GLU B CG  1 
ATOM   3102  C CD  . GLU B 1 146 ? 21.876  -4.303  17.234  1.00 151.29 ? 144  GLU B CD  1 
ATOM   3103  O OE1 . GLU B 1 146 ? 20.881  -4.285  16.479  1.00 150.90 ? 144  GLU B OE1 1 
ATOM   3104  O OE2 . GLU B 1 146 ? 22.926  -3.671  16.999  1.00 149.63 ? 144  GLU B OE2 1 
ATOM   3105  N N   . ASP B 1 147 ? 19.377  -1.770  21.148  1.00 180.70 ? 145  ASP B N   1 
ATOM   3106  C CA  . ASP B 1 147 ? 18.207  -1.261  21.842  1.00 180.43 ? 145  ASP B CA  1 
ATOM   3107  C C   . ASP B 1 147 ? 17.629  -0.106  21.026  1.00 179.81 ? 145  ASP B C   1 
ATOM   3108  O O   . ASP B 1 147 ? 16.419  0.123   21.024  1.00 179.80 ? 145  ASP B O   1 
ATOM   3109  C CB  . ASP B 1 147 ? 18.608  -0.801  23.247  1.00 166.83 ? 145  ASP B CB  1 
ATOM   3110  C CG  . ASP B 1 147 ? 17.423  -0.374  24.086  1.00 167.65 ? 145  ASP B CG  1 
ATOM   3111  O OD1 . ASP B 1 147 ? 16.388  -1.072  24.052  1.00 168.13 ? 145  ASP B OD1 1 
ATOM   3112  O OD2 . ASP B 1 147 ? 17.533  0.653   24.790  1.00 167.52 ? 145  ASP B OD2 1 
ATOM   3113  N N   . GLY B 1 148 ? 18.504  0.609   20.322  1.00 166.81 ? 146  GLY B N   1 
ATOM   3114  C CA  . GLY B 1 148 ? 18.062  1.717   19.495  1.00 164.51 ? 146  GLY B CA  1 
ATOM   3115  C C   . GLY B 1 148 ? 17.370  1.208   18.243  1.00 162.92 ? 146  GLY B C   1 
ATOM   3116  O O   . GLY B 1 148 ? 16.287  1.672   17.890  1.00 163.42 ? 146  GLY B O   1 
ATOM   3117  N N   . ARG B 1 149 ? 18.002  0.247   17.574  1.00 165.03 ? 147  ARG B N   1 
ATOM   3118  C CA  . ARG B 1 149 ? 17.457  -0.355  16.358  1.00 162.38 ? 147  ARG B CA  1 
ATOM   3119  C C   . ARG B 1 149 ? 16.048  -0.896  16.590  1.00 161.48 ? 147  ARG B C   1 
ATOM   3120  O O   . ARG B 1 149 ? 15.218  -0.908  15.679  1.00 161.46 ? 147  ARG B O   1 
ATOM   3121  C CB  . ARG B 1 149 ? 18.373  -1.490  15.882  1.00 143.15 ? 147  ARG B CB  1 
ATOM   3122  C CG  . ARG B 1 149 ? 17.730  -2.435  14.879  1.00 143.00 ? 147  ARG B CG  1 
ATOM   3123  C CD  . ARG B 1 149 ? 17.218  -1.686  13.661  1.00 144.72 ? 147  ARG B CD  1 
ATOM   3124  N NE  . ARG B 1 149 ? 16.398  -2.530  12.794  1.00 147.68 ? 147  ARG B NE  1 
ATOM   3125  C CZ  . ARG B 1 149 ? 15.779  -2.099  11.697  1.00 149.70 ? 147  ARG B CZ  1 
ATOM   3126  N NH1 . ARG B 1 149 ? 15.885  -0.829  11.326  1.00 150.82 ? 147  ARG B NH1 1 
ATOM   3127  N NH2 . ARG B 1 149 ? 15.052  -2.936  10.967  1.00 150.30 ? 147  ARG B NH2 1 
ATOM   3128  N N   . LEU B 1 150 ? 15.788  -1.346  17.813  1.00 126.49 ? 148  LEU B N   1 
ATOM   3129  C CA  . LEU B 1 150 ? 14.485  -1.891  18.181  1.00 125.25 ? 148  LEU B CA  1 
ATOM   3130  C C   . LEU B 1 150 ? 13.391  -0.847  17.954  1.00 123.01 ? 148  LEU B C   1 
ATOM   3131  O O   . LEU B 1 150 ? 12.272  -1.177  17.557  1.00 122.52 ? 148  LEU B O   1 
ATOM   3132  C CB  . LEU B 1 150 ? 14.509  -2.329  19.651  1.00 180.96 ? 148  LEU B CB  1 
ATOM   3133  C CG  . LEU B 1 150 ? 13.316  -3.102  20.218  1.00 181.46 ? 148  LEU B CG  1 
ATOM   3134  C CD1 . LEU B 1 150 ? 13.073  -4.369  19.406  1.00 181.02 ? 148  LEU B CD1 1 
ATOM   3135  C CD2 . LEU B 1 150 ? 13.594  -3.446  21.675  1.00 180.94 ? 148  LEU B CD2 1 
ATOM   3136  N N   . MET B 1 151 ? 13.725  0.413   18.212  1.00 110.16 ? 149  MET B N   1 
ATOM   3137  C CA  . MET B 1 151 ? 12.790  1.517   18.023  1.00 107.45 ? 149  MET B CA  1 
ATOM   3138  C C   . MET B 1 151 ? 12.378  1.568   16.559  1.00 104.16 ? 149  MET B C   1 
ATOM   3139  O O   . MET B 1 151 ? 11.192  1.482   16.228  1.00 102.08 ? 149  MET B O   1 
ATOM   3140  C CB  . MET B 1 151 ? 13.459  2.835   18.412  1.00 155.08 ? 149  MET B CB  1 
ATOM   3141  C CG  . MET B 1 151 ? 13.845  2.928   19.876  1.00 158.35 ? 149  MET B CG  1 
ATOM   3142  S SD  . MET B 1 151 ? 12.450  3.396   20.912  1.00 162.54 ? 149  MET B SD  1 
ATOM   3143  C CE  . MET B 1 151 ? 11.529  1.872   20.963  1.00 160.45 ? 149  MET B CE  1 
ATOM   3144  N N   . GLU B 1 152 ? 13.375  1.697   15.686  1.00 118.58 ? 150  GLU B N   1 
ATOM   3145  C CA  . GLU B 1 152 ? 13.145  1.758   14.248  1.00 116.81 ? 150  GLU B CA  1 
ATOM   3146  C C   . GLU B 1 152 ? 12.546  0.444   13.761  1.00 114.38 ? 150  GLU B C   1 
ATOM   3147  O O   . GLU B 1 152 ? 12.544  0.140   12.569  1.00 113.94 ? 150  GLU B O   1 
ATOM   3148  C CB  . GLU B 1 152 ? 14.457  2.037   13.509  1.00 138.69 ? 150  GLU B CB  1 
ATOM   3149  C CG  . GLU B 1 152 ? 14.266  2.340   12.032  1.00 140.77 ? 150  GLU B CG  1 
ATOM   3150  C CD  . GLU B 1 152 ? 15.571  2.565   11.293  1.00 142.09 ? 150  GLU B CD  1 
ATOM   3151  O OE1 . GLU B 1 152 ? 16.327  3.486   11.672  1.00 141.62 ? 150  GLU B OE1 1 
ATOM   3152  O OE2 . GLU B 1 152 ? 15.837  1.819   10.326  1.00 142.82 ? 150  GLU B OE2 1 
ATOM   3153  N N   . GLN B 1 153 ? 12.052  -0.344  14.703  1.00 71.32  ? 151  GLN B N   1 
ATOM   3154  C CA  . GLN B 1 153 ? 11.432  -1.604  14.369  1.00 69.14  ? 151  GLN B CA  1 
ATOM   3155  C C   . GLN B 1 153 ? 9.960   -1.492  14.702  1.00 67.73  ? 151  GLN B C   1 
ATOM   3156  O O   . GLN B 1 153 ? 9.112   -1.688  13.834  1.00 67.52  ? 151  GLN B O   1 
ATOM   3157  C CB  . GLN B 1 153 ? 12.068  -2.741  15.158  1.00 129.19 ? 151  GLN B CB  1 
ATOM   3158  C CG  . GLN B 1 153 ? 13.442  -3.135  14.669  1.00 130.77 ? 151  GLN B CG  1 
ATOM   3159  C CD  . GLN B 1 153 ? 14.063  -4.209  15.534  1.00 133.00 ? 151  GLN B CD  1 
ATOM   3160  O OE1 . GLN B 1 153 ? 13.443  -5.242  15.801  1.00 133.35 ? 151  GLN B OE1 1 
ATOM   3161  N NE2 . GLN B 1 153 ? 15.294  -3.976  15.976  1.00 132.93 ? 151  GLN B NE2 1 
ATOM   3162  N N   . LEU B 1 154 ? 9.657   -1.158  15.954  1.00 97.31  ? 152  LEU B N   1 
ATOM   3163  C CA  . LEU B 1 154 ? 8.270   -1.017  16.399  1.00 96.97  ? 152  LEU B CA  1 
ATOM   3164  C C   . LEU B 1 154 ? 7.553   0.098   15.652  1.00 95.89  ? 152  LEU B C   1 
ATOM   3165  O O   . LEU B 1 154 ? 6.326   0.078   15.487  1.00 94.91  ? 152  LEU B O   1 
ATOM   3166  C CB  . LEU B 1 154 ? 8.216   -0.714  17.901  1.00 97.03  ? 152  LEU B CB  1 
ATOM   3167  C CG  . LEU B 1 154 ? 6.881   -0.161  18.423  1.00 97.75  ? 152  LEU B CG  1 
ATOM   3168  C CD1 . LEU B 1 154 ? 5.759   -1.141  18.126  1.00 97.25  ? 152  LEU B CD1 1 
ATOM   3169  C CD2 . LEU B 1 154 ? 6.979   0.105   19.916  1.00 97.87  ? 152  LEU B CD2 1 
ATOM   3170  N N   . LEU B 1 155 ? 8.337   1.064   15.192  1.00 109.18 ? 153  LEU B N   1 
ATOM   3171  C CA  . LEU B 1 155 ? 7.796   2.220   14.504  1.00 105.84 ? 153  LEU B CA  1 
ATOM   3172  C C   . LEU B 1 155 ? 7.992   2.215   12.997  1.00 103.84 ? 153  LEU B C   1 
ATOM   3173  O O   . LEU B 1 155 ? 7.063   2.526   12.254  1.00 104.23 ? 153  LEU B O   1 
ATOM   3174  C CB  . LEU B 1 155 ? 8.408   3.471   15.122  1.00 92.31  ? 153  LEU B CB  1 
ATOM   3175  C CG  . LEU B 1 155 ? 8.266   3.440   16.649  1.00 91.96  ? 153  LEU B CG  1 
ATOM   3176  C CD1 . LEU B 1 155 ? 9.067   4.568   17.275  1.00 92.25  ? 153  LEU B CD1 1 
ATOM   3177  C CD2 . LEU B 1 155 ? 6.786   3.524   17.028  1.00 90.98  ? 153  LEU B CD2 1 
ATOM   3178  N N   . SER B 1 156 ? 9.190   1.863   12.542  1.00 74.66  ? 154  SER B N   1 
ATOM   3179  C CA  . SER B 1 156 ? 9.467   1.822   11.111  1.00 74.45  ? 154  SER B CA  1 
ATOM   3180  C C   . SER B 1 156 ? 8.516   0.824   10.460  1.00 74.60  ? 154  SER B C   1 
ATOM   3181  O O   . SER B 1 156 ? 8.610   0.523   9.269   1.00 73.78  ? 154  SER B O   1 
ATOM   3182  C CB  . SER B 1 156 ? 10.911  1.398   10.868  1.00 102.90 ? 154  SER B CB  1 
ATOM   3183  O OG  . SER B 1 156 ? 11.213  1.388   9.486   1.00 103.62 ? 154  SER B OG  1 
ATOM   3184  N N   . SER B 1 157 ? 7.597   0.321   11.272  1.00 88.14  ? 155  SER B N   1 
ATOM   3185  C CA  . SER B 1 157 ? 6.603   -0.645  10.841  1.00 89.81  ? 155  SER B CA  1 
ATOM   3186  C C   . SER B 1 157 ? 5.242   0.031   10.743  1.00 89.75  ? 155  SER B C   1 
ATOM   3187  O O   . SER B 1 157 ? 4.285   -0.558  10.248  1.00 89.46  ? 155  SER B O   1 
ATOM   3188  C CB  . SER B 1 157 ? 6.515   -1.781  11.857  1.00 112.59 ? 155  SER B CB  1 
ATOM   3189  O OG  . SER B 1 157 ? 6.042   -1.301  13.110  1.00 112.65 ? 155  SER B OG  1 
ATOM   3190  N N   . VAL B 1 158 ? 5.160   1.268   11.220  1.00 96.89  ? 156  VAL B N   1 
ATOM   3191  C CA  . VAL B 1 158 ? 3.904   2.009   11.196  1.00 96.98  ? 156  VAL B CA  1 
ATOM   3192  C C   . VAL B 1 158 ? 4.127   3.439   10.732  1.00 96.53  ? 156  VAL B C   1 
ATOM   3193  O O   . VAL B 1 158 ? 3.592   4.374   11.321  1.00 98.15  ? 156  VAL B O   1 
ATOM   3194  C CB  . VAL B 1 158 ? 3.277   2.074   12.595  1.00 76.85  ? 156  VAL B CB  1 
ATOM   3195  C CG1 . VAL B 1 158 ? 1.778   2.297   12.481  1.00 78.17  ? 156  VAL B CG1 1 
ATOM   3196  C CG2 . VAL B 1 158 ? 3.599   0.814   13.364  1.00 76.78  ? 156  VAL B CG2 1 
ATOM   3197  N N   . GLY B 1 159 ? 4.923   3.613   9.686   1.00 94.35  ? 157  GLY B N   1 
ATOM   3198  C CA  . GLY B 1 159 ? 5.185   4.952   9.198   1.00 93.29  ? 157  GLY B CA  1 
ATOM   3199  C C   . GLY B 1 159 ? 6.566   5.123   8.595   1.00 92.44  ? 157  GLY B C   1 
ATOM   3200  O O   . GLY B 1 159 ? 6.711   5.087   7.377   1.00 92.84  ? 157  GLY B O   1 
ATOM   3201  N N   . PHE B 1 160 ? 7.577   5.320   9.437   1.00 86.75  ? 158  PHE B N   1 
ATOM   3202  C CA  . PHE B 1 160 ? 8.951   5.497   8.969   1.00 86.23  ? 158  PHE B CA  1 
ATOM   3203  C C   . PHE B 1 160 ? 9.793   6.171   10.035  1.00 86.21  ? 158  PHE B C   1 
ATOM   3204  O O   . PHE B 1 160 ? 9.324   7.075   10.736  1.00 86.08  ? 158  PHE B O   1 
ATOM   3205  C CB  . PHE B 1 160 ? 8.997   6.347   7.704   1.00 94.19  ? 158  PHE B CB  1 
ATOM   3206  C CG  . PHE B 1 160 ? 10.370  6.753   7.307   1.00 97.00  ? 158  PHE B CG  1 
ATOM   3207  C CD1 . PHE B 1 160 ? 11.243  5.821   6.766   1.00 99.25  ? 158  PHE B CD1 1 
ATOM   3208  C CD2 . PHE B 1 160 ? 10.809  8.059   7.498   1.00 98.38  ? 158  PHE B CD2 1 
ATOM   3209  C CE1 . PHE B 1 160 ? 12.539  6.176   6.420   1.00 101.86 ? 158  PHE B CE1 1 
ATOM   3210  C CE2 . PHE B 1 160 ? 12.105  8.431   7.156   1.00 99.81  ? 158  PHE B CE2 1 
ATOM   3211  C CZ  . PHE B 1 160 ? 12.975  7.486   6.615   1.00 101.86 ? 158  PHE B CZ  1 
ATOM   3212  N N   . CYS B 1 161 ? 11.048  5.748   10.141  1.00 97.84  ? 159  CYS B N   1 
ATOM   3213  C CA  . CYS B 1 161 ? 11.935  6.308   11.149  1.00 98.67  ? 159  CYS B CA  1 
ATOM   3214  C C   . CYS B 1 161 ? 13.370  6.529   10.704  1.00 98.10  ? 159  CYS B C   1 
ATOM   3215  O O   . CYS B 1 161 ? 13.736  6.294   9.552   1.00 99.03  ? 159  CYS B O   1 
ATOM   3216  C CB  . CYS B 1 161 ? 11.939  5.414   12.389  1.00 90.38  ? 159  CYS B CB  1 
ATOM   3217  S SG  . CYS B 1 161 ? 10.310  5.156   13.108  1.00 93.18  ? 159  CYS B SG  1 
ATOM   3218  N N   . THR B 1 162 ? 14.167  6.975   11.668  1.00 87.19  ? 160  THR B N   1 
ATOM   3219  C CA  . THR B 1 162 ? 15.585  7.278   11.511  1.00 88.47  ? 160  THR B CA  1 
ATOM   3220  C C   . THR B 1 162 ? 15.916  8.100   12.749  1.00 89.48  ? 160  THR B C   1 
ATOM   3221  O O   . THR B 1 162 ? 15.004  8.608   13.406  1.00 88.93  ? 160  THR B O   1 
ATOM   3222  C CB  . THR B 1 162 ? 15.857  8.114   10.230  1.00 97.39  ? 160  THR B CB  1 
ATOM   3223  O OG1 . THR B 1 162 ? 16.143  7.233   9.136   1.00 98.11  ? 160  THR B OG1 1 
ATOM   3224  C CG2 . THR B 1 162 ? 17.027  9.063   10.429  1.00 96.70  ? 160  THR B CG2 1 
ATOM   3225  N N   . GLU B 1 163 ? 17.194  8.219   13.096  1.00 85.03  ? 161  GLU B N   1 
ATOM   3226  C CA  . GLU B 1 163 ? 17.539  9.006   14.270  1.00 88.37  ? 161  GLU B CA  1 
ATOM   3227  C C   . GLU B 1 163 ? 18.620  10.026  14.008  1.00 89.51  ? 161  GLU B C   1 
ATOM   3228  O O   . GLU B 1 163 ? 19.510  9.823   13.175  1.00 88.91  ? 161  GLU B O   1 
ATOM   3229  C CB  . GLU B 1 163 ? 17.978  8.115   15.439  1.00 141.07 ? 161  GLU B CB  1 
ATOM   3230  C CG  . GLU B 1 163 ? 19.484  7.881   15.579  1.00 144.74 ? 161  GLU B CG  1 
ATOM   3231  C CD  . GLU B 1 163 ? 19.975  6.679   14.799  1.00 146.36 ? 161  GLU B CD  1 
ATOM   3232  O OE1 . GLU B 1 163 ? 19.380  5.593   14.959  1.00 146.47 ? 161  GLU B OE1 1 
ATOM   3233  O OE2 . GLU B 1 163 ? 20.957  6.812   14.037  1.00 147.00 ? 161  GLU B OE2 1 
ATOM   3234  N N   . VAL B 1 164 ? 18.520  11.135  14.730  1.00 78.15  ? 162  VAL B N   1 
ATOM   3235  C CA  . VAL B 1 164 ? 19.488  12.215  14.642  1.00 80.10  ? 162  VAL B CA  1 
ATOM   3236  C C   . VAL B 1 164 ? 19.364  13.025  15.929  1.00 80.35  ? 162  VAL B C   1 
ATOM   3237  O O   . VAL B 1 164 ? 18.311  13.024  16.571  1.00 79.96  ? 162  VAL B O   1 
ATOM   3238  C CB  . VAL B 1 164 ? 19.215  13.147  13.442  1.00 129.31 ? 162  VAL B CB  1 
ATOM   3239  C CG1 . VAL B 1 164 ? 20.519  13.771  12.973  1.00 129.75 ? 162  VAL B CG1 1 
ATOM   3240  C CG2 . VAL B 1 164 ? 18.552  12.383  12.314  1.00 129.11 ? 162  VAL B CG2 1 
ATOM   3241  N N   . GLU B 1 165 ? 20.444  13.700  16.308  1.00 77.26  ? 163  GLU B N   1 
ATOM   3242  C CA  . GLU B 1 165 ? 20.458  14.511  17.519  1.00 79.02  ? 163  GLU B CA  1 
ATOM   3243  C C   . GLU B 1 165 ? 19.089  15.113  17.822  1.00 79.17  ? 163  GLU B C   1 
ATOM   3244  O O   . GLU B 1 165 ? 18.449  15.699  16.951  1.00 79.12  ? 163  GLU B O   1 
ATOM   3245  C CB  . GLU B 1 165 ? 21.503  15.622  17.392  1.00 138.67 ? 163  GLU B CB  1 
ATOM   3246  C CG  . GLU B 1 165 ? 21.622  16.220  15.994  1.00 143.34 ? 163  GLU B CG  1 
ATOM   3247  C CD  . GLU B 1 165 ? 22.843  15.717  15.241  1.00 145.29 ? 163  GLU B CD  1 
ATOM   3248  O OE1 . GLU B 1 165 ? 23.971  15.940  15.727  1.00 148.42 ? 163  GLU B OE1 1 
ATOM   3249  O OE2 . GLU B 1 165 ? 22.682  15.102  14.167  1.00 145.00 ? 163  GLU B OE2 1 
ATOM   3250  N N   . GLU B 1 166 ? 18.640  14.949  19.060  1.00 159.09 ? 164  GLU B N   1 
ATOM   3251  C CA  . GLU B 1 166 ? 17.347  15.473  19.471  1.00 161.52 ? 164  GLU B CA  1 
ATOM   3252  C C   . GLU B 1 166 ? 17.146  16.928  19.050  1.00 161.63 ? 164  GLU B C   1 
ATOM   3253  O O   . GLU B 1 166 ? 16.055  17.293  18.628  1.00 163.41 ? 164  GLU B O   1 
ATOM   3254  C CB  . GLU B 1 166 ? 17.176  15.335  20.992  1.00 124.79 ? 164  GLU B CB  1 
ATOM   3255  C CG  . GLU B 1 166 ? 16.034  16.166  21.585  1.00 127.01 ? 164  GLU B CG  1 
ATOM   3256  C CD  . GLU B 1 166 ? 15.861  15.960  23.079  1.00 127.61 ? 164  GLU B CD  1 
ATOM   3257  O OE1 . GLU B 1 166 ? 16.877  15.815  23.787  1.00 129.41 ? 164  GLU B OE1 1 
ATOM   3258  O OE2 . GLU B 1 166 ? 14.709  15.961  23.552  1.00 127.33 ? 164  GLU B OE2 1 
ATOM   3259  N N   . ASP B 1 167 ? 18.197  17.743  19.150  1.00 134.61 ? 165  ASP B N   1 
ATOM   3260  C CA  . ASP B 1 167 ? 18.135  19.167  18.793  1.00 131.79 ? 165  ASP B CA  1 
ATOM   3261  C C   . ASP B 1 167 ? 17.340  19.437  17.520  1.00 128.76 ? 165  ASP B C   1 
ATOM   3262  O O   . ASP B 1 167 ? 16.800  20.528  17.323  1.00 130.10 ? 165  ASP B O   1 
ATOM   3263  C CB  . ASP B 1 167 ? 19.543  19.732  18.616  1.00 151.28 ? 165  ASP B CB  1 
ATOM   3264  C CG  . ASP B 1 167 ? 20.317  19.024  17.526  1.00 153.08 ? 165  ASP B CG  1 
ATOM   3265  O OD1 . ASP B 1 167 ? 19.799  18.924  16.396  1.00 153.43 ? 165  ASP B OD1 1 
ATOM   3266  O OD2 . ASP B 1 167 ? 21.446  18.571  17.798  1.00 155.47 ? 165  ASP B OD2 1 
ATOM   3267  N N   . LEU B 1 168 ? 17.278  18.431  16.660  1.00 86.53  ? 166  LEU B N   1 
ATOM   3268  C CA  . LEU B 1 168 ? 16.557  18.532  15.405  1.00 80.23  ? 166  LEU B CA  1 
ATOM   3269  C C   . LEU B 1 168 ? 15.056  18.385  15.580  1.00 77.44  ? 166  LEU B C   1 
ATOM   3270  O O   . LEU B 1 168 ? 14.274  19.020  14.876  1.00 78.06  ? 166  LEU B O   1 
ATOM   3271  C CB  . LEU B 1 168 ? 17.054  17.456  14.450  1.00 76.32  ? 166  LEU B CB  1 
ATOM   3272  C CG  . LEU B 1 168 ? 18.538  17.561  14.114  1.00 74.72  ? 166  LEU B CG  1 
ATOM   3273  C CD1 . LEU B 1 168 ? 18.860  16.577  13.009  1.00 74.12  ? 166  LEU B CD1 1 
ATOM   3274  C CD2 . LEU B 1 168 ? 18.874  18.987  13.673  1.00 74.03  ? 166  LEU B CD2 1 
ATOM   3275  N N   . ILE B 1 169 ? 14.658  17.535  16.516  1.00 77.36  ? 167  ILE B N   1 
ATOM   3276  C CA  . ILE B 1 169 ? 13.250  17.293  16.770  1.00 75.37  ? 167  ILE B CA  1 
ATOM   3277  C C   . ILE B 1 169 ? 12.411  18.554  16.653  1.00 73.97  ? 167  ILE B C   1 
ATOM   3278  O O   . ILE B 1 169 ? 11.355  18.531  16.021  1.00 72.63  ? 167  ILE B O   1 
ATOM   3279  C CB  . ILE B 1 169 ? 13.034  16.674  18.154  1.00 76.54  ? 167  ILE B CB  1 
ATOM   3280  C CG1 . ILE B 1 169 ? 13.760  15.326  18.229  1.00 75.80  ? 167  ILE B CG1 1 
ATOM   3281  C CG2 . ILE B 1 169 ? 11.546  16.496  18.410  1.00 76.11  ? 167  ILE B CG2 1 
ATOM   3282  C CD1 . ILE B 1 169 ? 13.755  14.700  19.605  1.00 78.58  ? 167  ILE B CD1 1 
ATOM   3283  N N   . ASP B 1 170 ? 12.876  19.649  17.253  1.00 84.49  ? 168  ASP B N   1 
ATOM   3284  C CA  . ASP B 1 170 ? 12.137  20.908  17.185  1.00 85.34  ? 168  ASP B CA  1 
ATOM   3285  C C   . ASP B 1 170 ? 11.791  21.183  15.734  1.00 83.68  ? 168  ASP B C   1 
ATOM   3286  O O   . ASP B 1 170 ? 10.654  21.520  15.400  1.00 84.27  ? 168  ASP B O   1 
ATOM   3287  C CB  . ASP B 1 170 ? 12.971  22.075  17.698  1.00 115.06 ? 168  ASP B CB  1 
ATOM   3288  C CG  . ASP B 1 170 ? 13.362  21.927  19.147  1.00 121.42 ? 168  ASP B CG  1 
ATOM   3289  O OD1 . ASP B 1 170 ? 12.465  21.839  20.011  1.00 122.36 ? 168  ASP B OD1 1 
ATOM   3290  O OD2 . ASP B 1 170 ? 14.577  21.911  19.424  1.00 126.39 ? 168  ASP B OD2 1 
ATOM   3291  N N   . ALA B 1 171 ? 12.793  21.045  14.876  1.00 66.39  ? 169  ALA B N   1 
ATOM   3292  C CA  . ALA B 1 171 ? 12.613  21.258  13.453  1.00 61.49  ? 169  ALA B CA  1 
ATOM   3293  C C   . ALA B 1 171 ? 11.590  20.269  12.911  1.00 59.75  ? 169  ALA B C   1 
ATOM   3294  O O   . ALA B 1 171 ? 10.491  20.652  12.493  1.00 59.54  ? 169  ALA B O   1 
ATOM   3295  C CB  . ALA B 1 171 ? 13.928  21.075  12.744  1.00 42.93  ? 169  ALA B CB  1 
ATOM   3296  N N   . VAL B 1 172 ? 11.955  18.992  12.926  1.00 53.04  ? 170  VAL B N   1 
ATOM   3297  C CA  . VAL B 1 172 ? 11.073  17.944  12.428  1.00 52.15  ? 170  VAL B CA  1 
ATOM   3298  C C   . VAL B 1 172 ? 9.617   18.172  12.823  1.00 52.74  ? 170  VAL B C   1 
ATOM   3299  O O   . VAL B 1 172 ? 8.702   17.965  12.026  1.00 52.68  ? 170  VAL B O   1 
ATOM   3300  C CB  . VAL B 1 172 ? 11.518  16.571  12.941  1.00 61.59  ? 170  VAL B CB  1 
ATOM   3301  C CG1 . VAL B 1 172 ? 10.549  15.496  12.471  1.00 60.66  ? 170  VAL B CG1 1 
ATOM   3302  C CG2 . VAL B 1 172 ? 12.919  16.277  12.439  1.00 61.04  ? 170  VAL B CG2 1 
ATOM   3303  N N   . THR B 1 173 ? 9.409   18.600  14.062  1.00 67.16  ? 171  THR B N   1 
ATOM   3304  C CA  . THR B 1 173 ? 8.065   18.866  14.557  1.00 65.95  ? 171  THR B CA  1 
ATOM   3305  C C   . THR B 1 173 ? 7.450   19.936  13.681  1.00 63.28  ? 171  THR B C   1 
ATOM   3306  O O   . THR B 1 173 ? 6.382   19.747  13.103  1.00 60.41  ? 171  THR B O   1 
ATOM   3307  C CB  . THR B 1 173 ? 8.095   19.390  15.995  1.00 77.50  ? 171  THR B CB  1 
ATOM   3308  O OG1 . THR B 1 173 ? 8.822   18.470  16.817  1.00 78.60  ? 171  THR B OG1 1 
ATOM   3309  C CG2 . THR B 1 173 ? 6.677   19.554  16.530  1.00 77.36  ? 171  THR B CG2 1 
ATOM   3310  N N   . GLY B 1 174 ? 8.136   21.070  13.600  1.00 62.73  ? 172  GLY B N   1 
ATOM   3311  C CA  . GLY B 1 174 ? 7.644   22.150  12.778  1.00 61.99  ? 172  GLY B CA  1 
ATOM   3312  C C   . GLY B 1 174 ? 7.235   21.537  11.460  1.00 60.61  ? 172  GLY B C   1 
ATOM   3313  O O   . GLY B 1 174 ? 6.113   21.735  10.992  1.00 61.52  ? 172  GLY B O   1 
ATOM   3314  N N   . LEU B 1 175 ? 8.146   20.753  10.888  1.00 39.96  ? 173  LEU B N   1 
ATOM   3315  C CA  . LEU B 1 175 ? 7.910   20.093  9.611   1.00 38.18  ? 173  LEU B CA  1 
ATOM   3316  C C   . LEU B 1 175 ? 6.945   18.918  9.738   1.00 39.13  ? 173  LEU B C   1 
ATOM   3317  O O   . LEU B 1 175 ? 5.735   19.113  9.817   1.00 38.77  ? 173  LEU B O   1 
ATOM   3318  C CB  . LEU B 1 175 ? 9.240   19.613  9.014   1.00 35.09  ? 173  LEU B CB  1 
ATOM   3319  C CG  . LEU B 1 175 ? 9.190   18.899  7.655   1.00 34.78  ? 173  LEU B CG  1 
ATOM   3320  C CD1 . LEU B 1 175 ? 8.567   19.821  6.636   1.00 38.09  ? 173  LEU B CD1 1 
ATOM   3321  C CD2 . LEU B 1 175 ? 10.585  18.491  7.202   1.00 33.32  ? 173  LEU B CD2 1 
ATOM   3322  N N   . SER B 1 176 ? 7.484   17.702  9.754   1.00 50.79  ? 174  SER B N   1 
ATOM   3323  C CA  . SER B 1 176 ? 6.669   16.497  9.859   1.00 51.15  ? 174  SER B CA  1 
ATOM   3324  C C   . SER B 1 176 ? 5.612   16.671  10.929  1.00 50.25  ? 174  SER B C   1 
ATOM   3325  O O   . SER B 1 176 ? 4.454   16.396  10.693  1.00 51.23  ? 174  SER B O   1 
ATOM   3326  C CB  . SER B 1 176 ? 7.530   15.286  10.208  1.00 61.20  ? 174  SER B CB  1 
ATOM   3327  O OG  . SER B 1 176 ? 7.854   15.278  11.588  1.00 66.30  ? 174  SER B OG  1 
ATOM   3328  N N   . GLY B 1 177 ? 6.014   17.144  12.102  1.00 42.49  ? 175  GLY B N   1 
ATOM   3329  C CA  . GLY B 1 177 ? 5.061   17.328  13.183  1.00 42.04  ? 175  GLY B CA  1 
ATOM   3330  C C   . GLY B 1 177 ? 3.779   18.056  12.811  1.00 42.26  ? 175  GLY B C   1 
ATOM   3331  O O   . GLY B 1 177 ? 2.687   17.520  12.992  1.00 40.82  ? 175  GLY B O   1 
ATOM   3332  N N   . SER B 1 178 ? 3.905   19.276  12.293  1.00 61.63  ? 176  SER B N   1 
ATOM   3333  C CA  . SER B 1 178 ? 2.741   20.078  11.919  1.00 61.37  ? 176  SER B CA  1 
ATOM   3334  C C   . SER B 1 178 ? 2.264   19.901  10.481  1.00 61.63  ? 176  SER B C   1 
ATOM   3335  O O   . SER B 1 178 ? 1.097   20.159  10.181  1.00 61.57  ? 176  SER B O   1 
ATOM   3336  C CB  . SER B 1 178 ? 3.025   21.560  12.165  1.00 55.28  ? 176  SER B CB  1 
ATOM   3337  O OG  . SER B 1 178 ? 3.127   21.850  13.546  1.00 53.75  ? 176  SER B OG  1 
ATOM   3338  N N   . GLY B 1 179 ? 3.168   19.473  9.601   1.00 52.58  ? 177  GLY B N   1 
ATOM   3339  C CA  . GLY B 1 179 ? 2.837   19.267  8.197   1.00 52.90  ? 177  GLY B CA  1 
ATOM   3340  C C   . GLY B 1 179 ? 1.382   18.931  7.902   1.00 53.36  ? 177  GLY B C   1 
ATOM   3341  O O   . GLY B 1 179 ? 0.702   19.659  7.176   1.00 54.15  ? 177  GLY B O   1 
ATOM   3342  N N   . PRO B 1 180 ? 0.873   17.827  8.456   1.00 56.92  ? 178  PRO B N   1 
ATOM   3343  C CA  . PRO B 1 180 ? -0.505  17.386  8.259   1.00 58.48  ? 178  PRO B CA  1 
ATOM   3344  C C   . PRO B 1 180 ? -1.516  18.515  8.357   1.00 59.06  ? 178  PRO B C   1 
ATOM   3345  O O   . PRO B 1 180 ? -2.413  18.617  7.525   1.00 61.01  ? 178  PRO B O   1 
ATOM   3346  C CB  . PRO B 1 180 ? -0.680  16.350  9.356   1.00 86.29  ? 178  PRO B CB  1 
ATOM   3347  C CG  . PRO B 1 180 ? 0.644   15.714  9.384   1.00 85.34  ? 178  PRO B CG  1 
ATOM   3348  C CD  . PRO B 1 180 ? 1.580   16.904  9.353   1.00 85.01  ? 178  PRO B CD  1 
ATOM   3349  N N   . ALA B 1 181 ? -1.383  19.358  9.375   1.00 50.90  ? 179  ALA B N   1 
ATOM   3350  C CA  . ALA B 1 181 ? -2.305  20.477  9.538   1.00 48.21  ? 179  ALA B CA  1 
ATOM   3351  C C   . ALA B 1 181 ? -2.396  21.222  8.213   1.00 44.63  ? 179  ALA B C   1 
ATOM   3352  O O   . ALA B 1 181 ? -3.480  21.400  7.657   1.00 44.51  ? 179  ALA B O   1 
ATOM   3353  C CB  . ALA B 1 181 ? -1.811  21.409  10.627  1.00 82.19  ? 179  ALA B CB  1 
ATOM   3354  N N   . TYR B 1 182 ? -1.241  21.643  7.712   1.00 37.74  ? 180  TYR B N   1 
ATOM   3355  C CA  . TYR B 1 182 ? -1.148  22.362  6.451   1.00 35.16  ? 180  TYR B CA  1 
ATOM   3356  C C   . TYR B 1 182 ? -1.923  21.596  5.397   1.00 34.10  ? 180  TYR B C   1 
ATOM   3357  O O   . TYR B 1 182 ? -2.880  22.102  4.816   1.00 33.58  ? 180  TYR B O   1 
ATOM   3358  C CB  . TYR B 1 182 ? 0.304   22.443  6.018   1.00 39.83  ? 180  TYR B CB  1 
ATOM   3359  C CG  . TYR B 1 182 ? 1.266   22.701  7.150   1.00 40.49  ? 180  TYR B CG  1 
ATOM   3360  C CD1 . TYR B 1 182 ? 2.619   22.395  7.005   1.00 41.02  ? 180  TYR B CD1 1 
ATOM   3361  C CD2 . TYR B 1 182 ? 0.838   23.256  8.367   1.00 39.15  ? 180  TYR B CD2 1 
ATOM   3362  C CE1 . TYR B 1 182 ? 3.527   22.628  8.035   1.00 39.14  ? 180  TYR B CE1 1 
ATOM   3363  C CE2 . TYR B 1 182 ? 1.746   23.497  9.409   1.00 39.45  ? 180  TYR B CE2 1 
ATOM   3364  C CZ  . TYR B 1 182 ? 3.090   23.177  9.230   1.00 38.81  ? 180  TYR B CZ  1 
ATOM   3365  O OH  . TYR B 1 182 ? 4.009   23.402  10.229  1.00 36.35  ? 180  TYR B OH  1 
ATOM   3366  N N   . ALA B 1 183 ? -1.486  20.369  5.153   1.00 37.11  ? 181  ALA B N   1 
ATOM   3367  C CA  . ALA B 1 183 ? -2.125  19.500  4.181   1.00 39.04  ? 181  ALA B CA  1 
ATOM   3368  C C   . ALA B 1 183 ? -3.658  19.537  4.288   1.00 39.56  ? 181  ALA B C   1 
ATOM   3369  O O   . ALA B 1 183 ? -4.345  19.831  3.309   1.00 40.96  ? 181  ALA B O   1 
ATOM   3370  C CB  . ALA B 1 183 ? -1.621  18.089  4.367   1.00 22.60  ? 181  ALA B CB  1 
ATOM   3371  N N   . PHE B 1 184 ? -4.193  19.236  5.469   1.00 35.28  ? 182  PHE B N   1 
ATOM   3372  C CA  . PHE B 1 184 ? -5.642  19.254  5.668   1.00 34.97  ? 182  PHE B CA  1 
ATOM   3373  C C   . PHE B 1 184 ? -6.184  20.610  5.230   1.00 33.85  ? 182  PHE B C   1 
ATOM   3374  O O   . PHE B 1 184 ? -7.262  20.700  4.647   1.00 34.32  ? 182  PHE B O   1 
ATOM   3375  C CB  . PHE B 1 184 ? -5.997  18.992  7.143   1.00 53.02  ? 182  PHE B CB  1 
ATOM   3376  C CG  . PHE B 1 184 ? -5.680  17.591  7.614   1.00 58.35  ? 182  PHE B CG  1 
ATOM   3377  C CD1 . PHE B 1 184 ? -5.713  17.280  8.964   1.00 62.87  ? 182  PHE B CD1 1 
ATOM   3378  C CD2 . PHE B 1 184 ? -5.347  16.586  6.707   1.00 61.08  ? 182  PHE B CD2 1 
ATOM   3379  C CE1 . PHE B 1 184 ? -5.417  15.993  9.403   1.00 66.29  ? 182  PHE B CE1 1 
ATOM   3380  C CE2 . PHE B 1 184 ? -5.052  15.296  7.136   1.00 62.71  ? 182  PHE B CE2 1 
ATOM   3381  C CZ  . PHE B 1 184 ? -5.086  15.000  8.483   1.00 67.40  ? 182  PHE B CZ  1 
ATOM   3382  N N   . THR B 1 185 ? -5.433  21.667  5.514   1.00 43.71  ? 183  THR B N   1 
ATOM   3383  C CA  . THR B 1 185 ? -5.842  23.008  5.107   1.00 45.30  ? 183  THR B CA  1 
ATOM   3384  C C   . THR B 1 185 ? -5.788  23.085  3.591   1.00 45.04  ? 183  THR B C   1 
ATOM   3385  O O   . THR B 1 185 ? -6.763  23.429  2.936   1.00 45.19  ? 183  THR B O   1 
ATOM   3386  C CB  . THR B 1 185 ? -4.900  24.077  5.648   1.00 54.04  ? 183  THR B CB  1 
ATOM   3387  O OG1 . THR B 1 185 ? -5.024  24.139  7.071   1.00 52.60  ? 183  THR B OG1 1 
ATOM   3388  C CG2 . THR B 1 185 ? -5.237  25.428  5.038   1.00 53.44  ? 183  THR B CG2 1 
ATOM   3389  N N   . ALA B 1 186 ? -4.620  22.772  3.047   1.00 43.52  ? 184  ALA B N   1 
ATOM   3390  C CA  . ALA B 1 186 ? -4.428  22.780  1.613   1.00 44.03  ? 184  ALA B CA  1 
ATOM   3391  C C   . ALA B 1 186 ? -5.613  22.082  0.962   1.00 43.40  ? 184  ALA B C   1 
ATOM   3392  O O   . ALA B 1 186 ? -6.239  22.624  0.061   1.00 45.51  ? 184  ALA B O   1 
ATOM   3393  C CB  . ALA B 1 186 ? -3.142  22.057  1.261   1.00 34.35  ? 184  ALA B CB  1 
ATOM   3394  N N   . LEU B 1 187 ? -5.934  20.886  1.438   1.00 44.28  ? 185  LEU B N   1 
ATOM   3395  C CA  . LEU B 1 187 ? -7.041  20.119  0.877   1.00 43.60  ? 185  LEU B CA  1 
ATOM   3396  C C   . LEU B 1 187 ? -8.414  20.794  0.924   1.00 42.35  ? 185  LEU B C   1 
ATOM   3397  O O   . LEU B 1 187 ? -9.127  20.832  -0.080  1.00 43.54  ? 185  LEU B O   1 
ATOM   3398  C CB  . LEU B 1 187 ? -7.106  18.742  1.540   1.00 46.67  ? 185  LEU B CB  1 
ATOM   3399  C CG  . LEU B 1 187 ? -6.053  17.783  0.971   1.00 49.03  ? 185  LEU B CG  1 
ATOM   3400  C CD1 . LEU B 1 187 ? -6.089  16.457  1.701   1.00 51.66  ? 185  LEU B CD1 1 
ATOM   3401  C CD2 . LEU B 1 187 ? -6.324  17.572  -0.513  1.00 51.64  ? 185  LEU B CD2 1 
ATOM   3402  N N   . ASP B 1 188 ? -8.800  21.316  2.077   1.00 39.70  ? 186  ASP B N   1 
ATOM   3403  C CA  . ASP B 1 188 ? -10.086 21.988  2.167   1.00 38.53  ? 186  ASP B CA  1 
ATOM   3404  C C   . ASP B 1 188 ? -10.103 23.158  1.188   1.00 34.87  ? 186  ASP B C   1 
ATOM   3405  O O   . ASP B 1 188 ? -11.136 23.496  0.622   1.00 34.80  ? 186  ASP B O   1 
ATOM   3406  C CB  . ASP B 1 188 ? -10.320 22.518  3.576   1.00 45.87  ? 186  ASP B CB  1 
ATOM   3407  C CG  . ASP B 1 188 ? -11.629 23.266  3.693   1.00 51.20  ? 186  ASP B CG  1 
ATOM   3408  O OD1 . ASP B 1 188 ? -11.867 23.888  4.748   1.00 54.31  ? 186  ASP B OD1 1 
ATOM   3409  O OD2 . ASP B 1 188 ? -12.425 23.226  2.728   1.00 52.10  ? 186  ASP B OD2 1 
ATOM   3410  N N   . ALA B 1 189 ? -8.947  23.785  1.016   1.00 28.91  ? 187  ALA B N   1 
ATOM   3411  C CA  . ALA B 1 189 ? -8.802  24.907  0.105   1.00 24.91  ? 187  ALA B CA  1 
ATOM   3412  C C   . ALA B 1 189 ? -9.151  24.353  -1.260  1.00 27.51  ? 187  ALA B C   1 
ATOM   3413  O O   . ALA B 1 189 ? -10.197 24.677  -1.816  1.00 27.52  ? 187  ALA B O   1 
ATOM   3414  C CB  . ALA B 1 189 ? -7.370  25.405  0.125   1.00 19.97  ? 187  ALA B CB  1 
ATOM   3415  N N   . LEU B 1 190 ? -8.274  23.507  -1.787  1.00 29.21  ? 188  LEU B N   1 
ATOM   3416  C CA  . LEU B 1 190 ? -8.504  22.861  -3.071  1.00 33.57  ? 188  LEU B CA  1 
ATOM   3417  C C   . LEU B 1 190 ? -9.966  22.403  -3.206  1.00 35.80  ? 188  LEU B C   1 
ATOM   3418  O O   . LEU B 1 190 ? -10.611 22.640  -4.231  1.00 35.09  ? 188  LEU B O   1 
ATOM   3419  C CB  . LEU B 1 190 ? -7.587  21.651  -3.205  1.00 27.83  ? 188  LEU B CB  1 
ATOM   3420  C CG  . LEU B 1 190 ? -6.088  21.930  -3.277  1.00 28.02  ? 188  LEU B CG  1 
ATOM   3421  C CD1 . LEU B 1 190 ? -5.328  20.614  -3.252  1.00 24.43  ? 188  LEU B CD1 1 
ATOM   3422  C CD2 . LEU B 1 190 ? -5.775  22.712  -4.543  1.00 28.32  ? 188  LEU B CD2 1 
ATOM   3423  N N   . ALA B 1 191 ? -10.480 21.741  -2.172  1.00 35.37  ? 189  ALA B N   1 
ATOM   3424  C CA  . ALA B 1 191 ? -11.861 21.269  -2.170  1.00 36.02  ? 189  ALA B CA  1 
ATOM   3425  C C   . ALA B 1 191 ? -12.766 22.383  -2.695  1.00 37.39  ? 189  ALA B C   1 
ATOM   3426  O O   . ALA B 1 191 ? -13.382 22.249  -3.756  1.00 39.30  ? 189  ALA B O   1 
ATOM   3427  C CB  . ALA B 1 191 ? -12.269 20.876  -0.755  1.00 31.93  ? 189  ALA B CB  1 
ATOM   3428  N N   . ASP B 1 192 ? -12.831 23.481  -1.943  1.00 39.81  ? 190  ASP B N   1 
ATOM   3429  C CA  . ASP B 1 192 ? -13.625 24.644  -2.322  1.00 39.48  ? 190  ASP B CA  1 
ATOM   3430  C C   . ASP B 1 192 ? -13.145 25.098  -3.695  1.00 38.72  ? 190  ASP B C   1 
ATOM   3431  O O   . ASP B 1 192 ? -13.935 25.481  -4.553  1.00 36.17  ? 190  ASP B O   1 
ATOM   3432  C CB  . ASP B 1 192 ? -13.415 25.786  -1.327  1.00 47.94  ? 190  ASP B CB  1 
ATOM   3433  C CG  . ASP B 1 192 ? -13.781 25.407  0.093   1.00 52.09  ? 190  ASP B CG  1 
ATOM   3434  O OD1 . ASP B 1 192 ? -14.933 24.986  0.332   1.00 55.24  ? 190  ASP B OD1 1 
ATOM   3435  O OD2 . ASP B 1 192 ? -12.911 25.546  0.977   1.00 55.71  ? 190  ASP B OD2 1 
ATOM   3436  N N   . GLY B 1 193 ? -11.834 25.056  -3.892  1.00 35.80  ? 191  GLY B N   1 
ATOM   3437  C CA  . GLY B 1 193 ? -11.269 25.456  -5.162  1.00 35.32  ? 191  GLY B CA  1 
ATOM   3438  C C   . GLY B 1 193 ? -12.038 24.833  -6.305  1.00 34.24  ? 191  GLY B C   1 
ATOM   3439  O O   . GLY B 1 193 ? -12.746 25.528  -7.036  1.00 34.63  ? 191  GLY B O   1 
ATOM   3440  N N   . GLY B 1 194 ? -11.910 23.520  -6.453  1.00 51.30  ? 192  GLY B N   1 
ATOM   3441  C CA  . GLY B 1 194 ? -12.609 22.827  -7.518  1.00 49.84  ? 192  GLY B CA  1 
ATOM   3442  C C   . GLY B 1 194 ? -14.109 23.068  -7.508  1.00 47.02  ? 192  GLY B C   1 
ATOM   3443  O O   . GLY B 1 194 ? -14.703 23.425  -8.532  1.00 51.05  ? 192  GLY B O   1 
ATOM   3444  N N   . VAL B 1 195 ? -14.729 22.869  -6.351  1.00 23.53  ? 193  VAL B N   1 
ATOM   3445  C CA  . VAL B 1 195 ? -16.165 23.068  -6.229  1.00 21.86  ? 193  VAL B CA  1 
ATOM   3446  C C   . VAL B 1 195 ? -16.598 24.399  -6.842  1.00 23.65  ? 193  VAL B C   1 
ATOM   3447  O O   . VAL B 1 195 ? -17.701 24.516  -7.367  1.00 23.44  ? 193  VAL B O   1 
ATOM   3448  C CB  . VAL B 1 195 ? -16.605 23.020  -4.756  1.00 21.03  ? 193  VAL B CB  1 
ATOM   3449  C CG1 . VAL B 1 195 ? -18.088 23.322  -4.644  1.00 16.43  ? 193  VAL B CG1 1 
ATOM   3450  C CG2 . VAL B 1 195 ? -16.291 21.647  -4.171  1.00 23.53  ? 193  VAL B CG2 1 
ATOM   3451  N N   . LYS B 1 196 ? -15.733 25.405  -6.773  1.00 40.22  ? 194  LYS B N   1 
ATOM   3452  C CA  . LYS B 1 196 ? -16.062 26.704  -7.346  1.00 43.71  ? 194  LYS B CA  1 
ATOM   3453  C C   . LYS B 1 196 ? -16.196 26.512  -8.845  1.00 44.21  ? 194  LYS B C   1 
ATOM   3454  O O   . LYS B 1 196 ? -17.103 27.045  -9.489  1.00 44.61  ? 194  LYS B O   1 
ATOM   3455  C CB  . LYS B 1 196 ? -14.954 27.722  -7.068  1.00 34.64  ? 194  LYS B CB  1 
ATOM   3456  C CG  . LYS B 1 196 ? -15.220 29.067  -7.725  1.00 34.80  ? 194  LYS B CG  1 
ATOM   3457  C CD  . LYS B 1 196 ? -14.088 30.079  -7.544  1.00 30.41  ? 194  LYS B CD  1 
ATOM   3458  C CE  . LYS B 1 196 ? -14.498 31.423  -8.147  1.00 25.29  ? 194  LYS B CE  1 
ATOM   3459  N NZ  . LYS B 1 196 ? -13.509 32.517  -8.000  1.00 25.15  ? 194  LYS B NZ  1 
ATOM   3460  N N   . MET B 1 197 ? -15.268 25.740  -9.390  1.00 49.66  ? 195  MET B N   1 
ATOM   3461  C CA  . MET B 1 197 ? -15.254 25.452  -10.804 1.00 50.91  ? 195  MET B CA  1 
ATOM   3462  C C   . MET B 1 197 ? -16.382 24.509  -11.200 1.00 52.71  ? 195  MET B C   1 
ATOM   3463  O O   . MET B 1 197 ? -16.545 24.191  -12.376 1.00 56.72  ? 195  MET B O   1 
ATOM   3464  C CB  . MET B 1 197 ? -13.897 24.873  -11.193 1.00 45.26  ? 195  MET B CB  1 
ATOM   3465  C CG  . MET B 1 197 ? -12.750 25.835  -10.916 1.00 48.44  ? 195  MET B CG  1 
ATOM   3466  S SD  . MET B 1 197 ? -12.940 27.443  -11.747 1.00 50.42  ? 195  MET B SD  1 
ATOM   3467  C CE  . MET B 1 197 ? -14.213 28.238  -10.703 1.00 45.10  ? 195  MET B CE  1 
ATOM   3468  N N   . GLY B 1 198 ? -17.167 24.066  -10.222 1.00 35.75  ? 196  GLY B N   1 
ATOM   3469  C CA  . GLY B 1 198 ? -18.275 23.187  -10.541 1.00 36.84  ? 196  GLY B CA  1 
ATOM   3470  C C   . GLY B 1 198 ? -18.340 21.847  -9.834  1.00 39.16  ? 196  GLY B C   1 
ATOM   3471  O O   . GLY B 1 198 ? -19.434 21.341  -9.566  1.00 39.28  ? 196  GLY B O   1 
ATOM   3472  N N   . LEU B 1 199 ? -17.187 21.258  -9.534  1.00 32.45  ? 197  LEU B N   1 
ATOM   3473  C CA  . LEU B 1 199 ? -17.180 19.968  -8.863  1.00 35.09  ? 197  LEU B CA  1 
ATOM   3474  C C   . LEU B 1 199 ? -18.113 19.910  -7.661  1.00 39.27  ? 197  LEU B C   1 
ATOM   3475  O O   . LEU B 1 199 ? -18.424 20.926  -7.037  1.00 37.36  ? 197  LEU B O   1 
ATOM   3476  C CB  . LEU B 1 199 ? -15.777 19.616  -8.395  1.00 32.80  ? 197  LEU B CB  1 
ATOM   3477  C CG  . LEU B 1 199 ? -14.679 19.551  -9.448  1.00 34.66  ? 197  LEU B CG  1 
ATOM   3478  C CD1 . LEU B 1 199 ? -13.544 18.687  -8.911  1.00 35.54  ? 197  LEU B CD1 1 
ATOM   3479  C CD2 . LEU B 1 199 ? -15.217 18.945  -10.727 1.00 40.79  ? 197  LEU B CD2 1 
ATOM   3480  N N   . PRO B 1 200 ? -18.602 18.708  -7.340  1.00 53.94  ? 198  PRO B N   1 
ATOM   3481  C CA  . PRO B 1 200 ? -19.487 18.584  -6.190  1.00 54.97  ? 198  PRO B CA  1 
ATOM   3482  C C   . PRO B 1 200 ? -18.532 18.582  -5.002  1.00 56.00  ? 198  PRO B C   1 
ATOM   3483  O O   . PRO B 1 200 ? -17.332 18.331  -5.164  1.00 54.36  ? 198  PRO B O   1 
ATOM   3484  C CB  . PRO B 1 200 ? -20.143 17.233  -6.417  1.00 69.39  ? 198  PRO B CB  1 
ATOM   3485  C CG  . PRO B 1 200 ? -19.022 16.444  -6.996  1.00 70.34  ? 198  PRO B CG  1 
ATOM   3486  C CD  . PRO B 1 200 ? -18.427 17.407  -8.007  1.00 69.44  ? 198  PRO B CD  1 
ATOM   3487  N N   . ARG B 1 201 ? -19.053 18.853  -3.815  1.00 46.30  ? 199  ARG B N   1 
ATOM   3488  C CA  . ARG B 1 201 ? -18.208 18.907  -2.640  1.00 46.51  ? 199  ARG B CA  1 
ATOM   3489  C C   . ARG B 1 201 ? -17.316 17.701  -2.422  1.00 46.97  ? 199  ARG B C   1 
ATOM   3490  O O   . ARG B 1 201 ? -16.103 17.789  -2.600  1.00 46.32  ? 199  ARG B O   1 
ATOM   3491  C CB  . ARG B 1 201 ? -19.045 19.134  -1.383  1.00 68.58  ? 199  ARG B CB  1 
ATOM   3492  C CG  . ARG B 1 201 ? -18.192 19.355  -0.153  1.00 68.13  ? 199  ARG B CG  1 
ATOM   3493  C CD  . ARG B 1 201 ? -17.171 20.442  -0.423  1.00 68.34  ? 199  ARG B CD  1 
ATOM   3494  N NE  . ARG B 1 201 ? -16.221 20.575  0.674   1.00 73.31  ? 199  ARG B NE  1 
ATOM   3495  C CZ  . ARG B 1 201 ? -15.152 21.364  0.640   1.00 75.10  ? 199  ARG B CZ  1 
ATOM   3496  N NH1 . ARG B 1 201 ? -14.899 22.091  -0.441  1.00 73.88  ? 199  ARG B NH1 1 
ATOM   3497  N NH2 . ARG B 1 201 ? -14.338 21.426  1.684   1.00 74.77  ? 199  ARG B NH2 1 
ATOM   3498  N N   . ARG B 1 202 ? -17.910 16.575  -2.039  1.00 53.42  ? 200  ARG B N   1 
ATOM   3499  C CA  . ARG B 1 202 ? -17.118 15.388  -1.761  1.00 57.61  ? 200  ARG B CA  1 
ATOM   3500  C C   . ARG B 1 202 ? -16.178 15.005  -2.882  1.00 56.61  ? 200  ARG B C   1 
ATOM   3501  O O   . ARG B 1 202 ? -14.971 15.106  -2.716  1.00 57.37  ? 200  ARG B O   1 
ATOM   3502  C CB  . ARG B 1 202 ? -18.003 14.204  -1.385  1.00 135.92 ? 200  ARG B CB  1 
ATOM   3503  C CG  . ARG B 1 202 ? -17.452 13.467  -0.174  1.00 145.79 ? 200  ARG B CG  1 
ATOM   3504  C CD  . ARG B 1 202 ? -18.393 12.403  0.331   1.00 156.73 ? 200  ARG B CD  1 
ATOM   3505  N NE  . ARG B 1 202 ? -19.787 12.830  0.284   1.00 166.35 ? 200  ARG B NE  1 
ATOM   3506  C CZ  . ARG B 1 202 ? -20.812 12.020  0.526   1.00 169.69 ? 200  ARG B CZ  1 
ATOM   3507  N NH1 . ARG B 1 202 ? -20.586 10.749  0.835   1.00 172.07 ? 200  ARG B NH1 1 
ATOM   3508  N NH2 . ARG B 1 202 ? -22.059 12.470  0.441   1.00 169.91 ? 200  ARG B NH2 1 
ATOM   3509  N N   . LEU B 1 203 ? -16.711 14.581  -4.020  1.00 58.30  ? 201  LEU B N   1 
ATOM   3510  C CA  . LEU B 1 203 ? -15.864 14.200  -5.144  1.00 57.87  ? 201  LEU B CA  1 
ATOM   3511  C C   . LEU B 1 203 ? -14.584 15.036  -5.224  1.00 59.44  ? 201  LEU B C   1 
ATOM   3512  O O   . LEU B 1 203 ? -13.492 14.506  -5.468  1.00 59.67  ? 201  LEU B O   1 
ATOM   3513  C CB  . LEU B 1 203 ? -16.634 14.354  -6.451  1.00 45.02  ? 201  LEU B CB  1 
ATOM   3514  C CG  . LEU B 1 203 ? -15.744 14.418  -7.697  1.00 42.70  ? 201  LEU B CG  1 
ATOM   3515  C CD1 . LEU B 1 203 ? -15.068 13.076  -7.952  1.00 42.48  ? 201  LEU B CD1 1 
ATOM   3516  C CD2 . LEU B 1 203 ? -16.580 14.824  -8.877  1.00 41.03  ? 201  LEU B CD2 1 
ATOM   3517  N N   . ALA B 1 204 ? -14.740 16.345  -5.024  1.00 65.34  ? 202  ALA B N   1 
ATOM   3518  C CA  . ALA B 1 204 ? -13.640 17.312  -5.072  1.00 64.50  ? 202  ALA B CA  1 
ATOM   3519  C C   . ALA B 1 204 ? -12.508 17.018  -4.080  1.00 64.89  ? 202  ALA B C   1 
ATOM   3520  O O   . ALA B 1 204 ? -11.402 16.648  -4.483  1.00 64.92  ? 202  ALA B O   1 
ATOM   3521  C CB  . ALA B 1 204 ? -14.193 18.716  -4.832  1.00 35.06  ? 202  ALA B CB  1 
ATOM   3522  N N   . VAL B 1 205 ? -12.788 17.215  -2.792  1.00 64.07  ? 203  VAL B N   1 
ATOM   3523  C CA  . VAL B 1 205 ? -11.833 16.961  -1.709  1.00 63.53  ? 203  VAL B CA  1 
ATOM   3524  C C   . VAL B 1 205 ? -11.046 15.714  -2.050  1.00 62.90  ? 203  VAL B C   1 
ATOM   3525  O O   . VAL B 1 205 ? -9.814  15.639  -1.968  1.00 63.31  ? 203  VAL B O   1 
ATOM   3526  C CB  . VAL B 1 205 ? -12.571 16.634  -0.410  1.00 57.85  ? 203  VAL B CB  1 
ATOM   3527  C CG1 . VAL B 1 205 ? -11.577 16.487  0.726   1.00 60.28  ? 203  VAL B CG1 1 
ATOM   3528  C CG2 . VAL B 1 205 ? -13.617 17.690  -0.123  1.00 60.84  ? 203  VAL B CG2 1 
ATOM   3529  N N   . ARG B 1 206 ? -11.847 14.736  -2.421  1.00 51.00  ? 204  ARG B N   1 
ATOM   3530  C CA  . ARG B 1 206 ? -11.467 13.400  -2.794  1.00 52.44  ? 204  ARG B CA  1 
ATOM   3531  C C   . ARG B 1 206 ? -10.373 13.287  -3.850  1.00 49.07  ? 204  ARG B C   1 
ATOM   3532  O O   . ARG B 1 206 ? -9.357  12.618  -3.644  1.00 48.36  ? 204  ARG B O   1 
ATOM   3533  C CB  . ARG B 1 206 ? -12.757 12.731  -3.217  1.00 111.49 ? 204  ARG B CB  1 
ATOM   3534  C CG  . ARG B 1 206 ? -13.887 13.000  -2.196  1.00 122.60 ? 204  ARG B CG  1 
ATOM   3535  C CD  . ARG B 1 206 ? -13.371 13.046  -0.733  1.00 133.43 ? 204  ARG B CD  1 
ATOM   3536  N NE  . ARG B 1 206 ? -14.414 13.280  0.270   1.00 142.14 ? 204  ARG B NE  1 
ATOM   3537  C CZ  . ARG B 1 206 ? -14.204 13.341  1.588   1.00 146.30 ? 204  ARG B CZ  1 
ATOM   3538  N NH1 . ARG B 1 206 ? -12.983 13.188  2.094   1.00 147.46 ? 204  ARG B NH1 1 
ATOM   3539  N NH2 . ARG B 1 206 ? -15.224 13.553  2.407   1.00 147.33 ? 204  ARG B NH2 1 
ATOM   3540  N N   . LEU B 1 207 ? -10.580 13.938  -4.984  1.00 46.52  ? 205  LEU B N   1 
ATOM   3541  C CA  . LEU B 1 207 ? -9.591  13.931  -6.051  1.00 42.38  ? 205  LEU B CA  1 
ATOM   3542  C C   . LEU B 1 207 ? -8.323  14.640  -5.570  1.00 40.40  ? 205  LEU B C   1 
ATOM   3543  O O   . LEU B 1 207 ? -7.214  14.111  -5.688  1.00 35.25  ? 205  LEU B O   1 
ATOM   3544  C CB  . LEU B 1 207 ? -10.150 14.662  -7.266  1.00 43.91  ? 205  LEU B CB  1 
ATOM   3545  C CG  . LEU B 1 207 ? -11.244 13.944  -8.042  1.00 41.70  ? 205  LEU B CG  1 
ATOM   3546  C CD1 . LEU B 1 207 ? -12.417 14.871  -8.287  1.00 40.66  ? 205  LEU B CD1 1 
ATOM   3547  C CD2 . LEU B 1 207 ? -10.647 13.462  -9.355  1.00 40.46  ? 205  LEU B CD2 1 
ATOM   3548  N N   . GLY B 1 208 ? -8.506  15.848  -5.036  1.00 54.98  ? 206  GLY B N   1 
ATOM   3549  C CA  . GLY B 1 208 ? -7.387  16.630  -4.534  1.00 52.53  ? 206  GLY B CA  1 
ATOM   3550  C C   . GLY B 1 208 ? -6.584  15.794  -3.566  1.00 48.77  ? 206  GLY B C   1 
ATOM   3551  O O   . GLY B 1 208 ? -5.358  15.723  -3.637  1.00 45.98  ? 206  GLY B O   1 
ATOM   3552  N N   . ALA B 1 209 ? -7.302  15.157  -2.653  1.00 37.74  ? 207  ALA B N   1 
ATOM   3553  C CA  . ALA B 1 209 ? -6.696  14.281  -1.672  1.00 37.37  ? 207  ALA B CA  1 
ATOM   3554  C C   . ALA B 1 209 ? -5.779  13.325  -2.426  1.00 38.74  ? 207  ALA B C   1 
ATOM   3555  O O   . ALA B 1 209 ? -4.560  13.289  -2.214  1.00 37.64  ? 207  ALA B O   1 
ATOM   3556  C CB  . ALA B 1 209 ? -7.782  13.505  -0.964  1.00 10.59  ? 207  ALA B CB  1 
ATOM   3557  N N   . GLN B 1 210 ? -6.391  12.560  -3.321  1.00 40.12  ? 208  GLN B N   1 
ATOM   3558  C CA  . GLN B 1 210 ? -5.668  11.598  -4.126  1.00 42.89  ? 208  GLN B CA  1 
ATOM   3559  C C   . GLN B 1 210 ? -4.453  12.248  -4.773  1.00 43.27  ? 208  GLN B C   1 
ATOM   3560  O O   . GLN B 1 210 ? -3.358  11.677  -4.790  1.00 43.57  ? 208  GLN B O   1 
ATOM   3561  C CB  . GLN B 1 210 ? -6.579  11.035  -5.214  1.00 52.50  ? 208  GLN B CB  1 
ATOM   3562  C CG  . GLN B 1 210 ? -5.886  9.993   -6.054  1.00 57.29  ? 208  GLN B CG  1 
ATOM   3563  C CD  . GLN B 1 210 ? -5.484  8.795   -5.224  1.00 61.01  ? 208  GLN B CD  1 
ATOM   3564  O OE1 . GLN B 1 210 ? -6.317  8.238   -4.529  1.00 64.96  ? 208  GLN B OE1 1 
ATOM   3565  N NE2 . GLN B 1 210 ? -4.210  8.396   -5.286  1.00 58.95  ? 208  GLN B NE2 1 
ATOM   3566  N N   . ALA B 1 211 ? -4.661  13.450  -5.305  1.00 41.42  ? 209  ALA B N   1 
ATOM   3567  C CA  . ALA B 1 211 ? -3.594  14.196  -5.968  1.00 42.95  ? 209  ALA B CA  1 
ATOM   3568  C C   . ALA B 1 211 ? -2.332  14.278  -5.104  1.00 44.04  ? 209  ALA B C   1 
ATOM   3569  O O   . ALA B 1 211 ? -1.216  13.989  -5.562  1.00 41.12  ? 209  ALA B O   1 
ATOM   3570  C CB  . ALA B 1 211 ? -4.083  15.597  -6.319  1.00 48.19  ? 209  ALA B CB  1 
ATOM   3571  N N   . LEU B 1 212 ? -2.518  14.674  -3.850  1.00 39.16  ? 210  LEU B N   1 
ATOM   3572  C CA  . LEU B 1 212 ? -1.408  14.790  -2.919  1.00 40.01  ? 210  LEU B CA  1 
ATOM   3573  C C   . LEU B 1 212 ? -0.884  13.402  -2.624  1.00 41.45  ? 210  LEU B C   1 
ATOM   3574  O O   . LEU B 1 212 ? 0.328   13.154  -2.651  1.00 40.35  ? 210  LEU B O   1 
ATOM   3575  C CB  . LEU B 1 212 ? -1.888  15.447  -1.638  1.00 50.69  ? 210  LEU B CB  1 
ATOM   3576  C CG  . LEU B 1 212 ? -2.622  16.745  -1.953  1.00 52.64  ? 210  LEU B CG  1 
ATOM   3577  C CD1 . LEU B 1 212 ? -3.151  17.370  -0.675  1.00 50.72  ? 210  LEU B CD1 1 
ATOM   3578  C CD2 . LEU B 1 212 ? -1.665  17.683  -2.690  1.00 53.68  ? 210  LEU B CD2 1 
ATOM   3579  N N   . LEU B 1 213 ? -1.817  12.500  -2.344  1.00 65.86  ? 211  LEU B N   1 
ATOM   3580  C CA  . LEU B 1 213 ? -1.480  11.118  -2.058  1.00 67.86  ? 211  LEU B CA  1 
ATOM   3581  C C   . LEU B 1 213 ? -0.496  10.669  -3.144  1.00 68.04  ? 211  LEU B C   1 
ATOM   3582  O O   . LEU B 1 213 ? 0.584   10.145  -2.854  1.00 68.48  ? 211  LEU B O   1 
ATOM   3583  C CB  . LEU B 1 213 ? -2.756  10.267  -2.098  1.00 45.47  ? 211  LEU B CB  1 
ATOM   3584  C CG  . LEU B 1 213 ? -2.786  8.841   -1.524  1.00 44.84  ? 211  LEU B CG  1 
ATOM   3585  C CD1 . LEU B 1 213 ? -1.557  8.081   -2.002  1.00 44.86  ? 211  LEU B CD1 1 
ATOM   3586  C CD2 . LEU B 1 213 ? -2.853  8.859   -0.005  1.00 44.89  ? 211  LEU B CD2 1 
ATOM   3587  N N   . GLY B 1 214 ? -0.875  10.904  -4.396  1.00 48.29  ? 212  GLY B N   1 
ATOM   3588  C CA  . GLY B 1 214 ? -0.026  10.525  -5.506  1.00 45.83  ? 212  GLY B CA  1 
ATOM   3589  C C   . GLY B 1 214 ? 1.319   11.219  -5.479  1.00 45.50  ? 212  GLY B C   1 
ATOM   3590  O O   . GLY B 1 214 ? 2.331   10.610  -5.136  1.00 45.34  ? 212  GLY B O   1 
ATOM   3591  N N   . ALA B 1 215 ? 1.326   12.499  -5.835  1.00 41.09  ? 213  ALA B N   1 
ATOM   3592  C CA  . ALA B 1 215 ? 2.556   13.287  -5.876  1.00 40.72  ? 213  ALA B CA  1 
ATOM   3593  C C   . ALA B 1 215 ? 3.582   12.833  -4.843  1.00 39.76  ? 213  ALA B C   1 
ATOM   3594  O O   . ALA B 1 215 ? 4.696   12.433  -5.197  1.00 38.26  ? 213  ALA B O   1 
ATOM   3595  C CB  . ALA B 1 215 ? 2.230   14.771  -5.682  1.00 45.09  ? 213  ALA B CB  1 
ATOM   3596  N N   . ALA B 1 216 ? 3.189   12.890  -3.571  1.00 37.83  ? 214  ALA B N   1 
ATOM   3597  C CA  . ALA B 1 216 ? 4.050   12.499  -2.455  1.00 39.09  ? 214  ALA B CA  1 
ATOM   3598  C C   . ALA B 1 216 ? 4.765   11.204  -2.776  1.00 40.80  ? 214  ALA B C   1 
ATOM   3599  O O   . ALA B 1 216 ? 5.967   11.189  -3.069  1.00 39.50  ? 214  ALA B O   1 
ATOM   3600  C CB  . ALA B 1 216 ? 3.215   12.324  -1.193  1.00 23.77  ? 214  ALA B CB  1 
ATOM   3601  N N   . LYS B 1 217 ? 3.999   10.120  -2.709  1.00 43.87  ? 215  LYS B N   1 
ATOM   3602  C CA  . LYS B 1 217 ? 4.496   8.787   -2.998  1.00 46.06  ? 215  LYS B CA  1 
ATOM   3603  C C   . LYS B 1 217 ? 5.458   8.904   -4.160  1.00 45.54  ? 215  LYS B C   1 
ATOM   3604  O O   . LYS B 1 217 ? 6.607   8.465   -4.079  1.00 46.29  ? 215  LYS B O   1 
ATOM   3605  C CB  . LYS B 1 217 ? 3.329   7.871   -3.367  1.00 69.54  ? 215  LYS B CB  1 
ATOM   3606  C CG  . LYS B 1 217 ? 3.726   6.447   -3.707  1.00 74.65  ? 215  LYS B CG  1 
ATOM   3607  C CD  . LYS B 1 217 ? 2.505   5.532   -3.746  1.00 78.91  ? 215  LYS B CD  1 
ATOM   3608  C CE  . LYS B 1 217 ? 2.883   4.057   -3.918  1.00 80.63  ? 215  LYS B CE  1 
ATOM   3609  N NZ  . LYS B 1 217 ? 1.688   3.168   -4.096  1.00 80.16  ? 215  LYS B NZ  1 
ATOM   3610  N N   . MET B 1 218 ? 4.987   9.527   -5.233  1.00 37.23  ? 216  MET B N   1 
ATOM   3611  C CA  . MET B 1 218 ? 5.817   9.702   -6.405  1.00 37.99  ? 216  MET B CA  1 
ATOM   3612  C C   . MET B 1 218 ? 7.147   10.325  -6.023  1.00 37.61  ? 216  MET B C   1 
ATOM   3613  O O   . MET B 1 218 ? 8.203   9.750   -6.274  1.00 37.06  ? 216  MET B O   1 
ATOM   3614  C CB  . MET B 1 218 ? 5.123   10.577  -7.432  1.00 58.99  ? 216  MET B CB  1 
ATOM   3615  C CG  . MET B 1 218 ? 5.766   10.447  -8.780  1.00 64.76  ? 216  MET B CG  1 
ATOM   3616  S SD  . MET B 1 218 ? 4.734   11.086  -10.078 1.00 73.23  ? 216  MET B SD  1 
ATOM   3617  C CE  . MET B 1 218 ? 5.806   12.400  -10.720 1.00 74.46  ? 216  MET B CE  1 
ATOM   3618  N N   . LEU B 1 219 ? 7.104   11.496  -5.404  1.00 52.30  ? 217  LEU B N   1 
ATOM   3619  C CA  . LEU B 1 219 ? 8.338   12.145  -5.002  1.00 56.10  ? 217  LEU B CA  1 
ATOM   3620  C C   . LEU B 1 219 ? 9.193   11.208  -4.154  1.00 59.71  ? 217  LEU B C   1 
ATOM   3621  O O   . LEU B 1 219 ? 10.404  11.091  -4.358  1.00 61.33  ? 217  LEU B O   1 
ATOM   3622  C CB  . LEU B 1 219 ? 8.042   13.410  -4.207  1.00 57.27  ? 217  LEU B CB  1 
ATOM   3623  C CG  . LEU B 1 219 ? 9.319   14.075  -3.690  1.00 57.84  ? 217  LEU B CG  1 
ATOM   3624  C CD1 . LEU B 1 219 ? 10.217  14.471  -4.861  1.00 56.39  ? 217  LEU B CD1 1 
ATOM   3625  C CD2 . LEU B 1 219 ? 8.953   15.282  -2.848  1.00 57.36  ? 217  LEU B CD2 1 
ATOM   3626  N N   . LEU B 1 220 ? 8.551   10.539  -3.205  1.00 58.72  ? 218  LEU B N   1 
ATOM   3627  C CA  . LEU B 1 220 ? 9.230   9.618   -2.305  1.00 59.32  ? 218  LEU B CA  1 
ATOM   3628  C C   . LEU B 1 220 ? 10.065  8.551   -2.986  1.00 62.97  ? 218  LEU B C   1 
ATOM   3629  O O   . LEU B 1 220 ? 11.288  8.525   -2.840  1.00 64.11  ? 218  LEU B O   1 
ATOM   3630  C CB  . LEU B 1 220 ? 8.197   8.972   -1.414  1.00 37.41  ? 218  LEU B CB  1 
ATOM   3631  C CG  . LEU B 1 220 ? 7.649   10.088  -0.534  1.00 34.65  ? 218  LEU B CG  1 
ATOM   3632  C CD1 . LEU B 1 220 ? 6.280   9.721   0.048   1.00 35.13  ? 218  LEU B CD1 1 
ATOM   3633  C CD2 . LEU B 1 220 ? 8.692   10.384  0.543   1.00 33.78  ? 218  LEU B CD2 1 
ATOM   3634  N N   . HIS B 1 221 ? 9.406   7.661   -3.715  1.00 78.48  ? 219  HIS B N   1 
ATOM   3635  C CA  . HIS B 1 221 ? 10.119  6.609   -4.418  1.00 83.79  ? 219  HIS B CA  1 
ATOM   3636  C C   . HIS B 1 221 ? 11.090  7.239   -5.397  1.00 86.09  ? 219  HIS B C   1 
ATOM   3637  O O   . HIS B 1 221 ? 12.307  7.105   -5.257  1.00 88.25  ? 219  HIS B O   1 
ATOM   3638  C CB  . HIS B 1 221 ? 9.135   5.725   -5.168  1.00 94.10  ? 219  HIS B CB  1 
ATOM   3639  C CG  . HIS B 1 221 ? 8.048   5.190   -4.298  1.00 97.39  ? 219  HIS B CG  1 
ATOM   3640  N ND1 . HIS B 1 221 ? 8.294   4.683   -3.041  1.00 98.99  ? 219  HIS B ND1 1 
ATOM   3641  C CD2 . HIS B 1 221 ? 6.715   5.077   -4.498  1.00 98.20  ? 219  HIS B CD2 1 
ATOM   3642  C CE1 . HIS B 1 221 ? 7.158   4.279   -2.504  1.00 99.28  ? 219  HIS B CE1 1 
ATOM   3643  N NE2 . HIS B 1 221 ? 6.184   4.506   -3.368  1.00 98.67  ? 219  HIS B NE2 1 
ATOM   3644  N N   . SER B 1 222 ? 10.530  7.933   -6.381  1.00 65.59  ? 220  SER B N   1 
ATOM   3645  C CA  . SER B 1 222 ? 11.297  8.613   -7.413  1.00 68.16  ? 220  SER B CA  1 
ATOM   3646  C C   . SER B 1 222 ? 12.573  9.222   -6.845  1.00 68.74  ? 220  SER B C   1 
ATOM   3647  O O   . SER B 1 222 ? 13.569  8.524   -6.652  1.00 68.09  ? 220  SER B O   1 
ATOM   3648  C CB  . SER B 1 222 ? 10.436  9.707   -8.038  1.00 99.27  ? 220  SER B CB  1 
ATOM   3649  O OG  . SER B 1 222 ? 9.166   9.200   -8.405  1.00 103.15 ? 220  SER B OG  1 
ATOM   3650  N N   . GLU B 1 223 ? 12.521  10.527  -6.585  1.00 96.61  ? 221  GLU B N   1 
ATOM   3651  C CA  . GLU B 1 223 ? 13.630  11.303  -6.028  1.00 98.59  ? 221  GLU B CA  1 
ATOM   3652  C C   . GLU B 1 223 ? 13.853  12.568  -6.843  1.00 97.29  ? 221  GLU B C   1 
ATOM   3653  O O   . GLU B 1 223 ? 13.781  13.678  -6.306  1.00 95.91  ? 221  GLU B O   1 
ATOM   3654  C CB  . GLU B 1 223 ? 14.936  10.502  -6.013  1.00 118.40 ? 221  GLU B CB  1 
ATOM   3655  C CG  . GLU B 1 223 ? 15.568  10.367  -7.382  1.00 126.15 ? 221  GLU B CG  1 
ATOM   3656  C CD  . GLU B 1 223 ? 16.719  9.407   -7.402  1.00 131.56 ? 221  GLU B CD  1 
ATOM   3657  O OE1 . GLU B 1 223 ? 17.628  9.565   -6.563  1.00 134.73 ? 221  GLU B OE1 1 
ATOM   3658  O OE2 . GLU B 1 223 ? 16.716  8.499   -8.260  1.00 134.89 ? 221  GLU B OE2 1 
ATOM   3659  N N   . GLN B 1 224 ? 14.104  12.380  -8.140  1.00 95.02  ? 222  GLN B N   1 
ATOM   3660  C CA  . GLN B 1 224 ? 14.385  13.465  -9.076  1.00 92.22  ? 222  GLN B CA  1 
ATOM   3661  C C   . GLN B 1 224 ? 14.663  14.780  -8.373  1.00 89.13  ? 222  GLN B C   1 
ATOM   3662  O O   . GLN B 1 224 ? 15.812  15.214  -8.251  1.00 89.08  ? 222  GLN B O   1 
ATOM   3663  C CB  . GLN B 1 224 ? 13.224  13.680  -10.056 1.00 92.04  ? 222  GLN B CB  1 
ATOM   3664  C CG  . GLN B 1 224 ? 13.081  12.646  -11.157 1.00 93.94  ? 222  GLN B CG  1 
ATOM   3665  C CD  . GLN B 1 224 ? 14.363  12.418  -11.940 1.00 96.68  ? 222  GLN B CD  1 
ATOM   3666  O OE1 . GLN B 1 224 ? 14.943  13.345  -12.506 1.00 97.70  ? 222  GLN B OE1 1 
ATOM   3667  N NE2 . GLN B 1 224 ? 14.807  11.169  -11.979 1.00 99.57  ? 222  GLN B NE2 1 
ATOM   3668  N N   . HIS B 1 225 ? 13.586  15.394  -7.900  1.00 68.45  ? 223  HIS B N   1 
ATOM   3669  C CA  . HIS B 1 225 ? 13.649  16.675  -7.236  1.00 63.88  ? 223  HIS B CA  1 
ATOM   3670  C C   . HIS B 1 225 ? 12.282  17.267  -7.499  1.00 61.74  ? 223  HIS B C   1 
ATOM   3671  O O   . HIS B 1 225 ? 11.840  17.333  -8.646  1.00 62.60  ? 223  HIS B O   1 
ATOM   3672  C CB  . HIS B 1 225 ? 14.697  17.554  -7.902  1.00 60.50  ? 223  HIS B CB  1 
ATOM   3673  C CG  . HIS B 1 225 ? 15.031  18.788  -7.133  1.00 59.66  ? 223  HIS B CG  1 
ATOM   3674  N ND1 . HIS B 1 225 ? 14.072  19.577  -6.535  1.00 59.92  ? 223  HIS B ND1 1 
ATOM   3675  C CD2 . HIS B 1 225 ? 16.217  19.404  -6.917  1.00 58.81  ? 223  HIS B CD2 1 
ATOM   3676  C CE1 . HIS B 1 225 ? 14.655  20.626  -5.984  1.00 59.96  ? 223  HIS B CE1 1 
ATOM   3677  N NE2 . HIS B 1 225 ? 15.955  20.545  -6.202  1.00 59.65  ? 223  HIS B NE2 1 
ATOM   3678  N N   . PRO B 1 226 ? 11.588  17.697  -6.446  1.00 60.97  ? 224  PRO B N   1 
ATOM   3679  C CA  . PRO B 1 226 ? 10.256  18.292  -6.567  1.00 57.94  ? 224  PRO B CA  1 
ATOM   3680  C C   . PRO B 1 226 ? 10.185  19.258  -7.741  1.00 56.35  ? 224  PRO B C   1 
ATOM   3681  O O   . PRO B 1 226 ? 9.166   19.345  -8.425  1.00 57.14  ? 224  PRO B O   1 
ATOM   3682  C CB  . PRO B 1 226 ? 10.082  18.993  -5.232  1.00 68.98  ? 224  PRO B CB  1 
ATOM   3683  C CG  . PRO B 1 226 ? 10.762  18.047  -4.298  1.00 71.76  ? 224  PRO B CG  1 
ATOM   3684  C CD  . PRO B 1 226 ? 12.032  17.676  -5.044  1.00 71.75  ? 224  PRO B CD  1 
ATOM   3685  N N   . GLY B 1 227 ? 11.274  19.984  -7.969  1.00 54.87  ? 225  GLY B N   1 
ATOM   3686  C CA  . GLY B 1 227 ? 11.311  20.920  -9.076  1.00 51.46  ? 225  GLY B CA  1 
ATOM   3687  C C   . GLY B 1 227 ? 11.195  20.144  -10.367 1.00 48.88  ? 225  GLY B C   1 
ATOM   3688  O O   . GLY B 1 227 ? 10.261  20.350  -11.138 1.00 46.37  ? 225  GLY B O   1 
ATOM   3689  N N   . GLN B 1 228 ? 12.142  19.238  -10.589 1.00 48.55  ? 226  GLN B N   1 
ATOM   3690  C CA  . GLN B 1 228 ? 12.142  18.414  -11.785 1.00 49.07  ? 226  GLN B CA  1 
ATOM   3691  C C   . GLN B 1 228 ? 10.754  17.843  -12.019 1.00 46.75  ? 226  GLN B C   1 
ATOM   3692  O O   . GLN B 1 228 ? 10.155  18.062  -13.069 1.00 49.36  ? 226  GLN B O   1 
ATOM   3693  C CB  . GLN B 1 228 ? 13.133  17.264  -11.641 1.00 73.87  ? 226  GLN B CB  1 
ATOM   3694  C CG  . GLN B 1 228 ? 13.196  16.372  -12.867 1.00 77.34  ? 226  GLN B CG  1 
ATOM   3695  C CD  . GLN B 1 228 ? 13.860  17.049  -14.049 1.00 80.81  ? 226  GLN B CD  1 
ATOM   3696  O OE1 . GLN B 1 228 ? 15.088  17.133  -14.125 1.00 82.87  ? 226  GLN B OE1 1 
ATOM   3697  N NE2 . GLN B 1 228 ? 13.049  17.545  -14.977 1.00 82.59  ? 226  GLN B NE2 1 
ATOM   3698  N N   . LEU B 1 229 ? 10.241  17.111  -11.038 1.00 32.44  ? 227  LEU B N   1 
ATOM   3699  C CA  . LEU B 1 229 ? 8.918   16.523  -11.168 1.00 32.84  ? 227  LEU B CA  1 
ATOM   3700  C C   . LEU B 1 229 ? 7.901   17.553  -11.636 1.00 33.94  ? 227  LEU B C   1 
ATOM   3701  O O   . LEU B 1 229 ? 7.061   17.273  -12.493 1.00 35.97  ? 227  LEU B O   1 
ATOM   3702  C CB  . LEU B 1 229 ? 8.459   15.937  -9.835  1.00 45.04  ? 227  LEU B CB  1 
ATOM   3703  C CG  . LEU B 1 229 ? 9.237   14.762  -9.251  1.00 42.93  ? 227  LEU B CG  1 
ATOM   3704  C CD1 . LEU B 1 229 ? 8.331   13.988  -8.294  1.00 43.49  ? 227  LEU B CD1 1 
ATOM   3705  C CD2 . LEU B 1 229 ? 9.704   13.852  -10.376 1.00 42.36  ? 227  LEU B CD2 1 
ATOM   3706  N N   . LYS B 1 230 ? 7.982   18.747  -11.064 1.00 38.85  ? 228  LYS B N   1 
ATOM   3707  C CA  . LYS B 1 230 ? 7.077   19.830  -11.414 1.00 37.67  ? 228  LYS B CA  1 
ATOM   3708  C C   . LYS B 1 230 ? 7.141   20.080  -12.927 1.00 37.06  ? 228  LYS B C   1 
ATOM   3709  O O   . LYS B 1 230 ? 6.115   20.168  -13.603 1.00 34.92  ? 228  LYS B O   1 
ATOM   3710  C CB  . LYS B 1 230 ? 7.485   21.086  -10.647 1.00 49.28  ? 228  LYS B CB  1 
ATOM   3711  C CG  . LYS B 1 230 ? 6.581   22.273  -10.854 1.00 47.83  ? 228  LYS B CG  1 
ATOM   3712  C CD  . LYS B 1 230 ? 7.389   23.558  -10.818 1.00 48.84  ? 228  LYS B CD  1 
ATOM   3713  C CE  . LYS B 1 230 ? 8.444   23.550  -11.923 1.00 48.87  ? 228  LYS B CE  1 
ATOM   3714  N NZ  . LYS B 1 230 ? 9.227   24.813  -12.003 1.00 48.48  ? 228  LYS B NZ  1 
ATOM   3715  N N   . ASP B 1 231 ? 8.360   20.185  -13.444 1.00 36.84  ? 229  ASP B N   1 
ATOM   3716  C CA  . ASP B 1 231 ? 8.592   20.412  -14.864 1.00 38.31  ? 229  ASP B CA  1 
ATOM   3717  C C   . ASP B 1 231 ? 7.893   19.337  -15.689 1.00 42.09  ? 229  ASP B C   1 
ATOM   3718  O O   . ASP B 1 231 ? 7.227   19.620  -16.686 1.00 45.09  ? 229  ASP B O   1 
ATOM   3719  C CB  . ASP B 1 231 ? 10.098  20.380  -15.150 1.00 36.26  ? 229  ASP B CB  1 
ATOM   3720  C CG  . ASP B 1 231 ? 10.870  21.404  -14.328 1.00 35.59  ? 229  ASP B CG  1 
ATOM   3721  O OD1 . ASP B 1 231 ? 10.296  21.893  -13.333 1.00 34.16  ? 229  ASP B OD1 1 
ATOM   3722  O OD2 . ASP B 1 231 ? 12.041  21.713  -14.661 1.00 33.60  ? 229  ASP B OD2 1 
ATOM   3723  N N   . ASN B 1 232 ? 8.048   18.096  -15.249 1.00 47.14  ? 230  ASN B N   1 
ATOM   3724  C CA  . ASN B 1 232 ? 7.466   16.944  -15.920 1.00 48.38  ? 230  ASN B CA  1 
ATOM   3725  C C   . ASN B 1 232 ? 5.943   16.955  -15.950 1.00 47.95  ? 230  ASN B C   1 
ATOM   3726  O O   . ASN B 1 232 ? 5.328   16.065  -16.521 1.00 49.25  ? 230  ASN B O   1 
ATOM   3727  C CB  . ASN B 1 232 ? 7.946   15.668  -15.229 1.00 78.76  ? 230  ASN B CB  1 
ATOM   3728  C CG  . ASN B 1 232 ? 9.457   15.556  -15.203 1.00 82.86  ? 230  ASN B CG  1 
ATOM   3729  O OD1 . ASN B 1 232 ? 10.167  16.547  -15.398 1.00 84.65  ? 230  ASN B OD1 1 
ATOM   3730  N ND2 . ASN B 1 232 ? 9.960   14.350  -14.949 1.00 85.31  ? 230  ASN B ND2 1 
ATOM   3731  N N   . VAL B 1 233 ? 5.324   17.956  -15.348 1.00 49.56  ? 231  VAL B N   1 
ATOM   3732  C CA  . VAL B 1 233 ? 3.874   17.983  -15.332 1.00 50.29  ? 231  VAL B CA  1 
ATOM   3733  C C   . VAL B 1 233 ? 3.325   19.308  -15.846 1.00 52.56  ? 231  VAL B C   1 
ATOM   3734  O O   . VAL B 1 233 ? 2.125   19.586  -15.760 1.00 54.23  ? 231  VAL B O   1 
ATOM   3735  C CB  . VAL B 1 233 ? 3.370   17.706  -13.909 1.00 45.27  ? 231  VAL B CB  1 
ATOM   3736  C CG1 . VAL B 1 233 ? 1.862   17.464  -13.911 1.00 45.63  ? 231  VAL B CG1 1 
ATOM   3737  C CG2 . VAL B 1 233 ? 4.106   16.502  -13.351 1.00 42.34  ? 231  VAL B CG2 1 
ATOM   3738  N N   . SER B 1 234 ? 4.212   20.122  -16.401 1.00 50.97  ? 232  SER B N   1 
ATOM   3739  C CA  . SER B 1 234 ? 3.817   21.413  -16.931 1.00 50.80  ? 232  SER B CA  1 
ATOM   3740  C C   . SER B 1 234 ? 4.072   21.467  -18.430 1.00 51.19  ? 232  SER B C   1 
ATOM   3741  O O   . SER B 1 234 ? 5.215   21.605  -18.868 1.00 52.60  ? 232  SER B O   1 
ATOM   3742  C CB  . SER B 1 234 ? 4.602   22.524  -16.236 1.00 45.40  ? 232  SER B CB  1 
ATOM   3743  O OG  . SER B 1 234 ? 4.436   22.458  -14.833 1.00 47.20  ? 232  SER B OG  1 
ATOM   3744  N N   . SER B 1 235 ? 3.009   21.338  -19.215 1.00 53.04  ? 233  SER B N   1 
ATOM   3745  C CA  . SER B 1 235 ? 3.126   21.401  -20.669 1.00 52.55  ? 233  SER B CA  1 
ATOM   3746  C C   . SER B 1 235 ? 3.314   22.867  -21.030 1.00 50.67  ? 233  SER B C   1 
ATOM   3747  O O   . SER B 1 235 ? 2.616   23.724  -20.483 1.00 52.46  ? 233  SER B O   1 
ATOM   3748  C CB  . SER B 1 235 ? 1.847   20.869  -21.325 1.00 60.85  ? 233  SER B CB  1 
ATOM   3749  O OG  . SER B 1 235 ? 0.702   21.568  -20.862 1.00 62.11  ? 233  SER B OG  1 
ATOM   3750  N N   . PRO B 1 236 ? 4.251   23.181  -21.947 1.00 41.45  ? 234  PRO B N   1 
ATOM   3751  C CA  . PRO B 1 236 ? 4.465   24.586  -22.322 1.00 39.87  ? 234  PRO B CA  1 
ATOM   3752  C C   . PRO B 1 236 ? 3.145   25.330  -22.478 1.00 39.73  ? 234  PRO B C   1 
ATOM   3753  O O   . PRO B 1 236 ? 3.045   26.529  -22.185 1.00 37.34  ? 234  PRO B O   1 
ATOM   3754  C CB  . PRO B 1 236 ? 5.255   24.478  -23.619 1.00 38.80  ? 234  PRO B CB  1 
ATOM   3755  C CG  . PRO B 1 236 ? 6.141   23.288  -23.341 1.00 39.89  ? 234  PRO B CG  1 
ATOM   3756  C CD  . PRO B 1 236 ? 5.164   22.294  -22.694 1.00 40.96  ? 234  PRO B CD  1 
ATOM   3757  N N   . GLY B 1 237 ? 2.124   24.605  -22.919 1.00 49.70  ? 235  GLY B N   1 
ATOM   3758  C CA  . GLY B 1 237 ? 0.819   25.211  -23.070 1.00 50.69  ? 235  GLY B CA  1 
ATOM   3759  C C   . GLY B 1 237 ? 0.438   25.924  -21.787 1.00 47.36  ? 235  GLY B C   1 
ATOM   3760  O O   . GLY B 1 237 ? 0.608   27.139  -21.674 1.00 47.48  ? 235  GLY B O   1 
ATOM   3761  N N   . GLY B 1 238 ? -0.063  25.170  -20.813 1.00 30.45  ? 236  GLY B N   1 
ATOM   3762  C CA  . GLY B 1 238 ? -0.463  25.783  -19.564 1.00 28.14  ? 236  GLY B CA  1 
ATOM   3763  C C   . GLY B 1 238 ? -1.366  24.965  -18.671 1.00 26.93  ? 236  GLY B C   1 
ATOM   3764  O O   . GLY B 1 238 ? -1.095  23.799  -18.388 1.00 26.41  ? 236  GLY B O   1 
ATOM   3765  N N   . ALA B 1 239 ? -2.450  25.593  -18.229 1.00 52.11  ? 237  ALA B N   1 
ATOM   3766  C CA  . ALA B 1 239 ? -3.422  24.970  -17.337 1.00 54.08  ? 237  ALA B CA  1 
ATOM   3767  C C   . ALA B 1 239 ? -2.722  24.781  -16.008 1.00 54.96  ? 237  ALA B C   1 
ATOM   3768  O O   . ALA B 1 239 ? -3.174  25.250  -14.966 1.00 55.26  ? 237  ALA B O   1 
ATOM   3769  C CB  . ALA B 1 239 ? -3.870  23.631  -17.887 1.00 15.72  ? 237  ALA B CB  1 
ATOM   3770  N N   . THR B 1 240 ? -1.596  24.091  -16.073 1.00 27.91  ? 238  THR B N   1 
ATOM   3771  C CA  . THR B 1 240 ? -0.783  23.810  -14.918 1.00 26.04  ? 238  THR B CA  1 
ATOM   3772  C C   . THR B 1 240 ? 0.176   24.964  -14.706 1.00 27.35  ? 238  THR B C   1 
ATOM   3773  O O   . THR B 1 240 ? 0.038   25.751  -13.768 1.00 27.82  ? 238  THR B O   1 
ATOM   3774  C CB  . THR B 1 240 ? -0.003  22.524  -15.154 1.00 32.49  ? 238  THR B CB  1 
ATOM   3775  O OG1 . THR B 1 240 ? -0.899  21.420  -15.012 1.00 32.27  ? 238  THR B OG1 1 
ATOM   3776  C CG2 . THR B 1 240 ? 1.167   22.395  -14.183 1.00 33.05  ? 238  THR B CG2 1 
ATOM   3777  N N   . ILE B 1 241 ? 1.159   25.044  -15.588 1.00 46.60  ? 239  ILE B N   1 
ATOM   3778  C CA  . ILE B 1 241 ? 2.150   26.098  -15.542 1.00 47.32  ? 239  ILE B CA  1 
ATOM   3779  C C   . ILE B 1 241 ? 1.449   27.407  -15.204 1.00 46.83  ? 239  ILE B C   1 
ATOM   3780  O O   . ILE B 1 241 ? 2.039   28.314  -14.618 1.00 49.67  ? 239  ILE B O   1 
ATOM   3781  C CB  . ILE B 1 241 ? 2.784   26.266  -16.896 1.00 43.82  ? 239  ILE B CB  1 
ATOM   3782  C CG1 . ILE B 1 241 ? 3.924   27.278  -16.831 1.00 44.76  ? 239  ILE B CG1 1 
ATOM   3783  C CG2 . ILE B 1 241 ? 1.736   26.729  -17.855 1.00 44.28  ? 239  ILE B CG2 1 
ATOM   3784  C CD1 . ILE B 1 241 ? 5.143   26.763  -16.118 1.00 42.01  ? 239  ILE B CD1 1 
ATOM   3785  N N   . HIS B 1 242 ? 0.190   27.516  -15.602 1.00 29.72  ? 240  HIS B N   1 
ATOM   3786  C CA  . HIS B 1 242 ? -0.543  28.720  -15.298 1.00 28.05  ? 240  HIS B CA  1 
ATOM   3787  C C   . HIS B 1 242 ? -0.808  28.729  -13.808 1.00 27.83  ? 240  HIS B C   1 
ATOM   3788  O O   . HIS B 1 242 ? -0.228  29.534  -13.076 1.00 29.17  ? 240  HIS B O   1 
ATOM   3789  C CB  . HIS B 1 242 ? -1.837  28.773  -16.108 1.00 37.46  ? 240  HIS B CB  1 
ATOM   3790  C CG  . HIS B 1 242 ? -1.631  29.242  -17.517 1.00 38.85  ? 240  HIS B CG  1 
ATOM   3791  N ND1 . HIS B 1 242 ? -2.428  30.198  -18.113 1.00 37.07  ? 240  HIS B ND1 1 
ATOM   3792  C CD2 . HIS B 1 242 ? -0.665  28.946  -18.421 1.00 36.89  ? 240  HIS B CD2 1 
ATOM   3793  C CE1 . HIS B 1 242 ? -1.956  30.475  -19.315 1.00 34.88  ? 240  HIS B CE1 1 
ATOM   3794  N NE2 . HIS B 1 242 ? -0.886  29.730  -19.527 1.00 35.09  ? 240  HIS B NE2 1 
ATOM   3795  N N   . ALA B 1 243 ? -1.661  27.817  -13.358 1.00 34.77  ? 241  ALA B N   1 
ATOM   3796  C CA  . ALA B 1 243 ? -1.997  27.713  -11.940 1.00 33.90  ? 241  ALA B CA  1 
ATOM   3797  C C   . ALA B 1 243 ? -0.770  27.965  -11.061 1.00 33.42  ? 241  ALA B C   1 
ATOM   3798  O O   . ALA B 1 243 ? -0.851  28.671  -10.057 1.00 32.79  ? 241  ALA B O   1 
ATOM   3799  C CB  . ALA B 1 243 ? -2.586  26.335  -11.640 1.00 25.56  ? 241  ALA B CB  1 
ATOM   3800  N N   . LEU B 1 244 ? 0.363   27.384  -11.437 1.00 20.40  ? 242  LEU B N   1 
ATOM   3801  C CA  . LEU B 1 244 ? 1.587   27.581  -10.674 1.00 22.29  ? 242  LEU B CA  1 
ATOM   3802  C C   . LEU B 1 244 ? 1.853   29.072  -10.563 1.00 24.50  ? 242  LEU B C   1 
ATOM   3803  O O   . LEU B 1 244 ? 1.848   29.655  -9.471  1.00 26.14  ? 242  LEU B O   1 
ATOM   3804  C CB  . LEU B 1 244 ? 2.772   26.912  -11.370 1.00 38.06  ? 242  LEU B CB  1 
ATOM   3805  C CG  . LEU B 1 244 ? 2.668   25.396  -11.513 1.00 41.57  ? 242  LEU B CG  1 
ATOM   3806  C CD1 . LEU B 1 244 ? 4.033   24.826  -11.853 1.00 39.13  ? 242  LEU B CD1 1 
ATOM   3807  C CD2 . LEU B 1 244 ? 2.160   24.795  -10.206 1.00 42.49  ? 242  LEU B CD2 1 
ATOM   3808  N N   . HIS B 1 245 ? 2.097   29.684  -11.711 1.00 29.66  ? 243  HIS B N   1 
ATOM   3809  C CA  . HIS B 1 245 ? 2.344   31.105  -11.755 1.00 29.22  ? 243  HIS B CA  1 
ATOM   3810  C C   . HIS B 1 245 ? 1.451   31.804  -10.747 1.00 25.70  ? 243  HIS B C   1 
ATOM   3811  O O   . HIS B 1 245 ? 1.881   32.736  -10.073 1.00 25.89  ? 243  HIS B O   1 
ATOM   3812  C CB  . HIS B 1 245 ? 2.033   31.642  -13.139 1.00 48.16  ? 243  HIS B CB  1 
ATOM   3813  C CG  . HIS B 1 245 ? 2.210   33.117  -13.251 1.00 50.19  ? 243  HIS B CG  1 
ATOM   3814  N ND1 . HIS B 1 245 ? 3.414   33.738  -12.999 1.00 50.66  ? 243  HIS B ND1 1 
ATOM   3815  C CD2 . HIS B 1 245 ? 1.334   34.099  -13.560 1.00 51.02  ? 243  HIS B CD2 1 
ATOM   3816  C CE1 . HIS B 1 245 ? 3.271   35.042  -13.146 1.00 53.77  ? 243  HIS B CE1 1 
ATOM   3817  N NE2 . HIS B 1 245 ? 2.019   35.288  -13.486 1.00 55.04  ? 243  HIS B NE2 1 
ATOM   3818  N N   . VAL B 1 246 ? 0.207   31.343  -10.650 1.00 25.31  ? 244  VAL B N   1 
ATOM   3819  C CA  . VAL B 1 246 ? -0.754  31.926  -9.726  1.00 26.79  ? 244  VAL B CA  1 
ATOM   3820  C C   . VAL B 1 246 ? -0.322  31.794  -8.273  1.00 27.14  ? 244  VAL B C   1 
ATOM   3821  O O   . VAL B 1 246 ? -0.450  32.739  -7.491  1.00 30.14  ? 244  VAL B O   1 
ATOM   3822  C CB  . VAL B 1 246 ? -2.153  31.293  -9.896  1.00 34.63  ? 244  VAL B CB  1 
ATOM   3823  C CG1 . VAL B 1 246 ? -2.665  30.703  -8.574  1.00 29.23  ? 244  VAL B CG1 1 
ATOM   3824  C CG2 . VAL B 1 246 ? -3.107  32.343  -10.387 1.00 35.77  ? 244  VAL B CG2 1 
ATOM   3825  N N   . LEU B 1 247 ? 0.167   30.616  -7.904  1.00 25.47  ? 245  LEU B N   1 
ATOM   3826  C CA  . LEU B 1 247 ? 0.627   30.398  -6.539  1.00 21.71  ? 245  LEU B CA  1 
ATOM   3827  C C   . LEU B 1 247 ? 1.890   31.219  -6.445  1.00 20.56  ? 245  LEU B C   1 
ATOM   3828  O O   . LEU B 1 247 ? 1.988   32.163  -5.680  1.00 19.40  ? 245  LEU B O   1 
ATOM   3829  C CB  . LEU B 1 247 ? 0.966   28.922  -6.308  1.00 20.84  ? 245  LEU B CB  1 
ATOM   3830  C CG  . LEU B 1 247 ? -0.135  27.911  -6.638  1.00 19.87  ? 245  LEU B CG  1 
ATOM   3831  C CD1 . LEU B 1 247 ? 0.412   26.493  -6.460  1.00 11.85  ? 245  LEU B CD1 1 
ATOM   3832  C CD2 . LEU B 1 247 ? -1.379  28.172  -5.762  1.00 11.99  ? 245  LEU B CD2 1 
ATOM   3833  N N   . GLU B 1 248 ? 2.856   30.845  -7.263  1.00 30.35  ? 246  GLU B N   1 
ATOM   3834  C CA  . GLU B 1 248 ? 4.128   31.528  -7.305  1.00 36.38  ? 246  GLU B CA  1 
ATOM   3835  C C   . GLU B 1 248 ? 3.991   33.055  -7.269  1.00 40.31  ? 246  GLU B C   1 
ATOM   3836  O O   . GLU B 1 248 ? 4.909   33.768  -6.862  1.00 42.89  ? 246  GLU B O   1 
ATOM   3837  C CB  . GLU B 1 248 ? 4.852   31.087  -8.562  1.00 35.07  ? 246  GLU B CB  1 
ATOM   3838  C CG  . GLU B 1 248 ? 5.434   29.709  -8.450  1.00 38.57  ? 246  GLU B CG  1 
ATOM   3839  C CD  . GLU B 1 248 ? 6.703   29.695  -7.633  1.00 40.00  ? 246  GLU B CD  1 
ATOM   3840  O OE1 . GLU B 1 248 ? 6.653   30.064  -6.435  1.00 40.39  ? 246  GLU B OE1 1 
ATOM   3841  O OE2 . GLU B 1 248 ? 7.752   29.317  -8.205  1.00 43.00  ? 246  GLU B OE2 1 
ATOM   3842  N N   . SER B 1 249 ? 2.839   33.559  -7.686  1.00 38.17  ? 247  SER B N   1 
ATOM   3843  C CA  . SER B 1 249 ? 2.633   34.990  -7.698  1.00 38.11  ? 247  SER B CA  1 
ATOM   3844  C C   . SER B 1 249 ? 2.007   35.460  -6.391  1.00 38.85  ? 247  SER B C   1 
ATOM   3845  O O   . SER B 1 249 ? 1.791   36.653  -6.184  1.00 40.49  ? 247  SER B O   1 
ATOM   3846  C CB  . SER B 1 249 ? 1.748   35.368  -8.878  1.00 38.09  ? 247  SER B CB  1 
ATOM   3847  O OG  . SER B 1 249 ? 1.975   36.713  -9.259  1.00 42.92  ? 247  SER B OG  1 
ATOM   3848  N N   . GLY B 1 250 ? 1.714   34.511  -5.512  1.00 39.48  ? 248  GLY B N   1 
ATOM   3849  C CA  . GLY B 1 250 ? 1.130   34.833  -4.220  1.00 39.53  ? 248  GLY B CA  1 
ATOM   3850  C C   . GLY B 1 250 ? 2.048   34.389  -3.085  1.00 40.56  ? 248  GLY B C   1 
ATOM   3851  O O   . GLY B 1 250 ? 1.608   34.197  -1.946  1.00 39.08  ? 248  GLY B O   1 
ATOM   3852  N N   . GLY B 1 251 ? 3.329   34.209  -3.413  1.00 41.22  ? 249  GLY B N   1 
ATOM   3853  C CA  . GLY B 1 251 ? 4.321   33.800  -2.431  1.00 40.99  ? 249  GLY B CA  1 
ATOM   3854  C C   . GLY B 1 251 ? 3.991   32.488  -1.765  1.00 40.36  ? 249  GLY B C   1 
ATOM   3855  O O   . GLY B 1 251 ? 4.513   32.177  -0.698  1.00 42.16  ? 249  GLY B O   1 
ATOM   3856  N N   . PHE B 1 252 ? 3.113   31.727  -2.407  1.00 39.96  ? 250  PHE B N   1 
ATOM   3857  C CA  . PHE B 1 252 ? 2.674   30.424  -1.920  1.00 39.29  ? 250  PHE B CA  1 
ATOM   3858  C C   . PHE B 1 252 ? 3.757   29.674  -1.136  1.00 38.71  ? 250  PHE B C   1 
ATOM   3859  O O   . PHE B 1 252 ? 3.476   29.066  -0.096  1.00 36.51  ? 250  PHE B O   1 
ATOM   3860  C CB  . PHE B 1 252 ? 2.205   29.577  -3.105  1.00 33.82  ? 250  PHE B CB  1 
ATOM   3861  C CG  . PHE B 1 252 ? 1.897   28.158  -2.747  1.00 28.25  ? 250  PHE B CG  1 
ATOM   3862  C CD1 . PHE B 1 252 ? 0.778   27.845  -1.990  1.00 25.44  ? 250  PHE B CD1 1 
ATOM   3863  C CD2 . PHE B 1 252 ? 2.744   27.134  -3.147  1.00 26.05  ? 250  PHE B CD2 1 
ATOM   3864  C CE1 . PHE B 1 252 ? 0.507   26.522  -1.631  1.00 22.66  ? 250  PHE B CE1 1 
ATOM   3865  C CE2 . PHE B 1 252 ? 2.485   25.811  -2.793  1.00 25.09  ? 250  PHE B CE2 1 
ATOM   3866  C CZ  . PHE B 1 252 ? 1.361   25.505  -2.032  1.00 24.35  ? 250  PHE B CZ  1 
ATOM   3867  N N   . ARG B 1 253 ? 4.988   29.703  -1.637  1.00 33.45  ? 251  ARG B N   1 
ATOM   3868  C CA  . ARG B 1 253 ? 6.075   29.037  -0.943  1.00 32.92  ? 251  ARG B CA  1 
ATOM   3869  C C   . ARG B 1 253 ? 6.279   29.765  0.378   1.00 34.47  ? 251  ARG B C   1 
ATOM   3870  O O   . ARG B 1 253 ? 5.988   29.227  1.441   1.00 36.00  ? 251  ARG B O   1 
ATOM   3871  C CB  . ARG B 1 253 ? 7.345   29.092  -1.776  1.00 29.34  ? 251  ARG B CB  1 
ATOM   3872  C CG  . ARG B 1 253 ? 7.165   28.542  -3.159  1.00 27.43  ? 251  ARG B CG  1 
ATOM   3873  C CD  . ARG B 1 253 ? 8.496   28.297  -3.814  1.00 29.49  ? 251  ARG B CD  1 
ATOM   3874  N NE  . ARG B 1 253 ? 8.353   27.791  -5.173  1.00 30.69  ? 251  ARG B NE  1 
ATOM   3875  C CZ  . ARG B 1 253 ? 9.296   27.097  -5.795  1.00 31.68  ? 251  ARG B CZ  1 
ATOM   3876  N NH1 . ARG B 1 253 ? 10.434  26.837  -5.168  1.00 29.90  ? 251  ARG B NH1 1 
ATOM   3877  N NH2 . ARG B 1 253 ? 9.105   26.656  -7.033  1.00 31.90  ? 251  ARG B NH2 1 
ATOM   3878  N N   . SER B 1 254 ? 6.766   30.997  0.301   1.00 41.07  ? 252  SER B N   1 
ATOM   3879  C CA  . SER B 1 254 ? 6.990   31.812  1.488   1.00 43.00  ? 252  SER B CA  1 
ATOM   3880  C C   . SER B 1 254 ? 6.132   31.350  2.656   1.00 43.50  ? 252  SER B C   1 
ATOM   3881  O O   . SER B 1 254 ? 6.637   31.014  3.728   1.00 46.53  ? 252  SER B O   1 
ATOM   3882  C CB  . SER B 1 254 ? 6.658   33.268  1.185   1.00 42.33  ? 252  SER B CB  1 
ATOM   3883  O OG  . SER B 1 254 ? 7.514   33.780  0.191   1.00 44.59  ? 252  SER B OG  1 
ATOM   3884  N N   . LEU B 1 255 ? 4.827   31.319  2.434   1.00 31.68  ? 253  LEU B N   1 
ATOM   3885  C CA  . LEU B 1 255 ? 3.906   30.915  3.474   1.00 29.07  ? 253  LEU B CA  1 
ATOM   3886  C C   . LEU B 1 255 ? 4.295   29.600  4.138   1.00 28.58  ? 253  LEU B C   1 
ATOM   3887  O O   . LEU B 1 255 ? 4.234   29.479  5.358   1.00 30.70  ? 253  LEU B O   1 
ATOM   3888  C CB  . LEU B 1 255 ? 2.486   30.836  2.907   1.00 30.91  ? 253  LEU B CB  1 
ATOM   3889  C CG  . LEU B 1 255 ? 2.032   32.037  2.063   1.00 27.83  ? 253  LEU B CG  1 
ATOM   3890  C CD1 . LEU B 1 255 ? 0.509   32.128  2.051   1.00 23.61  ? 253  LEU B CD1 1 
ATOM   3891  C CD2 . LEU B 1 255 ? 2.615   33.316  2.641   1.00 31.75  ? 253  LEU B CD2 1 
ATOM   3892  N N   . LEU B 1 256 ? 4.712   28.615  3.355   1.00 30.45  ? 254  LEU B N   1 
ATOM   3893  C CA  . LEU B 1 256 ? 5.095   27.329  3.936   1.00 30.08  ? 254  LEU B CA  1 
ATOM   3894  C C   . LEU B 1 256 ? 6.350   27.428  4.811   1.00 29.06  ? 254  LEU B C   1 
ATOM   3895  O O   . LEU B 1 256 ? 6.386   26.868  5.912   1.00 27.63  ? 254  LEU B O   1 
ATOM   3896  C CB  . LEU B 1 256 ? 5.278   26.271  2.831   1.00 33.62  ? 254  LEU B CB  1 
ATOM   3897  C CG  . LEU B 1 256 ? 3.987   25.873  2.077   1.00 32.26  ? 254  LEU B CG  1 
ATOM   3898  C CD1 . LEU B 1 256 ? 4.286   25.049  0.805   1.00 24.71  ? 254  LEU B CD1 1 
ATOM   3899  C CD2 . LEU B 1 256 ? 3.083   25.101  3.038   1.00 26.93  ? 254  LEU B CD2 1 
ATOM   3900  N N   . ILE B 1 257 ? 7.378   28.132  4.349   1.00 20.57  ? 255  ILE B N   1 
ATOM   3901  C CA  . ILE B 1 257 ? 8.573   28.259  5.178   1.00 21.43  ? 255  ILE B CA  1 
ATOM   3902  C C   . ILE B 1 257 ? 8.128   28.941  6.455   1.00 21.96  ? 255  ILE B C   1 
ATOM   3903  O O   . ILE B 1 257 ? 8.477   28.550  7.562   1.00 21.69  ? 255  ILE B O   1 
ATOM   3904  C CB  . ILE B 1 257 ? 9.617   29.192  4.605   1.00 23.70  ? 255  ILE B CB  1 
ATOM   3905  C CG1 . ILE B 1 257 ? 9.869   28.901  3.128   1.00 27.37  ? 255  ILE B CG1 1 
ATOM   3906  C CG2 . ILE B 1 257 ? 10.869  29.070  5.431   1.00 21.13  ? 255  ILE B CG2 1 
ATOM   3907  C CD1 . ILE B 1 257 ? 10.371  27.532  2.836   1.00 39.39  ? 255  ILE B CD1 1 
ATOM   3908  N N   . ASN B 1 258 ? 7.358   29.996  6.283   1.00 24.22  ? 256  ASN B N   1 
ATOM   3909  C CA  . ASN B 1 258 ? 6.872   30.726  7.418   1.00 24.51  ? 256  ASN B CA  1 
ATOM   3910  C C   . ASN B 1 258 ? 6.231   29.824  8.430   1.00 25.99  ? 256  ASN B C   1 
ATOM   3911  O O   . ASN B 1 258 ? 6.441   29.989  9.623   1.00 29.47  ? 256  ASN B O   1 
ATOM   3912  C CB  . ASN B 1 258 ? 5.875   31.753  6.958   1.00 16.95  ? 256  ASN B CB  1 
ATOM   3913  C CG  . ASN B 1 258 ? 6.537   32.899  6.293   1.00 18.10  ? 256  ASN B CG  1 
ATOM   3914  O OD1 . ASN B 1 258 ? 7.663   32.778  5.813   1.00 16.19  ? 256  ASN B OD1 1 
ATOM   3915  N ND2 . ASN B 1 258 ? 5.855   34.030  6.249   1.00 21.20  ? 256  ASN B ND2 1 
ATOM   3916  N N   . ALA B 1 259 ? 5.450   28.865  7.961   1.00 37.16  ? 257  ALA B N   1 
ATOM   3917  C CA  . ALA B 1 259 ? 4.772   27.972  8.882   1.00 39.96  ? 257  ALA B CA  1 
ATOM   3918  C C   . ALA B 1 259 ? 5.702   26.929  9.487   1.00 41.63  ? 257  ALA B C   1 
ATOM   3919  O O   . ALA B 1 259 ? 5.598   26.632  10.681  1.00 43.40  ? 257  ALA B O   1 
ATOM   3920  C CB  . ALA B 1 259 ? 3.583   27.300  8.199   1.00 29.84  ? 257  ALA B CB  1 
ATOM   3921  N N   . VAL B 1 260 ? 6.614   26.373  8.695   1.00 32.83  ? 258  VAL B N   1 
ATOM   3922  C CA  . VAL B 1 260 ? 7.510   25.375  9.267   1.00 36.01  ? 258  VAL B CA  1 
ATOM   3923  C C   . VAL B 1 260 ? 8.257   26.070  10.392  1.00 38.28  ? 258  VAL B C   1 
ATOM   3924  O O   . VAL B 1 260 ? 8.306   25.592  11.523  1.00 40.47  ? 258  VAL B O   1 
ATOM   3925  C CB  . VAL B 1 260 ? 8.522   24.802  8.220   1.00 34.87  ? 258  VAL B CB  1 
ATOM   3926  C CG1 . VAL B 1 260 ? 9.528   25.847  7.812   1.00 37.47  ? 258  VAL B CG1 1 
ATOM   3927  C CG2 . VAL B 1 260 ? 9.245   23.606  8.802   1.00 32.93  ? 258  VAL B CG2 1 
ATOM   3928  N N   . GLU B 1 261 ? 8.803   27.231  10.070  1.00 46.30  ? 259  GLU B N   1 
ATOM   3929  C CA  . GLU B 1 261 ? 9.550   28.033  11.014  1.00 45.50  ? 259  GLU B CA  1 
ATOM   3930  C C   . GLU B 1 261 ? 8.654   28.345  12.207  1.00 44.44  ? 259  GLU B C   1 
ATOM   3931  O O   . GLU B 1 261 ? 8.831   27.801  13.288  1.00 46.33  ? 259  GLU B O   1 
ATOM   3932  C CB  . GLU B 1 261 ? 9.992   29.317  10.314  1.00 43.71  ? 259  GLU B CB  1 
ATOM   3933  C CG  . GLU B 1 261 ? 10.800  30.270  11.158  1.00 46.03  ? 259  GLU B CG  1 
ATOM   3934  C CD  . GLU B 1 261 ? 11.108  31.575  10.429  1.00 47.15  ? 259  GLU B CD  1 
ATOM   3935  O OE1 . GLU B 1 261 ? 10.156  32.324  10.100  1.00 47.53  ? 259  GLU B OE1 1 
ATOM   3936  O OE2 . GLU B 1 261 ? 12.304  31.848  10.184  1.00 46.24  ? 259  GLU B OE2 1 
ATOM   3937  N N   . ALA B 1 262 ? 7.676   29.212  11.993  1.00 37.47  ? 260  ALA B N   1 
ATOM   3938  C CA  . ALA B 1 262 ? 6.752   29.609  13.043  1.00 37.50  ? 260  ALA B CA  1 
ATOM   3939  C C   . ALA B 1 262 ? 6.335   28.450  13.937  1.00 40.01  ? 260  ALA B C   1 
ATOM   3940  O O   . ALA B 1 262 ? 6.103   28.641  15.131  1.00 40.80  ? 260  ALA B O   1 
ATOM   3941  C CB  . ALA B 1 262 ? 5.524   30.255  12.431  1.00 24.41  ? 260  ALA B CB  1 
ATOM   3942  N N   . SER B 1 263 ? 6.216   27.254  13.364  1.00 44.98  ? 261  SER B N   1 
ATOM   3943  C CA  . SER B 1 263 ? 5.836   26.089  14.159  1.00 47.29  ? 261  SER B CA  1 
ATOM   3944  C C   . SER B 1 263 ? 7.015   25.683  15.002  1.00 49.13  ? 261  SER B C   1 
ATOM   3945  O O   . SER B 1 263 ? 6.923   25.606  16.221  1.00 51.18  ? 261  SER B O   1 
ATOM   3946  C CB  . SER B 1 263 ? 5.461   24.907  13.277  1.00 62.83  ? 261  SER B CB  1 
ATOM   3947  O OG  . SER B 1 263 ? 5.440   23.718  14.050  1.00 61.74  ? 261  SER B OG  1 
ATOM   3948  N N   . CYS B 1 264 ? 8.122   25.410  14.326  1.00 46.16  ? 262  CYS B N   1 
ATOM   3949  C CA  . CYS B 1 264 ? 9.352   25.016  14.990  1.00 48.67  ? 262  CYS B CA  1 
ATOM   3950  C C   . CYS B 1 264 ? 9.656   25.943  16.158  1.00 46.43  ? 262  CYS B C   1 
ATOM   3951  O O   . CYS B 1 264 ? 9.819   25.495  17.291  1.00 48.29  ? 262  CYS B O   1 
ATOM   3952  C CB  . CYS B 1 264 ? 10.514  25.043  13.998  1.00 64.28  ? 262  CYS B CB  1 
ATOM   3953  S SG  . CYS B 1 264 ? 12.132  24.970  14.788  1.00 73.86  ? 262  CYS B SG  1 
ATOM   3954  N N   . ILE B 1 265 ? 9.732   27.238  15.878  1.00 41.51  ? 263  ILE B N   1 
ATOM   3955  C CA  . ILE B 1 265 ? 10.012  28.223  16.913  1.00 41.30  ? 263  ILE B CA  1 
ATOM   3956  C C   . ILE B 1 265 ? 9.104   28.014  18.112  1.00 40.71  ? 263  ILE B C   1 
ATOM   3957  O O   . ILE B 1 265 ? 9.578   27.825  19.228  1.00 40.60  ? 263  ILE B O   1 
ATOM   3958  C CB  . ILE B 1 265 ? 9.805   29.641  16.393  1.00 48.06  ? 263  ILE B CB  1 
ATOM   3959  C CG1 . ILE B 1 265 ? 10.860  29.956  15.337  1.00 48.97  ? 263  ILE B CG1 1 
ATOM   3960  C CG2 . ILE B 1 265 ? 9.874   30.627  17.537  1.00 46.13  ? 263  ILE B CG2 1 
ATOM   3961  C CD1 . ILE B 1 265 ? 10.547  31.197  14.531  1.00 54.04  ? 263  ILE B CD1 1 
ATOM   3962  N N   . ARG B 1 266 ? 7.798   28.049  17.884  1.00 42.51  ? 264  ARG B N   1 
ATOM   3963  C CA  . ARG B 1 266 ? 6.848   27.853  18.970  1.00 42.43  ? 264  ARG B CA  1 
ATOM   3964  C C   . ARG B 1 266 ? 7.271   26.656  19.797  1.00 43.61  ? 264  ARG B C   1 
ATOM   3965  O O   . ARG B 1 266 ? 7.272   26.703  21.026  1.00 43.40  ? 264  ARG B O   1 
ATOM   3966  C CB  . ARG B 1 266 ? 5.449   27.608  18.425  1.00 40.05  ? 264  ARG B CB  1 
ATOM   3967  C CG  . ARG B 1 266 ? 4.457   27.221  19.501  1.00 38.41  ? 264  ARG B CG  1 
ATOM   3968  C CD  . ARG B 1 266 ? 4.455   28.212  20.660  1.00 34.56  ? 264  ARG B CD  1 
ATOM   3969  N NE  . ARG B 1 266 ? 3.267   28.061  21.500  1.00 32.30  ? 264  ARG B NE  1 
ATOM   3970  C CZ  . ARG B 1 266 ? 3.014   28.793  22.581  1.00 31.55  ? 264  ARG B CZ  1 
ATOM   3971  N NH1 . ARG B 1 266 ? 3.872   29.731  22.962  1.00 32.73  ? 264  ARG B NH1 1 
ATOM   3972  N NH2 . ARG B 1 266 ? 1.894   28.603  23.271  1.00 29.65  ? 264  ARG B NH2 1 
ATOM   3973  N N   . THR B 1 267 ? 7.630   25.580  19.108  1.00 44.35  ? 265  THR B N   1 
ATOM   3974  C CA  . THR B 1 267 ? 8.069   24.368  19.772  1.00 46.11  ? 265  THR B CA  1 
ATOM   3975  C C   . THR B 1 267 ? 9.172   24.712  20.760  1.00 47.87  ? 265  THR B C   1 
ATOM   3976  O O   . THR B 1 267 ? 9.081   24.388  21.945  1.00 49.32  ? 265  THR B O   1 
ATOM   3977  C CB  . THR B 1 267 ? 8.604   23.357  18.759  1.00 44.26  ? 265  THR B CB  1 
ATOM   3978  O OG1 . THR B 1 267 ? 7.525   22.885  17.941  1.00 46.66  ? 265  THR B OG1 1 
ATOM   3979  C CG2 . THR B 1 267 ? 9.259   22.189  19.472  1.00 45.23  ? 265  THR B CG2 1 
ATOM   3980  N N   . ARG B 1 268 ? 10.211  25.376  20.265  1.00 46.13  ? 266  ARG B N   1 
ATOM   3981  C CA  . ARG B 1 268 ? 11.327  25.767  21.107  1.00 47.77  ? 266  ARG B CA  1 
ATOM   3982  C C   . ARG B 1 268 ? 10.818  26.536  22.319  1.00 50.97  ? 266  ARG B C   1 
ATOM   3983  O O   . ARG B 1 268 ? 11.151  26.196  23.454  1.00 51.55  ? 266  ARG B O   1 
ATOM   3984  C CB  . ARG B 1 268 ? 12.308  26.633  20.322  1.00 52.49  ? 266  ARG B CB  1 
ATOM   3985  C CG  . ARG B 1 268 ? 12.974  25.910  19.171  1.00 56.43  ? 266  ARG B CG  1 
ATOM   3986  C CD  . ARG B 1 268 ? 13.789  26.862  18.294  1.00 59.94  ? 266  ARG B CD  1 
ATOM   3987  N NE  . ARG B 1 268 ? 14.366  26.173  17.138  1.00 62.44  ? 266  ARG B NE  1 
ATOM   3988  C CZ  . ARG B 1 268 ? 15.016  26.770  16.140  1.00 63.09  ? 266  ARG B CZ  1 
ATOM   3989  N NH1 . ARG B 1 268 ? 15.178  28.088  16.141  1.00 63.50  ? 266  ARG B NH1 1 
ATOM   3990  N NH2 . ARG B 1 268 ? 15.510  26.044  15.141  1.00 64.01  ? 266  ARG B NH2 1 
ATOM   3991  N N   . GLU B 1 269 ? 10.002  27.563  22.081  1.00 60.21  ? 267  GLU B N   1 
ATOM   3992  C CA  . GLU B 1 269 ? 9.463   28.378  23.171  1.00 62.76  ? 267  GLU B CA  1 
ATOM   3993  C C   . GLU B 1 269 ? 8.802   27.516  24.238  1.00 63.83  ? 267  GLU B C   1 
ATOM   3994  O O   . GLU B 1 269 ? 8.821   27.839  25.430  1.00 63.16  ? 267  GLU B O   1 
ATOM   3995  C CB  . GLU B 1 269 ? 8.435   29.391  22.647  1.00 88.12  ? 267  GLU B CB  1 
ATOM   3996  C CG  . GLU B 1 269 ? 9.001   30.512  21.774  1.00 89.78  ? 267  GLU B CG  1 
ATOM   3997  C CD  . GLU B 1 269 ? 8.039   31.689  21.633  1.00 90.98  ? 267  GLU B CD  1 
ATOM   3998  O OE1 . GLU B 1 269 ? 6.851   31.459  21.297  1.00 87.94  ? 267  GLU B OE1 1 
ATOM   3999  O OE2 . GLU B 1 269 ? 8.478   32.843  21.857  1.00 91.40  ? 267  GLU B OE2 1 
ATOM   4000  N N   . LEU B 1 270 ? 8.220   26.412  23.794  1.00 65.46  ? 268  LEU B N   1 
ATOM   4001  C CA  . LEU B 1 270 ? 7.540   25.502  24.691  1.00 68.60  ? 268  LEU B CA  1 
ATOM   4002  C C   . LEU B 1 270 ? 8.493   24.767  25.607  1.00 72.20  ? 268  LEU B C   1 
ATOM   4003  O O   . LEU B 1 270 ? 8.235   24.648  26.803  1.00 73.05  ? 268  LEU B O   1 
ATOM   4004  C CB  . LEU B 1 270 ? 6.723   24.514  23.878  1.00 76.25  ? 268  LEU B CB  1 
ATOM   4005  C CG  . LEU B 1 270 ? 5.665   25.265  23.077  1.00 75.19  ? 268  LEU B CG  1 
ATOM   4006  C CD1 . LEU B 1 270 ? 4.937   24.308  22.154  1.00 74.91  ? 268  LEU B CD1 1 
ATOM   4007  C CD2 . LEU B 1 270 ? 4.706   25.958  24.044  1.00 72.55  ? 268  LEU B CD2 1 
ATOM   4008  N N   . GLN B 1 271 ? 9.592   24.265  25.059  1.00 76.47  ? 269  GLN B N   1 
ATOM   4009  C CA  . GLN B 1 271 ? 10.550  23.560  25.892  1.00 80.99  ? 269  GLN B CA  1 
ATOM   4010  C C   . GLN B 1 271 ? 11.137  24.554  26.883  1.00 81.87  ? 269  GLN B C   1 
ATOM   4011  O O   . GLN B 1 271 ? 11.527  24.178  27.979  1.00 82.90  ? 269  GLN B O   1 
ATOM   4012  C CB  . GLN B 1 271 ? 11.672  22.959  25.054  1.00 126.53 ? 269  GLN B CB  1 
ATOM   4013  C CG  . GLN B 1 271 ? 12.646  23.975  24.512  1.00 133.59 ? 269  GLN B CG  1 
ATOM   4014  C CD  . GLN B 1 271 ? 13.842  23.324  23.864  1.00 137.84 ? 269  GLN B CD  1 
ATOM   4015  O OE1 . GLN B 1 271 ? 13.701  22.533  22.930  1.00 140.11 ? 269  GLN B OE1 1 
ATOM   4016  N NE2 . GLN B 1 271 ? 15.033  23.648  24.358  1.00 139.55 ? 269  GLN B NE2 1 
ATOM   4017  N N   . SER B 1 272 ? 11.188  25.825  26.496  1.00 72.45  ? 270  SER B N   1 
ATOM   4018  C CA  . SER B 1 272 ? 11.731  26.862  27.366  1.00 74.84  ? 270  SER B CA  1 
ATOM   4019  C C   . SER B 1 272 ? 10.809  27.149  28.542  1.00 76.97  ? 270  SER B C   1 
ATOM   4020  O O   . SER B 1 272 ? 11.055  28.056  29.334  1.00 76.59  ? 270  SER B O   1 
ATOM   4021  C CB  . SER B 1 272 ? 11.975  28.141  26.575  1.00 103.85 ? 270  SER B CB  1 
ATOM   4022  O OG  . SER B 1 272 ? 12.941  27.909  25.569  1.00 106.78 ? 270  SER B OG  1 
ATOM   4023  N N   . MET B 1 273 ? 9.733   26.379  28.635  1.00 81.97  ? 271  MET B N   1 
ATOM   4024  C CA  . MET B 1 273 ? 8.790   26.508  29.734  1.00 86.55  ? 271  MET B CA  1 
ATOM   4025  C C   . MET B 1 273 ? 8.999   25.241  30.538  1.00 89.49  ? 271  MET B C   1 
ATOM   4026  O O   . MET B 1 273 ? 9.000   25.261  31.764  1.00 90.70  ? 271  MET B O   1 
ATOM   4027  C CB  . MET B 1 273 ? 7.358   26.559  29.215  1.00 129.84 ? 271  MET B CB  1 
ATOM   4028  C CG  . MET B 1 273 ? 7.032   27.811  28.434  1.00 134.15 ? 271  MET B CG  1 
ATOM   4029  S SD  . MET B 1 273 ? 5.398   27.712  27.686  1.00 139.62 ? 271  MET B SD  1 
ATOM   4030  C CE  . MET B 1 273 ? 4.355   28.285  29.031  1.00 138.78 ? 271  MET B CE  1 
ATOM   4031  N N   . ALA B 1 274 ? 9.192   24.139  29.819  1.00 133.45 ? 272  ALA B N   1 
ATOM   4032  C CA  . ALA B 1 274 ? 9.420   22.837  30.428  1.00 137.18 ? 272  ALA B CA  1 
ATOM   4033  C C   . ALA B 1 274 ? 10.893  22.683  30.794  1.00 139.96 ? 272  ALA B C   1 
ATOM   4034  O O   . ALA B 1 274 ? 11.308  21.649  31.313  1.00 141.87 ? 272  ALA B O   1 
ATOM   4035  C CB  . ALA B 1 274 ? 9.003   21.733  29.463  1.00 63.79  ? 272  ALA B CB  1 
ATOM   4036  N N   . ASP B 1 275 ? 11.678  23.720  30.518  1.00 146.26 ? 273  ASP B N   1 
ATOM   4037  C CA  . ASP B 1 275 ? 13.108  23.708  30.811  1.00 147.47 ? 273  ASP B CA  1 
ATOM   4038  C C   . ASP B 1 275 ? 13.465  24.774  31.845  1.00 149.50 ? 273  ASP B C   1 
ATOM   4039  O O   . ASP B 1 275 ? 14.631  24.939  32.200  1.00 150.34 ? 273  ASP B O   1 
ATOM   4040  C CB  . ASP B 1 275 ? 13.917  23.947  29.524  1.00 117.90 ? 273  ASP B CB  1 
ATOM   4041  C CG  . ASP B 1 275 ? 13.970  22.717  28.616  1.00 117.02 ? 273  ASP B CG  1 
ATOM   4042  O OD1 . ASP B 1 275 ? 12.909  22.119  28.329  1.00 116.15 ? 273  ASP B OD1 1 
ATOM   4043  O OD2 . ASP B 1 275 ? 15.081  22.352  28.177  1.00 115.82 ? 273  ASP B OD2 1 
ATOM   4044  N N   . GLN B 1 276 ? 12.457  25.490  32.333  1.00 123.10 ? 274  GLN B N   1 
ATOM   4045  C CA  . GLN B 1 276 ? 12.675  26.550  33.313  1.00 125.06 ? 274  GLN B CA  1 
ATOM   4046  C C   . GLN B 1 276 ? 11.920  26.306  34.609  1.00 126.30 ? 274  GLN B C   1 
ATOM   4047  O O   . GLN B 1 276 ? 12.413  26.603  35.700  1.00 125.91 ? 274  GLN B O   1 
ATOM   4048  C CB  . GLN B 1 276 ? 12.225  27.892  32.738  1.00 125.96 ? 274  GLN B CB  1 
ATOM   4049  C CG  . GLN B 1 276 ? 12.275  29.036  33.737  1.00 126.13 ? 274  GLN B CG  1 
ATOM   4050  C CD  . GLN B 1 276 ? 11.492  30.248  33.273  1.00 126.08 ? 274  GLN B CD  1 
ATOM   4051  O OE1 . GLN B 1 276 ? 11.681  30.734  32.161  1.00 127.60 ? 274  GLN B OE1 1 
ATOM   4052  N NE2 . GLN B 1 276 ? 10.609  30.746  34.130  1.00 125.15 ? 274  GLN B NE2 1 
ATOM   4053  N N   . GLU B 1 277 ? 10.712  25.773  34.474  1.00 117.10 ? 275  GLU B N   1 
ATOM   4054  C CA  . GLU B 1 277 ? 9.858   25.511  35.619  1.00 119.24 ? 275  GLU B CA  1 
ATOM   4055  C C   . GLU B 1 277 ? 9.113   24.195  35.429  1.00 118.36 ? 275  GLU B C   1 
ATOM   4056  O O   . GLU B 1 277 ? 8.702   23.561  36.399  1.00 118.03 ? 275  GLU B O   1 
ATOM   4057  C CB  . GLU B 1 277 ? 8.863   26.662  35.771  1.00 200.00 ? 275  GLU B CB  1 
ATOM   4058  C CG  . GLU B 1 277 ? 9.528   28.031  35.813  1.00 200.00 ? 275  GLU B CG  1 
ATOM   4059  C CD  . GLU B 1 277 ? 8.665   29.123  35.209  1.00 200.00 ? 275  GLU B CD  1 
ATOM   4060  O OE1 . GLU B 1 277 ? 8.338   29.025  34.006  1.00 200.00 ? 275  GLU B OE1 1 
ATOM   4061  O OE2 . GLU B 1 277 ? 8.318   30.080  35.934  1.00 200.00 ? 275  GLU B OE2 1 
ATOM   4062  N N   . ARG C 1 1   ? -14.745 88.283  37.279  1.00 188.79 ? -1   ARG C N   1 
ATOM   4063  C CA  . ARG C 1 1   ? -15.161 89.424  36.411  1.00 189.48 ? -1   ARG C CA  1 
ATOM   4064  C C   . ARG C 1 1   ? -13.962 90.017  35.666  1.00 189.58 ? -1   ARG C C   1 
ATOM   4065  O O   . ARG C 1 1   ? -13.390 89.367  34.790  1.00 189.62 ? -1   ARG C O   1 
ATOM   4066  C CB  . ARG C 1 1   ? -15.844 90.496  37.257  1.00 138.22 ? -1   ARG C CB  1 
ATOM   4067  N N   . GLY C 1 2   ? -13.591 91.250  36.010  1.00 200.00 ? 0    GLY C N   1 
ATOM   4068  C CA  . GLY C 1 2   ? -12.458 91.898  35.366  1.00 200.00 ? 0    GLY C CA  1 
ATOM   4069  C C   . GLY C 1 2   ? -11.238 90.999  35.409  1.00 200.00 ? 0    GLY C C   1 
ATOM   4070  O O   . GLY C 1 2   ? -11.151 90.125  36.273  1.00 200.00 ? 0    GLY C O   1 
ATOM   4071  N N   . MET C 1 3   ? -10.288 91.202  34.500  1.00 155.16 ? 1    MET C N   1 
ATOM   4072  C CA  . MET C 1 3   ? -9.109  90.345  34.481  1.00 153.56 ? 1    MET C CA  1 
ATOM   4073  C C   . MET C 1 3   ? -7.966  90.796  33.573  1.00 151.20 ? 1    MET C C   1 
ATOM   4074  O O   . MET C 1 3   ? -8.181  91.416  32.529  1.00 150.26 ? 1    MET C O   1 
ATOM   4075  C CB  . MET C 1 3   ? -9.536  88.931  34.092  1.00 200.00 ? 1    MET C CB  1 
ATOM   4076  C CG  . MET C 1 3   ? -8.407  87.939  33.954  1.00 200.00 ? 1    MET C CG  1 
ATOM   4077  S SD  . MET C 1 3   ? -9.040  86.386  33.320  1.00 200.00 ? 1    MET C SD  1 
ATOM   4078  C CE  . MET C 1 3   ? -9.115  86.771  31.575  1.00 200.00 ? 1    MET C CE  1 
ATOM   4079  N N   . SER C 1 4   ? -6.749  90.458  33.991  1.00 148.26 ? 2    SER C N   1 
ATOM   4080  C CA  . SER C 1 4   ? -5.531  90.786  33.262  1.00 146.40 ? 2    SER C CA  1 
ATOM   4081  C C   . SER C 1 4   ? -4.897  89.490  32.772  1.00 145.55 ? 2    SER C C   1 
ATOM   4082  O O   . SER C 1 4   ? -5.045  88.450  33.410  1.00 145.11 ? 2    SER C O   1 
ATOM   4083  C CB  . SER C 1 4   ? -4.551  91.511  34.182  1.00 145.40 ? 2    SER C CB  1 
ATOM   4084  O OG  . SER C 1 4   ? -5.117  92.692  34.722  1.00 144.90 ? 2    SER C OG  1 
ATOM   4085  N N   . VAL C 1 5   ? -4.191  89.546  31.646  1.00 158.94 ? 3    VAL C N   1 
ATOM   4086  C CA  . VAL C 1 5   ? -3.550  88.349  31.105  1.00 158.04 ? 3    VAL C CA  1 
ATOM   4087  C C   . VAL C 1 5   ? -2.193  88.649  30.477  1.00 157.18 ? 3    VAL C C   1 
ATOM   4088  O O   . VAL C 1 5   ? -1.955  89.754  29.985  1.00 156.86 ? 3    VAL C O   1 
ATOM   4089  C CB  . VAL C 1 5   ? -4.437  87.672  30.043  1.00 164.03 ? 3    VAL C CB  1 
ATOM   4090  C CG1 . VAL C 1 5   ? -3.830  86.339  29.638  1.00 164.59 ? 3    VAL C CG1 1 
ATOM   4091  C CG2 . VAL C 1 5   ? -5.845  87.487  30.580  1.00 163.10 ? 3    VAL C CG2 1 
ATOM   4092  N N   . GLY C 1 6   ? -1.309  87.655  30.492  1.00 112.34 ? 4    GLY C N   1 
ATOM   4093  C CA  . GLY C 1 6   ? 0.015   87.840  29.929  1.00 111.88 ? 4    GLY C CA  1 
ATOM   4094  C C   . GLY C 1 6   ? 0.489   86.685  29.069  1.00 111.79 ? 4    GLY C C   1 
ATOM   4095  O O   . GLY C 1 6   ? 0.085   85.538  29.267  1.00 110.96 ? 4    GLY C O   1 
ATOM   4096  N N   . PHE C 1 7   ? 1.355   86.997  28.109  1.00 157.97 ? 5    PHE C N   1 
ATOM   4097  C CA  . PHE C 1 7   ? 1.904   85.996  27.203  1.00 159.30 ? 5    PHE C CA  1 
ATOM   4098  C C   . PHE C 1 7   ? 3.425   86.019  27.158  1.00 159.76 ? 5    PHE C C   1 
ATOM   4099  O O   . PHE C 1 7   ? 4.020   86.884  26.514  1.00 160.06 ? 5    PHE C O   1 
ATOM   4100  C CB  . PHE C 1 7   ? 1.374   86.206  25.783  1.00 177.79 ? 5    PHE C CB  1 
ATOM   4101  C CG  . PHE C 1 7   ? 0.027   85.594  25.536  1.00 179.66 ? 5    PHE C CG  1 
ATOM   4102  C CD1 . PHE C 1 7   ? -1.096  86.039  26.226  1.00 180.34 ? 5    PHE C CD1 1 
ATOM   4103  C CD2 . PHE C 1 7   ? -0.122  84.580  24.595  1.00 180.11 ? 5    PHE C CD2 1 
ATOM   4104  C CE1 . PHE C 1 7   ? -2.349  85.482  25.980  1.00 180.30 ? 5    PHE C CE1 1 
ATOM   4105  C CE2 . PHE C 1 7   ? -1.368  84.018  24.343  1.00 180.48 ? 5    PHE C CE2 1 
ATOM   4106  C CZ  . PHE C 1 7   ? -2.485  84.470  25.037  1.00 180.40 ? 5    PHE C CZ  1 
ATOM   4107  N N   . ILE C 1 8   ? 4.049   85.065  27.842  1.00 141.38 ? 6    ILE C N   1 
ATOM   4108  C CA  . ILE C 1 8   ? 5.506   84.954  27.858  1.00 141.71 ? 6    ILE C CA  1 
ATOM   4109  C C   . ILE C 1 8   ? 5.903   84.133  26.640  1.00 141.36 ? 6    ILE C C   1 
ATOM   4110  O O   . ILE C 1 8   ? 7.040   84.187  26.164  1.00 140.98 ? 6    ILE C O   1 
ATOM   4111  C CB  . ILE C 1 8   ? 6.004   84.247  29.134  1.00 159.23 ? 6    ILE C CB  1 
ATOM   4112  C CG1 . ILE C 1 8   ? 5.709   85.117  30.358  1.00 159.51 ? 6    ILE C CG1 1 
ATOM   4113  C CG2 . ILE C 1 8   ? 7.493   83.962  29.027  1.00 159.48 ? 6    ILE C CG2 1 
ATOM   4114  C CD1 . ILE C 1 8   ? 6.335   86.501  30.302  1.00 159.66 ? 6    ILE C CD1 1 
ATOM   4115  N N   . GLY C 1 9   ? 4.939   83.364  26.151  1.00 147.90 ? 7    GLY C N   1 
ATOM   4116  C CA  . GLY C 1 9   ? 5.151   82.550  24.975  1.00 148.28 ? 7    GLY C CA  1 
ATOM   4117  C C   . GLY C 1 9   ? 4.395   83.212  23.844  1.00 148.89 ? 7    GLY C C   1 
ATOM   4118  O O   . GLY C 1 9   ? 3.390   82.691  23.357  1.00 149.38 ? 7    GLY C O   1 
ATOM   4119  N N   . ALA C 1 10  ? 4.890   84.378  23.442  1.00 199.84 ? 8    ALA C N   1 
ATOM   4120  C CA  . ALA C 1 10  ? 4.293   85.180  22.382  1.00 199.84 ? 8    ALA C CA  1 
ATOM   4121  C C   . ALA C 1 10  ? 4.671   84.709  20.976  1.00 199.84 ? 8    ALA C C   1 
ATOM   4122  O O   . ALA C 1 10  ? 5.852   84.636  20.631  1.00 199.84 ? 8    ALA C O   1 
ATOM   4123  C CB  . ALA C 1 10  ? 4.700   86.624  22.573  1.00 140.01 ? 8    ALA C CB  1 
ATOM   4124  N N   . GLY C 1 11  ? 3.658   84.405  20.167  1.00 161.27 ? 9    GLY C N   1 
ATOM   4125  C CA  . GLY C 1 11  ? 3.891   83.938  18.811  1.00 159.38 ? 9    GLY C CA  1 
ATOM   4126  C C   . GLY C 1 11  ? 3.036   82.726  18.487  1.00 157.78 ? 9    GLY C C   1 
ATOM   4127  O O   . GLY C 1 11  ? 2.467   82.112  19.387  1.00 157.72 ? 9    GLY C O   1 
ATOM   4128  N N   . GLN C 1 12  ? 2.951   82.372  17.208  1.00 195.15 ? 10   GLN C N   1 
ATOM   4129  C CA  . GLN C 1 12  ? 2.152   81.228  16.773  1.00 192.65 ? 10   GLN C CA  1 
ATOM   4130  C C   . GLN C 1 12  ? 0.796   81.186  17.469  1.00 190.17 ? 10   GLN C C   1 
ATOM   4131  O O   . GLN C 1 12  ? 0.063   82.176  17.466  1.00 189.92 ? 10   GLN C O   1 
ATOM   4132  C CB  . GLN C 1 12  ? 2.901   79.913  17.023  1.00 175.44 ? 10   GLN C CB  1 
ATOM   4133  C CG  . GLN C 1 12  ? 4.008   79.613  16.017  1.00 176.46 ? 10   GLN C CG  1 
ATOM   4134  C CD  . GLN C 1 12  ? 3.485   79.424  14.603  1.00 177.04 ? 10   GLN C CD  1 
ATOM   4135  O OE1 . GLN C 1 12  ? 2.846   80.314  14.041  1.00 177.47 ? 10   GLN C OE1 1 
ATOM   4136  N NE2 . GLN C 1 12  ? 3.757   78.260  14.019  1.00 176.87 ? 10   GLN C NE2 1 
ATOM   4137  N N   . LEU C 1 13  ? 0.474   80.045  18.074  1.00 146.75 ? 11   LEU C N   1 
ATOM   4138  C CA  . LEU C 1 13  ? -0.804  79.871  18.759  1.00 143.41 ? 11   LEU C CA  1 
ATOM   4139  C C   . LEU C 1 13  ? -1.055  80.909  19.850  1.00 142.32 ? 11   LEU C C   1 
ATOM   4140  O O   . LEU C 1 13  ? -2.068  80.854  20.538  1.00 142.58 ? 11   LEU C O   1 
ATOM   4141  C CB  . LEU C 1 13  ? -0.910  78.457  19.345  1.00 91.50  ? 11   LEU C CB  1 
ATOM   4142  C CG  . LEU C 1 13  ? -2.284  77.998  19.853  1.00 88.68  ? 11   LEU C CG  1 
ATOM   4143  C CD1 . LEU C 1 13  ? -3.343  78.213  18.778  1.00 87.10  ? 11   LEU C CD1 1 
ATOM   4144  C CD2 . LEU C 1 13  ? -2.210  76.527  20.244  1.00 87.63  ? 11   LEU C CD2 1 
ATOM   4145  N N   . ALA C 1 14  ? -0.128  81.846  20.016  1.00 102.42 ? 12   ALA C N   1 
ATOM   4146  C CA  . ALA C 1 14  ? -0.303  82.904  21.003  1.00 101.25 ? 12   ALA C CA  1 
ATOM   4147  C C   . ALA C 1 14  ? -1.158  83.947  20.301  1.00 100.55 ? 12   ALA C C   1 
ATOM   4148  O O   . ALA C 1 14  ? -2.138  84.449  20.850  1.00 99.38  ? 12   ALA C O   1 
ATOM   4149  C CB  . ALA C 1 14  ? 1.041   83.500  21.389  1.00 126.78 ? 12   ALA C CB  1 
ATOM   4150  N N   . PHE C 1 15  ? -0.773  84.250  19.067  1.00 126.01 ? 13   PHE C N   1 
ATOM   4151  C CA  . PHE C 1 15  ? -1.482  85.213  18.238  1.00 127.29 ? 13   PHE C CA  1 
ATOM   4152  C C   . PHE C 1 15  ? -2.944  84.772  18.105  1.00 125.79 ? 13   PHE C C   1 
ATOM   4153  O O   . PHE C 1 15  ? -3.861  85.589  18.204  1.00 125.39 ? 13   PHE C O   1 
ATOM   4154  C CB  . PHE C 1 15  ? -0.797  85.286  16.867  1.00 170.92 ? 13   PHE C CB  1 
ATOM   4155  C CG  . PHE C 1 15  ? -1.417  86.271  15.915  1.00 173.66 ? 13   PHE C CG  1 
ATOM   4156  C CD1 . PHE C 1 15  ? -1.544  87.614  16.257  1.00 174.45 ? 13   PHE C CD1 1 
ATOM   4157  C CD2 . PHE C 1 15  ? -1.844  85.857  14.658  1.00 174.55 ? 13   PHE C CD2 1 
ATOM   4158  C CE1 . PHE C 1 15  ? -2.089  88.529  15.357  1.00 176.11 ? 13   PHE C CE1 1 
ATOM   4159  C CE2 . PHE C 1 15  ? -2.388  86.760  13.753  1.00 175.38 ? 13   PHE C CE2 1 
ATOM   4160  C CZ  . PHE C 1 15  ? -2.511  88.100  14.102  1.00 176.46 ? 13   PHE C CZ  1 
ATOM   4161  N N   . ALA C 1 16  ? -3.147  83.473  17.900  1.00 151.77 ? 14   ALA C N   1 
ATOM   4162  C CA  . ALA C 1 16  ? -4.485  82.898  17.759  1.00 149.64 ? 14   ALA C CA  1 
ATOM   4163  C C   . ALA C 1 16  ? -5.318  83.220  18.986  1.00 147.96 ? 14   ALA C C   1 
ATOM   4164  O O   . ALA C 1 16  ? -6.361  83.871  18.896  1.00 148.30 ? 14   ALA C O   1 
ATOM   4165  C CB  . ALA C 1 16  ? -4.388  81.387  17.592  1.00 70.08  ? 14   ALA C CB  1 
ATOM   4166  N N   . LEU C 1 17  ? -4.842  82.738  20.129  1.00 123.51 ? 15   LEU C N   1 
ATOM   4167  C CA  . LEU C 1 17  ? -5.495  82.950  21.412  1.00 120.92 ? 15   LEU C CA  1 
ATOM   4168  C C   . LEU C 1 17  ? -5.939  84.398  21.510  1.00 119.95 ? 15   LEU C C   1 
ATOM   4169  O O   . LEU C 1 17  ? -7.131  84.688  21.599  1.00 119.22 ? 15   LEU C O   1 
ATOM   4170  C CB  . LEU C 1 17  ? -4.515  82.621  22.537  1.00 103.27 ? 15   LEU C CB  1 
ATOM   4171  C CG  . LEU C 1 17  ? -3.986  81.187  22.457  1.00 102.77 ? 15   LEU C CG  1 
ATOM   4172  C CD1 . LEU C 1 17  ? -2.749  81.020  23.325  1.00 102.02 ? 15   LEU C CD1 1 
ATOM   4173  C CD2 . LEU C 1 17  ? -5.088  80.231  22.864  1.00 101.97 ? 15   LEU C CD2 1 
ATOM   4174  N N   . ALA C 1 18  ? -4.967  85.302  21.486  1.00 125.82 ? 16   ALA C N   1 
ATOM   4175  C CA  . ALA C 1 18  ? -5.241  86.727  21.553  1.00 124.57 ? 16   ALA C CA  1 
ATOM   4176  C C   . ALA C 1 18  ? -6.485  87.049  20.733  1.00 124.23 ? 16   ALA C C   1 
ATOM   4177  O O   . ALA C 1 18  ? -7.559  87.307  21.285  1.00 124.53 ? 16   ALA C O   1 
ATOM   4178  C CB  . ALA C 1 18  ? -4.054  87.496  21.015  1.00 80.56  ? 16   ALA C CB  1 
ATOM   4179  N N   . LYS C 1 19  ? -6.323  87.017  19.412  1.00 131.71 ? 17   LYS C N   1 
ATOM   4180  C CA  . LYS C 1 19  ? -7.405  87.293  18.471  1.00 129.36 ? 17   LYS C CA  1 
ATOM   4181  C C   . LYS C 1 19  ? -8.726  86.673  18.898  1.00 127.78 ? 17   LYS C C   1 
ATOM   4182  O O   . LYS C 1 19  ? -9.797  87.213  18.616  1.00 127.35 ? 17   LYS C O   1 
ATOM   4183  C CB  . LYS C 1 19  ? -7.040  86.763  17.090  1.00 128.76 ? 17   LYS C CB  1 
ATOM   4184  C CG  . LYS C 1 19  ? -8.162  86.881  16.080  1.00 129.31 ? 17   LYS C CG  1 
ATOM   4185  C CD  . LYS C 1 19  ? -7.720  86.360  14.730  1.00 131.32 ? 17   LYS C CD  1 
ATOM   4186  C CE  . LYS C 1 19  ? -6.486  87.104  14.238  1.00 132.17 ? 17   LYS C CE  1 
ATOM   4187  N NZ  . LYS C 1 19  ? -6.037  86.640  12.898  1.00 133.37 ? 17   LYS C NZ  1 
ATOM   4188  N N   . GLY C 1 20  ? -8.639  85.526  19.563  1.00 136.60 ? 18   GLY C N   1 
ATOM   4189  C CA  . GLY C 1 20  ? -9.830  84.843  20.023  1.00 134.69 ? 18   GLY C CA  1 
ATOM   4190  C C   . GLY C 1 20  ? -10.614 85.658  21.031  1.00 133.86 ? 18   GLY C C   1 
ATOM   4191  O O   . GLY C 1 20  ? -11.713 86.122  20.738  1.00 133.77 ? 18   GLY C O   1 
ATOM   4192  N N   . PHE C 1 21  ? -10.053 85.837  22.223  1.00 99.28  ? 19   PHE C N   1 
ATOM   4193  C CA  . PHE C 1 21  ? -10.725 86.601  23.264  1.00 97.79  ? 19   PHE C CA  1 
ATOM   4194  C C   . PHE C 1 21  ? -11.198 87.917  22.668  1.00 98.12  ? 19   PHE C C   1 
ATOM   4195  O O   . PHE C 1 21  ? -12.251 88.442  23.039  1.00 96.23  ? 19   PHE C O   1 
ATOM   4196  C CB  . PHE C 1 21  ? -9.765  86.860  24.418  1.00 90.66  ? 19   PHE C CB  1 
ATOM   4197  C CG  . PHE C 1 21  ? -8.939  85.667  24.784  1.00 89.65  ? 19   PHE C CG  1 
ATOM   4198  C CD1 . PHE C 1 21  ? -7.724  85.428  24.150  1.00 88.65  ? 19   PHE C CD1 1 
ATOM   4199  C CD2 . PHE C 1 21  ? -9.385  84.766  25.746  1.00 88.93  ? 19   PHE C CD2 1 
ATOM   4200  C CE1 . PHE C 1 21  ? -6.961  84.305  24.469  1.00 88.19  ? 19   PHE C CE1 1 
ATOM   4201  C CE2 . PHE C 1 21  ? -8.631  83.641  26.072  1.00 87.70  ? 19   PHE C CE2 1 
ATOM   4202  C CZ  . PHE C 1 21  ? -7.415  83.411  25.431  1.00 87.84  ? 19   PHE C CZ  1 
ATOM   4203  N N   . THR C 1 22  ? -10.404 88.433  21.734  1.00 124.84 ? 20   THR C N   1 
ATOM   4204  C CA  . THR C 1 22  ? -10.715 89.674  21.041  1.00 128.10 ? 20   THR C CA  1 
ATOM   4205  C C   . THR C 1 22  ? -12.102 89.543  20.429  1.00 131.42 ? 20   THR C C   1 
ATOM   4206  O O   . THR C 1 22  ? -13.087 90.014  20.994  1.00 131.53 ? 20   THR C O   1 
ATOM   4207  C CB  . THR C 1 22  ? -9.720  89.937  19.903  1.00 115.91 ? 20   THR C CB  1 
ATOM   4208  O OG1 . THR C 1 22  ? -8.382  89.831  20.404  1.00 115.20 ? 20   THR C OG1 1 
ATOM   4209  C CG2 . THR C 1 22  ? -9.939  91.323  19.314  1.00 115.43 ? 20   THR C CG2 1 
ATOM   4210  N N   . ALA C 1 23  ? -12.168 88.890  19.272  1.00 163.66 ? 21   ALA C N   1 
ATOM   4211  C CA  . ALA C 1 23  ? -13.431 88.679  18.574  1.00 167.45 ? 21   ALA C CA  1 
ATOM   4212  C C   . ALA C 1 23  ? -14.463 88.070  19.518  1.00 170.36 ? 21   ALA C C   1 
ATOM   4213  O O   . ALA C 1 23  ? -15.668 88.218  19.313  1.00 170.87 ? 21   ALA C O   1 
ATOM   4214  C CB  . ALA C 1 23  ? -13.217 87.767  17.370  1.00 153.88 ? 21   ALA C CB  1 
ATOM   4215  N N   . ALA C 1 24  ? -13.982 87.383  20.552  1.00 160.77 ? 22   ALA C N   1 
ATOM   4216  C CA  . ALA C 1 24  ? -14.860 86.765  21.537  1.00 164.54 ? 22   ALA C CA  1 
ATOM   4217  C C   . ALA C 1 24  ? -15.693 87.874  22.156  1.00 167.51 ? 22   ALA C C   1 
ATOM   4218  O O   . ALA C 1 24  ? -16.710 87.625  22.802  1.00 167.81 ? 22   ALA C O   1 
ATOM   4219  C CB  . ALA C 1 24  ? -14.036 86.068  22.616  1.00 130.00 ? 22   ALA C CB  1 
ATOM   4220  N N   . GLY C 1 25  ? -15.250 89.105  21.936  1.00 164.28 ? 23   GLY C N   1 
ATOM   4221  C CA  . GLY C 1 25  ? -15.949 90.247  22.482  1.00 167.88 ? 23   GLY C CA  1 
ATOM   4222  C C   . GLY C 1 25  ? -15.892 90.165  23.989  1.00 170.52 ? 23   GLY C C   1 
ATOM   4223  O O   . GLY C 1 25  ? -16.878 90.441  24.671  1.00 171.43 ? 23   GLY C O   1 
ATOM   4224  N N   . VAL C 1 26  ? -14.735 89.768  24.513  1.00 179.39 ? 24   VAL C N   1 
ATOM   4225  C CA  . VAL C 1 26  ? -14.574 89.648  25.954  1.00 181.98 ? 24   VAL C CA  1 
ATOM   4226  C C   . VAL C 1 26  ? -13.181 90.054  26.441  1.00 184.69 ? 24   VAL C C   1 
ATOM   4227  O O   . VAL C 1 26  ? -12.734 89.585  27.486  1.00 185.18 ? 24   VAL C O   1 
ATOM   4228  C CB  . VAL C 1 26  ? -14.857 88.198  26.432  1.00 137.41 ? 24   VAL C CB  1 
ATOM   4229  C CG1 . VAL C 1 26  ? -15.206 88.200  27.911  1.00 136.63 ? 24   VAL C CG1 1 
ATOM   4230  C CG2 . VAL C 1 26  ? -15.990 87.583  25.629  1.00 137.14 ? 24   VAL C CG2 1 
ATOM   4231  N N   . LEU C 1 27  ? -12.492 90.920  25.700  1.00 147.03 ? 25   LEU C N   1 
ATOM   4232  C CA  . LEU C 1 27  ? -11.161 91.354  26.126  1.00 149.53 ? 25   LEU C CA  1 
ATOM   4233  C C   . LEU C 1 27  ? -10.553 92.488  25.296  1.00 150.68 ? 25   LEU C C   1 
ATOM   4234  O O   . LEU C 1 27  ? -10.913 92.686  24.134  1.00 150.42 ? 25   LEU C O   1 
ATOM   4235  C CB  . LEU C 1 27  ? -10.207 90.157  26.140  1.00 200.00 ? 25   LEU C CB  1 
ATOM   4236  C CG  . LEU C 1 27  ? -8.908  90.333  26.930  1.00 200.00 ? 25   LEU C CG  1 
ATOM   4237  C CD1 . LEU C 1 27  ? -9.216  90.745  28.366  1.00 200.00 ? 25   LEU C CD1 1 
ATOM   4238  C CD2 . LEU C 1 27  ? -8.131  89.030  26.907  1.00 200.00 ? 25   LEU C CD2 1 
ATOM   4239  N N   . ALA C 1 28  ? -9.623  93.222  25.909  1.00 200.00 ? 26   ALA C N   1 
ATOM   4240  C CA  . ALA C 1 28  ? -8.947  94.348  25.263  1.00 200.00 ? 26   ALA C CA  1 
ATOM   4241  C C   . ALA C 1 28  ? -7.472  94.055  24.970  1.00 200.00 ? 26   ALA C C   1 
ATOM   4242  O O   . ALA C 1 28  ? -6.707  93.694  25.867  1.00 200.00 ? 26   ALA C O   1 
ATOM   4243  C CB  . ALA C 1 28  ? -9.069  95.592  26.134  1.00 106.67 ? 26   ALA C CB  1 
ATOM   4244  N N   . ALA C 1 29  ? -7.086  94.238  23.708  1.00 177.97 ? 27   ALA C N   1 
ATOM   4245  C CA  . ALA C 1 29  ? -5.725  93.986  23.229  1.00 178.91 ? 27   ALA C CA  1 
ATOM   4246  C C   . ALA C 1 29  ? -4.614  94.653  24.031  1.00 179.33 ? 27   ALA C C   1 
ATOM   4247  O O   . ALA C 1 29  ? -3.436  94.338  23.854  1.00 178.66 ? 27   ALA C O   1 
ATOM   4248  C CB  . ALA C 1 29  ? -5.616  94.403  21.765  1.00 138.23 ? 27   ALA C CB  1 
ATOM   4249  N N   . HIS C 1 30  ? -4.985  95.569  24.913  1.00 190.09 ? 28   HIS C N   1 
ATOM   4250  C CA  . HIS C 1 30  ? -4.002  96.279  25.715  1.00 190.64 ? 28   HIS C CA  1 
ATOM   4251  C C   . HIS C 1 30  ? -3.984  95.776  27.151  1.00 189.18 ? 28   HIS C C   1 
ATOM   4252  O O   . HIS C 1 30  ? -2.989  95.924  27.861  1.00 189.15 ? 28   HIS C O   1 
ATOM   4253  C CB  . HIS C 1 30  ? -4.312  97.770  25.662  1.00 200.00 ? 28   HIS C CB  1 
ATOM   4254  C CG  . HIS C 1 30  ? -4.466  98.290  24.268  1.00 200.00 ? 28   HIS C CG  1 
ATOM   4255  N ND1 . HIS C 1 30  ? -3.398  98.451  23.412  1.00 200.00 ? 28   HIS C ND1 1 
ATOM   4256  C CD2 . HIS C 1 30  ? -5.569  98.633  23.561  1.00 200.00 ? 28   HIS C CD2 1 
ATOM   4257  C CE1 . HIS C 1 30  ? -3.836  98.871  22.238  1.00 200.00 ? 28   HIS C CE1 1 
ATOM   4258  N NE2 . HIS C 1 30  ? -5.149  98.988  22.301  1.00 200.00 ? 28   HIS C NE2 1 
ATOM   4259  N N   . LYS C 1 31  ? -5.093  95.174  27.567  1.00 141.85 ? 29   LYS C N   1 
ATOM   4260  C CA  . LYS C 1 31  ? -5.218  94.622  28.909  1.00 140.27 ? 29   LYS C CA  1 
ATOM   4261  C C   . LYS C 1 31  ? -4.230  93.470  29.065  1.00 140.94 ? 29   LYS C C   1 
ATOM   4262  O O   . LYS C 1 31  ? -4.090  92.892  30.146  1.00 140.28 ? 29   LYS C O   1 
ATOM   4263  C CB  . LYS C 1 31  ? -6.641  94.117  29.121  1.00 146.75 ? 29   LYS C CB  1 
ATOM   4264  C CG  . LYS C 1 31  ? -7.696  95.193  29.026  1.00 144.26 ? 29   LYS C CG  1 
ATOM   4265  C CD  . LYS C 1 31  ? -7.574  96.198  30.153  1.00 142.14 ? 29   LYS C CD  1 
ATOM   4266  C CE  . LYS C 1 31  ? -8.653  97.262  30.040  1.00 141.22 ? 29   LYS C CE  1 
ATOM   4267  N NZ  . LYS C 1 31  ? -10.017 96.662  29.995  1.00 140.66 ? 29   LYS C NZ  1 
ATOM   4268  N N   . ILE C 1 32  ? -3.559  93.134  27.966  1.00 165.33 ? 30   ILE C N   1 
ATOM   4269  C CA  . ILE C 1 32  ? -2.573  92.061  27.948  1.00 166.09 ? 30   ILE C CA  1 
ATOM   4270  C C   . ILE C 1 32  ? -1.329  92.489  27.181  1.00 166.86 ? 30   ILE C C   1 
ATOM   4271  O O   . ILE C 1 32  ? -1.411  93.256  26.219  1.00 166.52 ? 30   ILE C O   1 
ATOM   4272  C CB  . ILE C 1 32  ? -3.129  90.781  27.288  1.00 166.42 ? 30   ILE C CB  1 
ATOM   4273  C CG1 . ILE C 1 32  ? -4.278  90.214  28.124  1.00 166.85 ? 30   ILE C CG1 1 
ATOM   4274  C CG2 . ILE C 1 32  ? -2.021  89.743  27.143  1.00 165.63 ? 30   ILE C CG2 1 
ATOM   4275  C CD1 . ILE C 1 32  ? -5.576  90.989  28.026  1.00 167.11 ? 30   ILE C CD1 1 
ATOM   4276  N N   . MET C 1 33  ? -0.181  91.978  27.616  1.00 172.29 ? 31   MET C N   1 
ATOM   4277  C CA  . MET C 1 33  ? 1.098   92.288  26.993  1.00 172.70 ? 31   MET C CA  1 
ATOM   4278  C C   . MET C 1 33  ? 1.578   91.079  26.200  1.00 172.23 ? 31   MET C C   1 
ATOM   4279  O O   . MET C 1 33  ? 1.147   89.949  26.442  1.00 171.62 ? 31   MET C O   1 
ATOM   4280  C CB  . MET C 1 33  ? 2.134   92.643  28.059  1.00 172.41 ? 31   MET C CB  1 
ATOM   4281  C CG  . MET C 1 33  ? 3.331   93.412  27.548  1.00 172.90 ? 31   MET C CG  1 
ATOM   4282  S SD  . MET C 1 33  ? 3.215   95.167  27.943  1.00 174.22 ? 31   MET C SD  1 
ATOM   4283  C CE  . MET C 1 33  ? 3.902   95.180  29.590  1.00 173.20 ? 31   MET C CE  1 
ATOM   4284  N N   . ALA C 1 34  ? 2.492   91.327  25.269  1.00 200.00 ? 32   ALA C N   1 
ATOM   4285  C CA  . ALA C 1 34  ? 3.018   90.282  24.406  1.00 200.00 ? 32   ALA C CA  1 
ATOM   4286  C C   . ALA C 1 34  ? 4.536   90.142  24.464  1.00 200.00 ? 32   ALA C C   1 
ATOM   4287  O O   . ALA C 1 34  ? 5.243   90.560  23.545  1.00 200.00 ? 32   ALA C O   1 
ATOM   4288  C CB  . ALA C 1 34  ? 2.580   90.557  22.983  1.00 200.00 ? 32   ALA C CB  1 
ATOM   4289  N N   . SER C 1 35  ? 5.040   89.551  25.540  1.00 134.45 ? 33   SER C N   1 
ATOM   4290  C CA  . SER C 1 35  ? 6.475   89.365  25.669  1.00 133.39 ? 33   SER C CA  1 
ATOM   4291  C C   . SER C 1 35  ? 6.889   88.187  24.806  1.00 133.87 ? 33   SER C C   1 
ATOM   4292  O O   . SER C 1 35  ? 6.429   87.065  25.010  1.00 133.54 ? 33   SER C O   1 
ATOM   4293  C CB  . SER C 1 35  ? 6.861   89.091  27.119  1.00 142.03 ? 33   SER C CB  1 
ATOM   4294  O OG  . SER C 1 35  ? 8.264   88.950  27.219  1.00 139.97 ? 33   SER C OG  1 
ATOM   4295  N N   . SER C 1 36  ? 7.757   88.442  23.838  1.00 147.98 ? 34   SER C N   1 
ATOM   4296  C CA  . SER C 1 36  ? 8.201   87.378  22.957  1.00 149.61 ? 34   SER C CA  1 
ATOM   4297  C C   . SER C 1 36  ? 9.699   87.401  22.742  1.00 150.63 ? 34   SER C C   1 
ATOM   4298  O O   . SER C 1 36  ? 10.253  88.391  22.267  1.00 150.04 ? 34   SER C O   1 
ATOM   4299  C CB  . SER C 1 36  ? 7.506   87.487  21.599  1.00 200.00 ? 34   SER C CB  1 
ATOM   4300  O OG  . SER C 1 36  ? 7.932   86.456  20.725  1.00 200.00 ? 34   SER C OG  1 
ATOM   4301  N N   . PRO C 1 37  ? 10.383  86.309  23.103  1.00 200.00 ? 35   PRO C N   1 
ATOM   4302  C CA  . PRO C 1 37  ? 11.829  86.306  22.891  1.00 200.00 ? 35   PRO C CA  1 
ATOM   4303  C C   . PRO C 1 37  ? 12.100  86.375  21.387  1.00 200.00 ? 35   PRO C C   1 
ATOM   4304  O O   . PRO C 1 37  ? 11.978  85.372  20.680  1.00 200.00 ? 35   PRO C O   1 
ATOM   4305  C CB  . PRO C 1 37  ? 12.269  84.985  23.524  1.00 140.99 ? 35   PRO C CB  1 
ATOM   4306  C CG  . PRO C 1 37  ? 11.052  84.111  23.388  1.00 140.34 ? 35   PRO C CG  1 
ATOM   4307  C CD  . PRO C 1 37  ? 9.935   85.058  23.741  1.00 140.19 ? 35   PRO C CD  1 
ATOM   4308  N N   . ASP C 1 38  ? 12.435  87.576  20.914  1.00 200.00 ? 36   ASP C N   1 
ATOM   4309  C CA  . ASP C 1 38  ? 12.729  87.852  19.504  1.00 200.00 ? 36   ASP C CA  1 
ATOM   4310  C C   . ASP C 1 38  ? 11.480  88.207  18.708  1.00 200.00 ? 36   ASP C C   1 
ATOM   4311  O O   . ASP C 1 38  ? 10.486  88.678  19.263  1.00 200.00 ? 36   ASP C O   1 
ATOM   4312  C CB  . ASP C 1 38  ? 13.428  86.658  18.840  1.00 200.00 ? 36   ASP C CB  1 
ATOM   4313  C CG  . ASP C 1 38  ? 14.767  86.336  19.475  1.00 200.00 ? 36   ASP C CG  1 
ATOM   4314  O OD1 . ASP C 1 38  ? 15.434  85.389  19.007  1.00 200.00 ? 36   ASP C OD1 1 
ATOM   4315  O OD2 . ASP C 1 38  ? 15.154  87.028  20.441  1.00 200.00 ? 36   ASP C OD2 1 
ATOM   4316  N N   . MET C 1 39  ? 11.544  87.981  17.399  1.00 172.35 ? 37   MET C N   1 
ATOM   4317  C CA  . MET C 1 39  ? 10.424  88.275  16.519  1.00 171.35 ? 37   MET C CA  1 
ATOM   4318  C C   . MET C 1 39  ? 10.424  87.474  15.223  1.00 171.01 ? 37   MET C C   1 
ATOM   4319  O O   . MET C 1 39  ? 11.423  86.861  14.845  1.00 170.91 ? 37   MET C O   1 
ATOM   4320  C CB  . MET C 1 39  ? 10.394  89.765  16.175  1.00 152.66 ? 37   MET C CB  1 
ATOM   4321  C CG  . MET C 1 39  ? 9.847   90.653  17.273  1.00 151.55 ? 37   MET C CG  1 
ATOM   4322  S SD  . MET C 1 39  ? 9.489   92.300  16.652  1.00 151.33 ? 37   MET C SD  1 
ATOM   4323  C CE  . MET C 1 39  ? 8.003   91.978  15.679  1.00 150.27 ? 37   MET C CE  1 
ATOM   4324  N N   . ASP C 1 40  ? 9.279   87.497  14.550  1.00 200.00 ? 38   ASP C N   1 
ATOM   4325  C CA  . ASP C 1 40  ? 9.087   86.805  13.284  1.00 200.00 ? 38   ASP C CA  1 
ATOM   4326  C C   . ASP C 1 40  ? 7.865   87.424  12.618  1.00 199.89 ? 38   ASP C C   1 
ATOM   4327  O O   . ASP C 1 40  ? 6.763   87.385  13.171  1.00 199.89 ? 38   ASP C O   1 
ATOM   4328  C CB  . ASP C 1 40  ? 8.842   85.311  13.517  1.00 200.00 ? 38   ASP C CB  1 
ATOM   4329  C CG  . ASP C 1 40  ? 8.720   84.532  12.220  1.00 200.00 ? 38   ASP C CG  1 
ATOM   4330  O OD1 . ASP C 1 40  ? 8.364   83.335  12.273  1.00 200.00 ? 38   ASP C OD1 1 
ATOM   4331  O OD2 . ASP C 1 40  ? 8.986   85.114  11.147  1.00 200.00 ? 38   ASP C OD2 1 
ATOM   4332  N N   . LEU C 1 41  ? 8.061   88.003  11.437  1.00 169.21 ? 39   LEU C N   1 
ATOM   4333  C CA  . LEU C 1 41  ? 6.962   88.628  10.713  1.00 167.16 ? 39   LEU C CA  1 
ATOM   4334  C C   . LEU C 1 41  ? 5.732   87.721  10.718  1.00 166.85 ? 39   LEU C C   1 
ATOM   4335  O O   . LEU C 1 41  ? 4.599   88.202  10.682  1.00 166.60 ? 39   LEU C O   1 
ATOM   4336  C CB  . LEU C 1 41  ? 7.386   88.952  9.271   1.00 117.89 ? 39   LEU C CB  1 
ATOM   4337  C CG  . LEU C 1 41  ? 8.436   90.056  9.066   1.00 115.50 ? 39   LEU C CG  1 
ATOM   4338  C CD1 . LEU C 1 41  ? 8.899   90.076  7.615   1.00 114.00 ? 39   LEU C CD1 1 
ATOM   4339  C CD2 . LEU C 1 41  ? 7.852   91.409  9.456   1.00 114.08 ? 39   LEU C CD2 1 
ATOM   4340  N N   . ALA C 1 42  ? 5.964   86.412  10.785  1.00 200.00 ? 40   ALA C N   1 
ATOM   4341  C CA  . ALA C 1 42  ? 4.884   85.428  10.796  1.00 200.00 ? 40   ALA C CA  1 
ATOM   4342  C C   . ALA C 1 42  ? 3.746   85.830  11.729  1.00 200.00 ? 40   ALA C C   1 
ATOM   4343  O O   . ALA C 1 42  ? 2.730   86.363  11.285  1.00 200.00 ? 40   ALA C O   1 
ATOM   4344  C CB  . ALA C 1 42  ? 5.427   84.055  11.197  1.00 159.76 ? 40   ALA C CB  1 
ATOM   4345  N N   . THR C 1 43  ? 3.921   85.579  13.021  1.00 165.21 ? 41   THR C N   1 
ATOM   4346  C CA  . THR C 1 43  ? 2.892   85.907  14.002  1.00 162.14 ? 41   THR C CA  1 
ATOM   4347  C C   . THR C 1 43  ? 3.370   86.909  15.050  1.00 160.08 ? 41   THR C C   1 
ATOM   4348  O O   . THR C 1 43  ? 2.567   87.618  15.659  1.00 158.98 ? 41   THR C O   1 
ATOM   4349  C CB  . THR C 1 43  ? 2.395   84.633  14.719  1.00 176.24 ? 41   THR C CB  1 
ATOM   4350  O OG1 . THR C 1 43  ? 3.511   83.943  15.293  1.00 175.60 ? 41   THR C OG1 1 
ATOM   4351  C CG2 . THR C 1 43  ? 1.688   83.709  13.736  1.00 175.35 ? 41   THR C CG2 1 
ATOM   4352  N N   . VAL C 1 44  ? 4.680   86.964  15.260  1.00 121.78 ? 42   VAL C N   1 
ATOM   4353  C CA  . VAL C 1 44  ? 5.241   87.884  16.235  1.00 120.28 ? 42   VAL C CA  1 
ATOM   4354  C C   . VAL C 1 44  ? 5.146   89.309  15.707  1.00 119.67 ? 42   VAL C C   1 
ATOM   4355  O O   . VAL C 1 44  ? 5.340   90.268  16.450  1.00 119.25 ? 42   VAL C O   1 
ATOM   4356  C CB  . VAL C 1 44  ? 6.721   87.548  16.540  1.00 145.94 ? 42   VAL C CB  1 
ATOM   4357  C CG1 . VAL C 1 44  ? 7.234   88.426  17.672  1.00 145.60 ? 42   VAL C CG1 1 
ATOM   4358  C CG2 . VAL C 1 44  ? 6.855   86.079  16.909  1.00 145.52 ? 42   VAL C CG2 1 
ATOM   4359  N N   . SER C 1 45  ? 4.834   89.444  14.422  1.00 156.05 ? 43   SER C N   1 
ATOM   4360  C CA  . SER C 1 45  ? 4.722   90.763  13.812  1.00 156.44 ? 43   SER C CA  1 
ATOM   4361  C C   . SER C 1 45  ? 3.272   91.178  13.598  1.00 155.68 ? 43   SER C C   1 
ATOM   4362  O O   . SER C 1 45  ? 2.859   92.241  14.052  1.00 155.91 ? 43   SER C O   1 
ATOM   4363  C CB  . SER C 1 45  ? 5.467   90.796  12.478  1.00 200.00 ? 43   SER C CB  1 
ATOM   4364  O OG  . SER C 1 45  ? 5.554   92.118  11.974  1.00 200.00 ? 43   SER C OG  1 
ATOM   4365  N N   . ALA C 1 46  ? 2.504   90.347  12.901  1.00 171.68 ? 44   ALA C N   1 
ATOM   4366  C CA  . ALA C 1 46  ? 1.097   90.651  12.648  1.00 170.62 ? 44   ALA C CA  1 
ATOM   4367  C C   . ALA C 1 46  ? 0.429   90.937  13.986  1.00 169.77 ? 44   ALA C C   1 
ATOM   4368  O O   . ALA C 1 46  ? -0.550  91.681  14.075  1.00 169.38 ? 44   ALA C O   1 
ATOM   4369  C CB  . ALA C 1 46  ? 0.419   89.472  11.963  1.00 145.00 ? 44   ALA C CB  1 
ATOM   4370  N N   . LEU C 1 47  ? 0.982   90.335  15.029  1.00 136.38 ? 45   LEU C N   1 
ATOM   4371  C CA  . LEU C 1 47  ? 0.469   90.510  16.371  1.00 135.07 ? 45   LEU C CA  1 
ATOM   4372  C C   . LEU C 1 47  ? 0.592   91.975  16.748  1.00 134.62 ? 45   LEU C C   1 
ATOM   4373  O O   . LEU C 1 47  ? -0.235  92.512  17.483  1.00 133.61 ? 45   LEU C O   1 
ATOM   4374  C CB  . LEU C 1 47  ? 1.272   89.651  17.330  1.00 136.25 ? 45   LEU C CB  1 
ATOM   4375  C CG  . LEU C 1 47  ? 0.647   89.470  18.702  1.00 135.78 ? 45   LEU C CG  1 
ATOM   4376  C CD1 . LEU C 1 47  ? 1.206   88.196  19.288  1.00 135.75 ? 45   LEU C CD1 1 
ATOM   4377  C CD2 . LEU C 1 47  ? 0.903   90.687  19.590  1.00 135.41 ? 45   LEU C CD2 1 
ATOM   4378  N N   . ARG C 1 48  ? 1.645   92.610  16.246  1.00 144.53 ? 46   ARG C N   1 
ATOM   4379  C CA  . ARG C 1 48  ? 1.874   94.026  16.495  1.00 145.11 ? 46   ARG C CA  1 
ATOM   4380  C C   . ARG C 1 48  ? 0.599   94.759  16.099  1.00 144.09 ? 46   ARG C C   1 
ATOM   4381  O O   . ARG C 1 48  ? -0.107  95.319  16.940  1.00 143.56 ? 46   ARG C O   1 
ATOM   4382  C CB  . ARG C 1 48  ? 3.028   94.545  15.630  1.00 189.42 ? 46   ARG C CB  1 
ATOM   4383  C CG  . ARG C 1 48  ? 4.405   94.022  15.991  1.00 191.74 ? 46   ARG C CG  1 
ATOM   4384  C CD  . ARG C 1 48  ? 4.927   94.688  17.249  1.00 194.43 ? 46   ARG C CD  1 
ATOM   4385  N NE  . ARG C 1 48  ? 6.325   94.352  17.500  1.00 197.54 ? 46   ARG C NE  1 
ATOM   4386  C CZ  . ARG C 1 48  ? 7.029   94.806  18.531  1.00 198.60 ? 46   ARG C CZ  1 
ATOM   4387  N NH1 . ARG C 1 48  ? 6.467   95.619  19.415  1.00 198.86 ? 46   ARG C NH1 1 
ATOM   4388  N NH2 . ARG C 1 48  ? 8.297   94.446  18.679  1.00 198.68 ? 46   ARG C NH2 1 
ATOM   4389  N N   . LYS C 1 49  ? 0.317   94.731  14.800  1.00 160.45 ? 47   LYS C N   1 
ATOM   4390  C CA  . LYS C 1 49  ? -0.855  95.380  14.237  1.00 160.64 ? 47   LYS C CA  1 
ATOM   4391  C C   . LYS C 1 49  ? -2.098  95.148  15.084  1.00 161.45 ? 47   LYS C C   1 
ATOM   4392  O O   . LYS C 1 49  ? -2.967  96.016  15.175  1.00 162.04 ? 47   LYS C O   1 
ATOM   4393  C CB  . LYS C 1 49  ? -1.087  94.880  12.810  1.00 122.59 ? 47   LYS C CB  1 
ATOM   4394  C CG  . LYS C 1 49  ? -2.258  95.545  12.109  1.00 121.85 ? 47   LYS C CG  1 
ATOM   4395  C CD  . LYS C 1 49  ? -1.997  95.689  10.619  1.00 121.24 ? 47   LYS C CD  1 
ATOM   4396  C CE  . LYS C 1 49  ? -0.787  96.581  10.366  1.00 121.55 ? 47   LYS C CE  1 
ATOM   4397  N NZ  . LYS C 1 49  ? -0.490  96.752  8.916   1.00 122.18 ? 47   LYS C NZ  1 
ATOM   4398  N N   . MET C 1 50  ? -2.177  93.977  15.705  1.00 133.35 ? 48   MET C N   1 
ATOM   4399  C CA  . MET C 1 50  ? -3.312  93.640  16.555  1.00 133.86 ? 48   MET C CA  1 
ATOM   4400  C C   . MET C 1 50  ? -3.622  94.787  17.514  1.00 132.25 ? 48   MET C C   1 
ATOM   4401  O O   . MET C 1 50  ? -4.780  95.148  17.725  1.00 130.68 ? 48   MET C O   1 
ATOM   4402  C CB  . MET C 1 50  ? -2.998  92.372  17.351  1.00 191.96 ? 48   MET C CB  1 
ATOM   4403  C CG  . MET C 1 50  ? -4.016  92.023  18.419  1.00 196.75 ? 48   MET C CG  1 
ATOM   4404  S SD  . MET C 1 50  ? -5.662  91.729  17.762  1.00 200.00 ? 48   MET C SD  1 
ATOM   4405  C CE  . MET C 1 50  ? -6.544  93.170  18.367  1.00 200.00 ? 48   MET C CE  1 
ATOM   4406  N N   . GLY C 1 51  ? -2.572  95.371  18.075  1.00 109.21 ? 49   GLY C N   1 
ATOM   4407  C CA  . GLY C 1 51  ? -2.756  96.451  19.017  1.00 109.11 ? 49   GLY C CA  1 
ATOM   4408  C C   . GLY C 1 51  ? -2.502  95.867  20.386  1.00 109.81 ? 49   GLY C C   1 
ATOM   4409  O O   . GLY C 1 51  ? -3.215  96.150  21.346  1.00 109.87 ? 49   GLY C O   1 
ATOM   4410  N N   . VAL C 1 52  ? -1.481  95.019  20.458  1.00 157.51 ? 50   VAL C N   1 
ATOM   4411  C CA  . VAL C 1 52  ? -1.094  94.371  21.703  1.00 159.01 ? 50   VAL C CA  1 
ATOM   4412  C C   . VAL C 1 52  ? 0.395   94.603  21.937  1.00 160.09 ? 50   VAL C C   1 
ATOM   4413  O O   . VAL C 1 52  ? 1.236   94.105  21.186  1.00 160.08 ? 50   VAL C O   1 
ATOM   4414  C CB  . VAL C 1 52  ? -1.370  92.856  21.652  1.00 131.09 ? 50   VAL C CB  1 
ATOM   4415  C CG1 . VAL C 1 52  ? -1.005  92.215  22.977  1.00 131.45 ? 50   VAL C CG1 1 
ATOM   4416  C CG2 . VAL C 1 52  ? -2.830  92.611  21.342  1.00 130.47 ? 50   VAL C CG2 1 
ATOM   4417  N N   . LYS C 1 53  ? 0.707   95.367  22.981  1.00 196.28 ? 51   LYS C N   1 
ATOM   4418  C CA  . LYS C 1 53  ? 2.084   95.705  23.339  1.00 196.52 ? 51   LYS C CA  1 
ATOM   4419  C C   . LYS C 1 53  ? 3.030   94.505  23.366  1.00 196.21 ? 51   LYS C C   1 
ATOM   4420  O O   . LYS C 1 53  ? 2.667   93.431  23.840  1.00 196.68 ? 51   LYS C O   1 
ATOM   4421  C CB  . LYS C 1 53  ? 2.117   96.397  24.711  1.00 126.17 ? 51   LYS C CB  1 
ATOM   4422  C CG  . LYS C 1 53  ? 1.410   97.751  24.771  1.00 125.78 ? 51   LYS C CG  1 
ATOM   4423  C CD  . LYS C 1 53  ? -0.107  97.640  24.618  1.00 124.62 ? 51   LYS C CD  1 
ATOM   4424  C CE  . LYS C 1 53  ? -0.765  96.977  25.823  1.00 123.46 ? 51   LYS C CE  1 
ATOM   4425  N NZ  . LYS C 1 53  ? -0.392  95.547  25.987  1.00 122.34 ? 51   LYS C NZ  1 
ATOM   4426  N N   . LEU C 1 54  ? 4.245   94.698  22.857  1.00 187.11 ? 52   LEU C N   1 
ATOM   4427  C CA  . LEU C 1 54  ? 5.251   93.638  22.840  1.00 186.32 ? 52   LEU C CA  1 
ATOM   4428  C C   . LEU C 1 54  ? 6.384   93.945  23.813  1.00 186.51 ? 52   LEU C C   1 
ATOM   4429  O O   . LEU C 1 54  ? 7.212   94.819  23.557  1.00 186.85 ? 52   LEU C O   1 
ATOM   4430  C CB  . LEU C 1 54  ? 5.829   93.452  21.425  1.00 145.30 ? 52   LEU C CB  1 
ATOM   4431  C CG  . LEU C 1 54  ? 7.096   92.587  21.272  1.00 143.76 ? 52   LEU C CG  1 
ATOM   4432  C CD1 . LEU C 1 54  ? 7.112   91.903  19.913  1.00 142.69 ? 52   LEU C CD1 1 
ATOM   4433  C CD2 . LEU C 1 54  ? 8.341   93.447  21.448  1.00 141.98 ? 52   LEU C CD2 1 
ATOM   4434  N N   . THR C 1 55  ? 6.411   93.237  24.937  1.00 144.30 ? 53   THR C N   1 
ATOM   4435  C CA  . THR C 1 55  ? 7.473   93.440  25.908  1.00 143.63 ? 53   THR C CA  1 
ATOM   4436  C C   . THR C 1 55  ? 8.660   92.612  25.441  1.00 144.51 ? 53   THR C C   1 
ATOM   4437  O O   . THR C 1 55  ? 8.540   91.408  25.209  1.00 144.48 ? 53   THR C O   1 
ATOM   4438  C CB  . THR C 1 55  ? 7.079   92.974  27.326  1.00 100.24 ? 53   THR C CB  1 
ATOM   4439  O OG1 . THR C 1 55  ? 6.041   93.814  27.846  1.00 98.25  ? 53   THR C OG1 1 
ATOM   4440  C CG2 . THR C 1 55  ? 8.279   93.047  28.249  1.00 99.15  ? 53   THR C CG2 1 
ATOM   4441  N N   . PRO C 1 56  ? 9.822   93.253  25.279  1.00 171.94 ? 54   PRO C N   1 
ATOM   4442  C CA  . PRO C 1 56  ? 11.015  92.531  24.833  1.00 172.62 ? 54   PRO C CA  1 
ATOM   4443  C C   . PRO C 1 56  ? 11.533  91.592  25.922  1.00 173.63 ? 54   PRO C C   1 
ATOM   4444  O O   . PRO C 1 56  ? 12.450  90.802  25.695  1.00 173.49 ? 54   PRO C O   1 
ATOM   4445  C CB  . PRO C 1 56  ? 11.989  93.659  24.509  1.00 131.84 ? 54   PRO C CB  1 
ATOM   4446  C CG  . PRO C 1 56  ? 11.620  94.708  25.520  1.00 131.73 ? 54   PRO C CG  1 
ATOM   4447  C CD  . PRO C 1 56  ? 10.111  94.684  25.486  1.00 131.60 ? 54   PRO C CD  1 
ATOM   4448  N N   . HIS C 1 57  ? 10.926  91.677  27.102  1.00 154.81 ? 55   HIS C N   1 
ATOM   4449  C CA  . HIS C 1 57  ? 11.334  90.852  28.229  1.00 155.67 ? 55   HIS C CA  1 
ATOM   4450  C C   . HIS C 1 57  ? 10.171  90.053  28.788  1.00 155.69 ? 55   HIS C C   1 
ATOM   4451  O O   . HIS C 1 57  ? 9.100   90.598  29.049  1.00 155.73 ? 55   HIS C O   1 
ATOM   4452  C CB  . HIS C 1 57  ? 11.913  91.736  29.331  1.00 200.00 ? 55   HIS C CB  1 
ATOM   4453  C CG  . HIS C 1 57  ? 12.907  92.736  28.834  1.00 200.00 ? 55   HIS C CG  1 
ATOM   4454  N ND1 . HIS C 1 57  ? 14.028  92.376  28.120  1.00 200.00 ? 55   HIS C ND1 1 
ATOM   4455  C CD2 . HIS C 1 57  ? 12.941  94.086  28.936  1.00 200.00 ? 55   HIS C CD2 1 
ATOM   4456  C CE1 . HIS C 1 57  ? 14.711  93.461  27.801  1.00 200.00 ? 55   HIS C CE1 1 
ATOM   4457  N NE2 . HIS C 1 57  ? 14.073  94.512  28.284  1.00 200.00 ? 55   HIS C NE2 1 
ATOM   4458  N N   . ASN C 1 58  ? 10.390  88.756  28.974  1.00 199.77 ? 56   ASN C N   1 
ATOM   4459  C CA  . ASN C 1 58  ? 9.360   87.880  29.516  1.00 199.77 ? 56   ASN C CA  1 
ATOM   4460  C C   . ASN C 1 58  ? 9.131   88.240  30.983  1.00 199.41 ? 56   ASN C C   1 
ATOM   4461  O O   . ASN C 1 58  ? 9.095   87.372  31.856  1.00 199.13 ? 56   ASN C O   1 
ATOM   4462  C CB  . ASN C 1 58  ? 9.794   86.415  29.384  1.00 157.92 ? 56   ASN C CB  1 
ATOM   4463  C CG  . ASN C 1 58  ? 10.159  86.034  27.952  1.00 156.92 ? 56   ASN C CG  1 
ATOM   4464  O OD1 . ASN C 1 58  ? 9.390   86.266  27.017  1.00 156.11 ? 56   ASN C OD1 1 
ATOM   4465  N ND2 . ASN C 1 58  ? 11.334  85.439  27.779  1.00 156.03 ? 56   ASN C ND2 1 
ATOM   4466  N N   . LYS C 1 59  ? 8.974   89.535  31.241  1.00 124.81 ? 57   LYS C N   1 
ATOM   4467  C CA  . LYS C 1 59  ? 8.768   90.031  32.591  1.00 123.37 ? 57   LYS C CA  1 
ATOM   4468  C C   . LYS C 1 59  ? 7.684   91.104  32.646  1.00 122.47 ? 57   LYS C C   1 
ATOM   4469  O O   . LYS C 1 59  ? 6.618   90.870  33.198  1.00 121.97 ? 57   LYS C O   1 
ATOM   4470  C CB  . LYS C 1 59  ? 10.079  90.599  33.140  1.00 160.90 ? 57   LYS C CB  1 
ATOM   4471  C CG  . LYS C 1 59  ? 11.263  89.644  33.052  1.00 161.36 ? 57   LYS C CG  1 
ATOM   4472  C CD  . LYS C 1 59  ? 12.529  90.276  33.616  1.00 161.51 ? 57   LYS C CD  1 
ATOM   4473  C CE  . LYS C 1 59  ? 13.713  89.325  33.535  1.00 161.24 ? 57   LYS C CE  1 
ATOM   4474  N NZ  . LYS C 1 59  ? 14.920  89.888  34.201  1.00 161.62 ? 57   LYS C NZ  1 
ATOM   4475  N N   . GLU C 1 60  ? 7.959   92.274  32.070  1.00 127.76 ? 58   GLU C N   1 
ATOM   4476  C CA  . GLU C 1 60  ? 7.014   93.396  32.067  1.00 126.93 ? 58   GLU C CA  1 
ATOM   4477  C C   . GLU C 1 60  ? 5.580   92.949  31.824  1.00 126.12 ? 58   GLU C C   1 
ATOM   4478  O O   . GLU C 1 60  ? 4.629   93.576  32.296  1.00 125.45 ? 58   GLU C O   1 
ATOM   4479  C CB  . GLU C 1 60  ? 7.406   94.405  30.995  1.00 149.64 ? 58   GLU C CB  1 
ATOM   4480  C CG  . GLU C 1 60  ? 8.869   94.785  31.027  1.00 150.66 ? 58   GLU C CG  1 
ATOM   4481  C CD  . GLU C 1 60  ? 9.263   95.659  29.856  1.00 151.48 ? 58   GLU C CD  1 
ATOM   4482  O OE1 . GLU C 1 60  ? 8.762   96.801  29.766  1.00 152.96 ? 58   GLU C OE1 1 
ATOM   4483  O OE2 . GLU C 1 60  ? 10.072  95.201  29.020  1.00 151.43 ? 58   GLU C OE2 1 
ATOM   4484  N N   . THR C 1 61  ? 5.442   91.867  31.068  1.00 140.81 ? 59   THR C N   1 
ATOM   4485  C CA  . THR C 1 61  ? 4.143   91.292  30.748  1.00 138.59 ? 59   THR C CA  1 
ATOM   4486  C C   . THR C 1 61  ? 3.576   90.667  32.015  1.00 137.23 ? 59   THR C C   1 
ATOM   4487  O O   . THR C 1 61  ? 2.378   90.729  32.282  1.00 135.72 ? 59   THR C O   1 
ATOM   4488  C CB  . THR C 1 61  ? 4.295   90.193  29.691  1.00 143.60 ? 59   THR C CB  1 
ATOM   4489  O OG1 . THR C 1 61  ? 4.961   90.730  28.543  1.00 142.79 ? 59   THR C OG1 1 
ATOM   4490  C CG2 . THR C 1 61  ? 2.935   89.649  29.289  1.00 143.92 ? 59   THR C CG2 1 
ATOM   4491  N N   . VAL C 1 62  ? 4.477   90.068  32.785  1.00 150.65 ? 60   VAL C N   1 
ATOM   4492  C CA  . VAL C 1 62  ? 4.171   89.394  34.041  1.00 150.05 ? 60   VAL C CA  1 
ATOM   4493  C C   . VAL C 1 62  ? 3.698   90.346  35.149  1.00 150.67 ? 60   VAL C C   1 
ATOM   4494  O O   . VAL C 1 62  ? 3.547   89.938  36.301  1.00 150.64 ? 60   VAL C O   1 
ATOM   4495  C CB  . VAL C 1 62  ? 5.428   88.646  34.558  1.00 90.82  ? 60   VAL C CB  1 
ATOM   4496  C CG1 . VAL C 1 62  ? 5.036   87.609  35.599  1.00 90.60  ? 60   VAL C CG1 1 
ATOM   4497  C CG2 . VAL C 1 62  ? 6.178   88.014  33.391  1.00 88.89  ? 60   VAL C CG2 1 
ATOM   4498  N N   . GLN C 1 63  ? 3.466   91.610  34.811  1.00 121.68 ? 61   GLN C N   1 
ATOM   4499  C CA  . GLN C 1 63  ? 3.029   92.582  35.809  1.00 122.03 ? 61   GLN C CA  1 
ATOM   4500  C C   . GLN C 1 63  ? 1.558   92.937  35.725  1.00 122.63 ? 61   GLN C C   1 
ATOM   4501  O O   . GLN C 1 63  ? 0.792   92.683  36.652  1.00 122.19 ? 61   GLN C O   1 
ATOM   4502  C CB  . GLN C 1 63  ? 3.868   93.855  35.698  1.00 160.17 ? 61   GLN C CB  1 
ATOM   4503  C CG  . GLN C 1 63  ? 5.172   93.765  36.455  1.00 162.24 ? 61   GLN C CG  1 
ATOM   4504  C CD  . GLN C 1 63  ? 5.854   92.433  36.249  1.00 162.93 ? 61   GLN C CD  1 
ATOM   4505  O OE1 . GLN C 1 63  ? 6.258   92.098  35.139  1.00 163.03 ? 61   GLN C OE1 1 
ATOM   4506  N NE2 . GLN C 1 63  ? 5.976   91.658  37.320  1.00 163.52 ? 61   GLN C NE2 1 
ATOM   4507  N N   . HIS C 1 64  ? 1.170   93.536  34.608  1.00 200.00 ? 62   HIS C N   1 
ATOM   4508  C CA  . HIS C 1 64  ? -0.212  93.940  34.384  1.00 200.00 ? 62   HIS C CA  1 
ATOM   4509  C C   . HIS C 1 64  ? -1.106  92.704  34.313  1.00 200.00 ? 62   HIS C C   1 
ATOM   4510  O O   . HIS C 1 64  ? -2.255  92.797  33.888  1.00 200.00 ? 62   HIS C O   1 
ATOM   4511  C CB  . HIS C 1 64  ? -0.319  94.667  33.051  1.00 141.62 ? 62   HIS C CB  1 
ATOM   4512  C CG  . HIS C 1 64  ? -0.269  93.742  31.878  1.00 141.97 ? 62   HIS C CG  1 
ATOM   4513  N ND1 . HIS C 1 64  ? 0.798   92.901  31.644  1.00 141.50 ? 62   HIS C ND1 1 
ATOM   4514  C CD2 . HIS C 1 64  ? -1.192  93.451  30.932  1.00 141.74 ? 62   HIS C CD2 1 
ATOM   4515  C CE1 . HIS C 1 64  ? 0.527   92.129  30.608  1.00 141.19 ? 62   HIS C CE1 1 
ATOM   4516  N NE2 . HIS C 1 64  ? -0.674  92.442  30.158  1.00 141.71 ? 62   HIS C NE2 1 
ATOM   4517  N N   . SER C 1 65  ? -0.578  91.555  34.722  1.00 126.79 ? 63   SER C N   1 
ATOM   4518  C CA  . SER C 1 65  ? -1.322  90.305  34.647  1.00 125.44 ? 63   SER C CA  1 
ATOM   4519  C C   . SER C 1 65  ? -2.161  89.926  35.862  1.00 125.91 ? 63   SER C C   1 
ATOM   4520  O O   . SER C 1 65  ? -2.072  90.535  36.928  1.00 125.92 ? 63   SER C O   1 
ATOM   4521  C CB  . SER C 1 65  ? -0.356  89.163  34.338  1.00 102.75 ? 63   SER C CB  1 
ATOM   4522  O OG  . SER C 1 65  ? 0.558   89.534  33.321  1.00 100.74 ? 63   SER C OG  1 
ATOM   4523  N N   . ASP C 1 66  ? -2.984  88.902  35.665  1.00 199.63 ? 64   ASP C N   1 
ATOM   4524  C CA  . ASP C 1 66  ? -3.859  88.358  36.694  1.00 199.63 ? 64   ASP C CA  1 
ATOM   4525  C C   . ASP C 1 66  ? -3.941  86.864  36.366  1.00 199.63 ? 64   ASP C C   1 
ATOM   4526  O O   . ASP C 1 66  ? -4.573  86.082  37.077  1.00 199.63 ? 64   ASP C O   1 
ATOM   4527  C CB  . ASP C 1 66  ? -5.246  89.013  36.620  1.00 150.87 ? 64   ASP C CB  1 
ATOM   4528  C CG  . ASP C 1 66  ? -6.086  88.765  37.867  1.00 150.71 ? 64   ASP C CG  1 
ATOM   4529  O OD1 . ASP C 1 66  ? -7.215  89.296  37.942  1.00 150.50 ? 64   ASP C OD1 1 
ATOM   4530  O OD2 . ASP C 1 66  ? -5.620  88.041  38.772  1.00 150.34 ? 64   ASP C OD2 1 
ATOM   4531  N N   . VAL C 1 67  ? -3.278  86.500  35.268  1.00 150.99 ? 65   VAL C N   1 
ATOM   4532  C CA  . VAL C 1 67  ? -3.192  85.128  34.761  1.00 147.91 ? 65   VAL C CA  1 
ATOM   4533  C C   . VAL C 1 67  ? -2.302  85.157  33.523  1.00 146.80 ? 65   VAL C C   1 
ATOM   4534  O O   . VAL C 1 67  ? -2.479  85.999  32.642  1.00 146.61 ? 65   VAL C O   1 
ATOM   4535  C CB  . VAL C 1 67  ? -4.564  84.560  34.355  1.00 100.65 ? 65   VAL C CB  1 
ATOM   4536  C CG1 . VAL C 1 67  ? -5.212  85.455  33.316  1.00 100.15 ? 65   VAL C CG1 1 
ATOM   4537  C CG2 . VAL C 1 67  ? -4.394  83.151  33.801  1.00 99.66  ? 65   VAL C CG2 1 
ATOM   4538  N N   . LEU C 1 68  ? -1.351  84.235  33.447  1.00 140.82 ? 66   LEU C N   1 
ATOM   4539  C CA  . LEU C 1 68  ? -0.442  84.218  32.315  1.00 139.18 ? 66   LEU C CA  1 
ATOM   4540  C C   . LEU C 1 68  ? -0.337  82.862  31.623  1.00 137.42 ? 66   LEU C C   1 
ATOM   4541  O O   . LEU C 1 68  ? -0.113  81.829  32.258  1.00 136.43 ? 66   LEU C O   1 
ATOM   4542  C CB  . LEU C 1 68  ? 0.940   84.688  32.774  1.00 152.22 ? 66   LEU C CB  1 
ATOM   4543  C CG  . LEU C 1 68  ? 1.879   85.237  31.702  1.00 152.53 ? 66   LEU C CG  1 
ATOM   4544  C CD1 . LEU C 1 68  ? 3.093   85.837  32.378  1.00 152.49 ? 66   LEU C CD1 1 
ATOM   4545  C CD2 . LEU C 1 68  ? 2.283   84.136  30.731  1.00 153.93 ? 66   LEU C CD2 1 
ATOM   4546  N N   . PHE C 1 69  ? -0.492  82.884  30.305  1.00 109.20 ? 67   PHE C N   1 
ATOM   4547  C CA  . PHE C 1 69  ? -0.419  81.674  29.508  1.00 108.02 ? 67   PHE C CA  1 
ATOM   4548  C C   . PHE C 1 69  ? 0.998   81.419  29.033  1.00 106.85 ? 67   PHE C C   1 
ATOM   4549  O O   . PHE C 1 69  ? 1.421   81.936  27.999  1.00 105.53 ? 67   PHE C O   1 
ATOM   4550  C CB  . PHE C 1 69  ? -1.358  81.778  28.306  1.00 133.62 ? 67   PHE C CB  1 
ATOM   4551  C CG  . PHE C 1 69  ? -2.812  81.832  28.680  1.00 134.84 ? 67   PHE C CG  1 
ATOM   4552  C CD1 . PHE C 1 69  ? -3.334  82.938  29.340  1.00 135.25 ? 67   PHE C CD1 1 
ATOM   4553  C CD2 . PHE C 1 69  ? -3.653  80.760  28.403  1.00 134.73 ? 67   PHE C CD2 1 
ATOM   4554  C CE1 . PHE C 1 69  ? -4.674  82.974  29.720  1.00 135.49 ? 67   PHE C CE1 1 
ATOM   4555  C CE2 . PHE C 1 69  ? -4.994  80.786  28.780  1.00 134.74 ? 67   PHE C CE2 1 
ATOM   4556  C CZ  . PHE C 1 69  ? -5.505  81.896  29.440  1.00 134.78 ? 67   PHE C CZ  1 
ATOM   4557  N N   . LEU C 1 70  ? 1.731   80.624  29.802  1.00 95.10  ? 68   LEU C N   1 
ATOM   4558  C CA  . LEU C 1 70  ? 3.101   80.286  29.451  1.00 96.14  ? 68   LEU C CA  1 
ATOM   4559  C C   . LEU C 1 70  ? 3.075   79.395  28.215  1.00 97.08  ? 68   LEU C C   1 
ATOM   4560  O O   . LEU C 1 70  ? 3.085   78.168  28.325  1.00 97.14  ? 68   LEU C O   1 
ATOM   4561  C CB  . LEU C 1 70  ? 3.764   79.545  30.605  1.00 178.17 ? 68   LEU C CB  1 
ATOM   4562  C CG  . LEU C 1 70  ? 5.191   79.075  30.336  1.00 178.69 ? 68   LEU C CG  1 
ATOM   4563  C CD1 . LEU C 1 70  ? 6.099   80.278  30.096  1.00 178.61 ? 68   LEU C CD1 1 
ATOM   4564  C CD2 . LEU C 1 70  ? 5.664   78.248  31.514  1.00 178.39 ? 68   LEU C CD2 1 
ATOM   4565  N N   . ALA C 1 71  ? 3.050   80.017  27.039  1.00 130.96 ? 69   ALA C N   1 
ATOM   4566  C CA  . ALA C 1 71  ? 2.990   79.272  25.786  1.00 132.89 ? 69   ALA C CA  1 
ATOM   4567  C C   . ALA C 1 71  ? 4.289   79.263  24.993  1.00 133.67 ? 69   ALA C C   1 
ATOM   4568  O O   . ALA C 1 71  ? 4.475   80.069  24.084  1.00 133.19 ? 69   ALA C O   1 
ATOM   4569  C CB  . ALA C 1 71  ? 1.867   79.821  24.919  1.00 180.54 ? 69   ALA C CB  1 
ATOM   4570  N N   . VAL C 1 72  ? 5.179   78.336  25.327  1.00 150.69 ? 70   VAL C N   1 
ATOM   4571  C CA  . VAL C 1 72  ? 6.451   78.232  24.627  1.00 151.39 ? 70   VAL C CA  1 
ATOM   4572  C C   . VAL C 1 72  ? 6.782   76.769  24.356  1.00 152.01 ? 70   VAL C C   1 
ATOM   4573  O O   . VAL C 1 72  ? 6.296   75.880  25.057  1.00 152.40 ? 70   VAL C O   1 
ATOM   4574  C CB  . VAL C 1 72  ? 7.587   78.851  25.453  1.00 119.12 ? 70   VAL C CB  1 
ATOM   4575  C CG1 . VAL C 1 72  ? 8.829   78.985  24.594  1.00 118.56 ? 70   VAL C CG1 1 
ATOM   4576  C CG2 . VAL C 1 72  ? 7.159   80.204  25.995  1.00 118.60 ? 70   VAL C CG2 1 
ATOM   4577  N N   . LYS C 1 73  ? 7.604   76.526  23.337  1.00 137.20 ? 71   LYS C N   1 
ATOM   4578  C CA  . LYS C 1 73  ? 7.997   75.165  22.982  1.00 136.98 ? 71   LYS C CA  1 
ATOM   4579  C C   . LYS C 1 73  ? 8.471   74.442  24.234  1.00 137.00 ? 71   LYS C C   1 
ATOM   4580  O O   . LYS C 1 73  ? 9.207   75.007  25.043  1.00 137.92 ? 71   LYS C O   1 
ATOM   4581  C CB  . LYS C 1 73  ? 9.127   75.168  21.948  1.00 129.18 ? 71   LYS C CB  1 
ATOM   4582  C CG  . LYS C 1 73  ? 8.816   75.895  20.651  1.00 129.64 ? 71   LYS C CG  1 
ATOM   4583  C CD  . LYS C 1 73  ? 8.788   77.403  20.849  1.00 130.67 ? 71   LYS C CD  1 
ATOM   4584  C CE  . LYS C 1 73  ? 10.146  77.936  21.290  1.00 131.02 ? 71   LYS C CE  1 
ATOM   4585  N NZ  . LYS C 1 73  ? 10.142  79.415  21.475  1.00 131.05 ? 71   LYS C NZ  1 
ATOM   4586  N N   . PRO C 1 74  ? 8.057   73.177  24.408  1.00 163.01 ? 72   PRO C N   1 
ATOM   4587  C CA  . PRO C 1 74  ? 8.443   72.379  25.574  1.00 162.98 ? 72   PRO C CA  1 
ATOM   4588  C C   . PRO C 1 74  ? 9.916   72.508  25.952  1.00 163.33 ? 72   PRO C C   1 
ATOM   4589  O O   . PRO C 1 74  ? 10.254  72.591  27.134  1.00 162.73 ? 72   PRO C O   1 
ATOM   4590  C CB  . PRO C 1 74  ? 8.072   70.963  25.150  1.00 135.57 ? 72   PRO C CB  1 
ATOM   4591  C CG  . PRO C 1 74  ? 6.838   71.192  24.342  1.00 134.85 ? 72   PRO C CG  1 
ATOM   4592  C CD  . PRO C 1 74  ? 7.235   72.377  23.482  1.00 135.31 ? 72   PRO C CD  1 
ATOM   4593  N N   . HIS C 1 75  ? 10.788  72.536  24.949  1.00 161.37 ? 73   HIS C N   1 
ATOM   4594  C CA  . HIS C 1 75  ? 12.219  72.639  25.200  1.00 162.26 ? 73   HIS C CA  1 
ATOM   4595  C C   . HIS C 1 75  ? 12.638  74.032  25.680  1.00 162.13 ? 73   HIS C C   1 
ATOM   4596  O O   . HIS C 1 75  ? 13.829  74.317  25.814  1.00 162.10 ? 73   HIS C O   1 
ATOM   4597  C CB  . HIS C 1 75  ? 13.005  72.257  23.939  1.00 144.46 ? 73   HIS C CB  1 
ATOM   4598  C CG  . HIS C 1 75  ? 13.066  73.340  22.908  1.00 145.50 ? 73   HIS C CG  1 
ATOM   4599  N ND1 . HIS C 1 75  ? 11.941  73.899  22.342  1.00 145.67 ? 73   HIS C ND1 1 
ATOM   4600  C CD2 . HIS C 1 75  ? 14.123  73.969  22.343  1.00 146.02 ? 73   HIS C CD2 1 
ATOM   4601  C CE1 . HIS C 1 75  ? 12.302  74.827  21.474  1.00 146.02 ? 73   HIS C CE1 1 
ATOM   4602  N NE2 . HIS C 1 75  ? 13.621  74.890  21.456  1.00 146.27 ? 73   HIS C NE2 1 
ATOM   4603  N N   . ILE C 1 76  ? 11.658  74.892  25.947  1.00 150.30 ? 74   ILE C N   1 
ATOM   4604  C CA  . ILE C 1 76  ? 11.939  76.247  26.413  1.00 149.68 ? 74   ILE C CA  1 
ATOM   4605  C C   . ILE C 1 76  ? 11.170  76.572  27.691  1.00 149.15 ? 74   ILE C C   1 
ATOM   4606  O O   . ILE C 1 76  ? 11.585  77.433  28.468  1.00 148.73 ? 74   ILE C O   1 
ATOM   4607  C CB  . ILE C 1 76  ? 11.581  77.302  25.334  1.00 154.99 ? 74   ILE C CB  1 
ATOM   4608  C CG1 . ILE C 1 76  ? 12.341  77.008  24.039  1.00 154.27 ? 74   ILE C CG1 1 
ATOM   4609  C CG2 . ILE C 1 76  ? 11.948  78.701  25.824  1.00 154.54 ? 74   ILE C CG2 1 
ATOM   4610  C CD1 . ILE C 1 76  ? 13.848  77.101  24.176  1.00 154.96 ? 74   ILE C CD1 1 
ATOM   4611  N N   . ILE C 1 77  ? 10.052  75.883  27.908  1.00 110.26 ? 75   ILE C N   1 
ATOM   4612  C CA  . ILE C 1 77  ? 9.251   76.107  29.105  1.00 110.24 ? 75   ILE C CA  1 
ATOM   4613  C C   . ILE C 1 77  ? 10.161  76.165  30.329  1.00 112.34 ? 75   ILE C C   1 
ATOM   4614  O O   . ILE C 1 77  ? 9.905   76.923  31.261  1.00 112.07 ? 75   ILE C O   1 
ATOM   4615  C CB  . ILE C 1 77  ? 8.195   74.991  29.297  1.00 108.68 ? 75   ILE C CB  1 
ATOM   4616  C CG1 . ILE C 1 77  ? 7.195   75.014  28.138  1.00 106.82 ? 75   ILE C CG1 1 
ATOM   4617  C CG2 . ILE C 1 77  ? 7.450   75.194  30.605  1.00 107.76 ? 75   ILE C CG2 1 
ATOM   4618  C CD1 . ILE C 1 77  ? 6.394   76.297  28.047  1.00 103.79 ? 75   ILE C CD1 1 
ATOM   4619  N N   . PRO C 1 78  ? 11.238  75.357  30.343  1.00 198.73 ? 76   PRO C N   1 
ATOM   4620  C CA  . PRO C 1 78  ? 12.180  75.342  31.467  1.00 199.78 ? 76   PRO C CA  1 
ATOM   4621  C C   . PRO C 1 78  ? 12.913  76.670  31.670  1.00 199.78 ? 76   PRO C C   1 
ATOM   4622  O O   . PRO C 1 78  ? 12.744  77.321  32.702  1.00 199.78 ? 76   PRO C O   1 
ATOM   4623  C CB  . PRO C 1 78  ? 13.130  74.212  31.096  1.00 117.29 ? 76   PRO C CB  1 
ATOM   4624  C CG  . PRO C 1 78  ? 12.227  73.257  30.398  1.00 116.55 ? 76   PRO C CG  1 
ATOM   4625  C CD  . PRO C 1 78  ? 11.449  74.174  29.489  1.00 115.51 ? 76   PRO C CD  1 
ATOM   4626  N N   . PHE C 1 79  ? 13.734  77.057  30.693  1.00 134.42 ? 77   PHE C N   1 
ATOM   4627  C CA  . PHE C 1 79  ? 14.484  78.315  30.755  1.00 134.64 ? 77   PHE C CA  1 
ATOM   4628  C C   . PHE C 1 79  ? 13.640  79.395  31.425  1.00 135.02 ? 77   PHE C C   1 
ATOM   4629  O O   . PHE C 1 79  ? 14.085  80.082  32.350  1.00 134.97 ? 77   PHE C O   1 
ATOM   4630  C CB  . PHE C 1 79  ? 14.838  78.799  29.343  1.00 145.59 ? 77   PHE C CB  1 
ATOM   4631  C CG  . PHE C 1 79  ? 15.959  78.042  28.690  1.00 145.43 ? 77   PHE C CG  1 
ATOM   4632  C CD1 . PHE C 1 79  ? 15.973  76.652  28.679  1.00 145.30 ? 77   PHE C CD1 1 
ATOM   4633  C CD2 . PHE C 1 79  ? 16.986  78.727  28.045  1.00 145.16 ? 77   PHE C CD2 1 
ATOM   4634  C CE1 . PHE C 1 79  ? 16.994  75.956  28.034  1.00 145.40 ? 77   PHE C CE1 1 
ATOM   4635  C CE2 . PHE C 1 79  ? 18.010  78.041  27.397  1.00 145.03 ? 77   PHE C CE2 1 
ATOM   4636  C CZ  . PHE C 1 79  ? 18.013  76.653  27.391  1.00 145.02 ? 77   PHE C CZ  1 
ATOM   4637  N N   . ILE C 1 80  ? 12.411  79.523  30.936  1.00 181.53 ? 78   ILE C N   1 
ATOM   4638  C CA  . ILE C 1 80  ? 11.457  80.508  31.424  1.00 180.96 ? 78   ILE C CA  1 
ATOM   4639  C C   . ILE C 1 80  ? 11.059  80.314  32.886  1.00 180.64 ? 78   ILE C C   1 
ATOM   4640  O O   . ILE C 1 80  ? 11.186  81.236  33.690  1.00 180.90 ? 78   ILE C O   1 
ATOM   4641  C CB  . ILE C 1 80  ? 10.183  80.504  30.550  1.00 154.82 ? 78   ILE C CB  1 
ATOM   4642  C CG1 . ILE C 1 80  ? 10.553  80.726  29.082  1.00 154.48 ? 78   ILE C CG1 1 
ATOM   4643  C CG2 . ILE C 1 80  ? 9.249   81.620  30.986  1.00 154.71 ? 78   ILE C CG2 1 
ATOM   4644  C CD1 . ILE C 1 80  ? 11.127  82.105  28.801  1.00 153.76 ? 78   ILE C CD1 1 
ATOM   4645  N N   . LEU C 1 81  ? 10.576  79.123  33.229  1.00 135.96 ? 79   LEU C N   1 
ATOM   4646  C CA  . LEU C 1 81  ? 10.163  78.837  34.599  1.00 135.40 ? 79   LEU C CA  1 
ATOM   4647  C C   . LEU C 1 81  ? 11.231  79.258  35.604  1.00 135.59 ? 79   LEU C C   1 
ATOM   4648  O O   . LEU C 1 81  ? 10.919  79.628  36.736  1.00 135.37 ? 79   LEU C O   1 
ATOM   4649  C CB  . LEU C 1 81  ? 9.848   77.348  34.760  1.00 131.97 ? 79   LEU C CB  1 
ATOM   4650  C CG  . LEU C 1 81  ? 8.588   76.845  34.050  1.00 131.55 ? 79   LEU C CG  1 
ATOM   4651  C CD1 . LEU C 1 81  ? 8.500   75.335  34.167  1.00 131.74 ? 79   LEU C CD1 1 
ATOM   4652  C CD2 . LEU C 1 81  ? 7.360   77.503  34.657  1.00 131.12 ? 79   LEU C CD2 1 
ATOM   4653  N N   . ASP C 1 82  ? 12.490  79.200  35.183  1.00 184.74 ? 80   ASP C N   1 
ATOM   4654  C CA  . ASP C 1 82  ? 13.597  79.593  36.043  1.00 185.09 ? 80   ASP C CA  1 
ATOM   4655  C C   . ASP C 1 82  ? 13.529  81.108  36.203  1.00 186.34 ? 80   ASP C C   1 
ATOM   4656  O O   . ASP C 1 82  ? 13.619  81.635  37.314  1.00 186.30 ? 80   ASP C O   1 
ATOM   4657  C CB  . ASP C 1 82  ? 14.935  79.194  35.409  1.00 119.89 ? 80   ASP C CB  1 
ATOM   4658  C CG  . ASP C 1 82  ? 14.995  77.718  35.051  1.00 118.63 ? 80   ASP C CG  1 
ATOM   4659  O OD1 . ASP C 1 82  ? 16.078  77.232  34.657  1.00 116.93 ? 80   ASP C OD1 1 
ATOM   4660  O OD2 . ASP C 1 82  ? 13.952  77.043  35.160  1.00 118.34 ? 80   ASP C OD2 1 
ATOM   4661  N N   . GLU C 1 83  ? 13.348  81.793  35.077  1.00 161.82 ? 81   GLU C N   1 
ATOM   4662  C CA  . GLU C 1 83  ? 13.260  83.249  35.040  1.00 162.53 ? 81   GLU C CA  1 
ATOM   4663  C C   . GLU C 1 83  ? 12.121  83.821  35.884  1.00 162.77 ? 81   GLU C C   1 
ATOM   4664  O O   . GLU C 1 83  ? 12.304  84.812  36.592  1.00 162.49 ? 81   GLU C O   1 
ATOM   4665  C CB  . GLU C 1 83  ? 13.100  83.723  33.592  1.00 175.89 ? 81   GLU C CB  1 
ATOM   4666  C CG  . GLU C 1 83  ? 12.860  85.221  33.449  1.00 177.93 ? 81   GLU C CG  1 
ATOM   4667  C CD  . GLU C 1 83  ? 12.659  85.651  32.006  1.00 179.13 ? 81   GLU C CD  1 
ATOM   4668  O OE1 . GLU C 1 83  ? 12.420  86.855  31.772  1.00 179.94 ? 81   GLU C OE1 1 
ATOM   4669  O OE2 . GLU C 1 83  ? 12.740  84.789  31.106  1.00 179.58 ? 81   GLU C OE2 1 
ATOM   4670  N N   . ILE C 1 84  ? 10.947  83.202  35.806  1.00 185.81 ? 82   ILE C N   1 
ATOM   4671  C CA  . ILE C 1 84  ? 9.788   83.677  36.555  1.00 186.17 ? 82   ILE C CA  1 
ATOM   4672  C C   . ILE C 1 84  ? 9.547   82.883  37.837  1.00 186.81 ? 82   ILE C C   1 
ATOM   4673  O O   . ILE C 1 84  ? 8.572   83.122  38.549  1.00 186.84 ? 82   ILE C O   1 
ATOM   4674  C CB  . ILE C 1 84  ? 8.508   83.624  35.686  1.00 156.37 ? 82   ILE C CB  1 
ATOM   4675  C CG1 . ILE C 1 84  ? 8.781   84.265  34.324  1.00 156.29 ? 82   ILE C CG1 1 
ATOM   4676  C CG2 . ILE C 1 84  ? 7.365   84.358  36.379  1.00 155.39 ? 82   ILE C CG2 1 
ATOM   4677  C CD1 . ILE C 1 84  ? 9.227   85.711  34.401  1.00 156.55 ? 82   ILE C CD1 1 
ATOM   4678  N N   . GLY C 1 85  ? 10.438  81.941  38.132  1.00 142.08 ? 83   GLY C N   1 
ATOM   4679  C CA  . GLY C 1 85  ? 10.287  81.145  39.337  1.00 142.67 ? 83   GLY C CA  1 
ATOM   4680  C C   . GLY C 1 85  ? 10.133  82.025  40.563  1.00 143.42 ? 83   GLY C C   1 
ATOM   4681  O O   . GLY C 1 85  ? 9.202   81.862  41.350  1.00 142.62 ? 83   GLY C O   1 
ATOM   4682  N N   . ALA C 1 86  ? 11.060  82.962  40.729  1.00 190.14 ? 84   ALA C N   1 
ATOM   4683  C CA  . ALA C 1 86  ? 11.020  83.879  41.859  1.00 191.34 ? 84   ALA C CA  1 
ATOM   4684  C C   . ALA C 1 86  ? 10.104  85.044  41.507  1.00 192.01 ? 84   ALA C C   1 
ATOM   4685  O O   . ALA C 1 86  ? 9.732   85.841  42.368  1.00 192.28 ? 84   ALA C O   1 
ATOM   4686  C CB  . ALA C 1 86  ? 12.423  84.386  42.170  1.00 136.27 ? 84   ALA C CB  1 
ATOM   4687  N N   . ASP C 1 87  ? 9.746   85.127  40.228  1.00 141.62 ? 85   ASP C N   1 
ATOM   4688  C CA  . ASP C 1 87  ? 8.877   86.185  39.720  1.00 141.85 ? 85   ASP C CA  1 
ATOM   4689  C C   . ASP C 1 87  ? 7.423   85.737  39.823  1.00 140.87 ? 85   ASP C C   1 
ATOM   4690  O O   . ASP C 1 87  ? 6.589   86.075  38.982  1.00 139.72 ? 85   ASP C O   1 
ATOM   4691  C CB  . ASP C 1 87  ? 9.215   86.487  38.255  1.00 199.66 ? 85   ASP C CB  1 
ATOM   4692  C CG  . ASP C 1 87  ? 10.701  86.729  38.027  1.00 200.00 ? 85   ASP C CG  1 
ATOM   4693  O OD1 . ASP C 1 87  ? 11.084  86.998  36.869  1.00 200.00 ? 85   ASP C OD1 1 
ATOM   4694  O OD2 . ASP C 1 87  ? 11.485  86.649  38.997  1.00 200.00 ? 85   ASP C OD2 1 
ATOM   4695  N N   . ILE C 1 88  ? 7.128   84.974  40.866  1.00 134.04 ? 86   ILE C N   1 
ATOM   4696  C CA  . ILE C 1 88  ? 5.789   84.455  41.082  1.00 134.56 ? 86   ILE C CA  1 
ATOM   4697  C C   . ILE C 1 88  ? 5.059   85.224  42.179  1.00 135.23 ? 86   ILE C C   1 
ATOM   4698  O O   . ILE C 1 88  ? 5.689   85.899  42.990  1.00 135.85 ? 86   ILE C O   1 
ATOM   4699  C CB  . ILE C 1 88  ? 5.872   82.962  41.437  1.00 150.25 ? 86   ILE C CB  1 
ATOM   4700  C CG1 . ILE C 1 88  ? 6.526   82.221  40.272  1.00 149.71 ? 86   ILE C CG1 1 
ATOM   4701  C CG2 . ILE C 1 88  ? 4.491   82.398  41.722  1.00 151.14 ? 86   ILE C CG2 1 
ATOM   4702  C CD1 . ILE C 1 88  ? 6.819   80.785  40.531  1.00 148.50 ? 86   ILE C CD1 1 
ATOM   4703  N N   . GLU C 1 89  ? 3.730   85.130  42.181  1.00 143.84 ? 87   GLU C N   1 
ATOM   4704  C CA  . GLU C 1 89  ? 2.884   85.801  43.168  1.00 144.28 ? 87   GLU C CA  1 
ATOM   4705  C C   . GLU C 1 89  ? 1.586   85.038  43.412  1.00 144.18 ? 87   GLU C C   1 
ATOM   4706  O O   . GLU C 1 89  ? 1.406   83.926  42.919  1.00 144.01 ? 87   GLU C O   1 
ATOM   4707  C CB  . GLU C 1 89  ? 2.539   87.219  42.718  1.00 169.76 ? 87   GLU C CB  1 
ATOM   4708  C CG  . GLU C 1 89  ? 3.695   88.188  42.740  1.00 171.12 ? 87   GLU C CG  1 
ATOM   4709  C CD  . GLU C 1 89  ? 3.227   89.625  42.674  1.00 172.27 ? 87   GLU C CD  1 
ATOM   4710  O OE1 . GLU C 1 89  ? 4.084   90.529  42.590  1.00 172.86 ? 87   GLU C OE1 1 
ATOM   4711  O OE2 . GLU C 1 89  ? 1.998   89.850  42.713  1.00 172.61 ? 87   GLU C OE2 1 
ATOM   4712  N N   . ASP C 1 90  ? 0.676   85.651  44.164  1.00 144.27 ? 88   ASP C N   1 
ATOM   4713  C CA  . ASP C 1 90  ? -0.607  85.032  44.496  1.00 144.62 ? 88   ASP C CA  1 
ATOM   4714  C C   . ASP C 1 90  ? -1.735  85.467  43.569  1.00 144.35 ? 88   ASP C C   1 
ATOM   4715  O O   . ASP C 1 90  ? -2.703  84.730  43.368  1.00 143.86 ? 88   ASP C O   1 
ATOM   4716  C CB  . ASP C 1 90  ? -1.003  85.382  45.933  1.00 194.70 ? 88   ASP C CB  1 
ATOM   4717  C CG  . ASP C 1 90  ? 0.066   85.018  46.939  1.00 196.02 ? 88   ASP C CG  1 
ATOM   4718  O OD1 . ASP C 1 90  ? -0.095  85.363  48.127  1.00 196.42 ? 88   ASP C OD1 1 
ATOM   4719  O OD2 . ASP C 1 90  ? 1.066   84.386  46.544  1.00 196.42 ? 88   ASP C OD2 1 
ATOM   4720  N N   . ARG C 1 91  ? -1.607  86.668  43.014  1.00 200.00 ? 89   ARG C N   1 
ATOM   4721  C CA  . ARG C 1 91  ? -2.625  87.224  42.130  1.00 200.00 ? 89   ARG C CA  1 
ATOM   4722  C C   . ARG C 1 91  ? -2.759  86.503  40.792  1.00 200.00 ? 89   ARG C C   1 
ATOM   4723  O O   . ARG C 1 91  ? -3.860  86.400  40.248  1.00 200.00 ? 89   ARG C O   1 
ATOM   4724  C CB  . ARG C 1 91  ? -2.351  88.719  41.890  1.00 134.24 ? 89   ARG C CB  1 
ATOM   4725  C CG  . ARG C 1 91  ? -1.128  89.044  41.026  1.00 131.85 ? 89   ARG C CG  1 
ATOM   4726  C CD  . ARG C 1 91  ? -1.475  89.064  39.537  1.00 130.10 ? 89   ARG C CD  1 
ATOM   4727  N NE  . ARG C 1 91  ? -0.314  89.352  38.697  1.00 128.22 ? 89   ARG C NE  1 
ATOM   4728  C CZ  . ARG C 1 91  ? 0.322   90.518  38.664  1.00 127.81 ? 89   ARG C CZ  1 
ATOM   4729  N NH1 . ARG C 1 91  ? -0.090  91.522  39.425  1.00 128.38 ? 89   ARG C NH1 1 
ATOM   4730  N NH2 . ARG C 1 91  ? 1.379   90.675  37.880  1.00 126.57 ? 89   ARG C NH2 1 
ATOM   4731  N N   . HIS C 1 92  ? -1.644  85.999  40.269  1.00 200.00 ? 90   HIS C N   1 
ATOM   4732  C CA  . HIS C 1 92  ? -1.658  85.314  38.980  1.00 200.00 ? 90   HIS C CA  1 
ATOM   4733  C C   . HIS C 1 92  ? -1.589  83.781  39.023  1.00 200.00 ? 90   HIS C C   1 
ATOM   4734  O O   . HIS C 1 92  ? -1.026  83.197  39.952  1.00 200.00 ? 90   HIS C O   1 
ATOM   4735  C CB  . HIS C 1 92  ? -0.543  85.885  38.079  1.00 154.06 ? 90   HIS C CB  1 
ATOM   4736  C CG  . HIS C 1 92  ? 0.788   86.043  38.757  1.00 153.70 ? 90   HIS C CG  1 
ATOM   4737  N ND1 . HIS C 1 92  ? 1.605   84.975  39.060  1.00 153.41 ? 90   HIS C ND1 1 
ATOM   4738  C CD2 . HIS C 1 92  ? 1.461   87.151  39.150  1.00 153.03 ? 90   HIS C CD2 1 
ATOM   4739  C CE1 . HIS C 1 92  ? 2.724   85.418  39.605  1.00 152.97 ? 90   HIS C CE1 1 
ATOM   4740  N NE2 . HIS C 1 92  ? 2.663   86.735  39.670  1.00 152.69 ? 90   HIS C NE2 1 
ATOM   4741  N N   . ILE C 1 93  ? -2.188  83.147  38.011  1.00 156.78 ? 91   ILE C N   1 
ATOM   4742  C CA  . ILE C 1 93  ? -2.227  81.684  37.875  1.00 154.80 ? 91   ILE C CA  1 
ATOM   4743  C C   . ILE C 1 93  ? -1.656  81.269  36.516  1.00 153.84 ? 91   ILE C C   1 
ATOM   4744  O O   . ILE C 1 93  ? -1.964  81.885  35.494  1.00 153.74 ? 91   ILE C O   1 
ATOM   4745  C CB  . ILE C 1 93  ? -3.673  81.144  37.962  1.00 121.93 ? 91   ILE C CB  1 
ATOM   4746  C CG1 . ILE C 1 93  ? -4.303  81.537  39.300  1.00 121.86 ? 91   ILE C CG1 1 
ATOM   4747  C CG2 . ILE C 1 93  ? -3.670  79.632  37.799  1.00 121.37 ? 91   ILE C CG2 1 
ATOM   4748  C CD1 . ILE C 1 93  ? -5.765  81.153  39.427  1.00 120.57 ? 91   ILE C CD1 1 
ATOM   4749  N N   . VAL C 1 94  ? -0.839  80.218  36.503  1.00 200.00 ? 92   VAL C N   1 
ATOM   4750  C CA  . VAL C 1 94  ? -0.226  79.750  35.262  1.00 200.00 ? 92   VAL C CA  1 
ATOM   4751  C C   . VAL C 1 94  ? -1.075  78.748  34.499  1.00 200.00 ? 92   VAL C C   1 
ATOM   4752  O O   . VAL C 1 94  ? -1.264  77.610  34.929  1.00 200.00 ? 92   VAL C O   1 
ATOM   4753  C CB  . VAL C 1 94  ? 1.150   79.097  35.508  1.00 151.16 ? 92   VAL C CB  1 
ATOM   4754  C CG1 . VAL C 1 94  ? 1.793   78.726  34.178  1.00 150.41 ? 92   VAL C CG1 1 
ATOM   4755  C CG2 . VAL C 1 94  ? 2.043   80.043  36.276  1.00 151.72 ? 92   VAL C CG2 1 
ATOM   4756  N N   . VAL C 1 95  ? -1.576  79.185  33.354  1.00 136.77 ? 93   VAL C N   1 
ATOM   4757  C CA  . VAL C 1 95  ? -2.388  78.340  32.503  1.00 132.56 ? 93   VAL C CA  1 
ATOM   4758  C C   . VAL C 1 95  ? -1.539  77.974  31.297  1.00 129.94 ? 93   VAL C C   1 
ATOM   4759  O O   . VAL C 1 95  ? -1.865  78.325  30.166  1.00 129.39 ? 93   VAL C O   1 
ATOM   4760  C CB  . VAL C 1 95  ? -3.649  79.086  32.049  1.00 179.38 ? 93   VAL C CB  1 
ATOM   4761  C CG1 . VAL C 1 95  ? -4.674  79.094  33.167  1.00 178.56 ? 93   VAL C CG1 1 
ATOM   4762  C CG2 . VAL C 1 95  ? -3.290  80.515  31.684  1.00 179.91 ? 93   VAL C CG2 1 
ATOM   4763  N N   . SER C 1 96  ? -0.434  77.278  31.550  1.00 129.63 ? 94   SER C N   1 
ATOM   4764  C CA  . SER C 1 96  ? 0.466   76.871  30.478  1.00 127.67 ? 94   SER C CA  1 
ATOM   4765  C C   . SER C 1 96  ? -0.092  75.726  29.667  1.00 126.95 ? 94   SER C C   1 
ATOM   4766  O O   . SER C 1 96  ? -0.429  74.665  30.197  1.00 126.09 ? 94   SER C O   1 
ATOM   4767  C CB  . SER C 1 96  ? 1.829   76.450  31.024  1.00 111.42 ? 94   SER C CB  1 
ATOM   4768  O OG  . SER C 1 96  ? 2.626   75.892  29.987  1.00 109.52 ? 94   SER C OG  1 
ATOM   4769  N N   . CYS C 1 97  ? -0.178  75.951  28.367  1.00 127.07 ? 95   CYS C N   1 
ATOM   4770  C CA  . CYS C 1 97  ? -0.678  74.938  27.471  1.00 126.67 ? 95   CYS C CA  1 
ATOM   4771  C C   . CYS C 1 97  ? 0.438   74.675  26.468  1.00 126.07 ? 95   CYS C C   1 
ATOM   4772  O O   . CYS C 1 97  ? 0.606   75.403  25.491  1.00 125.89 ? 95   CYS C O   1 
ATOM   4773  C CB  . CYS C 1 97  ? -1.949  75.436  26.778  1.00 155.79 ? 95   CYS C CB  1 
ATOM   4774  S SG  . CYS C 1 97  ? -3.121  76.307  27.881  1.00 157.13 ? 95   CYS C SG  1 
ATOM   4775  N N   . ALA C 1 98  ? 1.226   73.648  26.754  1.00 142.13 ? 96   ALA C N   1 
ATOM   4776  C CA  . ALA C 1 98  ? 2.332   73.252  25.899  1.00 141.95 ? 96   ALA C CA  1 
ATOM   4777  C C   . ALA C 1 98  ? 2.555   71.768  26.149  1.00 142.46 ? 96   ALA C C   1 
ATOM   4778  O O   . ALA C 1 98  ? 3.171   71.381  27.142  1.00 143.41 ? 96   ALA C O   1 
ATOM   4779  C CB  . ALA C 1 98  ? 3.584   74.053  26.242  1.00 40.37  ? 96   ALA C CB  1 
ATOM   4780  N N   . ALA C 1 99  ? 2.030   70.945  25.247  1.00 157.22 ? 97   ALA C N   1 
ATOM   4781  C CA  . ALA C 1 99  ? 2.136   69.493  25.347  1.00 156.12 ? 97   ALA C CA  1 
ATOM   4782  C C   . ALA C 1 99  ? 3.556   69.008  25.617  1.00 154.99 ? 97   ALA C C   1 
ATOM   4783  O O   . ALA C 1 99  ? 4.526   69.743  25.428  1.00 154.75 ? 97   ALA C O   1 
ATOM   4784  C CB  . ALA C 1 99  ? 1.600   68.848  24.076  1.00 143.62 ? 97   ALA C CB  1 
ATOM   4785  N N   . GLY C 1 100 ? 3.666   67.759  26.057  1.00 168.89 ? 98   GLY C N   1 
ATOM   4786  C CA  . GLY C 1 100 ? 4.969   67.196  26.354  1.00 167.15 ? 98   GLY C CA  1 
ATOM   4787  C C   . GLY C 1 100 ? 5.570   67.848  27.583  1.00 165.88 ? 98   GLY C C   1 
ATOM   4788  O O   . GLY C 1 100 ? 6.754   67.676  27.877  1.00 166.79 ? 98   GLY C O   1 
ATOM   4789  N N   . VAL C 1 101 ? 4.745   68.606  28.299  1.00 97.00  ? 99   VAL C N   1 
ATOM   4790  C CA  . VAL C 1 101 ? 5.177   69.299  29.508  1.00 93.85  ? 99   VAL C CA  1 
ATOM   4791  C C   . VAL C 1 101 ? 4.180   69.018  30.629  1.00 92.99  ? 99   VAL C C   1 
ATOM   4792  O O   . VAL C 1 101 ? 3.131   69.659  30.728  1.00 91.11  ? 99   VAL C O   1 
ATOM   4793  C CB  . VAL C 1 101 ? 5.273   70.828  29.276  1.00 104.26 ? 99   VAL C CB  1 
ATOM   4794  C CG1 . VAL C 1 101 ? 5.875   71.502  30.501  1.00 103.82 ? 99   VAL C CG1 1 
ATOM   4795  C CG2 . VAL C 1 101 ? 6.117   71.122  28.037  1.00 101.64 ? 99   VAL C CG2 1 
ATOM   4796  N N   . THR C 1 102 ? 4.526   68.042  31.461  1.00 114.72 ? 100  THR C N   1 
ATOM   4797  C CA  . THR C 1 102 ? 3.704   67.617  32.589  1.00 116.39 ? 100  THR C CA  1 
ATOM   4798  C C   . THR C 1 102 ? 3.406   68.766  33.558  1.00 116.52 ? 100  THR C C   1 
ATOM   4799  O O   . THR C 1 102 ? 3.971   69.853  33.438  1.00 116.24 ? 100  THR C O   1 
ATOM   4800  C CB  . THR C 1 102 ? 4.416   66.483  33.360  1.00 165.00 ? 100  THR C CB  1 
ATOM   4801  O OG1 . THR C 1 102 ? 4.864   65.487  32.431  1.00 166.73 ? 100  THR C OG1 1 
ATOM   4802  C CG2 . THR C 1 102 ? 3.480   65.834  34.369  1.00 165.48 ? 100  THR C CG2 1 
ATOM   4803  N N   . ILE C 1 103 ? 2.510   68.510  34.510  1.00 114.30 ? 101  ILE C N   1 
ATOM   4804  C CA  . ILE C 1 103 ? 2.117   69.490  35.523  1.00 115.44 ? 101  ILE C CA  1 
ATOM   4805  C C   . ILE C 1 103 ? 3.066   69.377  36.711  1.00 117.53 ? 101  ILE C C   1 
ATOM   4806  O O   . ILE C 1 103 ? 3.530   70.382  37.245  1.00 118.58 ? 101  ILE C O   1 
ATOM   4807  C CB  . ILE C 1 103 ? 0.669   69.233  36.023  1.00 95.46  ? 101  ILE C CB  1 
ATOM   4808  C CG1 . ILE C 1 103 ? 0.268   70.264  37.079  1.00 94.26  ? 101  ILE C CG1 1 
ATOM   4809  C CG2 . ILE C 1 103 ? 0.566   67.848  36.630  1.00 95.44  ? 101  ILE C CG2 1 
ATOM   4810  C CD1 . ILE C 1 103 ? -0.026  71.622  36.523  1.00 95.20  ? 101  ILE C CD1 1 
ATOM   4811  N N   . SER C 1 104 ? 3.344   68.142  37.121  1.00 130.36 ? 102  SER C N   1 
ATOM   4812  C CA  . SER C 1 104 ? 4.242   67.890  38.239  1.00 131.91 ? 102  SER C CA  1 
ATOM   4813  C C   . SER C 1 104 ? 5.599   68.468  37.890  1.00 132.87 ? 102  SER C C   1 
ATOM   4814  O O   . SER C 1 104 ? 6.335   68.919  38.762  1.00 133.49 ? 102  SER C O   1 
ATOM   4815  C CB  . SER C 1 104 ? 4.374   66.389  38.492  1.00 136.73 ? 102  SER C CB  1 
ATOM   4816  O OG  . SER C 1 104 ? 3.115   65.816  38.795  1.00 137.26 ? 102  SER C OG  1 
ATOM   4817  N N   . SER C 1 105 ? 5.921   68.445  36.601  1.00 119.30 ? 103  SER C N   1 
ATOM   4818  C CA  . SER C 1 105 ? 7.184   68.981  36.113  1.00 119.95 ? 103  SER C CA  1 
ATOM   4819  C C   . SER C 1 105 ? 7.313   70.437  36.550  1.00 121.02 ? 103  SER C C   1 
ATOM   4820  O O   . SER C 1 105 ? 8.353   70.858  37.059  1.00 120.91 ? 103  SER C O   1 
ATOM   4821  C CB  . SER C 1 105 ? 7.234   68.892  34.586  1.00 129.07 ? 103  SER C CB  1 
ATOM   4822  O OG  . SER C 1 105 ? 8.416   69.482  34.075  1.00 128.24 ? 103  SER C OG  1 
ATOM   4823  N N   . ILE C 1 106 ? 6.241   71.195  36.353  1.00 155.01 ? 104  ILE C N   1 
ATOM   4824  C CA  . ILE C 1 106 ? 6.209   72.605  36.717  1.00 155.90 ? 104  ILE C CA  1 
ATOM   4825  C C   . ILE C 1 106 ? 6.032   72.802  38.219  1.00 156.16 ? 104  ILE C C   1 
ATOM   4826  O O   . ILE C 1 106 ? 6.783   73.548  38.848  1.00 156.74 ? 104  ILE C O   1 
ATOM   4827  C CB  . ILE C 1 106 ? 5.073   73.326  35.971  1.00 137.67 ? 104  ILE C CB  1 
ATOM   4828  C CG1 . ILE C 1 106 ? 5.402   73.375  34.478  1.00 138.27 ? 104  ILE C CG1 1 
ATOM   4829  C CG2 . ILE C 1 106 ? 4.866   74.720  36.544  1.00 137.36 ? 104  ILE C CG2 1 
ATOM   4830  C CD1 . ILE C 1 106 ? 4.293   73.931  33.622  1.00 138.76 ? 104  ILE C CD1 1 
ATOM   4831  N N   . GLU C 1 107 ? 5.039   72.129  38.792  1.00 143.79 ? 105  GLU C N   1 
ATOM   4832  C CA  . GLU C 1 107 ? 4.776   72.238  40.220  1.00 143.84 ? 105  GLU C CA  1 
ATOM   4833  C C   . GLU C 1 107 ? 5.980   71.842  41.063  1.00 146.12 ? 105  GLU C C   1 
ATOM   4834  O O   . GLU C 1 107 ? 6.085   72.228  42.226  1.00 147.55 ? 105  GLU C O   1 
ATOM   4835  C CB  . GLU C 1 107 ? 3.577   71.380  40.601  1.00 104.15 ? 105  GLU C CB  1 
ATOM   4836  C CG  . GLU C 1 107 ? 2.294   71.862  39.982  1.00 101.41 ? 105  GLU C CG  1 
ATOM   4837  C CD  . GLU C 1 107 ? 1.092   71.117  40.502  1.00 100.97 ? 105  GLU C CD  1 
ATOM   4838  O OE1 . GLU C 1 107 ? -0.044  71.525  40.177  1.00 101.63 ? 105  GLU C OE1 1 
ATOM   4839  O OE2 . GLU C 1 107 ? 1.283   70.121  41.234  1.00 99.01  ? 105  GLU C OE2 1 
ATOM   4840  N N   . LYS C 1 108 ? 6.887   71.067  40.475  1.00 135.43 ? 106  LYS C N   1 
ATOM   4841  C CA  . LYS C 1 108 ? 8.089   70.634  41.178  1.00 136.02 ? 106  LYS C CA  1 
ATOM   4842  C C   . LYS C 1 108 ? 9.301   71.333  40.580  1.00 135.60 ? 106  LYS C C   1 
ATOM   4843  O O   . LYS C 1 108 ? 10.291  70.699  40.210  1.00 135.02 ? 106  LYS C O   1 
ATOM   4844  C CB  . LYS C 1 108 ? 8.254   69.114  41.075  1.00 188.65 ? 106  LYS C CB  1 
ATOM   4845  C CG  . LYS C 1 108 ? 7.066   68.327  41.616  1.00 189.99 ? 106  LYS C CG  1 
ATOM   4846  C CD  . LYS C 1 108 ? 7.399   66.854  41.811  1.00 190.61 ? 106  LYS C CD  1 
ATOM   4847  C CE  . LYS C 1 108 ? 8.435   66.664  42.914  1.00 191.29 ? 106  LYS C CE  1 
ATOM   4848  N NZ  . LYS C 1 108 ? 8.698   65.227  43.205  1.00 191.70 ? 106  LYS C NZ  1 
ATOM   4849  N N   . LYS C 1 109 ? 9.206   72.653  40.484  1.00 123.64 ? 107  LYS C N   1 
ATOM   4850  C CA  . LYS C 1 109 ? 10.277  73.467  39.934  1.00 124.71 ? 107  LYS C CA  1 
ATOM   4851  C C   . LYS C 1 109 ? 10.000  74.906  40.331  1.00 125.69 ? 107  LYS C C   1 
ATOM   4852  O O   . LYS C 1 109 ? 10.890  75.622  40.790  1.00 125.83 ? 107  LYS C O   1 
ATOM   4853  C CB  . LYS C 1 109 ? 10.308  73.345  38.411  1.00 170.64 ? 107  LYS C CB  1 
ATOM   4854  C CG  . LYS C 1 109 ? 11.518  73.997  37.764  1.00 171.16 ? 107  LYS C CG  1 
ATOM   4855  C CD  . LYS C 1 109 ? 11.506  73.805  36.257  1.00 171.13 ? 107  LYS C CD  1 
ATOM   4856  C CE  . LYS C 1 109 ? 12.784  74.326  35.607  1.00 172.16 ? 107  LYS C CE  1 
ATOM   4857  N NZ  . LYS C 1 109 ? 13.997  73.549  35.999  1.00 172.26 ? 107  LYS C NZ  1 
ATOM   4858  N N   . LEU C 1 110 ? 8.750   75.319  40.145  1.00 142.04 ? 108  LEU C N   1 
ATOM   4859  C CA  . LEU C 1 110 ? 8.337   76.666  40.498  1.00 142.71 ? 108  LEU C CA  1 
ATOM   4860  C C   . LEU C 1 110 ? 8.037   76.723  41.990  1.00 142.11 ? 108  LEU C C   1 
ATOM   4861  O O   . LEU C 1 110 ? 8.342   77.715  42.646  1.00 142.78 ? 108  LEU C O   1 
ATOM   4862  C CB  . LEU C 1 110 ? 7.105   77.090  39.687  1.00 167.70 ? 108  LEU C CB  1 
ATOM   4863  C CG  . LEU C 1 110 ? 7.326   77.565  38.245  1.00 167.51 ? 108  LEU C CG  1 
ATOM   4864  C CD1 . LEU C 1 110 ? 6.002   78.020  37.651  1.00 167.20 ? 108  LEU C CD1 1 
ATOM   4865  C CD2 . LEU C 1 110 ? 8.324   78.710  38.226  1.00 167.37 ? 108  LEU C CD2 1 
ATOM   4866  N N   . SER C 1 111 ? 7.442   75.662  42.528  1.00 149.05 ? 109  SER C N   1 
ATOM   4867  C CA  . SER C 1 111 ? 7.146   75.628  43.955  1.00 148.35 ? 109  SER C CA  1 
ATOM   4868  C C   . SER C 1 111 ? 8.480   75.660  44.693  1.00 149.17 ? 109  SER C C   1 
ATOM   4869  O O   . SER C 1 111 ? 8.529   75.880  45.906  1.00 149.49 ? 109  SER C O   1 
ATOM   4870  C CB  . SER C 1 111 ? 6.369   74.359  44.328  1.00 81.02  ? 109  SER C CB  1 
ATOM   4871  O OG  . SER C 1 111 ? 5.047   74.387  43.813  1.00 77.33  ? 109  SER C OG  1 
ATOM   4872  N N   . ALA C 1 112 ? 9.559   75.439  43.942  1.00 173.49 ? 110  ALA C N   1 
ATOM   4873  C CA  . ALA C 1 112 ? 10.913  75.453  44.488  1.00 173.21 ? 110  ALA C CA  1 
ATOM   4874  C C   . ALA C 1 112 ? 11.277  76.892  44.843  1.00 173.56 ? 110  ALA C C   1 
ATOM   4875  O O   . ALA C 1 112 ? 12.318  77.158  45.445  1.00 173.11 ? 110  ALA C O   1 
ATOM   4876  C CB  . ALA C 1 112 ? 11.902  74.893  43.465  1.00 78.91  ? 110  ALA C CB  1 
ATOM   4877  N N   . PHE C 1 113 ? 10.403  77.815  44.452  1.00 112.41 ? 111  PHE C N   1 
ATOM   4878  C CA  . PHE C 1 113 ? 10.583  79.235  44.727  1.00 113.11 ? 111  PHE C CA  1 
ATOM   4879  C C   . PHE C 1 113 ? 9.427   79.678  45.627  1.00 114.07 ? 111  PHE C C   1 
ATOM   4880  O O   . PHE C 1 113 ? 9.537   79.681  46.853  1.00 113.95 ? 111  PHE C O   1 
ATOM   4881  C CB  . PHE C 1 113 ? 10.546  80.053  43.427  1.00 140.65 ? 111  PHE C CB  1 
ATOM   4882  C CG  . PHE C 1 113 ? 11.640  79.712  42.445  1.00 141.21 ? 111  PHE C CG  1 
ATOM   4883  C CD1 . PHE C 1 113 ? 11.787  78.416  41.957  1.00 141.79 ? 111  PHE C CD1 1 
ATOM   4884  C CD2 . PHE C 1 113 ? 12.496  80.704  41.971  1.00 140.87 ? 111  PHE C CD2 1 
ATOM   4885  C CE1 . PHE C 1 113 ? 12.768  78.114  41.008  1.00 141.99 ? 111  PHE C CE1 1 
ATOM   4886  C CE2 . PHE C 1 113 ? 13.479  80.414  41.022  1.00 140.79 ? 111  PHE C CE2 1 
ATOM   4887  C CZ  . PHE C 1 113 ? 13.614  79.117  40.539  1.00 141.30 ? 111  PHE C CZ  1 
ATOM   4888  N N   . ARG C 1 114 ? 8.315   80.034  44.991  1.00 153.72 ? 112  ARG C N   1 
ATOM   4889  C CA  . ARG C 1 114 ? 7.108   80.493  45.674  1.00 155.40 ? 112  ARG C CA  1 
ATOM   4890  C C   . ARG C 1 114 ? 6.519   79.386  46.554  1.00 155.14 ? 112  ARG C C   1 
ATOM   4891  O O   . ARG C 1 114 ? 6.814   78.206  46.363  1.00 155.10 ? 112  ARG C O   1 
ATOM   4892  C CB  . ARG C 1 114 ? 6.079   80.931  44.623  1.00 172.62 ? 112  ARG C CB  1 
ATOM   4893  C CG  . ARG C 1 114 ? 5.115   82.027  45.056  1.00 175.06 ? 112  ARG C CG  1 
ATOM   4894  C CD  . ARG C 1 114 ? 5.861   83.298  45.428  1.00 176.14 ? 112  ARG C CD  1 
ATOM   4895  N NE  . ARG C 1 114 ? 4.968   84.440  45.618  1.00 178.30 ? 112  ARG C NE  1 
ATOM   4896  C CZ  . ARG C 1 114 ? 3.996   84.502  46.524  1.00 178.98 ? 112  ARG C CZ  1 
ATOM   4897  N NH1 . ARG C 1 114 ? 3.772   83.482  47.342  1.00 178.82 ? 112  ARG C NH1 1 
ATOM   4898  N NH2 . ARG C 1 114 ? 3.250   85.596  46.617  1.00 179.57 ? 112  ARG C NH2 1 
ATOM   4899  N N   . PRO C 1 115 ? 5.683   79.758  47.538  1.00 162.05 ? 113  PRO C N   1 
ATOM   4900  C CA  . PRO C 1 115 ? 5.053   78.794  48.443  1.00 161.60 ? 113  PRO C CA  1 
ATOM   4901  C C   . PRO C 1 115 ? 4.327   77.687  47.697  1.00 161.20 ? 113  PRO C C   1 
ATOM   4902  O O   . PRO C 1 115 ? 4.844   76.581  47.535  1.00 161.22 ? 113  PRO C O   1 
ATOM   4903  C CB  . PRO C 1 115 ? 4.084   79.660  49.237  1.00 143.22 ? 113  PRO C CB  1 
ATOM   4904  C CG  . PRO C 1 115 ? 4.820   80.936  49.351  1.00 143.63 ? 113  PRO C CG  1 
ATOM   4905  C CD  . PRO C 1 115 ? 5.374   81.135  47.960  1.00 143.69 ? 113  PRO C CD  1 
ATOM   4906  N N   . ALA C 1 116 ? 3.119   78.004  47.246  1.00 147.04 ? 114  ALA C N   1 
ATOM   4907  C CA  . ALA C 1 116 ? 2.298   77.050  46.522  1.00 145.76 ? 114  ALA C CA  1 
ATOM   4908  C C   . ALA C 1 116 ? 1.686   77.693  45.279  1.00 144.98 ? 114  ALA C C   1 
ATOM   4909  O O   . ALA C 1 116 ? 0.550   78.164  45.304  1.00 145.23 ? 114  ALA C O   1 
ATOM   4910  C CB  . ALA C 1 116 ? 1.201   76.519  47.438  1.00 135.59 ? 114  ALA C CB  1 
ATOM   4911  N N   . PRO C 1 117 ? 2.442   77.719  44.171  1.00 155.62 ? 115  PRO C N   1 
ATOM   4912  C CA  . PRO C 1 117 ? 2.004   78.295  42.896  1.00 155.22 ? 115  PRO C CA  1 
ATOM   4913  C C   . PRO C 1 117 ? 0.820   77.544  42.299  1.00 155.57 ? 115  PRO C C   1 
ATOM   4914  O O   . PRO C 1 117 ? 0.820   76.320  42.252  1.00 155.78 ? 115  PRO C O   1 
ATOM   4915  C CB  . PRO C 1 117 ? 3.241   78.164  42.024  1.00 81.16  ? 115  PRO C CB  1 
ATOM   4916  C CG  . PRO C 1 117 ? 3.852   76.899  42.541  1.00 81.15  ? 115  PRO C CG  1 
ATOM   4917  C CD  . PRO C 1 117 ? 3.779   77.120  44.026  1.00 81.87  ? 115  PRO C CD  1 
ATOM   4918  N N   . ARG C 1 118 ? -0.170  78.291  41.825  1.00 200.00 ? 116  ARG C N   1 
ATOM   4919  C CA  . ARG C 1 118 ? -1.381  77.731  41.225  1.00 200.00 ? 116  ARG C CA  1 
ATOM   4920  C C   . ARG C 1 118 ? -1.134  77.365  39.752  1.00 200.00 ? 116  ARG C C   1 
ATOM   4921  O O   . ARG C 1 118 ? -0.967  78.254  38.918  1.00 200.00 ? 116  ARG C O   1 
ATOM   4922  C CB  . ARG C 1 118 ? -2.493  78.776  41.333  1.00 148.66 ? 116  ARG C CB  1 
ATOM   4923  C CG  . ARG C 1 118 ? -2.442  79.542  42.653  1.00 147.52 ? 116  ARG C CG  1 
ATOM   4924  C CD  . ARG C 1 118 ? -3.121  80.905  42.580  1.00 147.26 ? 116  ARG C CD  1 
ATOM   4925  N NE  . ARG C 1 118 ? -4.578  80.815  42.555  1.00 146.72 ? 116  ARG C NE  1 
ATOM   4926  C CZ  . ARG C 1 118 ? -5.391  81.867  42.570  1.00 146.18 ? 116  ARG C CZ  1 
ATOM   4927  N NH1 . ARG C 1 118 ? -4.893  83.097  42.609  1.00 145.84 ? 116  ARG C NH1 1 
ATOM   4928  N NH2 . ARG C 1 118 ? -6.704  81.690  42.549  1.00 146.34 ? 116  ARG C NH2 1 
ATOM   4929  N N   . VAL C 1 119 ? -1.124  76.069  39.428  1.00 168.27 ? 117  VAL C N   1 
ATOM   4930  C CA  . VAL C 1 119 ? -0.868  75.635  38.047  1.00 165.95 ? 117  VAL C CA  1 
ATOM   4931  C C   . VAL C 1 119 ? -1.857  74.623  37.455  1.00 164.67 ? 117  VAL C C   1 
ATOM   4932  O O   . VAL C 1 119 ? -2.222  73.636  38.101  1.00 164.18 ? 117  VAL C O   1 
ATOM   4933  C CB  . VAL C 1 119 ? 0.548   75.015  37.907  1.00 158.56 ? 117  VAL C CB  1 
ATOM   4934  C CG1 . VAL C 1 119 ? 0.878   74.799  36.439  1.00 157.40 ? 117  VAL C CG1 1 
ATOM   4935  C CG2 . VAL C 1 119 ? 1.585   75.911  38.556  1.00 159.21 ? 117  VAL C CG2 1 
ATOM   4936  N N   . ILE C 1 120 ? -2.266  74.872  36.210  1.00 191.85 ? 118  ILE C N   1 
ATOM   4937  C CA  . ILE C 1 120 ? -3.185  73.987  35.496  1.00 189.84 ? 118  ILE C CA  1 
ATOM   4938  C C   . ILE C 1 120 ? -2.762  73.803  34.035  1.00 188.20 ? 118  ILE C C   1 
ATOM   4939  O O   . ILE C 1 120 ? -2.841  74.734  33.230  1.00 187.92 ? 118  ILE C O   1 
ATOM   4940  C CB  . ILE C 1 120 ? -4.644  74.521  35.521  1.00 143.11 ? 118  ILE C CB  1 
ATOM   4941  C CG1 . ILE C 1 120 ? -4.730  75.880  34.826  1.00 141.75 ? 118  ILE C CG1 1 
ATOM   4942  C CG2 . ILE C 1 120 ? -5.131  74.637  36.955  1.00 142.69 ? 118  ILE C CG2 1 
ATOM   4943  C CD1 . ILE C 1 120 ? -6.150  76.353  34.614  1.00 140.76 ? 118  ILE C CD1 1 
ATOM   4944  N N   . ARG C 1 121 ? -2.305  72.599  33.698  1.00 148.33 ? 119  ARG C N   1 
ATOM   4945  C CA  . ARG C 1 121 ? -1.884  72.300  32.333  1.00 145.32 ? 119  ARG C CA  1 
ATOM   4946  C C   . ARG C 1 121 ? -3.113  72.499  31.456  1.00 145.13 ? 119  ARG C C   1 
ATOM   4947  O O   . ARG C 1 121 ? -4.225  72.651  31.970  1.00 145.69 ? 119  ARG C O   1 
ATOM   4948  C CB  . ARG C 1 121 ? -1.381  70.851  32.235  1.00 115.46 ? 119  ARG C CB  1 
ATOM   4949  C CG  . ARG C 1 121 ? -0.730  70.463  30.900  1.00 112.72 ? 119  ARG C CG  1 
ATOM   4950  C CD  . ARG C 1 121 ? -0.297  68.996  30.926  1.00 110.56 ? 119  ARG C CD  1 
ATOM   4951  N NE  . ARG C 1 121 ? 0.301   68.535  29.675  1.00 108.56 ? 119  ARG C NE  1 
ATOM   4952  C CZ  . ARG C 1 121 ? 0.732   67.292  29.472  1.00 107.60 ? 119  ARG C CZ  1 
ATOM   4953  N NH1 . ARG C 1 121 ? 0.630   66.391  30.438  1.00 106.26 ? 119  ARG C NH1 1 
ATOM   4954  N NH2 . ARG C 1 121 ? 1.261   66.945  28.305  1.00 107.18 ? 119  ARG C NH2 1 
ATOM   4955  N N   . CYS C 1 122 ? -2.926  72.504  30.142  1.00 115.24 ? 120  CYS C N   1 
ATOM   4956  C CA  . CYS C 1 122 ? -4.055  72.703  29.245  1.00 114.24 ? 120  CYS C CA  1 
ATOM   4957  C C   . CYS C 1 122 ? -3.715  72.431  27.780  1.00 111.86 ? 120  CYS C C   1 
ATOM   4958  O O   . CYS C 1 122 ? -2.576  72.616  27.350  1.00 112.07 ? 120  CYS C O   1 
ATOM   4959  C CB  . CYS C 1 122 ? -4.590  74.125  29.438  1.00 128.14 ? 120  CYS C CB  1 
ATOM   4960  S SG  . CYS C 1 122 ? -4.794  75.150  27.951  1.00 132.00 ? 120  CYS C SG  1 
ATOM   4961  N N   . MET C 1 123 ? -4.713  71.974  27.025  1.00 98.98  ? 121  MET C N   1 
ATOM   4962  C CA  . MET C 1 123 ? -4.539  71.660  25.609  1.00 93.24  ? 121  MET C CA  1 
ATOM   4963  C C   . MET C 1 123 ? -5.631  72.324  24.779  1.00 88.86  ? 121  MET C C   1 
ATOM   4964  O O   . MET C 1 123 ? -6.811  72.307  25.144  1.00 87.01  ? 121  MET C O   1 
ATOM   4965  C CB  . MET C 1 123 ? -4.588  70.141  25.395  1.00 126.66 ? 121  MET C CB  1 
ATOM   4966  C CG  . MET C 1 123 ? -3.386  69.534  24.683  1.00 126.11 ? 121  MET C CG  1 
ATOM   4967  S SD  . MET C 1 123 ? -3.350  69.829  22.902  1.00 125.31 ? 121  MET C SD  1 
ATOM   4968  C CE  . MET C 1 123 ? -2.139  71.150  22.785  1.00 125.93 ? 121  MET C CE  1 
ATOM   4969  N N   . THR C 1 124 ? -5.222  72.925  23.668  1.00 109.70 ? 122  THR C N   1 
ATOM   4970  C CA  . THR C 1 124 ? -6.148  73.585  22.756  1.00 106.56 ? 122  THR C CA  1 
ATOM   4971  C C   . THR C 1 124 ? -5.539  73.511  21.364  1.00 103.37 ? 122  THR C C   1 
ATOM   4972  O O   . THR C 1 124 ? -4.369  73.149  21.205  1.00 103.09 ? 122  THR C O   1 
ATOM   4973  C CB  . THR C 1 124 ? -6.359  75.058  23.114  1.00 84.04  ? 122  THR C CB  1 
ATOM   4974  O OG1 . THR C 1 124 ? -5.202  75.809  22.728  1.00 84.78  ? 122  THR C OG1 1 
ATOM   4975  C CG2 . THR C 1 124 ? -6.592  75.211  24.601  1.00 85.64  ? 122  THR C CG2 1 
ATOM   4976  N N   . ASN C 1 125 ? -6.331  73.856  20.356  1.00 71.45  ? 123  ASN C N   1 
ATOM   4977  C CA  . ASN C 1 125 ? -5.866  73.811  18.979  1.00 66.41  ? 123  ASN C CA  1 
ATOM   4978  C C   . ASN C 1 125 ? -5.804  75.188  18.336  1.00 63.75  ? 123  ASN C C   1 
ATOM   4979  O O   . ASN C 1 125 ? -6.216  76.184  18.926  1.00 61.09  ? 123  ASN C O   1 
ATOM   4980  C CB  . ASN C 1 125 ? -6.775  72.897  18.161  1.00 86.33  ? 123  ASN C CB  1 
ATOM   4981  C CG  . ASN C 1 125 ? -8.207  72.926  18.645  1.00 86.49  ? 123  ASN C CG  1 
ATOM   4982  O OD1 . ASN C 1 125 ? -8.743  73.982  18.970  1.00 88.21  ? 123  ASN C OD1 1 
ATOM   4983  N ND2 . ASN C 1 125 ? -8.839  71.763  18.686  1.00 87.65  ? 123  ASN C ND2 1 
ATOM   4984  N N   . THR C 1 126 ? -5.284  75.224  17.117  1.00 71.47  ? 124  THR C N   1 
ATOM   4985  C CA  . THR C 1 126 ? -5.146  76.462  16.368  1.00 72.59  ? 124  THR C CA  1 
ATOM   4986  C C   . THR C 1 126 ? -6.485  77.113  16.021  1.00 71.94  ? 124  THR C C   1 
ATOM   4987  O O   . THR C 1 126 ? -6.672  78.308  16.254  1.00 71.87  ? 124  THR C O   1 
ATOM   4988  C CB  . THR C 1 126 ? -4.387  76.220  15.067  1.00 96.36  ? 124  THR C CB  1 
ATOM   4989  O OG1 . THR C 1 126 ? -3.501  75.109  15.237  1.00 99.81  ? 124  THR C OG1 1 
ATOM   4990  C CG2 . THR C 1 126 ? -3.576  77.448  14.697  1.00 98.72  ? 124  THR C CG2 1 
ATOM   4991  N N   . PRO C 1 127 ? -7.436  76.334  15.462  1.00 76.28  ? 125  PRO C N   1 
ATOM   4992  C CA  . PRO C 1 127 ? -8.753  76.861  15.085  1.00 74.62  ? 125  PRO C CA  1 
ATOM   4993  C C   . PRO C 1 127 ? -9.387  77.775  16.124  1.00 73.84  ? 125  PRO C C   1 
ATOM   4994  O O   . PRO C 1 127 ? -10.406 78.413  15.864  1.00 75.07  ? 125  PRO C O   1 
ATOM   4995  C CB  . PRO C 1 127 ? -9.574  75.597  14.813  1.00 51.57  ? 125  PRO C CB  1 
ATOM   4996  C CG  . PRO C 1 127 ? -8.872  74.542  15.596  1.00 52.66  ? 125  PRO C CG  1 
ATOM   4997  C CD  . PRO C 1 127 ? -7.429  74.868  15.346  1.00 54.02  ? 125  PRO C CD  1 
ATOM   4998  N N   . VAL C 1 128 ? -8.777  77.835  17.301  1.00 91.19  ? 126  VAL C N   1 
ATOM   4999  C CA  . VAL C 1 128 ? -9.262  78.708  18.354  1.00 89.10  ? 126  VAL C CA  1 
ATOM   5000  C C   . VAL C 1 128 ? -9.181  80.118  17.813  1.00 88.91  ? 126  VAL C C   1 
ATOM   5001  O O   . VAL C 1 128 ? -9.650  81.060  18.442  1.00 91.19  ? 126  VAL C O   1 
ATOM   5002  C CB  . VAL C 1 128 ? -8.385  78.635  19.594  1.00 75.32  ? 126  VAL C CB  1 
ATOM   5003  C CG1 . VAL C 1 128 ? -8.512  77.291  20.207  1.00 74.77  ? 126  VAL C CG1 1 
ATOM   5004  C CG2 . VAL C 1 128 ? -6.928  78.930  19.230  1.00 73.75  ? 126  VAL C CG2 1 
ATOM   5005  N N   . VAL C 1 129 ? -8.557  80.261  16.649  1.00 59.80  ? 127  VAL C N   1 
ATOM   5006  C CA  . VAL C 1 129 ? -8.447  81.563  16.017  1.00 58.34  ? 127  VAL C CA  1 
ATOM   5007  C C   . VAL C 1 129 ? -9.866  81.934  15.617  1.00 58.28  ? 127  VAL C C   1 
ATOM   5008  O O   . VAL C 1 129 ? -10.121 83.003  15.066  1.00 57.04  ? 127  VAL C O   1 
ATOM   5009  C CB  . VAL C 1 129 ? -7.591  81.503  14.757  1.00 61.26  ? 127  VAL C CB  1 
ATOM   5010  C CG1 . VAL C 1 129 ? -7.444  82.891  14.178  1.00 61.85  ? 127  VAL C CG1 1 
ATOM   5011  C CG2 . VAL C 1 129 ? -6.237  80.911  15.075  1.00 61.89  ? 127  VAL C CG2 1 
ATOM   5012  N N   . VAL C 1 130 ? -10.781 81.015  15.900  1.00 62.99  ? 128  VAL C N   1 
ATOM   5013  C CA  . VAL C 1 130 ? -12.194 81.179  15.610  1.00 64.13  ? 128  VAL C CA  1 
ATOM   5014  C C   . VAL C 1 130 ? -12.955 80.625  16.815  1.00 68.52  ? 128  VAL C C   1 
ATOM   5015  O O   . VAL C 1 130 ? -12.384 79.887  17.620  1.00 69.42  ? 128  VAL C O   1 
ATOM   5016  C CB  . VAL C 1 130 ? -12.589 80.382  14.353  1.00 40.52  ? 128  VAL C CB  1 
ATOM   5017  C CG1 . VAL C 1 130 ? -14.018 80.703  13.979  1.00 41.41  ? 128  VAL C CG1 1 
ATOM   5018  C CG2 . VAL C 1 130 ? -11.644 80.705  13.202  1.00 35.80  ? 128  VAL C CG2 1 
ATOM   5019  N N   . ARG C 1 131 ? -14.232 80.974  16.948  1.00 88.21  ? 129  ARG C N   1 
ATOM   5020  C CA  . ARG C 1 131 ? -15.035 80.485  18.067  1.00 92.74  ? 129  ARG C CA  1 
ATOM   5021  C C   . ARG C 1 131 ? -15.055 78.966  17.996  1.00 92.25  ? 129  ARG C C   1 
ATOM   5022  O O   . ARG C 1 131 ? -15.812 78.305  18.707  1.00 93.86  ? 129  ARG C O   1 
ATOM   5023  C CB  . ARG C 1 131 ? -16.472 81.002  17.971  1.00 168.96 ? 129  ARG C CB  1 
ATOM   5024  C CG  . ARG C 1 131 ? -17.306 80.300  16.904  1.00 177.51 ? 129  ARG C CG  1 
ATOM   5025  C CD  . ARG C 1 131 ? -18.741 80.799  16.889  1.00 184.04 ? 129  ARG C CD  1 
ATOM   5026  N NE  . ARG C 1 131 ? -19.582 80.021  15.982  1.00 192.29 ? 129  ARG C NE  1 
ATOM   5027  C CZ  . ARG C 1 131 ? -20.884 80.223  15.811  1.00 197.06 ? 129  ARG C CZ  1 
ATOM   5028  N NH1 . ARG C 1 131 ? -21.501 81.184  16.484  1.00 199.42 ? 129  ARG C NH1 1 
ATOM   5029  N NH2 . ARG C 1 131 ? -21.573 79.460  14.974  1.00 199.06 ? 129  ARG C NH2 1 
ATOM   5030  N N   . GLU C 1 132 ? -14.223 78.424  17.114  1.00 68.51  ? 130  GLU C N   1 
ATOM   5031  C CA  . GLU C 1 132 ? -14.136 76.991  16.920  1.00 67.05  ? 130  GLU C CA  1 
ATOM   5032  C C   . GLU C 1 132 ? -12.789 76.439  17.348  1.00 67.09  ? 130  GLU C C   1 
ATOM   5033  O O   . GLU C 1 132 ? -11.802 76.523  16.620  1.00 67.31  ? 130  GLU C O   1 
ATOM   5034  C CB  . GLU C 1 132 ? -14.384 76.659  15.455  1.00 92.80  ? 130  GLU C CB  1 
ATOM   5035  C CG  . GLU C 1 132 ? -15.659 77.267  14.899  1.00 90.92  ? 130  GLU C CG  1 
ATOM   5036  C CD  . GLU C 1 132 ? -16.899 76.906  15.709  1.00 90.92  ? 130  GLU C CD  1 
ATOM   5037  O OE1 . GLU C 1 132 ? -18.013 77.266  15.268  1.00 90.71  ? 130  GLU C OE1 1 
ATOM   5038  O OE2 . GLU C 1 132 ? -16.767 76.269  16.781  1.00 87.85  ? 130  GLU C OE2 1 
ATOM   5039  N N   . GLY C 1 133 ? -12.763 75.869  18.542  1.00 66.09  ? 131  GLY C N   1 
ATOM   5040  C CA  . GLY C 1 133 ? -11.544 75.294  19.059  1.00 67.09  ? 131  GLY C CA  1 
ATOM   5041  C C   . GLY C 1 133 ? -11.874 74.325  20.173  1.00 69.49  ? 131  GLY C C   1 
ATOM   5042  O O   . GLY C 1 133 ? -12.717 74.613  21.028  1.00 70.19  ? 131  GLY C O   1 
ATOM   5043  N N   . ALA C 1 134 ? -11.236 73.162  20.152  1.00 75.56  ? 132  ALA C N   1 
ATOM   5044  C CA  . ALA C 1 134 ? -11.450 72.168  21.193  1.00 78.40  ? 132  ALA C CA  1 
ATOM   5045  C C   . ALA C 1 134 ? -10.436 72.496  22.274  1.00 80.86  ? 132  ALA C C   1 
ATOM   5046  O O   . ALA C 1 134 ? -9.233  72.509  22.019  1.00 83.56  ? 132  ALA C O   1 
ATOM   5047  C CB  . ALA C 1 134 ? -11.210 70.770  20.652  1.00 89.88  ? 132  ALA C CB  1 
ATOM   5048  N N   . THR C 1 135 ? -10.923 72.780  23.475  1.00 87.49  ? 133  THR C N   1 
ATOM   5049  C CA  . THR C 1 135 ? -10.043 73.128  24.585  1.00 88.44  ? 133  THR C CA  1 
ATOM   5050  C C   . THR C 1 135 ? -10.317 72.269  25.815  1.00 88.65  ? 133  THR C C   1 
ATOM   5051  O O   . THR C 1 135 ? -11.458 72.137  26.267  1.00 86.78  ? 133  THR C O   1 
ATOM   5052  C CB  . THR C 1 135 ? -10.214 74.602  24.967  1.00 102.06 ? 133  THR C CB  1 
ATOM   5053  O OG1 . THR C 1 135 ? -11.597 74.864  25.239  1.00 103.61 ? 133  THR C OG1 1 
ATOM   5054  C CG2 . THR C 1 135 ? -9.750  75.501  23.838  1.00 99.98  ? 133  THR C CG2 1 
ATOM   5055  N N   . VAL C 1 136 ? -9.260  71.694  26.365  1.00 69.28  ? 134  VAL C N   1 
ATOM   5056  C CA  . VAL C 1 136 ? -9.400  70.835  27.527  1.00 73.11  ? 134  VAL C CA  1 
ATOM   5057  C C   . VAL C 1 136 ? -8.363  71.294  28.567  1.00 76.10  ? 134  VAL C C   1 
ATOM   5058  O O   . VAL C 1 136 ? -7.256  71.700  28.206  1.00 75.59  ? 134  VAL C O   1 
ATOM   5059  C CB  . VAL C 1 136 ? -9.204  69.355  27.079  1.00 114.17 ? 134  VAL C CB  1 
ATOM   5060  C CG1 . VAL C 1 136 ? -9.490  68.402  28.190  1.00 116.07 ? 134  VAL C CG1 1 
ATOM   5061  C CG2 . VAL C 1 136 ? -10.120 69.050  25.913  1.00 115.04 ? 134  VAL C CG2 1 
ATOM   5062  N N   . TYR C 1 137 ? -8.730  71.263  29.849  1.00 121.56 ? 135  TYR C N   1 
ATOM   5063  C CA  . TYR C 1 137 ? -7.830  71.703  30.920  1.00 124.28 ? 135  TYR C CA  1 
ATOM   5064  C C   . TYR C 1 137 ? -7.823  70.759  32.127  1.00 126.80 ? 135  TYR C C   1 
ATOM   5065  O O   . TYR C 1 137 ? -8.719  69.936  32.300  1.00 126.73 ? 135  TYR C O   1 
ATOM   5066  C CB  . TYR C 1 137 ? -8.235  73.106  31.387  1.00 108.06 ? 135  TYR C CB  1 
ATOM   5067  C CG  . TYR C 1 137 ? -9.554  73.134  32.139  1.00 108.60 ? 135  TYR C CG  1 
ATOM   5068  C CD1 . TYR C 1 137 ? -9.626  72.752  33.483  1.00 108.39 ? 135  TYR C CD1 1 
ATOM   5069  C CD2 . TYR C 1 137 ? -10.736 73.508  31.500  1.00 108.03 ? 135  TYR C CD2 1 
ATOM   5070  C CE1 . TYR C 1 137 ? -10.839 72.742  34.168  1.00 107.73 ? 135  TYR C CE1 1 
ATOM   5071  C CE2 . TYR C 1 137 ? -11.957 73.500  32.176  1.00 107.68 ? 135  TYR C CE2 1 
ATOM   5072  C CZ  . TYR C 1 137 ? -12.001 73.117  33.509  1.00 107.81 ? 135  TYR C CZ  1 
ATOM   5073  O OH  . TYR C 1 137 ? -13.206 73.100  34.181  1.00 108.55 ? 135  TYR C OH  1 
ATOM   5074  N N   . ALA C 1 138 ? -6.813  70.897  32.976  1.00 132.10 ? 136  ALA C N   1 
ATOM   5075  C CA  . ALA C 1 138 ? -6.712  70.062  34.164  1.00 135.45 ? 136  ALA C CA  1 
ATOM   5076  C C   . ALA C 1 138 ? -6.190  70.900  35.322  1.00 138.41 ? 136  ALA C C   1 
ATOM   5077  O O   . ALA C 1 138 ? -5.206  71.623  35.178  1.00 138.67 ? 136  ALA C O   1 
ATOM   5078  C CB  . ALA C 1 138 ? -5.783  68.884  33.900  1.00 73.69  ? 136  ALA C CB  1 
ATOM   5079  N N   . THR C 1 139 ? -6.854  70.801  36.468  1.00 140.06 ? 137  THR C N   1 
ATOM   5080  C CA  . THR C 1 139 ? -6.456  71.556  37.649  1.00 142.17 ? 137  THR C CA  1 
ATOM   5081  C C   . THR C 1 139 ? -5.491  70.758  38.513  1.00 144.43 ? 137  THR C C   1 
ATOM   5082  O O   . THR C 1 139 ? -5.844  69.706  39.040  1.00 144.70 ? 137  THR C O   1 
ATOM   5083  C CB  . THR C 1 139 ? -7.675  71.925  38.493  1.00 99.11  ? 137  THR C CB  1 
ATOM   5084  O OG1 . THR C 1 139 ? -8.245  70.737  39.060  1.00 97.49  ? 137  THR C OG1 1 
ATOM   5085  C CG2 . THR C 1 139 ? -8.715  72.613  37.623  1.00 100.02 ? 137  THR C CG2 1 
ATOM   5086  N N   . GLY C 1 140 ? -4.273  71.268  38.659  1.00 144.05 ? 138  GLY C N   1 
ATOM   5087  C CA  . GLY C 1 140 ? -3.281  70.574  39.456  1.00 147.40 ? 138  GLY C CA  1 
ATOM   5088  C C   . GLY C 1 140 ? -3.055  71.161  40.837  1.00 149.70 ? 138  GLY C C   1 
ATOM   5089  O O   . GLY C 1 140 ? -2.870  72.368  40.988  1.00 149.64 ? 138  GLY C O   1 
ATOM   5090  N N   . THR C 1 141 ? -3.077  70.288  41.842  1.00 178.27 ? 139  THR C N   1 
ATOM   5091  C CA  . THR C 1 141 ? -2.856  70.647  43.243  1.00 178.87 ? 139  THR C CA  1 
ATOM   5092  C C   . THR C 1 141 ? -3.321  72.040  43.683  1.00 180.17 ? 139  THR C C   1 
ATOM   5093  O O   . THR C 1 141 ? -4.457  72.214  44.131  1.00 179.94 ? 139  THR C O   1 
ATOM   5094  C CB  . THR C 1 141 ? -1.356  70.495  43.611  1.00 102.84 ? 139  THR C CB  1 
ATOM   5095  O OG1 . THR C 1 141 ? -0.566  71.378  42.804  1.00 103.06 ? 139  THR C OG1 1 
ATOM   5096  C CG2 . THR C 1 141 ? -0.891  69.066  43.368  1.00 101.98 ? 139  THR C CG2 1 
ATOM   5097  N N   . HIS C 1 142 ? -2.427  73.019  43.562  1.00 160.12 ? 140  HIS C N   1 
ATOM   5098  C CA  . HIS C 1 142 ? -2.697  74.400  43.958  1.00 161.78 ? 140  HIS C CA  1 
ATOM   5099  C C   . HIS C 1 142 ? -3.773  75.049  43.086  1.00 163.47 ? 140  HIS C C   1 
ATOM   5100  O O   . HIS C 1 142 ? -3.484  75.932  42.279  1.00 163.66 ? 140  HIS C O   1 
ATOM   5101  C CB  . HIS C 1 142 ? -1.399  75.218  43.883  1.00 132.79 ? 140  HIS C CB  1 
ATOM   5102  C CG  . HIS C 1 142 ? -0.209  74.526  44.482  1.00 132.32 ? 140  HIS C CG  1 
ATOM   5103  N ND1 . HIS C 1 142 ? -0.170  74.111  45.796  1.00 131.96 ? 140  HIS C ND1 1 
ATOM   5104  C CD2 . HIS C 1 142 ? 0.982   74.169  43.942  1.00 131.98 ? 140  HIS C CD2 1 
ATOM   5105  C CE1 . HIS C 1 142 ? 0.991   73.528  46.039  1.00 131.44 ? 140  HIS C CE1 1 
ATOM   5106  N NE2 . HIS C 1 142 ? 1.709   73.550  44.930  1.00 131.38 ? 140  HIS C NE2 1 
ATOM   5107  N N   . ALA C 1 143 ? -5.017  74.614  43.258  1.00 177.11 ? 141  ALA C N   1 
ATOM   5108  C CA  . ALA C 1 143 ? -6.127  75.150  42.479  1.00 178.58 ? 141  ALA C CA  1 
ATOM   5109  C C   . ALA C 1 143 ? -7.459  74.954  43.200  1.00 179.47 ? 141  ALA C C   1 
ATOM   5110  O O   . ALA C 1 143 ? -7.837  73.828  43.529  1.00 179.81 ? 141  ALA C O   1 
ATOM   5111  C CB  . ALA C 1 143 ? -6.168  74.478  41.112  1.00 146.17 ? 141  ALA C CB  1 
ATOM   5112  N N   . GLN C 1 144 ? -8.169  76.055  43.436  1.00 144.49 ? 142  GLN C N   1 
ATOM   5113  C CA  . GLN C 1 144 ? -9.456  76.010  44.123  1.00 145.34 ? 142  GLN C CA  1 
ATOM   5114  C C   . GLN C 1 144 ? -10.636 75.811  43.183  1.00 144.92 ? 142  GLN C C   1 
ATOM   5115  O O   . GLN C 1 144 ? -10.482 75.825  41.966  1.00 144.81 ? 142  GLN C O   1 
ATOM   5116  C CB  . GLN C 1 144 ? -9.670  77.289  44.927  1.00 194.05 ? 142  GLN C CB  1 
ATOM   5117  C CG  . GLN C 1 144 ? -8.658  77.491  46.030  1.00 197.05 ? 142  GLN C CG  1 
ATOM   5118  C CD  . GLN C 1 144 ? -8.994  78.676  46.899  1.00 198.56 ? 142  GLN C CD  1 
ATOM   5119  O OE1 . GLN C 1 144 ? -9.113  79.798  46.414  1.00 200.00 ? 142  GLN C OE1 1 
ATOM   5120  N NE2 . GLN C 1 144 ? -9.154  78.435  48.195  1.00 199.57 ? 142  GLN C NE2 1 
ATOM   5121  N N   . VAL C 1 145 ? -11.817 75.642  43.769  1.00 168.12 ? 143  VAL C N   1 
ATOM   5122  C CA  . VAL C 1 145 ? -13.050 75.417  43.016  1.00 168.08 ? 143  VAL C CA  1 
ATOM   5123  C C   . VAL C 1 145 ? -13.446 76.598  42.128  1.00 167.15 ? 143  VAL C C   1 
ATOM   5124  O O   . VAL C 1 145 ? -14.474 76.562  41.448  1.00 166.82 ? 143  VAL C O   1 
ATOM   5125  C CB  . VAL C 1 145 ? -14.221 75.110  43.978  1.00 169.60 ? 143  VAL C CB  1 
ATOM   5126  C CG1 . VAL C 1 145 ? -15.434 74.623  43.196  1.00 169.33 ? 143  VAL C CG1 1 
ATOM   5127  C CG2 . VAL C 1 145 ? -13.788 74.077  45.005  1.00 169.60 ? 143  VAL C CG2 1 
ATOM   5128  N N   . GLU C 1 146 ? -12.627 77.643  42.131  1.00 109.88 ? 144  GLU C N   1 
ATOM   5129  C CA  . GLU C 1 146 ? -12.909 78.820  41.324  1.00 108.96 ? 144  GLU C CA  1 
ATOM   5130  C C   . GLU C 1 146 ? -11.850 78.958  40.250  1.00 107.63 ? 144  GLU C C   1 
ATOM   5131  O O   . GLU C 1 146 ? -12.052 79.638  39.243  1.00 107.47 ? 144  GLU C O   1 
ATOM   5132  C CB  . GLU C 1 146 ? -12.906 80.056  42.206  1.00 192.84 ? 144  GLU C CB  1 
ATOM   5133  C CG  . GLU C 1 146 ? -13.841 79.939  43.379  1.00 195.89 ? 144  GLU C CG  1 
ATOM   5134  C CD  . GLU C 1 146 ? -13.422 80.822  44.524  1.00 198.02 ? 144  GLU C CD  1 
ATOM   5135  O OE1 . GLU C 1 146 ? -13.361 82.054  44.332  1.00 199.61 ? 144  GLU C OE1 1 
ATOM   5136  O OE2 . GLU C 1 146 ? -13.146 80.281  45.616  1.00 198.64 ? 144  GLU C OE2 1 
ATOM   5137  N N   . ASP C 1 147 ? -10.716 78.308  40.478  1.00 200.00 ? 145  ASP C N   1 
ATOM   5138  C CA  . ASP C 1 147 ? -9.613  78.343  39.532  1.00 200.00 ? 145  ASP C CA  1 
ATOM   5139  C C   . ASP C 1 147 ? -10.018 77.597  38.259  1.00 200.00 ? 145  ASP C C   1 
ATOM   5140  O O   . ASP C 1 147 ? -9.403  77.757  37.204  1.00 200.00 ? 145  ASP C O   1 
ATOM   5141  C CB  . ASP C 1 147 ? -8.366  77.703  40.157  1.00 156.55 ? 145  ASP C CB  1 
ATOM   5142  C CG  . ASP C 1 147 ? -7.987  78.337  41.487  1.00 156.63 ? 145  ASP C CG  1 
ATOM   5143  O OD1 . ASP C 1 147 ? -6.916  77.993  42.033  1.00 155.81 ? 145  ASP C OD1 1 
ATOM   5144  O OD2 . ASP C 1 147 ? -8.764  79.177  41.989  1.00 157.47 ? 145  ASP C OD2 1 
ATOM   5145  N N   . GLY C 1 148 ? -11.064 76.783  38.368  1.00 112.57 ? 146  GLY C N   1 
ATOM   5146  C CA  . GLY C 1 148 ? -11.540 76.039  37.219  1.00 108.07 ? 146  GLY C CA  1 
ATOM   5147  C C   . GLY C 1 148 ? -12.621 76.829  36.515  1.00 105.38 ? 146  GLY C C   1 
ATOM   5148  O O   . GLY C 1 148 ? -12.590 76.999  35.296  1.00 104.87 ? 146  GLY C O   1 
ATOM   5149  N N   . ARG C 1 149 ? -13.572 77.325  37.299  1.00 123.98 ? 147  ARG C N   1 
ATOM   5150  C CA  . ARG C 1 149 ? -14.686 78.102  36.776  1.00 122.05 ? 147  ARG C CA  1 
ATOM   5151  C C   . ARG C 1 149 ? -14.290 79.119  35.718  1.00 121.02 ? 147  ARG C C   1 
ATOM   5152  O O   . ARG C 1 149 ? -14.720 79.025  34.569  1.00 121.50 ? 147  ARG C O   1 
ATOM   5153  C CB  . ARG C 1 149 ? -15.396 78.829  37.907  1.00 129.46 ? 147  ARG C CB  1 
ATOM   5154  C CG  . ARG C 1 149 ? -16.544 79.684  37.428  1.00 129.35 ? 147  ARG C CG  1 
ATOM   5155  C CD  . ARG C 1 149 ? -17.331 80.168  38.602  1.00 131.19 ? 147  ARG C CD  1 
ATOM   5156  N NE  . ARG C 1 149 ? -17.614 79.062  39.507  1.00 134.54 ? 147  ARG C NE  1 
ATOM   5157  C CZ  . ARG C 1 149 ? -18.321 79.175  40.624  1.00 136.40 ? 147  ARG C CZ  1 
ATOM   5158  N NH1 . ARG C 1 149 ? -18.821 80.352  40.974  1.00 137.64 ? 147  ARG C NH1 1 
ATOM   5159  N NH2 . ARG C 1 149 ? -18.528 78.113  41.392  1.00 137.33 ? 147  ARG C NH2 1 
ATOM   5160  N N   . LEU C 1 150 ? -13.483 80.097  36.118  1.00 125.25 ? 148  LEU C N   1 
ATOM   5161  C CA  . LEU C 1 150 ? -13.030 81.145  35.212  1.00 122.90 ? 148  LEU C CA  1 
ATOM   5162  C C   . LEU C 1 150 ? -12.664 80.593  33.840  1.00 120.98 ? 148  LEU C C   1 
ATOM   5163  O O   . LEU C 1 150 ? -13.117 81.098  32.812  1.00 120.35 ? 148  LEU C O   1 
ATOM   5164  C CB  . LEU C 1 150 ? -11.819 81.862  35.804  1.00 126.93 ? 148  LEU C CB  1 
ATOM   5165  C CG  . LEU C 1 150 ? -11.371 83.070  34.984  1.00 127.16 ? 148  LEU C CG  1 
ATOM   5166  C CD1 . LEU C 1 150 ? -12.504 84.088  34.935  1.00 127.92 ? 148  LEU C CD1 1 
ATOM   5167  C CD2 . LEU C 1 150 ? -10.127 83.680  35.598  1.00 127.29 ? 148  LEU C CD2 1 
ATOM   5168  N N   . MET C 1 151 ? -11.842 79.551  33.838  1.00 111.71 ? 149  MET C N   1 
ATOM   5169  C CA  . MET C 1 151 ? -11.403 78.908  32.610  1.00 109.87 ? 149  MET C CA  1 
ATOM   5170  C C   . MET C 1 151 ? -12.547 78.496  31.682  1.00 109.18 ? 149  MET C C   1 
ATOM   5171  O O   . MET C 1 151 ? -12.667 79.020  30.573  1.00 109.11 ? 149  MET C O   1 
ATOM   5172  C CB  . MET C 1 151 ? -10.562 77.683  32.952  1.00 114.78 ? 149  MET C CB  1 
ATOM   5173  C CG  . MET C 1 151 ? -9.260  78.018  33.639  1.00 114.47 ? 149  MET C CG  1 
ATOM   5174  S SD  . MET C 1 151 ? -8.203  79.010  32.571  1.00 114.53 ? 149  MET C SD  1 
ATOM   5175  C CE  . MET C 1 151 ? -7.332  77.703  31.629  1.00 113.99 ? 149  MET C CE  1 
ATOM   5176  N N   . GLU C 1 152 ? -13.381 77.559  32.140  1.00 154.83 ? 150  GLU C N   1 
ATOM   5177  C CA  . GLU C 1 152 ? -14.509 77.048  31.350  1.00 153.63 ? 150  GLU C CA  1 
ATOM   5178  C C   . GLU C 1 152 ? -15.573 78.090  31.006  1.00 152.77 ? 150  GLU C C   1 
ATOM   5179  O O   . GLU C 1 152 ? -16.762 77.777  30.904  1.00 152.57 ? 150  GLU C O   1 
ATOM   5180  C CB  . GLU C 1 152 ? -15.176 75.865  32.068  1.00 97.13  ? 150  GLU C CB  1 
ATOM   5181  C CG  . GLU C 1 152 ? -15.124 74.554  31.279  1.00 97.19  ? 150  GLU C CG  1 
ATOM   5182  C CD  . GLU C 1 152 ? -15.983 73.446  31.883  1.00 97.31  ? 150  GLU C CD  1 
ATOM   5183  O OE1 . GLU C 1 152 ? -17.225 73.593  31.896  1.00 98.08  ? 150  GLU C OE1 1 
ATOM   5184  O OE2 . GLU C 1 152 ? -15.421 72.425  32.340  1.00 95.01  ? 150  GLU C OE2 1 
ATOM   5185  N N   . GLN C 1 153 ? -15.129 79.325  30.820  1.00 93.80  ? 151  GLN C N   1 
ATOM   5186  C CA  . GLN C 1 153 ? -15.994 80.443  30.472  1.00 91.42  ? 151  GLN C CA  1 
ATOM   5187  C C   . GLN C 1 153 ? -15.036 81.335  29.718  1.00 88.75  ? 151  GLN C C   1 
ATOM   5188  O O   . GLN C 1 153 ? -15.391 81.967  28.725  1.00 87.32  ? 151  GLN C O   1 
ATOM   5189  C CB  . GLN C 1 153 ? -16.475 81.157  31.735  1.00 132.42 ? 151  GLN C CB  1 
ATOM   5190  C CG  . GLN C 1 153 ? -17.040 80.222  32.792  1.00 136.40 ? 151  GLN C CG  1 
ATOM   5191  C CD  . GLN C 1 153 ? -17.065 80.847  34.173  1.00 138.10 ? 151  GLN C CD  1 
ATOM   5192  O OE1 . GLN C 1 153 ? -16.046 81.336  34.664  1.00 139.32 ? 151  GLN C OE1 1 
ATOM   5193  N NE2 . GLN C 1 153 ? -18.229 80.826  34.812  1.00 139.15 ? 151  GLN C NE2 1 
ATOM   5194  N N   . LEU C 1 154 ? -13.804 81.355  30.219  1.00 116.51 ? 152  LEU C N   1 
ATOM   5195  C CA  . LEU C 1 154 ? -12.709 82.128  29.646  1.00 116.69 ? 152  LEU C CA  1 
ATOM   5196  C C   . LEU C 1 154 ? -12.413 81.641  28.239  1.00 115.90 ? 152  LEU C C   1 
ATOM   5197  O O   . LEU C 1 154 ? -12.443 82.408  27.273  1.00 115.78 ? 152  LEU C O   1 
ATOM   5198  C CB  . LEU C 1 154 ? -11.448 81.967  30.507  1.00 105.60 ? 152  LEU C CB  1 
ATOM   5199  C CG  . LEU C 1 154 ? -10.083 82.155  29.824  1.00 104.39 ? 152  LEU C CG  1 
ATOM   5200  C CD1 . LEU C 1 154 ? -9.984  83.542  29.213  1.00 103.86 ? 152  LEU C CD1 1 
ATOM   5201  C CD2 . LEU C 1 154 ? -8.966  81.934  30.834  1.00 103.52 ? 152  LEU C CD2 1 
ATOM   5202  N N   . LEU C 1 155 ? -12.113 80.352  28.145  1.00 127.97 ? 153  LEU C N   1 
ATOM   5203  C CA  . LEU C 1 155 ? -11.797 79.725  26.872  1.00 125.81 ? 153  LEU C CA  1 
ATOM   5204  C C   . LEU C 1 155 ? -13.035 79.040  26.317  1.00 123.54 ? 153  LEU C C   1 
ATOM   5205  O O   . LEU C 1 155 ? -13.110 78.725  25.128  1.00 123.68 ? 153  LEU C O   1 
ATOM   5206  C CB  . LEU C 1 155 ? -10.662 78.720  27.067  1.00 100.88 ? 153  LEU C CB  1 
ATOM   5207  C CG  . LEU C 1 155 ? -9.329  79.365  27.469  1.00 101.77 ? 153  LEU C CG  1 
ATOM   5208  C CD1 . LEU C 1 155 ? -8.342  78.304  27.919  1.00 101.16 ? 153  LEU C CD1 1 
ATOM   5209  C CD2 . LEU C 1 155 ? -8.769  80.160  26.293  1.00 101.84 ? 153  LEU C CD2 1 
ATOM   5210  N N   . SER C 1 156 ? -14.011 78.822  27.190  1.00 78.32  ? 154  SER C N   1 
ATOM   5211  C CA  . SER C 1 156 ? -15.256 78.195  26.790  1.00 75.98  ? 154  SER C CA  1 
ATOM   5212  C C   . SER C 1 156 ? -15.964 79.164  25.851  1.00 75.73  ? 154  SER C C   1 
ATOM   5213  O O   . SER C 1 156 ? -17.096 78.928  25.428  1.00 75.83  ? 154  SER C O   1 
ATOM   5214  C CB  . SER C 1 156 ? -16.125 77.925  28.018  1.00 87.19  ? 154  SER C CB  1 
ATOM   5215  O OG  . SER C 1 156 ? -17.259 77.146  27.685  1.00 87.87  ? 154  SER C OG  1 
ATOM   5216  N N   . SER C 1 157 ? -15.283 80.260  25.530  1.00 98.30  ? 155  SER C N   1 
ATOM   5217  C CA  . SER C 1 157 ? -15.832 81.278  24.647  1.00 99.19  ? 155  SER C CA  1 
ATOM   5218  C C   . SER C 1 157 ? -15.148 81.234  23.291  1.00 97.99  ? 155  SER C C   1 
ATOM   5219  O O   . SER C 1 157 ? -15.302 82.146  22.480  1.00 98.25  ? 155  SER C O   1 
ATOM   5220  C CB  . SER C 1 157 ? -15.646 82.669  25.253  1.00 149.40 ? 155  SER C CB  1 
ATOM   5221  O OG  . SER C 1 157 ? -14.283 83.056  25.228  1.00 152.75 ? 155  SER C OG  1 
ATOM   5222  N N   . VAL C 1 158 ? -14.389 80.174  23.045  1.00 97.86  ? 156  VAL C N   1 
ATOM   5223  C CA  . VAL C 1 158 ? -13.690 80.033  21.776  1.00 97.62  ? 156  VAL C CA  1 
ATOM   5224  C C   . VAL C 1 158 ? -13.706 78.572  21.354  1.00 96.60  ? 156  VAL C C   1 
ATOM   5225  O O   . VAL C 1 158 ? -12.698 78.018  20.922  1.00 98.07  ? 156  VAL C O   1 
ATOM   5226  C CB  . VAL C 1 158 ? -12.231 80.514  21.891  1.00 116.67 ? 156  VAL C CB  1 
ATOM   5227  C CG1 . VAL C 1 158 ? -11.553 80.445  20.536  1.00 117.96 ? 156  VAL C CG1 1 
ATOM   5228  C CG2 . VAL C 1 158 ? -12.193 81.933  22.434  1.00 116.57 ? 156  VAL C CG2 1 
ATOM   5229  N N   . GLY C 1 159 ? -14.867 77.950  21.489  1.00 63.31  ? 157  GLY C N   1 
ATOM   5230  C CA  . GLY C 1 159 ? -15.005 76.557  21.124  1.00 61.44  ? 157  GLY C CA  1 
ATOM   5231  C C   . GLY C 1 159 ? -15.357 75.727  22.334  1.00 60.71  ? 157  GLY C C   1 
ATOM   5232  O O   . GLY C 1 159 ? -15.621 76.253  23.411  1.00 60.53  ? 157  GLY C O   1 
ATOM   5233  N N   . PHE C 1 160 ? -15.362 74.416  22.160  1.00 92.50  ? 158  PHE C N   1 
ATOM   5234  C CA  . PHE C 1 160 ? -15.685 73.532  23.259  1.00 92.78  ? 158  PHE C CA  1 
ATOM   5235  C C   . PHE C 1 160 ? -14.628 73.599  24.350  1.00 92.79  ? 158  PHE C C   1 
ATOM   5236  O O   . PHE C 1 160 ? -13.465 73.908  24.083  1.00 91.50  ? 158  PHE C O   1 
ATOM   5237  C CB  . PHE C 1 160 ? -15.806 72.097  22.761  1.00 87.52  ? 158  PHE C CB  1 
ATOM   5238  C CG  . PHE C 1 160 ? -15.978 71.092  23.860  1.00 87.22  ? 158  PHE C CG  1 
ATOM   5239  C CD1 . PHE C 1 160 ? -17.001 71.234  24.798  1.00 87.19  ? 158  PHE C CD1 1 
ATOM   5240  C CD2 . PHE C 1 160 ? -15.128 69.995  23.952  1.00 86.04  ? 158  PHE C CD2 1 
ATOM   5241  C CE1 . PHE C 1 160 ? -17.177 70.295  25.811  1.00 86.77  ? 158  PHE C CE1 1 
ATOM   5242  C CE2 . PHE C 1 160 ? -15.293 69.051  24.958  1.00 86.17  ? 158  PHE C CE2 1 
ATOM   5243  C CZ  . PHE C 1 160 ? -16.321 69.201  25.890  1.00 86.54  ? 158  PHE C CZ  1 
ATOM   5244  N N   . CYS C 1 161 ? -15.053 73.297  25.575  1.00 79.13  ? 159  CYS C N   1 
ATOM   5245  C CA  . CYS C 1 161 ? -14.174 73.299  26.733  1.00 77.93  ? 159  CYS C CA  1 
ATOM   5246  C C   . CYS C 1 161 ? -14.793 72.533  27.904  1.00 77.43  ? 159  CYS C C   1 
ATOM   5247  O O   . CYS C 1 161 ? -15.974 72.713  28.211  1.00 76.33  ? 159  CYS C O   1 
ATOM   5248  C CB  . CYS C 1 161 ? -13.886 74.736  27.159  1.00 101.18 ? 159  CYS C CB  1 
ATOM   5249  S SG  . CYS C 1 161 ? -12.816 74.867  28.599  1.00 100.76 ? 159  CYS C SG  1 
ATOM   5250  N N   . THR C 1 162 ? -13.989 71.678  28.540  1.00 74.40  ? 160  THR C N   1 
ATOM   5251  C CA  . THR C 1 162 ? -14.404 70.874  29.701  1.00 75.73  ? 160  THR C CA  1 
ATOM   5252  C C   . THR C 1 162 ? -13.143 70.396  30.423  1.00 77.17  ? 160  THR C C   1 
ATOM   5253  O O   . THR C 1 162 ? -12.043 70.512  29.879  1.00 76.13  ? 160  THR C O   1 
ATOM   5254  C CB  . THR C 1 162 ? -15.268 69.639  29.283  1.00 81.26  ? 160  THR C CB  1 
ATOM   5255  O OG1 . THR C 1 162 ? -16.632 70.043  29.102  1.00 81.61  ? 160  THR C OG1 1 
ATOM   5256  C CG2 . THR C 1 162 ? -15.214 68.541  30.344  1.00 80.23  ? 160  THR C CG2 1 
ATOM   5257  N N   . GLU C 1 163 ? -13.301 69.869  31.639  1.00 74.70  ? 161  GLU C N   1 
ATOM   5258  C CA  . GLU C 1 163 ? -12.163 69.389  32.422  1.00 77.36  ? 161  GLU C CA  1 
ATOM   5259  C C   . GLU C 1 163 ? -11.978 67.877  32.422  1.00 76.86  ? 161  GLU C C   1 
ATOM   5260  O O   . GLU C 1 163 ? -12.948 67.115  32.373  1.00 75.73  ? 161  GLU C O   1 
ATOM   5261  C CB  . GLU C 1 163 ? -12.268 69.867  33.866  1.00 158.40 ? 161  GLU C CB  1 
ATOM   5262  C CG  . GLU C 1 163 ? -13.404 69.254  34.652  1.00 164.77 ? 161  GLU C CG  1 
ATOM   5263  C CD  . GLU C 1 163 ? -13.491 69.825  36.048  1.00 168.56 ? 161  GLU C CD  1 
ATOM   5264  O OE1 . GLU C 1 163 ? -12.488 69.732  36.789  1.00 170.99 ? 161  GLU C OE1 1 
ATOM   5265  O OE2 . GLU C 1 163 ? -14.557 70.372  36.401  1.00 169.61 ? 161  GLU C OE2 1 
ATOM   5266  N N   . VAL C 1 164 ? -10.715 67.461  32.499  1.00 88.70  ? 162  VAL C N   1 
ATOM   5267  C CA  . VAL C 1 164 ? -10.325 66.050  32.504  1.00 89.97  ? 162  VAL C CA  1 
ATOM   5268  C C   . VAL C 1 164 ? -8.920  65.904  33.091  1.00 90.47  ? 162  VAL C C   1 
ATOM   5269  O O   . VAL C 1 164 ? -8.147  66.864  33.103  1.00 90.12  ? 162  VAL C O   1 
ATOM   5270  C CB  . VAL C 1 164 ? -10.260 65.491  31.092  1.00 95.45  ? 162  VAL C CB  1 
ATOM   5271  C CG1 . VAL C 1 164 ? -11.581 65.686  30.384  1.00 97.29  ? 162  VAL C CG1 1 
ATOM   5272  C CG2 . VAL C 1 164 ? -9.151  66.178  30.344  1.00 93.89  ? 162  VAL C CG2 1 
ATOM   5273  N N   . GLU C 1 165 ? -8.578  64.696  33.538  1.00 82.37  ? 163  GLU C N   1 
ATOM   5274  C CA  . GLU C 1 165 ? -7.264  64.451  34.130  1.00 84.36  ? 163  GLU C CA  1 
ATOM   5275  C C   . GLU C 1 165 ? -6.119  64.530  33.120  1.00 83.59  ? 163  GLU C C   1 
ATOM   5276  O O   . GLU C 1 165 ? -6.292  64.216  31.941  1.00 82.92  ? 163  GLU C O   1 
ATOM   5277  C CB  . GLU C 1 165 ? -7.269  63.104  34.847  1.00 112.09 ? 163  GLU C CB  1 
ATOM   5278  C CG  . GLU C 1 165 ? -8.418  62.991  35.825  1.00 119.21 ? 163  GLU C CG  1 
ATOM   5279  C CD  . GLU C 1 165 ? -8.228  61.887  36.834  1.00 123.48 ? 163  GLU C CD  1 
ATOM   5280  O OE1 . GLU C 1 165 ? -7.237  61.941  37.593  1.00 125.21 ? 163  GLU C OE1 1 
ATOM   5281  O OE2 . GLU C 1 165 ? -9.072  60.968  36.871  1.00 127.05 ? 163  GLU C OE2 1 
ATOM   5282  N N   . GLU C 1 166 ? -4.950  64.959  33.593  1.00 82.06  ? 164  GLU C N   1 
ATOM   5283  C CA  . GLU C 1 166 ? -3.776  65.126  32.740  1.00 82.95  ? 164  GLU C CA  1 
ATOM   5284  C C   . GLU C 1 166 ? -3.266  63.827  32.124  1.00 81.60  ? 164  GLU C C   1 
ATOM   5285  O O   . GLU C 1 166 ? -2.383  63.830  31.260  1.00 80.87  ? 164  GLU C O   1 
ATOM   5286  C CB  . GLU C 1 166 ? -2.659  65.806  33.531  1.00 130.87 ? 164  GLU C CB  1 
ATOM   5287  C CG  . GLU C 1 166 ? -1.456  66.191  32.696  1.00 136.49 ? 164  GLU C CG  1 
ATOM   5288  C CD  . GLU C 1 166 ? -0.513  67.099  33.446  1.00 140.01 ? 164  GLU C CD  1 
ATOM   5289  O OE1 . GLU C 1 166 ? -0.948  68.201  33.837  1.00 141.57 ? 164  GLU C OE1 1 
ATOM   5290  O OE2 . GLU C 1 166 ? 0.658   66.714  33.644  1.00 141.53 ? 164  GLU C OE2 1 
ATOM   5291  N N   . ASP C 1 167 ? -3.822  62.713  32.573  1.00 132.01 ? 165  ASP C N   1 
ATOM   5292  C CA  . ASP C 1 167 ? -3.435  61.418  32.042  1.00 130.32 ? 165  ASP C CA  1 
ATOM   5293  C C   . ASP C 1 167 ? -4.112  61.236  30.683  1.00 127.45 ? 165  ASP C C   1 
ATOM   5294  O O   . ASP C 1 167 ? -3.768  60.337  29.914  1.00 128.86 ? 165  ASP C O   1 
ATOM   5295  C CB  . ASP C 1 167 ? -3.872  60.316  33.009  1.00 123.35 ? 165  ASP C CB  1 
ATOM   5296  C CG  . ASP C 1 167 ? -5.315  60.478  33.467  1.00 125.49 ? 165  ASP C CG  1 
ATOM   5297  O OD1 . ASP C 1 167 ? -5.794  59.631  34.251  1.00 126.44 ? 165  ASP C OD1 1 
ATOM   5298  O OD2 . ASP C 1 167 ? -5.971  61.454  33.044  1.00 127.00 ? 165  ASP C OD2 1 
ATOM   5299  N N   . LEU C 1 168 ? -5.071  62.111  30.398  1.00 66.62  ? 166  LEU C N   1 
ATOM   5300  C CA  . LEU C 1 168 ? -5.828  62.071  29.153  1.00 57.89  ? 166  LEU C CA  1 
ATOM   5301  C C   . LEU C 1 168 ? -5.375  63.160  28.194  1.00 54.79  ? 166  LEU C C   1 
ATOM   5302  O O   . LEU C 1 168 ? -5.534  63.051  26.981  1.00 54.52  ? 166  LEU C O   1 
ATOM   5303  C CB  . LEU C 1 168 ? -7.314  62.266  29.450  1.00 54.25  ? 166  LEU C CB  1 
ATOM   5304  C CG  . LEU C 1 168 ? -7.980  61.261  30.386  1.00 52.82  ? 166  LEU C CG  1 
ATOM   5305  C CD1 . LEU C 1 168 ? -9.462  61.621  30.562  1.00 50.49  ? 166  LEU C CD1 1 
ATOM   5306  C CD2 . LEU C 1 168 ? -7.821  59.863  29.805  1.00 50.94  ? 166  LEU C CD2 1 
ATOM   5307  N N   . ILE C 1 169 ? -4.824  64.223  28.752  1.00 63.63  ? 167  ILE C N   1 
ATOM   5308  C CA  . ILE C 1 169 ? -4.373  65.345  27.951  1.00 64.16  ? 167  ILE C CA  1 
ATOM   5309  C C   . ILE C 1 169 ? -3.474  64.879  26.829  1.00 63.02  ? 167  ILE C C   1 
ATOM   5310  O O   . ILE C 1 169 ? -3.457  65.458  25.740  1.00 62.26  ? 167  ILE C O   1 
ATOM   5311  C CB  . ILE C 1 169 ? -3.653  66.381  28.845  1.00 62.59  ? 167  ILE C CB  1 
ATOM   5312  C CG1 . ILE C 1 169 ? -4.708  67.247  29.537  1.00 60.71  ? 167  ILE C CG1 1 
ATOM   5313  C CG2 . ILE C 1 169 ? -2.665  67.214  28.030  1.00 62.49  ? 167  ILE C CG2 1 
ATOM   5314  C CD1 . ILE C 1 169 ? -4.159  68.123  30.604  1.00 63.48  ? 167  ILE C CD1 1 
ATOM   5315  N N   . ASP C 1 170 ? -2.740  63.812  27.097  1.00 66.04  ? 168  ASP C N   1 
ATOM   5316  C CA  . ASP C 1 170 ? -1.838  63.267  26.107  1.00 66.93  ? 168  ASP C CA  1 
ATOM   5317  C C   . ASP C 1 170 ? -2.642  62.644  24.971  1.00 64.30  ? 168  ASP C C   1 
ATOM   5318  O O   . ASP C 1 170 ? -2.226  62.686  23.812  1.00 64.32  ? 168  ASP C O   1 
ATOM   5319  C CB  . ASP C 1 170 ? -0.924  62.254  26.782  1.00 100.94 ? 168  ASP C CB  1 
ATOM   5320  C CG  . ASP C 1 170 ? -0.270  62.825  28.029  1.00 106.30 ? 168  ASP C CG  1 
ATOM   5321  O OD1 . ASP C 1 170 ? 0.428   63.858  27.919  1.00 109.19 ? 168  ASP C OD1 1 
ATOM   5322  O OD2 . ASP C 1 170 ? -0.461  62.251  29.119  1.00 108.13 ? 168  ASP C OD2 1 
ATOM   5323  N N   . ALA C 1 171 ? -3.804  62.082  25.305  1.00 64.37  ? 169  ALA C N   1 
ATOM   5324  C CA  . ALA C 1 171 ? -4.680  61.480  24.301  1.00 60.56  ? 169  ALA C CA  1 
ATOM   5325  C C   . ALA C 1 171 ? -5.325  62.606  23.509  1.00 59.65  ? 169  ALA C C   1 
ATOM   5326  O O   . ALA C 1 171 ? -5.160  62.694  22.293  1.00 59.59  ? 169  ALA C O   1 
ATOM   5327  C CB  . ALA C 1 171 ? -5.761  60.636  24.965  1.00 22.49  ? 169  ALA C CB  1 
ATOM   5328  N N   . VAL C 1 172 ? -6.065  63.461  24.211  1.00 44.86  ? 170  VAL C N   1 
ATOM   5329  C CA  . VAL C 1 172 ? -6.728  64.604  23.588  1.00 43.25  ? 170  VAL C CA  1 
ATOM   5330  C C   . VAL C 1 172 ? -5.859  65.191  22.482  1.00 43.98  ? 170  VAL C C   1 
ATOM   5331  O O   . VAL C 1 172 ? -6.338  65.499  21.391  1.00 42.76  ? 170  VAL C O   1 
ATOM   5332  C CB  . VAL C 1 172 ? -7.021  65.694  24.629  1.00 37.68  ? 170  VAL C CB  1 
ATOM   5333  C CG1 . VAL C 1 172 ? -7.294  67.022  23.951  1.00 34.87  ? 170  VAL C CG1 1 
ATOM   5334  C CG2 . VAL C 1 172 ? -8.211  65.277  25.464  1.00 36.33  ? 170  VAL C CG2 1 
ATOM   5335  N N   . THR C 1 173 ? -4.575  65.337  22.777  1.00 46.10  ? 171  THR C N   1 
ATOM   5336  C CA  . THR C 1 173 ? -3.627  65.869  21.816  1.00 49.41  ? 171  THR C CA  1 
ATOM   5337  C C   . THR C 1 173 ? -3.731  65.089  20.505  1.00 49.27  ? 171  THR C C   1 
ATOM   5338  O O   . THR C 1 173 ? -3.930  65.665  19.436  1.00 48.51  ? 171  THR C O   1 
ATOM   5339  C CB  . THR C 1 173 ? -2.192  65.748  22.358  1.00 83.97  ? 171  THR C CB  1 
ATOM   5340  O OG1 . THR C 1 173 ? -2.128  66.314  23.674  1.00 88.15  ? 171  THR C OG1 1 
ATOM   5341  C CG2 . THR C 1 173 ? -1.216  66.474  21.445  1.00 85.98  ? 171  THR C CG2 1 
ATOM   5342  N N   . GLY C 1 174 ? -3.596  63.771  20.597  1.00 67.40  ? 172  GLY C N   1 
ATOM   5343  C CA  . GLY C 1 174 ? -3.673  62.938  19.410  1.00 64.96  ? 172  GLY C CA  1 
ATOM   5344  C C   . GLY C 1 174 ? -4.958  63.173  18.655  1.00 63.62  ? 172  GLY C C   1 
ATOM   5345  O O   . GLY C 1 174 ? -4.984  63.183  17.425  1.00 63.18  ? 172  GLY C O   1 
ATOM   5346  N N   . LEU C 1 175 ? -6.030  63.376  19.411  1.00 37.20  ? 173  LEU C N   1 
ATOM   5347  C CA  . LEU C 1 175 ? -7.339  63.611  18.828  1.00 34.91  ? 173  LEU C CA  1 
ATOM   5348  C C   . LEU C 1 175 ? -7.472  65.052  18.332  1.00 35.13  ? 173  LEU C C   1 
ATOM   5349  O O   . LEU C 1 175 ? -6.973  65.393  17.258  1.00 34.44  ? 173  LEU C O   1 
ATOM   5350  C CB  . LEU C 1 175 ? -8.426  63.297  19.859  1.00 36.34  ? 173  LEU C CB  1 
ATOM   5351  C CG  . LEU C 1 175 ? -9.855  63.163  19.332  1.00 35.84  ? 173  LEU C CG  1 
ATOM   5352  C CD1 . LEU C 1 175 ? -9.873  62.138  18.209  1.00 37.59  ? 173  LEU C CD1 1 
ATOM   5353  C CD2 . LEU C 1 175 ? -10.800 62.751  20.461  1.00 34.85  ? 173  LEU C CD2 1 
ATOM   5354  N N   . SER C 1 176 ? -8.128  65.901  19.116  1.00 49.95  ? 174  SER C N   1 
ATOM   5355  C CA  . SER C 1 176 ? -8.323  67.295  18.723  1.00 53.14  ? 174  SER C CA  1 
ATOM   5356  C C   . SER C 1 176 ? -7.000  68.023  18.536  1.00 54.39  ? 174  SER C C   1 
ATOM   5357  O O   . SER C 1 176 ? -6.900  68.943  17.725  1.00 55.22  ? 174  SER C O   1 
ATOM   5358  C CB  . SER C 1 176 ? -9.141  68.045  19.772  1.00 51.29  ? 174  SER C CB  1 
ATOM   5359  O OG  . SER C 1 176 ? -8.283  68.682  20.704  1.00 52.00  ? 174  SER C OG  1 
ATOM   5360  N N   . GLY C 1 177 ? -5.994  67.611  19.300  1.00 54.08  ? 175  GLY C N   1 
ATOM   5361  C CA  . GLY C 1 177 ? -4.689  68.241  19.219  1.00 54.02  ? 175  GLY C CA  1 
ATOM   5362  C C   . GLY C 1 177 ? -4.101  68.281  17.822  1.00 54.82  ? 175  GLY C C   1 
ATOM   5363  O O   . GLY C 1 177 ? -3.731  69.351  17.332  1.00 53.93  ? 175  GLY C O   1 
ATOM   5364  N N   . SER C 1 178 ? -4.004  67.121  17.178  1.00 54.32  ? 176  SER C N   1 
ATOM   5365  C CA  . SER C 1 178 ? -3.458  67.061  15.829  1.00 55.03  ? 176  SER C CA  1 
ATOM   5366  C C   . SER C 1 178 ? -4.560  66.999  14.766  1.00 54.63  ? 176  SER C C   1 
ATOM   5367  O O   . SER C 1 178 ? -4.300  67.217  13.584  1.00 53.43  ? 176  SER C O   1 
ATOM   5368  C CB  . SER C 1 178 ? -2.530  65.854  15.698  1.00 41.95  ? 176  SER C CB  1 
ATOM   5369  O OG  . SER C 1 178 ? -1.465  65.944  16.627  1.00 41.89  ? 176  SER C OG  1 
ATOM   5370  N N   . GLY C 1 179 ? -5.787  66.718  15.205  1.00 49.70  ? 177  GLY C N   1 
ATOM   5371  C CA  . GLY C 1 179 ? -6.924  66.620  14.302  1.00 50.00  ? 177  GLY C CA  1 
ATOM   5372  C C   . GLY C 1 179 ? -6.891  67.524  13.081  1.00 51.28  ? 177  GLY C C   1 
ATOM   5373  O O   . GLY C 1 179 ? -6.838  67.043  11.947  1.00 50.76  ? 177  GLY C O   1 
ATOM   5374  N N   . PRO C 1 180 ? -6.928  68.847  13.283  1.00 68.31  ? 178  PRO C N   1 
ATOM   5375  C CA  . PRO C 1 180 ? -6.903  69.834  12.204  1.00 67.11  ? 178  PRO C CA  1 
ATOM   5376  C C   . PRO C 1 180 ? -5.984  69.451  11.048  1.00 64.50  ? 178  PRO C C   1 
ATOM   5377  O O   . PRO C 1 180 ? -6.377  69.504  9.882   1.00 67.33  ? 178  PRO C O   1 
ATOM   5378  C CB  . PRO C 1 180 ? -6.438  71.091  12.919  1.00 87.18  ? 178  PRO C CB  1 
ATOM   5379  C CG  . PRO C 1 180 ? -7.129  70.967  14.232  1.00 90.03  ? 178  PRO C CG  1 
ATOM   5380  C CD  . PRO C 1 180 ? -6.914  69.513  14.598  1.00 89.53  ? 178  PRO C CD  1 
ATOM   5381  N N   . ALA C 1 181 ? -4.759  69.064  11.377  1.00 37.68  ? 179  ALA C N   1 
ATOM   5382  C CA  . ALA C 1 181 ? -3.788  68.681  10.364  1.00 33.47  ? 179  ALA C CA  1 
ATOM   5383  C C   . ALA C 1 181 ? -4.301  67.522  9.522   1.00 30.55  ? 179  ALA C C   1 
ATOM   5384  O O   . ALA C 1 181 ? -3.990  67.423  8.341   1.00 31.57  ? 179  ALA C O   1 
ATOM   5385  C CB  . ALA C 1 181 ? -2.474  68.306  11.020  1.00 64.81  ? 179  ALA C CB  1 
ATOM   5386  N N   . TYR C 1 182 ? -5.078  66.638  10.135  1.00 37.27  ? 180  TYR C N   1 
ATOM   5387  C CA  . TYR C 1 182 ? -5.635  65.498  9.416   1.00 35.87  ? 180  TYR C CA  1 
ATOM   5388  C C   . TYR C 1 182 ? -6.590  66.091  8.407   1.00 34.01  ? 180  TYR C C   1 
ATOM   5389  O O   . TYR C 1 182 ? -6.482  65.845  7.208   1.00 32.98  ? 180  TYR C O   1 
ATOM   5390  C CB  . TYR C 1 182 ? -6.424  64.602  10.363  1.00 48.59  ? 180  TYR C CB  1 
ATOM   5391  C CG  . TYR C 1 182 ? -5.665  64.183  11.603  1.00 54.21  ? 180  TYR C CG  1 
ATOM   5392  C CD1 . TYR C 1 182 ? -6.352  63.800  12.763  1.00 54.73  ? 180  TYR C CD1 1 
ATOM   5393  C CD2 . TYR C 1 182 ? -4.263  64.156  11.624  1.00 54.76  ? 180  TYR C CD2 1 
ATOM   5394  C CE1 . TYR C 1 182 ? -5.668  63.401  13.916  1.00 55.44  ? 180  TYR C CE1 1 
ATOM   5395  C CE2 . TYR C 1 182 ? -3.566  63.756  12.773  1.00 55.69  ? 180  TYR C CE2 1 
ATOM   5396  C CZ  . TYR C 1 182 ? -4.278  63.380  13.916  1.00 57.95  ? 180  TYR C CZ  1 
ATOM   5397  O OH  . TYR C 1 182 ? -3.608  62.975  15.056  1.00 58.61  ? 180  TYR C OH  1 
ATOM   5398  N N   . ALA C 1 183 ? -7.522  66.884  8.930   1.00 34.65  ? 181  ALA C N   1 
ATOM   5399  C CA  . ALA C 1 183 ? -8.541  67.559  8.139   1.00 35.50  ? 181  ALA C CA  1 
ATOM   5400  C C   . ALA C 1 183 ? -7.944  68.296  6.954   1.00 38.22  ? 181  ALA C C   1 
ATOM   5401  O O   . ALA C 1 183 ? -8.394  68.129  5.821   1.00 41.48  ? 181  ALA C O   1 
ATOM   5402  C CB  . ALA C 1 183 ? -9.302  68.528  9.011   1.00 4.02   ? 181  ALA C CB  1 
ATOM   5403  N N   . PHE C 1 184 ? -6.937  69.121  7.218   1.00 41.37  ? 182  PHE C N   1 
ATOM   5404  C CA  . PHE C 1 184 ? -6.286  69.872  6.152   1.00 44.17  ? 182  PHE C CA  1 
ATOM   5405  C C   . PHE C 1 184 ? -5.835  68.880  5.096   1.00 43.33  ? 182  PHE C C   1 
ATOM   5406  O O   . PHE C 1 184 ? -5.901  69.154  3.898   1.00 45.43  ? 182  PHE C O   1 
ATOM   5407  C CB  . PHE C 1 184 ? -5.086  70.646  6.707   1.00 61.98  ? 182  PHE C CB  1 
ATOM   5408  C CG  . PHE C 1 184 ? -5.458  71.686  7.728   1.00 66.03  ? 182  PHE C CG  1 
ATOM   5409  C CD1 . PHE C 1 184 ? -4.528  72.120  8.663   1.00 69.44  ? 182  PHE C CD1 1 
ATOM   5410  C CD2 . PHE C 1 184 ? -6.742  72.225  7.761   1.00 67.07  ? 182  PHE C CD2 1 
ATOM   5411  C CE1 . PHE C 1 184 ? -4.869  73.071  9.616   1.00 70.03  ? 182  PHE C CE1 1 
ATOM   5412  C CE2 . PHE C 1 184 ? -7.094  73.177  8.708   1.00 68.77  ? 182  PHE C CE2 1 
ATOM   5413  C CZ  . PHE C 1 184 ? -6.157  73.600  9.638   1.00 70.90  ? 182  PHE C CZ  1 
ATOM   5414  N N   . THR C 1 185 ? -5.388  67.718  5.561   1.00 43.72  ? 183  THR C N   1 
ATOM   5415  C CA  . THR C 1 185 ? -4.935  66.661  4.678   1.00 44.80  ? 183  THR C CA  1 
ATOM   5416  C C   . THR C 1 185 ? -6.149  66.108  3.951   1.00 46.59  ? 183  THR C C   1 
ATOM   5417  O O   . THR C 1 185 ? -6.245  66.195  2.731   1.00 48.99  ? 183  THR C O   1 
ATOM   5418  C CB  . THR C 1 185 ? -4.254  65.542  5.470   1.00 33.01  ? 183  THR C CB  1 
ATOM   5419  O OG1 . THR C 1 185 ? -3.155  66.092  6.206   1.00 32.81  ? 183  THR C OG1 1 
ATOM   5420  C CG2 . THR C 1 185 ? -3.733  64.465  4.533   1.00 32.42  ? 183  THR C CG2 1 
ATOM   5421  N N   . ALA C 1 186 ? -7.084  65.547  4.701   1.00 44.94  ? 184  ALA C N   1 
ATOM   5422  C CA  . ALA C 1 186 ? -8.294  65.011  4.101   1.00 46.21  ? 184  ALA C CA  1 
ATOM   5423  C C   . ALA C 1 186 ? -8.837  65.984  3.050   1.00 48.23  ? 184  ALA C C   1 
ATOM   5424  O O   . ALA C 1 186 ? -9.351  65.565  2.011   1.00 50.19  ? 184  ALA C O   1 
ATOM   5425  C CB  . ALA C 1 186 ? -9.344  64.768  5.181   1.00 50.44  ? 184  ALA C CB  1 
ATOM   5426  N N   . LEU C 1 187 ? -8.703  67.282  3.316   1.00 51.87  ? 185  LEU C N   1 
ATOM   5427  C CA  . LEU C 1 187 ? -9.203  68.303  2.403   1.00 51.81  ? 185  LEU C CA  1 
ATOM   5428  C C   . LEU C 1 187 ? -8.422  68.481  1.123   1.00 51.68  ? 185  LEU C C   1 
ATOM   5429  O O   . LEU C 1 187 ? -8.978  68.386  0.028   1.00 55.13  ? 185  LEU C O   1 
ATOM   5430  C CB  . LEU C 1 187 ? -9.314  69.640  3.118   1.00 61.69  ? 185  LEU C CB  1 
ATOM   5431  C CG  . LEU C 1 187 ? -10.675 69.712  3.811   1.00 64.89  ? 185  LEU C CG  1 
ATOM   5432  C CD1 . LEU C 1 187 ? -10.756 70.929  4.695   1.00 65.60  ? 185  LEU C CD1 1 
ATOM   5433  C CD2 . LEU C 1 187 ? -11.777 69.730  2.746   1.00 69.00  ? 185  LEU C CD2 1 
ATOM   5434  N N   . ASP C 1 188 ? -7.137  68.758  1.244   1.00 35.37  ? 186  ASP C N   1 
ATOM   5435  C CA  . ASP C 1 188 ? -6.334  68.919  0.052   1.00 34.95  ? 186  ASP C CA  1 
ATOM   5436  C C   . ASP C 1 188 ? -6.549  67.681  -0.837  1.00 34.14  ? 186  ASP C C   1 
ATOM   5437  O O   . ASP C 1 188 ? -6.433  67.748  -2.066  1.00 34.19  ? 186  ASP C O   1 
ATOM   5438  C CB  . ASP C 1 188 ? -4.869  69.060  0.443   1.00 50.48  ? 186  ASP C CB  1 
ATOM   5439  C CG  . ASP C 1 188 ? -3.997  69.413  -0.727  1.00 55.08  ? 186  ASP C CG  1 
ATOM   5440  O OD1 . ASP C 1 188 ? -4.324  70.394  -1.428  1.00 58.45  ? 186  ASP C OD1 1 
ATOM   5441  O OD2 . ASP C 1 188 ? -2.986  68.715  -0.946  1.00 57.09  ? 186  ASP C OD2 1 
ATOM   5442  N N   . ALA C 1 189 ? -6.887  66.558  -0.199  1.00 46.52  ? 187  ALA C N   1 
ATOM   5443  C CA  . ALA C 1 189 ? -7.120  65.291  -0.894  1.00 41.54  ? 187  ALA C CA  1 
ATOM   5444  C C   . ALA C 1 189 ? -8.396  65.366  -1.692  1.00 41.00  ? 187  ALA C C   1 
ATOM   5445  O O   . ALA C 1 189 ? -8.359  65.286  -2.910  1.00 40.36  ? 187  ALA C O   1 
ATOM   5446  C CB  . ALA C 1 189 ? -7.200  64.141  0.104   1.00 25.85  ? 187  ALA C CB  1 
ATOM   5447  N N   . LEU C 1 190 ? -9.523  65.505  -1.001  1.00 49.82  ? 188  LEU C N   1 
ATOM   5448  C CA  . LEU C 1 190 ? -10.823 65.610  -1.661  1.00 52.40  ? 188  LEU C CA  1 
ATOM   5449  C C   . LEU C 1 190 ? -10.747 66.600  -2.821  1.00 55.55  ? 188  LEU C C   1 
ATOM   5450  O O   . LEU C 1 190 ? -11.009 66.254  -3.985  1.00 58.29  ? 188  LEU C O   1 
ATOM   5451  C CB  . LEU C 1 190 ? -11.870 66.095  -0.671  1.00 24.86  ? 188  LEU C CB  1 
ATOM   5452  C CG  . LEU C 1 190 ? -12.113 65.135  0.480   1.00 22.78  ? 188  LEU C CG  1 
ATOM   5453  C CD1 . LEU C 1 190 ? -12.999 65.812  1.502   1.00 21.02  ? 188  LEU C CD1 1 
ATOM   5454  C CD2 . LEU C 1 190 ? -12.752 63.846  -0.049  1.00 21.96  ? 188  LEU C CD2 1 
ATOM   5455  N N   . ALA C 1 191 ? -10.397 67.838  -2.487  1.00 51.66  ? 189  ALA C N   1 
ATOM   5456  C CA  . ALA C 1 191 ? -10.264 68.874  -3.488  1.00 50.85  ? 189  ALA C CA  1 
ATOM   5457  C C   . ALA C 1 191 ? -8.986  68.584  -4.264  1.00 51.49  ? 189  ALA C C   1 
ATOM   5458  O O   . ALA C 1 191 ? -8.013  69.330  -4.202  1.00 52.51  ? 189  ALA C O   1 
ATOM   5459  C CB  . ALA C 1 191 ? -10.201 70.214  -2.826  1.00 105.49 ? 189  ALA C CB  1 
ATOM   5460  N N   . ASP C 1 192 ? -9.017  67.474  -4.990  1.00 34.35  ? 190  ASP C N   1 
ATOM   5461  C CA  . ASP C 1 192 ? -7.899  66.984  -5.786  1.00 35.40  ? 190  ASP C CA  1 
ATOM   5462  C C   . ASP C 1 192 ? -8.583  65.906  -6.575  1.00 34.79  ? 190  ASP C C   1 
ATOM   5463  O O   . ASP C 1 192 ? -8.287  65.666  -7.745  1.00 35.03  ? 190  ASP C O   1 
ATOM   5464  C CB  . ASP C 1 192 ? -6.838  66.350  -4.891  1.00 46.54  ? 190  ASP C CB  1 
ATOM   5465  C CG  . ASP C 1 192 ? -5.500  67.041  -4.991  1.00 49.89  ? 190  ASP C CG  1 
ATOM   5466  O OD1 . ASP C 1 192 ? -4.546  66.594  -4.314  1.00 52.49  ? 190  ASP C OD1 1 
ATOM   5467  O OD2 . ASP C 1 192 ? -5.399  68.031  -5.747  1.00 51.80  ? 190  ASP C OD2 1 
ATOM   5468  N N   . GLY C 1 193 ? -9.508  65.246  -5.891  1.00 39.92  ? 191  GLY C N   1 
ATOM   5469  C CA  . GLY C 1 193 ? -10.288 64.213  -6.524  1.00 42.03  ? 191  GLY C CA  1 
ATOM   5470  C C   . GLY C 1 193 ? -11.288 64.998  -7.338  1.00 41.85  ? 191  GLY C C   1 
ATOM   5471  O O   . GLY C 1 193 ? -11.334 64.885  -8.561  1.00 40.31  ? 191  GLY C O   1 
ATOM   5472  N N   . GLY C 1 194 ? -12.071 65.823  -6.644  1.00 43.24  ? 192  GLY C N   1 
ATOM   5473  C CA  . GLY C 1 194 ? -13.067 66.644  -7.308  1.00 40.45  ? 192  GLY C CA  1 
ATOM   5474  C C   . GLY C 1 194 ? -12.440 67.359  -8.485  1.00 37.72  ? 192  GLY C C   1 
ATOM   5475  O O   . GLY C 1 194 ? -13.061 67.540  -9.533  1.00 37.03  ? 192  GLY C O   1 
ATOM   5476  N N   . VAL C 1 195 ? -11.197 67.776  -8.317  1.00 28.39  ? 193  VAL C N   1 
ATOM   5477  C CA  . VAL C 1 195 ? -10.530 68.435  -9.414  1.00 27.44  ? 193  VAL C CA  1 
ATOM   5478  C C   . VAL C 1 195 ? -10.421 67.354  -10.481 1.00 29.50  ? 193  VAL C C   1 
ATOM   5479  O O   . VAL C 1 195 ? -10.761 67.568  -11.639 1.00 31.05  ? 193  VAL C O   1 
ATOM   5480  C CB  . VAL C 1 195 ? -9.116  68.903  -9.031  1.00 20.00  ? 193  VAL C CB  1 
ATOM   5481  C CG1 . VAL C 1 195 ? -8.637  69.942  -10.022 1.00 15.98  ? 193  VAL C CG1 1 
ATOM   5482  C CG2 . VAL C 1 195 ? -9.109  69.464  -7.617  1.00 21.17  ? 193  VAL C CG2 1 
ATOM   5483  N N   . LYS C 1 196 ? -9.964  66.174  -10.080 1.00 39.39  ? 194  LYS C N   1 
ATOM   5484  C CA  . LYS C 1 196 ? -9.809  65.072  -11.020 1.00 39.42  ? 194  LYS C CA  1 
ATOM   5485  C C   . LYS C 1 196 ? -11.090 64.839  -11.828 1.00 38.71  ? 194  LYS C C   1 
ATOM   5486  O O   . LYS C 1 196 ? -11.054 64.293  -12.923 1.00 39.06  ? 194  LYS C O   1 
ATOM   5487  C CB  . LYS C 1 196 ? -9.416  63.779  -10.282 1.00 30.71  ? 194  LYS C CB  1 
ATOM   5488  C CG  . LYS C 1 196 ? -8.638  62.788  -11.158 1.00 27.45  ? 194  LYS C CG  1 
ATOM   5489  C CD  . LYS C 1 196 ? -8.759  61.340  -10.701 1.00 20.95  ? 194  LYS C CD  1 
ATOM   5490  C CE  . LYS C 1 196 ? -8.072  60.412  -11.695 1.00 19.19  ? 194  LYS C CE  1 
ATOM   5491  N NZ  . LYS C 1 196 ? -8.340  58.962  -11.468 1.00 21.25  ? 194  LYS C NZ  1 
ATOM   5492  N N   . MET C 1 197 ? -12.227 65.257  -11.297 1.00 39.28  ? 195  MET C N   1 
ATOM   5493  C CA  . MET C 1 197 ? -13.477 65.054  -12.008 1.00 40.60  ? 195  MET C CA  1 
ATOM   5494  C C   . MET C 1 197 ? -13.960 66.371  -12.577 1.00 42.10  ? 195  MET C C   1 
ATOM   5495  O O   . MET C 1 197 ? -15.163 66.619  -12.645 1.00 45.62  ? 195  MET C O   1 
ATOM   5496  C CB  . MET C 1 197 ? -14.532 64.484  -11.062 1.00 43.30  ? 195  MET C CB  1 
ATOM   5497  C CG  . MET C 1 197 ? -14.021 63.336  -10.221 1.00 44.60  ? 195  MET C CG  1 
ATOM   5498  S SD  . MET C 1 197 ? -13.275 62.045  -11.223 1.00 45.37  ? 195  MET C SD  1 
ATOM   5499  C CE  . MET C 1 197 ? -14.549 60.823  -11.076 1.00 47.95  ? 195  MET C CE  1 
ATOM   5500  N N   . GLY C 1 198 ? -13.015 67.210  -12.989 1.00 45.93  ? 196  GLY C N   1 
ATOM   5501  C CA  . GLY C 1 198 ? -13.354 68.508  -13.543 1.00 45.15  ? 196  GLY C CA  1 
ATOM   5502  C C   . GLY C 1 198 ? -13.124 69.579  -12.500 1.00 46.72  ? 196  GLY C C   1 
ATOM   5503  O O   . GLY C 1 198 ? -11.987 69.847  -12.141 1.00 49.81  ? 196  GLY C O   1 
ATOM   5504  N N   . LEU C 1 199 ? -14.206 70.178  -12.012 1.00 38.04  ? 197  LEU C N   1 
ATOM   5505  C CA  . LEU C 1 199 ? -14.158 71.221  -10.989 1.00 39.40  ? 197  LEU C CA  1 
ATOM   5506  C C   . LEU C 1 199 ? -12.950 72.162  -10.946 1.00 41.77  ? 197  LEU C C   1 
ATOM   5507  O O   . LEU C 1 199 ? -11.801 71.761  -11.144 1.00 39.69  ? 197  LEU C O   1 
ATOM   5508  C CB  . LEU C 1 199 ? -14.324 70.596  -9.604  1.00 43.41  ? 197  LEU C CB  1 
ATOM   5509  C CG  . LEU C 1 199 ? -15.655 69.893  -9.344  1.00 45.50  ? 197  LEU C CG  1 
ATOM   5510  C CD1 . LEU C 1 199 ? -15.711 69.387  -7.913  1.00 47.08  ? 197  LEU C CD1 1 
ATOM   5511  C CD2 . LEU C 1 199 ? -16.789 70.861  -9.590  1.00 49.06  ? 197  LEU C CD2 1 
ATOM   5512  N N   . PRO C 1 200 ? -13.210 73.449  -10.682 1.00 50.65  ? 198  PRO C N   1 
ATOM   5513  C CA  . PRO C 1 200 ? -12.157 74.461  -10.596 1.00 50.55  ? 198  PRO C CA  1 
ATOM   5514  C C   . PRO C 1 200 ? -11.530 74.319  -9.205  1.00 50.63  ? 198  PRO C C   1 
ATOM   5515  O O   . PRO C 1 200 ? -12.234 74.144  -8.200  1.00 48.30  ? 198  PRO C O   1 
ATOM   5516  C CB  . PRO C 1 200 ? -12.925 75.760  -10.783 1.00 84.15  ? 198  PRO C CB  1 
ATOM   5517  C CG  . PRO C 1 200 ? -14.205 75.466  -10.082 1.00 85.98  ? 198  PRO C CG  1 
ATOM   5518  C CD  . PRO C 1 200 ? -14.542 74.060  -10.531 1.00 85.21  ? 198  PRO C CD  1 
ATOM   5519  N N   . ARG C 1 201 ? -10.206 74.374  -9.159  1.00 43.56  ? 199  ARG C N   1 
ATOM   5520  C CA  . ARG C 1 201 ? -9.474  74.206  -7.914  1.00 45.04  ? 199  ARG C CA  1 
ATOM   5521  C C   . ARG C 1 201 ? -10.117 74.853  -6.709  1.00 44.21  ? 199  ARG C C   1 
ATOM   5522  O O   . ARG C 1 201 ? -10.391 74.188  -5.711  1.00 43.97  ? 199  ARG C O   1 
ATOM   5523  C CB  . ARG C 1 201 ? -8.052  74.740  -8.043  1.00 57.22  ? 199  ARG C CB  1 
ATOM   5524  C CG  . ARG C 1 201 ? -7.227  74.401  -6.841  1.00 60.09  ? 199  ARG C CG  1 
ATOM   5525  C CD  . ARG C 1 201 ? -7.109  72.907  -6.724  1.00 62.88  ? 199  ARG C CD  1 
ATOM   5526  N NE  . ARG C 1 201 ? -6.642  72.511  -5.405  1.00 68.69  ? 199  ARG C NE  1 
ATOM   5527  C CZ  . ARG C 1 201 ? -5.984  71.384  -5.163  1.00 71.86  ? 199  ARG C CZ  1 
ATOM   5528  N NH1 . ARG C 1 201 ? -5.720  70.548  -6.163  1.00 71.76  ? 199  ARG C NH1 1 
ATOM   5529  N NH2 . ARG C 1 201 ? -5.585  71.099  -3.930  1.00 71.93  ? 199  ARG C NH2 1 
ATOM   5530  N N   . ARG C 1 202 ? -10.345 76.156  -6.795  1.00 35.10  ? 200  ARG C N   1 
ATOM   5531  C CA  . ARG C 1 202 ? -10.934 76.862  -5.680  1.00 35.50  ? 200  ARG C CA  1 
ATOM   5532  C C   . ARG C 1 202 ? -12.204 76.187  -5.235  1.00 31.67  ? 200  ARG C C   1 
ATOM   5533  O O   . ARG C 1 202 ? -12.197 75.467  -4.247  1.00 30.79  ? 200  ARG C O   1 
ATOM   5534  C CB  . ARG C 1 202 ? -11.165 78.325  -6.041  1.00 93.72  ? 200  ARG C CB  1 
ATOM   5535  C CG  . ARG C 1 202 ? -9.947  79.149  -5.699  1.00 103.83 ? 200  ARG C CG  1 
ATOM   5536  C CD  . ARG C 1 202 ? -9.774  80.366  -6.556  1.00 113.39 ? 200  ARG C CD  1 
ATOM   5537  N NE  . ARG C 1 202 ? -8.363  80.476  -6.903  1.00 120.92 ? 200  ARG C NE  1 
ATOM   5538  C CZ  . ARG C 1 202 ? -7.866  81.341  -7.776  1.00 124.49 ? 200  ARG C CZ  1 
ATOM   5539  N NH1 . ARG C 1 202 ? -8.664  82.196  -8.399  1.00 125.60 ? 200  ARG C NH1 1 
ATOM   5540  N NH2 . ARG C 1 202 ? -6.570  81.329  -8.044  1.00 125.83 ? 200  ARG C NH2 1 
ATOM   5541  N N   . LEU C 1 203 ? -13.279 76.394  -5.978  1.00 45.74  ? 201  LEU C N   1 
ATOM   5542  C CA  . LEU C 1 203 ? -14.581 75.804  -5.674  1.00 45.32  ? 201  LEU C CA  1 
ATOM   5543  C C   . LEU C 1 203 ? -14.529 74.409  -5.053  1.00 44.15  ? 201  LEU C C   1 
ATOM   5544  O O   . LEU C 1 203 ? -15.314 74.085  -4.153  1.00 42.52  ? 201  LEU C O   1 
ATOM   5545  C CB  . LEU C 1 203 ? -15.401 75.732  -6.952  1.00 58.33  ? 201  LEU C CB  1 
ATOM   5546  C CG  . LEU C 1 203 ? -16.693 74.938  -6.838  1.00 58.72  ? 201  LEU C CG  1 
ATOM   5547  C CD1 . LEU C 1 203 ? -17.674 75.685  -5.943  1.00 56.68  ? 201  LEU C CD1 1 
ATOM   5548  C CD2 . LEU C 1 203 ? -17.256 74.719  -8.232  1.00 58.06  ? 201  LEU C CD2 1 
ATOM   5549  N N   . ALA C 1 204 ? -13.624 73.582  -5.570  1.00 42.44  ? 202  ALA C N   1 
ATOM   5550  C CA  . ALA C 1 204 ? -13.433 72.216  -5.089  1.00 40.03  ? 202  ALA C CA  1 
ATOM   5551  C C   . ALA C 1 204 ? -13.047 72.220  -3.607  1.00 39.50  ? 202  ALA C C   1 
ATOM   5552  O O   . ALA C 1 204 ? -13.753 71.654  -2.763  1.00 38.11  ? 202  ALA C O   1 
ATOM   5553  C CB  . ALA C 1 204 ? -12.348 71.552  -5.906  1.00 21.30  ? 202  ALA C CB  1 
ATOM   5554  N N   . VAL C 1 205 ? -11.912 72.859  -3.319  1.00 33.64  ? 203  VAL C N   1 
ATOM   5555  C CA  . VAL C 1 205 ? -11.374 73.008  -1.961  1.00 35.04  ? 203  VAL C CA  1 
ATOM   5556  C C   . VAL C 1 205 ? -12.506 73.412  -1.044  1.00 36.66  ? 203  VAL C C   1 
ATOM   5557  O O   . VAL C 1 205 ? -12.775 72.821  0.003   1.00 37.88  ? 203  VAL C O   1 
ATOM   5558  C CB  . VAL C 1 205 ? -10.358 74.168  -1.892  1.00 34.37  ? 203  VAL C CB  1 
ATOM   5559  C CG1 . VAL C 1 205 ? -9.946  74.396  -0.455  1.00 33.42  ? 203  VAL C CG1 1 
ATOM   5560  C CG2 . VAL C 1 205 ? -9.152  73.894  -2.787  1.00 38.32  ? 203  VAL C CG2 1 
ATOM   5561  N N   . ARG C 1 206 ? -13.140 74.468  -1.508  1.00 50.18  ? 204  ARG C N   1 
ATOM   5562  C CA  . ARG C 1 206 ? -14.246 75.160  -0.898  1.00 54.46  ? 204  ARG C CA  1 
ATOM   5563  C C   . ARG C 1 206 ? -15.460 74.328  -0.507  1.00 52.26  ? 204  ARG C C   1 
ATOM   5564  O O   . ARG C 1 206 ? -15.983 74.450  0.605   1.00 49.90  ? 204  ARG C O   1 
ATOM   5565  C CB  . ARG C 1 206 ? -14.618 76.249  -1.875  1.00 106.91 ? 204  ARG C CB  1 
ATOM   5566  C CG  . ARG C 1 206 ? -13.370 76.954  -2.428  1.00 118.82 ? 204  ARG C CG  1 
ATOM   5567  C CD  . ARG C 1 206 ? -12.246 77.170  -1.369  1.00 129.77 ? 204  ARG C CD  1 
ATOM   5568  N NE  . ARG C 1 206 ? -11.022 77.685  -1.992  1.00 140.83 ? 204  ARG C NE  1 
ATOM   5569  C CZ  . ARG C 1 206 ? -9.872  77.963  -1.372  1.00 143.87 ? 204  ARG C CZ  1 
ATOM   5570  N NH1 . ARG C 1 206 ? -9.729  77.784  -0.063  1.00 145.60 ? 204  ARG C NH1 1 
ATOM   5571  N NH2 . ARG C 1 206 ? -8.854  78.437  -2.082  1.00 145.36 ? 204  ARG C NH2 1 
ATOM   5572  N N   . LEU C 1 207 ? -15.911 73.491  -1.432  1.00 54.54  ? 205  LEU C N   1 
ATOM   5573  C CA  . LEU C 1 207 ? -17.054 72.625  -1.193  1.00 50.63  ? 205  LEU C CA  1 
ATOM   5574  C C   . LEU C 1 207 ? -16.689 71.559  -0.164  1.00 49.07  ? 205  LEU C C   1 
ATOM   5575  O O   . LEU C 1 207 ? -17.431 71.326  0.798   1.00 44.80  ? 205  LEU C O   1 
ATOM   5576  C CB  . LEU C 1 207 ? -17.468 71.969  -2.503  1.00 39.29  ? 205  LEU C CB  1 
ATOM   5577  C CG  . LEU C 1 207 ? -18.074 72.917  -3.535  1.00 34.68  ? 205  LEU C CG  1 
ATOM   5578  C CD1 . LEU C 1 207 ? -17.742 72.444  -4.932  1.00 32.46  ? 205  LEU C CD1 1 
ATOM   5579  C CD2 . LEU C 1 207 ? -19.570 72.981  -3.328  1.00 33.97  ? 205  LEU C CD2 1 
ATOM   5580  N N   . GLY C 1 208 ? -15.543 70.914  -0.380  1.00 45.63  ? 206  GLY C N   1 
ATOM   5581  C CA  . GLY C 1 208 ? -15.080 69.895  0.545   1.00 45.78  ? 206  GLY C CA  1 
ATOM   5582  C C   . GLY C 1 208 ? -15.157 70.459  1.945   1.00 44.12  ? 206  GLY C C   1 
ATOM   5583  O O   . GLY C 1 208 ? -15.788 69.893  2.839   1.00 43.08  ? 206  GLY C O   1 
ATOM   5584  N N   . ALA C 1 209 ? -14.519 71.605  2.126   1.00 32.45  ? 207  ALA C N   1 
ATOM   5585  C CA  . ALA C 1 209 ? -14.533 72.274  3.410   1.00 33.70  ? 207  ALA C CA  1 
ATOM   5586  C C   . ALA C 1 209 ? -15.966 72.364  3.940   1.00 34.24  ? 207  ALA C C   1 
ATOM   5587  O O   . ALA C 1 209 ? -16.274 71.868  5.034   1.00 33.00  ? 207  ALA C O   1 
ATOM   5588  C CB  . ALA C 1 209 ? -13.947 73.660  3.261   1.00 36.83  ? 207  ALA C CB  1 
ATOM   5589  N N   . GLN C 1 210 ? -16.841 72.984  3.152   1.00 39.80  ? 208  GLN C N   1 
ATOM   5590  C CA  . GLN C 1 210 ? -18.232 73.152  3.554   1.00 40.85  ? 208  GLN C CA  1 
ATOM   5591  C C   . GLN C 1 210 ? -18.867 71.861  4.060   1.00 39.39  ? 208  GLN C C   1 
ATOM   5592  O O   . GLN C 1 210 ? -19.662 71.874  4.997   1.00 39.83  ? 208  GLN C O   1 
ATOM   5593  C CB  . GLN C 1 210 ? -19.074 73.713  2.400   1.00 40.43  ? 208  GLN C CB  1 
ATOM   5594  C CG  . GLN C 1 210 ? -20.556 73.892  2.766   1.00 40.36  ? 208  GLN C CG  1 
ATOM   5595  C CD  . GLN C 1 210 ? -20.720 74.767  3.988   1.00 38.42  ? 208  GLN C CD  1 
ATOM   5596  O OE1 . GLN C 1 210 ? -21.278 74.322  4.966   1.00 39.83  ? 208  GLN C OE1 1 
ATOM   5597  N NE2 . GLN C 1 210 ? -20.242 76.010  3.934   1.00 34.33  ? 208  GLN C NE2 1 
ATOM   5598  N N   . ALA C 1 211 ? -18.525 70.744  3.442   1.00 43.06  ? 209  ALA C N   1 
ATOM   5599  C CA  . ALA C 1 211 ? -19.092 69.489  3.882   1.00 44.36  ? 209  ALA C CA  1 
ATOM   5600  C C   . ALA C 1 211 ? -18.605 69.156  5.299   1.00 44.81  ? 209  ALA C C   1 
ATOM   5601  O O   . ALA C 1 211 ? -19.413 68.988  6.219   1.00 43.94  ? 209  ALA C O   1 
ATOM   5602  C CB  . ALA C 1 211 ? -18.719 68.393  2.919   1.00 42.39  ? 209  ALA C CB  1 
ATOM   5603  N N   . LEU C 1 212 ? -17.289 69.067  5.481   1.00 32.32  ? 210  LEU C N   1 
ATOM   5604  C CA  . LEU C 1 212 ? -16.737 68.750  6.794   1.00 31.99  ? 210  LEU C CA  1 
ATOM   5605  C C   . LEU C 1 212 ? -17.343 69.687  7.818   1.00 32.24  ? 210  LEU C C   1 
ATOM   5606  O O   . LEU C 1 212 ? -17.811 69.270  8.887   1.00 30.55  ? 210  LEU C O   1 
ATOM   5607  C CB  . LEU C 1 212 ? -15.231 68.929  6.773   1.00 41.07  ? 210  LEU C CB  1 
ATOM   5608  C CG  . LEU C 1 212 ? -14.623 68.084  5.665   1.00 44.99  ? 210  LEU C CG  1 
ATOM   5609  C CD1 . LEU C 1 212 ? -13.137 68.347  5.572   1.00 44.28  ? 210  LEU C CD1 1 
ATOM   5610  C CD2 . LEU C 1 212 ? -14.915 66.615  5.943   1.00 47.61  ? 210  LEU C CD2 1 
ATOM   5611  N N   . LEU C 1 213 ? -17.315 70.967  7.475   1.00 38.09  ? 211  LEU C N   1 
ATOM   5612  C CA  . LEU C 1 213 ? -17.872 71.983  8.328   1.00 37.06  ? 211  LEU C CA  1 
ATOM   5613  C C   . LEU C 1 213 ? -19.264 71.486  8.688   1.00 35.13  ? 211  LEU C C   1 
ATOM   5614  O O   . LEU C 1 213 ? -19.583 71.280  9.860   1.00 34.80  ? 211  LEU C O   1 
ATOM   5615  C CB  . LEU C 1 213 ? -17.972 73.291  7.553   1.00 42.53  ? 211  LEU C CB  1 
ATOM   5616  C CG  . LEU C 1 213 ? -18.319 74.556  8.338   1.00 46.35  ? 211  LEU C CG  1 
ATOM   5617  C CD1 . LEU C 1 213 ? -19.610 74.371  9.115   1.00 42.23  ? 211  LEU C CD1 1 
ATOM   5618  C CD2 . LEU C 1 213 ? -17.179 74.870  9.279   1.00 47.43  ? 211  LEU C CD2 1 
ATOM   5619  N N   . GLY C 1 214 ? -20.076 71.276  7.655   1.00 24.12  ? 212  GLY C N   1 
ATOM   5620  C CA  . GLY C 1 214 ? -21.445 70.820  7.841   1.00 24.48  ? 212  GLY C CA  1 
ATOM   5621  C C   . GLY C 1 214 ? -21.578 69.513  8.592   1.00 24.78  ? 212  GLY C C   1 
ATOM   5622  O O   . GLY C 1 214 ? -22.257 69.441  9.624   1.00 24.38  ? 212  GLY C O   1 
ATOM   5623  N N   . ALA C 1 215 ? -20.928 68.476  8.073   1.00 35.41  ? 213  ALA C N   1 
ATOM   5624  C CA  . ALA C 1 215 ? -20.956 67.154  8.696   1.00 37.60  ? 213  ALA C CA  1 
ATOM   5625  C C   . ALA C 1 215 ? -20.686 67.250  10.202  1.00 38.41  ? 213  ALA C C   1 
ATOM   5626  O O   . ALA C 1 215 ? -21.427 66.688  11.019  1.00 35.04  ? 213  ALA C O   1 
ATOM   5627  C CB  . ALA C 1 215 ? -19.915 66.251  8.032   1.00 19.42  ? 213  ALA C CB  1 
ATOM   5628  N N   . ALA C 1 216 ? -19.619 67.969  10.551  1.00 38.16  ? 214  ALA C N   1 
ATOM   5629  C CA  . ALA C 1 216 ? -19.228 68.156  11.939  1.00 37.28  ? 214  ALA C CA  1 
ATOM   5630  C C   . ALA C 1 216 ? -20.376 68.755  12.747  1.00 38.60  ? 214  ALA C C   1 
ATOM   5631  O O   . ALA C 1 216 ? -20.928 68.112  13.647  1.00 36.46  ? 214  ALA C O   1 
ATOM   5632  C CB  . ALA C 1 216 ? -18.013 69.058  12.005  1.00 25.68  ? 214  ALA C CB  1 
ATOM   5633  N N   . LYS C 1 217 ? -20.727 69.993  12.415  1.00 30.57  ? 215  LYS C N   1 
ATOM   5634  C CA  . LYS C 1 217 ? -21.804 70.696  13.096  1.00 34.06  ? 215  LYS C CA  1 
ATOM   5635  C C   . LYS C 1 217 ? -23.002 69.759  13.177  1.00 34.75  ? 215  LYS C C   1 
ATOM   5636  O O   . LYS C 1 217 ? -23.684 69.658  14.207  1.00 31.95  ? 215  LYS C O   1 
ATOM   5637  C CB  . LYS C 1 217 ? -22.167 71.956  12.311  1.00 56.05  ? 215  LYS C CB  1 
ATOM   5638  C CG  . LYS C 1 217 ? -23.146 72.846  13.029  1.00 60.66  ? 215  LYS C CG  1 
ATOM   5639  C CD  . LYS C 1 217 ? -23.267 74.199  12.371  1.00 65.42  ? 215  LYS C CD  1 
ATOM   5640  C CE  . LYS C 1 217 ? -24.115 75.125  13.231  1.00 69.62  ? 215  LYS C CE  1 
ATOM   5641  N NZ  . LYS C 1 217 ? -24.369 76.427  12.562  1.00 73.35  ? 215  LYS C NZ  1 
ATOM   5642  N N   . MET C 1 218 ? -23.230 69.075  12.061  1.00 42.88  ? 216  MET C N   1 
ATOM   5643  C CA  . MET C 1 218 ? -24.303 68.102  11.919  1.00 45.47  ? 216  MET C CA  1 
ATOM   5644  C C   . MET C 1 218 ? -24.200 67.123  13.070  1.00 46.78  ? 216  MET C C   1 
ATOM   5645  O O   . MET C 1 218 ? -25.152 66.883  13.810  1.00 43.68  ? 216  MET C O   1 
ATOM   5646  C CB  . MET C 1 218 ? -24.117 67.331  10.609  1.00 44.83  ? 216  MET C CB  1 
ATOM   5647  C CG  . MET C 1 218 ? -25.082 67.671  9.504   1.00 44.36  ? 216  MET C CG  1 
ATOM   5648  S SD  . MET C 1 218 ? -26.202 66.289  9.204   1.00 49.20  ? 216  MET C SD  1 
ATOM   5649  C CE  . MET C 1 218 ? -27.227 66.368  10.692  1.00 44.62  ? 216  MET C CE  1 
ATOM   5650  N N   . LEU C 1 219 ? -23.012 66.555  13.205  1.00 44.86  ? 217  LEU C N   1 
ATOM   5651  C CA  . LEU C 1 219 ? -22.765 65.578  14.237  1.00 48.29  ? 217  LEU C CA  1 
ATOM   5652  C C   . LEU C 1 219 ? -22.937 66.147  15.629  1.00 49.89  ? 217  LEU C C   1 
ATOM   5653  O O   . LEU C 1 219 ? -23.618 65.572  16.474  1.00 51.61  ? 217  LEU C O   1 
ATOM   5654  C CB  . LEU C 1 219 ? -21.356 65.022  14.094  1.00 64.62  ? 217  LEU C CB  1 
ATOM   5655  C CG  . LEU C 1 219 ? -21.128 63.807  14.992  1.00 67.84  ? 217  LEU C CG  1 
ATOM   5656  C CD1 . LEU C 1 219 ? -22.240 62.777  14.756  1.00 68.49  ? 217  LEU C CD1 1 
ATOM   5657  C CD2 . LEU C 1 219 ? -19.767 63.207  14.701  1.00 65.98  ? 217  LEU C CD2 1 
ATOM   5658  N N   . LEU C 1 220 ? -22.314 67.289  15.856  1.00 58.52  ? 218  LEU C N   1 
ATOM   5659  C CA  . LEU C 1 220 ? -22.360 67.945  17.148  1.00 59.82  ? 218  LEU C CA  1 
ATOM   5660  C C   . LEU C 1 220 ? -23.762 68.224  17.692  1.00 60.37  ? 218  LEU C C   1 
ATOM   5661  O O   . LEU C 1 220 ? -24.107 67.768  18.780  1.00 60.27  ? 218  LEU C O   1 
ATOM   5662  C CB  . LEU C 1 220 ? -21.536 69.218  17.048  1.00 65.40  ? 218  LEU C CB  1 
ATOM   5663  C CG  . LEU C 1 220 ? -20.116 68.822  16.614  1.00 63.89  ? 218  LEU C CG  1 
ATOM   5664  C CD1 . LEU C 1 220 ? -19.342 69.993  16.013  1.00 63.87  ? 218  LEU C CD1 1 
ATOM   5665  C CD2 . LEU C 1 220 ? -19.399 68.242  17.820  1.00 63.82  ? 218  LEU C CD2 1 
ATOM   5666  N N   . HIS C 1 221 ? -24.576 68.959  16.946  1.00 64.14  ? 219  HIS C N   1 
ATOM   5667  C CA  . HIS C 1 221 ? -25.924 69.262  17.412  1.00 66.77  ? 219  HIS C CA  1 
ATOM   5668  C C   . HIS C 1 221 ? -26.807 68.026  17.504  1.00 66.85  ? 219  HIS C C   1 
ATOM   5669  O O   . HIS C 1 221 ? -27.856 68.044  18.147  1.00 67.18  ? 219  HIS C O   1 
ATOM   5670  C CB  . HIS C 1 221 ? -26.579 70.278  16.485  1.00 77.39  ? 219  HIS C CB  1 
ATOM   5671  C CG  . HIS C 1 221 ? -25.832 71.566  16.398  1.00 77.83  ? 219  HIS C CG  1 
ATOM   5672  N ND1 . HIS C 1 221 ? -24.487 71.621  16.100  1.00 80.36  ? 219  HIS C ND1 1 
ATOM   5673  C CD2 . HIS C 1 221 ? -26.235 72.846  16.571  1.00 77.67  ? 219  HIS C CD2 1 
ATOM   5674  C CE1 . HIS C 1 221 ? -24.093 72.882  16.092  1.00 82.16  ? 219  HIS C CE1 1 
ATOM   5675  N NE2 . HIS C 1 221 ? -25.135 73.645  16.374  1.00 81.13  ? 219  HIS C NE2 1 
ATOM   5676  N N   . SER C 1 222 ? -26.375 66.949  16.867  1.00 53.33  ? 220  SER C N   1 
ATOM   5677  C CA  . SER C 1 222 ? -27.139 65.715  16.858  1.00 55.00  ? 220  SER C CA  1 
ATOM   5678  C C   . SER C 1 222 ? -26.954 64.865  18.122  1.00 56.44  ? 220  SER C C   1 
ATOM   5679  O O   . SER C 1 222 ? -26.064 65.112  18.937  1.00 57.08  ? 220  SER C O   1 
ATOM   5680  C CB  . SER C 1 222 ? -26.748 64.914  15.615  1.00 71.54  ? 220  SER C CB  1 
ATOM   5681  O OG  . SER C 1 222 ? -27.396 63.660  15.580  1.00 74.25  ? 220  SER C OG  1 
ATOM   5682  N N   . GLU C 1 223 ? -27.829 63.882  18.289  1.00 82.27  ? 221  GLU C N   1 
ATOM   5683  C CA  . GLU C 1 223 ? -27.759 62.956  19.412  1.00 83.97  ? 221  GLU C CA  1 
ATOM   5684  C C   . GLU C 1 223 ? -27.446 61.630  18.730  1.00 83.55  ? 221  GLU C C   1 
ATOM   5685  O O   . GLU C 1 223 ? -27.211 60.602  19.368  1.00 84.69  ? 221  GLU C O   1 
ATOM   5686  C CB  . GLU C 1 223 ? -29.110 62.861  20.117  1.00 103.64 ? 221  GLU C CB  1 
ATOM   5687  C CG  . GLU C 1 223 ? -30.225 62.361  19.214  1.00 111.74 ? 221  GLU C CG  1 
ATOM   5688  C CD  . GLU C 1 223 ? -31.535 62.146  19.947  1.00 116.40 ? 221  GLU C CD  1 
ATOM   5689  O OE1 . GLU C 1 223 ? -32.009 63.088  20.614  1.00 120.04 ? 221  GLU C OE1 1 
ATOM   5690  O OE2 . GLU C 1 223 ? -32.099 61.036  19.850  1.00 120.33 ? 221  GLU C OE2 1 
ATOM   5691  N N   . GLN C 1 224 ? -27.448 61.688  17.403  1.00 71.68  ? 222  GLN C N   1 
ATOM   5692  C CA  . GLN C 1 224 ? -27.194 60.537  16.559  1.00 67.69  ? 222  GLN C CA  1 
ATOM   5693  C C   . GLN C 1 224 ? -25.760 60.061  16.609  1.00 62.34  ? 222  GLN C C   1 
ATOM   5694  O O   . GLN C 1 224 ? -24.842 60.790  16.986  1.00 61.31  ? 222  GLN C O   1 
ATOM   5695  C CB  . GLN C 1 224 ? -27.546 60.860  15.104  1.00 77.66  ? 222  GLN C CB  1 
ATOM   5696  C CG  . GLN C 1 224 ? -29.005 61.204  14.857  1.00 81.74  ? 222  GLN C CG  1 
ATOM   5697  C CD  . GLN C 1 224 ? -29.927 60.059  15.199  1.00 84.06  ? 222  GLN C CD  1 
ATOM   5698  O OE1 . GLN C 1 224 ? -30.032 59.657  16.358  1.00 86.54  ? 222  GLN C OE1 1 
ATOM   5699  N NE2 . GLN C 1 224 ? -30.597 59.519  14.190  1.00 84.46  ? 222  GLN C NE2 1 
ATOM   5700  N N   . HIS C 1 225 ? -25.597 58.814  16.199  1.00 48.93  ? 223  HIS C N   1 
ATOM   5701  C CA  . HIS C 1 225 ? -24.316 58.156  16.144  1.00 44.64  ? 223  HIS C CA  1 
ATOM   5702  C C   . HIS C 1 225 ? -23.832 58.330  14.723  1.00 43.15  ? 223  HIS C C   1 
ATOM   5703  O O   . HIS C 1 225 ? -24.578 58.085  13.779  1.00 44.45  ? 223  HIS C O   1 
ATOM   5704  C CB  . HIS C 1 225 ? -24.487 56.674  16.438  1.00 40.30  ? 223  HIS C CB  1 
ATOM   5705  C CG  . HIS C 1 225 ? -23.205 55.920  16.432  1.00 35.21  ? 223  HIS C CG  1 
ATOM   5706  N ND1 . HIS C 1 225 ? -22.213 56.159  15.506  1.00 35.82  ? 223  HIS C ND1 1 
ATOM   5707  C CD2 . HIS C 1 225 ? -22.740 54.945  17.245  1.00 31.88  ? 223  HIS C CD2 1 
ATOM   5708  C CE1 . HIS C 1 225 ? -21.188 55.365  15.752  1.00 34.97  ? 223  HIS C CE1 1 
ATOM   5709  N NE2 . HIS C 1 225 ? -21.483 54.618  16.802  1.00 33.90  ? 223  HIS C NE2 1 
ATOM   5710  N N   . PRO C 1 226 ? -22.575 58.744  14.548  1.00 44.45  ? 224  PRO C N   1 
ATOM   5711  C CA  . PRO C 1 226 ? -21.962 58.961  13.237  1.00 45.05  ? 224  PRO C CA  1 
ATOM   5712  C C   . PRO C 1 226 ? -22.379 57.908  12.229  1.00 45.39  ? 224  PRO C C   1 
ATOM   5713  O O   . PRO C 1 226 ? -22.497 58.185  11.034  1.00 44.24  ? 224  PRO C O   1 
ATOM   5714  C CB  . PRO C 1 226 ? -20.475 58.894  13.545  1.00 28.66  ? 224  PRO C CB  1 
ATOM   5715  C CG  . PRO C 1 226 ? -20.413 59.513  14.872  1.00 30.12  ? 224  PRO C CG  1 
ATOM   5716  C CD  . PRO C 1 226 ? -21.565 58.853  15.608  1.00 29.78  ? 224  PRO C CD  1 
ATOM   5717  N N   . GLY C 1 227 ? -22.586 56.695  12.725  1.00 39.82  ? 225  GLY C N   1 
ATOM   5718  C CA  . GLY C 1 227 ? -22.994 55.607  11.865  1.00 42.27  ? 225  GLY C CA  1 
ATOM   5719  C C   . GLY C 1 227 ? -24.406 55.811  11.373  1.00 44.21  ? 225  GLY C C   1 
ATOM   5720  O O   . GLY C 1 227 ? -24.663 55.727  10.176  1.00 44.22  ? 225  GLY C O   1 
ATOM   5721  N N   . GLN C 1 228 ? -25.325 56.089  12.295  1.00 58.21  ? 226  GLN C N   1 
ATOM   5722  C CA  . GLN C 1 228 ? -26.725 56.298  11.934  1.00 59.57  ? 226  GLN C CA  1 
ATOM   5723  C C   . GLN C 1 228 ? -26.841 57.460  10.965  1.00 57.29  ? 226  GLN C C   1 
ATOM   5724  O O   . GLN C 1 228 ? -27.810 57.568  10.227  1.00 58.70  ? 226  GLN C O   1 
ATOM   5725  C CB  . GLN C 1 228 ? -27.574 56.578  13.178  1.00 74.89  ? 226  GLN C CB  1 
ATOM   5726  C CG  . GLN C 1 228 ? -29.075 56.409  12.948  1.00 78.62  ? 226  GLN C CG  1 
ATOM   5727  C CD  . GLN C 1 228 ? -29.472 54.965  12.658  1.00 83.42  ? 226  GLN C CD  1 
ATOM   5728  O OE1 . GLN C 1 228 ? -29.528 54.124  13.562  1.00 83.57  ? 226  GLN C OE1 1 
ATOM   5729  N NE2 . GLN C 1 228 ? -29.740 54.671  11.389  1.00 85.09  ? 226  GLN C NE2 1 
ATOM   5730  N N   . LEU C 1 229 ? -25.846 58.335  10.976  1.00 46.07  ? 227  LEU C N   1 
ATOM   5731  C CA  . LEU C 1 229 ? -25.844 59.469  10.074  1.00 42.78  ? 227  LEU C CA  1 
ATOM   5732  C C   . LEU C 1 229 ? -25.250 59.029  8.737   1.00 43.61  ? 227  LEU C C   1 
ATOM   5733  O O   . LEU C 1 229 ? -25.694 59.464  7.673   1.00 43.64  ? 227  LEU C O   1 
ATOM   5734  C CB  . LEU C 1 229 ? -25.044 60.616  10.682  1.00 34.36  ? 227  LEU C CB  1 
ATOM   5735  C CG  . LEU C 1 229 ? -25.618 61.114  12.014  1.00 30.58  ? 227  LEU C CG  1 
ATOM   5736  C CD1 . LEU C 1 229 ? -24.834 62.319  12.505  1.00 29.75  ? 227  LEU C CD1 1 
ATOM   5737  C CD2 . LEU C 1 229 ? -27.078 61.483  11.834  1.00 29.03  ? 227  LEU C CD2 1 
ATOM   5738  N N   . LYS C 1 230 ? -24.245 58.160  8.789   1.00 40.87  ? 228  LYS C N   1 
ATOM   5739  C CA  . LYS C 1 230 ? -23.644 57.644  7.564   1.00 40.30  ? 228  LYS C CA  1 
ATOM   5740  C C   . LYS C 1 230 ? -24.773 56.927  6.836   1.00 41.52  ? 228  LYS C C   1 
ATOM   5741  O O   . LYS C 1 230 ? -25.027 57.162  5.655   1.00 40.73  ? 228  LYS C O   1 
ATOM   5742  C CB  . LYS C 1 230 ? -22.540 56.642  7.883   1.00 51.20  ? 228  LYS C CB  1 
ATOM   5743  C CG  . LYS C 1 230 ? -21.830 56.113  6.651   1.00 48.73  ? 228  LYS C CG  1 
ATOM   5744  C CD  . LYS C 1 230 ? -20.998 54.875  6.964   1.00 47.47  ? 228  LYS C CD  1 
ATOM   5745  C CE  . LYS C 1 230 ? -21.784 53.575  6.752   1.00 46.50  ? 228  LYS C CE  1 
ATOM   5746  N NZ  . LYS C 1 230 ? -23.105 53.532  7.451   1.00 38.76  ? 228  LYS C NZ  1 
ATOM   5747  N N   . ASP C 1 231 ? -25.440 56.041  7.567   1.00 43.70  ? 229  ASP C N   1 
ATOM   5748  C CA  . ASP C 1 231 ? -26.564 55.295  7.042   1.00 45.61  ? 229  ASP C CA  1 
ATOM   5749  C C   . ASP C 1 231 ? -27.456 56.311  6.369   1.00 47.85  ? 229  ASP C C   1 
ATOM   5750  O O   . ASP C 1 231 ? -27.482 56.413  5.146   1.00 52.05  ? 229  ASP C O   1 
ATOM   5751  C CB  . ASP C 1 231 ? -27.320 54.625  8.183   1.00 62.86  ? 229  ASP C CB  1 
ATOM   5752  C CG  . ASP C 1 231 ? -26.516 53.521  8.842   1.00 66.64  ? 229  ASP C CG  1 
ATOM   5753  O OD1 . ASP C 1 231 ? -25.270 53.593  8.787   1.00 67.46  ? 229  ASP C OD1 1 
ATOM   5754  O OD2 . ASP C 1 231 ? -27.123 52.589  9.420   1.00 66.69  ? 229  ASP C OD2 1 
ATOM   5755  N N   . ASN C 1 232 ? -28.168 57.074  7.187   1.00 50.80  ? 230  ASN C N   1 
ATOM   5756  C CA  . ASN C 1 232 ? -29.074 58.125  6.726   1.00 49.93  ? 230  ASN C CA  1 
ATOM   5757  C C   . ASN C 1 232 ? -28.703 58.778  5.389   1.00 51.13  ? 230  ASN C C   1 
ATOM   5758  O O   . ASN C 1 232 ? -29.537 58.889  4.499   1.00 52.23  ? 230  ASN C O   1 
ATOM   5759  C CB  . ASN C 1 232 ? -29.155 59.229  7.787   1.00 52.39  ? 230  ASN C CB  1 
ATOM   5760  C CG  . ASN C 1 232 ? -30.002 58.841  8.983   1.00 51.17  ? 230  ASN C CG  1 
ATOM   5761  O OD1 . ASN C 1 232 ? -30.036 57.679  9.393   1.00 51.67  ? 230  ASN C OD1 1 
ATOM   5762  N ND2 . ASN C 1 232 ? -30.680 59.823  9.563   1.00 50.76  ? 230  ASN C ND2 1 
ATOM   5763  N N   . VAL C 1 233 ? -27.451 59.203  5.259   1.00 47.68  ? 231  VAL C N   1 
ATOM   5764  C CA  . VAL C 1 233 ? -26.988 59.896  4.062   1.00 50.96  ? 231  VAL C CA  1 
ATOM   5765  C C   . VAL C 1 233 ? -26.484 59.011  2.916   1.00 51.85  ? 231  VAL C C   1 
ATOM   5766  O O   . VAL C 1 233 ? -25.657 59.434  2.096   1.00 52.82  ? 231  VAL C O   1 
ATOM   5767  C CB  . VAL C 1 233 ? -25.877 60.898  4.445   1.00 109.58 ? 231  VAL C CB  1 
ATOM   5768  C CG1 . VAL C 1 233 ? -25.606 61.848  3.309   1.00 110.99 ? 231  VAL C CG1 1 
ATOM   5769  C CG2 . VAL C 1 233 ? -26.281 61.663  5.689   1.00 111.17 ? 231  VAL C CG2 1 
ATOM   5770  N N   . SER C 1 234 ? -26.990 57.789  2.838   1.00 73.96  ? 232  SER C N   1 
ATOM   5771  C CA  . SER C 1 234 ? -26.559 56.884  1.784   1.00 74.01  ? 232  SER C CA  1 
ATOM   5772  C C   . SER C 1 234 ? -27.768 56.282  1.065   1.00 73.76  ? 232  SER C C   1 
ATOM   5773  O O   . SER C 1 234 ? -28.744 55.899  1.702   1.00 76.41  ? 232  SER C O   1 
ATOM   5774  C CB  . SER C 1 234 ? -25.686 55.784  2.393   1.00 55.57  ? 232  SER C CB  1 
ATOM   5775  O OG  . SER C 1 234 ? -25.017 55.050  1.389   1.00 56.94  ? 232  SER C OG  1 
ATOM   5776  N N   . SER C 1 235 ? -27.706 56.214  -0.263  1.00 63.87  ? 233  SER C N   1 
ATOM   5777  C CA  . SER C 1 235 ? -28.795 55.656  -1.070  1.00 62.56  ? 233  SER C CA  1 
ATOM   5778  C C   . SER C 1 235 ? -28.427 54.259  -1.569  1.00 60.67  ? 233  SER C C   1 
ATOM   5779  O O   . SER C 1 235 ? -27.441 54.100  -2.301  1.00 62.12  ? 233  SER C O   1 
ATOM   5780  C CB  . SER C 1 235 ? -29.072 56.560  -2.268  1.00 116.57 ? 233  SER C CB  1 
ATOM   5781  O OG  . SER C 1 235 ? -29.331 57.886  -1.847  1.00 123.73 ? 233  SER C OG  1 
ATOM   5782  N N   . PRO C 1 236 ? -29.233 53.237  -1.208  1.00 43.11  ? 234  PRO C N   1 
ATOM   5783  C CA  . PRO C 1 236 ? -28.996 51.846  -1.607  1.00 41.11  ? 234  PRO C CA  1 
ATOM   5784  C C   . PRO C 1 236 ? -28.371 51.744  -2.989  1.00 40.66  ? 234  PRO C C   1 
ATOM   5785  O O   . PRO C 1 236 ? -27.410 50.990  -3.208  1.00 38.05  ? 234  PRO C O   1 
ATOM   5786  C CB  . PRO C 1 236 ? -30.388 51.232  -1.554  1.00 42.03  ? 234  PRO C CB  1 
ATOM   5787  C CG  . PRO C 1 236 ? -31.009 51.944  -0.426  1.00 41.80  ? 234  PRO C CG  1 
ATOM   5788  C CD  . PRO C 1 236 ? -30.603 53.386  -0.690  1.00 43.84  ? 234  PRO C CD  1 
ATOM   5789  N N   . GLY C 1 237 ? -28.923 52.518  -3.915  1.00 41.92  ? 235  GLY C N   1 
ATOM   5790  C CA  . GLY C 1 237 ? -28.407 52.518  -5.265  1.00 41.53  ? 235  GLY C CA  1 
ATOM   5791  C C   . GLY C 1 237 ? -26.903 52.631  -5.231  1.00 40.53  ? 235  GLY C C   1 
ATOM   5792  O O   . GLY C 1 237 ? -26.195 51.624  -5.232  1.00 39.11  ? 235  GLY C O   1 
ATOM   5793  N N   . GLY C 1 238 ? -26.413 53.861  -5.176  1.00 53.16  ? 236  GLY C N   1 
ATOM   5794  C CA  . GLY C 1 238 ? -24.980 54.059  -5.153  1.00 52.04  ? 236  GLY C CA  1 
ATOM   5795  C C   . GLY C 1 238 ? -24.590 55.469  -4.796  1.00 50.80  ? 236  GLY C C   1 
ATOM   5796  O O   . GLY C 1 238 ? -25.183 56.071  -3.901  1.00 52.82  ? 236  GLY C O   1 
ATOM   5797  N N   . ALA C 1 239 ? -23.600 55.993  -5.510  1.00 41.37  ? 237  ALA C N   1 
ATOM   5798  C CA  . ALA C 1 239 ? -23.101 57.342  -5.278  1.00 40.87  ? 237  ALA C CA  1 
ATOM   5799  C C   . ALA C 1 239 ? -22.200 57.309  -4.058  1.00 40.63  ? 237  ALA C C   1 
ATOM   5800  O O   . ALA C 1 239 ? -20.993 57.071  -4.160  1.00 40.70  ? 237  ALA C O   1 
ATOM   5801  C CB  . ALA C 1 239 ? -24.265 58.310  -5.048  1.00 50.02  ? 237  ALA C CB  1 
ATOM   5802  N N   . THR C 1 240 ? -22.811 57.551  -2.904  1.00 41.54  ? 238  THR C N   1 
ATOM   5803  C CA  . THR C 1 240 ? -22.126 57.545  -1.622  1.00 40.37  ? 238  THR C CA  1 
ATOM   5804  C C   . THR C 1 240 ? -21.681 56.125  -1.266  1.00 38.96  ? 238  THR C C   1 
ATOM   5805  O O   . THR C 1 240 ? -20.483 55.826  -1.193  1.00 33.82  ? 238  THR C O   1 
ATOM   5806  C CB  . THR C 1 240 ? -23.074 58.077  -0.533  1.00 54.71  ? 238  THR C CB  1 
ATOM   5807  O OG1 . THR C 1 240 ? -23.154 59.502  -0.641  1.00 57.82  ? 238  THR C OG1 1 
ATOM   5808  C CG2 . THR C 1 240 ? -22.609 57.671  0.858   1.00 53.62  ? 238  THR C CG2 1 
ATOM   5809  N N   . ILE C 1 241 ? -22.663 55.256  -1.058  1.00 32.93  ? 239  ILE C N   1 
ATOM   5810  C CA  . ILE C 1 241 ? -22.398 53.874  -0.706  1.00 34.04  ? 239  ILE C CA  1 
ATOM   5811  C C   . ILE C 1 241 ? -21.262 53.288  -1.534  1.00 33.15  ? 239  ILE C C   1 
ATOM   5812  O O   . ILE C 1 241 ? -20.476 52.482  -1.041  1.00 35.44  ? 239  ILE C O   1 
ATOM   5813  C CB  . ILE C 1 241 ? -23.657 53.001  -0.896  1.00 42.48  ? 239  ILE C CB  1 
ATOM   5814  C CG1 . ILE C 1 241 ? -23.434 51.628  -0.270  1.00 42.44  ? 239  ILE C CG1 1 
ATOM   5815  C CG2 . ILE C 1 241 ? -23.974 52.844  -2.371  1.00 42.63  ? 239  ILE C CG2 1 
ATOM   5816  C CD1 . ILE C 1 241 ? -23.317 51.681  1.202   1.00 41.99  ? 239  ILE C CD1 1 
ATOM   5817  N N   . HIS C 1 242 ? -21.166 53.687  -2.794  1.00 30.05  ? 240  HIS C N   1 
ATOM   5818  C CA  . HIS C 1 242 ? -20.102 53.160  -3.628  1.00 28.78  ? 240  HIS C CA  1 
ATOM   5819  C C   . HIS C 1 242 ? -18.790 53.739  -3.158  1.00 28.27  ? 240  HIS C C   1 
ATOM   5820  O O   . HIS C 1 242 ? -17.822 53.012  -2.943  1.00 28.01  ? 240  HIS C O   1 
ATOM   5821  C CB  . HIS C 1 242 ? -20.350 53.501  -5.099  1.00 26.93  ? 240  HIS C CB  1 
ATOM   5822  C CG  . HIS C 1 242 ? -21.208 52.497  -5.808  1.00 30.56  ? 240  HIS C CG  1 
ATOM   5823  N ND1 . HIS C 1 242 ? -20.711 51.624  -6.752  1.00 29.85  ? 240  HIS C ND1 1 
ATOM   5824  C CD2 . HIS C 1 242 ? -22.523 52.199  -5.680  1.00 31.26  ? 240  HIS C CD2 1 
ATOM   5825  C CE1 . HIS C 1 242 ? -21.681 50.833  -7.174  1.00 29.86  ? 240  HIS C CE1 1 
ATOM   5826  N NE2 . HIS C 1 242 ? -22.792 51.161  -6.538  1.00 31.41  ? 240  HIS C NE2 1 
ATOM   5827  N N   . ALA C 1 243 ? -18.775 55.054  -2.982  1.00 40.36  ? 241  ALA C N   1 
ATOM   5828  C CA  . ALA C 1 243 ? -17.581 55.752  -2.534  1.00 38.22  ? 241  ALA C CA  1 
ATOM   5829  C C   . ALA C 1 243 ? -17.050 55.135  -1.243  1.00 36.74  ? 241  ALA C C   1 
ATOM   5830  O O   . ALA C 1 243 ? -15.879 54.765  -1.153  1.00 34.71  ? 241  ALA C O   1 
ATOM   5831  C CB  . ALA C 1 243 ? -17.897 57.230  -2.319  1.00 42.52  ? 241  ALA C CB  1 
ATOM   5832  N N   . LEU C 1 244 ? -17.918 55.024  -0.244  1.00 22.56  ? 242  LEU C N   1 
ATOM   5833  C CA  . LEU C 1 244 ? -17.515 54.456  1.027   1.00 21.47  ? 242  LEU C CA  1 
ATOM   5834  C C   . LEU C 1 244 ? -16.757 53.148  0.837   1.00 25.81  ? 242  LEU C C   1 
ATOM   5835  O O   . LEU C 1 244 ? -15.622 53.005  1.319   1.00 26.76  ? 242  LEU C O   1 
ATOM   5836  C CB  . LEU C 1 244 ? -18.738 54.238  1.905   1.00 6.99   ? 242  LEU C CB  1 
ATOM   5837  C CG  . LEU C 1 244 ? -19.448 55.547  2.266   1.00 8.41   ? 242  LEU C CG  1 
ATOM   5838  C CD1 . LEU C 1 244 ? -20.550 55.244  3.262   1.00 4.62   ? 242  LEU C CD1 1 
ATOM   5839  C CD2 . LEU C 1 244 ? -18.464 56.558  2.866   1.00 7.70   ? 242  LEU C CD2 1 
ATOM   5840  N N   . HIS C 1 245 ? -17.380 52.202  0.133   1.00 24.04  ? 243  HIS C N   1 
ATOM   5841  C CA  . HIS C 1 245 ? -16.756 50.908  -0.135  1.00 26.04  ? 243  HIS C CA  1 
ATOM   5842  C C   . HIS C 1 245 ? -15.300 51.063  -0.522  1.00 24.68  ? 243  HIS C C   1 
ATOM   5843  O O   . HIS C 1 245 ? -14.453 50.252  -0.155  1.00 26.23  ? 243  HIS C O   1 
ATOM   5844  C CB  . HIS C 1 245 ? -17.441 50.196  -1.292  1.00 50.25  ? 243  HIS C CB  1 
ATOM   5845  C CG  . HIS C 1 245 ? -17.006 48.771  -1.455  1.00 55.47  ? 243  HIS C CG  1 
ATOM   5846  N ND1 . HIS C 1 245 ? -17.535 47.936  -2.414  1.00 58.65  ? 243  HIS C ND1 1 
ATOM   5847  C CD2 . HIS C 1 245 ? -16.145 48.014  -0.733  1.00 56.53  ? 243  HIS C CD2 1 
ATOM   5848  C CE1 . HIS C 1 245 ? -17.022 46.725  -2.273  1.00 59.15  ? 243  HIS C CE1 1 
ATOM   5849  N NE2 . HIS C 1 245 ? -16.178 46.745  -1.259  1.00 54.67  ? 243  HIS C NE2 1 
ATOM   5850  N N   . VAL C 1 246 ? -15.026 52.107  -1.290  1.00 22.48  ? 244  VAL C N   1 
ATOM   5851  C CA  . VAL C 1 246 ? -13.687 52.372  -1.767  1.00 22.56  ? 244  VAL C CA  1 
ATOM   5852  C C   . VAL C 1 246 ? -12.759 52.723  -0.617  1.00 23.66  ? 244  VAL C C   1 
ATOM   5853  O O   . VAL C 1 246 ? -11.583 52.354  -0.637  1.00 23.82  ? 244  VAL C O   1 
ATOM   5854  C CB  . VAL C 1 246 ? -13.702 53.517  -2.816  1.00 31.46  ? 244  VAL C CB  1 
ATOM   5855  C CG1 . VAL C 1 246 ? -13.250 54.833  -2.199  1.00 35.30  ? 244  VAL C CG1 1 
ATOM   5856  C CG2 . VAL C 1 246 ? -12.822 53.157  -3.978  1.00 32.72  ? 244  VAL C CG2 1 
ATOM   5857  N N   . LEU C 1 247 ? -13.286 53.439  0.379   1.00 29.30  ? 245  LEU C N   1 
ATOM   5858  C CA  . LEU C 1 247 ? -12.491 53.833  1.540   1.00 25.85  ? 245  LEU C CA  1 
ATOM   5859  C C   . LEU C 1 247 ? -12.274 52.570  2.334   1.00 26.27  ? 245  LEU C C   1 
ATOM   5860  O O   . LEU C 1 247 ? -11.144 52.169  2.589   1.00 27.12  ? 245  LEU C O   1 
ATOM   5861  C CB  . LEU C 1 247 ? -13.238 54.858  2.404   1.00 14.92  ? 245  LEU C CB  1 
ATOM   5862  C CG  . LEU C 1 247 ? -13.592 56.242  1.830   1.00 9.72   ? 245  LEU C CG  1 
ATOM   5863  C CD1 . LEU C 1 247 ? -14.402 57.013  2.868   1.00 1.68   ? 245  LEU C CD1 1 
ATOM   5864  C CD2 . LEU C 1 247 ? -12.331 57.015  1.413   1.00 3.94   ? 245  LEU C CD2 1 
ATOM   5865  N N   . GLU C 1 248 ? -13.379 51.944  2.714   1.00 28.56  ? 246  GLU C N   1 
ATOM   5866  C CA  . GLU C 1 248 ? -13.336 50.702  3.466   1.00 31.50  ? 246  GLU C CA  1 
ATOM   5867  C C   . GLU C 1 248 ? -12.320 49.700  2.881   1.00 33.76  ? 246  GLU C C   1 
ATOM   5868  O O   . GLU C 1 248 ? -11.706 48.921  3.613   1.00 33.85  ? 246  GLU C O   1 
ATOM   5869  C CB  . GLU C 1 248 ? -14.733 50.091  3.499   1.00 21.76  ? 246  GLU C CB  1 
ATOM   5870  C CG  . GLU C 1 248 ? -15.754 50.947  4.226   1.00 21.94  ? 246  GLU C CG  1 
ATOM   5871  C CD  . GLU C 1 248 ? -15.494 51.019  5.724   1.00 25.36  ? 246  GLU C CD  1 
ATOM   5872  O OE1 . GLU C 1 248 ? -16.432 51.347  6.488   1.00 24.41  ? 246  GLU C OE1 1 
ATOM   5873  O OE2 . GLU C 1 248 ? -14.347 50.752  6.146   1.00 28.81  ? 246  GLU C OE2 1 
ATOM   5874  N N   . SER C 1 249 ? -12.140 49.722  1.565   1.00 32.49  ? 247  SER C N   1 
ATOM   5875  C CA  . SER C 1 249 ? -11.191 48.817  0.937   1.00 34.71  ? 247  SER C CA  1 
ATOM   5876  C C   . SER C 1 249 ? -9.796  49.383  1.065   1.00 33.70  ? 247  SER C C   1 
ATOM   5877  O O   . SER C 1 249 ? -8.830  48.840  0.526   1.00 33.79  ? 247  SER C O   1 
ATOM   5878  C CB  . SER C 1 249 ? -11.539 48.611  -0.534  1.00 43.03  ? 247  SER C CB  1 
ATOM   5879  O OG  . SER C 1 249 ? -12.405 47.502  -0.683  1.00 45.13  ? 247  SER C OG  1 
ATOM   5880  N N   . GLY C 1 250 ? -9.705  50.486  1.791   1.00 33.01  ? 248  GLY C N   1 
ATOM   5881  C CA  . GLY C 1 250 ? -8.426  51.128  1.998   1.00 32.49  ? 248  GLY C CA  1 
ATOM   5882  C C   . GLY C 1 250 ? -8.027  51.161  3.462   1.00 32.51  ? 248  GLY C C   1 
ATOM   5883  O O   . GLY C 1 250 ? -6.941  51.617  3.818   1.00 31.76  ? 248  GLY C O   1 
ATOM   5884  N N   . GLY C 1 251 ? -8.903  50.665  4.323   1.00 46.10  ? 249  GLY C N   1 
ATOM   5885  C CA  . GLY C 1 251 ? -8.585  50.692  5.733   1.00 49.17  ? 249  GLY C CA  1 
ATOM   5886  C C   . GLY C 1 251 ? -8.577  52.143  6.165   1.00 49.49  ? 249  GLY C C   1 
ATOM   5887  O O   . GLY C 1 251 ? -7.843  52.536  7.075   1.00 52.34  ? 249  GLY C O   1 
ATOM   5888  N N   . PHE C 1 252 ? -9.388  52.944  5.480   1.00 31.61  ? 250  PHE C N   1 
ATOM   5889  C CA  . PHE C 1 252 ? -9.530  54.362  5.775   1.00 27.66  ? 250  PHE C CA  1 
ATOM   5890  C C   . PHE C 1 252 ? -9.897  54.506  7.253   1.00 28.65  ? 250  PHE C C   1 
ATOM   5891  O O   . PHE C 1 252 ? -9.403  55.398  7.946   1.00 28.21  ? 250  PHE C O   1 
ATOM   5892  C CB  . PHE C 1 252 ? -10.638 54.954  4.909   1.00 28.54  ? 250  PHE C CB  1 
ATOM   5893  C CG  . PHE C 1 252 ? -10.931 56.398  5.193   1.00 22.86  ? 250  PHE C CG  1 
ATOM   5894  C CD1 . PHE C 1 252 ? -10.052 57.396  4.778   1.00 20.79  ? 250  PHE C CD1 1 
ATOM   5895  C CD2 . PHE C 1 252 ? -12.098 56.763  5.868   1.00 21.34  ? 250  PHE C CD2 1 
ATOM   5896  C CE1 . PHE C 1 252 ? -10.332 58.743  5.030   1.00 20.81  ? 250  PHE C CE1 1 
ATOM   5897  C CE2 . PHE C 1 252 ? -12.394 58.111  6.130   1.00 20.97  ? 250  PHE C CE2 1 
ATOM   5898  C CZ  . PHE C 1 252 ? -11.509 59.102  5.710   1.00 22.64  ? 250  PHE C CZ  1 
ATOM   5899  N N   . ARG C 1 253 ? -10.777 53.628  7.729   1.00 35.82  ? 251  ARG C N   1 
ATOM   5900  C CA  . ARG C 1 253 ? -11.185 53.643  9.132   1.00 35.98  ? 251  ARG C CA  1 
ATOM   5901  C C   . ARG C 1 253 ? -9.916  53.608  9.973   1.00 33.89  ? 251  ARG C C   1 
ATOM   5902  O O   . ARG C 1 253 ? -9.763  54.396  10.907  1.00 31.72  ? 251  ARG C O   1 
ATOM   5903  C CB  . ARG C 1 253 ? -12.020 52.413  9.455   1.00 33.78  ? 251  ARG C CB  1 
ATOM   5904  C CG  . ARG C 1 253 ? -13.349 52.359  8.766   1.00 34.68  ? 251  ARG C CG  1 
ATOM   5905  C CD  . ARG C 1 253 ? -14.376 53.183  9.501   1.00 36.65  ? 251  ARG C CD  1 
ATOM   5906  N NE  . ARG C 1 253 ? -15.686 52.558  9.362   1.00 39.50  ? 251  ARG C NE  1 
ATOM   5907  C CZ  . ARG C 1 253 ? -16.829 53.116  9.739   1.00 44.19  ? 251  ARG C CZ  1 
ATOM   5908  N NH1 . ARG C 1 253 ? -16.830 54.324  10.285  1.00 51.58  ? 251  ARG C NH1 1 
ATOM   5909  N NH2 . ARG C 1 253 ? -17.976 52.471  9.558   1.00 44.19  ? 251  ARG C NH2 1 
ATOM   5910  N N   . SER C 1 254 ? -9.025  52.673  9.630   1.00 26.78  ? 252  SER C N   1 
ATOM   5911  C CA  . SER C 1 254 ? -7.749  52.516  10.309  1.00 26.89  ? 252  SER C CA  1 
ATOM   5912  C C   . SER C 1 254 ? -7.033  53.827  10.137  1.00 24.93  ? 252  SER C C   1 
ATOM   5913  O O   . SER C 1 254 ? -7.566  54.858  10.517  1.00 23.95  ? 252  SER C O   1 
ATOM   5914  C CB  . SER C 1 254 ? -6.934  51.410  9.664   1.00 24.71  ? 252  SER C CB  1 
ATOM   5915  O OG  . SER C 1 254 ? -7.616  50.180  9.763   1.00 32.40  ? 252  SER C OG  1 
ATOM   5916  N N   . LEU C 1 255 ? -5.840  53.787  9.552   1.00 24.12  ? 253  LEU C N   1 
ATOM   5917  C CA  . LEU C 1 255 ? -5.044  54.993  9.314   1.00 26.77  ? 253  LEU C CA  1 
ATOM   5918  C C   . LEU C 1 255 ? -5.319  56.111  10.313  1.00 26.46  ? 253  LEU C C   1 
ATOM   5919  O O   . LEU C 1 255 ? -4.447  56.464  11.109  1.00 24.72  ? 253  LEU C O   1 
ATOM   5920  C CB  . LEU C 1 255 ? -5.279  55.494  7.895   1.00 35.99  ? 253  LEU C CB  1 
ATOM   5921  C CG  . LEU C 1 255 ? -4.571  54.682  6.808   1.00 41.12  ? 253  LEU C CG  1 
ATOM   5922  C CD1 . LEU C 1 255 ? -5.083  53.236  6.795   1.00 41.90  ? 253  LEU C CD1 1 
ATOM   5923  C CD2 . LEU C 1 255 ? -4.790  55.368  5.468   1.00 41.77  ? 253  LEU C CD2 1 
ATOM   5924  N N   . LEU C 1 256 ? -6.522  56.679  10.251  1.00 34.04  ? 254  LEU C N   1 
ATOM   5925  C CA  . LEU C 1 256 ? -6.929  57.715  11.189  1.00 34.28  ? 254  LEU C CA  1 
ATOM   5926  C C   . LEU C 1 256 ? -6.556  57.224  12.587  1.00 36.22  ? 254  LEU C C   1 
ATOM   5927  O O   . LEU C 1 256 ? -5.879  57.930  13.345  1.00 37.95  ? 254  LEU C O   1 
ATOM   5928  C CB  . LEU C 1 256 ? -8.440  57.948  11.127  1.00 21.22  ? 254  LEU C CB  1 
ATOM   5929  C CG  . LEU C 1 256 ? -9.081  58.581  9.885   1.00 22.40  ? 254  LEU C CG  1 
ATOM   5930  C CD1 . LEU C 1 256 ? -10.581 58.694  10.118  1.00 20.82  ? 254  LEU C CD1 1 
ATOM   5931  C CD2 . LEU C 1 256 ? -8.483  59.960  9.598   1.00 17.39  ? 254  LEU C CD2 1 
ATOM   5932  N N   . ILE C 1 257 ? -6.990  56.014  12.933  1.00 23.68  ? 255  ILE C N   1 
ATOM   5933  C CA  . ILE C 1 257 ? -6.654  55.479  14.248  1.00 25.01  ? 255  ILE C CA  1 
ATOM   5934  C C   . ILE C 1 257 ? -5.144  55.559  14.406  1.00 25.69  ? 255  ILE C C   1 
ATOM   5935  O O   . ILE C 1 257 ? -4.620  56.227  15.296  1.00 25.60  ? 255  ILE C O   1 
ATOM   5936  C CB  . ILE C 1 257 ? -7.018  54.002  14.408  1.00 31.45  ? 255  ILE C CB  1 
ATOM   5937  C CG1 . ILE C 1 257 ? -8.505  53.775  14.147  1.00 28.83  ? 255  ILE C CG1 1 
ATOM   5938  C CG2 . ILE C 1 257 ? -6.654  53.560  15.815  1.00 27.22  ? 255  ILE C CG2 1 
ATOM   5939  C CD1 . ILE C 1 257 ? -9.383  54.469  15.129  1.00 33.77  ? 255  ILE C CD1 1 
ATOM   5940  N N   . ASN C 1 258 ? -4.449  54.855  13.528  1.00 31.38  ? 256  ASN C N   1 
ATOM   5941  C CA  . ASN C 1 258 ? -3.011  54.846  13.568  1.00 33.26  ? 256  ASN C CA  1 
ATOM   5942  C C   . ASN C 1 258 ? -2.546  56.249  13.903  1.00 33.61  ? 256  ASN C C   1 
ATOM   5943  O O   . ASN C 1 258 ? -1.741  56.431  14.810  1.00 37.13  ? 256  ASN C O   1 
ATOM   5944  C CB  . ASN C 1 258 ? -2.463  54.396  12.215  1.00 40.63  ? 256  ASN C CB  1 
ATOM   5945  C CG  . ASN C 1 258 ? -2.952  53.010  11.822  1.00 43.02  ? 256  ASN C CG  1 
ATOM   5946  O OD1 . ASN C 1 258 ? -4.091  52.636  12.121  1.00 48.50  ? 256  ASN C OD1 1 
ATOM   5947  N ND2 . ASN C 1 258 ? -2.103  52.249  11.138  1.00 39.59  ? 256  ASN C ND2 1 
ATOM   5948  N N   . ALA C 1 259 ? -3.089  57.240  13.202  1.00 30.95  ? 257  ALA C N   1 
ATOM   5949  C CA  . ALA C 1 259 ? -2.712  58.640  13.415  1.00 28.50  ? 257  ALA C CA  1 
ATOM   5950  C C   . ALA C 1 259 ? -2.978  59.147  14.834  1.00 28.85  ? 257  ALA C C   1 
ATOM   5951  O O   . ALA C 1 259 ? -2.069  59.638  15.509  1.00 28.16  ? 257  ALA C O   1 
ATOM   5952  C CB  . ALA C 1 259 ? -3.426  59.533  12.401  1.00 11.34  ? 257  ALA C CB  1 
ATOM   5953  N N   . VAL C 1 260 ? -4.223  59.045  15.282  1.00 23.00  ? 258  VAL C N   1 
ATOM   5954  C CA  . VAL C 1 260 ? -4.568  59.494  16.626  1.00 24.58  ? 258  VAL C CA  1 
ATOM   5955  C C   . VAL C 1 260 ? -3.884  58.621  17.669  1.00 27.18  ? 258  VAL C C   1 
ATOM   5956  O O   . VAL C 1 260 ? -3.999  58.867  18.866  1.00 31.02  ? 258  VAL C O   1 
ATOM   5957  C CB  . VAL C 1 260 ? -6.115  59.471  16.847  1.00 32.12  ? 258  VAL C CB  1 
ATOM   5958  C CG1 . VAL C 1 260 ? -6.484  59.051  18.290  1.00 30.30  ? 258  VAL C CG1 1 
ATOM   5959  C CG2 . VAL C 1 260 ? -6.672  60.843  16.571  1.00 33.57  ? 258  VAL C CG2 1 
ATOM   5960  N N   . GLU C 1 261 ? -3.163  57.601  17.222  1.00 33.63  ? 259  GLU C N   1 
ATOM   5961  C CA  . GLU C 1 261 ? -2.493  56.719  18.161  1.00 33.93  ? 259  GLU C CA  1 
ATOM   5962  C C   . GLU C 1 261 ? -1.005  56.968  18.132  1.00 34.52  ? 259  GLU C C   1 
ATOM   5963  O O   . GLU C 1 261 ? -0.270  56.512  18.994  1.00 35.58  ? 259  GLU C O   1 
ATOM   5964  C CB  . GLU C 1 261 ? -2.763  55.265  17.819  1.00 25.40  ? 259  GLU C CB  1 
ATOM   5965  C CG  . GLU C 1 261 ? -2.046  54.306  18.731  1.00 24.23  ? 259  GLU C CG  1 
ATOM   5966  C CD  . GLU C 1 261 ? -1.422  53.152  17.981  1.00 27.27  ? 259  GLU C CD  1 
ATOM   5967  O OE1 . GLU C 1 261 ? -1.615  52.003  18.428  1.00 23.81  ? 259  GLU C OE1 1 
ATOM   5968  O OE2 . GLU C 1 261 ? -0.739  53.392  16.954  1.00 29.75  ? 259  GLU C OE2 1 
ATOM   5969  N N   . ALA C 1 262 ? -0.557  57.712  17.138  1.00 26.93  ? 260  ALA C N   1 
ATOM   5970  C CA  . ALA C 1 262 ? 0.855   58.002  17.047  1.00 29.46  ? 260  ALA C CA  1 
ATOM   5971  C C   . ALA C 1 262 ? 1.110   59.430  17.495  1.00 32.65  ? 260  ALA C C   1 
ATOM   5972  O O   . ALA C 1 262 ? 2.201   59.756  17.948  1.00 35.57  ? 260  ALA C O   1 
ATOM   5973  C CB  . ALA C 1 262 ? 1.324   57.796  15.642  1.00 43.88  ? 260  ALA C CB  1 
ATOM   5974  N N   . SER C 1 263 ? 0.101   60.282  17.348  1.00 41.62  ? 261  SER C N   1 
ATOM   5975  C CA  . SER C 1 263 ? 0.199   61.670  17.774  1.00 41.90  ? 261  SER C CA  1 
ATOM   5976  C C   . SER C 1 263 ? 0.461   61.623  19.263  1.00 42.45  ? 261  SER C C   1 
ATOM   5977  O O   . SER C 1 263 ? 1.435   62.186  19.761  1.00 43.77  ? 261  SER C O   1 
ATOM   5978  C CB  . SER C 1 263 ? -1.120  62.400  17.510  1.00 49.93  ? 261  SER C CB  1 
ATOM   5979  O OG  . SER C 1 263 ? -1.154  63.653  18.171  1.00 51.83  ? 261  SER C OG  1 
ATOM   5980  N N   . CYS C 1 264 ? -0.437  60.931  19.953  1.00 41.81  ? 262  CYS C N   1 
ATOM   5981  C CA  . CYS C 1 264 ? -0.393  60.728  21.386  1.00 44.27  ? 262  CYS C CA  1 
ATOM   5982  C C   . CYS C 1 264 ? 0.842   59.937  21.814  1.00 44.82  ? 262  CYS C C   1 
ATOM   5983  O O   . CYS C 1 264 ? 1.631   60.421  22.629  1.00 46.64  ? 262  CYS C O   1 
ATOM   5984  C CB  . CYS C 1 264 ? -1.660  60.007  21.822  1.00 48.49  ? 262  CYS C CB  1 
ATOM   5985  S SG  . CYS C 1 264 ? -1.429  58.890  23.191  1.00 56.44  ? 262  CYS C SG  1 
ATOM   5986  N N   . ILE C 1 265 ? 1.021   58.730  21.280  1.00 43.74  ? 263  ILE C N   1 
ATOM   5987  C CA  . ILE C 1 265 ? 2.198   57.942  21.651  1.00 45.03  ? 263  ILE C CA  1 
ATOM   5988  C C   . ILE C 1 265 ? 3.433   58.836  21.651  1.00 44.91  ? 263  ILE C C   1 
ATOM   5989  O O   . ILE C 1 265 ? 4.275   58.752  22.545  1.00 46.54  ? 263  ILE C O   1 
ATOM   5990  C CB  . ILE C 1 265 ? 2.441   56.768  20.682  1.00 36.22  ? 263  ILE C CB  1 
ATOM   5991  C CG1 . ILE C 1 265 ? 1.417   55.671  20.941  1.00 35.28  ? 263  ILE C CG1 1 
ATOM   5992  C CG2 . ILE C 1 265 ? 3.835   56.192  20.886  1.00 36.49  ? 263  ILE C CG2 1 
ATOM   5993  C CD1 . ILE C 1 265 ? 1.408   55.197  22.369  1.00 40.34  ? 263  ILE C CD1 1 
ATOM   5994  N N   . ARG C 1 266 ? 3.518   59.701  20.645  1.00 35.42  ? 264  ARG C N   1 
ATOM   5995  C CA  . ARG C 1 266 ? 4.630   60.632  20.508  1.00 35.80  ? 264  ARG C CA  1 
ATOM   5996  C C   . ARG C 1 266 ? 4.582   61.734  21.550  1.00 37.43  ? 264  ARG C C   1 
ATOM   5997  O O   . ARG C 1 266 ? 5.617   62.220  21.996  1.00 35.80  ? 264  ARG C O   1 
ATOM   5998  C CB  . ARG C 1 266 ? 4.625   61.278  19.132  1.00 40.32  ? 264  ARG C CB  1 
ATOM   5999  C CG  . ARG C 1 266 ? 5.613   62.405  19.012  1.00 36.08  ? 264  ARG C CG  1 
ATOM   6000  C CD  . ARG C 1 266 ? 7.032   61.929  19.294  1.00 36.74  ? 264  ARG C CD  1 
ATOM   6001  N NE  . ARG C 1 266 ? 8.012   62.964  18.965  1.00 36.70  ? 264  ARG C NE  1 
ATOM   6002  C CZ  . ARG C 1 266 ? 9.329   62.783  18.904  1.00 35.71  ? 264  ARG C CZ  1 
ATOM   6003  N NH1 . ARG C 1 266 ? 9.865   61.590  19.152  1.00 33.06  ? 264  ARG C NH1 1 
ATOM   6004  N NH2 . ARG C 1 266 ? 10.113  63.805  18.584  1.00 36.14  ? 264  ARG C NH2 1 
ATOM   6005  N N   . THR C 1 267 ? 3.381   62.157  21.913  1.00 56.55  ? 265  THR C N   1 
ATOM   6006  C CA  . THR C 1 267 ? 3.245   63.195  22.919  1.00 60.65  ? 265  THR C CA  1 
ATOM   6007  C C   . THR C 1 267 ? 3.868   62.641  24.191  1.00 63.53  ? 265  THR C C   1 
ATOM   6008  O O   . THR C 1 267 ? 4.606   63.335  24.893  1.00 64.56  ? 265  THR C O   1 
ATOM   6009  C CB  . THR C 1 267 ? 1.768   63.533  23.177  1.00 59.14  ? 265  THR C CB  1 
ATOM   6010  O OG1 . THR C 1 267 ? 1.198   64.108  21.995  1.00 61.12  ? 265  THR C OG1 1 
ATOM   6011  C CG2 . THR C 1 267 ? 1.639   64.517  24.330  1.00 59.44  ? 265  THR C CG2 1 
ATOM   6012  N N   . ARG C 1 268 ? 3.577   61.375  24.471  1.00 52.30  ? 266  ARG C N   1 
ATOM   6013  C CA  . ARG C 1 268 ? 4.116   60.721  25.649  1.00 55.09  ? 266  ARG C CA  1 
ATOM   6014  C C   . ARG C 1 268 ? 5.629   60.778  25.621  1.00 56.74  ? 266  ARG C C   1 
ATOM   6015  O O   . ARG C 1 268 ? 6.259   61.244  26.564  1.00 58.91  ? 266  ARG C O   1 
ATOM   6016  C CB  . ARG C 1 268 ? 3.670   59.265  25.700  1.00 62.05  ? 266  ARG C CB  1 
ATOM   6017  C CG  . ARG C 1 268 ? 2.173   59.066  25.743  1.00 65.71  ? 266  ARG C CG  1 
ATOM   6018  C CD  . ARG C 1 268 ? 1.844   57.601  25.955  1.00 68.56  ? 266  ARG C CD  1 
ATOM   6019  N NE  . ARG C 1 268 ? 0.419   57.326  25.820  1.00 73.15  ? 266  ARG C NE  1 
ATOM   6020  C CZ  . ARG C 1 268 ? -0.522  57.825  26.615  1.00 78.51  ? 266  ARG C CZ  1 
ATOM   6021  N NH1 . ARG C 1 268 ? -0.196  58.633  27.620  1.00 79.78  ? 266  ARG C NH1 1 
ATOM   6022  N NH2 . ARG C 1 268 ? -1.795  57.519  26.400  1.00 79.71  ? 266  ARG C NH2 1 
ATOM   6023  N N   . GLU C 1 269 ? 6.207   60.305  24.525  1.00 58.69  ? 267  GLU C N   1 
ATOM   6024  C CA  . GLU C 1 269 ? 7.654   60.286  24.377  1.00 61.37  ? 267  GLU C CA  1 
ATOM   6025  C C   . GLU C 1 269 ? 8.286   61.650  24.589  1.00 60.92  ? 267  GLU C C   1 
ATOM   6026  O O   . GLU C 1 269 ? 9.477   61.746  24.866  1.00 60.45  ? 267  GLU C O   1 
ATOM   6027  C CB  . GLU C 1 269 ? 8.052   59.784  22.987  1.00 94.73  ? 267  GLU C CB  1 
ATOM   6028  C CG  . GLU C 1 269 ? 7.568   58.392  22.632  1.00 99.75  ? 267  GLU C CG  1 
ATOM   6029  C CD  . GLU C 1 269 ? 8.348   57.794  21.471  1.00 103.23 ? 267  GLU C CD  1 
ATOM   6030  O OE1 . GLU C 1 269 ? 8.457   58.454  20.412  1.00 101.73 ? 267  GLU C OE1 1 
ATOM   6031  O OE2 . GLU C 1 269 ? 8.853   56.660  21.624  1.00 107.51 ? 267  GLU C OE2 1 
ATOM   6032  N N   . LEU C 1 270 ? 7.492   62.704  24.452  1.00 79.79  ? 268  LEU C N   1 
ATOM   6033  C CA  . LEU C 1 270 ? 8.007   64.056  24.605  1.00 80.96  ? 268  LEU C CA  1 
ATOM   6034  C C   . LEU C 1 270 ? 8.136   64.524  26.041  1.00 82.92  ? 268  LEU C C   1 
ATOM   6035  O O   . LEU C 1 270 ? 9.188   65.024  26.440  1.00 83.71  ? 268  LEU C O   1 
ATOM   6036  C CB  . LEU C 1 270 ? 7.136   65.039  23.826  1.00 58.46  ? 268  LEU C CB  1 
ATOM   6037  C CG  . LEU C 1 270 ? 7.239   64.880  22.310  1.00 55.19  ? 268  LEU C CG  1 
ATOM   6038  C CD1 . LEU C 1 270 ? 6.507   66.034  21.630  1.00 53.74  ? 268  LEU C CD1 1 
ATOM   6039  C CD2 . LEU C 1 270 ? 8.713   64.855  21.892  1.00 51.23  ? 268  LEU C CD2 1 
ATOM   6040  N N   . GLN C 1 271 ? 7.064   64.383  26.810  1.00 87.37  ? 269  GLN C N   1 
ATOM   6041  C CA  . GLN C 1 271 ? 7.092   64.800  28.201  1.00 90.40  ? 269  GLN C CA  1 
ATOM   6042  C C   . GLN C 1 271 ? 8.025   63.895  28.973  1.00 92.77  ? 269  GLN C C   1 
ATOM   6043  O O   . GLN C 1 271 ? 8.896   64.367  29.706  1.00 94.77  ? 269  GLN C O   1 
ATOM   6044  C CB  . GLN C 1 271 ? 5.688   64.763  28.804  1.00 83.17  ? 269  GLN C CB  1 
ATOM   6045  C CG  . GLN C 1 271 ? 4.873   63.542  28.447  1.00 83.63  ? 269  GLN C CG  1 
ATOM   6046  C CD  . GLN C 1 271 ? 3.448   63.645  28.961  1.00 84.90  ? 269  GLN C CD  1 
ATOM   6047  O OE1 . GLN C 1 271 ? 2.777   64.666  28.775  1.00 84.95  ? 269  GLN C OE1 1 
ATOM   6048  N NE2 . GLN C 1 271 ? 2.975   62.586  29.607  1.00 84.77  ? 269  GLN C NE2 1 
ATOM   6049  N N   . SER C 1 272 ? 7.850   62.590  28.799  1.00 71.59  ? 270  SER C N   1 
ATOM   6050  C CA  . SER C 1 272 ? 8.704   61.633  29.479  1.00 74.95  ? 270  SER C CA  1 
ATOM   6051  C C   . SER C 1 272 ? 10.076  61.667  28.810  1.00 76.83  ? 270  SER C C   1 
ATOM   6052  O O   . SER C 1 272 ? 10.751  60.647  28.670  1.00 76.62  ? 270  SER C O   1 
ATOM   6053  C CB  . SER C 1 272 ? 8.101   60.226  29.408  1.00 123.40 ? 270  SER C CB  1 
ATOM   6054  O OG  . SER C 1 272 ? 7.977   59.783  28.069  1.00 124.76 ? 270  SER C OG  1 
ATOM   6055  N N   . MET C 1 273 ? 10.467  62.863  28.390  1.00 78.20  ? 271  MET C N   1 
ATOM   6056  C CA  . MET C 1 273 ? 11.748  63.094  27.749  1.00 83.20  ? 271  MET C CA  1 
ATOM   6057  C C   . MET C 1 273 ? 12.233  64.450  28.228  1.00 86.87  ? 271  MET C C   1 
ATOM   6058  O O   . MET C 1 273 ? 13.420  64.757  28.157  1.00 87.49  ? 271  MET C O   1 
ATOM   6059  C CB  . MET C 1 273 ? 11.592  63.117  26.231  1.00 105.02 ? 271  MET C CB  1 
ATOM   6060  C CG  . MET C 1 273 ? 12.832  63.591  25.498  1.00 107.13 ? 271  MET C CG  1 
ATOM   6061  S SD  . MET C 1 273 ? 12.567  63.773  23.729  1.00 109.31 ? 271  MET C SD  1 
ATOM   6062  C CE  . MET C 1 273 ? 13.442  62.328  23.110  1.00 108.33 ? 271  MET C CE  1 
ATOM   6063  N N   . ALA C 1 274 ? 11.294  65.261  28.708  1.00 114.10 ? 272  ALA C N   1 
ATOM   6064  C CA  . ALA C 1 274 ? 11.603  66.592  29.216  1.00 119.10 ? 272  ALA C CA  1 
ATOM   6065  C C   . ALA C 1 274 ? 12.372  66.432  30.523  1.00 124.01 ? 272  ALA C C   1 
ATOM   6066  O O   . ALA C 1 274 ? 13.358  67.128  30.780  1.00 124.76 ? 272  ALA C O   1 
ATOM   6067  C CB  . ALA C 1 274 ? 10.311  67.370  29.456  1.00 52.34  ? 272  ALA C CB  1 
ATOM   6068  N N   . ASP C 1 275 ? 11.907  65.493  31.338  1.00 132.46 ? 273  ASP C N   1 
ATOM   6069  C CA  . ASP C 1 275 ? 12.512  65.194  32.629  1.00 136.90 ? 273  ASP C CA  1 
ATOM   6070  C C   . ASP C 1 275 ? 13.462  64.008  32.510  1.00 140.21 ? 273  ASP C C   1 
ATOM   6071  O O   . ASP C 1 275 ? 14.442  63.912  33.251  1.00 140.00 ? 273  ASP C O   1 
ATOM   6072  C CB  . ASP C 1 275 ? 11.408  64.886  33.638  1.00 109.67 ? 273  ASP C CB  1 
ATOM   6073  C CG  . ASP C 1 275 ? 10.181  64.283  32.980  1.00 109.20 ? 273  ASP C CG  1 
ATOM   6074  O OD1 . ASP C 1 275 ? 10.285  63.174  32.417  1.00 110.16 ? 273  ASP C OD1 1 
ATOM   6075  O OD2 . ASP C 1 275 ? 9.112   64.927  33.014  1.00 108.32 ? 273  ASP C OD2 1 
ATOM   6076  N N   . GLN C 1 276 ? 13.162  63.111  31.573  1.00 164.15 ? 274  GLN C N   1 
ATOM   6077  C CA  . GLN C 1 276 ? 13.986  61.926  31.336  1.00 167.47 ? 274  GLN C CA  1 
ATOM   6078  C C   . GLN C 1 276 ? 15.406  62.375  31.040  1.00 169.00 ? 274  GLN C C   1 
ATOM   6079  O O   . GLN C 1 276 ? 16.350  61.587  31.124  1.00 169.02 ? 274  GLN C O   1 
ATOM   6080  C CB  . GLN C 1 276 ? 13.456  61.127  30.135  1.00 149.46 ? 274  GLN C CB  1 
ATOM   6081  C CG  . GLN C 1 276 ? 14.235  59.840  29.838  1.00 149.09 ? 274  GLN C CG  1 
ATOM   6082  C CD  . GLN C 1 276 ? 13.853  59.203  28.508  1.00 148.55 ? 274  GLN C CD  1 
ATOM   6083  O OE1 . GLN C 1 276 ? 12.677  58.976  28.228  1.00 148.26 ? 274  GLN C OE1 1 
ATOM   6084  N NE2 . GLN C 1 276 ? 14.853  58.906  27.687  1.00 147.80 ? 274  GLN C NE2 1 
ATOM   6085  N N   . GLU C 1 277 ? 15.544  63.652  30.695  1.00 121.39 ? 275  GLU C N   1 
ATOM   6086  C CA  . GLU C 1 277 ? 16.841  64.221  30.362  1.00 123.02 ? 275  GLU C CA  1 
ATOM   6087  C C   . GLU C 1 277 ? 16.721  65.721  30.090  1.00 122.08 ? 275  GLU C C   1 
ATOM   6088  O O   . GLU C 1 277 ? 16.741  66.537  31.013  1.00 120.77 ? 275  GLU C O   1 
ATOM   6089  C CB  . GLU C 1 277 ? 17.397  63.503  29.131  1.00 194.13 ? 275  GLU C CB  1 
ATOM   6090  C CG  . GLU C 1 277 ? 18.785  63.927  28.713  1.00 198.71 ? 275  GLU C CG  1 
ATOM   6091  C CD  . GLU C 1 277 ? 19.323  63.065  27.591  1.00 199.77 ? 275  GLU C CD  1 
ATOM   6092  O OE1 . GLU C 1 277 ? 19.435  61.837  27.793  1.00 199.77 ? 275  GLU C OE1 1 
ATOM   6093  O OE2 . GLU C 1 277 ? 19.628  63.611  26.510  1.00 199.77 ? 275  GLU C OE2 1 
ATOM   6094  N N   . ARG D 1 1   ? -33.177 32.210  46.692  1.00 47.25  ? -1   ARG D N   1 
ATOM   6095  C CA  . ARG D 1 1   ? -34.658 32.326  46.916  1.00 51.54  ? -1   ARG D CA  1 
ATOM   6096  C C   . ARG D 1 1   ? -35.018 33.514  47.804  1.00 49.91  ? -1   ARG D C   1 
ATOM   6097  O O   . ARG D 1 1   ? -36.152 34.014  47.783  1.00 47.69  ? -1   ARG D O   1 
ATOM   6098  C CB  . ARG D 1 1   ? -35.192 31.069  47.581  1.00 124.73 ? -1   ARG D CB  1 
ATOM   6099  C CG  . ARG D 1 1   ? -34.557 29.812  47.098  1.00 131.66 ? -1   ARG D CG  1 
ATOM   6100  C CD  . ARG D 1 1   ? -35.138 28.670  47.864  1.00 137.15 ? -1   ARG D CD  1 
ATOM   6101  N NE  . ARG D 1 1   ? -34.489 27.412  47.539  1.00 143.43 ? -1   ARG D NE  1 
ATOM   6102  C CZ  . ARG D 1 1   ? -34.926 26.235  47.965  1.00 146.97 ? -1   ARG D CZ  1 
ATOM   6103  N NH1 . ARG D 1 1   ? -36.010 26.174  48.728  1.00 148.91 ? -1   ARG D NH1 1 
ATOM   6104  N NH2 . ARG D 1 1   ? -34.285 25.123  47.633  1.00 148.48 ? -1   ARG D NH2 1 
ATOM   6105  N N   . GLY D 1 2   ? -34.053 33.919  48.618  1.00 78.77  ? 0    GLY D N   1 
ATOM   6106  C CA  . GLY D 1 2   ? -34.225 35.047  49.508  1.00 76.57  ? 0    GLY D CA  1 
ATOM   6107  C C   . GLY D 1 2   ? -32.979 35.855  49.258  1.00 75.63  ? 0    GLY D C   1 
ATOM   6108  O O   . GLY D 1 2   ? -32.569 36.685  50.059  1.00 76.63  ? 0    GLY D O   1 
ATOM   6109  N N   . MET D 1 3   ? -32.376 35.585  48.109  1.00 60.49  ? 1    MET D N   1 
ATOM   6110  C CA  . MET D 1 3   ? -31.145 36.234  47.701  1.00 59.06  ? 1    MET D CA  1 
ATOM   6111  C C   . MET D 1 3   ? -31.351 37.612  47.098  1.00 57.79  ? 1    MET D C   1 
ATOM   6112  O O   . MET D 1 3   ? -32.305 37.844  46.354  1.00 56.64  ? 1    MET D O   1 
ATOM   6113  C CB  . MET D 1 3   ? -30.426 35.347  46.699  1.00 76.34  ? 1    MET D CB  1 
ATOM   6114  C CG  . MET D 1 3   ? -29.292 36.017  45.974  1.00 79.97  ? 1    MET D CG  1 
ATOM   6115  S SD  . MET D 1 3   ? -28.941 35.061  44.502  1.00 84.85  ? 1    MET D SD  1 
ATOM   6116  C CE  . MET D 1 3   ? -30.299 35.632  43.421  1.00 82.94  ? 1    MET D CE  1 
ATOM   6117  N N   . SER D 1 4   ? -30.430 38.514  47.420  1.00 71.26  ? 2    SER D N   1 
ATOM   6118  C CA  . SER D 1 4   ? -30.461 39.889  46.936  1.00 71.18  ? 2    SER D CA  1 
ATOM   6119  C C   . SER D 1 4   ? -29.129 40.148  46.233  1.00 69.10  ? 2    SER D C   1 
ATOM   6120  O O   . SER D 1 4   ? -28.109 39.577  46.617  1.00 69.68  ? 2    SER D O   1 
ATOM   6121  C CB  . SER D 1 4   ? -30.620 40.848  48.114  1.00 108.78 ? 2    SER D CB  1 
ATOM   6122  O OG  . SER D 1 4   ? -31.616 40.390  49.011  1.00 113.32 ? 2    SER D OG  1 
ATOM   6123  N N   . VAL D 1 5   ? -29.128 41.016  45.224  1.00 66.66  ? 3    VAL D N   1 
ATOM   6124  C CA  . VAL D 1 5   ? -27.901 41.289  44.472  1.00 61.41  ? 3    VAL D CA  1 
ATOM   6125  C C   . VAL D 1 5   ? -27.498 42.754  44.391  1.00 59.79  ? 3    VAL D C   1 
ATOM   6126  O O   . VAL D 1 5   ? -28.343 43.655  44.414  1.00 59.19  ? 3    VAL D O   1 
ATOM   6127  C CB  . VAL D 1 5   ? -28.006 40.771  43.005  1.00 48.50  ? 3    VAL D CB  1 
ATOM   6128  C CG1 . VAL D 1 5   ? -26.635 40.777  42.346  1.00 47.65  ? 3    VAL D CG1 1 
ATOM   6129  C CG2 . VAL D 1 5   ? -28.609 39.380  42.973  1.00 46.88  ? 3    VAL D CG2 1 
ATOM   6130  N N   . GLY D 1 6   ? -26.192 42.970  44.265  1.00 42.99  ? 4    GLY D N   1 
ATOM   6131  C CA  . GLY D 1 6   ? -25.660 44.315  44.151  1.00 43.55  ? 4    GLY D CA  1 
ATOM   6132  C C   . GLY D 1 6   ? -24.417 44.367  43.272  1.00 45.16  ? 4    GLY D C   1 
ATOM   6133  O O   . GLY D 1 6   ? -23.612 43.423  43.252  1.00 43.33  ? 4    GLY D O   1 
ATOM   6134  N N   . PHE D 1 7   ? -24.267 45.465  42.531  1.00 60.35  ? 5    PHE D N   1 
ATOM   6135  C CA  . PHE D 1 7   ? -23.114 45.667  41.653  1.00 62.23  ? 5    PHE D CA  1 
ATOM   6136  C C   . PHE D 1 7   ? -22.391 46.915  42.104  1.00 64.24  ? 5    PHE D C   1 
ATOM   6137  O O   . PHE D 1 7   ? -23.008 47.969  42.273  1.00 64.06  ? 5    PHE D O   1 
ATOM   6138  C CB  . PHE D 1 7   ? -23.521 45.900  40.189  1.00 71.59  ? 5    PHE D CB  1 
ATOM   6139  C CG  . PHE D 1 7   ? -24.377 44.822  39.602  1.00 68.54  ? 5    PHE D CG  1 
ATOM   6140  C CD1 . PHE D 1 7   ? -25.755 44.840  39.773  1.00 66.33  ? 5    PHE D CD1 1 
ATOM   6141  C CD2 . PHE D 1 7   ? -23.807 43.789  38.871  1.00 66.53  ? 5    PHE D CD2 1 
ATOM   6142  C CE1 . PHE D 1 7   ? -26.554 43.844  39.221  1.00 65.86  ? 5    PHE D CE1 1 
ATOM   6143  C CE2 . PHE D 1 7   ? -24.597 42.787  38.315  1.00 64.56  ? 5    PHE D CE2 1 
ATOM   6144  C CZ  . PHE D 1 7   ? -25.973 42.814  38.490  1.00 65.49  ? 5    PHE D CZ  1 
ATOM   6145  N N   . ILE D 1 8   ? -21.085 46.799  42.299  1.00 63.30  ? 6    ILE D N   1 
ATOM   6146  C CA  . ILE D 1 8   ? -20.297 47.951  42.695  1.00 67.70  ? 6    ILE D CA  1 
ATOM   6147  C C   . ILE D 1 8   ? -19.932 48.643  41.397  1.00 71.28  ? 6    ILE D C   1 
ATOM   6148  O O   . ILE D 1 8   ? -19.256 48.069  40.542  1.00 69.63  ? 6    ILE D O   1 
ATOM   6149  C CB  . ILE D 1 8   ? -19.025 47.535  43.466  1.00 56.68  ? 6    ILE D CB  1 
ATOM   6150  C CG1 . ILE D 1 8   ? -19.413 47.055  44.862  1.00 56.50  ? 6    ILE D CG1 1 
ATOM   6151  C CG2 . ILE D 1 8   ? -18.066 48.712  43.585  1.00 55.76  ? 6    ILE D CG2 1 
ATOM   6152  C CD1 . ILE D 1 8   ? -20.180 48.096  45.649  1.00 60.97  ? 6    ILE D CD1 1 
ATOM   6153  N N   . GLY D 1 9   ? -20.399 49.878  41.252  1.00 84.96  ? 7    GLY D N   1 
ATOM   6154  C CA  . GLY D 1 9   ? -20.146 50.623  40.040  1.00 88.50  ? 7    GLY D CA  1 
ATOM   6155  C C   . GLY D 1 9   ? -21.192 50.200  39.029  1.00 90.72  ? 7    GLY D C   1 
ATOM   6156  O O   . GLY D 1 9   ? -21.403 49.005  38.816  1.00 90.26  ? 7    GLY D O   1 
ATOM   6157  N N   . ALA D 1 10  ? -21.865 51.169  38.421  1.00 164.87 ? 8    ALA D N   1 
ATOM   6158  C CA  . ALA D 1 10  ? -22.883 50.859  37.427  1.00 165.75 ? 8    ALA D CA  1 
ATOM   6159  C C   . ALA D 1 10  ? -22.192 50.436  36.135  1.00 166.17 ? 8    ALA D C   1 
ATOM   6160  O O   . ALA D 1 10  ? -21.461 49.443  36.100  1.00 166.99 ? 8    ALA D O   1 
ATOM   6161  C CB  . ALA D 1 10  ? -23.764 52.080  37.177  1.00 40.84  ? 8    ALA D CB  1 
ATOM   6162  N N   . GLY D 1 11  ? -22.429 51.198  35.075  1.00 105.89 ? 9    GLY D N   1 
ATOM   6163  C CA  . GLY D 1 11  ? -21.812 50.893  33.802  1.00 102.39 ? 9    GLY D CA  1 
ATOM   6164  C C   . GLY D 1 11  ? -22.603 49.939  32.934  1.00 99.08  ? 9    GLY D C   1 
ATOM   6165  O O   . GLY D 1 11  ? -23.625 49.378  33.343  1.00 97.57  ? 9    GLY D O   1 
ATOM   6166  N N   . GLN D 1 12  ? -22.109 49.760  31.716  1.00 72.83  ? 10   GLN D N   1 
ATOM   6167  C CA  . GLN D 1 12  ? -22.740 48.881  30.754  1.00 70.95  ? 10   GLN D CA  1 
ATOM   6168  C C   . GLN D 1 12  ? -23.084 47.550  31.401  1.00 68.64  ? 10   GLN D C   1 
ATOM   6169  O O   . GLN D 1 12  ? -24.207 47.348  31.861  1.00 70.02  ? 10   GLN D O   1 
ATOM   6170  C CB  . GLN D 1 12  ? -21.801 48.653  29.574  1.00 91.39  ? 10   GLN D CB  1 
ATOM   6171  C CG  . GLN D 1 12  ? -22.496 48.723  28.241  1.00 96.91  ? 10   GLN D CG  1 
ATOM   6172  C CD  . GLN D 1 12  ? -23.229 50.038  28.052  1.00 100.42 ? 10   GLN D CD  1 
ATOM   6173  O OE1 . GLN D 1 12  ? -22.644 51.113  28.185  1.00 100.40 ? 10   GLN D OE1 1 
ATOM   6174  N NE2 . GLN D 1 12  ? -24.517 49.958  27.742  1.00 102.09 ? 10   GLN D NE2 1 
ATOM   6175  N N   . LEU D 1 13  ? -22.097 46.660  31.453  1.00 57.66  ? 11   LEU D N   1 
ATOM   6176  C CA  . LEU D 1 13  ? -22.262 45.328  32.020  1.00 53.67  ? 11   LEU D CA  1 
ATOM   6177  C C   . LEU D 1 13  ? -23.216 45.275  33.209  1.00 52.17  ? 11   LEU D C   1 
ATOM   6178  O O   . LEU D 1 13  ? -24.005 44.335  33.335  1.00 51.03  ? 11   LEU D O   1 
ATOM   6179  C CB  . LEU D 1 13  ? -20.900 44.755  32.417  1.00 62.66  ? 11   LEU D CB  1 
ATOM   6180  C CG  . LEU D 1 13  ? -20.875 43.234  32.608  1.00 62.09  ? 11   LEU D CG  1 
ATOM   6181  C CD1 . LEU D 1 13  ? -21.458 42.562  31.368  1.00 59.17  ? 11   LEU D CD1 1 
ATOM   6182  C CD2 . LEU D 1 13  ? -19.446 42.754  32.856  1.00 61.65  ? 11   LEU D CD2 1 
ATOM   6183  N N   . ALA D 1 14  ? -23.145 46.276  34.082  1.00 47.11  ? 12   ALA D N   1 
ATOM   6184  C CA  . ALA D 1 14  ? -24.032 46.326  35.242  1.00 46.97  ? 12   ALA D CA  1 
ATOM   6185  C C   . ALA D 1 14  ? -25.474 46.243  34.748  1.00 48.21  ? 12   ALA D C   1 
ATOM   6186  O O   . ALA D 1 14  ? -26.232 45.340  35.120  1.00 47.62  ? 12   ALA D O   1 
ATOM   6187  C CB  . ALA D 1 14  ? -23.817 47.620  36.003  1.00 85.60  ? 12   ALA D CB  1 
ATOM   6188  N N   . PHE D 1 15  ? -25.837 47.198  33.897  1.00 57.03  ? 13   PHE D N   1 
ATOM   6189  C CA  . PHE D 1 15  ? -27.165 47.258  33.317  1.00 56.35  ? 13   PHE D CA  1 
ATOM   6190  C C   . PHE D 1 15  ? -27.522 45.949  32.601  1.00 53.58  ? 13   PHE D C   1 
ATOM   6191  O O   . PHE D 1 15  ? -28.617 45.425  32.772  1.00 50.95  ? 13   PHE D O   1 
ATOM   6192  C CB  . PHE D 1 15  ? -27.229 48.426  32.340  1.00 73.67  ? 13   PHE D CB  1 
ATOM   6193  C CG  . PHE D 1 15  ? -28.508 48.500  31.573  1.00 77.66  ? 13   PHE D CG  1 
ATOM   6194  C CD1 . PHE D 1 15  ? -29.655 49.032  32.149  1.00 78.10  ? 13   PHE D CD1 1 
ATOM   6195  C CD2 . PHE D 1 15  ? -28.575 48.010  30.277  1.00 78.94  ? 13   PHE D CD2 1 
ATOM   6196  C CE1 . PHE D 1 15  ? -30.852 49.072  31.445  1.00 78.17  ? 13   PHE D CE1 1 
ATOM   6197  C CE2 . PHE D 1 15  ? -29.761 48.046  29.564  1.00 78.77  ? 13   PHE D CE2 1 
ATOM   6198  C CZ  . PHE D 1 15  ? -30.904 48.577  30.149  1.00 78.47  ? 13   PHE D CZ  1 
ATOM   6199  N N   . ALA D 1 16  ? -26.598 45.417  31.804  1.00 60.52  ? 14   ALA D N   1 
ATOM   6200  C CA  . ALA D 1 16  ? -26.854 44.171  31.077  1.00 59.31  ? 14   ALA D CA  1 
ATOM   6201  C C   . ALA D 1 16  ? -27.402 43.112  32.024  1.00 57.59  ? 14   ALA D C   1 
ATOM   6202  O O   . ALA D 1 16  ? -28.567 42.715  31.921  1.00 56.67  ? 14   ALA D O   1 
ATOM   6203  C CB  . ALA D 1 16  ? -25.575 43.666  30.412  1.00 40.47  ? 14   ALA D CB  1 
ATOM   6204  N N   . LEU D 1 17  ? -26.554 42.658  32.944  1.00 51.79  ? 15   LEU D N   1 
ATOM   6205  C CA  . LEU D 1 17  ? -26.958 41.659  33.923  1.00 48.07  ? 15   LEU D CA  1 
ATOM   6206  C C   . LEU D 1 17  ? -28.167 42.143  34.676  1.00 48.68  ? 15   LEU D C   1 
ATOM   6207  O O   . LEU D 1 17  ? -29.158 41.424  34.818  1.00 50.43  ? 15   LEU D O   1 
ATOM   6208  C CB  . LEU D 1 17  ? -25.849 41.393  34.921  1.00 40.60  ? 15   LEU D CB  1 
ATOM   6209  C CG  . LEU D 1 17  ? -24.944 40.269  34.456  1.00 39.75  ? 15   LEU D CG  1 
ATOM   6210  C CD1 . LEU D 1 17  ? -24.055 40.784  33.334  1.00 42.22  ? 15   LEU D CD1 1 
ATOM   6211  C CD2 . LEU D 1 17  ? -24.118 39.761  35.618  1.00 40.44  ? 15   LEU D CD2 1 
ATOM   6212  N N   . ALA D 1 18  ? -28.069 43.368  35.172  1.00 34.37  ? 16   ALA D N   1 
ATOM   6213  C CA  . ALA D 1 18  ? -29.163 43.965  35.906  1.00 35.97  ? 16   ALA D CA  1 
ATOM   6214  C C   . ALA D 1 18  ? -30.456 43.588  35.199  1.00 37.96  ? 16   ALA D C   1 
ATOM   6215  O O   . ALA D 1 18  ? -31.381 43.056  35.810  1.00 35.54  ? 16   ALA D O   1 
ATOM   6216  C CB  . ALA D 1 18  ? -29.002 45.475  35.936  1.00 27.99  ? 16   ALA D CB  1 
ATOM   6217  N N   . LYS D 1 19  ? -30.495 43.839  33.894  1.00 48.94  ? 17   LYS D N   1 
ATOM   6218  C CA  . LYS D 1 19  ? -31.675 43.541  33.099  1.00 51.14  ? 17   LYS D CA  1 
ATOM   6219  C C   . LYS D 1 19  ? -31.897 42.054  32.871  1.00 48.94  ? 17   LYS D C   1 
ATOM   6220  O O   . LYS D 1 19  ? -32.992 41.543  33.112  1.00 47.95  ? 17   LYS D O   1 
ATOM   6221  C CB  . LYS D 1 19  ? -31.594 44.245  31.754  1.00 90.85  ? 17   LYS D CB  1 
ATOM   6222  C CG  . LYS D 1 19  ? -32.728 43.856  30.851  1.00 98.47  ? 17   LYS D CG  1 
ATOM   6223  C CD  . LYS D 1 19  ? -32.785 44.731  29.637  1.00 105.84 ? 17   LYS D CD  1 
ATOM   6224  C CE  . LYS D 1 19  ? -33.215 46.132  29.987  1.00 110.01 ? 17   LYS D CE  1 
ATOM   6225  N NZ  . LYS D 1 19  ? -33.458 46.891  28.732  1.00 113.66 ? 17   LYS D NZ  1 
ATOM   6226  N N   . GLY D 1 20  ? -30.867 41.364  32.393  1.00 45.59  ? 18   GLY D N   1 
ATOM   6227  C CA  . GLY D 1 20  ? -31.000 39.940  32.154  1.00 45.28  ? 18   GLY D CA  1 
ATOM   6228  C C   . GLY D 1 20  ? -31.708 39.268  33.317  1.00 44.86  ? 18   GLY D C   1 
ATOM   6229  O O   . GLY D 1 20  ? -32.709 38.567  33.144  1.00 43.74  ? 18   GLY D O   1 
ATOM   6230  N N   . PHE D 1 21  ? -31.184 39.506  34.513  1.00 46.42  ? 19   PHE D N   1 
ATOM   6231  C CA  . PHE D 1 21  ? -31.731 38.936  35.733  1.00 46.82  ? 19   PHE D CA  1 
ATOM   6232  C C   . PHE D 1 21  ? -33.185 39.311  35.933  1.00 47.91  ? 19   PHE D C   1 
ATOM   6233  O O   . PHE D 1 21  ? -33.995 38.485  36.353  1.00 49.07  ? 19   PHE D O   1 
ATOM   6234  C CB  . PHE D 1 21  ? -30.900 39.408  36.917  1.00 49.51  ? 19   PHE D CB  1 
ATOM   6235  C CG  . PHE D 1 21  ? -29.474 38.958  36.858  1.00 51.61  ? 19   PHE D CG  1 
ATOM   6236  C CD1 . PHE D 1 21  ? -28.444 39.818  37.202  1.00 53.35  ? 19   PHE D CD1 1 
ATOM   6237  C CD2 . PHE D 1 21  ? -29.159 37.665  36.464  1.00 53.85  ? 19   PHE D CD2 1 
ATOM   6238  C CE1 . PHE D 1 21  ? -27.117 39.394  37.154  1.00 54.07  ? 19   PHE D CE1 1 
ATOM   6239  C CE2 . PHE D 1 21  ? -27.843 37.234  36.412  1.00 53.39  ? 19   PHE D CE2 1 
ATOM   6240  C CZ  . PHE D 1 21  ? -26.819 38.101  36.758  1.00 53.98  ? 19   PHE D CZ  1 
ATOM   6241  N N   . THR D 1 22  ? -33.509 40.564  35.630  1.00 40.94  ? 20   THR D N   1 
ATOM   6242  C CA  . THR D 1 22  ? -34.871 41.062  35.777  1.00 41.48  ? 20   THR D CA  1 
ATOM   6243  C C   . THR D 1 22  ? -35.761 40.315  34.811  1.00 42.13  ? 20   THR D C   1 
ATOM   6244  O O   . THR D 1 22  ? -36.738 39.676  35.203  1.00 41.65  ? 20   THR D O   1 
ATOM   6245  C CB  . THR D 1 22  ? -34.977 42.547  35.414  1.00 46.74  ? 20   THR D CB  1 
ATOM   6246  O OG1 . THR D 1 22  ? -33.936 43.280  36.065  1.00 47.53  ? 20   THR D OG1 1 
ATOM   6247  C CG2 . THR D 1 22  ? -36.331 43.093  35.838  1.00 47.76  ? 20   THR D CG2 1 
ATOM   6248  N N   . ALA D 1 23  ? -35.397 40.423  33.536  1.00 62.26  ? 21   ALA D N   1 
ATOM   6249  C CA  . ALA D 1 23  ? -36.119 39.797  32.441  1.00 62.49  ? 21   ALA D CA  1 
ATOM   6250  C C   . ALA D 1 23  ? -36.218 38.300  32.642  1.00 62.99  ? 21   ALA D C   1 
ATOM   6251  O O   . ALA D 1 23  ? -37.265 37.705  32.398  1.00 62.93  ? 21   ALA D O   1 
ATOM   6252  C CB  . ALA D 1 23  ? -35.417 40.100  31.128  1.00 65.49  ? 21   ALA D CB  1 
ATOM   6253  N N   . ALA D 1 24  ? -35.122 37.695  33.085  1.00 56.01  ? 22   ALA D N   1 
ATOM   6254  C CA  . ALA D 1 24  ? -35.100 36.259  33.314  1.00 58.69  ? 22   ALA D CA  1 
ATOM   6255  C C   . ALA D 1 24  ? -36.086 35.913  34.414  1.00 60.10  ? 22   ALA D C   1 
ATOM   6256  O O   . ALA D 1 24  ? -36.425 34.746  34.620  1.00 59.05  ? 22   ALA D O   1 
ATOM   6257  C CB  . ALA D 1 24  ? -33.706 35.812  33.701  1.00 82.77  ? 22   ALA D CB  1 
ATOM   6258  N N   . GLY D 1 25  ? -36.550 36.942  35.113  1.00 79.82  ? 23   GLY D N   1 
ATOM   6259  C CA  . GLY D 1 25  ? -37.494 36.733  36.191  1.00 81.94  ? 23   GLY D CA  1 
ATOM   6260  C C   . GLY D 1 25  ? -36.863 36.014  37.368  1.00 83.05  ? 23   GLY D C   1 
ATOM   6261  O O   . GLY D 1 25  ? -37.543 35.286  38.094  1.00 83.58  ? 23   GLY D O   1 
ATOM   6262  N N   . VAL D 1 26  ? -35.560 36.215  37.556  1.00 79.79  ? 24   VAL D N   1 
ATOM   6263  C CA  . VAL D 1 26  ? -34.839 35.579  38.653  1.00 78.29  ? 24   VAL D CA  1 
ATOM   6264  C C   . VAL D 1 26  ? -35.198 36.287  39.945  1.00 78.54  ? 24   VAL D C   1 
ATOM   6265  O O   . VAL D 1 26  ? -35.559 35.658  40.939  1.00 79.05  ? 24   VAL D O   1 
ATOM   6266  C CB  . VAL D 1 26  ? -33.314 35.679  38.472  1.00 60.66  ? 24   VAL D CB  1 
ATOM   6267  C CG1 . VAL D 1 26  ? -32.619 34.680  39.393  1.00 59.78  ? 24   VAL D CG1 1 
ATOM   6268  C CG2 . VAL D 1 26  ? -32.943 35.439  37.027  1.00 56.73  ? 24   VAL D CG2 1 
ATOM   6269  N N   . LEU D 1 27  ? -35.085 37.609  39.915  1.00 68.56  ? 25   LEU D N   1 
ATOM   6270  C CA  . LEU D 1 27  ? -35.403 38.440  41.064  1.00 69.79  ? 25   LEU D CA  1 
ATOM   6271  C C   . LEU D 1 27  ? -35.904 39.785  40.562  1.00 70.21  ? 25   LEU D C   1 
ATOM   6272  O O   . LEU D 1 27  ? -35.723 40.127  39.389  1.00 70.67  ? 25   LEU D O   1 
ATOM   6273  C CB  . LEU D 1 27  ? -34.170 38.649  41.935  1.00 87.25  ? 25   LEU D CB  1 
ATOM   6274  C CG  . LEU D 1 27  ? -33.045 39.440  41.276  1.00 89.14  ? 25   LEU D CG  1 
ATOM   6275  C CD1 . LEU D 1 27  ? -31.993 39.793  42.315  1.00 89.78  ? 25   LEU D CD1 1 
ATOM   6276  C CD2 . LEU D 1 27  ? -32.452 38.624  40.137  1.00 89.36  ? 25   LEU D CD2 1 
ATOM   6277  N N   . ALA D 1 28  ? -36.530 40.548  41.451  1.00 58.15  ? 26   ALA D N   1 
ATOM   6278  C CA  . ALA D 1 28  ? -37.076 41.845  41.087  1.00 58.77  ? 26   ALA D CA  1 
ATOM   6279  C C   . ALA D 1 28  ? -35.989 42.903  40.941  1.00 60.04  ? 26   ALA D C   1 
ATOM   6280  O O   . ALA D 1 28  ? -34.892 42.764  41.485  1.00 59.10  ? 26   ALA D O   1 
ATOM   6281  C CB  . ALA D 1 28  ? -38.096 42.274  42.122  1.00 62.03  ? 26   ALA D CB  1 
ATOM   6282  N N   . ALA D 1 29  ? -36.299 43.960  40.196  1.00 73.40  ? 27   ALA D N   1 
ATOM   6283  C CA  . ALA D 1 29  ? -35.347 45.042  39.977  1.00 76.38  ? 27   ALA D CA  1 
ATOM   6284  C C   . ALA D 1 29  ? -35.037 45.755  41.288  1.00 77.65  ? 27   ALA D C   1 
ATOM   6285  O O   . ALA D 1 29  ? -33.887 46.103  41.569  1.00 76.40  ? 27   ALA D O   1 
ATOM   6286  C CB  . ALA D 1 29  ? -35.909 46.031  38.966  1.00 81.07  ? 27   ALA D CB  1 
ATOM   6287  N N   . HIS D 1 30  ? -36.074 45.971  42.087  1.00 82.00  ? 28   HIS D N   1 
ATOM   6288  C CA  . HIS D 1 30  ? -35.918 46.638  43.367  1.00 82.10  ? 28   HIS D CA  1 
ATOM   6289  C C   . HIS D 1 30  ? -35.093 45.773  44.307  1.00 82.05  ? 28   HIS D C   1 
ATOM   6290  O O   . HIS D 1 30  ? -34.736 46.199  45.401  1.00 83.20  ? 28   HIS D O   1 
ATOM   6291  C CB  . HIS D 1 30  ? -37.292 46.926  43.986  1.00 85.98  ? 28   HIS D CB  1 
ATOM   6292  C CG  . HIS D 1 30  ? -38.053 45.701  44.407  1.00 86.50  ? 28   HIS D CG  1 
ATOM   6293  N ND1 . HIS D 1 30  ? -39.296 45.769  45.000  1.00 86.98  ? 28   HIS D ND1 1 
ATOM   6294  C CD2 . HIS D 1 30  ? -37.747 44.384  44.331  1.00 86.86  ? 28   HIS D CD2 1 
ATOM   6295  C CE1 . HIS D 1 30  ? -39.724 44.548  45.270  1.00 86.16  ? 28   HIS D CE1 1 
ATOM   6296  N NE2 . HIS D 1 30  ? -38.803 43.689  44.873  1.00 86.58  ? 28   HIS D NE2 1 
ATOM   6297  N N   . LYS D 1 31  ? -34.801 44.552  43.873  1.00 61.98  ? 29   LYS D N   1 
ATOM   6298  C CA  . LYS D 1 31  ? -34.015 43.617  44.670  1.00 60.31  ? 29   LYS D CA  1 
ATOM   6299  C C   . LYS D 1 31  ? -32.545 43.702  44.297  1.00 58.23  ? 29   LYS D C   1 
ATOM   6300  O O   . LYS D 1 31  ? -31.724 42.900  44.747  1.00 56.32  ? 29   LYS D O   1 
ATOM   6301  C CB  . LYS D 1 31  ? -34.518 42.186  44.463  1.00 81.65  ? 29   LYS D CB  1 
ATOM   6302  C CG  . LYS D 1 31  ? -35.555 41.738  45.481  1.00 83.99  ? 29   LYS D CG  1 
ATOM   6303  C CD  . LYS D 1 31  ? -34.953 41.681  46.880  1.00 85.39  ? 29   LYS D CD  1 
ATOM   6304  C CE  . LYS D 1 31  ? -35.924 41.081  47.878  1.00 85.34  ? 29   LYS D CE  1 
ATOM   6305  N NZ  . LYS D 1 31  ? -35.326 40.955  49.233  1.00 86.20  ? 29   LYS D NZ  1 
ATOM   6306  N N   . ILE D 1 32  ? -32.220 44.689  43.473  1.00 56.02  ? 30   ILE D N   1 
ATOM   6307  C CA  . ILE D 1 32  ? -30.852 44.881  43.034  1.00 53.76  ? 30   ILE D CA  1 
ATOM   6308  C C   . ILE D 1 32  ? -30.341 46.244  43.463  1.00 53.98  ? 30   ILE D C   1 
ATOM   6309  O O   . ILE D 1 32  ? -31.113 47.189  43.649  1.00 52.11  ? 30   ILE D O   1 
ATOM   6310  C CB  . ILE D 1 32  ? -30.765 44.777  41.526  1.00 62.79  ? 30   ILE D CB  1 
ATOM   6311  C CG1 . ILE D 1 32  ? -31.508 43.529  41.067  1.00 62.62  ? 30   ILE D CG1 1 
ATOM   6312  C CG2 . ILE D 1 32  ? -29.316 44.732  41.096  1.00 60.99  ? 30   ILE D CG2 1 
ATOM   6313  C CD1 . ILE D 1 32  ? -31.749 43.497  39.591  1.00 66.13  ? 30   ILE D CD1 1 
ATOM   6314  N N   . MET D 1 33  ? -29.029 46.346  43.609  1.00 42.52  ? 31   MET D N   1 
ATOM   6315  C CA  . MET D 1 33  ? -28.425 47.591  44.037  1.00 46.87  ? 31   MET D CA  1 
ATOM   6316  C C   . MET D 1 33  ? -27.159 47.877  43.241  1.00 48.00  ? 31   MET D C   1 
ATOM   6317  O O   . MET D 1 33  ? -26.398 46.960  42.929  1.00 46.55  ? 31   MET D O   1 
ATOM   6318  C CB  . MET D 1 33  ? -28.086 47.503  45.528  1.00 105.27 ? 31   MET D CB  1 
ATOM   6319  C CG  . MET D 1 33  ? -27.473 48.762  46.114  1.00 110.55 ? 31   MET D CG  1 
ATOM   6320  S SD  . MET D 1 33  ? -28.590 49.631  47.224  1.00 114.81 ? 31   MET D SD  1 
ATOM   6321  C CE  . MET D 1 33  ? -27.654 49.599  48.726  1.00 116.41 ? 31   MET D CE  1 
ATOM   6322  N N   . ALA D 1 34  ? -26.933 49.152  42.924  1.00 77.78  ? 32   ALA D N   1 
ATOM   6323  C CA  . ALA D 1 34  ? -25.744 49.552  42.178  1.00 80.40  ? 32   ALA D CA  1 
ATOM   6324  C C   . ALA D 1 34  ? -25.120 50.841  42.706  1.00 82.26  ? 32   ALA D C   1 
ATOM   6325  O O   . ALA D 1 34  ? -25.814 51.808  43.021  1.00 81.70  ? 32   ALA D O   1 
ATOM   6326  C CB  . ALA D 1 34  ? -26.076 49.707  40.713  1.00 81.34  ? 32   ALA D CB  1 
ATOM   6327  N N   . SER D 1 35  ? -23.795 50.838  42.788  1.00 72.08  ? 33   SER D N   1 
ATOM   6328  C CA  . SER D 1 35  ? -23.041 51.983  43.272  1.00 74.21  ? 33   SER D CA  1 
ATOM   6329  C C   . SER D 1 35  ? -22.756 52.931  42.122  1.00 76.53  ? 33   SER D C   1 
ATOM   6330  O O   . SER D 1 35  ? -22.132 52.547  41.133  1.00 76.53  ? 33   SER D O   1 
ATOM   6331  C CB  . SER D 1 35  ? -21.722 51.515  43.876  1.00 75.53  ? 33   SER D CB  1 
ATOM   6332  O OG  . SER D 1 35  ? -21.931 50.507  44.849  1.00 75.37  ? 33   SER D OG  1 
ATOM   6333  N N   . SER D 1 36  ? -23.208 54.171  42.256  1.00 121.70 ? 34   SER D N   1 
ATOM   6334  C CA  . SER D 1 36  ? -22.999 55.167  41.218  1.00 126.06 ? 34   SER D CA  1 
ATOM   6335  C C   . SER D 1 36  ? -21.869 56.117  41.586  1.00 128.46 ? 34   SER D C   1 
ATOM   6336  O O   . SER D 1 36  ? -22.114 57.238  42.033  1.00 128.70 ? 34   SER D O   1 
ATOM   6337  C CB  . SER D 1 36  ? -24.282 55.973  40.987  1.00 88.06  ? 34   SER D CB  1 
ATOM   6338  O OG  . SER D 1 36  ? -24.627 56.734  42.133  1.00 87.76  ? 34   SER D OG  1 
ATOM   6339  N N   . PRO D 1 37  ? -20.611 55.685  41.405  1.00 112.06 ? 35   PRO D N   1 
ATOM   6340  C CA  . PRO D 1 37  ? -19.513 56.590  41.752  1.00 113.74 ? 35   PRO D CA  1 
ATOM   6341  C C   . PRO D 1 37  ? -19.622 57.859  40.911  1.00 115.88 ? 35   PRO D C   1 
ATOM   6342  O O   . PRO D 1 37  ? -18.853 58.806  41.087  1.00 115.87 ? 35   PRO D O   1 
ATOM   6343  C CB  . PRO D 1 37  ? -18.274 55.766  41.413  1.00 108.09 ? 35   PRO D CB  1 
ATOM   6344  C CG  . PRO D 1 37  ? -18.742 54.956  40.242  1.00 108.73 ? 35   PRO D CG  1 
ATOM   6345  C CD  . PRO D 1 37  ? -20.101 54.488  40.716  1.00 107.27 ? 35   PRO D CD  1 
ATOM   6346  N N   . ASP D 1 38  ? -20.593 57.862  39.998  1.00 116.07 ? 36   ASP D N   1 
ATOM   6347  C CA  . ASP D 1 38  ? -20.835 58.992  39.108  1.00 117.71 ? 36   ASP D CA  1 
ATOM   6348  C C   . ASP D 1 38  ? -22.254 58.928  38.541  1.00 117.67 ? 36   ASP D C   1 
ATOM   6349  O O   . ASP D 1 38  ? -22.878 57.866  38.530  1.00 116.65 ? 36   ASP D O   1 
ATOM   6350  C CB  . ASP D 1 38  ? -19.817 58.979  37.964  1.00 142.01 ? 36   ASP D CB  1 
ATOM   6351  C CG  . ASP D 1 38  ? -19.871 60.234  37.121  1.00 144.76 ? 36   ASP D CG  1 
ATOM   6352  O OD1 . ASP D 1 38  ? -20.888 60.445  36.430  1.00 146.83 ? 36   ASP D OD1 1 
ATOM   6353  O OD2 . ASP D 1 38  ? -18.896 61.014  37.155  1.00 146.67 ? 36   ASP D OD2 1 
ATOM   6354  N N   . MET D 1 39  ? -22.753 60.069  38.071  1.00 91.26  ? 37   MET D N   1 
ATOM   6355  C CA  . MET D 1 39  ? -24.095 60.161  37.500  1.00 93.11  ? 37   MET D CA  1 
ATOM   6356  C C   . MET D 1 39  ? -24.141 60.451  36.005  1.00 93.08  ? 37   MET D C   1 
ATOM   6357  O O   . MET D 1 39  ? -23.674 61.494  35.552  1.00 92.87  ? 37   MET D O   1 
ATOM   6358  C CB  . MET D 1 39  ? -24.906 61.239  38.216  1.00 141.72 ? 37   MET D CB  1 
ATOM   6359  C CG  . MET D 1 39  ? -25.822 60.694  39.275  1.00 144.26 ? 37   MET D CG  1 
ATOM   6360  S SD  . MET D 1 39  ? -26.584 59.164  38.713  1.00 147.47 ? 37   MET D SD  1 
ATOM   6361  C CE  . MET D 1 39  ? -27.767 59.754  37.489  1.00 145.37 ? 37   MET D CE  1 
ATOM   6362  N N   . ASP D 1 40  ? -24.730 59.533  35.246  1.00 147.78 ? 38   ASP D N   1 
ATOM   6363  C CA  . ASP D 1 40  ? -24.859 59.702  33.803  1.00 147.80 ? 38   ASP D CA  1 
ATOM   6364  C C   . ASP D 1 40  ? -26.210 59.158  33.339  1.00 149.00 ? 38   ASP D C   1 
ATOM   6365  O O   . ASP D 1 40  ? -26.629 58.079  33.758  1.00 149.99 ? 38   ASP D O   1 
ATOM   6366  C CB  . ASP D 1 40  ? -23.726 58.973  33.067  1.00 89.51  ? 38   ASP D CB  1 
ATOM   6367  C CG  . ASP D 1 40  ? -23.822 57.465  33.192  1.00 86.49  ? 38   ASP D CG  1 
ATOM   6368  O OD1 . ASP D 1 40  ? -23.589 56.945  34.303  1.00 83.47  ? 38   ASP D OD1 1 
ATOM   6369  O OD2 . ASP D 1 40  ? -24.141 56.801  32.180  1.00 83.49  ? 38   ASP D OD2 1 
ATOM   6370  N N   . LEU D 1 41  ? -26.892 59.913  32.481  1.00 162.56 ? 39   LEU D N   1 
ATOM   6371  C CA  . LEU D 1 41  ? -28.195 59.506  31.954  1.00 162.61 ? 39   LEU D CA  1 
ATOM   6372  C C   . LEU D 1 41  ? -28.115 58.129  31.302  1.00 161.29 ? 39   LEU D C   1 
ATOM   6373  O O   . LEU D 1 41  ? -29.064 57.343  31.354  1.00 160.58 ? 39   LEU D O   1 
ATOM   6374  C CB  . LEU D 1 41  ? -28.688 60.517  30.909  1.00 121.31 ? 39   LEU D CB  1 
ATOM   6375  C CG  . LEU D 1 41  ? -29.109 61.928  31.326  1.00 120.73 ? 39   LEU D CG  1 
ATOM   6376  C CD1 . LEU D 1 41  ? -29.056 62.863  30.122  1.00 120.45 ? 39   LEU D CD1 1 
ATOM   6377  C CD2 . LEU D 1 41  ? -30.510 61.883  31.916  1.00 119.43 ? 39   LEU D CD2 1 
ATOM   6378  N N   . ALA D 1 42  ? -26.976 57.848  30.678  1.00 101.19 ? 40   ALA D N   1 
ATOM   6379  C CA  . ALA D 1 42  ? -26.776 56.581  30.002  1.00 97.71  ? 40   ALA D CA  1 
ATOM   6380  C C   . ALA D 1 42  ? -27.077 55.420  30.931  1.00 95.54  ? 40   ALA D C   1 
ATOM   6381  O O   . ALA D 1 42  ? -28.235 55.079  31.165  1.00 95.83  ? 40   ALA D O   1 
ATOM   6382  C CB  . ALA D 1 42  ? -25.349 56.485  29.484  1.00 92.07  ? 40   ALA D CB  1 
ATOM   6383  N N   . THR D 1 43  ? -26.020 54.824  31.464  1.00 87.17  ? 41   THR D N   1 
ATOM   6384  C CA  . THR D 1 43  ? -26.146 53.684  32.357  1.00 85.09  ? 41   THR D CA  1 
ATOM   6385  C C   . THR D 1 43  ? -27.111 53.918  33.511  1.00 83.38  ? 41   THR D C   1 
ATOM   6386  O O   . THR D 1 43  ? -28.229 53.394  33.519  1.00 82.65  ? 41   THR D O   1 
ATOM   6387  C CB  . THR D 1 43  ? -24.784 53.306  32.953  1.00 112.34 ? 41   THR D CB  1 
ATOM   6388  O OG1 . THR D 1 43  ? -23.858 53.019  31.899  1.00 112.82 ? 41   THR D OG1 1 
ATOM   6389  C CG2 . THR D 1 43  ? -24.925 52.090  33.848  1.00 113.30 ? 41   THR D CG2 1 
ATOM   6390  N N   . VAL D 1 44  ? -26.654 54.704  34.483  1.00 88.06  ? 42   VAL D N   1 
ATOM   6391  C CA  . VAL D 1 44  ? -27.416 55.030  35.683  1.00 85.58  ? 42   VAL D CA  1 
ATOM   6392  C C   . VAL D 1 44  ? -28.907 55.255  35.453  1.00 84.44  ? 42   VAL D C   1 
ATOM   6393  O O   . VAL D 1 44  ? -29.730 54.415  35.821  1.00 83.90  ? 42   VAL D O   1 
ATOM   6394  C CB  . VAL D 1 44  ? -26.853 56.283  36.371  1.00 113.70 ? 42   VAL D CB  1 
ATOM   6395  C CG1 . VAL D 1 44  ? -27.540 56.473  37.703  1.00 114.64 ? 42   VAL D CG1 1 
ATOM   6396  C CG2 . VAL D 1 44  ? -25.347 56.155  36.552  1.00 113.33 ? 42   VAL D CG2 1 
ATOM   6397  N N   . SER D 1 45  ? -29.246 56.396  34.858  1.00 79.56  ? 43   SER D N   1 
ATOM   6398  C CA  . SER D 1 45  ? -30.639 56.748  34.586  1.00 77.87  ? 43   SER D CA  1 
ATOM   6399  C C   . SER D 1 45  ? -31.482 55.539  34.189  1.00 76.60  ? 43   SER D C   1 
ATOM   6400  O O   . SER D 1 45  ? -32.496 55.238  34.823  1.00 75.00  ? 43   SER D O   1 
ATOM   6401  C CB  . SER D 1 45  ? -30.707 57.803  33.481  1.00 86.08  ? 43   SER D CB  1 
ATOM   6402  O OG  . SER D 1 45  ? -32.049 58.160  33.208  1.00 84.57  ? 43   SER D OG  1 
ATOM   6403  N N   . ALA D 1 46  ? -31.054 54.855  33.134  1.00 91.22  ? 44   ALA D N   1 
ATOM   6404  C CA  . ALA D 1 46  ? -31.751 53.673  32.646  1.00 90.94  ? 44   ALA D CA  1 
ATOM   6405  C C   . ALA D 1 46  ? -32.141 52.779  33.813  1.00 90.89  ? 44   ALA D C   1 
ATOM   6406  O O   . ALA D 1 46  ? -33.318 52.485  34.021  1.00 91.63  ? 44   ALA D O   1 
ATOM   6407  C CB  . ALA D 1 46  ? -30.855 52.915  31.694  1.00 66.55  ? 44   ALA D CB  1 
ATOM   6408  N N   . LEU D 1 47  ? -31.132 52.351  34.566  1.00 68.36  ? 45   LEU D N   1 
ATOM   6409  C CA  . LEU D 1 47  ? -31.315 51.493  35.732  1.00 66.69  ? 45   LEU D CA  1 
ATOM   6410  C C   . LEU D 1 47  ? -32.412 52.032  36.634  1.00 66.16  ? 45   LEU D C   1 
ATOM   6411  O O   . LEU D 1 47  ? -33.297 51.293  37.069  1.00 64.67  ? 45   LEU D O   1 
ATOM   6412  C CB  . LEU D 1 47  ? -30.009 51.413  36.512  1.00 83.79  ? 45   LEU D CB  1 
ATOM   6413  C CG  . LEU D 1 47  ? -28.843 50.822  35.719  1.00 85.94  ? 45   LEU D CG  1 
ATOM   6414  C CD1 . LEU D 1 47  ? -27.529 51.090  36.433  1.00 86.44  ? 45   LEU D CD1 1 
ATOM   6415  C CD2 . LEU D 1 47  ? -29.069 49.328  35.532  1.00 87.29  ? 45   LEU D CD2 1 
ATOM   6416  N N   . ARG D 1 48  ? -32.340 53.326  36.922  1.00 70.80  ? 46   ARG D N   1 
ATOM   6417  C CA  . ARG D 1 48  ? -33.347 53.952  37.758  1.00 72.56  ? 46   ARG D CA  1 
ATOM   6418  C C   . ARG D 1 48  ? -34.699 53.608  37.177  1.00 71.82  ? 46   ARG D C   1 
ATOM   6419  O O   . ARG D 1 48  ? -35.501 52.930  37.814  1.00 71.45  ? 46   ARG D O   1 
ATOM   6420  C CB  . ARG D 1 48  ? -33.191 55.467  37.766  1.00 115.65 ? 46   ARG D CB  1 
ATOM   6421  C CG  . ARG D 1 48  ? -31.955 55.971  38.451  1.00 120.24 ? 46   ARG D CG  1 
ATOM   6422  C CD  . ARG D 1 48  ? -32.165 57.409  38.856  1.00 125.21 ? 46   ARG D CD  1 
ATOM   6423  N NE  . ARG D 1 48  ? -30.990 57.970  39.504  1.00 129.51 ? 46   ARG D NE  1 
ATOM   6424  C CZ  . ARG D 1 48  ? -30.990 59.118  40.170  1.00 132.21 ? 46   ARG D CZ  1 
ATOM   6425  N NH1 . ARG D 1 48  ? -32.109 59.826  40.278  1.00 133.36 ? 46   ARG D NH1 1 
ATOM   6426  N NH2 . ARG D 1 48  ? -29.870 59.555  40.727  1.00 133.62 ? 46   ARG D NH2 1 
ATOM   6427  N N   . LYS D 1 49  ? -34.942 54.086  35.959  1.00 87.04  ? 47   LYS D N   1 
ATOM   6428  C CA  . LYS D 1 49  ? -36.201 53.828  35.276  1.00 87.32  ? 47   LYS D CA  1 
ATOM   6429  C C   . LYS D 1 49  ? -36.515 52.350  35.429  1.00 85.85  ? 47   LYS D C   1 
ATOM   6430  O O   . LYS D 1 49  ? -37.635 51.968  35.779  1.00 84.33  ? 47   LYS D O   1 
ATOM   6431  C CB  . LYS D 1 49  ? -36.086 54.151  33.786  1.00 109.00 ? 47   LYS D CB  1 
ATOM   6432  C CG  . LYS D 1 49  ? -35.603 55.547  33.465  1.00 112.32 ? 47   LYS D CG  1 
ATOM   6433  C CD  . LYS D 1 49  ? -35.440 55.706  31.962  1.00 113.82 ? 47   LYS D CD  1 
ATOM   6434  C CE  . LYS D 1 49  ? -34.731 57.001  31.610  1.00 115.86 ? 47   LYS D CE  1 
ATOM   6435  N NZ  . LYS D 1 49  ? -34.433 57.081  30.152  1.00 115.10 ? 47   LYS D NZ  1 
ATOM   6436  N N   . MET D 1 50  ? -35.503 51.526  35.175  1.00 74.01  ? 48   MET D N   1 
ATOM   6437  C CA  . MET D 1 50  ? -35.656 50.086  35.258  1.00 73.65  ? 48   MET D CA  1 
ATOM   6438  C C   . MET D 1 50  ? -36.292 49.654  36.573  1.00 73.08  ? 48   MET D C   1 
ATOM   6439  O O   . MET D 1 50  ? -37.004 48.651  36.624  1.00 72.98  ? 48   MET D O   1 
ATOM   6440  C CB  . MET D 1 50  ? -34.303 49.397  35.078  1.00 88.34  ? 48   MET D CB  1 
ATOM   6441  C CG  . MET D 1 50  ? -34.428 47.890  34.941  1.00 88.64  ? 48   MET D CG  1 
ATOM   6442  S SD  . MET D 1 50  ? -32.899 47.072  34.474  1.00 89.99  ? 48   MET D SD  1 
ATOM   6443  C CE  . MET D 1 50  ? -32.492 46.216  35.999  1.00 91.73  ? 48   MET D CE  1 
ATOM   6444  N N   . GLY D 1 51  ? -36.041 50.415  37.634  1.00 91.45  ? 49   GLY D N   1 
ATOM   6445  C CA  . GLY D 1 51  ? -36.609 50.079  38.929  1.00 89.96  ? 49   GLY D CA  1 
ATOM   6446  C C   . GLY D 1 51  ? -35.573 49.562  39.911  1.00 88.65  ? 49   GLY D C   1 
ATOM   6447  O O   . GLY D 1 51  ? -35.869 49.288  41.078  1.00 88.52  ? 49   GLY D O   1 
ATOM   6448  N N   . VAL D 1 52  ? -34.345 49.423  39.434  1.00 77.69  ? 50   VAL D N   1 
ATOM   6449  C CA  . VAL D 1 52  ? -33.271 48.942  40.277  1.00 76.45  ? 50   VAL D CA  1 
ATOM   6450  C C   . VAL D 1 52  ? -32.893 50.070  41.239  1.00 75.77  ? 50   VAL D C   1 
ATOM   6451  O O   . VAL D 1 52  ? -33.145 51.243  40.954  1.00 73.52  ? 50   VAL D O   1 
ATOM   6452  C CB  . VAL D 1 52  ? -32.058 48.552  39.426  1.00 66.60  ? 50   VAL D CB  1 
ATOM   6453  C CG1 . VAL D 1 52  ? -31.336 49.804  38.955  1.00 68.00  ? 50   VAL D CG1 1 
ATOM   6454  C CG2 . VAL D 1 52  ? -31.147 47.641  40.214  1.00 66.31  ? 50   VAL D CG2 1 
ATOM   6455  N N   . LYS D 1 53  ? -32.291 49.712  42.371  1.00 62.52  ? 51   LYS D N   1 
ATOM   6456  C CA  . LYS D 1 53  ? -31.895 50.695  43.377  1.00 60.98  ? 51   LYS D CA  1 
ATOM   6457  C C   . LYS D 1 53  ? -30.453 51.165  43.237  1.00 59.33  ? 51   LYS D C   1 
ATOM   6458  O O   . LYS D 1 53  ? -29.541 50.360  43.009  1.00 56.31  ? 51   LYS D O   1 
ATOM   6459  C CB  . LYS D 1 53  ? -32.141 50.125  44.773  1.00 104.48 ? 51   LYS D CB  1 
ATOM   6460  C CG  . LYS D 1 53  ? -33.617 49.929  45.065  1.00 108.32 ? 51   LYS D CG  1 
ATOM   6461  C CD  . LYS D 1 53  ? -33.868 49.459  46.481  1.00 110.89 ? 51   LYS D CD  1 
ATOM   6462  C CE  . LYS D 1 53  ? -35.359 49.431  46.776  1.00 113.86 ? 51   LYS D CE  1 
ATOM   6463  N NZ  . LYS D 1 53  ? -35.654 48.849  48.114  1.00 116.82 ? 51   LYS D NZ  1 
ATOM   6464  N N   . LEU D 1 54  ? -30.254 52.474  43.398  1.00 76.57  ? 52   LEU D N   1 
ATOM   6465  C CA  . LEU D 1 54  ? -28.934 53.079  43.239  1.00 77.78  ? 52   LEU D CA  1 
ATOM   6466  C C   . LEU D 1 54  ? -28.458 53.987  44.376  1.00 78.49  ? 52   LEU D C   1 
ATOM   6467  O O   . LEU D 1 54  ? -29.214 54.826  44.872  1.00 78.87  ? 52   LEU D O   1 
ATOM   6468  C CB  . LEU D 1 54  ? -28.922 53.876  41.940  1.00 64.43  ? 52   LEU D CB  1 
ATOM   6469  C CG  . LEU D 1 54  ? -29.453 53.120  40.727  1.00 65.35  ? 52   LEU D CG  1 
ATOM   6470  C CD1 . LEU D 1 54  ? -29.521 54.036  39.520  1.00 66.47  ? 52   LEU D CD1 1 
ATOM   6471  C CD2 . LEU D 1 54  ? -28.550 51.938  40.464  1.00 66.39  ? 52   LEU D CD2 1 
ATOM   6472  N N   . THR D 1 55  ? -27.190 53.825  44.760  1.00 78.88  ? 53   THR D N   1 
ATOM   6473  C CA  . THR D 1 55  ? -26.568 54.621  45.821  1.00 79.94  ? 53   THR D CA  1 
ATOM   6474  C C   . THR D 1 55  ? -25.122 54.947  45.482  1.00 79.23  ? 53   THR D C   1 
ATOM   6475  O O   . THR D 1 55  ? -24.394 54.105  44.962  1.00 79.10  ? 53   THR D O   1 
ATOM   6476  C CB  . THR D 1 55  ? -26.566 53.877  47.164  1.00 100.45 ? 53   THR D CB  1 
ATOM   6477  O OG1 . THR D 1 55  ? -27.884 53.890  47.719  1.00 106.17 ? 53   THR D OG1 1 
ATOM   6478  C CG2 . THR D 1 55  ? -25.606 54.535  48.137  1.00 101.08 ? 53   THR D CG2 1 
ATOM   6479  N N   . PRO D 1 56  ? -24.684 56.179  45.775  1.00 88.90  ? 54   PRO D N   1 
ATOM   6480  C CA  . PRO D 1 56  ? -23.300 56.557  45.477  1.00 88.76  ? 54   PRO D CA  1 
ATOM   6481  C C   . PRO D 1 56  ? -22.335 56.006  46.518  1.00 89.53  ? 54   PRO D C   1 
ATOM   6482  O O   . PRO D 1 56  ? -21.145 56.322  46.500  1.00 90.12  ? 54   PRO D O   1 
ATOM   6483  C CB  . PRO D 1 56  ? -23.352 58.079  45.488  1.00 47.78  ? 54   PRO D CB  1 
ATOM   6484  C CG  . PRO D 1 56  ? -24.370 58.355  46.554  1.00 47.00  ? 54   PRO D CG  1 
ATOM   6485  C CD  . PRO D 1 56  ? -25.458 57.339  46.256  1.00 47.78  ? 54   PRO D CD  1 
ATOM   6486  N N   . HIS D 1 57  ? -22.855 55.180  47.423  1.00 61.62  ? 55   HIS D N   1 
ATOM   6487  C CA  . HIS D 1 57  ? -22.041 54.592  48.484  1.00 62.04  ? 55   HIS D CA  1 
ATOM   6488  C C   . HIS D 1 57  ? -21.934 53.083  48.339  1.00 61.56  ? 55   HIS D C   1 
ATOM   6489  O O   . HIS D 1 57  ? -22.909 52.353  48.532  1.00 59.14  ? 55   HIS D O   1 
ATOM   6490  C CB  . HIS D 1 57  ? -22.639 54.932  49.844  1.00 98.71  ? 55   HIS D CB  1 
ATOM   6491  C CG  . HIS D 1 57  ? -23.081 56.356  49.961  1.00 100.81 ? 55   HIS D CG  1 
ATOM   6492  N ND1 . HIS D 1 57  ? -22.234 57.419  49.732  1.00 101.13 ? 55   HIS D ND1 1 
ATOM   6493  C CD2 . HIS D 1 57  ? -24.284 56.892  50.273  1.00 101.56 ? 55   HIS D CD2 1 
ATOM   6494  C CE1 . HIS D 1 57  ? -22.897 58.549  49.898  1.00 101.47 ? 55   HIS D CE1 1 
ATOM   6495  N NE2 . HIS D 1 57  ? -24.144 58.257  50.227  1.00 101.95 ? 55   HIS D NE2 1 
ATOM   6496  N N   . ASN D 1 58  ? -20.730 52.627  48.017  1.00 85.39  ? 56   ASN D N   1 
ATOM   6497  C CA  . ASN D 1 58  ? -20.457 51.213  47.808  1.00 88.17  ? 56   ASN D CA  1 
ATOM   6498  C C   . ASN D 1 58  ? -20.707 50.305  49.010  1.00 88.16  ? 56   ASN D C   1 
ATOM   6499  O O   . ASN D 1 58  ? -20.940 49.105  48.847  1.00 89.16  ? 56   ASN D O   1 
ATOM   6500  C CB  . ASN D 1 58  ? -19.022 51.058  47.316  1.00 91.68  ? 56   ASN D CB  1 
ATOM   6501  C CG  . ASN D 1 58  ? -18.749 51.885  46.076  1.00 93.16  ? 56   ASN D CG  1 
ATOM   6502  O OD1 . ASN D 1 58  ? -19.349 51.664  45.030  1.00 94.42  ? 56   ASN D OD1 1 
ATOM   6503  N ND2 . ASN D 1 58  ? -17.848 52.851  46.190  1.00 95.07  ? 56   ASN D ND2 1 
ATOM   6504  N N   . LYS D 1 59  ? -20.655 50.865  50.214  1.00 78.05  ? 57   LYS D N   1 
ATOM   6505  C CA  . LYS D 1 59  ? -20.907 50.069  51.408  1.00 76.76  ? 57   LYS D CA  1 
ATOM   6506  C C   . LYS D 1 59  ? -22.393 49.752  51.458  1.00 74.76  ? 57   LYS D C   1 
ATOM   6507  O O   . LYS D 1 59  ? -22.779 48.588  51.594  1.00 73.63  ? 57   LYS D O   1 
ATOM   6508  C CB  . LYS D 1 59  ? -20.469 50.821  52.671  1.00 108.00 ? 57   LYS D CB  1 
ATOM   6509  C CG  . LYS D 1 59  ? -18.954 50.957  52.776  1.00 113.60 ? 57   LYS D CG  1 
ATOM   6510  C CD  . LYS D 1 59  ? -18.480 51.461  54.135  1.00 117.24 ? 57   LYS D CD  1 
ATOM   6511  C CE  . LYS D 1 59  ? -16.948 51.476  54.199  1.00 118.65 ? 57   LYS D CE  1 
ATOM   6512  N NZ  . LYS D 1 59  ? -16.397 51.953  55.500  1.00 117.47 ? 57   LYS D NZ  1 
ATOM   6513  N N   . GLU D 1 60  ? -23.222 50.787  51.325  1.00 69.28  ? 58   GLU D N   1 
ATOM   6514  C CA  . GLU D 1 60  ? -24.674 50.620  51.339  1.00 68.72  ? 58   GLU D CA  1 
ATOM   6515  C C   . GLU D 1 60  ? -25.000 49.422  50.455  1.00 65.82  ? 58   GLU D C   1 
ATOM   6516  O O   . GLU D 1 60  ? -25.810 48.569  50.812  1.00 65.04  ? 58   GLU D O   1 
ATOM   6517  C CB  . GLU D 1 60  ? -25.365 51.882  50.803  1.00 94.41  ? 58   GLU D CB  1 
ATOM   6518  C CG  . GLU D 1 60  ? -26.436 52.444  51.735  1.00 100.68 ? 58   GLU D CG  1 
ATOM   6519  C CD  . GLU D 1 60  ? -27.047 53.737  51.225  1.00 104.62 ? 58   GLU D CD  1 
ATOM   6520  O OE1 . GLU D 1 60  ? -26.286 54.696  50.982  1.00 106.72 ? 58   GLU D OE1 1 
ATOM   6521  O OE2 . GLU D 1 60  ? -28.287 53.799  51.073  1.00 107.93 ? 58   GLU D OE2 1 
ATOM   6522  N N   . THR D 1 61  ? -24.346 49.358  49.301  1.00 71.41  ? 59   THR D N   1 
ATOM   6523  C CA  . THR D 1 61  ? -24.546 48.247  48.385  1.00 68.26  ? 59   THR D CA  1 
ATOM   6524  C C   . THR D 1 61  ? -24.338 46.964  49.164  1.00 66.67  ? 59   THR D C   1 
ATOM   6525  O O   . THR D 1 61  ? -25.290 46.260  49.492  1.00 67.14  ? 59   THR D O   1 
ATOM   6526  C CB  . THR D 1 61  ? -23.525 48.272  47.234  1.00 72.18  ? 59   THR D CB  1 
ATOM   6527  O OG1 . THR D 1 61  ? -23.790 49.387  46.376  1.00 73.47  ? 59   THR D OG1 1 
ATOM   6528  C CG2 . THR D 1 61  ? -23.602 46.986  46.430  1.00 70.77  ? 59   THR D CG2 1 
ATOM   6529  N N   . VAL D 1 62  ? -23.075 46.687  49.464  1.00 48.47  ? 60   VAL D N   1 
ATOM   6530  C CA  . VAL D 1 62  ? -22.669 45.495  50.197  1.00 47.39  ? 60   VAL D CA  1 
ATOM   6531  C C   . VAL D 1 62  ? -23.678 44.970  51.215  1.00 49.42  ? 60   VAL D C   1 
ATOM   6532  O O   . VAL D 1 62  ? -23.949 43.771  51.266  1.00 49.28  ? 60   VAL D O   1 
ATOM   6533  C CB  . VAL D 1 62  ? -21.357 45.747  50.917  1.00 40.03  ? 60   VAL D CB  1 
ATOM   6534  C CG1 . VAL D 1 62  ? -20.795 44.435  51.441  1.00 38.79  ? 60   VAL D CG1 1 
ATOM   6535  C CG2 . VAL D 1 62  ? -20.388 46.432  49.968  1.00 39.30  ? 60   VAL D CG2 1 
ATOM   6536  N N   . GLN D 1 63  ? -24.227 45.856  52.034  1.00 59.82  ? 61   GLN D N   1 
ATOM   6537  C CA  . GLN D 1 63  ? -25.208 45.435  53.023  1.00 63.23  ? 61   GLN D CA  1 
ATOM   6538  C C   . GLN D 1 63  ? -26.428 44.874  52.296  1.00 64.50  ? 61   GLN D C   1 
ATOM   6539  O O   . GLN D 1 63  ? -26.981 43.842  52.673  1.00 64.99  ? 61   GLN D O   1 
ATOM   6540  C CB  . GLN D 1 63  ? -25.611 46.626  53.883  1.00 91.04  ? 61   GLN D CB  1 
ATOM   6541  C CG  . GLN D 1 63  ? -24.420 47.402  54.410  1.00 94.11  ? 61   GLN D CG  1 
ATOM   6542  C CD  . GLN D 1 63  ? -24.821 48.624  55.213  1.00 96.41  ? 61   GLN D CD  1 
ATOM   6543  O OE1 . GLN D 1 63  ? -25.583 49.471  54.745  1.00 96.96  ? 61   GLN D OE1 1 
ATOM   6544  N NE2 . GLN D 1 63  ? -24.303 48.724  56.430  1.00 98.34  ? 61   GLN D NE2 1 
ATOM   6545  N N   . HIS D 1 64  ? -26.826 45.565  51.236  1.00 85.93  ? 62   HIS D N   1 
ATOM   6546  C CA  . HIS D 1 64  ? -27.975 45.177  50.431  1.00 87.73  ? 62   HIS D CA  1 
ATOM   6547  C C   . HIS D 1 64  ? -27.711 43.964  49.537  1.00 84.39  ? 62   HIS D C   1 
ATOM   6548  O O   . HIS D 1 64  ? -28.616 43.487  48.856  1.00 84.72  ? 62   HIS D O   1 
ATOM   6549  C CB  . HIS D 1 64  ? -28.411 46.380  49.577  1.00 112.78 ? 62   HIS D CB  1 
ATOM   6550  C CG  . HIS D 1 64  ? -29.537 46.091  48.630  1.00 119.16 ? 62   HIS D CG  1 
ATOM   6551  N ND1 . HIS D 1 64  ? -29.368 45.364  47.470  1.00 121.14 ? 62   HIS D ND1 1 
ATOM   6552  C CD2 . HIS D 1 64  ? -30.847 46.431  48.672  1.00 122.20 ? 62   HIS D CD2 1 
ATOM   6553  C CE1 . HIS D 1 64  ? -30.525 45.269  46.840  1.00 123.16 ? 62   HIS D CE1 1 
ATOM   6554  N NE2 . HIS D 1 64  ? -31.439 45.908  47.548  1.00 124.25 ? 62   HIS D NE2 1 
ATOM   6555  N N   . SER D 1 65  ? -26.496 43.429  49.557  1.00 51.97  ? 63   SER D N   1 
ATOM   6556  C CA  . SER D 1 65  ? -26.212 42.311  48.671  1.00 49.45  ? 63   SER D CA  1 
ATOM   6557  C C   . SER D 1 65  ? -25.732 40.986  49.242  1.00 48.29  ? 63   SER D C   1 
ATOM   6558  O O   . SER D 1 65  ? -24.720 40.940  49.920  1.00 47.92  ? 63   SER D O   1 
ATOM   6559  C CB  . SER D 1 65  ? -25.207 42.760  47.610  1.00 53.23  ? 63   SER D CB  1 
ATOM   6560  O OG  . SER D 1 65  ? -24.006 43.210  48.205  1.00 51.94  ? 63   SER D OG  1 
ATOM   6561  N N   . ASP D 1 66  ? -26.453 39.904  48.945  1.00 57.22  ? 64   ASP D N   1 
ATOM   6562  C CA  . ASP D 1 66  ? -26.038 38.573  49.383  1.00 57.42  ? 64   ASP D CA  1 
ATOM   6563  C C   . ASP D 1 66  ? -24.889 38.217  48.441  1.00 57.90  ? 64   ASP D C   1 
ATOM   6564  O O   . ASP D 1 66  ? -23.840 37.722  48.860  1.00 57.28  ? 64   ASP D O   1 
ATOM   6565  C CB  . ASP D 1 66  ? -27.180 37.565  49.232  1.00 80.71  ? 64   ASP D CB  1 
ATOM   6566  C CG  . ASP D 1 66  ? -28.293 37.803  50.224  1.00 83.67  ? 64   ASP D CG  1 
ATOM   6567  O OD1 . ASP D 1 66  ? -28.830 38.928  50.241  1.00 83.44  ? 64   ASP D OD1 1 
ATOM   6568  O OD2 . ASP D 1 66  ? -28.629 36.872  50.987  1.00 86.94  ? 64   ASP D OD2 1 
ATOM   6569  N N   . VAL D 1 67  ? -25.097 38.493  47.157  1.00 75.87  ? 65   VAL D N   1 
ATOM   6570  C CA  . VAL D 1 67  ? -24.080 38.252  46.138  1.00 73.46  ? 65   VAL D CA  1 
ATOM   6571  C C   . VAL D 1 67  ? -23.566 39.601  45.652  1.00 72.40  ? 65   VAL D C   1 
ATOM   6572  O O   . VAL D 1 67  ? -24.349 40.498  45.308  1.00 70.40  ? 65   VAL D O   1 
ATOM   6573  C CB  . VAL D 1 67  ? -24.639 37.471  44.929  1.00 41.64  ? 65   VAL D CB  1 
ATOM   6574  C CG1 . VAL D 1 67  ? -25.892 38.140  44.413  1.00 43.25  ? 65   VAL D CG1 1 
ATOM   6575  C CG2 . VAL D 1 67  ? -23.590 37.413  43.825  1.00 40.14  ? 65   VAL D CG2 1 
ATOM   6576  N N   . LEU D 1 68  ? -22.247 39.745  45.619  1.00 61.97  ? 66   LEU D N   1 
ATOM   6577  C CA  . LEU D 1 68  ? -21.671 41.005  45.189  1.00 60.61  ? 66   LEU D CA  1 
ATOM   6578  C C   . LEU D 1 68  ? -20.894 40.951  43.882  1.00 60.76  ? 66   LEU D C   1 
ATOM   6579  O O   . LEU D 1 68  ? -19.950 40.172  43.727  1.00 60.24  ? 66   LEU D O   1 
ATOM   6580  C CB  . LEU D 1 68  ? -20.771 41.567  46.279  1.00 58.18  ? 66   LEU D CB  1 
ATOM   6581  C CG  . LEU D 1 68  ? -20.406 43.019  45.993  1.00 56.69  ? 66   LEU D CG  1 
ATOM   6582  C CD1 . LEU D 1 68  ? -21.649 43.906  46.101  1.00 55.26  ? 66   LEU D CD1 1 
ATOM   6583  C CD2 . LEU D 1 68  ? -19.354 43.456  46.973  1.00 56.38  ? 66   LEU D CD2 1 
ATOM   6584  N N   . PHE D 1 69  ? -21.303 41.799  42.945  1.00 43.19  ? 67   PHE D N   1 
ATOM   6585  C CA  . PHE D 1 69  ? -20.650 41.879  41.653  1.00 42.77  ? 67   PHE D CA  1 
ATOM   6586  C C   . PHE D 1 69  ? -19.765 43.097  41.607  1.00 42.87  ? 67   PHE D C   1 
ATOM   6587  O O   . PHE D 1 69  ? -20.162 44.191  42.011  1.00 40.96  ? 67   PHE D O   1 
ATOM   6588  C CB  . PHE D 1 69  ? -21.671 41.974  40.524  1.00 56.84  ? 67   PHE D CB  1 
ATOM   6589  C CG  . PHE D 1 69  ? -22.421 40.699  40.273  1.00 57.85  ? 67   PHE D CG  1 
ATOM   6590  C CD1 . PHE D 1 69  ? -23.564 40.390  41.004  1.00 56.27  ? 67   PHE D CD1 1 
ATOM   6591  C CD2 . PHE D 1 69  ? -21.978 39.800  39.301  1.00 57.44  ? 67   PHE D CD2 1 
ATOM   6592  C CE1 . PHE D 1 69  ? -24.256 39.203  40.766  1.00 55.88  ? 67   PHE D CE1 1 
ATOM   6593  C CE2 . PHE D 1 69  ? -22.663 38.609  39.056  1.00 53.39  ? 67   PHE D CE2 1 
ATOM   6594  C CZ  . PHE D 1 69  ? -23.803 38.310  39.787  1.00 54.79  ? 67   PHE D CZ  1 
ATOM   6595  N N   . LEU D 1 70  ? -18.561 42.899  41.099  1.00 70.53  ? 68   LEU D N   1 
ATOM   6596  C CA  . LEU D 1 70  ? -17.609 43.982  40.987  1.00 72.77  ? 68   LEU D CA  1 
ATOM   6597  C C   . LEU D 1 70  ? -17.559 44.452  39.550  1.00 76.61  ? 68   LEU D C   1 
ATOM   6598  O O   . LEU D 1 70  ? -16.612 44.148  38.822  1.00 78.37  ? 68   LEU D O   1 
ATOM   6599  C CB  . LEU D 1 70  ? -16.242 43.491  41.420  1.00 47.15  ? 68   LEU D CB  1 
ATOM   6600  C CG  . LEU D 1 70  ? -16.334 42.764  42.752  1.00 43.77  ? 68   LEU D CG  1 
ATOM   6601  C CD1 . LEU D 1 70  ? -14.941 42.538  43.283  1.00 42.04  ? 68   LEU D CD1 1 
ATOM   6602  C CD2 . LEU D 1 70  ? -17.154 43.593  43.732  1.00 41.92  ? 68   LEU D CD2 1 
ATOM   6603  N N   . ALA D 1 71  ? -18.588 45.188  39.141  1.00 72.70  ? 69   ALA D N   1 
ATOM   6604  C CA  . ALA D 1 71  ? -18.664 45.693  37.778  1.00 75.45  ? 69   ALA D CA  1 
ATOM   6605  C C   . ALA D 1 71  ? -17.885 46.993  37.649  1.00 77.58  ? 69   ALA D C   1 
ATOM   6606  O O   . ALA D 1 71  ? -18.418 48.012  37.210  1.00 78.81  ? 69   ALA D O   1 
ATOM   6607  C CB  . ALA D 1 71  ? -20.121 45.906  37.381  1.00 62.71  ? 69   ALA D CB  1 
ATOM   6608  N N   . VAL D 1 72  ? -16.618 46.954  38.039  1.00 73.25  ? 70   VAL D N   1 
ATOM   6609  C CA  . VAL D 1 72  ? -15.783 48.138  37.954  1.00 74.92  ? 70   VAL D CA  1 
ATOM   6610  C C   . VAL D 1 72  ? -14.565 47.856  37.081  1.00 75.76  ? 70   VAL D C   1 
ATOM   6611  O O   . VAL D 1 72  ? -14.235 46.703  36.792  1.00 75.77  ? 70   VAL D O   1 
ATOM   6612  C CB  . VAL D 1 72  ? -15.314 48.609  39.357  1.00 69.01  ? 70   VAL D CB  1 
ATOM   6613  C CG1 . VAL D 1 72  ? -15.011 50.099  39.329  1.00 68.86  ? 70   VAL D CG1 1 
ATOM   6614  C CG2 . VAL D 1 72  ? -16.383 48.318  40.391  1.00 68.66  ? 70   VAL D CG2 1 
ATOM   6615  N N   . LYS D 1 73  ? -13.914 48.931  36.654  1.00 71.80  ? 71   LYS D N   1 
ATOM   6616  C CA  . LYS D 1 73  ? -12.734 48.854  35.812  1.00 71.84  ? 71   LYS D CA  1 
ATOM   6617  C C   . LYS D 1 73  ? -11.642 48.096  36.554  1.00 72.19  ? 71   LYS D C   1 
ATOM   6618  O O   . LYS D 1 73  ? -11.519 48.196  37.771  1.00 72.15  ? 71   LYS D O   1 
ATOM   6619  C CB  . LYS D 1 73  ? -12.287 50.274  35.465  1.00 93.00  ? 71   LYS D CB  1 
ATOM   6620  C CG  . LYS D 1 73  ? -13.445 51.122  34.941  1.00 94.66  ? 71   LYS D CG  1 
ATOM   6621  C CD  . LYS D 1 73  ? -13.184 52.613  35.036  1.00 96.01  ? 71   LYS D CD  1 
ATOM   6622  C CE  . LYS D 1 73  ? -14.438 53.398  34.665  1.00 97.05  ? 71   LYS D CE  1 
ATOM   6623  N NZ  . LYS D 1 73  ? -14.270 54.868  34.848  1.00 96.29  ? 71   LYS D NZ  1 
ATOM   6624  N N   . PRO D 1 74  ? -10.839 47.317  35.825  1.00 81.10  ? 72   PRO D N   1 
ATOM   6625  C CA  . PRO D 1 74  ? -9.751  46.526  36.409  1.00 81.86  ? 72   PRO D CA  1 
ATOM   6626  C C   . PRO D 1 74  ? -8.844  47.250  37.406  1.00 80.80  ? 72   PRO D C   1 
ATOM   6627  O O   . PRO D 1 74  ? -8.443  46.666  38.409  1.00 81.91  ? 72   PRO D O   1 
ATOM   6628  C CB  . PRO D 1 74  ? -8.997  46.031  35.178  1.00 95.10  ? 72   PRO D CB  1 
ATOM   6629  C CG  . PRO D 1 74  ? -10.112 45.836  34.183  1.00 95.02  ? 72   PRO D CG  1 
ATOM   6630  C CD  . PRO D 1 74  ? -10.920 47.103  34.368  1.00 94.43  ? 72   PRO D CD  1 
ATOM   6631  N N   . HIS D 1 75  ? -8.525  48.513  37.137  1.00 82.73  ? 73   HIS D N   1 
ATOM   6632  C CA  . HIS D 1 75  ? -7.649  49.280  38.026  1.00 82.62  ? 73   HIS D CA  1 
ATOM   6633  C C   . HIS D 1 75  ? -8.360  49.858  39.250  1.00 81.18  ? 73   HIS D C   1 
ATOM   6634  O O   . HIS D 1 75  ? -7.727  50.109  40.281  1.00 80.80  ? 73   HIS D O   1 
ATOM   6635  C CB  . HIS D 1 75  ? -6.963  50.415  37.258  1.00 97.65  ? 73   HIS D CB  1 
ATOM   6636  C CG  . HIS D 1 75  ? -7.916  51.346  36.574  1.00 99.91  ? 73   HIS D CG  1 
ATOM   6637  N ND1 . HIS D 1 75  ? -9.026  51.869  37.202  1.00 101.66 ? 73   HIS D ND1 1 
ATOM   6638  C CD2 . HIS D 1 75  ? -7.916  51.859  35.321  1.00 100.52 ? 73   HIS D CD2 1 
ATOM   6639  C CE1 . HIS D 1 75  ? -9.670  52.663  36.365  1.00 101.67 ? 73   HIS D CE1 1 
ATOM   6640  N NE2 . HIS D 1 75  ? -9.018  52.675  35.217  1.00 101.21 ? 73   HIS D NE2 1 
ATOM   6641  N N   . ILE D 1 76  ? -9.665  50.086  39.131  1.00 68.83  ? 74   ILE D N   1 
ATOM   6642  C CA  . ILE D 1 76  ? -10.441 50.616  40.245  1.00 67.71  ? 74   ILE D CA  1 
ATOM   6643  C C   . ILE D 1 76  ? -10.485 49.551  41.318  1.00 66.70  ? 74   ILE D C   1 
ATOM   6644  O O   . ILE D 1 76  ? -10.172 49.815  42.476  1.00 66.76  ? 74   ILE D O   1 
ATOM   6645  C CB  . ILE D 1 76  ? -11.896 50.947  39.839  1.00 76.27  ? 74   ILE D CB  1 
ATOM   6646  C CG1 . ILE D 1 76  ? -11.910 52.108  38.855  1.00 78.03  ? 74   ILE D CG1 1 
ATOM   6647  C CG2 . ILE D 1 76  ? -12.704 51.356  41.059  1.00 75.57  ? 74   ILE D CG2 1 
ATOM   6648  C CD1 . ILE D 1 76  ? -11.254 53.359  39.411  1.00 80.52  ? 74   ILE D CD1 1 
ATOM   6649  N N   . ILE D 1 77  ? -10.873 48.344  40.914  1.00 65.70  ? 75   ILE D N   1 
ATOM   6650  C CA  . ILE D 1 77  ? -10.971 47.214  41.822  1.00 65.42  ? 75   ILE D CA  1 
ATOM   6651  C C   . ILE D 1 77  ? -10.052 47.393  43.022  1.00 66.69  ? 75   ILE D C   1 
ATOM   6652  O O   . ILE D 1 77  ? -10.525 47.549  44.148  1.00 67.04  ? 75   ILE D O   1 
ATOM   6653  C CB  . ILE D 1 77  ? -10.625 45.883  41.104  1.00 66.57  ? 75   ILE D CB  1 
ATOM   6654  C CG1 . ILE D 1 77  ? -11.689 45.572  40.049  1.00 66.60  ? 75   ILE D CG1 1 
ATOM   6655  C CG2 . ILE D 1 77  ? -10.502 44.752  42.117  1.00 64.61  ? 75   ILE D CG2 1 
ATOM   6656  C CD1 . ILE D 1 77  ? -13.105 45.561  40.592  1.00 68.58  ? 75   ILE D CD1 1 
ATOM   6657  N N   . PRO D 1 78  ? -8.725  47.403  42.794  1.00 74.53  ? 76   PRO D N   1 
ATOM   6658  C CA  . PRO D 1 78  ? -7.743  47.568  43.872  1.00 75.38  ? 76   PRO D CA  1 
ATOM   6659  C C   . PRO D 1 78  ? -8.244  48.502  44.966  1.00 76.00  ? 76   PRO D C   1 
ATOM   6660  O O   . PRO D 1 78  ? -8.169  48.186  46.151  1.00 76.64  ? 76   PRO D O   1 
ATOM   6661  C CB  . PRO D 1 78  ? -6.535  48.134  43.141  1.00 72.96  ? 76   PRO D CB  1 
ATOM   6662  C CG  . PRO D 1 78  ? -6.592  47.412  41.842  1.00 73.69  ? 76   PRO D CG  1 
ATOM   6663  C CD  . PRO D 1 78  ? -8.063  47.487  41.479  1.00 73.21  ? 76   PRO D CD  1 
ATOM   6664  N N   . PHE D 1 79  ? -8.756  49.654  44.549  1.00 58.90  ? 77   PHE D N   1 
ATOM   6665  C CA  . PHE D 1 79  ? -9.290  50.645  45.470  1.00 59.61  ? 77   PHE D CA  1 
ATOM   6666  C C   . PHE D 1 79  ? -10.486 50.009  46.145  1.00 58.61  ? 77   PHE D C   1 
ATOM   6667  O O   . PHE D 1 79  ? -10.433 49.635  47.315  1.00 57.50  ? 77   PHE D O   1 
ATOM   6668  C CB  . PHE D 1 79  ? -9.734  51.889  44.700  1.00 105.82 ? 77   PHE D CB  1 
ATOM   6669  C CG  . PHE D 1 79  ? -8.621  52.569  43.957  1.00 108.41 ? 77   PHE D CG  1 
ATOM   6670  C CD1 . PHE D 1 79  ? -7.653  51.824  43.283  1.00 108.89 ? 77   PHE D CD1 1 
ATOM   6671  C CD2 . PHE D 1 79  ? -8.550  53.954  43.912  1.00 109.61 ? 77   PHE D CD2 1 
ATOM   6672  C CE1 . PHE D 1 79  ? -6.633  52.444  42.578  1.00 109.33 ? 77   PHE D CE1 1 
ATOM   6673  C CE2 . PHE D 1 79  ? -7.533  54.588  43.207  1.00 111.31 ? 77   PHE D CE2 1 
ATOM   6674  C CZ  . PHE D 1 79  ? -6.571  53.828  42.538  1.00 111.44 ? 77   PHE D CZ  1 
ATOM   6675  N N   . ILE D 1 80  ? -11.562 49.889  45.381  1.00 76.42  ? 78   ILE D N   1 
ATOM   6676  C CA  . ILE D 1 80  ? -12.794 49.282  45.854  1.00 78.89  ? 78   ILE D CA  1 
ATOM   6677  C C   . ILE D 1 80  ? -12.487 48.189  46.868  1.00 78.97  ? 78   ILE D C   1 
ATOM   6678  O O   . ILE D 1 80  ? -12.957 48.217  48.012  1.00 79.27  ? 78   ILE D O   1 
ATOM   6679  C CB  . ILE D 1 80  ? -13.563 48.663  44.668  1.00 98.48  ? 78   ILE D CB  1 
ATOM   6680  C CG1 . ILE D 1 80  ? -13.943 49.763  43.686  1.00 100.96 ? 78   ILE D CG1 1 
ATOM   6681  C CG2 . ILE D 1 80  ? -14.816 47.958  45.144  1.00 98.61  ? 78   ILE D CG2 1 
ATOM   6682  C CD1 . ILE D 1 80  ? -14.642 50.924  44.352  1.00 103.58 ? 78   ILE D CD1 1 
ATOM   6683  N N   . LEU D 1 81  ? -11.670 47.242  46.428  1.00 63.78  ? 79   LEU D N   1 
ATOM   6684  C CA  . LEU D 1 81  ? -11.272 46.103  47.231  1.00 63.99  ? 79   LEU D CA  1 
ATOM   6685  C C   . LEU D 1 81  ? -11.035 46.420  48.710  1.00 65.35  ? 79   LEU D C   1 
ATOM   6686  O O   . LEU D 1 81  ? -11.405 45.629  49.577  1.00 66.05  ? 79   LEU D O   1 
ATOM   6687  C CB  . LEU D 1 81  ? -10.027 45.472  46.613  1.00 95.78  ? 79   LEU D CB  1 
ATOM   6688  C CG  . LEU D 1 81  ? -9.881  43.956  46.745  1.00 98.35  ? 79   LEU D CG  1 
ATOM   6689  C CD1 . LEU D 1 81  ? -11.164 43.259  46.316  1.00 96.90  ? 79   LEU D CD1 1 
ATOM   6690  C CD2 . LEU D 1 81  ? -8.720  43.494  45.876  1.00 101.42 ? 79   LEU D CD2 1 
ATOM   6691  N N   . ASP D 1 82  ? -10.430 47.568  49.008  1.00 77.64  ? 80   ASP D N   1 
ATOM   6692  C CA  . ASP D 1 82  ? -10.166 47.932  50.398  1.00 77.13  ? 80   ASP D CA  1 
ATOM   6693  C C   . ASP D 1 82  ? -11.393 48.538  51.034  1.00 76.68  ? 80   ASP D C   1 
ATOM   6694  O O   . ASP D 1 82  ? -11.949 47.991  51.985  1.00 77.80  ? 80   ASP D O   1 
ATOM   6695  C CB  . ASP D 1 82  ? -9.035  48.949  50.492  1.00 91.10  ? 80   ASP D CB  1 
ATOM   6696  C CG  . ASP D 1 82  ? -7.810  48.527  49.727  1.00 95.31  ? 80   ASP D CG  1 
ATOM   6697  O OD1 . ASP D 1 82  ? -7.235  47.466  50.055  1.00 96.43  ? 80   ASP D OD1 1 
ATOM   6698  O OD2 . ASP D 1 82  ? -7.424  49.263  48.794  1.00 98.19  ? 80   ASP D OD2 1 
ATOM   6699  N N   . GLU D 1 83  ? -11.795 49.686  50.503  1.00 70.72  ? 81   GLU D N   1 
ATOM   6700  C CA  . GLU D 1 83  ? -12.952 50.419  50.998  1.00 69.99  ? 81   GLU D CA  1 
ATOM   6701  C C   . GLU D 1 83  ? -14.047 49.530  51.547  1.00 68.47  ? 81   GLU D C   1 
ATOM   6702  O O   . GLU D 1 83  ? -14.658 49.827  52.578  1.00 68.07  ? 81   GLU D O   1 
ATOM   6703  C CB  . GLU D 1 83  ? -13.549 51.257  49.884  1.00 90.12  ? 81   GLU D CB  1 
ATOM   6704  C CG  . GLU D 1 83  ? -14.906 51.811  50.247  1.00 93.85  ? 81   GLU D CG  1 
ATOM   6705  C CD  . GLU D 1 83  ? -15.650 52.321  49.044  1.00 95.22  ? 81   GLU D CD  1 
ATOM   6706  O OE1 . GLU D 1 83  ? -16.782 52.828  49.217  1.00 97.42  ? 81   GLU D OE1 1 
ATOM   6707  O OE2 . GLU D 1 83  ? -15.098 52.209  47.926  1.00 95.94  ? 81   GLU D OE2 1 
ATOM   6708  N N   . ILE D 1 84  ? -14.298 48.442  50.832  1.00 62.52  ? 82   ILE D N   1 
ATOM   6709  C CA  . ILE D 1 84  ? -15.333 47.502  51.209  1.00 61.51  ? 82   ILE D CA  1 
ATOM   6710  C C   . ILE D 1 84  ? -14.786 46.249  51.893  1.00 61.14  ? 82   ILE D C   1 
ATOM   6711  O O   . ILE D 1 84  ? -15.513 45.571  52.622  1.00 59.99  ? 82   ILE D O   1 
ATOM   6712  C CB  . ILE D 1 84  ? -16.143 47.096  49.970  1.00 81.77  ? 82   ILE D CB  1 
ATOM   6713  C CG1 . ILE D 1 84  ? -16.684 48.347  49.271  1.00 82.51  ? 82   ILE D CG1 1 
ATOM   6714  C CG2 . ILE D 1 84  ? -17.290 46.201  50.371  1.00 84.12  ? 82   ILE D CG2 1 
ATOM   6715  C CD1 . ILE D 1 84  ? -17.635 49.171  50.117  1.00 82.20  ? 82   ILE D CD1 1 
ATOM   6716  N N   . GLY D 1 85  ? -13.510 45.947  51.662  1.00 68.56  ? 83   GLY D N   1 
ATOM   6717  C CA  . GLY D 1 85  ? -12.901 44.775  52.272  1.00 70.06  ? 83   GLY D CA  1 
ATOM   6718  C C   . GLY D 1 85  ? -13.315 44.593  53.723  1.00 71.43  ? 83   GLY D C   1 
ATOM   6719  O O   . GLY D 1 85  ? -13.351 43.481  54.250  1.00 71.51  ? 83   GLY D O   1 
ATOM   6720  N N   . ALA D 1 86  ? -13.627 45.703  54.376  1.00 85.74  ? 84   ALA D N   1 
ATOM   6721  C CA  . ALA D 1 86  ? -14.050 45.678  55.766  1.00 84.54  ? 84   ALA D CA  1 
ATOM   6722  C C   . ALA D 1 86  ? -15.478 45.161  55.854  1.00 84.44  ? 84   ALA D C   1 
ATOM   6723  O O   . ALA D 1 86  ? -15.752 44.129  56.472  1.00 84.94  ? 84   ALA D O   1 
ATOM   6724  C CB  . ALA D 1 86  ? -13.976 47.084  56.343  1.00 57.38  ? 84   ALA D CB  1 
ATOM   6725  N N   . ASP D 1 87  ? -16.365 45.908  55.202  1.00 71.31  ? 85   ASP D N   1 
ATOM   6726  C CA  . ASP D 1 87  ? -17.806 45.665  55.149  1.00 72.20  ? 85   ASP D CA  1 
ATOM   6727  C C   . ASP D 1 87  ? -18.257 44.281  54.676  1.00 70.50  ? 85   ASP D C   1 
ATOM   6728  O O   . ASP D 1 87  ? -19.423 43.899  54.851  1.00 68.64  ? 85   ASP D O   1 
ATOM   6729  C CB  . ASP D 1 87  ? -18.427 46.751  54.279  1.00 106.92 ? 85   ASP D CB  1 
ATOM   6730  C CG  . ASP D 1 87  ? -17.733 48.090  54.462  1.00 110.77 ? 85   ASP D CG  1 
ATOM   6731  O OD1 . ASP D 1 87  ? -17.795 48.648  55.580  1.00 111.27 ? 85   ASP D OD1 1 
ATOM   6732  O OD2 . ASP D 1 87  ? -17.108 48.573  53.494  1.00 115.39 ? 85   ASP D OD2 1 
ATOM   6733  N N   . ILE D 1 88  ? -17.342 43.532  54.078  1.00 71.15  ? 86   ILE D N   1 
ATOM   6734  C CA  . ILE D 1 88  ? -17.676 42.198  53.622  1.00 71.69  ? 86   ILE D CA  1 
ATOM   6735  C C   . ILE D 1 88  ? -18.053 41.340  54.835  1.00 73.44  ? 86   ILE D C   1 
ATOM   6736  O O   . ILE D 1 88  ? -17.375 41.367  55.867  1.00 73.76  ? 86   ILE D O   1 
ATOM   6737  C CB  . ILE D 1 88  ? -16.488 41.564  52.888  1.00 71.65  ? 86   ILE D CB  1 
ATOM   6738  C CG1 . ILE D 1 88  ? -16.823 40.125  52.502  1.00 70.44  ? 86   ILE D CG1 1 
ATOM   6739  C CG2 . ILE D 1 88  ? -15.260 41.601  53.771  1.00 72.00  ? 86   ILE D CG2 1 
ATOM   6740  C CD1 . ILE D 1 88  ? -15.779 39.482  51.634  1.00 70.26  ? 86   ILE D CD1 1 
ATOM   6741  N N   . GLU D 1 89  ? -19.150 40.597  54.700  1.00 69.96  ? 87   GLU D N   1 
ATOM   6742  C CA  . GLU D 1 89  ? -19.658 39.716  55.748  1.00 71.13  ? 87   GLU D CA  1 
ATOM   6743  C C   . GLU D 1 89  ? -19.244 38.273  55.468  1.00 70.78  ? 87   GLU D C   1 
ATOM   6744  O O   . GLU D 1 89  ? -18.306 38.028  54.709  1.00 69.44  ? 87   GLU D O   1 
ATOM   6745  C CB  . GLU D 1 89  ? -21.180 39.818  55.812  1.00 98.41  ? 87   GLU D CB  1 
ATOM   6746  C CG  . GLU D 1 89  ? -21.671 41.195  56.210  1.00 104.16 ? 87   GLU D CG  1 
ATOM   6747  C CD  . GLU D 1 89  ? -21.982 41.283  57.686  1.00 107.56 ? 87   GLU D CD  1 
ATOM   6748  O OE1 . GLU D 1 89  ? -23.016 40.720  58.105  1.00 110.23 ? 87   GLU D OE1 1 
ATOM   6749  O OE2 . GLU D 1 89  ? -21.192 41.901  58.429  1.00 109.86 ? 87   GLU D OE2 1 
ATOM   6750  N N   . ASP D 1 90  ? -19.938 37.320  56.082  1.00 97.66  ? 88   ASP D N   1 
ATOM   6751  C CA  . ASP D 1 90  ? -19.615 35.910  55.888  1.00 98.21  ? 88   ASP D CA  1 
ATOM   6752  C C   . ASP D 1 90  ? -20.459 35.322  54.781  1.00 97.11  ? 88   ASP D C   1 
ATOM   6753  O O   . ASP D 1 90  ? -19.993 34.479  54.015  1.00 97.64  ? 88   ASP D O   1 
ATOM   6754  C CB  . ASP D 1 90  ? -19.852 35.111  57.172  1.00 112.82 ? 88   ASP D CB  1 
ATOM   6755  C CG  . ASP D 1 90  ? -18.971 35.567  58.317  1.00 116.41 ? 88   ASP D CG  1 
ATOM   6756  O OD1 . ASP D 1 90  ? -17.732 35.587  58.146  1.00 115.56 ? 88   ASP D OD1 1 
ATOM   6757  O OD2 . ASP D 1 90  ? -19.518 35.902  59.390  1.00 118.58 ? 88   ASP D OD2 1 
ATOM   6758  N N   . ARG D 1 91  ? -21.708 35.772  54.709  1.00 83.13  ? 89   ARG D N   1 
ATOM   6759  C CA  . ARG D 1 91  ? -22.642 35.293  53.699  1.00 79.49  ? 89   ARG D CA  1 
ATOM   6760  C C   . ARG D 1 91  ? -22.155 35.660  52.300  1.00 78.64  ? 89   ARG D C   1 
ATOM   6761  O O   . ARG D 1 91  ? -22.187 34.846  51.373  1.00 78.17  ? 89   ARG D O   1 
ATOM   6762  C CB  . ARG D 1 91  ? -24.032 35.897  53.943  1.00 68.76  ? 89   ARG D CB  1 
ATOM   6763  C CG  . ARG D 1 91  ? -24.127 37.418  53.763  1.00 64.78  ? 89   ARG D CG  1 
ATOM   6764  C CD  . ARG D 1 91  ? -25.538 37.930  54.089  1.00 63.30  ? 89   ARG D CD  1 
ATOM   6765  N NE  . ARG D 1 91  ? -25.875 39.185  53.408  1.00 62.32  ? 89   ARG D NE  1 
ATOM   6766  C CZ  . ARG D 1 91  ? -25.250 40.346  53.592  1.00 61.96  ? 89   ARG D CZ  1 
ATOM   6767  N NH1 . ARG D 1 91  ? -24.240 40.433  54.445  1.00 62.72  ? 89   ARG D NH1 1 
ATOM   6768  N NH2 . ARG D 1 91  ? -25.634 41.424  52.917  1.00 59.44  ? 89   ARG D NH2 1 
ATOM   6769  N N   . HIS D 1 92  ? -21.682 36.892  52.171  1.00 82.24  ? 90   HIS D N   1 
ATOM   6770  C CA  . HIS D 1 92  ? -21.207 37.422  50.906  1.00 79.40  ? 90   HIS D CA  1 
ATOM   6771  C C   . HIS D 1 92  ? -20.423 36.498  50.002  1.00 78.31  ? 90   HIS D C   1 
ATOM   6772  O O   . HIS D 1 92  ? -19.511 35.788  50.436  1.00 77.78  ? 90   HIS D O   1 
ATOM   6773  C CB  . HIS D 1 92  ? -20.368 38.675  51.145  1.00 69.30  ? 90   HIS D CB  1 
ATOM   6774  C CG  . HIS D 1 92  ? -21.164 39.861  51.585  1.00 69.25  ? 90   HIS D CG  1 
ATOM   6775  N ND1 . HIS D 1 92  ? -22.190 40.391  50.833  1.00 68.47  ? 90   HIS D ND1 1 
ATOM   6776  C CD2 . HIS D 1 92  ? -21.080 40.627  52.698  1.00 70.79  ? 90   HIS D CD2 1 
ATOM   6777  C CE1 . HIS D 1 92  ? -22.702 41.432  51.466  1.00 69.55  ? 90   HIS D CE1 1 
ATOM   6778  N NE2 . HIS D 1 92  ? -22.047 41.596  52.599  1.00 71.31  ? 90   HIS D NE2 1 
ATOM   6779  N N   . ILE D 1 93  ? -20.812 36.525  48.731  1.00 61.12  ? 91   ILE D N   1 
ATOM   6780  C CA  . ILE D 1 93  ? -20.146 35.780  47.675  1.00 59.11  ? 91   ILE D CA  1 
ATOM   6781  C C   . ILE D 1 93  ? -19.748 36.887  46.726  1.00 59.47  ? 91   ILE D C   1 
ATOM   6782  O O   . ILE D 1 93  ? -20.592 37.672  46.281  1.00 59.59  ? 91   ILE D O   1 
ATOM   6783  C CB  . ILE D 1 93  ? -21.074 34.860  46.897  1.00 49.17  ? 91   ILE D CB  1 
ATOM   6784  C CG1 . ILE D 1 93  ? -21.753 33.868  47.833  1.00 49.54  ? 91   ILE D CG1 1 
ATOM   6785  C CG2 . ILE D 1 93  ? -20.273 34.121  45.855  1.00 45.51  ? 91   ILE D CG2 1 
ATOM   6786  C CD1 . ILE D 1 93  ? -22.771 32.997  47.128  1.00 50.99  ? 91   ILE D CD1 1 
ATOM   6787  N N   . VAL D 1 94  ? -18.468 36.967  46.421  1.00 71.93  ? 92   VAL D N   1 
ATOM   6788  C CA  . VAL D 1 94  ? -18.022 38.015  45.535  1.00 72.98  ? 92   VAL D CA  1 
ATOM   6789  C C   . VAL D 1 94  ? -17.662 37.482  44.160  1.00 72.97  ? 92   VAL D C   1 
ATOM   6790  O O   . VAL D 1 94  ? -16.794 36.620  44.000  1.00 72.91  ? 92   VAL D O   1 
ATOM   6791  C CB  . VAL D 1 94  ? -16.823 38.767  46.136  1.00 75.29  ? 92   VAL D CB  1 
ATOM   6792  C CG1 . VAL D 1 94  ? -16.538 40.028  45.326  1.00 73.39  ? 92   VAL D CG1 1 
ATOM   6793  C CG2 . VAL D 1 94  ? -17.110 39.107  47.594  1.00 73.65  ? 92   VAL D CG2 1 
ATOM   6794  N N   . VAL D 1 95  ? -18.370 37.996  43.167  1.00 53.21  ? 93   VAL D N   1 
ATOM   6795  C CA  . VAL D 1 95  ? -18.142 37.625  41.791  1.00 52.19  ? 93   VAL D CA  1 
ATOM   6796  C C   . VAL D 1 95  ? -17.688 38.912  41.132  1.00 51.05  ? 93   VAL D C   1 
ATOM   6797  O O   . VAL D 1 95  ? -18.416 39.903  41.069  1.00 47.61  ? 93   VAL D O   1 
ATOM   6798  C CB  . VAL D 1 95  ? -19.430 37.096  41.164  1.00 67.01  ? 93   VAL D CB  1 
ATOM   6799  C CG1 . VAL D 1 95  ? -19.681 35.683  41.645  1.00 67.28  ? 93   VAL D CG1 1 
ATOM   6800  C CG2 . VAL D 1 95  ? -20.595 37.966  41.585  1.00 69.70  ? 93   VAL D CG2 1 
ATOM   6801  N N   . SER D 1 96  ? -16.449 38.907  40.683  1.00 68.74  ? 94   SER D N   1 
ATOM   6802  C CA  . SER D 1 96  ? -15.894 40.083  40.058  1.00 72.72  ? 94   SER D CA  1 
ATOM   6803  C C   . SER D 1 96  ? -15.598 39.788  38.608  1.00 73.93  ? 94   SER D C   1 
ATOM   6804  O O   . SER D 1 96  ? -14.945 38.794  38.302  1.00 76.17  ? 94   SER D O   1 
ATOM   6805  C CB  . SER D 1 96  ? -14.603 40.475  40.769  1.00 105.97 ? 94   SER D CB  1 
ATOM   6806  O OG  . SER D 1 96  ? -13.962 41.551  40.114  1.00 110.08 ? 94   SER D OG  1 
ATOM   6807  N N   . CYS D 1 97  ? -16.094 40.638  37.716  1.00 54.42  ? 95   CYS D N   1 
ATOM   6808  C CA  . CYS D 1 97  ? -15.829 40.467  36.302  1.00 51.50  ? 95   CYS D CA  1 
ATOM   6809  C C   . CYS D 1 97  ? -15.067 41.712  35.907  1.00 49.46  ? 95   CYS D C   1 
ATOM   6810  O O   . CYS D 1 97  ? -15.559 42.830  36.050  1.00 49.90  ? 95   CYS D O   1 
ATOM   6811  C CB  . CYS D 1 97  ? -17.119 40.386  35.515  1.00 80.06  ? 95   CYS D CB  1 
ATOM   6812  S SG  . CYS D 1 97  ? -18.501 39.730  36.491  1.00 84.60  ? 95   CYS D SG  1 
ATOM   6813  N N   . ALA D 1 98  ? -13.847 41.506  35.443  1.00 59.84  ? 96   ALA D N   1 
ATOM   6814  C CA  . ALA D 1 98  ? -12.970 42.583  35.027  1.00 60.37  ? 96   ALA D CA  1 
ATOM   6815  C C   . ALA D 1 98  ? -11.765 41.824  34.534  1.00 61.58  ? 96   ALA D C   1 
ATOM   6816  O O   . ALA D 1 98  ? -11.161 41.050  35.275  1.00 62.31  ? 96   ALA D O   1 
ATOM   6817  C CB  . ALA D 1 98  ? -12.596 43.471  36.211  1.00 44.04  ? 96   ALA D CB  1 
ATOM   6818  N N   . ALA D 1 99  ? -11.442 42.020  33.266  1.00 65.98  ? 97   ALA D N   1 
ATOM   6819  C CA  . ALA D 1 99  ? -10.320 41.337  32.659  1.00 66.51  ? 97   ALA D CA  1 
ATOM   6820  C C   . ALA D 1 99  ? -9.091  41.426  33.539  1.00 66.51  ? 97   ALA D C   1 
ATOM   6821  O O   . ALA D 1 99  ? -8.915  42.394  34.281  1.00 67.70  ? 97   ALA D O   1 
ATOM   6822  C CB  . ALA D 1 99  ? -10.027 41.942  31.297  1.00 99.58  ? 97   ALA D CB  1 
ATOM   6823  N N   . GLY D 1 100 ? -8.250  40.402  33.455  1.00 86.77  ? 98   GLY D N   1 
ATOM   6824  C CA  . GLY D 1 100 ? -7.021  40.382  34.224  1.00 86.18  ? 98   GLY D CA  1 
ATOM   6825  C C   . GLY D 1 100 ? -7.169  40.057  35.693  1.00 85.37  ? 98   GLY D C   1 
ATOM   6826  O O   . GLY D 1 100 ? -6.759  38.983  36.122  1.00 86.23  ? 98   GLY D O   1 
ATOM   6827  N N   . VAL D 1 101 ? -7.739  40.988  36.459  1.00 70.84  ? 99   VAL D N   1 
ATOM   6828  C CA  . VAL D 1 101 ? -7.943  40.823  37.899  1.00 68.08  ? 99   VAL D CA  1 
ATOM   6829  C C   . VAL D 1 101 ? -8.026  39.347  38.258  1.00 67.51  ? 99   VAL D C   1 
ATOM   6830  O O   . VAL D 1 101 ? -8.939  38.656  37.832  1.00 68.14  ? 99   VAL D O   1 
ATOM   6831  C CB  . VAL D 1 101 ? -9.229  41.544  38.361  1.00 65.88  ? 99   VAL D CB  1 
ATOM   6832  C CG1 . VAL D 1 101 ? -9.431  41.343  39.851  1.00 65.49  ? 99   VAL D CG1 1 
ATOM   6833  C CG2 . VAL D 1 101 ? -9.137  43.041  38.031  1.00 64.95  ? 99   VAL D CG2 1 
ATOM   6834  N N   . THR D 1 102 ? -7.062  38.868  39.039  1.00 59.67  ? 100  THR D N   1 
ATOM   6835  C CA  . THR D 1 102 ? -7.002  37.456  39.423  1.00 58.76  ? 100  THR D CA  1 
ATOM   6836  C C   . THR D 1 102 ? -7.757  37.097  40.697  1.00 60.84  ? 100  THR D C   1 
ATOM   6837  O O   . THR D 1 102 ? -8.002  37.956  41.545  1.00 61.48  ? 100  THR D O   1 
ATOM   6838  C CB  . THR D 1 102 ? -5.552  37.028  39.631  1.00 50.56  ? 100  THR D CB  1 
ATOM   6839  O OG1 . THR D 1 102 ? -4.750  37.551  38.568  1.00 48.97  ? 100  THR D OG1 1 
ATOM   6840  C CG2 . THR D 1 102 ? -5.442  35.513  39.660  1.00 50.46  ? 100  THR D CG2 1 
ATOM   6841  N N   . ILE D 1 103 ? -8.125  35.821  40.823  1.00 73.63  ? 101  ILE D N   1 
ATOM   6842  C CA  . ILE D 1 103 ? -8.812  35.336  42.021  1.00 75.57  ? 101  ILE D CA  1 
ATOM   6843  C C   . ILE D 1 103 ? -7.838  35.684  43.126  1.00 76.55  ? 101  ILE D C   1 
ATOM   6844  O O   . ILE D 1 103 ? -8.097  36.545  43.968  1.00 77.31  ? 101  ILE D O   1 
ATOM   6845  C CB  . ILE D 1 103 ? -9.002  33.785  42.002  1.00 64.95  ? 101  ILE D CB  1 
ATOM   6846  C CG1 . ILE D 1 103 ? -10.286 33.418  41.267  1.00 64.85  ? 101  ILE D CG1 1 
ATOM   6847  C CG2 . ILE D 1 103 ? -9.102  33.234  43.424  1.00 65.06  ? 101  ILE D CG2 1 
ATOM   6848  C CD1 . ILE D 1 103 ? -11.528 33.815  42.019  1.00 69.34  ? 101  ILE D CD1 1 
ATOM   6849  N N   . SER D 1 104 ? -6.700  35.005  43.082  1.00 67.88  ? 102  SER D N   1 
ATOM   6850  C CA  . SER D 1 104 ? -5.632  35.204  44.036  1.00 68.52  ? 102  SER D CA  1 
ATOM   6851  C C   . SER D 1 104 ? -5.501  36.671  44.437  1.00 68.16  ? 102  SER D C   1 
ATOM   6852  O O   . SER D 1 104 ? -5.790  37.040  45.576  1.00 68.97  ? 102  SER D O   1 
ATOM   6853  C CB  . SER D 1 104 ? -4.327  34.717  43.423  1.00 83.45  ? 102  SER D CB  1 
ATOM   6854  O OG  . SER D 1 104 ? -3.228  35.129  44.205  1.00 87.12  ? 102  SER D OG  1 
ATOM   6855  N N   . SER D 1 105 ? -5.069  37.502  43.493  1.00 59.19  ? 103  SER D N   1 
ATOM   6856  C CA  . SER D 1 105 ? -4.884  38.932  43.732  1.00 58.56  ? 103  SER D CA  1 
ATOM   6857  C C   . SER D 1 105 ? -6.050  39.579  44.476  1.00 57.46  ? 103  SER D C   1 
ATOM   6858  O O   . SER D 1 105 ? -5.857  40.488  45.276  1.00 57.35  ? 103  SER D O   1 
ATOM   6859  C CB  . SER D 1 105 ? -4.665  39.652  42.401  1.00 82.47  ? 103  SER D CB  1 
ATOM   6860  O OG  . SER D 1 105 ? -5.757  39.439  41.523  1.00 84.06  ? 103  SER D OG  1 
ATOM   6861  N N   . ILE D 1 106 ? -7.260  39.117  44.202  1.00 58.27  ? 104  ILE D N   1 
ATOM   6862  C CA  . ILE D 1 106 ? -8.435  39.662  44.860  1.00 59.65  ? 104  ILE D CA  1 
ATOM   6863  C C   . ILE D 1 106 ? -8.449  39.236  46.314  1.00 59.89  ? 104  ILE D C   1 
ATOM   6864  O O   . ILE D 1 106 ? -8.716  40.036  47.208  1.00 61.03  ? 104  ILE D O   1 
ATOM   6865  C CB  . ILE D 1 106 ? -9.724  39.156  44.200  1.00 74.86  ? 104  ILE D CB  1 
ATOM   6866  C CG1 . ILE D 1 106 ? -9.917  39.849  42.854  1.00 76.39  ? 104  ILE D CG1 1 
ATOM   6867  C CG2 . ILE D 1 106 ? -10.915 39.409  45.108  1.00 76.29  ? 104  ILE D CG2 1 
ATOM   6868  C CD1 . ILE D 1 106 ? -11.030 39.256  42.026  1.00 79.84  ? 104  ILE D CD1 1 
ATOM   6869  N N   . GLU D 1 107 ? -8.162  37.963  46.545  1.00 68.72  ? 105  GLU D N   1 
ATOM   6870  C CA  . GLU D 1 107 ? -8.156  37.425  47.892  1.00 67.33  ? 105  GLU D CA  1 
ATOM   6871  C C   . GLU D 1 107 ? -7.092  38.081  48.763  1.00 68.16  ? 105  GLU D C   1 
ATOM   6872  O O   . GLU D 1 107 ? -7.396  38.557  49.857  1.00 68.21  ? 105  GLU D O   1 
ATOM   6873  C CB  . GLU D 1 107 ? -7.969  35.911  47.826  1.00 61.01  ? 105  GLU D CB  1 
ATOM   6874  C CG  . GLU D 1 107 ? -9.078  35.245  47.017  1.00 59.88  ? 105  GLU D CG  1 
ATOM   6875  C CD  . GLU D 1 107 ? -8.930  33.740  46.899  1.00 58.53  ? 105  GLU D CD  1 
ATOM   6876  O OE1 . GLU D 1 107 ? -7.806  33.276  46.595  1.00 59.30  ? 105  GLU D OE1 1 
ATOM   6877  O OE2 . GLU D 1 107 ? -9.944  33.025  47.094  1.00 53.32  ? 105  GLU D OE2 1 
ATOM   6878  N N   . LYS D 1 108 ? -5.853  38.119  48.278  1.00 66.22  ? 106  LYS D N   1 
ATOM   6879  C CA  . LYS D 1 108 ? -4.756  38.736  49.023  1.00 66.78  ? 106  LYS D CA  1 
ATOM   6880  C C   . LYS D 1 108 ? -5.023  40.227  49.155  1.00 65.60  ? 106  LYS D C   1 
ATOM   6881  O O   . LYS D 1 108 ? -4.208  41.059  48.765  1.00 65.88  ? 106  LYS D O   1 
ATOM   6882  C CB  . LYS D 1 108 ? -3.441  38.525  48.288  1.00 90.61  ? 106  LYS D CB  1 
ATOM   6883  C CG  . LYS D 1 108 ? -3.211  37.098  47.877  1.00 95.12  ? 106  LYS D CG  1 
ATOM   6884  C CD  . LYS D 1 108 ? -1.943  36.987  47.065  1.00 101.18 ? 106  LYS D CD  1 
ATOM   6885  C CE  . LYS D 1 108 ? -1.699  35.558  46.614  1.00 105.07 ? 106  LYS D CE  1 
ATOM   6886  N NZ  . LYS D 1 108 ? -0.424  35.429  45.846  1.00 106.09 ? 106  LYS D NZ  1 
ATOM   6887  N N   . LYS D 1 109 ? -6.178  40.547  49.713  1.00 46.64  ? 107  LYS D N   1 
ATOM   6888  C CA  . LYS D 1 109 ? -6.608  41.916  49.894  1.00 49.52  ? 107  LYS D CA  1 
ATOM   6889  C C   . LYS D 1 109 ? -7.785  41.823  50.844  1.00 52.89  ? 107  LYS D C   1 
ATOM   6890  O O   . LYS D 1 109 ? -7.904  42.595  51.794  1.00 53.42  ? 107  LYS D O   1 
ATOM   6891  C CB  . LYS D 1 109 ? -7.063  42.483  48.555  1.00 68.68  ? 107  LYS D CB  1 
ATOM   6892  C CG  . LYS D 1 109 ? -6.042  43.344  47.840  1.00 70.38  ? 107  LYS D CG  1 
ATOM   6893  C CD  . LYS D 1 109 ? -6.245  44.797  48.219  1.00 71.29  ? 107  LYS D CD  1 
ATOM   6894  C CE  . LYS D 1 109 ? -5.351  45.724  47.425  1.00 70.48  ? 107  LYS D CE  1 
ATOM   6895  N NZ  . LYS D 1 109 ? -5.640  47.150  47.745  1.00 69.55  ? 107  LYS D NZ  1 
ATOM   6896  N N   . LEU D 1 110 ? -8.651  40.856  50.569  1.00 70.34  ? 108  LEU D N   1 
ATOM   6897  C CA  . LEU D 1 110 ? -9.832  40.612  51.381  1.00 73.26  ? 108  LEU D CA  1 
ATOM   6898  C C   . LEU D 1 110 ? -9.446  39.646  52.484  1.00 75.18  ? 108  LEU D C   1 
ATOM   6899  O O   . LEU D 1 110 ? -10.137 39.527  53.495  1.00 75.20  ? 108  LEU D O   1 
ATOM   6900  C CB  . LEU D 1 110 ? -10.931 40.004  50.523  1.00 89.25  ? 108  LEU D CB  1 
ATOM   6901  C CG  . LEU D 1 110 ? -11.298 40.874  49.331  1.00 89.15  ? 108  LEU D CG  1 
ATOM   6902  C CD1 . LEU D 1 110 ? -12.144 40.067  48.376  1.00 90.45  ? 108  LEU D CD1 1 
ATOM   6903  C CD2 . LEU D 1 110 ? -12.021 42.125  49.808  1.00 88.14  ? 108  LEU D CD2 1 
ATOM   6904  N N   . SER D 1 111 ? -8.346  38.935  52.266  1.00 107.11 ? 109  SER D N   1 
ATOM   6905  C CA  . SER D 1 111 ? -7.841  38.001  53.258  1.00 108.89 ? 109  SER D CA  1 
ATOM   6906  C C   . SER D 1 111 ? -7.386  38.882  54.410  1.00 109.22 ? 109  SER D C   1 
ATOM   6907  O O   . SER D 1 111 ? -7.490  38.507  55.581  1.00 109.62 ? 109  SER D O   1 
ATOM   6908  C CB  . SER D 1 111 ? -6.642  37.228  52.709  1.00 107.82 ? 109  SER D CB  1 
ATOM   6909  O OG  . SER D 1 111 ? -6.995  36.463  51.575  1.00 108.09 ? 109  SER D OG  1 
ATOM   6910  N N   . ALA D 1 112 ? -6.884  40.064  54.052  1.00 70.49  ? 110  ALA D N   1 
ATOM   6911  C CA  . ALA D 1 112 ? -6.413  41.041  55.022  1.00 69.31  ? 110  ALA D CA  1 
ATOM   6912  C C   . ALA D 1 112 ? -7.582  41.563  55.859  1.00 69.85  ? 110  ALA D C   1 
ATOM   6913  O O   . ALA D 1 112 ? -7.477  42.592  56.517  1.00 69.26  ? 110  ALA D O   1 
ATOM   6914  C CB  . ALA D 1 112 ? -5.714  42.192  54.308  1.00 61.14  ? 110  ALA D CB  1 
ATOM   6915  N N   . PHE D 1 113 ? -8.705  40.854  55.794  1.00 78.36  ? 111  PHE D N   1 
ATOM   6916  C CA  . PHE D 1 113 ? -9.908  41.170  56.564  1.00 80.46  ? 111  PHE D CA  1 
ATOM   6917  C C   . PHE D 1 113 ? -10.500 39.806  56.898  1.00 82.95  ? 111  PHE D C   1 
ATOM   6918  O O   . PHE D 1 113 ? -9.798  38.923  57.394  1.00 82.93  ? 111  PHE D O   1 
ATOM   6919  C CB  . PHE D 1 113 ? -10.939 41.957  55.748  1.00 76.61  ? 111  PHE D CB  1 
ATOM   6920  C CG  . PHE D 1 113 ? -10.467 43.300  55.285  1.00 76.17  ? 111  PHE D CG  1 
ATOM   6921  C CD1 . PHE D 1 113 ? -9.548  43.410  54.248  1.00 76.84  ? 111  PHE D CD1 1 
ATOM   6922  C CD2 . PHE D 1 113 ? -10.978 44.458  55.852  1.00 75.45  ? 111  PHE D CD2 1 
ATOM   6923  C CE1 . PHE D 1 113 ? -9.147  44.658  53.777  1.00 76.30  ? 111  PHE D CE1 1 
ATOM   6924  C CE2 . PHE D 1 113 ? -10.584 45.712  55.389  1.00 75.93  ? 111  PHE D CE2 1 
ATOM   6925  C CZ  . PHE D 1 113 ? -9.666  45.810  54.348  1.00 75.91  ? 111  PHE D CZ  1 
ATOM   6926  N N   . ARG D 1 114 ? -11.784 39.630  56.603  1.00 98.62  ? 112  ARG D N   1 
ATOM   6927  C CA  . ARG D 1 114 ? -12.447 38.359  56.858  1.00 102.61 ? 112  ARG D CA  1 
ATOM   6928  C C   . ARG D 1 114 ? -11.478 37.207  56.545  1.00 103.32 ? 112  ARG D C   1 
ATOM   6929  O O   . ARG D 1 114 ? -10.705 37.267  55.581  1.00 102.45 ? 112  ARG D O   1 
ATOM   6930  C CB  . ARG D 1 114 ? -13.718 38.251  56.004  1.00 129.21 ? 112  ARG D CB  1 
ATOM   6931  C CG  . ARG D 1 114 ? -14.840 39.218  56.395  1.00 131.41 ? 112  ARG D CG  1 
ATOM   6932  C CD  . ARG D 1 114 ? -15.552 38.771  57.669  1.00 134.74 ? 112  ARG D CD  1 
ATOM   6933  N NE  . ARG D 1 114 ? -16.640 39.674  58.045  1.00 138.10 ? 112  ARG D NE  1 
ATOM   6934  C CZ  . ARG D 1 114 ? -17.485 39.455  59.049  1.00 139.26 ? 112  ARG D CZ  1 
ATOM   6935  N NH1 . ARG D 1 114 ? -17.373 38.358  59.787  1.00 140.87 ? 112  ARG D NH1 1 
ATOM   6936  N NH2 . ARG D 1 114 ? -18.443 40.332  59.317  1.00 139.18 ? 112  ARG D NH2 1 
ATOM   6937  N N   . PRO D 1 115 ? -11.497 36.152  57.376  1.00 116.63 ? 113  PRO D N   1 
ATOM   6938  C CA  . PRO D 1 115 ? -10.646 34.967  57.245  1.00 116.19 ? 113  PRO D CA  1 
ATOM   6939  C C   . PRO D 1 115 ? -10.589 34.362  55.850  1.00 115.02 ? 113  PRO D C   1 
ATOM   6940  O O   . PRO D 1 115 ? -9.588  34.496  55.147  1.00 115.10 ? 113  PRO D O   1 
ATOM   6941  C CB  . PRO D 1 115 ? -11.248 34.003  58.260  1.00 142.57 ? 113  PRO D CB  1 
ATOM   6942  C CG  . PRO D 1 115 ? -11.719 34.924  59.335  1.00 142.90 ? 113  PRO D CG  1 
ATOM   6943  C CD  . PRO D 1 115 ? -12.392 36.015  58.540  1.00 142.93 ? 113  PRO D CD  1 
ATOM   6944  N N   . ALA D 1 116 ? -11.666 33.694  55.452  1.00 90.24  ? 114  ALA D N   1 
ATOM   6945  C CA  . ALA D 1 116 ? -11.701 33.060  54.146  1.00 89.71  ? 114  ALA D CA  1 
ATOM   6946  C C   . ALA D 1 116 ? -12.797 33.582  53.230  1.00 89.84  ? 114  ALA D C   1 
ATOM   6947  O O   . ALA D 1 116 ? -13.973 33.241  53.387  1.00 90.19  ? 114  ALA D O   1 
ATOM   6948  C CB  . ALA D 1 116 ? -11.834 31.555  54.305  1.00 110.76 ? 114  ALA D CB  1 
ATOM   6949  N N   . PRO D 1 117 ? -12.420 34.458  52.284  1.00 96.01  ? 115  PRO D N   1 
ATOM   6950  C CA  . PRO D 1 117 ? -13.292 35.084  51.284  1.00 93.57  ? 115  PRO D CA  1 
ATOM   6951  C C   . PRO D 1 117 ? -13.804 34.127  50.202  1.00 90.56  ? 115  PRO D C   1 
ATOM   6952  O O   . PRO D 1 117 ? -13.025 33.495  49.485  1.00 89.27  ? 115  PRO D O   1 
ATOM   6953  C CB  . PRO D 1 117 ? -12.405 36.177  50.702  1.00 92.54  ? 115  PRO D CB  1 
ATOM   6954  C CG  . PRO D 1 117 ? -11.645 36.625  51.889  1.00 94.65  ? 115  PRO D CG  1 
ATOM   6955  C CD  . PRO D 1 117 ? -11.240 35.311  52.526  1.00 95.16  ? 115  PRO D CD  1 
ATOM   6956  N N   . ARG D 1 118 ? -15.125 34.033  50.104  1.00 101.99 ? 116  ARG D N   1 
ATOM   6957  C CA  . ARG D 1 118 ? -15.791 33.198  49.111  1.00 97.47  ? 116  ARG D CA  1 
ATOM   6958  C C   . ARG D 1 118 ? -15.805 34.075  47.857  1.00 94.79  ? 116  ARG D C   1 
ATOM   6959  O O   . ARG D 1 118 ? -16.565 35.045  47.788  1.00 95.09  ? 116  ARG D O   1 
ATOM   6960  C CB  . ARG D 1 118 ? -17.217 32.907  49.576  1.00 83.14  ? 116  ARG D CB  1 
ATOM   6961  C CG  . ARG D 1 118 ? -17.312 32.624  51.064  1.00 84.56  ? 116  ARG D CG  1 
ATOM   6962  C CD  . ARG D 1 118 ? -18.746 32.658  51.545  1.00 87.09  ? 116  ARG D CD  1 
ATOM   6963  N NE  . ARG D 1 118 ? -19.487 31.470  51.140  1.00 89.47  ? 116  ARG D NE  1 
ATOM   6964  C CZ  . ARG D 1 118 ? -20.808 31.351  51.220  1.00 90.96  ? 116  ARG D CZ  1 
ATOM   6965  N NH1 . ARG D 1 118 ? -21.544 32.351  51.687  1.00 91.31  ? 116  ARG D NH1 1 
ATOM   6966  N NH2 . ARG D 1 118 ? -21.397 30.226  50.839  1.00 92.12  ? 116  ARG D NH2 1 
ATOM   6967  N N   . VAL D 1 119 ? -14.970 33.734  46.874  1.00 54.90  ? 117  VAL D N   1 
ATOM   6968  C CA  . VAL D 1 119 ? -14.842 34.526  45.646  1.00 49.46  ? 117  VAL D CA  1 
ATOM   6969  C C   . VAL D 1 119 ? -14.801 33.726  44.342  1.00 47.60  ? 117  VAL D C   1 
ATOM   6970  O O   . VAL D 1 119 ? -14.069 32.740  44.233  1.00 45.31  ? 117  VAL D O   1 
ATOM   6971  C CB  . VAL D 1 119 ? -13.557 35.409  45.723  1.00 50.43  ? 117  VAL D CB  1 
ATOM   6972  C CG1 . VAL D 1 119 ? -13.107 35.829  44.342  1.00 49.82  ? 117  VAL D CG1 1 
ATOM   6973  C CG2 . VAL D 1 119 ? -13.825 36.640  46.570  1.00 48.61  ? 117  VAL D CG2 1 
ATOM   6974  N N   . ILE D 1 120 ? -15.575 34.177  43.350  1.00 60.42  ? 118  ILE D N   1 
ATOM   6975  C CA  . ILE D 1 120 ? -15.626 33.525  42.035  1.00 58.38  ? 118  ILE D CA  1 
ATOM   6976  C C   . ILE D 1 120 ? -15.248 34.484  40.914  1.00 56.72  ? 118  ILE D C   1 
ATOM   6977  O O   . ILE D 1 120 ? -15.700 35.634  40.899  1.00 55.66  ? 118  ILE D O   1 
ATOM   6978  C CB  . ILE D 1 120 ? -17.029 33.012  41.677  1.00 66.77  ? 118  ILE D CB  1 
ATOM   6979  C CG1 . ILE D 1 120 ? -17.743 32.475  42.915  1.00 68.45  ? 118  ILE D CG1 1 
ATOM   6980  C CG2 . ILE D 1 120 ? -16.901 31.912  40.631  1.00 65.20  ? 118  ILE D CG2 1 
ATOM   6981  C CD1 . ILE D 1 120 ? -17.043 31.300  43.561  1.00 74.39  ? 118  ILE D CD1 1 
ATOM   6982  N N   . ARG D 1 121 ? -14.437 34.012  39.968  1.00 57.03  ? 119  ARG D N   1 
ATOM   6983  C CA  . ARG D 1 121 ? -14.044 34.861  38.848  1.00 56.07  ? 119  ARG D CA  1 
ATOM   6984  C C   . ARG D 1 121 ? -15.095 34.749  37.754  1.00 56.49  ? 119  ARG D C   1 
ATOM   6985  O O   . ARG D 1 121 ? -15.414 33.665  37.253  1.00 54.59  ? 119  ARG D O   1 
ATOM   6986  C CB  . ARG D 1 121 ? -12.667 34.487  38.291  1.00 63.81  ? 119  ARG D CB  1 
ATOM   6987  C CG  . ARG D 1 121 ? -12.029 35.665  37.556  1.00 64.16  ? 119  ARG D CG  1 
ATOM   6988  C CD  . ARG D 1 121 ? -10.670 35.386  36.913  1.00 63.66  ? 119  ARG D CD  1 
ATOM   6989  N NE  . ARG D 1 121 ? -10.222 36.574  36.186  1.00 65.78  ? 119  ARG D NE  1 
ATOM   6990  C CZ  . ARG D 1 121 ? -9.110  36.663  35.459  1.00 66.99  ? 119  ARG D CZ  1 
ATOM   6991  N NH1 . ARG D 1 121 ? -8.288  35.625  35.339  1.00 67.81  ? 119  ARG D NH1 1 
ATOM   6992  N NH2 . ARG D 1 121 ? -8.822  37.805  34.842  1.00 67.63  ? 119  ARG D NH2 1 
ATOM   6993  N N   . CYS D 1 122 ? -15.626 35.899  37.383  1.00 56.67  ? 120  CYS D N   1 
ATOM   6994  C CA  . CYS D 1 122 ? -16.677 35.961  36.399  1.00 56.69  ? 120  CYS D CA  1 
ATOM   6995  C C   . CYS D 1 122 ? -16.259 36.504  35.041  1.00 54.55  ? 120  CYS D C   1 
ATOM   6996  O O   . CYS D 1 122 ? -15.293 37.256  34.928  1.00 53.77  ? 120  CYS D O   1 
ATOM   6997  C CB  . CYS D 1 122 ? -17.803 36.798  36.990  1.00 79.50  ? 120  CYS D CB  1 
ATOM   6998  S SG  . CYS D 1 122 ? -18.752 37.815  35.826  1.00 90.50  ? 120  CYS D SG  1 
ATOM   6999  N N   . MET D 1 123 ? -16.986 36.097  34.004  1.00 62.01  ? 121  MET D N   1 
ATOM   7000  C CA  . MET D 1 123 ? -16.728 36.578  32.650  1.00 59.50  ? 121  MET D CA  1 
ATOM   7001  C C   . MET D 1 123 ? -17.870 36.362  31.666  1.00 56.92  ? 121  MET D C   1 
ATOM   7002  O O   . MET D 1 123 ? -18.186 35.236  31.290  1.00 57.76  ? 121  MET D O   1 
ATOM   7003  C CB  . MET D 1 123 ? -15.473 35.955  32.067  1.00 59.64  ? 121  MET D CB  1 
ATOM   7004  C CG  . MET D 1 123 ? -15.299 36.352  30.617  1.00 61.13  ? 121  MET D CG  1 
ATOM   7005  S SD  . MET D 1 123 ? -15.423 38.133  30.319  1.00 62.96  ? 121  MET D SD  1 
ATOM   7006  C CE  . MET D 1 123 ? -13.678 38.655  30.247  1.00 57.95  ? 121  MET D CE  1 
ATOM   7007  N N   . THR D 1 124 ? -18.472 37.461  31.235  1.00 50.86  ? 122  THR D N   1 
ATOM   7008  C CA  . THR D 1 124 ? -19.575 37.402  30.293  1.00 47.62  ? 122  THR D CA  1 
ATOM   7009  C C   . THR D 1 124 ? -19.434 38.500  29.259  1.00 47.17  ? 122  THR D C   1 
ATOM   7010  O O   . THR D 1 124 ? -18.345 39.022  29.014  1.00 45.98  ? 122  THR D O   1 
ATOM   7011  C CB  . THR D 1 124 ? -20.922 37.653  30.968  1.00 36.15  ? 122  THR D CB  1 
ATOM   7012  O OG1 . THR D 1 124 ? -20.918 38.971  31.529  1.00 39.05  ? 122  THR D OG1 1 
ATOM   7013  C CG2 . THR D 1 124 ? -21.172 36.674  32.047  1.00 33.78  ? 122  THR D CG2 1 
ATOM   7014  N N   . ASN D 1 125 ? -20.579 38.848  28.679  1.00 39.44  ? 123  ASN D N   1 
ATOM   7015  C CA  . ASN D 1 125 ? -20.692 39.886  27.668  1.00 37.66  ? 123  ASN D CA  1 
ATOM   7016  C C   . ASN D 1 125 ? -22.080 40.512  27.743  1.00 35.66  ? 123  ASN D C   1 
ATOM   7017  O O   . ASN D 1 125 ? -22.964 40.036  28.466  1.00 35.37  ? 123  ASN D O   1 
ATOM   7018  C CB  . ASN D 1 125 ? -20.464 39.295  26.280  1.00 46.68  ? 123  ASN D CB  1 
ATOM   7019  C CG  . ASN D 1 125 ? -21.145 37.957  26.106  1.00 48.42  ? 123  ASN D CG  1 
ATOM   7020  O OD1 . ASN D 1 125 ? -22.162 37.684  26.736  1.00 48.93  ? 123  ASN D OD1 1 
ATOM   7021  N ND2 . ASN D 1 125 ? -20.593 37.118  25.242  1.00 49.42  ? 123  ASN D ND2 1 
ATOM   7022  N N   . THR D 1 126 ? -22.267 41.581  26.984  1.00 38.68  ? 124  THR D N   1 
ATOM   7023  C CA  . THR D 1 126 ? -23.540 42.287  26.965  1.00 38.30  ? 124  THR D CA  1 
ATOM   7024  C C   . THR D 1 126 ? -24.785 41.478  26.587  1.00 33.16  ? 124  THR D C   1 
ATOM   7025  O O   . THR D 1 126 ? -25.835 41.674  27.186  1.00 31.33  ? 124  THR D O   1 
ATOM   7026  C CB  . THR D 1 126 ? -23.450 43.507  26.053  1.00 52.83  ? 124  THR D CB  1 
ATOM   7027  O OG1 . THR D 1 126 ? -22.208 43.471  25.338  1.00 55.51  ? 124  THR D OG1 1 
ATOM   7028  C CG2 . THR D 1 126 ? -23.530 44.783  26.877  1.00 52.58  ? 124  THR D CG2 1 
ATOM   7029  N N   . PRO D 1 127 ? -24.687 40.564  25.594  1.00 32.62  ? 125  PRO D N   1 
ATOM   7030  C CA  . PRO D 1 127 ? -25.808 39.719  25.131  1.00 35.92  ? 125  PRO D CA  1 
ATOM   7031  C C   . PRO D 1 127 ? -26.678 39.226  26.279  1.00 37.39  ? 125  PRO D C   1 
ATOM   7032  O O   . PRO D 1 127 ? -27.767 38.685  26.087  1.00 35.61  ? 125  PRO D O   1 
ATOM   7033  C CB  . PRO D 1 127 ? -25.104 38.576  24.419  1.00 23.11  ? 125  PRO D CB  1 
ATOM   7034  C CG  . PRO D 1 127 ? -23.933 39.258  23.807  1.00 21.71  ? 125  PRO D CG  1 
ATOM   7035  C CD  . PRO D 1 127 ? -23.444 40.207  24.886  1.00 21.10  ? 125  PRO D CD  1 
ATOM   7036  N N   . VAL D 1 128 ? -26.149 39.402  27.478  1.00 48.15  ? 126  VAL D N   1 
ATOM   7037  C CA  . VAL D 1 128 ? -26.818 39.053  28.710  1.00 50.09  ? 126  VAL D CA  1 
ATOM   7038  C C   . VAL D 1 128 ? -28.129 39.843  28.774  1.00 50.68  ? 126  VAL D C   1 
ATOM   7039  O O   . VAL D 1 128 ? -29.128 39.375  29.318  1.00 49.84  ? 126  VAL D O   1 
ATOM   7040  C CB  . VAL D 1 128 ? -25.903 39.432  29.910  1.00 36.89  ? 126  VAL D CB  1 
ATOM   7041  C CG1 . VAL D 1 128 ? -26.733 39.823  31.125  1.00 39.01  ? 126  VAL D CG1 1 
ATOM   7042  C CG2 . VAL D 1 128 ? -24.974 38.275  30.231  1.00 33.83  ? 126  VAL D CG2 1 
ATOM   7043  N N   . VAL D 1 129 ? -28.125 41.043  28.202  1.00 32.31  ? 127  VAL D N   1 
ATOM   7044  C CA  . VAL D 1 129 ? -29.313 41.883  28.234  1.00 35.81  ? 127  VAL D CA  1 
ATOM   7045  C C   . VAL D 1 129 ? -30.476 41.217  27.524  1.00 38.55  ? 127  VAL D C   1 
ATOM   7046  O O   . VAL D 1 129 ? -31.633 41.549  27.765  1.00 37.75  ? 127  VAL D O   1 
ATOM   7047  C CB  . VAL D 1 129 ? -29.064 43.253  27.588  1.00 41.71  ? 127  VAL D CB  1 
ATOM   7048  C CG1 . VAL D 1 129 ? -29.826 44.315  28.360  1.00 42.81  ? 127  VAL D CG1 1 
ATOM   7049  C CG2 . VAL D 1 129 ? -27.578 43.577  27.574  1.00 45.70  ? 127  VAL D CG2 1 
ATOM   7050  N N   . VAL D 1 130 ? -30.163 40.265  26.653  1.00 70.05  ? 128  VAL D N   1 
ATOM   7051  C CA  . VAL D 1 130 ? -31.189 39.546  25.913  1.00 72.93  ? 128  VAL D CA  1 
ATOM   7052  C C   . VAL D 1 130 ? -31.159 38.079  26.323  1.00 75.51  ? 128  VAL D C   1 
ATOM   7053  O O   . VAL D 1 130 ? -31.603 37.203  25.587  1.00 76.63  ? 128  VAL D O   1 
ATOM   7054  C CB  . VAL D 1 130 ? -30.958 39.666  24.396  1.00 64.85  ? 128  VAL D CB  1 
ATOM   7055  C CG1 . VAL D 1 130 ? -29.755 38.833  23.980  1.00 66.65  ? 128  VAL D CG1 1 
ATOM   7056  C CG2 . VAL D 1 130 ? -32.198 39.241  23.652  1.00 64.86  ? 128  VAL D CG2 1 
ATOM   7057  N N   . ARG D 1 131 ? -30.620 37.830  27.510  1.00 60.08  ? 129  ARG D N   1 
ATOM   7058  C CA  . ARG D 1 131 ? -30.517 36.486  28.064  1.00 59.91  ? 129  ARG D CA  1 
ATOM   7059  C C   . ARG D 1 131 ? -29.799 35.539  27.128  1.00 59.20  ? 129  ARG D C   1 
ATOM   7060  O O   . ARG D 1 131 ? -30.111 34.349  27.067  1.00 58.44  ? 129  ARG D O   1 
ATOM   7061  C CB  . ARG D 1 131 ? -31.909 35.960  28.405  1.00 65.07  ? 129  ARG D CB  1 
ATOM   7062  C CG  . ARG D 1 131 ? -32.631 36.884  29.367  1.00 69.50  ? 129  ARG D CG  1 
ATOM   7063  C CD  . ARG D 1 131 ? -33.441 36.118  30.373  1.00 73.54  ? 129  ARG D CD  1 
ATOM   7064  N NE  . ARG D 1 131 ? -34.755 35.754  29.861  1.00 77.41  ? 129  ARG D NE  1 
ATOM   7065  C CZ  . ARG D 1 131 ? -35.478 34.746  30.335  1.00 80.86  ? 129  ARG D CZ  1 
ATOM   7066  N NH1 . ARG D 1 131 ? -35.004 33.998  31.326  1.00 80.52  ? 129  ARG D NH1 1 
ATOM   7067  N NH2 . ARG D 1 131 ? -36.681 34.496  29.830  1.00 84.45  ? 129  ARG D NH2 1 
ATOM   7068  N N   . GLU D 1 132 ? -28.826 36.089  26.406  1.00 70.67  ? 130  GLU D N   1 
ATOM   7069  C CA  . GLU D 1 132 ? -28.027 35.326  25.462  1.00 72.09  ? 130  GLU D CA  1 
ATOM   7070  C C   . GLU D 1 132 ? -26.542 35.517  25.647  1.00 71.91  ? 130  GLU D C   1 
ATOM   7071  O O   . GLU D 1 132 ? -25.761 35.167  24.769  1.00 72.65  ? 130  GLU D O   1 
ATOM   7072  C CB  . GLU D 1 132 ? -28.380 35.698  24.029  1.00 77.22  ? 130  GLU D CB  1 
ATOM   7073  C CG  . GLU D 1 132 ? -29.620 35.012  23.548  1.00 81.89  ? 130  GLU D CG  1 
ATOM   7074  C CD  . GLU D 1 132 ? -29.671 33.577  24.008  1.00 82.73  ? 130  GLU D CD  1 
ATOM   7075  O OE1 . GLU D 1 132 ? -28.692 32.836  23.762  1.00 82.50  ? 130  GLU D OE1 1 
ATOM   7076  O OE2 . GLU D 1 132 ? -30.690 33.204  24.625  1.00 84.14  ? 130  GLU D OE2 1 
ATOM   7077  N N   . GLY D 1 133 ? -26.147 36.087  26.778  1.00 59.07  ? 131  GLY D N   1 
ATOM   7078  C CA  . GLY D 1 133 ? -24.733 36.282  27.012  1.00 57.65  ? 131  GLY D CA  1 
ATOM   7079  C C   . GLY D 1 133 ? -24.028 34.938  27.061  1.00 57.03  ? 131  GLY D C   1 
ATOM   7080  O O   . GLY D 1 133 ? -24.678 33.892  27.093  1.00 57.67  ? 131  GLY D O   1 
ATOM   7081  N N   . ALA D 1 134 ? -22.700 34.966  27.049  1.00 58.70  ? 132  ALA D N   1 
ATOM   7082  C CA  . ALA D 1 134 ? -21.897 33.751  27.122  1.00 59.57  ? 132  ALA D CA  1 
ATOM   7083  C C   . ALA D 1 134 ? -20.982 33.940  28.314  1.00 58.28  ? 132  ALA D C   1 
ATOM   7084  O O   . ALA D 1 134 ? -20.007 34.686  28.247  1.00 56.57  ? 132  ALA D O   1 
ATOM   7085  C CB  . ALA D 1 134 ? -21.080 33.573  25.857  1.00 107.77 ? 132  ALA D CB  1 
ATOM   7086  N N   . THR D 1 135 ? -21.304 33.269  29.410  1.00 78.48  ? 133  THR D N   1 
ATOM   7087  C CA  . THR D 1 135 ? -20.517 33.407  30.614  1.00 77.31  ? 133  THR D CA  1 
ATOM   7088  C C   . THR D 1 135 ? -19.775 32.181  31.120  1.00 77.51  ? 133  THR D C   1 
ATOM   7089  O O   . THR D 1 135 ? -20.274 31.058  31.088  1.00 80.09  ? 133  THR D O   1 
ATOM   7090  C CB  . THR D 1 135 ? -21.381 33.927  31.751  1.00 59.07  ? 133  THR D CB  1 
ATOM   7091  O OG1 . THR D 1 135 ? -20.654 33.809  32.973  1.00 58.90  ? 133  THR D OG1 1 
ATOM   7092  C CG2 . THR D 1 135 ? -22.684 33.164  31.844  1.00 57.77  ? 133  THR D CG2 1 
ATOM   7093  N N   . VAL D 1 136 ? -18.567 32.421  31.605  1.00 44.01  ? 134  VAL D N   1 
ATOM   7094  C CA  . VAL D 1 136 ? -17.743 31.367  32.160  1.00 43.63  ? 134  VAL D CA  1 
ATOM   7095  C C   . VAL D 1 136 ? -17.206 31.876  33.501  1.00 46.65  ? 134  VAL D C   1 
ATOM   7096  O O   . VAL D 1 136 ? -17.018 33.089  33.680  1.00 46.67  ? 134  VAL D O   1 
ATOM   7097  C CB  . VAL D 1 136 ? -16.576 31.030  31.232  1.00 47.24  ? 134  VAL D CB  1 
ATOM   7098  C CG1 . VAL D 1 136 ? -15.672 32.233  31.066  1.00 46.22  ? 134  VAL D CG1 1 
ATOM   7099  C CG2 . VAL D 1 136 ? -15.800 29.881  31.804  1.00 47.13  ? 134  VAL D CG2 1 
ATOM   7100  N N   . TYR D 1 137 ? -16.968 30.963  34.444  1.00 61.62  ? 135  TYR D N   1 
ATOM   7101  C CA  . TYR D 1 137 ? -16.470 31.366  35.758  1.00 62.30  ? 135  TYR D CA  1 
ATOM   7102  C C   . TYR D 1 137 ? -15.381 30.465  36.319  1.00 61.55  ? 135  TYR D C   1 
ATOM   7103  O O   . TYR D 1 137 ? -15.169 29.334  35.866  1.00 58.19  ? 135  TYR D O   1 
ATOM   7104  C CB  . TYR D 1 137 ? -17.621 31.433  36.765  1.00 68.92  ? 135  TYR D CB  1 
ATOM   7105  C CG  . TYR D 1 137 ? -18.199 30.077  37.104  1.00 72.96  ? 135  TYR D CG  1 
ATOM   7106  C CD1 . TYR D 1 137 ? -17.488 29.167  37.886  1.00 74.58  ? 135  TYR D CD1 1 
ATOM   7107  C CD2 . TYR D 1 137 ? -19.445 29.688  36.613  1.00 74.29  ? 135  TYR D CD2 1 
ATOM   7108  C CE1 . TYR D 1 137 ? -18.002 27.903  38.169  1.00 75.91  ? 135  TYR D CE1 1 
ATOM   7109  C CE2 . TYR D 1 137 ? -19.969 28.427  36.889  1.00 74.97  ? 135  TYR D CE2 1 
ATOM   7110  C CZ  . TYR D 1 137 ? -19.244 27.538  37.666  1.00 75.78  ? 135  TYR D CZ  1 
ATOM   7111  O OH  . TYR D 1 137 ? -19.754 26.284  37.930  1.00 74.34  ? 135  TYR D OH  1 
ATOM   7112  N N   . ALA D 1 138 ? -14.705 30.997  37.331  1.00 51.00  ? 136  ALA D N   1 
ATOM   7113  C CA  . ALA D 1 138 ? -13.629 30.302  38.019  1.00 49.31  ? 136  ALA D CA  1 
ATOM   7114  C C   . ALA D 1 138 ? -13.958 30.298  39.499  1.00 48.51  ? 136  ALA D C   1 
ATOM   7115  O O   . ALA D 1 138 ? -14.118 31.352  40.115  1.00 45.75  ? 136  ALA D O   1 
ATOM   7116  C CB  . ALA D 1 138 ? -12.306 31.010  37.782  1.00 75.40  ? 136  ALA D CB  1 
ATOM   7117  N N   . THR D 1 139 ? -14.069 29.097  40.053  1.00 71.43  ? 137  THR D N   1 
ATOM   7118  C CA  . THR D 1 139 ? -14.378 28.906  41.458  1.00 74.65  ? 137  THR D CA  1 
ATOM   7119  C C   . THR D 1 139 ? -13.165 29.319  42.306  1.00 78.09  ? 137  THR D C   1 
ATOM   7120  O O   . THR D 1 139 ? -12.036 28.881  42.062  1.00 81.30  ? 137  THR D O   1 
ATOM   7121  C CB  . THR D 1 139 ? -14.761 27.427  41.708  1.00 57.46  ? 137  THR D CB  1 
ATOM   7122  O OG1 . THR D 1 139 ? -15.618 27.347  42.849  1.00 57.18  ? 137  THR D OG1 1 
ATOM   7123  C CG2 . THR D 1 139 ? -13.517 26.556  41.930  1.00 55.72  ? 137  THR D CG2 1 
ATOM   7124  N N   . GLY D 1 140 ? -13.401 30.172  43.297  1.00 65.68  ? 138  GLY D N   1 
ATOM   7125  C CA  . GLY D 1 140 ? -12.312 30.644  44.133  1.00 67.28  ? 138  GLY D CA  1 
ATOM   7126  C C   . GLY D 1 140 ? -11.716 29.676  45.136  1.00 67.89  ? 138  GLY D C   1 
ATOM   7127  O O   . GLY D 1 140 ? -12.133 28.520  45.267  1.00 66.49  ? 138  GLY D O   1 
ATOM   7128  N N   . THR D 1 141 ? -10.723 30.180  45.857  1.00 81.18  ? 139  THR D N   1 
ATOM   7129  C CA  . THR D 1 141 ? -10.022 29.408  46.867  1.00 82.64  ? 139  THR D CA  1 
ATOM   7130  C C   . THR D 1 141 ? -10.936 28.996  48.020  1.00 83.97  ? 139  THR D C   1 
ATOM   7131  O O   . THR D 1 141 ? -10.975 27.827  48.394  1.00 84.55  ? 139  THR D O   1 
ATOM   7132  C CB  . THR D 1 141 ? -8.838  30.209  47.434  1.00 64.90  ? 139  THR D CB  1 
ATOM   7133  O OG1 . THR D 1 141 ? -8.029  30.694  46.356  1.00 64.66  ? 139  THR D OG1 1 
ATOM   7134  C CG2 . THR D 1 141 ? -7.986  29.332  48.325  1.00 62.79  ? 139  THR D CG2 1 
ATOM   7135  N N   . HIS D 1 142 ? -11.665 29.957  48.579  1.00 63.97  ? 140  HIS D N   1 
ATOM   7136  C CA  . HIS D 1 142 ? -12.564 29.684  49.697  1.00 64.97  ? 140  HIS D CA  1 
ATOM   7137  C C   . HIS D 1 142 ? -13.993 29.576  49.208  1.00 65.90  ? 140  HIS D C   1 
ATOM   7138  O O   . HIS D 1 142 ? -14.941 29.615  49.994  1.00 67.64  ? 140  HIS D O   1 
ATOM   7139  C CB  . HIS D 1 142 ? -12.470 30.796  50.742  1.00 77.70  ? 140  HIS D CB  1 
ATOM   7140  C CG  . HIS D 1 142 ? -11.068 31.209  51.051  1.00 79.32  ? 140  HIS D CG  1 
ATOM   7141  N ND1 . HIS D 1 142 ? -10.057 30.299  51.264  1.00 80.64  ? 140  HIS D ND1 1 
ATOM   7142  C CD2 . HIS D 1 142 ? -10.503 32.434  51.165  1.00 80.60  ? 140  HIS D CD2 1 
ATOM   7143  C CE1 . HIS D 1 142 ? -8.927  30.945  51.493  1.00 81.17  ? 140  HIS D CE1 1 
ATOM   7144  N NE2 . HIS D 1 142 ? -9.171  32.242  51.439  1.00 81.41  ? 140  HIS D NE2 1 
ATOM   7145  N N   . ALA D 1 143 ? -14.144 29.447  47.898  1.00 72.20  ? 141  ALA D N   1 
ATOM   7146  C CA  . ALA D 1 143 ? -15.464 29.328  47.307  1.00 72.22  ? 141  ALA D CA  1 
ATOM   7147  C C   . ALA D 1 143 ? -15.936 27.884  47.447  1.00 72.45  ? 141  ALA D C   1 
ATOM   7148  O O   . ALA D 1 143 ? -15.336 26.965  46.885  1.00 71.71  ? 141  ALA D O   1 
ATOM   7149  C CB  . ALA D 1 143 ? -15.413 29.733  45.848  1.00 67.99  ? 141  ALA D CB  1 
ATOM   7150  N N   . GLN D 1 144 ? -17.012 27.701  48.207  1.00 68.96  ? 142  GLN D N   1 
ATOM   7151  C CA  . GLN D 1 144 ? -17.590 26.384  48.454  1.00 71.19  ? 142  GLN D CA  1 
ATOM   7152  C C   . GLN D 1 144 ? -18.118 25.710  47.194  1.00 70.84  ? 142  GLN D C   1 
ATOM   7153  O O   . GLN D 1 144 ? -17.604 25.911  46.093  1.00 69.19  ? 142  GLN D O   1 
ATOM   7154  C CB  . GLN D 1 144 ? -18.735 26.498  49.458  1.00 110.12 ? 142  GLN D CB  1 
ATOM   7155  C CG  . GLN D 1 144 ? -18.379 27.254  50.718  1.00 114.08 ? 142  GLN D CG  1 
ATOM   7156  C CD  . GLN D 1 144 ? -19.599 27.589  51.549  1.00 116.32 ? 142  GLN D CD  1 
ATOM   7157  O OE1 . GLN D 1 144 ? -19.502 28.278  52.565  1.00 118.66 ? 142  GLN D OE1 1 
ATOM   7158  N NE2 . GLN D 1 144 ? -20.760 27.104  51.120  1.00 116.53 ? 142  GLN D NE2 1 
ATOM   7159  N N   . VAL D 1 145 ? -19.151 24.896  47.375  1.00 91.63  ? 143  VAL D N   1 
ATOM   7160  C CA  . VAL D 1 145 ? -19.766 24.180  46.271  1.00 93.27  ? 143  VAL D CA  1 
ATOM   7161  C C   . VAL D 1 145 ? -21.070 24.849  45.898  1.00 94.36  ? 143  VAL D C   1 
ATOM   7162  O O   . VAL D 1 145 ? -21.236 25.317  44.773  1.00 94.18  ? 143  VAL D O   1 
ATOM   7163  C CB  . VAL D 1 145 ? -20.065 22.721  46.644  1.00 101.60 ? 143  VAL D CB  1 
ATOM   7164  C CG1 . VAL D 1 145 ? -20.935 22.081  45.576  1.00 100.47 ? 143  VAL D CG1 1 
ATOM   7165  C CG2 . VAL D 1 145 ? -18.771 21.953  46.801  1.00 101.90 ? 143  VAL D CG2 1 
ATOM   7166  N N   . GLU D 1 146 ? -21.997 24.889  46.850  1.00 83.62  ? 144  GLU D N   1 
ATOM   7167  C CA  . GLU D 1 146 ? -23.288 25.503  46.599  1.00 84.03  ? 144  GLU D CA  1 
ATOM   7168  C C   . GLU D 1 146 ? -23.047 26.921  46.111  1.00 81.45  ? 144  GLU D C   1 
ATOM   7169  O O   . GLU D 1 146 ? -23.954 27.581  45.607  1.00 82.07  ? 144  GLU D O   1 
ATOM   7170  C CB  . GLU D 1 146 ? -24.138 25.520  47.867  1.00 149.93 ? 144  GLU D CB  1 
ATOM   7171  C CG  . GLU D 1 146 ? -25.610 25.154  47.640  1.00 155.86 ? 144  GLU D CG  1 
ATOM   7172  C CD  . GLU D 1 146 ? -26.298 26.012  46.584  1.00 159.61 ? 144  GLU D CD  1 
ATOM   7173  O OE1 . GLU D 1 146 ? -25.950 25.888  45.391  1.00 161.66 ? 144  GLU D OE1 1 
ATOM   7174  O OE2 . GLU D 1 146 ? -27.190 26.811  46.944  1.00 162.08 ? 144  GLU D OE2 1 
ATOM   7175  N N   . ASP D 1 147 ? -21.819 27.398  46.274  1.00 66.54  ? 145  ASP D N   1 
ATOM   7176  C CA  . ASP D 1 147 ? -21.487 28.724  45.792  1.00 64.50  ? 145  ASP D CA  1 
ATOM   7177  C C   . ASP D 1 147 ? -21.505 28.623  44.277  1.00 64.24  ? 145  ASP D C   1 
ATOM   7178  O O   . ASP D 1 147 ? -22.339 29.239  43.611  1.00 64.99  ? 145  ASP D O   1 
ATOM   7179  C CB  . ASP D 1 147 ? -20.106 29.145  46.280  1.00 78.46  ? 145  ASP D CB  1 
ATOM   7180  C CG  . ASP D 1 147 ? -20.077 29.388  47.767  1.00 78.06  ? 145  ASP D CG  1 
ATOM   7181  O OD1 . ASP D 1 147 ? -21.149 29.710  48.320  1.00 74.91  ? 145  ASP D OD1 1 
ATOM   7182  O OD2 . ASP D 1 147 ? -18.993 29.273  48.377  1.00 78.63  ? 145  ASP D OD2 1 
ATOM   7183  N N   . GLY D 1 148 ? -20.590 27.825  43.737  1.00 71.04  ? 146  GLY D N   1 
ATOM   7184  C CA  . GLY D 1 148 ? -20.539 27.637  42.301  1.00 71.09  ? 146  GLY D CA  1 
ATOM   7185  C C   . GLY D 1 148 ? -21.921 27.284  41.796  1.00 71.39  ? 146  GLY D C   1 
ATOM   7186  O O   . GLY D 1 148 ? -22.453 27.953  40.915  1.00 70.64  ? 146  GLY D O   1 
ATOM   7187  N N   . ARG D 1 149 ? -22.509 26.235  42.361  1.00 69.98  ? 147  ARG D N   1 
ATOM   7188  C CA  . ARG D 1 149 ? -23.845 25.820  41.968  1.00 71.72  ? 147  ARG D CA  1 
ATOM   7189  C C   . ARG D 1 149 ? -24.795 27.007  41.879  1.00 69.86  ? 147  ARG D C   1 
ATOM   7190  O O   . ARG D 1 149 ? -25.622 27.065  40.970  1.00 71.80  ? 147  ARG D O   1 
ATOM   7191  C CB  . ARG D 1 149 ? -24.404 24.804  42.959  1.00 155.33 ? 147  ARG D CB  1 
ATOM   7192  C CG  . ARG D 1 149 ? -24.053 23.371  42.641  1.00 164.09 ? 147  ARG D CG  1 
ATOM   7193  C CD  . ARG D 1 149 ? -24.890 22.432  43.489  1.00 170.51 ? 147  ARG D CD  1 
ATOM   7194  N NE  . ARG D 1 149 ? -24.901 21.073  42.956  1.00 175.64 ? 147  ARG D NE  1 
ATOM   7195  C CZ  . ARG D 1 149 ? -25.688 20.101  43.408  1.00 177.90 ? 147  ARG D CZ  1 
ATOM   7196  N NH1 . ARG D 1 149 ? -26.529 20.341  44.406  1.00 179.07 ? 147  ARG D NH1 1 
ATOM   7197  N NH2 . ARG D 1 149 ? -25.639 18.892  42.861  1.00 178.35 ? 147  ARG D NH2 1 
ATOM   7198  N N   . LEU D 1 150 ? -24.685 27.950  42.816  1.00 61.07  ? 148  LEU D N   1 
ATOM   7199  C CA  . LEU D 1 150 ? -25.556 29.127  42.807  1.00 57.12  ? 148  LEU D CA  1 
ATOM   7200  C C   . LEU D 1 150 ? -25.162 30.077  41.695  1.00 56.07  ? 148  LEU D C   1 
ATOM   7201  O O   . LEU D 1 150 ? -25.998 30.792  41.140  1.00 55.40  ? 148  LEU D O   1 
ATOM   7202  C CB  . LEU D 1 150 ? -25.503 29.877  44.136  1.00 50.27  ? 148  LEU D CB  1 
ATOM   7203  C CG  . LEU D 1 150 ? -26.221 31.235  44.062  1.00 47.60  ? 148  LEU D CG  1 
ATOM   7204  C CD1 . LEU D 1 150 ? -27.623 31.063  43.486  1.00 47.95  ? 148  LEU D CD1 1 
ATOM   7205  C CD2 . LEU D 1 150 ? -26.296 31.859  45.439  1.00 47.05  ? 148  LEU D CD2 1 
ATOM   7206  N N   . MET D 1 151 ? -23.876 30.092  41.384  1.00 54.08  ? 149  MET D N   1 
ATOM   7207  C CA  . MET D 1 151 ? -23.381 30.940  40.319  1.00 53.94  ? 149  MET D CA  1 
ATOM   7208  C C   . MET D 1 151 ? -24.058 30.519  39.017  1.00 51.61  ? 149  MET D C   1 
ATOM   7209  O O   . MET D 1 151 ? -24.724 31.320  38.363  1.00 49.61  ? 149  MET D O   1 
ATOM   7210  C CB  . MET D 1 151 ? -21.869 30.789  40.188  1.00 80.19  ? 149  MET D CB  1 
ATOM   7211  C CG  . MET D 1 151 ? -21.291 31.652  39.098  1.00 85.28  ? 149  MET D CG  1 
ATOM   7212  S SD  . MET D 1 151 ? -21.694 33.388  39.370  1.00 90.51  ? 149  MET D SD  1 
ATOM   7213  C CE  . MET D 1 151 ? -20.184 34.190  38.738  1.00 88.04  ? 149  MET D CE  1 
ATOM   7214  N N   . GLU D 1 152 ? -23.890 29.248  38.661  1.00 62.02  ? 150  GLU D N   1 
ATOM   7215  C CA  . GLU D 1 152 ? -24.472 28.704  37.444  1.00 61.36  ? 150  GLU D CA  1 
ATOM   7216  C C   . GLU D 1 152 ? -25.941 29.040  37.287  1.00 61.13  ? 150  GLU D C   1 
ATOM   7217  O O   . GLU D 1 152 ? -26.320 29.720  36.339  1.00 64.14  ? 150  GLU D O   1 
ATOM   7218  C CB  . GLU D 1 152 ? -24.285 27.190  37.399  1.00 72.83  ? 150  GLU D CB  1 
ATOM   7219  C CG  . GLU D 1 152 ? -22.882 26.773  37.005  1.00 75.34  ? 150  GLU D CG  1 
ATOM   7220  C CD  . GLU D 1 152 ? -22.847 25.944  35.728  1.00 76.16  ? 150  GLU D CD  1 
ATOM   7221  O OE1 . GLU D 1 152 ? -23.884 25.857  35.032  1.00 75.45  ? 150  GLU D OE1 1 
ATOM   7222  O OE2 . GLU D 1 152 ? -21.773 25.384  35.417  1.00 78.24  ? 150  GLU D OE2 1 
ATOM   7223  N N   . GLN D 1 153 ? -26.771 28.561  38.204  1.00 56.74  ? 151  GLN D N   1 
ATOM   7224  C CA  . GLN D 1 153 ? -28.200 28.845  38.128  1.00 56.67  ? 151  GLN D CA  1 
ATOM   7225  C C   . GLN D 1 153 ? -28.396 30.303  37.742  1.00 52.87  ? 151  GLN D C   1 
ATOM   7226  O O   . GLN D 1 153 ? -29.165 30.634  36.835  1.00 52.87  ? 151  GLN D O   1 
ATOM   7227  C CB  . GLN D 1 153 ? -28.878 28.607  39.480  1.00 116.37 ? 151  GLN D CB  1 
ATOM   7228  C CG  . GLN D 1 153 ? -28.926 27.163  39.939  1.00 122.89 ? 151  GLN D CG  1 
ATOM   7229  C CD  . GLN D 1 153 ? -29.789 26.986  41.175  1.00 126.83 ? 151  GLN D CD  1 
ATOM   7230  O OE1 . GLN D 1 153 ? -30.998 27.236  41.146  1.00 129.54 ? 151  GLN D OE1 1 
ATOM   7231  N NE2 . GLN D 1 153 ? -29.172 26.559  42.272  1.00 129.68 ? 151  GLN D NE2 1 
ATOM   7232  N N   . LEU D 1 154 ? -27.661 31.158  38.441  1.00 41.83  ? 152  LEU D N   1 
ATOM   7233  C CA  . LEU D 1 154 ? -27.711 32.601  38.261  1.00 37.12  ? 152  LEU D CA  1 
ATOM   7234  C C   . LEU D 1 154 ? -27.379 33.091  36.851  1.00 34.80  ? 152  LEU D C   1 
ATOM   7235  O O   . LEU D 1 154 ? -28.191 33.756  36.206  1.00 30.97  ? 152  LEU D O   1 
ATOM   7236  C CB  . LEU D 1 154 ? -26.771 33.249  39.282  1.00 59.98  ? 152  LEU D CB  1 
ATOM   7237  C CG  . LEU D 1 154 ? -27.300 34.483  40.008  1.00 58.78  ? 152  LEU D CG  1 
ATOM   7238  C CD1 . LEU D 1 154 ? -27.104 35.726  39.162  1.00 57.96  ? 152  LEU D CD1 1 
ATOM   7239  C CD2 . LEU D 1 154 ? -28.768 34.267  40.337  1.00 58.70  ? 152  LEU D CD2 1 
ATOM   7240  N N   . LEU D 1 155 ? -26.182 32.768  36.379  1.00 45.71  ? 153  LEU D N   1 
ATOM   7241  C CA  . LEU D 1 155 ? -25.778 33.203  35.058  1.00 45.87  ? 153  LEU D CA  1 
ATOM   7242  C C   . LEU D 1 155 ? -26.287 32.304  33.944  1.00 46.12  ? 153  LEU D C   1 
ATOM   7243  O O   . LEU D 1 155 ? -26.365 32.713  32.786  1.00 48.08  ? 153  LEU D O   1 
ATOM   7244  C CB  . LEU D 1 155 ? -24.261 33.356  34.992  1.00 39.74  ? 153  LEU D CB  1 
ATOM   7245  C CG  . LEU D 1 155 ? -23.713 34.502  35.855  1.00 39.13  ? 153  LEU D CG  1 
ATOM   7246  C CD1 . LEU D 1 155 ? -22.377 34.941  35.278  1.00 39.92  ? 153  LEU D CD1 1 
ATOM   7247  C CD2 . LEU D 1 155 ? -24.676 35.695  35.872  1.00 36.59  ? 153  LEU D CD2 1 
ATOM   7248  N N   . SER D 1 156 ? -26.646 31.079  34.285  1.00 44.67  ? 154  SER D N   1 
ATOM   7249  C CA  . SER D 1 156 ? -27.176 30.200  33.273  1.00 44.46  ? 154  SER D CA  1 
ATOM   7250  C C   . SER D 1 156 ? -28.577 30.685  32.948  1.00 44.15  ? 154  SER D C   1 
ATOM   7251  O O   . SER D 1 156 ? -29.156 30.269  31.953  1.00 47.98  ? 154  SER D O   1 
ATOM   7252  C CB  . SER D 1 156 ? -27.218 28.762  33.773  1.00 54.87  ? 154  SER D CB  1 
ATOM   7253  O OG  . SER D 1 156 ? -25.912 28.219  33.825  1.00 62.26  ? 154  SER D OG  1 
ATOM   7254  N N   . SER D 1 157 ? -29.118 31.577  33.774  1.00 45.67  ? 155  SER D N   1 
ATOM   7255  C CA  . SER D 1 157 ? -30.470 32.086  33.542  1.00 45.89  ? 155  SER D CA  1 
ATOM   7256  C C   . SER D 1 157 ? -30.505 33.215  32.527  1.00 47.08  ? 155  SER D C   1 
ATOM   7257  O O   . SER D 1 157 ? -31.576 33.717  32.177  1.00 48.08  ? 155  SER D O   1 
ATOM   7258  C CB  . SER D 1 157 ? -31.100 32.570  34.846  1.00 39.16  ? 155  SER D CB  1 
ATOM   7259  O OG  . SER D 1 157 ? -30.428 33.712  35.335  1.00 37.73  ? 155  SER D OG  1 
ATOM   7260  N N   . VAL D 1 158 ? -29.330 33.623  32.068  1.00 46.57  ? 156  VAL D N   1 
ATOM   7261  C CA  . VAL D 1 158 ? -29.227 34.681  31.077  1.00 48.34  ? 156  VAL D CA  1 
ATOM   7262  C C   . VAL D 1 158 ? -28.122 34.300  30.106  1.00 48.98  ? 156  VAL D C   1 
ATOM   7263  O O   . VAL D 1 158 ? -27.073 34.937  30.021  1.00 50.77  ? 156  VAL D O   1 
ATOM   7264  C CB  . VAL D 1 158 ? -28.941 36.049  31.739  1.00 51.84  ? 156  VAL D CB  1 
ATOM   7265  C CG1 . VAL D 1 158 ? -28.371 37.021  30.733  1.00 52.94  ? 156  VAL D CG1 1 
ATOM   7266  C CG2 . VAL D 1 158 ? -30.230 36.619  32.293  1.00 50.74  ? 156  VAL D CG2 1 
ATOM   7267  N N   . GLY D 1 159 ? -28.374 33.226  29.376  1.00 52.68  ? 157  GLY D N   1 
ATOM   7268  C CA  . GLY D 1 159 ? -27.405 32.752  28.416  1.00 53.31  ? 157  GLY D CA  1 
ATOM   7269  C C   . GLY D 1 159 ? -26.570 31.607  28.954  1.00 54.62  ? 157  GLY D C   1 
ATOM   7270  O O   . GLY D 1 159 ? -26.687 31.205  30.114  1.00 55.05  ? 157  GLY D O   1 
ATOM   7271  N N   . PHE D 1 160 ? -25.733 31.073  28.078  1.00 57.02  ? 158  PHE D N   1 
ATOM   7272  C CA  . PHE D 1 160 ? -24.831 29.980  28.396  1.00 58.10  ? 158  PHE D CA  1 
ATOM   7273  C C   . PHE D 1 160 ? -24.090 30.293  29.697  1.00 59.29  ? 158  PHE D C   1 
ATOM   7274  O O   . PHE D 1 160 ? -24.075 31.441  30.139  1.00 59.93  ? 158  PHE D O   1 
ATOM   7275  C CB  . PHE D 1 160 ? -23.854 29.826  27.227  1.00 54.16  ? 158  PHE D CB  1 
ATOM   7276  C CG  . PHE D 1 160 ? -22.826 28.756  27.422  1.00 50.23  ? 158  PHE D CG  1 
ATOM   7277  C CD1 . PHE D 1 160 ? -23.202 27.474  27.788  1.00 48.84  ? 158  PHE D CD1 1 
ATOM   7278  C CD2 . PHE D 1 160 ? -21.477 29.034  27.224  1.00 48.18  ? 158  PHE D CD2 1 
ATOM   7279  C CE1 . PHE D 1 160 ? -22.246 26.487  27.954  1.00 49.72  ? 158  PHE D CE1 1 
ATOM   7280  C CE2 . PHE D 1 160 ? -20.519 28.064  27.388  1.00 45.75  ? 158  PHE D CE2 1 
ATOM   7281  C CZ  . PHE D 1 160 ? -20.898 26.786  27.753  1.00 48.52  ? 158  PHE D CZ  1 
ATOM   7282  N N   . CYS D 1 161 ? -23.473 29.276  30.300  1.00 52.07  ? 159  CYS D N   1 
ATOM   7283  C CA  . CYS D 1 161 ? -22.740 29.444  31.555  1.00 51.73  ? 159  CYS D CA  1 
ATOM   7284  C C   . CYS D 1 161 ? -22.012 28.143  31.940  1.00 50.34  ? 159  CYS D C   1 
ATOM   7285  O O   . CYS D 1 161 ? -22.660 27.120  32.186  1.00 50.13  ? 159  CYS D O   1 
ATOM   7286  C CB  . CYS D 1 161 ? -23.732 29.843  32.659  1.00 59.06  ? 159  CYS D CB  1 
ATOM   7287  S SG  . CYS D 1 161 ? -23.009 30.475  34.185  1.00 64.31  ? 159  CYS D SG  1 
ATOM   7288  N N   . THR D 1 162 ? -20.678 28.178  31.971  1.00 49.70  ? 160  THR D N   1 
ATOM   7289  C CA  . THR D 1 162 ? -19.868 27.005  32.344  1.00 50.36  ? 160  THR D CA  1 
ATOM   7290  C C   . THR D 1 162 ? -18.608 27.365  33.140  1.00 50.95  ? 160  THR D C   1 
ATOM   7291  O O   . THR D 1 162 ? -18.057 28.459  32.996  1.00 49.74  ? 160  THR D O   1 
ATOM   7292  C CB  . THR D 1 162 ? -19.382 26.200  31.121  1.00 59.08  ? 160  THR D CB  1 
ATOM   7293  O OG1 . THR D 1 162 ? -18.687 25.025  31.569  1.00 62.03  ? 160  THR D OG1 1 
ATOM   7294  C CG2 . THR D 1 162 ? -18.412 27.028  30.295  1.00 57.77  ? 160  THR D CG2 1 
ATOM   7295  N N   . GLU D 1 163 ? -18.138 26.425  33.961  1.00 68.41  ? 161  GLU D N   1 
ATOM   7296  C CA  . GLU D 1 163 ? -16.940 26.654  34.762  1.00 68.98  ? 161  GLU D CA  1 
ATOM   7297  C C   . GLU D 1 163 ? -15.679 26.471  33.938  1.00 67.79  ? 161  GLU D C   1 
ATOM   7298  O O   . GLU D 1 163 ? -15.679 25.772  32.925  1.00 67.87  ? 161  GLU D O   1 
ATOM   7299  C CB  . GLU D 1 163 ? -16.882 25.708  35.964  1.00 73.03  ? 161  GLU D CB  1 
ATOM   7300  C CG  . GLU D 1 163 ? -15.617 25.913  36.802  1.00 75.21  ? 161  GLU D CG  1 
ATOM   7301  C CD  . GLU D 1 163 ? -15.652 25.187  38.128  1.00 75.27  ? 161  GLU D CD  1 
ATOM   7302  O OE1 . GLU D 1 163 ? -14.663 25.293  38.889  1.00 72.06  ? 161  GLU D OE1 1 
ATOM   7303  O OE2 . GLU D 1 163 ? -16.667 24.512  38.408  1.00 77.15  ? 161  GLU D OE2 1 
ATOM   7304  N N   . VAL D 1 164 ? -14.598 27.086  34.399  1.00 49.01  ? 162  VAL D N   1 
ATOM   7305  C CA  . VAL D 1 164 ? -13.331 27.011  33.700  1.00 48.75  ? 162  VAL D CA  1 
ATOM   7306  C C   . VAL D 1 164 ? -12.112 27.202  34.597  1.00 51.28  ? 162  VAL D C   1 
ATOM   7307  O O   . VAL D 1 164 ? -12.163 27.936  35.590  1.00 52.40  ? 162  VAL D O   1 
ATOM   7308  C CB  . VAL D 1 164 ? -13.298 28.064  32.581  1.00 42.23  ? 162  VAL D CB  1 
ATOM   7309  C CG1 . VAL D 1 164 ? -11.868 28.447  32.240  1.00 41.21  ? 162  VAL D CG1 1 
ATOM   7310  C CG2 . VAL D 1 164 ? -13.992 27.514  31.359  1.00 43.38  ? 162  VAL D CG2 1 
ATOM   7311  N N   . GLU D 1 165 ? -11.018 26.530  34.239  1.00 59.91  ? 163  GLU D N   1 
ATOM   7312  C CA  . GLU D 1 165 ? -9.770  26.644  34.976  1.00 63.93  ? 163  GLU D CA  1 
ATOM   7313  C C   . GLU D 1 165 ? -9.291  28.069  34.703  1.00 63.95  ? 163  GLU D C   1 
ATOM   7314  O O   . GLU D 1 165 ? -8.821  28.360  33.610  1.00 66.20  ? 163  GLU D O   1 
ATOM   7315  C CB  . GLU D 1 165 ? -8.746  25.640  34.441  1.00 88.57  ? 163  GLU D CB  1 
ATOM   7316  C CG  . GLU D 1 165 ? -7.555  25.428  35.355  1.00 99.34  ? 163  GLU D CG  1 
ATOM   7317  C CD  . GLU D 1 165 ? -7.953  24.780  36.670  1.00 106.20 ? 163  GLU D CD  1 
ATOM   7318  O OE1 . GLU D 1 165 ? -8.484  23.647  36.640  1.00 109.00 ? 163  GLU D OE1 1 
ATOM   7319  O OE2 . GLU D 1 165 ? -7.738  25.400  37.734  1.00 108.71 ? 163  GLU D OE2 1 
ATOM   7320  N N   . GLU D 1 166 ? -9.421  28.950  35.693  1.00 57.08  ? 164  GLU D N   1 
ATOM   7321  C CA  . GLU D 1 166 ? -9.036  30.357  35.565  1.00 57.04  ? 164  GLU D CA  1 
ATOM   7322  C C   . GLU D 1 166 ? -7.994  30.751  34.511  1.00 55.80  ? 164  GLU D C   1 
ATOM   7323  O O   . GLU D 1 166 ? -8.146  31.786  33.856  1.00 57.37  ? 164  GLU D O   1 
ATOM   7324  C CB  . GLU D 1 166 ? -8.604  30.907  36.926  1.00 78.54  ? 164  GLU D CB  1 
ATOM   7325  C CG  . GLU D 1 166 ? -8.063  32.325  36.865  1.00 85.66  ? 164  GLU D CG  1 
ATOM   7326  C CD  . GLU D 1 166 ? -8.209  33.062  38.176  1.00 88.79  ? 164  GLU D CD  1 
ATOM   7327  O OE1 . GLU D 1 166 ? -9.361  33.301  38.584  1.00 90.80  ? 164  GLU D OE1 1 
ATOM   7328  O OE2 . GLU D 1 166 ? -7.181  33.402  38.800  1.00 91.57  ? 164  GLU D OE2 1 
ATOM   7329  N N   . ASP D 1 167 ? -6.941  29.958  34.334  1.00 68.61  ? 165  ASP D N   1 
ATOM   7330  C CA  . ASP D 1 167 ? -5.923  30.303  33.338  1.00 68.24  ? 165  ASP D CA  1 
ATOM   7331  C C   . ASP D 1 167 ? -6.453  30.454  31.895  1.00 66.23  ? 165  ASP D C   1 
ATOM   7332  O O   . ASP D 1 167 ? -5.709  30.807  30.979  1.00 67.97  ? 165  ASP D O   1 
ATOM   7333  C CB  . ASP D 1 167 ? -4.773  29.285  33.381  1.00 81.84  ? 165  ASP D CB  1 
ATOM   7334  C CG  . ASP D 1 167 ? -5.252  27.841  33.367  1.00 83.89  ? 165  ASP D CG  1 
ATOM   7335  O OD1 . ASP D 1 167 ? -4.391  26.937  33.325  1.00 85.07  ? 165  ASP D OD1 1 
ATOM   7336  O OD2 . ASP D 1 167 ? -6.475  27.603  33.403  1.00 83.81  ? 165  ASP D OD2 1 
ATOM   7337  N N   . LEU D 1 168 ? -7.741  30.198  31.701  1.00 54.19  ? 166  LEU D N   1 
ATOM   7338  C CA  . LEU D 1 168 ? -8.360  30.320  30.388  1.00 50.00  ? 166  LEU D CA  1 
ATOM   7339  C C   . LEU D 1 168 ? -9.083  31.652  30.294  1.00 50.21  ? 166  LEU D C   1 
ATOM   7340  O O   . LEU D 1 168 ? -9.118  32.289  29.242  1.00 50.22  ? 166  LEU D O   1 
ATOM   7341  C CB  . LEU D 1 168 ? -9.391  29.216  30.174  1.00 42.93  ? 166  LEU D CB  1 
ATOM   7342  C CG  . LEU D 1 168 ? -8.952  27.755  30.180  1.00 40.17  ? 166  LEU D CG  1 
ATOM   7343  C CD1 . LEU D 1 168 ? -10.165 26.855  29.926  1.00 36.40  ? 166  LEU D CD1 1 
ATOM   7344  C CD2 . LEU D 1 168 ? -7.893  27.545  29.114  1.00 40.09  ? 166  LEU D CD2 1 
ATOM   7345  N N   . ILE D 1 169 ? -9.679  32.045  31.411  1.00 48.08  ? 167  ILE D N   1 
ATOM   7346  C CA  . ILE D 1 169 ? -10.439 33.282  31.510  1.00 48.76  ? 167  ILE D CA  1 
ATOM   7347  C C   . ILE D 1 169 ? -9.920  34.433  30.644  1.00 48.38  ? 167  ILE D C   1 
ATOM   7348  O O   . ILE D 1 169 ? -10.686 35.309  30.247  1.00 48.15  ? 167  ILE D O   1 
ATOM   7349  C CB  . ILE D 1 169 ? -10.519 33.755  32.982  1.00 41.24  ? 167  ILE D CB  1 
ATOM   7350  C CG1 . ILE D 1 169 ? -11.072 32.630  33.864  1.00 36.73  ? 167  ILE D CG1 1 
ATOM   7351  C CG2 . ILE D 1 169 ? -11.406 34.991  33.087  1.00 43.49  ? 167  ILE D CG2 1 
ATOM   7352  C CD1 . ILE D 1 169 ? -12.467 32.191  33.513  1.00 32.06  ? 167  ILE D CD1 1 
ATOM   7353  N N   . ASP D 1 170 ? -8.627  34.449  30.352  1.00 47.40  ? 168  ASP D N   1 
ATOM   7354  C CA  . ASP D 1 170 ? -8.100  35.521  29.521  1.00 49.57  ? 168  ASP D CA  1 
ATOM   7355  C C   . ASP D 1 170 ? -8.422  35.306  28.045  1.00 47.67  ? 168  ASP D C   1 
ATOM   7356  O O   . ASP D 1 170 ? -8.915  36.214  27.371  1.00 45.26  ? 168  ASP D O   1 
ATOM   7357  C CB  . ASP D 1 170 ? -6.598  35.661  29.733  1.00 66.60  ? 168  ASP D CB  1 
ATOM   7358  C CG  . ASP D 1 170 ? -6.273  36.321  31.048  1.00 71.58  ? 168  ASP D CG  1 
ATOM   7359  O OD1 . ASP D 1 170 ? -6.562  35.722  32.109  1.00 75.58  ? 168  ASP D OD1 1 
ATOM   7360  O OD2 . ASP D 1 170 ? -5.742  37.449  31.017  1.00 73.38  ? 168  ASP D OD2 1 
ATOM   7361  N N   . ALA D 1 171 ? -8.145  34.106  27.545  1.00 47.81  ? 169  ALA D N   1 
ATOM   7362  C CA  . ALA D 1 171 ? -8.449  33.794  26.155  1.00 43.65  ? 169  ALA D CA  1 
ATOM   7363  C C   . ALA D 1 171 ? -9.947  34.004  25.977  1.00 41.03  ? 169  ALA D C   1 
ATOM   7364  O O   . ALA D 1 171 ? -10.375 34.745  25.095  1.00 41.50  ? 169  ALA D O   1 
ATOM   7365  C CB  . ALA D 1 171 ? -8.082  32.361  25.849  1.00 38.28  ? 169  ALA D CB  1 
ATOM   7366  N N   . VAL D 1 172 ? -10.739 33.360  26.832  1.00 29.32  ? 170  VAL D N   1 
ATOM   7367  C CA  . VAL D 1 172 ? -12.184 33.501  26.765  1.00 27.49  ? 170  VAL D CA  1 
ATOM   7368  C C   . VAL D 1 172 ? -12.550 34.974  26.710  1.00 29.14  ? 170  VAL D C   1 
ATOM   7369  O O   . VAL D 1 172 ? -13.630 35.339  26.257  1.00 28.84  ? 170  VAL D O   1 
ATOM   7370  C CB  . VAL D 1 172 ? -12.882 32.877  27.993  1.00 20.98  ? 170  VAL D CB  1 
ATOM   7371  C CG1 . VAL D 1 172 ? -14.367 33.225  27.980  1.00 16.64  ? 170  VAL D CG1 1 
ATOM   7372  C CG2 . VAL D 1 172 ? -12.706 31.366  27.979  1.00 21.30  ? 170  VAL D CG2 1 
ATOM   7373  N N   . THR D 1 173 ? -11.661 35.832  27.186  1.00 50.94  ? 171  THR D N   1 
ATOM   7374  C CA  . THR D 1 173 ? -11.980 37.246  27.153  1.00 55.37  ? 171  THR D CA  1 
ATOM   7375  C C   . THR D 1 173 ? -11.946 37.665  25.698  1.00 55.88  ? 171  THR D C   1 
ATOM   7376  O O   . THR D 1 173 ? -12.909 38.226  25.184  1.00 57.23  ? 171  THR D O   1 
ATOM   7377  C CB  . THR D 1 173 ? -10.979 38.085  27.973  1.00 50.37  ? 171  THR D CB  1 
ATOM   7378  O OG1 . THR D 1 173 ? -10.876 37.551  29.298  1.00 53.46  ? 171  THR D OG1 1 
ATOM   7379  C CG2 . THR D 1 173 ? -11.458 39.527  28.077  1.00 48.93  ? 171  THR D CG2 1 
ATOM   7380  N N   . GLY D 1 174 ? -10.840 37.363  25.032  1.00 61.30  ? 172  GLY D N   1 
ATOM   7381  C CA  . GLY D 1 174 ? -10.705 37.719  23.635  1.00 60.49  ? 172  GLY D CA  1 
ATOM   7382  C C   . GLY D 1 174 ? -11.859 37.179  22.817  1.00 61.37  ? 172  GLY D C   1 
ATOM   7383  O O   . GLY D 1 174 ? -12.508 37.924  22.079  1.00 63.79  ? 172  GLY D O   1 
ATOM   7384  N N   . LEU D 1 175 ? -12.142 35.888  22.965  1.00 35.64  ? 173  LEU D N   1 
ATOM   7385  C CA  . LEU D 1 175 ? -13.215 35.267  22.200  1.00 32.70  ? 173  LEU D CA  1 
ATOM   7386  C C   . LEU D 1 175 ? -14.623 35.674  22.628  1.00 31.68  ? 173  LEU D C   1 
ATOM   7387  O O   . LEU D 1 175 ? -15.276 36.471  21.967  1.00 30.67  ? 173  LEU D O   1 
ATOM   7388  C CB  . LEU D 1 175 ? -13.068 33.746  22.254  1.00 40.96  ? 173  LEU D CB  1 
ATOM   7389  C CG  . LEU D 1 175 ? -13.874 32.963  21.215  1.00 40.77  ? 173  LEU D CG  1 
ATOM   7390  C CD1 . LEU D 1 175 ? -13.104 31.733  20.751  1.00 40.85  ? 173  LEU D CD1 1 
ATOM   7391  C CD2 . LEU D 1 175 ? -15.206 32.569  21.806  1.00 43.17  ? 173  LEU D CD2 1 
ATOM   7392  N N   . SER D 1 176 ? -15.088 35.133  23.743  1.00 40.37  ? 174  SER D N   1 
ATOM   7393  C CA  . SER D 1 176 ? -16.430 35.422  24.224  1.00 39.51  ? 174  SER D CA  1 
ATOM   7394  C C   . SER D 1 176 ? -16.612 36.838  24.771  1.00 40.88  ? 174  SER D C   1 
ATOM   7395  O O   . SER D 1 176 ? -17.730 37.343  24.843  1.00 40.42  ? 174  SER D O   1 
ATOM   7396  C CB  . SER D 1 176 ? -16.805 34.391  25.292  1.00 49.04  ? 174  SER D CB  1 
ATOM   7397  O OG  . SER D 1 176 ? -18.120 34.592  25.774  1.00 54.00  ? 174  SER D OG  1 
ATOM   7398  N N   . GLY D 1 177 ? -15.518 37.487  25.148  1.00 44.79  ? 175  GLY D N   1 
ATOM   7399  C CA  . GLY D 1 177 ? -15.633 38.824  25.704  1.00 47.71  ? 175  GLY D CA  1 
ATOM   7400  C C   . GLY D 1 177 ? -15.844 39.941  24.700  1.00 49.47  ? 175  GLY D C   1 
ATOM   7401  O O   . GLY D 1 177 ? -16.829 40.684  24.779  1.00 50.65  ? 175  GLY D O   1 
ATOM   7402  N N   . SER D 1 178 ? -14.906 40.064  23.764  1.00 53.39  ? 176  SER D N   1 
ATOM   7403  C CA  . SER D 1 178 ? -14.955 41.089  22.725  1.00 53.30  ? 176  SER D CA  1 
ATOM   7404  C C   . SER D 1 178 ? -15.914 40.716  21.600  1.00 52.89  ? 176  SER D C   1 
ATOM   7405  O O   . SER D 1 178 ? -16.640 41.569  21.106  1.00 56.38  ? 176  SER D O   1 
ATOM   7406  C CB  . SER D 1 178 ? -13.558 41.309  22.146  1.00 45.24  ? 176  SER D CB  1 
ATOM   7407  O OG  . SER D 1 178 ? -12.635 41.646  23.165  1.00 44.56  ? 176  SER D OG  1 
ATOM   7408  N N   . GLY D 1 179 ? -15.899 39.442  21.210  1.00 40.83  ? 177  GLY D N   1 
ATOM   7409  C CA  . GLY D 1 179 ? -16.756 38.924  20.150  1.00 39.62  ? 177  GLY D CA  1 
ATOM   7410  C C   . GLY D 1 179 ? -17.933 39.774  19.701  1.00 40.51  ? 177  GLY D C   1 
ATOM   7411  O O   . GLY D 1 179 ? -17.990 40.203  18.545  1.00 41.21  ? 177  GLY D O   1 
ATOM   7412  N N   . PRO D 1 180 ? -18.900 40.032  20.590  1.00 46.38  ? 178  PRO D N   1 
ATOM   7413  C CA  . PRO D 1 180 ? -20.077 40.844  20.260  1.00 46.79  ? 178  PRO D CA  1 
ATOM   7414  C C   . PRO D 1 180 ? -19.709 42.102  19.465  1.00 46.21  ? 178  PRO D C   1 
ATOM   7415  O O   . PRO D 1 180 ? -20.484 42.571  18.638  1.00 47.94  ? 178  PRO D O   1 
ATOM   7416  C CB  . PRO D 1 180 ? -20.646 41.205  21.630  1.00 47.43  ? 178  PRO D CB  1 
ATOM   7417  C CG  . PRO D 1 180 ? -20.253 40.066  22.482  1.00 49.79  ? 178  PRO D CG  1 
ATOM   7418  C CD  . PRO D 1 180 ? -18.864 39.701  22.023  1.00 48.08  ? 178  PRO D CD  1 
ATOM   7419  N N   . ALA D 1 181 ? -18.530 42.653  19.742  1.00 45.73  ? 179  ALA D N   1 
ATOM   7420  C CA  . ALA D 1 181 ? -18.050 43.859  19.073  1.00 42.50  ? 179  ALA D CA  1 
ATOM   7421  C C   . ALA D 1 181 ? -17.699 43.518  17.639  1.00 41.77  ? 179  ALA D C   1 
ATOM   7422  O O   . ALA D 1 181 ? -17.927 44.301  16.715  1.00 44.00  ? 179  ALA D O   1 
ATOM   7423  C CB  . ALA D 1 181 ? -16.832 44.396  19.798  1.00 31.72  ? 179  ALA D CB  1 
ATOM   7424  N N   . TYR D 1 182 ? -17.138 42.331  17.474  1.00 34.70  ? 180  TYR D N   1 
ATOM   7425  C CA  . TYR D 1 182 ? -16.759 41.830  16.167  1.00 34.00  ? 180  TYR D CA  1 
ATOM   7426  C C   . TYR D 1 182 ? -18.028 41.643  15.352  1.00 31.38  ? 180  TYR D C   1 
ATOM   7427  O O   . TYR D 1 182 ? -18.104 42.036  14.186  1.00 28.71  ? 180  TYR D O   1 
ATOM   7428  C CB  . TYR D 1 182 ? -16.051 40.493  16.321  1.00 46.68  ? 180  TYR D CB  1 
ATOM   7429  C CG  . TYR D 1 182 ? -14.878 40.529  17.267  1.00 50.97  ? 180  TYR D CG  1 
ATOM   7430  C CD1 . TYR D 1 182 ? -14.398 39.357  17.848  1.00 51.42  ? 180  TYR D CD1 1 
ATOM   7431  C CD2 . TYR D 1 182 ? -14.227 41.727  17.562  1.00 53.33  ? 180  TYR D CD2 1 
ATOM   7432  C CE1 . TYR D 1 182 ? -13.305 39.371  18.692  1.00 52.21  ? 180  TYR D CE1 1 
ATOM   7433  C CE2 . TYR D 1 182 ? -13.131 41.750  18.403  1.00 55.00  ? 180  TYR D CE2 1 
ATOM   7434  C CZ  . TYR D 1 182 ? -12.676 40.567  18.963  1.00 53.73  ? 180  TYR D CZ  1 
ATOM   7435  O OH  . TYR D 1 182 ? -11.583 40.582  19.786  1.00 55.40  ? 180  TYR D OH  1 
ATOM   7436  N N   . ALA D 1 183 ? -19.020 41.027  15.981  1.00 32.59  ? 181  ALA D N   1 
ATOM   7437  C CA  . ALA D 1 183 ? -20.284 40.795  15.321  1.00 32.69  ? 181  ALA D CA  1 
ATOM   7438  C C   . ALA D 1 183 ? -20.812 42.139  14.864  1.00 35.49  ? 181  ALA D C   1 
ATOM   7439  O O   . ALA D 1 183 ? -21.008 42.364  13.674  1.00 41.79  ? 181  ALA D O   1 
ATOM   7440  C CB  . ALA D 1 183 ? -21.270 40.140  16.283  1.00 6.68   ? 181  ALA D CB  1 
ATOM   7441  N N   . PHE D 1 184 ? -21.027 43.035  15.818  1.00 41.07  ? 182  PHE D N   1 
ATOM   7442  C CA  . PHE D 1 184 ? -21.543 44.360  15.523  1.00 40.14  ? 182  PHE D CA  1 
ATOM   7443  C C   . PHE D 1 184 ? -20.794 44.981  14.376  1.00 40.33  ? 182  PHE D C   1 
ATOM   7444  O O   . PHE D 1 184 ? -21.392 45.615  13.510  1.00 42.70  ? 182  PHE D O   1 
ATOM   7445  C CB  . PHE D 1 184 ? -21.435 45.238  16.758  1.00 33.35  ? 182  PHE D CB  1 
ATOM   7446  C CG  . PHE D 1 184 ? -22.321 44.793  17.868  1.00 34.64  ? 182  PHE D CG  1 
ATOM   7447  C CD1 . PHE D 1 184 ? -22.083 45.190  19.173  1.00 38.18  ? 182  PHE D CD1 1 
ATOM   7448  C CD2 . PHE D 1 184 ? -23.407 43.967  17.603  1.00 35.59  ? 182  PHE D CD2 1 
ATOM   7449  C CE1 . PHE D 1 184 ? -22.913 44.771  20.198  1.00 38.97  ? 182  PHE D CE1 1 
ATOM   7450  C CE2 . PHE D 1 184 ? -24.242 43.542  18.612  1.00 33.64  ? 182  PHE D CE2 1 
ATOM   7451  C CZ  . PHE D 1 184 ? -23.998 43.942  19.914  1.00 39.35  ? 182  PHE D CZ  1 
ATOM   7452  N N   . THR D 1 185 ? -19.482 44.791  14.370  1.00 28.48  ? 183  THR D N   1 
ATOM   7453  C CA  . THR D 1 185 ? -18.657 45.336  13.311  1.00 29.50  ? 183  THR D CA  1 
ATOM   7454  C C   . THR D 1 185 ? -18.927 44.595  12.019  1.00 30.55  ? 183  THR D C   1 
ATOM   7455  O O   . THR D 1 185 ? -18.857 45.172  10.938  1.00 32.67  ? 183  THR D O   1 
ATOM   7456  C CB  . THR D 1 185 ? -17.178 45.196  13.645  1.00 34.91  ? 183  THR D CB  1 
ATOM   7457  O OG1 . THR D 1 185 ? -16.798 46.243  14.544  1.00 35.19  ? 183  THR D OG1 1 
ATOM   7458  C CG2 . THR D 1 185 ? -16.334 45.252  12.377  1.00 36.03  ? 183  THR D CG2 1 
ATOM   7459  N N   . ALA D 1 186 ? -19.224 43.306  12.134  1.00 50.25  ? 184  ALA D N   1 
ATOM   7460  C CA  . ALA D 1 186 ? -19.499 42.489  10.963  1.00 48.27  ? 184  ALA D CA  1 
ATOM   7461  C C   . ALA D 1 186 ? -20.898 42.759  10.447  1.00 49.15  ? 184  ALA D C   1 
ATOM   7462  O O   . ALA D 1 186 ? -21.106 42.814  9.241   1.00 51.04  ? 184  ALA D O   1 
ATOM   7463  C CB  . ALA D 1 186 ? -19.342 41.029  11.300  1.00 13.83  ? 184  ALA D CB  1 
ATOM   7464  N N   . LEU D 1 187 ? -21.850 42.929  11.363  1.00 42.06  ? 185  LEU D N   1 
ATOM   7465  C CA  . LEU D 1 187 ? -23.245 43.210  11.004  1.00 43.35  ? 185  LEU D CA  1 
ATOM   7466  C C   . LEU D 1 187 ? -23.385 44.557  10.317  1.00 43.13  ? 185  LEU D C   1 
ATOM   7467  O O   . LEU D 1 187 ? -24.259 44.749  9.477   1.00 43.06  ? 185  LEU D O   1 
ATOM   7468  C CB  . LEU D 1 187 ? -24.127 43.205  12.245  1.00 46.57  ? 185  LEU D CB  1 
ATOM   7469  C CG  . LEU D 1 187 ? -24.258 41.842  12.909  1.00 48.41  ? 185  LEU D CG  1 
ATOM   7470  C CD1 . LEU D 1 187 ? -25.061 41.960  14.192  1.00 51.64  ? 185  LEU D CD1 1 
ATOM   7471  C CD2 . LEU D 1 187 ? -24.930 40.892  11.940  1.00 47.61  ? 185  LEU D CD2 1 
ATOM   7472  N N   . ASP D 1 188 ? -22.522 45.490  10.694  1.00 34.88  ? 186  ASP D N   1 
ATOM   7473  C CA  . ASP D 1 188 ? -22.544 46.808  10.109  1.00 36.35  ? 186  ASP D CA  1 
ATOM   7474  C C   . ASP D 1 188 ? -22.018 46.721  8.692   1.00 36.57  ? 186  ASP D C   1 
ATOM   7475  O O   . ASP D 1 188 ? -22.643 47.220  7.750   1.00 39.20  ? 186  ASP D O   1 
ATOM   7476  C CB  . ASP D 1 188 ? -21.669 47.764  10.909  1.00 57.62  ? 186  ASP D CB  1 
ATOM   7477  C CG  . ASP D 1 188 ? -21.819 49.201  10.451  1.00 64.25  ? 186  ASP D CG  1 
ATOM   7478  O OD1 . ASP D 1 188 ? -22.966 49.699  10.476  1.00 68.79  ? 186  ASP D OD1 1 
ATOM   7479  O OD2 . ASP D 1 188 ? -20.805 49.830  10.066  1.00 67.67  ? 186  ASP D OD2 1 
ATOM   7480  N N   . ALA D 1 189 ? -20.863 46.085  8.538   1.00 46.80  ? 187  ALA D N   1 
ATOM   7481  C CA  . ALA D 1 189 ? -20.253 45.945  7.221   1.00 46.56  ? 187  ALA D CA  1 
ATOM   7482  C C   . ALA D 1 189 ? -21.230 45.329  6.223   1.00 45.03  ? 187  ALA D C   1 
ATOM   7483  O O   . ALA D 1 189 ? -21.349 45.797  5.101   1.00 48.16  ? 187  ALA D O   1 
ATOM   7484  C CB  . ALA D 1 189 ? -18.986 45.100  7.314   1.00 72.66  ? 187  ALA D CB  1 
ATOM   7485  N N   . LEU D 1 190 ? -21.937 44.285  6.634   1.00 34.79  ? 188  LEU D N   1 
ATOM   7486  C CA  . LEU D 1 190 ? -22.890 43.647  5.744   1.00 32.56  ? 188  LEU D CA  1 
ATOM   7487  C C   . LEU D 1 190 ? -23.988 44.628  5.362   1.00 32.99  ? 188  LEU D C   1 
ATOM   7488  O O   . LEU D 1 190 ? -24.293 44.792  4.176   1.00 32.84  ? 188  LEU D O   1 
ATOM   7489  C CB  . LEU D 1 190 ? -23.481 42.413  6.414   1.00 30.13  ? 188  LEU D CB  1 
ATOM   7490  C CG  . LEU D 1 190 ? -22.409 41.361  6.716   1.00 32.48  ? 188  LEU D CG  1 
ATOM   7491  C CD1 . LEU D 1 190 ? -23.019 40.171  7.427   1.00 31.35  ? 188  LEU D CD1 1 
ATOM   7492  C CD2 . LEU D 1 190 ? -21.742 40.925  5.417   1.00 32.14  ? 188  LEU D CD2 1 
ATOM   7493  N N   . ALA D 1 191 ? -24.577 45.280  6.364   1.00 37.24  ? 189  ALA D N   1 
ATOM   7494  C CA  . ALA D 1 191 ? -25.631 46.260  6.119   1.00 34.76  ? 189  ALA D CA  1 
ATOM   7495  C C   . ALA D 1 191 ? -25.160 47.163  4.988   1.00 34.22  ? 189  ALA D C   1 
ATOM   7496  O O   . ALA D 1 191 ? -25.918 47.489  4.075   1.00 34.78  ? 189  ALA D O   1 
ATOM   7497  C CB  . ALA D 1 191 ? -25.896 47.081  7.367   1.00 14.05  ? 189  ALA D CB  1 
ATOM   7498  N N   . ASP D 1 192 ? -23.899 47.569  5.050   1.00 28.86  ? 190  ASP D N   1 
ATOM   7499  C CA  . ASP D 1 192 ? -23.357 48.412  3.999   1.00 31.07  ? 190  ASP D CA  1 
ATOM   7500  C C   . ASP D 1 192 ? -23.424 47.605  2.708   1.00 29.62  ? 190  ASP D C   1 
ATOM   7501  O O   . ASP D 1 192 ? -23.883 48.109  1.676   1.00 32.49  ? 190  ASP D O   1 
ATOM   7502  C CB  . ASP D 1 192 ? -21.916 48.809  4.330   1.00 52.40  ? 190  ASP D CB  1 
ATOM   7503  C CG  . ASP D 1 192 ? -21.837 49.795  5.491   1.00 57.28  ? 190  ASP D CG  1 
ATOM   7504  O OD1 . ASP D 1 192 ? -22.814 49.877  6.271   1.00 56.77  ? 190  ASP D OD1 1 
ATOM   7505  O OD2 . ASP D 1 192 ? -20.795 50.478  5.628   1.00 60.44  ? 190  ASP D OD2 1 
ATOM   7506  N N   . GLY D 1 193 ? -22.972 46.352  2.778   1.00 25.81  ? 191  GLY D N   1 
ATOM   7507  C CA  . GLY D 1 193 ? -23.010 45.469  1.626   1.00 24.54  ? 191  GLY D CA  1 
ATOM   7508  C C   . GLY D 1 193 ? -24.424 45.457  1.086   1.00 23.76  ? 191  GLY D C   1 
ATOM   7509  O O   . GLY D 1 193 ? -24.697 45.918  -0.024  1.00 19.88  ? 191  GLY D O   1 
ATOM   7510  N N   . GLY D 1 194 ? -25.339 44.941  1.889   1.00 24.21  ? 192  GLY D N   1 
ATOM   7511  C CA  . GLY D 1 194 ? -26.718 44.910  1.459   1.00 27.90  ? 192  GLY D CA  1 
ATOM   7512  C C   . GLY D 1 194 ? -27.066 46.165  0.679   1.00 28.44  ? 192  GLY D C   1 
ATOM   7513  O O   . GLY D 1 194 ? -27.352 46.105  -0.511  1.00 30.83  ? 192  GLY D O   1 
ATOM   7514  N N   . VAL D 1 195 ? -27.027 47.307  1.351   1.00 37.23  ? 193  VAL D N   1 
ATOM   7515  C CA  . VAL D 1 195 ? -27.342 48.580  0.725   1.00 32.62  ? 193  VAL D CA  1 
ATOM   7516  C C   . VAL D 1 195 ? -26.692 48.761  -0.630  1.00 32.60  ? 193  VAL D C   1 
ATOM   7517  O O   . VAL D 1 195 ? -27.370 48.926  -1.641  1.00 35.74  ? 193  VAL D O   1 
ATOM   7518  C CB  . VAL D 1 195 ? -26.904 49.741  1.610   1.00 17.25  ? 193  VAL D CB  1 
ATOM   7519  C CG1 . VAL D 1 195 ? -26.845 51.031  0.797   1.00 18.22  ? 193  VAL D CG1 1 
ATOM   7520  C CG2 . VAL D 1 195 ? -27.875 49.878  2.763   1.00 14.57  ? 193  VAL D CG2 1 
ATOM   7521  N N   . LYS D 1 196 ? -25.373 48.744  -0.655  1.00 24.01  ? 194  LYS D N   1 
ATOM   7522  C CA  . LYS D 1 196 ? -24.696 48.939  -1.914  1.00 24.46  ? 194  LYS D CA  1 
ATOM   7523  C C   . LYS D 1 196 ? -25.344 48.132  -3.040  1.00 26.33  ? 194  LYS D C   1 
ATOM   7524  O O   . LYS D 1 196 ? -25.263 48.513  -4.203  1.00 29.59  ? 194  LYS D O   1 
ATOM   7525  C CB  . LYS D 1 196 ? -23.212 48.581  -1.803  1.00 19.06  ? 194  LYS D CB  1 
ATOM   7526  C CG  . LYS D 1 196 ? -22.461 49.033  -3.043  1.00 12.82  ? 194  LYS D CG  1 
ATOM   7527  C CD  . LYS D 1 196 ? -21.030 48.574  -3.105  1.00 10.64  ? 194  LYS D CD  1 
ATOM   7528  C CE  . LYS D 1 196 ? -20.444 48.946  -4.451  1.00 12.33  ? 194  LYS D CE  1 
ATOM   7529  N NZ  . LYS D 1 196 ? -19.185 48.212  -4.745  1.00 19.20  ? 194  LYS D NZ  1 
ATOM   7530  N N   . MET D 1 197 ? -25.970 47.010  -2.699  1.00 25.96  ? 195  MET D N   1 
ATOM   7531  C CA  . MET D 1 197 ? -26.644 46.175  -3.691  1.00 26.50  ? 195  MET D CA  1 
ATOM   7532  C C   . MET D 1 197 ? -28.114 46.578  -3.707  1.00 29.77  ? 195  MET D C   1 
ATOM   7533  O O   . MET D 1 197 ? -29.010 45.735  -3.799  1.00 31.06  ? 195  MET D O   1 
ATOM   7534  C CB  . MET D 1 197 ? -26.529 44.695  -3.325  1.00 29.04  ? 195  MET D CB  1 
ATOM   7535  C CG  . MET D 1 197 ? -25.110 44.195  -3.169  1.00 30.63  ? 195  MET D CG  1 
ATOM   7536  S SD  . MET D 1 197 ? -24.141 44.420  -4.663  1.00 38.74  ? 195  MET D SD  1 
ATOM   7537  C CE  . MET D 1 197 ? -23.560 46.080  -4.426  1.00 41.36  ? 195  MET D CE  1 
ATOM   7538  N N   . GLY D 1 198 ? -28.350 47.879  -3.576  1.00 35.73  ? 196  GLY D N   1 
ATOM   7539  C CA  . GLY D 1 198 ? -29.700 48.404  -3.596  1.00 41.02  ? 196  GLY D CA  1 
ATOM   7540  C C   . GLY D 1 198 ? -30.624 47.995  -2.468  1.00 45.73  ? 196  GLY D C   1 
ATOM   7541  O O   . GLY D 1 198 ? -31.821 48.246  -2.551  1.00 50.05  ? 196  GLY D O   1 
ATOM   7542  N N   . LEU D 1 199 ? -30.114 47.375  -1.413  1.00 52.98  ? 197  LEU D N   1 
ATOM   7543  C CA  . LEU D 1 199 ? -31.002 46.988  -0.322  1.00 56.48  ? 197  LEU D CA  1 
ATOM   7544  C C   . LEU D 1 199 ? -31.199 48.121  0.677   1.00 58.94  ? 197  LEU D C   1 
ATOM   7545  O O   . LEU D 1 199 ? -30.248 48.805  1.051   1.00 61.25  ? 197  LEU D O   1 
ATOM   7546  C CB  . LEU D 1 199 ? -30.467 45.746  0.398   1.00 61.97  ? 197  LEU D CB  1 
ATOM   7547  C CG  . LEU D 1 199 ? -30.559 44.419  -0.367  1.00 64.89  ? 197  LEU D CG  1 
ATOM   7548  C CD1 . LEU D 1 199 ? -29.850 43.319  0.400   1.00 64.43  ? 197  LEU D CD1 1 
ATOM   7549  C CD2 . LEU D 1 199 ? -32.018 44.044  -0.580  1.00 67.04  ? 197  LEU D CD2 1 
ATOM   7550  N N   . PRO D 1 200 ? -32.450 48.353  1.101   1.00 59.60  ? 198  PRO D N   1 
ATOM   7551  C CA  . PRO D 1 200 ? -32.728 49.418  2.068   1.00 60.07  ? 198  PRO D CA  1 
ATOM   7552  C C   . PRO D 1 200 ? -32.085 49.069  3.412   1.00 61.13  ? 198  PRO D C   1 
ATOM   7553  O O   . PRO D 1 200 ? -32.133 47.920  3.865   1.00 61.63  ? 198  PRO D O   1 
ATOM   7554  C CB  . PRO D 1 200 ? -34.256 49.447  2.121   1.00 48.24  ? 198  PRO D CB  1 
ATOM   7555  C CG  . PRO D 1 200 ? -34.634 48.035  1.828   1.00 48.23  ? 198  PRO D CG  1 
ATOM   7556  C CD  . PRO D 1 200 ? -33.692 47.669  0.701   1.00 49.62  ? 198  PRO D CD  1 
ATOM   7557  N N   . ARG D 1 201 ? -31.479 50.067  4.042   1.00 58.30  ? 199  ARG D N   1 
ATOM   7558  C CA  . ARG D 1 201 ? -30.792 49.870  5.314   1.00 58.58  ? 199  ARG D CA  1 
ATOM   7559  C C   . ARG D 1 201 ? -31.615 49.083  6.307   1.00 58.19  ? 199  ARG D C   1 
ATOM   7560  O O   . ARG D 1 201 ? -31.385 47.897  6.529   1.00 57.55  ? 199  ARG D O   1 
ATOM   7561  C CB  . ARG D 1 201 ? -30.430 51.214  5.946   1.00 55.90  ? 199  ARG D CB  1 
ATOM   7562  C CG  . ARG D 1 201 ? -29.347 51.118  7.000   1.00 54.04  ? 199  ARG D CG  1 
ATOM   7563  C CD  . ARG D 1 201 ? -27.977 51.223  6.357   1.00 54.78  ? 199  ARG D CD  1 
ATOM   7564  N NE  . ARG D 1 201 ? -26.915 50.763  7.245   1.00 58.20  ? 199  ARG D NE  1 
ATOM   7565  C CZ  . ARG D 1 201 ? -25.620 50.831  6.954   1.00 61.85  ? 199  ARG D CZ  1 
ATOM   7566  N NH1 . ARG D 1 201 ? -25.225 51.347  5.797   1.00 60.38  ? 199  ARG D NH1 1 
ATOM   7567  N NH2 . ARG D 1 201 ? -24.717 50.370  7.811   1.00 64.27  ? 199  ARG D NH2 1 
ATOM   7568  N N   . ARG D 1 202 ? -32.581 49.763  6.903   1.00 50.91  ? 200  ARG D N   1 
ATOM   7569  C CA  . ARG D 1 202 ? -33.425 49.140  7.899   1.00 53.20  ? 200  ARG D CA  1 
ATOM   7570  C C   . ARG D 1 202 ? -33.734 47.697  7.584   1.00 50.88  ? 200  ARG D C   1 
ATOM   7571  O O   . ARG D 1 202 ? -33.977 46.919  8.485   1.00 49.87  ? 200  ARG D O   1 
ATOM   7572  C CB  . ARG D 1 202 ? -34.715 49.939  8.076   1.00 96.24  ? 200  ARG D CB  1 
ATOM   7573  C CG  . ARG D 1 202 ? -34.576 51.074  9.075   1.00 106.51 ? 200  ARG D CG  1 
ATOM   7574  C CD  . ARG D 1 202 ? -34.198 50.534  10.454  1.00 114.07 ? 200  ARG D CD  1 
ATOM   7575  N NE  . ARG D 1 202 ? -33.636 51.570  11.319  1.00 119.35 ? 200  ARG D NE  1 
ATOM   7576  C CZ  . ARG D 1 202 ? -33.074 51.338  12.503  1.00 120.83 ? 200  ARG D CZ  1 
ATOM   7577  N NH1 . ARG D 1 202 ? -32.998 50.102  12.970  1.00 120.02 ? 200  ARG D NH1 1 
ATOM   7578  N NH2 . ARG D 1 202 ? -32.578 52.342  13.217  1.00 122.73 ? 200  ARG D NH2 1 
ATOM   7579  N N   . LEU D 1 203 ? -33.720 47.338  6.306   1.00 38.81  ? 201  LEU D N   1 
ATOM   7580  C CA  . LEU D 1 203 ? -34.003 45.966  5.915   1.00 37.56  ? 201  LEU D CA  1 
ATOM   7581  C C   . LEU D 1 203 ? -32.732 45.149  5.935   1.00 38.01  ? 201  LEU D C   1 
ATOM   7582  O O   . LEU D 1 203 ? -32.623 44.158  6.654   1.00 36.31  ? 201  LEU D O   1 
ATOM   7583  C CB  . LEU D 1 203 ? -34.592 45.922  4.507   1.00 49.24  ? 201  LEU D CB  1 
ATOM   7584  C CG  . LEU D 1 203 ? -34.625 44.524  3.873   1.00 50.89  ? 201  LEU D CG  1 
ATOM   7585  C CD1 . LEU D 1 203 ? -35.657 43.652  4.574   1.00 49.96  ? 201  LEU D CD1 1 
ATOM   7586  C CD2 . LEU D 1 203 ? -34.941 44.646  2.394   1.00 49.83  ? 201  LEU D CD2 1 
ATOM   7587  N N   . ALA D 1 204 ? -31.779 45.583  5.117   1.00 51.23  ? 202  ALA D N   1 
ATOM   7588  C CA  . ALA D 1 204 ? -30.485 44.927  4.977   1.00 52.32  ? 202  ALA D CA  1 
ATOM   7589  C C   . ALA D 1 204 ? -29.831 44.647  6.323   1.00 51.22  ? 202  ALA D C   1 
ATOM   7590  O O   . ALA D 1 204 ? -29.570 43.498  6.684   1.00 49.19  ? 202  ALA D O   1 
ATOM   7591  C CB  . ALA D 1 204 ? -29.567 45.797  4.127   1.00 72.85  ? 202  ALA D CB  1 
ATOM   7592  N N   . VAL D 1 205 ? -29.563 45.722  7.052   1.00 59.42  ? 203  VAL D N   1 
ATOM   7593  C CA  . VAL D 1 205 ? -28.938 45.658  8.363   1.00 58.05  ? 203  VAL D CA  1 
ATOM   7594  C C   . VAL D 1 205 ? -29.847 44.905  9.309   1.00 54.93  ? 203  VAL D C   1 
ATOM   7595  O O   . VAL D 1 205 ? -29.765 45.078  10.516  1.00 52.40  ? 203  VAL D O   1 
ATOM   7596  C CB  . VAL D 1 205 ? -28.729 47.080  8.932   1.00 67.88  ? 203  VAL D CB  1 
ATOM   7597  C CG1 . VAL D 1 205 ? -30.083 47.726  9.227   1.00 65.78  ? 203  VAL D CG1 1 
ATOM   7598  C CG2 . VAL D 1 205 ? -27.873 47.031  10.179  1.00 67.05  ? 203  VAL D CG2 1 
ATOM   7599  N N   . ARG D 1 206 ? -30.696 44.046  8.765   1.00 42.98  ? 204  ARG D N   1 
ATOM   7600  C CA  . ARG D 1 206 ? -31.645 43.328  9.589   1.00 43.14  ? 204  ARG D CA  1 
ATOM   7601  C C   . ARG D 1 206 ? -31.904 41.888  9.161   1.00 39.17  ? 204  ARG D C   1 
ATOM   7602  O O   . ARG D 1 206 ? -32.702 41.170  9.767   1.00 34.35  ? 204  ARG D O   1 
ATOM   7603  C CB  . ARG D 1 206 ? -32.913 44.139  9.564   1.00 94.11  ? 204  ARG D CB  1 
ATOM   7604  C CG  . ARG D 1 206 ? -32.680 45.586  9.995   1.00 107.69 ? 204  ARG D CG  1 
ATOM   7605  C CD  . ARG D 1 206 ? -32.143 45.714  11.418  1.00 119.60 ? 204  ARG D CD  1 
ATOM   7606  N NE  . ARG D 1 206 ? -31.730 47.074  11.760  1.00 130.46 ? 204  ARG D NE  1 
ATOM   7607  C CZ  . ARG D 1 206 ? -31.199 47.422  12.931  1.00 133.78 ? 204  ARG D CZ  1 
ATOM   7608  N NH1 . ARG D 1 206 ? -31.018 46.509  13.878  1.00 132.96 ? 204  ARG D NH1 1 
ATOM   7609  N NH2 . ARG D 1 206 ? -30.840 48.680  13.155  1.00 135.19 ? 204  ARG D NH2 1 
ATOM   7610  N N   . LEU D 1 207 ? -31.222 41.490  8.096   1.00 48.29  ? 205  LEU D N   1 
ATOM   7611  C CA  . LEU D 1 207 ? -31.323 40.151  7.546   1.00 46.84  ? 205  LEU D CA  1 
ATOM   7612  C C   . LEU D 1 207 ? -30.001 39.494  7.896   1.00 45.63  ? 205  LEU D C   1 
ATOM   7613  O O   . LEU D 1 207 ? -29.952 38.319  8.263   1.00 44.14  ? 205  LEU D O   1 
ATOM   7614  C CB  . LEU D 1 207 ? -31.482 40.211  6.025   1.00 54.10  ? 205  LEU D CB  1 
ATOM   7615  C CG  . LEU D 1 207 ? -32.612 41.076  5.458   1.00 55.12  ? 205  LEU D CG  1 
ATOM   7616  C CD1 . LEU D 1 207 ? -32.520 41.113  3.936   1.00 55.59  ? 205  LEU D CD1 1 
ATOM   7617  C CD2 . LEU D 1 207 ? -33.948 40.522  5.906   1.00 55.74  ? 205  LEU D CD2 1 
ATOM   7618  N N   . GLY D 1 208 ? -28.927 40.270  7.768   1.00 39.93  ? 206  GLY D N   1 
ATOM   7619  C CA  . GLY D 1 208 ? -27.604 39.773  8.100   1.00 38.23  ? 206  GLY D CA  1 
ATOM   7620  C C   . GLY D 1 208 ? -27.573 39.392  9.568   1.00 36.06  ? 206  GLY D C   1 
ATOM   7621  O O   . GLY D 1 208 ? -26.863 38.474  9.978   1.00 34.60  ? 206  GLY D O   1 
ATOM   7622  N N   . ALA D 1 209 ? -28.347 40.106  10.373  1.00 37.59  ? 207  ALA D N   1 
ATOM   7623  C CA  . ALA D 1 209 ? -28.408 39.794  11.783  1.00 39.11  ? 207  ALA D CA  1 
ATOM   7624  C C   . ALA D 1 209 ? -29.086 38.431  11.842  1.00 41.87  ? 207  ALA D C   1 
ATOM   7625  O O   . ALA D 1 209 ? -28.492 37.442  12.285  1.00 41.78  ? 207  ALA D O   1 
ATOM   7626  C CB  . ALA D 1 209 ? -29.232 40.838  12.514  1.00 14.13  ? 207  ALA D CB  1 
ATOM   7627  N N   . GLN D 1 210 ? -30.327 38.386  11.362  1.00 50.72  ? 208  GLN D N   1 
ATOM   7628  C CA  . GLN D 1 210 ? -31.102 37.152  11.340  1.00 49.25  ? 208  GLN D CA  1 
ATOM   7629  C C   . GLN D 1 210 ? -30.271 36.018  10.761  1.00 45.96  ? 208  GLN D C   1 
ATOM   7630  O O   . GLN D 1 210 ? -30.373 34.875  11.191  1.00 44.92  ? 208  GLN D O   1 
ATOM   7631  C CB  . GLN D 1 210 ? -32.367 37.339  10.503  1.00 47.94  ? 208  GLN D CB  1 
ATOM   7632  C CG  . GLN D 1 210 ? -33.265 36.121  10.491  1.00 47.39  ? 208  GLN D CG  1 
ATOM   7633  C CD  . GLN D 1 210 ? -33.515 35.588  11.884  1.00 48.31  ? 208  GLN D CD  1 
ATOM   7634  O OE1 . GLN D 1 210 ? -32.692 34.876  12.457  1.00 50.50  ? 208  GLN D OE1 1 
ATOM   7635  N NE2 . GLN D 1 210 ? -34.647 35.941  12.440  1.00 49.18  ? 208  GLN D NE2 1 
ATOM   7636  N N   . ALA D 1 211 ? -29.443 36.347  9.782   1.00 44.01  ? 209  ALA D N   1 
ATOM   7637  C CA  . ALA D 1 211 ? -28.600 35.347  9.162   1.00 43.33  ? 209  ALA D CA  1 
ATOM   7638  C C   . ALA D 1 211 ? -27.641 34.779  10.203  1.00 44.15  ? 209  ALA D C   1 
ATOM   7639  O O   . ALA D 1 211 ? -27.616 33.567  10.426  1.00 44.75  ? 209  ALA D O   1 
ATOM   7640  C CB  . ALA D 1 211 ? -27.831 35.953  8.002   1.00 18.00  ? 209  ALA D CB  1 
ATOM   7641  N N   . LEU D 1 212 ? -26.866 35.647  10.854  1.00 44.91  ? 210  LEU D N   1 
ATOM   7642  C CA  . LEU D 1 212 ? -25.917 35.196  11.876  1.00 44.94  ? 210  LEU D CA  1 
ATOM   7643  C C   . LEU D 1 212 ? -26.595 34.391  12.972  1.00 42.65  ? 210  LEU D C   1 
ATOM   7644  O O   . LEU D 1 212 ? -26.251 33.234  13.195  1.00 42.44  ? 210  LEU D O   1 
ATOM   7645  C CB  . LEU D 1 212 ? -25.204 36.379  12.516  1.00 58.73  ? 210  LEU D CB  1 
ATOM   7646  C CG  . LEU D 1 212 ? -24.348 37.229  11.589  1.00 64.52  ? 210  LEU D CG  1 
ATOM   7647  C CD1 . LEU D 1 212 ? -23.432 38.094  12.438  1.00 66.39  ? 210  LEU D CD1 1 
ATOM   7648  C CD2 . LEU D 1 212 ? -23.533 36.335  10.666  1.00 66.38  ? 210  LEU D CD2 1 
ATOM   7649  N N   . LEU D 1 213 ? -27.547 35.009  13.663  1.00 31.25  ? 211  LEU D N   1 
ATOM   7650  C CA  . LEU D 1 213 ? -28.262 34.314  14.721  1.00 30.96  ? 211  LEU D CA  1 
ATOM   7651  C C   . LEU D 1 213 ? -28.667 32.902  14.260  1.00 30.67  ? 211  LEU D C   1 
ATOM   7652  O O   . LEU D 1 213 ? -28.552 31.924  15.014  1.00 31.32  ? 211  LEU D O   1 
ATOM   7653  C CB  . LEU D 1 213 ? -29.478 35.146  15.154  1.00 30.06  ? 211  LEU D CB  1 
ATOM   7654  C CG  . LEU D 1 213 ? -30.860 34.543  15.443  1.00 32.23  ? 211  LEU D CG  1 
ATOM   7655  C CD1 . LEU D 1 213 ? -30.770 33.240  16.240  1.00 35.11  ? 211  LEU D CD1 1 
ATOM   7656  C CD2 . LEU D 1 213 ? -31.675 35.589  16.206  1.00 30.49  ? 211  LEU D CD2 1 
ATOM   7657  N N   . GLY D 1 214 ? -29.125 32.793  13.020  1.00 30.16  ? 212  GLY D N   1 
ATOM   7658  C CA  . GLY D 1 214 ? -29.502 31.491  12.509  1.00 31.36  ? 212  GLY D CA  1 
ATOM   7659  C C   . GLY D 1 214 ? -28.265 30.629  12.340  1.00 32.07  ? 212  GLY D C   1 
ATOM   7660  O O   . GLY D 1 214 ? -28.190 29.503  12.831  1.00 32.34  ? 212  GLY D O   1 
ATOM   7661  N N   . ALA D 1 215 ? -27.282 31.167  11.634  1.00 33.96  ? 213  ALA D N   1 
ATOM   7662  C CA  . ALA D 1 215 ? -26.040 30.453  11.397  1.00 34.35  ? 213  ALA D CA  1 
ATOM   7663  C C   . ALA D 1 215 ? -25.532 29.887  12.711  1.00 36.21  ? 213  ALA D C   1 
ATOM   7664  O O   . ALA D 1 215 ? -25.214 28.703  12.805  1.00 34.56  ? 213  ALA D O   1 
ATOM   7665  C CB  . ALA D 1 215 ? -25.016 31.400  10.817  1.00 27.27  ? 213  ALA D CB  1 
ATOM   7666  N N   . ALA D 1 216 ? -25.468 30.758  13.719  1.00 41.97  ? 214  ALA D N   1 
ATOM   7667  C CA  . ALA D 1 216 ? -24.999 30.411  15.057  1.00 40.55  ? 214  ALA D CA  1 
ATOM   7668  C C   . ALA D 1 216 ? -25.837 29.291  15.635  1.00 39.77  ? 214  ALA D C   1 
ATOM   7669  O O   . ALA D 1 216 ? -25.363 28.165  15.794  1.00 39.16  ? 214  ALA D O   1 
ATOM   7670  C CB  . ALA D 1 216 ? -25.063 31.632  15.968  1.00 58.09  ? 214  ALA D CB  1 
ATOM   7671  N N   . LYS D 1 217 ? -27.088 29.613  15.944  1.00 31.68  ? 215  LYS D N   1 
ATOM   7672  C CA  . LYS D 1 217 ? -28.019 28.643  16.502  1.00 33.21  ? 215  LYS D CA  1 
ATOM   7673  C C   . LYS D 1 217 ? -27.877 27.292  15.796  1.00 33.33  ? 215  LYS D C   1 
ATOM   7674  O O   . LYS D 1 217 ? -28.006 26.237  16.414  1.00 30.80  ? 215  LYS D O   1 
ATOM   7675  C CB  . LYS D 1 217 ? -29.449 29.182  16.372  1.00 39.01  ? 215  LYS D CB  1 
ATOM   7676  C CG  . LYS D 1 217 ? -30.549 28.312  16.976  1.00 43.37  ? 215  LYS D CG  1 
ATOM   7677  C CD  . LYS D 1 217 ? -31.767 29.177  17.344  1.00 49.33  ? 215  LYS D CD  1 
ATOM   7678  C CE  . LYS D 1 217 ? -33.061 28.380  17.511  1.00 51.19  ? 215  LYS D CE  1 
ATOM   7679  N NZ  . LYS D 1 217 ? -33.020 27.361  18.598  1.00 55.81  ? 215  LYS D NZ  1 
ATOM   7680  N N   . MET D 1 218 ? -27.571 27.329  14.507  1.00 47.07  ? 216  MET D N   1 
ATOM   7681  C CA  . MET D 1 218 ? -27.425 26.105  13.734  1.00 52.08  ? 216  MET D CA  1 
ATOM   7682  C C   . MET D 1 218 ? -26.252 25.225  14.169  1.00 54.34  ? 216  MET D C   1 
ATOM   7683  O O   . MET D 1 218 ? -26.430 24.027  14.406  1.00 54.81  ? 216  MET D O   1 
ATOM   7684  C CB  . MET D 1 218 ? -27.292 26.444  12.255  1.00 52.44  ? 216  MET D CB  1 
ATOM   7685  C CG  . MET D 1 218 ? -27.733 25.326  11.355  1.00 52.48  ? 216  MET D CG  1 
ATOM   7686  S SD  . MET D 1 218 ? -28.093 25.951  9.722   1.00 53.65  ? 216  MET D SD  1 
ATOM   7687  C CE  . MET D 1 218 ? -26.767 25.232  8.821   1.00 52.89  ? 216  MET D CE  1 
ATOM   7688  N N   . LEU D 1 219 ? -25.059 25.809  14.266  1.00 58.78  ? 217  LEU D N   1 
ATOM   7689  C CA  . LEU D 1 219 ? -23.875 25.051  14.675  1.00 61.12  ? 217  LEU D CA  1 
ATOM   7690  C C   . LEU D 1 219 ? -23.940 24.647  16.147  1.00 60.44  ? 217  LEU D C   1 
ATOM   7691  O O   . LEU D 1 219 ? -23.335 23.658  16.562  1.00 60.60  ? 217  LEU D O   1 
ATOM   7692  C CB  . LEU D 1 219 ? -22.600 25.869  14.443  1.00 73.71  ? 217  LEU D CB  1 
ATOM   7693  C CG  . LEU D 1 219 ? -21.257 25.234  14.841  1.00 79.23  ? 217  LEU D CG  1 
ATOM   7694  C CD1 . LEU D 1 219 ? -20.914 24.098  13.888  1.00 80.68  ? 217  LEU D CD1 1 
ATOM   7695  C CD2 . LEU D 1 219 ? -20.158 26.283  14.803  1.00 80.57  ? 217  LEU D CD2 1 
ATOM   7696  N N   . LEU D 1 220 ? -24.676 25.413  16.936  1.00 53.76  ? 218  LEU D N   1 
ATOM   7697  C CA  . LEU D 1 220 ? -24.792 25.125  18.352  1.00 54.74  ? 218  LEU D CA  1 
ATOM   7698  C C   . LEU D 1 220 ? -25.586 23.847  18.572  1.00 56.97  ? 218  LEU D C   1 
ATOM   7699  O O   . LEU D 1 220 ? -25.172 22.981  19.344  1.00 57.46  ? 218  LEU D O   1 
ATOM   7700  C CB  . LEU D 1 220 ? -25.430 26.324  19.055  1.00 50.81  ? 218  LEU D CB  1 
ATOM   7701  C CG  . LEU D 1 220 ? -24.521 27.561  18.921  1.00 48.16  ? 218  LEU D CG  1 
ATOM   7702  C CD1 . LEU D 1 220 ? -25.258 28.882  19.222  1.00 42.94  ? 218  LEU D CD1 1 
ATOM   7703  C CD2 . LEU D 1 220 ? -23.321 27.356  19.837  1.00 45.46  ? 218  LEU D CD2 1 
ATOM   7704  N N   . HIS D 1 221 ? -26.713 23.722  17.879  1.00 59.68  ? 219  HIS D N   1 
ATOM   7705  C CA  . HIS D 1 221 ? -27.539 22.528  17.991  1.00 63.72  ? 219  HIS D CA  1 
ATOM   7706  C C   . HIS D 1 221 ? -27.041 21.482  17.008  1.00 64.60  ? 219  HIS D C   1 
ATOM   7707  O O   . HIS D 1 221 ? -27.845 20.833  16.343  1.00 66.50  ? 219  HIS D O   1 
ATOM   7708  C CB  . HIS D 1 221 ? -28.999 22.842  17.672  1.00 68.92  ? 219  HIS D CB  1 
ATOM   7709  C CG  . HIS D 1 221 ? -29.600 23.879  18.564  1.00 73.73  ? 219  HIS D CG  1 
ATOM   7710  N ND1 . HIS D 1 221 ? -29.058 25.138  18.711  1.00 76.31  ? 219  HIS D ND1 1 
ATOM   7711  C CD2 . HIS D 1 221 ? -30.708 23.853  19.340  1.00 75.99  ? 219  HIS D CD2 1 
ATOM   7712  C CE1 . HIS D 1 221 ? -29.807 25.844  19.540  1.00 76.52  ? 219  HIS D CE1 1 
ATOM   7713  N NE2 . HIS D 1 221 ? -30.815 25.088  19.936  1.00 77.64  ? 219  HIS D NE2 1 
ATOM   7714  N N   . SER D 1 222 ? -25.723 21.322  16.909  1.00 62.69  ? 220  SER D N   1 
ATOM   7715  C CA  . SER D 1 222 ? -25.160 20.340  15.992  1.00 66.13  ? 220  SER D CA  1 
ATOM   7716  C C   . SER D 1 222 ? -23.648 20.250  16.021  1.00 69.79  ? 220  SER D C   1 
ATOM   7717  O O   . SER D 1 222 ? -22.960 21.104  15.466  1.00 71.63  ? 220  SER D O   1 
ATOM   7718  C CB  . SER D 1 222 ? -25.587 20.647  14.556  1.00 66.63  ? 220  SER D CB  1 
ATOM   7719  O OG  . SER D 1 222 ? -25.008 21.857  14.099  1.00 63.32  ? 220  SER D OG  1 
ATOM   7720  N N   . GLU D 1 223 ? -23.128 19.208  16.653  1.00 82.16  ? 221  GLU D N   1 
ATOM   7721  C CA  . GLU D 1 223 ? -21.689 19.000  16.702  1.00 86.59  ? 221  GLU D CA  1 
ATOM   7722  C C   . GLU D 1 223 ? -21.200 18.690  15.281  1.00 83.30  ? 221  GLU D C   1 
ATOM   7723  O O   . GLU D 1 223 ? -20.327 17.845  15.083  1.00 82.79  ? 221  GLU D O   1 
ATOM   7724  C CB  . GLU D 1 223 ? -21.379 17.826  17.619  1.00 183.91 ? 221  GLU D CB  1 
ATOM   7725  C CG  . GLU D 1 223 ? -22.290 16.649  17.360  1.00 194.10 ? 221  GLU D CG  1 
ATOM   7726  C CD  . GLU D 1 223 ? -21.807 15.383  18.014  1.00 199.71 ? 221  GLU D CD  1 
ATOM   7727  O OE1 . GLU D 1 223 ? -20.719 14.902  17.634  1.00 199.95 ? 221  GLU D OE1 1 
ATOM   7728  O OE2 . GLU D 1 223 ? -22.514 14.871  18.906  1.00 199.95 ? 221  GLU D OE2 1 
ATOM   7729  N N   . GLN D 1 224 ? -21.776 19.381  14.301  1.00 59.60  ? 222  GLN D N   1 
ATOM   7730  C CA  . GLN D 1 224 ? -21.441 19.197  12.895  1.00 56.20  ? 222  GLN D CA  1 
ATOM   7731  C C   . GLN D 1 224 ? -20.060 19.686  12.473  1.00 52.29  ? 222  GLN D C   1 
ATOM   7732  O O   . GLN D 1 224 ? -19.365 19.014  11.712  1.00 51.36  ? 222  GLN D O   1 
ATOM   7733  C CB  . GLN D 1 224 ? -22.496 19.880  12.025  1.00 83.73  ? 222  GLN D CB  1 
ATOM   7734  C CG  . GLN D 1 224 ? -23.729 19.038  11.787  1.00 89.19  ? 222  GLN D CG  1 
ATOM   7735  C CD  . GLN D 1 224 ? -23.382 17.705  11.155  1.00 93.48  ? 222  GLN D CD  1 
ATOM   7736  O OE1 . GLN D 1 224 ? -22.678 17.652  10.145  1.00 94.03  ? 222  GLN D OE1 1 
ATOM   7737  N NE2 . GLN D 1 224 ? -23.873 16.619  11.748  1.00 96.53  ? 222  GLN D NE2 1 
ATOM   7738  N N   . HIS D 1 225 ? -19.686 20.861  12.968  1.00 54.49  ? 223  HIS D N   1 
ATOM   7739  C CA  . HIS D 1 225 ? -18.412 21.512  12.667  1.00 51.90  ? 223  HIS D CA  1 
ATOM   7740  C C   . HIS D 1 225 ? -18.631 22.480  11.530  1.00 51.52  ? 223  HIS D C   1 
ATOM   7741  O O   . HIS D 1 225 ? -19.290 22.153  10.543  1.00 51.06  ? 223  HIS D O   1 
ATOM   7742  C CB  . HIS D 1 225 ? -17.333 20.523  12.244  1.00 51.77  ? 223  HIS D CB  1 
ATOM   7743  C CG  . HIS D 1 225 ? -16.014 21.160  11.923  1.00 48.75  ? 223  HIS D CG  1 
ATOM   7744  N ND1 . HIS D 1 225 ? -15.896 22.268  11.110  1.00 46.03  ? 223  HIS D ND1 1 
ATOM   7745  C CD2 . HIS D 1 225 ? -14.751 20.825  12.283  1.00 47.44  ? 223  HIS D CD2 1 
ATOM   7746  C CE1 . HIS D 1 225 ? -14.619 22.587  10.985  1.00 43.56  ? 223  HIS D CE1 1 
ATOM   7747  N NE2 . HIS D 1 225 ? -13.904 21.725  11.686  1.00 43.29  ? 223  HIS D NE2 1 
ATOM   7748  N N   . PRO D 1 226 ? -18.067 23.686  11.653  1.00 52.47  ? 224  PRO D N   1 
ATOM   7749  C CA  . PRO D 1 226 ? -18.172 24.750  10.658  1.00 53.69  ? 224  PRO D CA  1 
ATOM   7750  C C   . PRO D 1 226 ? -17.971 24.282  9.218   1.00 54.94  ? 224  PRO D C   1 
ATOM   7751  O O   . PRO D 1 226 ? -18.935 24.146  8.464   1.00 56.39  ? 224  PRO D O   1 
ATOM   7752  C CB  . PRO D 1 226 ? -17.108 25.738  11.113  1.00 62.50  ? 224  PRO D CB  1 
ATOM   7753  C CG  . PRO D 1 226 ? -17.182 25.618  12.593  1.00 62.33  ? 224  PRO D CG  1 
ATOM   7754  C CD  . PRO D 1 226 ? -17.246 24.124  12.796  1.00 60.82  ? 224  PRO D CD  1 
ATOM   7755  N N   . GLY D 1 227 ? -16.719 24.038  8.845   1.00 69.21  ? 225  GLY D N   1 
ATOM   7756  C CA  . GLY D 1 227 ? -16.410 23.593  7.495   1.00 66.74  ? 225  GLY D CA  1 
ATOM   7757  C C   . GLY D 1 227 ? -17.506 22.754  6.868   1.00 62.80  ? 225  GLY D C   1 
ATOM   7758  O O   . GLY D 1 227 ? -17.823 22.907  5.690   1.00 61.47  ? 225  GLY D O   1 
ATOM   7759  N N   . GLN D 1 228 ? -18.083 21.859  7.659   1.00 39.45  ? 226  GLN D N   1 
ATOM   7760  C CA  . GLN D 1 228 ? -19.149 21.019  7.168   1.00 37.43  ? 226  GLN D CA  1 
ATOM   7761  C C   . GLN D 1 228 ? -20.309 21.900  6.736   1.00 34.59  ? 226  GLN D C   1 
ATOM   7762  O O   . GLN D 1 228 ? -20.485 22.179  5.552   1.00 35.55  ? 226  GLN D O   1 
ATOM   7763  C CB  . GLN D 1 228 ? -19.612 20.054  8.253   1.00 72.00  ? 226  GLN D CB  1 
ATOM   7764  C CG  . GLN D 1 228 ? -20.506 18.970  7.706   1.00 79.17  ? 226  GLN D CG  1 
ATOM   7765  C CD  . GLN D 1 228 ? -19.812 18.150  6.631   1.00 84.01  ? 226  GLN D CD  1 
ATOM   7766  O OE1 . GLN D 1 228 ? -18.895 17.385  6.921   1.00 88.27  ? 226  GLN D OE1 1 
ATOM   7767  N NE2 . GLN D 1 228 ? -20.242 18.315  5.382   1.00 84.61  ? 226  GLN D NE2 1 
ATOM   7768  N N   . LEU D 1 229 ? -21.091 22.354  7.704   1.00 42.00  ? 227  LEU D N   1 
ATOM   7769  C CA  . LEU D 1 229 ? -22.241 23.197  7.411   1.00 41.40  ? 227  LEU D CA  1 
ATOM   7770  C C   . LEU D 1 229 ? -21.937 24.289  6.380   1.00 42.68  ? 227  LEU D C   1 
ATOM   7771  O O   . LEU D 1 229 ? -22.839 24.766  5.696   1.00 43.81  ? 227  LEU D O   1 
ATOM   7772  C CB  . LEU D 1 229 ? -22.757 23.839  8.695   1.00 33.05  ? 227  LEU D CB  1 
ATOM   7773  C CG  . LEU D 1 229 ? -22.998 22.928  9.895   1.00 33.39  ? 227  LEU D CG  1 
ATOM   7774  C CD1 . LEU D 1 229 ? -23.257 23.784  11.109  1.00 37.95  ? 227  LEU D CD1 1 
ATOM   7775  C CD2 . LEU D 1 229 ? -24.174 21.998  9.639   1.00 33.64  ? 227  LEU D CD2 1 
ATOM   7776  N N   . LYS D 1 230 ? -20.680 24.706  6.279   1.00 50.15  ? 228  LYS D N   1 
ATOM   7777  C CA  . LYS D 1 230 ? -20.320 25.729  5.303   1.00 48.72  ? 228  LYS D CA  1 
ATOM   7778  C C   . LYS D 1 230 ? -20.584 25.107  3.943   1.00 49.52  ? 228  LYS D C   1 
ATOM   7779  O O   . LYS D 1 230 ? -21.354 25.628  3.136   1.00 50.52  ? 228  LYS D O   1 
ATOM   7780  C CB  . LYS D 1 230 ? -18.837 26.082  5.411   1.00 57.44  ? 228  LYS D CB  1 
ATOM   7781  C CG  . LYS D 1 230 ? -18.384 27.127  4.407   1.00 57.10  ? 228  LYS D CG  1 
ATOM   7782  C CD  . LYS D 1 230 ? -16.867 27.157  4.203   1.00 55.45  ? 228  LYS D CD  1 
ATOM   7783  C CE  . LYS D 1 230 ? -16.411 26.037  3.281   1.00 58.78  ? 228  LYS D CE  1 
ATOM   7784  N NZ  . LYS D 1 230 ? -14.968 26.153  2.948   1.00 58.20  ? 228  LYS D NZ  1 
ATOM   7785  N N   . ASP D 1 231 ? -19.931 23.975  3.711   1.00 42.32  ? 229  ASP D N   1 
ATOM   7786  C CA  . ASP D 1 231 ? -20.070 23.229  2.480   1.00 42.51  ? 229  ASP D CA  1 
ATOM   7787  C C   . ASP D 1 231 ? -21.546 23.051  2.159   1.00 43.45  ? 229  ASP D C   1 
ATOM   7788  O O   . ASP D 1 231 ? -22.006 23.413  1.080   1.00 43.40  ? 229  ASP D O   1 
ATOM   7789  C CB  . ASP D 1 231 ? -19.406 21.868  2.646   1.00 51.83  ? 229  ASP D CB  1 
ATOM   7790  C CG  . ASP D 1 231 ? -17.953 21.986  3.036   1.00 54.47  ? 229  ASP D CG  1 
ATOM   7791  O OD1 . ASP D 1 231 ? -17.488 23.136  3.190   1.00 53.59  ? 229  ASP D OD1 1 
ATOM   7792  O OD2 . ASP D 1 231 ? -17.277 20.940  3.185   1.00 57.28  ? 229  ASP D OD2 1 
ATOM   7793  N N   . ASN D 1 232 ? -22.287 22.502  3.112   1.00 41.57  ? 230  ASN D N   1 
ATOM   7794  C CA  . ASN D 1 232 ? -23.711 22.267  2.938   1.00 43.13  ? 230  ASN D CA  1 
ATOM   7795  C C   . ASN D 1 232 ? -24.497 23.457  2.410   1.00 44.28  ? 230  ASN D C   1 
ATOM   7796  O O   . ASN D 1 232 ? -25.653 23.308  2.035   1.00 46.87  ? 230  ASN D O   1 
ATOM   7797  C CB  . ASN D 1 232 ? -24.311 21.804  4.259   1.00 64.47  ? 230  ASN D CB  1 
ATOM   7798  C CG  . ASN D 1 232 ? -23.913 20.386  4.603   1.00 67.55  ? 230  ASN D CG  1 
ATOM   7799  O OD1 . ASN D 1 232 ? -22.781 19.962  4.348   1.00 65.38  ? 230  ASN D OD1 1 
ATOM   7800  N ND2 . ASN D 1 232 ? -24.840 19.643  5.194   1.00 68.73  ? 230  ASN D ND2 1 
ATOM   7801  N N   . VAL D 1 233 ? -23.882 24.632  2.370   1.00 51.36  ? 231  VAL D N   1 
ATOM   7802  C CA  . VAL D 1 233 ? -24.573 25.818  1.882   1.00 54.91  ? 231  VAL D CA  1 
ATOM   7803  C C   . VAL D 1 233 ? -23.847 26.357  0.657   1.00 56.52  ? 231  VAL D C   1 
ATOM   7804  O O   . VAL D 1 233 ? -23.815 27.563  0.415   1.00 57.86  ? 231  VAL D O   1 
ATOM   7805  C CB  . VAL D 1 233 ? -24.627 26.907  2.987   1.00 67.34  ? 231  VAL D CB  1 
ATOM   7806  C CG1 . VAL D 1 233 ? -25.366 28.158  2.493   1.00 70.43  ? 231  VAL D CG1 1 
ATOM   7807  C CG2 . VAL D 1 233 ? -25.319 26.343  4.210   1.00 68.50  ? 231  VAL D CG2 1 
ATOM   7808  N N   . SER D 1 234 ? -23.291 25.458  -0.143  1.00 63.62  ? 232  SER D N   1 
ATOM   7809  C CA  . SER D 1 234 ? -22.531 25.900  -1.300  1.00 66.15  ? 232  SER D CA  1 
ATOM   7810  C C   . SER D 1 234 ? -22.767 25.118  -2.588  1.00 67.22  ? 232  SER D C   1 
ATOM   7811  O O   . SER D 1 234 ? -22.109 24.104  -2.816  1.00 69.52  ? 232  SER D O   1 
ATOM   7812  C CB  . SER D 1 234 ? -21.040 25.838  -0.959  1.00 65.19  ? 232  SER D CB  1 
ATOM   7813  O OG  . SER D 1 234 ? -20.776 26.334  0.347   1.00 66.17  ? 232  SER D OG  1 
ATOM   7814  N N   . SER D 1 235 ? -23.684 25.577  -3.438  1.00 73.89  ? 233  SER D N   1 
ATOM   7815  C CA  . SER D 1 235 ? -23.919 24.882  -4.704  1.00 72.31  ? 233  SER D CA  1 
ATOM   7816  C C   . SER D 1 235 ? -22.633 25.042  -5.516  1.00 67.99  ? 233  SER D C   1 
ATOM   7817  O O   . SER D 1 235 ? -22.059 26.129  -5.569  1.00 67.92  ? 233  SER D O   1 
ATOM   7818  C CB  . SER D 1 235 ? -25.103 25.502  -5.438  1.00 94.86  ? 233  SER D CB  1 
ATOM   7819  O OG  . SER D 1 235 ? -24.935 26.900  -5.557  1.00 100.54 ? 233  SER D OG  1 
ATOM   7820  N N   . PRO D 1 236 ? -22.167 23.964  -6.163  1.00 46.21  ? 234  PRO D N   1 
ATOM   7821  C CA  . PRO D 1 236 ? -20.932 24.016  -6.954  1.00 45.38  ? 234  PRO D CA  1 
ATOM   7822  C C   . PRO D 1 236 ? -20.889 25.144  -7.974  1.00 44.83  ? 234  PRO D C   1 
ATOM   7823  O O   . PRO D 1 236 ? -19.811 25.602  -8.376  1.00 44.80  ? 234  PRO D O   1 
ATOM   7824  C CB  . PRO D 1 236 ? -20.882 22.636  -7.613  1.00 41.28  ? 234  PRO D CB  1 
ATOM   7825  C CG  . PRO D 1 236 ? -21.630 21.766  -6.654  1.00 41.41  ? 234  PRO D CG  1 
ATOM   7826  C CD  . PRO D 1 236 ? -22.815 22.652  -6.305  1.00 40.49  ? 234  PRO D CD  1 
ATOM   7827  N N   . GLY D 1 237 ? -22.066 25.590  -8.392  1.00 46.04  ? 235  GLY D N   1 
ATOM   7828  C CA  . GLY D 1 237 ? -22.128 26.659  -9.368  1.00 44.40  ? 235  GLY D CA  1 
ATOM   7829  C C   . GLY D 1 237 ? -21.402 27.918  -8.934  1.00 43.57  ? 235  GLY D C   1 
ATOM   7830  O O   . GLY D 1 237 ? -20.290 28.210  -9.398  1.00 39.28  ? 235  GLY D O   1 
ATOM   7831  N N   . GLY D 1 238 ? -22.041 28.672  -8.044  1.00 48.07  ? 236  GLY D N   1 
ATOM   7832  C CA  . GLY D 1 238 ? -21.440 29.897  -7.572  1.00 47.94  ? 236  GLY D CA  1 
ATOM   7833  C C   . GLY D 1 238 ? -22.196 30.683  -6.520  1.00 49.08  ? 236  GLY D C   1 
ATOM   7834  O O   . GLY D 1 238 ? -23.005 30.142  -5.763  1.00 48.73  ? 236  GLY D O   1 
ATOM   7835  N N   . ALA D 1 239 ? -21.925 31.986  -6.502  1.00 52.63  ? 237  ALA D N   1 
ATOM   7836  C CA  . ALA D 1 239 ? -22.504 32.919  -5.545  1.00 48.80  ? 237  ALA D CA  1 
ATOM   7837  C C   . ALA D 1 239 ? -21.819 32.638  -4.211  1.00 47.03  ? 237  ALA D C   1 
ATOM   7838  O O   . ALA D 1 239 ? -20.656 33.001  -4.027  1.00 44.27  ? 237  ALA D O   1 
ATOM   7839  C CB  . ALA D 1 239 ? -24.016 32.729  -5.437  1.00 16.01  ? 237  ALA D CB  1 
ATOM   7840  N N   . THR D 1 240 ? -22.516 31.967  -3.299  1.00 32.95  ? 238  THR D N   1 
ATOM   7841  C CA  . THR D 1 240 ? -21.951 31.667  -1.993  1.00 32.25  ? 238  THR D CA  1 
ATOM   7842  C C   . THR D 1 240 ? -20.487 31.251  -2.075  1.00 32.44  ? 238  THR D C   1 
ATOM   7843  O O   . THR D 1 240 ? -19.637 31.814  -1.384  1.00 32.36  ? 238  THR D O   1 
ATOM   7844  C CB  . THR D 1 240 ? -22.758 30.591  -1.295  1.00 33.83  ? 238  THR D CB  1 
ATOM   7845  O OG1 . THR D 1 240 ? -24.148 30.927  -1.383  1.00 34.52  ? 238  THR D OG1 1 
ATOM   7846  C CG2 . THR D 1 240 ? -22.374 30.515  0.169   1.00 34.96  ? 238  THR D CG2 1 
ATOM   7847  N N   . ILE D 1 241 ? -20.179 30.280  -2.923  1.00 42.49  ? 239  ILE D N   1 
ATOM   7848  C CA  . ILE D 1 241 ? -18.798 29.854  -3.059  1.00 42.26  ? 239  ILE D CA  1 
ATOM   7849  C C   . ILE D 1 241 ? -17.970 31.009  -3.549  1.00 41.53  ? 239  ILE D C   1 
ATOM   7850  O O   . ILE D 1 241 ? -16.830 31.188  -3.122  1.00 43.83  ? 239  ILE D O   1 
ATOM   7851  C CB  . ILE D 1 241 ? -18.630 28.729  -4.067  1.00 47.58  ? 239  ILE D CB  1 
ATOM   7852  C CG1 . ILE D 1 241 ? -19.140 27.433  -3.466  1.00 53.36  ? 239  ILE D CG1 1 
ATOM   7853  C CG2 . ILE D 1 241 ? -17.155 28.545  -4.390  1.00 47.84  ? 239  ILE D CG2 1 
ATOM   7854  C CD1 . ILE D 1 241 ? -18.343 27.018  -2.246  1.00 60.12  ? 239  ILE D CD1 1 
ATOM   7855  N N   . HIS D 1 242 ? -18.540 31.785  -4.460  1.00 35.64  ? 240  HIS D N   1 
ATOM   7856  C CA  . HIS D 1 242 ? -17.829 32.919  -5.015  1.00 34.96  ? 240  HIS D CA  1 
ATOM   7857  C C   . HIS D 1 242 ? -17.547 33.975  -3.960  1.00 34.68  ? 240  HIS D C   1 
ATOM   7858  O O   . HIS D 1 242 ? -16.446 34.541  -3.919  1.00 32.72  ? 240  HIS D O   1 
ATOM   7859  C CB  . HIS D 1 242 ? -18.611 33.500  -6.198  1.00 40.13  ? 240  HIS D CB  1 
ATOM   7860  C CG  . HIS D 1 242 ? -18.474 32.695  -7.453  1.00 41.11  ? 240  HIS D CG  1 
ATOM   7861  N ND1 . HIS D 1 242 ? -17.306 32.647  -8.185  1.00 39.98  ? 240  HIS D ND1 1 
ATOM   7862  C CD2 . HIS D 1 242 ? -19.340 31.864  -8.076  1.00 41.86  ? 240  HIS D CD2 1 
ATOM   7863  C CE1 . HIS D 1 242 ? -17.459 31.819  -9.204  1.00 40.52  ? 240  HIS D CE1 1 
ATOM   7864  N NE2 . HIS D 1 242 ? -18.684 31.329  -9.159  1.00 45.86  ? 240  HIS D NE2 1 
ATOM   7865  N N   . ALA D 1 243 ? -18.533 34.242  -3.106  1.00 31.85  ? 241  ALA D N   1 
ATOM   7866  C CA  . ALA D 1 243 ? -18.346 35.221  -2.043  1.00 29.90  ? 241  ALA D CA  1 
ATOM   7867  C C   . ALA D 1 243 ? -17.198 34.657  -1.212  1.00 28.85  ? 241  ALA D C   1 
ATOM   7868  O O   . ALA D 1 243 ? -16.198 35.330  -0.956  1.00 27.87  ? 241  ALA D O   1 
ATOM   7869  C CB  . ALA D 1 243 ? -19.613 35.346  -1.203  1.00 12.99  ? 241  ALA D CB  1 
ATOM   7870  N N   . LEU D 1 244 ? -17.343 33.399  -0.820  1.00 26.31  ? 242  LEU D N   1 
ATOM   7871  C CA  . LEU D 1 244 ? -16.311 32.734  -0.059  1.00 22.74  ? 242  LEU D CA  1 
ATOM   7872  C C   . LEU D 1 244 ? -14.926 32.992  -0.620  1.00 24.02  ? 242  LEU D C   1 
ATOM   7873  O O   . LEU D 1 244 ? -14.066 33.530  0.075   1.00 30.10  ? 242  LEU D O   1 
ATOM   7874  C CB  . LEU D 1 244 ? -16.558 31.233  -0.036  1.00 19.82  ? 242  LEU D CB  1 
ATOM   7875  C CG  . LEU D 1 244 ? -17.727 30.836  0.865   1.00 21.07  ? 242  LEU D CG  1 
ATOM   7876  C CD1 . LEU D 1 244 ? -17.818 29.313  1.010   1.00 20.99  ? 242  LEU D CD1 1 
ATOM   7877  C CD2 . LEU D 1 244 ? -17.510 31.471  2.211   1.00 14.96  ? 242  LEU D CD2 1 
ATOM   7878  N N   . HIS D 1 245 ? -14.695 32.615  -1.870  1.00 19.05  ? 243  HIS D N   1 
ATOM   7879  C CA  . HIS D 1 245 ? -13.370 32.810  -2.445  1.00 21.13  ? 243  HIS D CA  1 
ATOM   7880  C C   . HIS D 1 245 ? -12.910 34.241  -2.233  1.00 21.14  ? 243  HIS D C   1 
ATOM   7881  O O   . HIS D 1 245 ? -11.711 34.519  -2.122  1.00 21.78  ? 243  HIS D O   1 
ATOM   7882  C CB  . HIS D 1 245 ? -13.350 32.491  -3.942  1.00 25.16  ? 243  HIS D CB  1 
ATOM   7883  C CG  . HIS D 1 245 ? -11.976 32.519  -4.538  1.00 28.44  ? 243  HIS D CG  1 
ATOM   7884  N ND1 . HIS D 1 245 ? -11.748 32.395  -5.890  1.00 29.61  ? 243  HIS D ND1 1 
ATOM   7885  C CD2 . HIS D 1 245 ? -10.756 32.650  -3.963  1.00 32.48  ? 243  HIS D CD2 1 
ATOM   7886  C CE1 . HIS D 1 245 ? -10.447 32.449  -6.122  1.00 32.85  ? 243  HIS D CE1 1 
ATOM   7887  N NE2 . HIS D 1 245 ? -9.823  32.604  -4.969  1.00 31.72  ? 243  HIS D NE2 1 
ATOM   7888  N N   . VAL D 1 246 ? -13.871 35.150  -2.168  1.00 29.15  ? 244  VAL D N   1 
ATOM   7889  C CA  . VAL D 1 246 ? -13.539 36.548  -1.976  1.00 30.85  ? 244  VAL D CA  1 
ATOM   7890  C C   . VAL D 1 246 ? -13.038 36.799  -0.552  1.00 29.33  ? 244  VAL D C   1 
ATOM   7891  O O   . VAL D 1 246 ? -11.915 37.276  -0.374  1.00 30.20  ? 244  VAL D O   1 
ATOM   7892  C CB  . VAL D 1 246 ? -14.757 37.444  -2.346  1.00 41.79  ? 244  VAL D CB  1 
ATOM   7893  C CG1 . VAL D 1 246 ? -15.018 38.509  -1.285  1.00 43.99  ? 244  VAL D CG1 1 
ATOM   7894  C CG2 . VAL D 1 246 ? -14.498 38.088  -3.686  1.00 39.34  ? 244  VAL D CG2 1 
ATOM   7895  N N   . LEU D 1 247 ? -13.851 36.466  0.454   1.00 30.24  ? 245  LEU D N   1 
ATOM   7896  C CA  . LEU D 1 247 ? -13.454 36.645  1.848   1.00 27.16  ? 245  LEU D CA  1 
ATOM   7897  C C   . LEU D 1 247 ? -12.122 35.953  2.006   1.00 30.08  ? 245  LEU D C   1 
ATOM   7898  O O   . LEU D 1 247 ? -11.163 36.509  2.551   1.00 33.43  ? 245  LEU D O   1 
ATOM   7899  C CB  . LEU D 1 247 ? -14.455 35.990  2.798   1.00 8.11   ? 245  LEU D CB  1 
ATOM   7900  C CG  . LEU D 1 247 ? -15.805 36.692  2.995   1.00 9.24   ? 245  LEU D CG  1 
ATOM   7901  C CD1 . LEU D 1 247 ? -16.634 35.912  3.987   1.00 5.99   ? 245  LEU D CD1 1 
ATOM   7902  C CD2 . LEU D 1 247 ? -15.599 38.129  3.509   1.00 12.87  ? 245  LEU D CD2 1 
ATOM   7903  N N   . GLU D 1 248 ? -12.069 34.729  1.503   1.00 20.36  ? 246  GLU D N   1 
ATOM   7904  C CA  . GLU D 1 248 ? -10.863 33.949  1.593   1.00 22.50  ? 246  GLU D CA  1 
ATOM   7905  C C   . GLU D 1 248 ? -9.662  34.735  1.099   1.00 22.70  ? 246  GLU D C   1 
ATOM   7906  O O   . GLU D 1 248 ? -8.594  34.689  1.715   1.00 21.15  ? 246  GLU D O   1 
ATOM   7907  C CB  . GLU D 1 248 ? -11.009 32.674  0.786   1.00 34.79  ? 246  GLU D CB  1 
ATOM   7908  C CG  . GLU D 1 248 ? -10.380 31.499  1.477   1.00 38.75  ? 246  GLU D CG  1 
ATOM   7909  C CD  . GLU D 1 248 ? -11.129 31.123  2.719   1.00 41.95  ? 246  GLU D CD  1 
ATOM   7910  O OE1 . GLU D 1 248 ? -10.637 30.258  3.473   1.00 48.00  ? 246  GLU D OE1 1 
ATOM   7911  O OE2 . GLU D 1 248 ? -12.220 31.694  2.929   1.00 40.63  ? 246  GLU D OE2 1 
ATOM   7912  N N   . SER D 1 249 ? -9.839  35.460  -0.004  1.00 28.00  ? 247  SER D N   1 
ATOM   7913  C CA  . SER D 1 249 ? -8.761  36.256  -0.598  1.00 31.05  ? 247  SER D CA  1 
ATOM   7914  C C   . SER D 1 249 ? -8.312  37.472  0.222   1.00 31.39  ? 247  SER D C   1 
ATOM   7915  O O   . SER D 1 249 ? -7.300  38.108  -0.092  1.00 28.84  ? 247  SER D O   1 
ATOM   7916  C CB  . SER D 1 249 ? -9.153  36.706  -2.010  1.00 36.85  ? 247  SER D CB  1 
ATOM   7917  O OG  . SER D 1 249 ? -9.011  35.649  -2.948  1.00 40.25  ? 247  SER D OG  1 
ATOM   7918  N N   . GLY D 1 250 ? -9.060  37.790  1.270   1.00 34.22  ? 248  GLY D N   1 
ATOM   7919  C CA  . GLY D 1 250 ? -8.688  38.909  2.106   1.00 37.11  ? 248  GLY D CA  1 
ATOM   7920  C C   . GLY D 1 250 ? -8.260  38.431  3.480   1.00 39.68  ? 248  GLY D C   1 
ATOM   7921  O O   . GLY D 1 250 ? -8.374  39.163  4.461   1.00 45.26  ? 248  GLY D O   1 
ATOM   7922  N N   . GLY D 1 251 ? -7.757  37.206  3.565   1.00 37.35  ? 249  GLY D N   1 
ATOM   7923  C CA  . GLY D 1 251 ? -7.348  36.684  4.856   1.00 35.91  ? 249  GLY D CA  1 
ATOM   7924  C C   . GLY D 1 251 ? -8.411  36.907  5.928   1.00 34.81  ? 249  GLY D C   1 
ATOM   7925  O O   . GLY D 1 251 ? -8.091  37.071  7.102   1.00 36.71  ? 249  GLY D O   1 
ATOM   7926  N N   . PHE D 1 252 ? -9.678  36.921  5.523   1.00 26.74  ? 250  PHE D N   1 
ATOM   7927  C CA  . PHE D 1 252 ? -10.795 37.117  6.448   1.00 23.16  ? 250  PHE D CA  1 
ATOM   7928  C C   . PHE D 1 252 ? -10.613 36.299  7.707   1.00 23.67  ? 250  PHE D C   1 
ATOM   7929  O O   . PHE D 1 252 ? -10.843 36.785  8.813   1.00 26.09  ? 250  PHE D O   1 
ATOM   7930  C CB  . PHE D 1 252 ? -12.112 36.694  5.799   1.00 20.57  ? 250  PHE D CB  1 
ATOM   7931  C CG  . PHE D 1 252 ? -13.316 36.886  6.681   1.00 13.10  ? 250  PHE D CG  1 
ATOM   7932  C CD1 . PHE D 1 252 ? -13.763 38.175  7.007   1.00 9.21   ? 250  PHE D CD1 1 
ATOM   7933  C CD2 . PHE D 1 252 ? -14.038 35.785  7.148   1.00 7.77   ? 250  PHE D CD2 1 
ATOM   7934  C CE1 . PHE D 1 252 ? -14.936 38.367  7.793   1.00 6.42   ? 250  PHE D CE1 1 
ATOM   7935  C CE2 . PHE D 1 252 ? -15.207 35.964  7.933   1.00 7.26   ? 250  PHE D CE2 1 
ATOM   7936  C CZ  . PHE D 1 252 ? -15.658 37.257  8.255   1.00 5.47   ? 250  PHE D CZ  1 
ATOM   7937  N N   . ARG D 1 253 ? -10.238 35.036  7.538   1.00 32.79  ? 251  ARG D N   1 
ATOM   7938  C CA  . ARG D 1 253 ? -10.020 34.178  8.689   1.00 33.41  ? 251  ARG D CA  1 
ATOM   7939  C C   . ARG D 1 253 ? -8.966  34.856  9.556   1.00 33.37  ? 251  ARG D C   1 
ATOM   7940  O O   . ARG D 1 253 ? -9.216  35.162  10.717  1.00 34.50  ? 251  ARG D O   1 
ATOM   7941  C CB  . ARG D 1 253 ? -9.519  32.807  8.252   1.00 26.15  ? 251  ARG D CB  1 
ATOM   7942  C CG  . ARG D 1 253 ? -10.537 31.943  7.557   1.00 29.68  ? 251  ARG D CG  1 
ATOM   7943  C CD  . ARG D 1 253 ? -9.852  30.672  7.089   1.00 31.22  ? 251  ARG D CD  1 
ATOM   7944  N NE  . ARG D 1 253 ? -10.776 29.682  6.555   1.00 30.93  ? 251  ARG D NE  1 
ATOM   7945  C CZ  . ARG D 1 253 ? -11.802 29.188  7.234   1.00 34.04  ? 251  ARG D CZ  1 
ATOM   7946  N NH1 . ARG D 1 253 ? -12.028 29.599  8.476   1.00 35.54  ? 251  ARG D NH1 1 
ATOM   7947  N NH2 . ARG D 1 253 ? -12.603 28.286  6.673   1.00 31.90  ? 251  ARG D NH2 1 
ATOM   7948  N N   . SER D 1 254 ? -7.798  35.107  8.968   1.00 25.84  ? 252  SER D N   1 
ATOM   7949  C CA  . SER D 1 254 ? -6.680  35.744  9.657   1.00 24.63  ? 252  SER D CA  1 
ATOM   7950  C C   . SER D 1 254 ? -7.116  36.893  10.547  1.00 23.87  ? 252  SER D C   1 
ATOM   7951  O O   . SER D 1 254 ? -6.860  36.907  11.752  1.00 26.12  ? 252  SER D O   1 
ATOM   7952  C CB  . SER D 1 254 ? -5.661  36.256  8.638   1.00 24.65  ? 252  SER D CB  1 
ATOM   7953  O OG  . SER D 1 254 ? -4.885  37.314  9.181   1.00 31.20  ? 252  SER D OG  1 
ATOM   7954  N N   . LEU D 1 255 ? -7.785  37.864  9.953   1.00 17.19  ? 253  LEU D N   1 
ATOM   7955  C CA  . LEU D 1 255 ? -8.218  39.007  10.718  1.00 18.25  ? 253  LEU D CA  1 
ATOM   7956  C C   . LEU D 1 255 ? -9.053  38.615  11.931  1.00 16.17  ? 253  LEU D C   1 
ATOM   7957  O O   . LEU D 1 255 ? -9.002  39.282  12.957  1.00 17.39  ? 253  LEU D O   1 
ATOM   7958  C CB  . LEU D 1 255 ? -8.990  39.975  9.824   1.00 43.67  ? 253  LEU D CB  1 
ATOM   7959  C CG  . LEU D 1 255 ? -8.348  40.318  8.473   1.00 47.28  ? 253  LEU D CG  1 
ATOM   7960  C CD1 . LEU D 1 255 ? -8.981  41.609  7.996   1.00 51.39  ? 253  LEU D CD1 1 
ATOM   7961  C CD2 . LEU D 1 255 ? -6.823  40.475  8.566   1.00 48.54  ? 253  LEU D CD2 1 
ATOM   7962  N N   . LEU D 1 256 ? -9.831  37.549  11.841  1.00 20.01  ? 254  LEU D N   1 
ATOM   7963  C CA  . LEU D 1 256 ? -10.605 37.176  13.012  1.00 24.69  ? 254  LEU D CA  1 
ATOM   7964  C C   . LEU D 1 256 ? -9.723  36.515  14.073  1.00 27.37  ? 254  LEU D C   1 
ATOM   7965  O O   . LEU D 1 256 ? -10.052 36.517  15.264  1.00 29.24  ? 254  LEU D O   1 
ATOM   7966  C CB  . LEU D 1 256 ? -11.766 36.257  12.632  1.00 26.06  ? 254  LEU D CB  1 
ATOM   7967  C CG  . LEU D 1 256 ? -12.915 37.003  11.961  1.00 25.18  ? 254  LEU D CG  1 
ATOM   7968  C CD1 . LEU D 1 256 ? -14.177 36.153  12.011  1.00 23.58  ? 254  LEU D CD1 1 
ATOM   7969  C CD2 . LEU D 1 256 ? -13.146 38.315  12.691  1.00 30.36  ? 254  LEU D CD2 1 
ATOM   7970  N N   . ILE D 1 257 ? -8.603  35.942  13.654  1.00 26.00  ? 255  ILE D N   1 
ATOM   7971  C CA  . ILE D 1 257 ? -7.718  35.322  14.624  1.00 26.90  ? 255  ILE D CA  1 
ATOM   7972  C C   . ILE D 1 257 ? -7.004  36.493  15.274  1.00 29.45  ? 255  ILE D C   1 
ATOM   7973  O O   . ILE D 1 257 ? -7.028  36.654  16.498  1.00 30.91  ? 255  ILE D O   1 
ATOM   7974  C CB  . ILE D 1 257 ? -6.649  34.447  13.965  1.00 36.51  ? 255  ILE D CB  1 
ATOM   7975  C CG1 . ILE D 1 257 ? -7.246  33.632  12.820  1.00 36.00  ? 255  ILE D CG1 1 
ATOM   7976  C CG2 . ILE D 1 257 ? -6.055  33.534  14.997  1.00 36.53  ? 255  ILE D CG2 1 
ATOM   7977  C CD1 . ILE D 1 257 ? -8.395  32.783  13.228  1.00 42.16  ? 255  ILE D CD1 1 
ATOM   7978  N N   . ASN D 1 258 ? -6.374  37.308  14.427  1.00 25.20  ? 256  ASN D N   1 
ATOM   7979  C CA  . ASN D 1 258 ? -5.643  38.491  14.859  1.00 24.70  ? 256  ASN D CA  1 
ATOM   7980  C C   . ASN D 1 258 ? -6.446  39.220  15.917  1.00 25.40  ? 256  ASN D C   1 
ATOM   7981  O O   . ASN D 1 258 ? -5.917  39.649  16.931  1.00 27.21  ? 256  ASN D O   1 
ATOM   7982  C CB  . ASN D 1 258 ? -5.389  39.396  13.663  1.00 31.92  ? 256  ASN D CB  1 
ATOM   7983  C CG  . ASN D 1 258 ? -4.412  38.791  12.682  1.00 33.92  ? 256  ASN D CG  1 
ATOM   7984  O OD1 . ASN D 1 258 ? -4.285  37.571  12.579  1.00 35.93  ? 256  ASN D OD1 1 
ATOM   7985  N ND2 . ASN D 1 258 ? -3.725  39.642  11.940  1.00 32.57  ? 256  ASN D ND2 1 
ATOM   7986  N N   . ALA D 1 259 ? -7.740  39.332  15.668  1.00 33.87  ? 257  ALA D N   1 
ATOM   7987  C CA  . ALA D 1 259 ? -8.667  39.987  16.575  1.00 35.74  ? 257  ALA D CA  1 
ATOM   7988  C C   . ALA D 1 259 ? -8.553  39.398  17.973  1.00 36.98  ? 257  ALA D C   1 
ATOM   7989  O O   . ALA D 1 259 ? -8.190  40.084  18.938  1.00 37.59  ? 257  ALA D O   1 
ATOM   7990  C CB  . ALA D 1 259 ? -10.080 39.801  16.063  1.00 48.01  ? 257  ALA D CB  1 
ATOM   7991  N N   . VAL D 1 260 ? -8.893  38.117  18.061  1.00 39.23  ? 258  VAL D N   1 
ATOM   7992  C CA  . VAL D 1 260 ? -8.849  37.373  19.306  1.00 34.93  ? 258  VAL D CA  1 
ATOM   7993  C C   . VAL D 1 260 ? -7.495  37.524  19.975  1.00 35.01  ? 258  VAL D C   1 
ATOM   7994  O O   . VAL D 1 260 ? -7.379  38.110  21.047  1.00 35.20  ? 258  VAL D O   1 
ATOM   7995  C CB  . VAL D 1 260 ? -9.162  35.887  19.046  1.00 21.80  ? 258  VAL D CB  1 
ATOM   7996  C CG1 . VAL D 1 260 ? -8.498  35.004  20.101  1.00 17.84  ? 258  VAL D CG1 1 
ATOM   7997  C CG2 . VAL D 1 260 ? -10.671 35.688  19.046  1.00 16.70  ? 258  VAL D CG2 1 
ATOM   7998  N N   . GLU D 1 261 ? -6.471  36.991  19.332  1.00 30.63  ? 259  GLU D N   1 
ATOM   7999  C CA  . GLU D 1 261 ? -5.133  37.092  19.867  1.00 31.54  ? 259  GLU D CA  1 
ATOM   8000  C C   . GLU D 1 261 ? -4.941  38.471  20.474  1.00 34.18  ? 259  GLU D C   1 
ATOM   8001  O O   . GLU D 1 261 ? -4.735  38.600  21.674  1.00 36.88  ? 259  GLU D O   1 
ATOM   8002  C CB  . GLU D 1 261 ? -4.117  36.861  18.750  1.00 21.56  ? 259  GLU D CB  1 
ATOM   8003  C CG  . GLU D 1 261 ? -2.701  37.232  19.097  1.00 19.28  ? 259  GLU D CG  1 
ATOM   8004  C CD  . GLU D 1 261 ? -1.683  36.476  18.260  1.00 23.78  ? 259  GLU D CD  1 
ATOM   8005  O OE1 . GLU D 1 261 ? -1.699  35.223  18.303  1.00 28.27  ? 259  GLU D OE1 1 
ATOM   8006  O OE2 . GLU D 1 261 ? -0.866  37.120  17.563  1.00 23.17  ? 259  GLU D OE2 1 
ATOM   8007  N N   . ALA D 1 262 ? -5.046  39.497  19.636  1.00 32.01  ? 260  ALA D N   1 
ATOM   8008  C CA  . ALA D 1 262 ? -4.859  40.884  20.054  1.00 32.33  ? 260  ALA D CA  1 
ATOM   8009  C C   . ALA D 1 262 ? -5.598  41.280  21.305  1.00 31.34  ? 260  ALA D C   1 
ATOM   8010  O O   . ALA D 1 262 ? -5.031  41.928  22.184  1.00 33.62  ? 260  ALA D O   1 
ATOM   8011  C CB  . ALA D 1 262 ? -5.240  41.824  18.927  1.00 64.14  ? 260  ALA D CB  1 
ATOM   8012  N N   . SER D 1 263 ? -6.869  40.916  21.386  1.00 19.02  ? 261  SER D N   1 
ATOM   8013  C CA  . SER D 1 263 ? -7.642  41.276  22.556  1.00 20.59  ? 261  SER D CA  1 
ATOM   8014  C C   . SER D 1 263 ? -7.208  40.496  23.780  1.00 23.64  ? 261  SER D C   1 
ATOM   8015  O O   . SER D 1 263 ? -7.244  41.026  24.886  1.00 25.47  ? 261  SER D O   1 
ATOM   8016  C CB  . SER D 1 263 ? -9.125  41.050  22.314  1.00 29.75  ? 261  SER D CB  1 
ATOM   8017  O OG  . SER D 1 263 ? -9.840  41.244  23.518  1.00 28.92  ? 261  SER D OG  1 
ATOM   8018  N N   . CYS D 1 264 ? -6.807  39.242  23.584  1.00 33.98  ? 262  CYS D N   1 
ATOM   8019  C CA  . CYS D 1 264 ? -6.358  38.393  24.686  1.00 37.37  ? 262  CYS D CA  1 
ATOM   8020  C C   . CYS D 1 264 ? -5.043  38.937  25.254  1.00 37.40  ? 262  CYS D C   1 
ATOM   8021  O O   . CYS D 1 264 ? -4.906  39.128  26.465  1.00 37.52  ? 262  CYS D O   1 
ATOM   8022  C CB  . CYS D 1 264 ? -6.172  36.957  24.190  1.00 54.00  ? 262  CYS D CB  1 
ATOM   8023  S SG  . CYS D 1 264 ? -5.754  35.740  25.468  1.00 64.95  ? 262  CYS D SG  1 
ATOM   8024  N N   . ILE D 1 265 ? -4.084  39.186  24.366  1.00 34.71  ? 263  ILE D N   1 
ATOM   8025  C CA  . ILE D 1 265 ? -2.785  39.732  24.742  1.00 33.55  ? 263  ILE D CA  1 
ATOM   8026  C C   . ILE D 1 265 ? -2.957  41.007  25.551  1.00 35.34  ? 263  ILE D C   1 
ATOM   8027  O O   . ILE D 1 265 ? -2.212  41.245  26.489  1.00 38.60  ? 263  ILE D O   1 
ATOM   8028  C CB  . ILE D 1 265 ? -1.933  40.088  23.506  1.00 29.05  ? 263  ILE D CB  1 
ATOM   8029  C CG1 . ILE D 1 265 ? -1.659  38.839  22.678  1.00 30.55  ? 263  ILE D CG1 1 
ATOM   8030  C CG2 . ILE D 1 265 ? -0.613  40.709  23.942  1.00 30.80  ? 263  ILE D CG2 1 
ATOM   8031  C CD1 . ILE D 1 265 ? -0.909  37.767  23.447  1.00 38.31  ? 263  ILE D CD1 1 
ATOM   8032  N N   . ARG D 1 266 ? -3.924  41.839  25.176  1.00 37.53  ? 264  ARG D N   1 
ATOM   8033  C CA  . ARG D 1 266 ? -4.163  43.081  25.901  1.00 39.44  ? 264  ARG D CA  1 
ATOM   8034  C C   . ARG D 1 266 ? -4.635  42.778  27.317  1.00 40.56  ? 264  ARG D C   1 
ATOM   8035  O O   . ARG D 1 266 ? -4.125  43.338  28.282  1.00 41.25  ? 264  ARG D O   1 
ATOM   8036  C CB  . ARG D 1 266 ? -5.217  43.940  25.195  1.00 66.34  ? 264  ARG D CB  1 
ATOM   8037  C CG  . ARG D 1 266 ? -5.625  45.185  25.996  1.00 67.02  ? 264  ARG D CG  1 
ATOM   8038  C CD  . ARG D 1 266 ? -4.429  46.106  26.203  1.00 69.12  ? 264  ARG D CD  1 
ATOM   8039  N NE  . ARG D 1 266 ? -4.646  47.240  27.102  1.00 73.60  ? 264  ARG D NE  1 
ATOM   8040  C CZ  . ARG D 1 266 ? -3.809  48.274  27.208  1.00 74.41  ? 264  ARG D CZ  1 
ATOM   8041  N NH1 . ARG D 1 266 ? -2.705  48.325  26.469  1.00 74.38  ? 264  ARG D NH1 1 
ATOM   8042  N NH2 . ARG D 1 266 ? -4.071  49.258  28.057  1.00 74.55  ? 264  ARG D NH2 1 
ATOM   8043  N N   . THR D 1 267 ? -5.613  41.892  27.443  1.00 54.79  ? 265  THR D N   1 
ATOM   8044  C CA  . THR D 1 267 ? -6.125  41.537  28.756  1.00 56.30  ? 265  THR D CA  1 
ATOM   8045  C C   . THR D 1 267 ? -5.027  41.014  29.666  1.00 58.14  ? 265  THR D C   1 
ATOM   8046  O O   . THR D 1 267 ? -5.102  41.165  30.886  1.00 58.69  ? 265  THR D O   1 
ATOM   8047  C CB  . THR D 1 267 ? -7.227  40.487  28.649  1.00 49.67  ? 265  THR D CB  1 
ATOM   8048  O OG1 . THR D 1 267 ? -8.431  41.128  28.216  1.00 53.55  ? 265  THR D OG1 1 
ATOM   8049  C CG2 . THR D 1 267 ? -7.463  39.808  29.992  1.00 49.08  ? 265  THR D CG2 1 
ATOM   8050  N N   . ARG D 1 268 ? -4.012  40.391  29.081  1.00 46.98  ? 266  ARG D N   1 
ATOM   8051  C CA  . ARG D 1 268 ? -2.909  39.884  29.880  1.00 48.55  ? 266  ARG D CA  1 
ATOM   8052  C C   . ARG D 1 268 ? -2.045  41.068  30.333  1.00 50.42  ? 266  ARG D C   1 
ATOM   8053  O O   . ARG D 1 268 ? -1.923  41.318  31.529  1.00 50.38  ? 266  ARG D O   1 
ATOM   8054  C CB  . ARG D 1 268 ? -2.086  38.866  29.077  1.00 58.42  ? 266  ARG D CB  1 
ATOM   8055  C CG  . ARG D 1 268 ? -2.841  37.557  28.778  1.00 60.84  ? 266  ARG D CG  1 
ATOM   8056  C CD  . ARG D 1 268 ? -2.016  36.578  27.921  1.00 64.07  ? 266  ARG D CD  1 
ATOM   8057  N NE  . ARG D 1 268 ? -2.748  35.348  27.598  1.00 64.54  ? 266  ARG D NE  1 
ATOM   8058  C CZ  . ARG D 1 268 ? -2.321  34.411  26.751  1.00 64.15  ? 266  ARG D CZ  1 
ATOM   8059  N NH1 . ARG D 1 268 ? -1.157  34.547  26.125  1.00 63.43  ? 266  ARG D NH1 1 
ATOM   8060  N NH2 . ARG D 1 268 ? -3.062  33.332  26.527  1.00 62.29  ? 266  ARG D NH2 1 
ATOM   8061  N N   . GLU D 1 269 ? -1.474  41.809  29.384  1.00 69.51  ? 267  GLU D N   1 
ATOM   8062  C CA  . GLU D 1 269 ? -0.635  42.968  29.700  1.00 71.94  ? 267  GLU D CA  1 
ATOM   8063  C C   . GLU D 1 269 ? -1.353  43.865  30.687  1.00 73.57  ? 267  GLU D C   1 
ATOM   8064  O O   . GLU D 1 269 ? -0.740  44.496  31.540  1.00 75.45  ? 267  GLU D O   1 
ATOM   8065  C CB  . GLU D 1 269 ? -0.325  43.769  28.439  1.00 79.26  ? 267  GLU D CB  1 
ATOM   8066  C CG  . GLU D 1 269 ? 0.244   42.938  27.308  1.00 84.17  ? 267  GLU D CG  1 
ATOM   8067  C CD  . GLU D 1 269 ? 0.693   43.790  26.140  1.00 87.83  ? 267  GLU D CD  1 
ATOM   8068  O OE1 . GLU D 1 269 ? -0.051  44.735  25.779  1.00 88.30  ? 267  GLU D OE1 1 
ATOM   8069  O OE2 . GLU D 1 269 ? 1.782   43.508  25.584  1.00 89.51  ? 267  GLU D OE2 1 
ATOM   8070  N N   . LEU D 1 270 ? -2.667  43.919  30.547  1.00 68.02  ? 268  LEU D N   1 
ATOM   8071  C CA  . LEU D 1 270 ? -3.519  44.704  31.426  1.00 71.60  ? 268  LEU D CA  1 
ATOM   8072  C C   . LEU D 1 270 ? -3.159  44.348  32.872  1.00 74.21  ? 268  LEU D C   1 
ATOM   8073  O O   . LEU D 1 270 ? -2.610  45.168  33.615  1.00 73.49  ? 268  LEU D O   1 
ATOM   8074  C CB  . LEU D 1 270 ? -4.972  44.332  31.146  1.00 71.34  ? 268  LEU D CB  1 
ATOM   8075  C CG  . LEU D 1 270 ? -6.005  45.442  31.188  1.00 70.77  ? 268  LEU D CG  1 
ATOM   8076  C CD1 . LEU D 1 270 ? -5.511  46.597  30.340  1.00 69.43  ? 268  LEU D CD1 1 
ATOM   8077  C CD2 . LEU D 1 270 ? -7.338  44.905  30.692  1.00 69.34  ? 268  LEU D CD2 1 
ATOM   8078  N N   . GLN D 1 271 ? -3.482  43.110  33.248  1.00 58.61  ? 269  GLN D N   1 
ATOM   8079  C CA  . GLN D 1 271 ? -3.199  42.572  34.575  1.00 62.23  ? 269  GLN D CA  1 
ATOM   8080  C C   . GLN D 1 271 ? -1.687  42.525  34.771  1.00 64.72  ? 269  GLN D C   1 
ATOM   8081  O O   . GLN D 1 271 ? -1.174  42.849  35.842  1.00 64.01  ? 269  GLN D O   1 
ATOM   8082  C CB  . GLN D 1 271 ? -3.772  41.154  34.693  1.00 80.62  ? 269  GLN D CB  1 
ATOM   8083  C CG  . GLN D 1 271 ? -3.364  40.399  35.954  1.00 83.08  ? 269  GLN D CG  1 
ATOM   8084  C CD  . GLN D 1 271 ? -3.965  40.992  37.219  1.00 83.44  ? 269  GLN D CD  1 
ATOM   8085  O OE1 . GLN D 1 271 ? -5.179  41.139  37.326  1.00 84.72  ? 269  GLN D OE1 1 
ATOM   8086  N NE2 . GLN D 1 271 ? -3.116  41.326  38.186  1.00 82.46  ? 269  GLN D NE2 1 
ATOM   8087  N N   . SER D 1 272 ? -0.989  42.123  33.712  1.00 91.76  ? 270  SER D N   1 
ATOM   8088  C CA  . SER D 1 272 ? 0.467   41.995  33.700  1.00 96.83  ? 270  SER D CA  1 
ATOM   8089  C C   . SER D 1 272 ? 1.214   43.187  34.278  1.00 99.40  ? 270  SER D C   1 
ATOM   8090  O O   . SER D 1 272 ? 2.441   43.202  34.290  1.00 98.64  ? 270  SER D O   1 
ATOM   8091  C CB  . SER D 1 272 ? 0.965   41.741  32.273  1.00 143.58 ? 270  SER D CB  1 
ATOM   8092  O OG  . SER D 1 272 ? 0.486   40.507  31.765  1.00 145.35 ? 270  SER D OG  1 
ATOM   8093  N N   . MET D 1 273 ? 0.475   44.189  34.737  1.00 87.16  ? 271  MET D N   1 
ATOM   8094  C CA  . MET D 1 273 ? 1.076   45.368  35.340  1.00 92.53  ? 271  MET D CA  1 
ATOM   8095  C C   . MET D 1 273 ? 0.106   45.985  36.336  1.00 94.80  ? 271  MET D C   1 
ATOM   8096  O O   . MET D 1 273 ? 0.280   47.116  36.790  1.00 93.72  ? 271  MET D O   1 
ATOM   8097  C CB  . MET D 1 273 ? 1.474   46.374  34.265  1.00 122.69 ? 271  MET D CB  1 
ATOM   8098  C CG  . MET D 1 273 ? 0.500   46.472  33.129  1.00 128.35 ? 271  MET D CG  1 
ATOM   8099  S SD  . MET D 1 273 ? 1.079   47.628  31.889  1.00 134.87 ? 271  MET D SD  1 
ATOM   8100  C CE  . MET D 1 273 ? 2.177   46.584  30.958  1.00 133.28 ? 271  MET D CE  1 
ATOM   8101  N N   . ALA D 1 274 ? -0.922  45.218  36.673  1.00 101.79 ? 272  ALA D N   1 
ATOM   8102  C CA  . ALA D 1 274 ? -1.918  45.647  37.639  1.00 107.14 ? 272  ALA D CA  1 
ATOM   8103  C C   . ALA D 1 274 ? -1.457  45.115  38.987  1.00 111.27 ? 272  ALA D C   1 
ATOM   8104  O O   . ALA D 1 274 ? -1.621  45.764  40.020  1.00 111.44 ? 272  ALA D O   1 
ATOM   8105  C CB  . ALA D 1 274 ? -3.278  45.068  37.283  1.00 102.24 ? 272  ALA D CB  1 
ATOM   8106  N N   . ASP D 1 275 ? -0.869  43.923  38.954  1.00 177.51 ? 273  ASP D N   1 
ATOM   8107  C CA  . ASP D 1 275 ? -0.363  43.256  40.146  1.00 182.02 ? 273  ASP D CA  1 
ATOM   8108  C C   . ASP D 1 275 ? 1.084   43.656  40.424  1.00 184.45 ? 273  ASP D C   1 
ATOM   8109  O O   . ASP D 1 275 ? 1.557   43.556  41.557  1.00 185.70 ? 273  ASP D O   1 
ATOM   8110  C CB  . ASP D 1 275 ? -0.454  41.740  39.965  1.00 138.31 ? 273  ASP D CB  1 
ATOM   8111  C CG  . ASP D 1 275 ? 0.164   41.273  38.657  1.00 139.52 ? 273  ASP D CG  1 
ATOM   8112  O OD1 . ASP D 1 275 ? 1.346   41.594  38.403  1.00 139.74 ? 273  ASP D OD1 1 
ATOM   8113  O OD2 . ASP D 1 275 ? -0.531  40.582  37.882  1.00 140.20 ? 273  ASP D OD2 1 
ATOM   8114  N N   . GLN D 1 276 ? 1.783   44.102  39.383  1.00 150.91 ? 274  GLN D N   1 
ATOM   8115  C CA  . GLN D 1 276 ? 3.173   44.523  39.522  1.00 153.07 ? 274  GLN D CA  1 
ATOM   8116  C C   . GLN D 1 276 ? 3.231   45.897  40.166  1.00 153.65 ? 274  GLN D C   1 
ATOM   8117  O O   . GLN D 1 276 ? 3.479   46.045  41.364  1.00 154.28 ? 274  GLN D O   1 
ATOM   8118  C CB  . GLN D 1 276 ? 3.858   44.634  38.159  1.00 195.08 ? 274  GLN D CB  1 
ATOM   8119  C CG  . GLN D 1 276 ? 3.862   43.394  37.301  1.00 198.77 ? 274  GLN D CG  1 
ATOM   8120  C CD  . GLN D 1 276 ? 4.624   43.621  36.008  1.00 200.00 ? 274  GLN D CD  1 
ATOM   8121  O OE1 . GLN D 1 276 ? 4.342   44.565  35.268  1.00 200.00 ? 274  GLN D OE1 1 
ATOM   8122  N NE2 . GLN D 1 276 ? 5.596   42.759  35.731  1.00 200.00 ? 274  GLN D NE2 1 
ATOM   8123  N N   . GLU D 1 277 ? 2.992   46.899  39.329  1.00 122.35 ? 275  GLU D N   1 
ATOM   8124  C CA  . GLU D 1 277 ? 3.023   48.298  39.716  1.00 122.40 ? 275  GLU D CA  1 
ATOM   8125  C C   . GLU D 1 277 ? 1.707   48.739  40.357  1.00 121.66 ? 275  GLU D C   1 
ATOM   8126  O O   . GLU D 1 277 ? 1.500   48.565  41.560  1.00 120.51 ? 275  GLU D O   1 
ATOM   8127  C CB  . GLU D 1 277 ? 3.325   49.127  38.466  1.00 191.73 ? 275  GLU D CB  1 
ATOM   8128  C CG  . GLU D 1 277 ? 4.474   48.539  37.645  1.00 192.36 ? 275  GLU D CG  1 
ATOM   8129  C CD  . GLU D 1 277 ? 4.399   48.882  36.168  1.00 192.66 ? 275  GLU D CD  1 
ATOM   8130  O OE1 . GLU D 1 277 ? 3.345   48.622  35.547  1.00 192.21 ? 275  GLU D OE1 1 
ATOM   8131  O OE2 . GLU D 1 277 ? 5.398   49.398  35.624  1.00 193.36 ? 275  GLU D OE2 1 
ATOM   8132  N N   . ARG E 1 1   ? 54.389  24.775  -7.098  1.00 71.63  ? -1   ARG E N   1 
ATOM   8133  C CA  . ARG E 1 1   ? 55.408  23.980  -7.856  1.00 73.91  ? -1   ARG E CA  1 
ATOM   8134  C C   . ARG E 1 1   ? 55.448  22.539  -7.359  1.00 71.51  ? -1   ARG E C   1 
ATOM   8135  O O   . ARG E 1 1   ? 55.000  21.613  -8.037  1.00 70.60  ? -1   ARG E O   1 
ATOM   8136  C CB  . ARG E 1 1   ? 56.789  24.617  -7.700  1.00 117.74 ? -1   ARG E CB  1 
ATOM   8137  C CG  . ARG E 1 1   ? 56.901  25.999  -8.314  1.00 122.81 ? -1   ARG E CG  1 
ATOM   8138  C CD  . ARG E 1 1   ? 58.227  26.643  -7.959  1.00 127.39 ? -1   ARG E CD  1 
ATOM   8139  N NE  . ARG E 1 1   ? 58.257  28.058  -8.311  1.00 131.73 ? -1   ARG E NE  1 
ATOM   8140  C CZ  . ARG E 1 1   ? 59.288  28.865  -8.081  1.00 133.09 ? -1   ARG E CZ  1 
ATOM   8141  N NH1 . ARG E 1 1   ? 60.385  28.399  -7.497  1.00 133.66 ? -1   ARG E NH1 1 
ATOM   8142  N NH2 . ARG E 1 1   ? 59.220  30.141  -8.434  1.00 134.76 ? -1   ARG E NH2 1 
ATOM   8143  N N   . GLY E 1 2   ? 56.017  22.355  -6.178  1.00 92.39  ? 0    GLY E N   1 
ATOM   8144  C CA  . GLY E 1 2   ? 56.069  21.037  -5.588  1.00 90.17  ? 0    GLY E CA  1 
ATOM   8145  C C   . GLY E 1 2   ? 55.123  21.102  -4.408  1.00 88.46  ? 0    GLY E C   1 
ATOM   8146  O O   . GLY E 1 2   ? 55.312  20.430  -3.397  1.00 88.87  ? 0    GLY E O   1 
ATOM   8147  N N   . MET E 1 3   ? 54.105  21.946  -4.547  1.00 61.65  ? 1    MET E N   1 
ATOM   8148  C CA  . MET E 1 3   ? 53.095  22.147  -3.516  1.00 59.60  ? 1    MET E CA  1 
ATOM   8149  C C   . MET E 1 3   ? 52.063  21.029  -3.574  1.00 58.53  ? 1    MET E C   1 
ATOM   8150  O O   . MET E 1 3   ? 51.839  20.457  -4.634  1.00 58.98  ? 1    MET E O   1 
ATOM   8151  C CB  . MET E 1 3   ? 52.407  23.491  -3.746  1.00 84.16  ? 1    MET E CB  1 
ATOM   8152  C CG  . MET E 1 3   ? 51.167  23.721  -2.902  1.00 87.97  ? 1    MET E CG  1 
ATOM   8153  S SD  . MET E 1 3   ? 50.239  25.183  -3.428  1.00 91.10  ? 1    MET E SD  1 
ATOM   8154  C CE  . MET E 1 3   ? 49.081  24.442  -4.563  1.00 90.29  ? 1    MET E CE  1 
ATOM   8155  N N   . SER E 1 4   ? 51.441  20.717  -2.440  1.00 60.59  ? 2    SER E N   1 
ATOM   8156  C CA  . SER E 1 4   ? 50.415  19.672  -2.378  1.00 62.67  ? 2    SER E CA  1 
ATOM   8157  C C   . SER E 1 4   ? 49.231  20.195  -1.562  1.00 61.53  ? 2    SER E C   1 
ATOM   8158  O O   . SER E 1 4   ? 49.420  21.011  -0.658  1.00 60.73  ? 2    SER E O   1 
ATOM   8159  C CB  . SER E 1 4   ? 50.982  18.409  -1.726  1.00 171.60 ? 2    SER E CB  1 
ATOM   8160  O OG  . SER E 1 4   ? 52.072  17.892  -2.470  1.00 177.42 ? 2    SER E OG  1 
ATOM   8161  N N   . VAL E 1 5   ? 48.015  19.735  -1.862  1.00 67.72  ? 3    VAL E N   1 
ATOM   8162  C CA  . VAL E 1 5   ? 46.852  20.229  -1.127  1.00 66.72  ? 3    VAL E CA  1 
ATOM   8163  C C   . VAL E 1 5   ? 45.950  19.196  -0.468  1.00 65.16  ? 3    VAL E C   1 
ATOM   8164  O O   . VAL E 1 5   ? 45.788  18.072  -0.950  1.00 64.66  ? 3    VAL E O   1 
ATOM   8165  C CB  . VAL E 1 5   ? 45.962  21.120  -2.020  1.00 92.25  ? 3    VAL E CB  1 
ATOM   8166  C CG1 . VAL E 1 5   ? 44.807  21.688  -1.204  1.00 92.65  ? 3    VAL E CG1 1 
ATOM   8167  C CG2 . VAL E 1 5   ? 46.783  22.247  -2.607  1.00 93.39  ? 3    VAL E CG2 1 
ATOM   8168  N N   . GLY E 1 6   ? 45.355  19.614  0.643   1.00 46.38  ? 4    GLY E N   1 
ATOM   8169  C CA  . GLY E 1 6   ? 44.460  18.759  1.387   1.00 45.57  ? 4    GLY E CA  1 
ATOM   8170  C C   . GLY E 1 6   ? 43.387  19.603  2.038   1.00 46.59  ? 4    GLY E C   1 
ATOM   8171  O O   . GLY E 1 6   ? 43.618  20.766  2.402   1.00 43.93  ? 4    GLY E O   1 
ATOM   8172  N N   . PHE E 1 7   ? 42.208  19.007  2.184   1.00 68.78  ? 5    PHE E N   1 
ATOM   8173  C CA  . PHE E 1 7   ? 41.063  19.673  2.784   1.00 72.35  ? 5    PHE E CA  1 
ATOM   8174  C C   . PHE E 1 7   ? 40.530  18.889  3.964   1.00 73.89  ? 5    PHE E C   1 
ATOM   8175  O O   . PHE E 1 7   ? 40.184  17.717  3.839   1.00 74.17  ? 5    PHE E O   1 
ATOM   8176  C CB  . PHE E 1 7   ? 39.921  19.803  1.781   1.00 91.78  ? 5    PHE E CB  1 
ATOM   8177  C CG  . PHE E 1 7   ? 40.254  20.608  0.568   1.00 92.91  ? 5    PHE E CG  1 
ATOM   8178  C CD1 . PHE E 1 7   ? 41.111  20.108  -0.405  1.00 93.79  ? 5    PHE E CD1 1 
ATOM   8179  C CD2 . PHE E 1 7   ? 39.683  21.860  0.380   1.00 92.49  ? 5    PHE E CD2 1 
ATOM   8180  C CE1 . PHE E 1 7   ? 41.391  20.846  -1.551  1.00 94.92  ? 5    PHE E CE1 1 
ATOM   8181  C CE2 . PHE E 1 7   ? 39.956  22.605  -0.759  1.00 92.32  ? 5    PHE E CE2 1 
ATOM   8182  C CZ  . PHE E 1 7   ? 40.811  22.097  -1.728  1.00 93.20  ? 5    PHE E CZ  1 
ATOM   8183  N N   . ILE E 1 8   ? 40.452  19.542  5.110   1.00 71.44  ? 6    ILE E N   1 
ATOM   8184  C CA  . ILE E 1 8   ? 39.918  18.899  6.295   1.00 73.35  ? 6    ILE E CA  1 
ATOM   8185  C C   . ILE E 1 8   ? 38.407  18.900  6.136   1.00 74.54  ? 6    ILE E C   1 
ATOM   8186  O O   . ILE E 1 8   ? 37.760  19.934  6.250   1.00 72.99  ? 6    ILE E O   1 
ATOM   8187  C CB  . ILE E 1 8   ? 40.332  19.671  7.548   1.00 73.34  ? 6    ILE E CB  1 
ATOM   8188  C CG1 . ILE E 1 8   ? 41.836  19.518  7.738   1.00 72.85  ? 6    ILE E CG1 1 
ATOM   8189  C CG2 . ILE E 1 8   ? 39.579  19.163  8.764   1.00 73.97  ? 6    ILE E CG2 1 
ATOM   8190  C CD1 . ILE E 1 8   ? 42.420  20.532  8.650   1.00 73.35  ? 6    ILE E CD1 1 
ATOM   8191  N N   . GLY E 1 9   ? 37.855  17.729  5.852   1.00 98.86  ? 7    GLY E N   1 
ATOM   8192  C CA  . GLY E 1 9   ? 36.427  17.616  5.655   1.00 101.48 ? 7    GLY E CA  1 
ATOM   8193  C C   . GLY E 1 9   ? 36.145  17.739  4.173   1.00 103.02 ? 7    GLY E C   1 
ATOM   8194  O O   . GLY E 1 9   ? 36.797  18.519  3.485   1.00 103.12 ? 7    GLY E O   1 
ATOM   8195  N N   . ALA E 1 10  ? 35.189  16.963  3.675   1.00 114.38 ? 8    ALA E N   1 
ATOM   8196  C CA  . ALA E 1 10  ? 34.832  17.000  2.262   1.00 116.69 ? 8    ALA E CA  1 
ATOM   8197  C C   . ALA E 1 10  ? 33.718  18.016  2.018   1.00 118.51 ? 8    ALA E C   1 
ATOM   8198  O O   . ALA E 1 10  ? 33.840  19.192  2.375   1.00 120.40 ? 8    ALA E O   1 
ATOM   8199  C CB  . ALA E 1 10  ? 34.389  15.615  1.803   1.00 42.49  ? 8    ALA E CB  1 
ATOM   8200  N N   . GLY E 1 11  ? 32.634  17.556  1.402   1.00 113.23 ? 9    GLY E N   1 
ATOM   8201  C CA  . GLY E 1 11  ? 31.512  18.432  1.129   1.00 112.20 ? 9    GLY E CA  1 
ATOM   8202  C C   . GLY E 1 11  ? 31.591  19.130  -0.211  1.00 110.47 ? 9    GLY E C   1 
ATOM   8203  O O   . GLY E 1 11  ? 32.621  19.108  -0.888  1.00 110.23 ? 9    GLY E O   1 
ATOM   8204  N N   . GLN E 1 12  ? 30.484  19.753  -0.591  1.00 103.56 ? 10   GLN E N   1 
ATOM   8205  C CA  . GLN E 1 12  ? 30.406  20.469  -1.848  1.00 101.86 ? 10   GLN E CA  1 
ATOM   8206  C C   . GLN E 1 12  ? 31.620  21.373  -2.048  1.00 99.90  ? 10   GLN E C   1 
ATOM   8207  O O   . GLN E 1 12  ? 32.364  21.210  -3.015  1.00 99.56  ? 10   GLN E O   1 
ATOM   8208  C CB  . GLN E 1 12  ? 29.115  21.290  -1.893  1.00 101.44 ? 10   GLN E CB  1 
ATOM   8209  C CG  . GLN E 1 12  ? 27.864  20.468  -2.170  1.00 102.47 ? 10   GLN E CG  1 
ATOM   8210  C CD  . GLN E 1 12  ? 27.791  20.006  -3.611  1.00 104.47 ? 10   GLN E CD  1 
ATOM   8211  O OE1 . GLN E 1 12  ? 27.922  20.809  -4.533  1.00 104.67 ? 10   GLN E OE1 1 
ATOM   8212  N NE2 . GLN E 1 12  ? 27.573  18.711  -3.812  1.00 104.22 ? 10   GLN E NE2 1 
ATOM   8213  N N   . LEU E 1 13  ? 31.835  22.305  -1.123  1.00 58.47  ? 11   LEU E N   1 
ATOM   8214  C CA  . LEU E 1 13  ? 32.953  23.241  -1.232  1.00 55.79  ? 11   LEU E CA  1 
ATOM   8215  C C   . LEU E 1 13  ? 34.290  22.547  -1.409  1.00 53.78  ? 11   LEU E C   1 
ATOM   8216  O O   . LEU E 1 13  ? 35.175  23.060  -2.099  1.00 52.80  ? 11   LEU E O   1 
ATOM   8217  C CB  . LEU E 1 13  ? 33.017  24.155  -0.011  1.00 77.87  ? 11   LEU E CB  1 
ATOM   8218  C CG  . LEU E 1 13  ? 33.902  25.389  -0.208  1.00 78.24  ? 11   LEU E CG  1 
ATOM   8219  C CD1 . LEU E 1 13  ? 33.378  26.214  -1.372  1.00 77.09  ? 11   LEU E CD1 1 
ATOM   8220  C CD2 . LEU E 1 13  ? 33.914  26.219  1.058   1.00 79.45  ? 11   LEU E CD2 1 
ATOM   8221  N N   . ALA E 1 14  ? 34.443  21.392  -0.768  1.00 74.79  ? 12   ALA E N   1 
ATOM   8222  C CA  . ALA E 1 14  ? 35.670  20.607  -0.888  1.00 71.97  ? 12   ALA E CA  1 
ATOM   8223  C C   . ALA E 1 14  ? 35.740  20.222  -2.355  1.00 69.54  ? 12   ALA E C   1 
ATOM   8224  O O   . ALA E 1 14  ? 36.672  20.569  -3.084  1.00 67.60  ? 12   ALA E O   1 
ATOM   8225  C CB  . ALA E 1 14  ? 35.574  19.356  -0.038  1.00 61.78  ? 12   ALA E CB  1 
ATOM   8226  N N   . PHE E 1 15  ? 34.718  19.493  -2.770  1.00 64.55  ? 13   PHE E N   1 
ATOM   8227  C CA  . PHE E 1 15  ? 34.590  19.057  -4.141  1.00 63.18  ? 13   PHE E CA  1 
ATOM   8228  C C   . PHE E 1 15  ? 34.839  20.238  -5.086  1.00 60.12  ? 13   PHE E C   1 
ATOM   8229  O O   . PHE E 1 15  ? 35.837  20.261  -5.801  1.00 58.81  ? 13   PHE E O   1 
ATOM   8230  C CB  . PHE E 1 15  ? 33.186  18.491  -4.335  1.00 81.96  ? 13   PHE E CB  1 
ATOM   8231  C CG  . PHE E 1 15  ? 32.825  18.256  -5.755  1.00 85.78  ? 13   PHE E CG  1 
ATOM   8232  C CD1 . PHE E 1 15  ? 33.563  17.380  -6.536  1.00 87.06  ? 13   PHE E CD1 1 
ATOM   8233  C CD2 . PHE E 1 15  ? 31.746  18.919  -6.321  1.00 88.32  ? 13   PHE E CD2 1 
ATOM   8234  C CE1 . PHE E 1 15  ? 33.233  17.167  -7.867  1.00 89.01  ? 13   PHE E CE1 1 
ATOM   8235  C CE2 . PHE E 1 15  ? 31.404  18.716  -7.650  1.00 90.91  ? 13   PHE E CE2 1 
ATOM   8236  C CZ  . PHE E 1 15  ? 32.152  17.836  -8.427  1.00 90.85  ? 13   PHE E CZ  1 
ATOM   8237  N N   . ALA E 1 16  ? 33.931  21.217  -5.067  1.00 65.59  ? 14   ALA E N   1 
ATOM   8238  C CA  . ALA E 1 16  ? 34.016  22.416  -5.910  1.00 63.25  ? 14   ALA E CA  1 
ATOM   8239  C C   . ALA E 1 16  ? 35.443  22.810  -6.240  1.00 62.81  ? 14   ALA E C   1 
ATOM   8240  O O   . ALA E 1 16  ? 35.847  22.841  -7.408  1.00 64.10  ? 14   ALA E O   1 
ATOM   8241  C CB  . ALA E 1 16  ? 33.317  23.582  -5.231  1.00 38.76  ? 14   ALA E CB  1 
ATOM   8242  N N   . LEU E 1 17  ? 36.195  23.127  -5.193  1.00 54.22  ? 15   LEU E N   1 
ATOM   8243  C CA  . LEU E 1 17  ? 37.586  23.511  -5.333  1.00 49.80  ? 15   LEU E CA  1 
ATOM   8244  C C   . LEU E 1 17  ? 38.413  22.343  -5.843  1.00 48.45  ? 15   LEU E C   1 
ATOM   8245  O O   . LEU E 1 17  ? 39.354  22.528  -6.621  1.00 46.00  ? 15   LEU E O   1 
ATOM   8246  C CB  . LEU E 1 17  ? 38.125  23.974  -3.993  1.00 47.41  ? 15   LEU E CB  1 
ATOM   8247  C CG  . LEU E 1 17  ? 37.651  25.368  -3.610  1.00 49.18  ? 15   LEU E CG  1 
ATOM   8248  C CD1 . LEU E 1 17  ? 37.460  25.447  -2.104  1.00 50.63  ? 15   LEU E CD1 1 
ATOM   8249  C CD2 . LEU E 1 17  ? 38.663  26.398  -4.109  1.00 47.99  ? 15   LEU E CD2 1 
ATOM   8250  N N   . ALA E 1 18  ? 38.068  21.138  -5.405  1.00 47.80  ? 16   ALA E N   1 
ATOM   8251  C CA  . ALA E 1 18  ? 38.802  19.967  -5.853  1.00 49.16  ? 16   ALA E CA  1 
ATOM   8252  C C   . ALA E 1 18  ? 38.917  20.028  -7.372  1.00 50.39  ? 16   ALA E C   1 
ATOM   8253  O O   . ALA E 1 18  ? 40.028  20.072  -7.925  1.00 48.46  ? 16   ALA E O   1 
ATOM   8254  C CB  . ALA E 1 18  ? 38.079  18.700  -5.432  1.00 78.63  ? 16   ALA E CB  1 
ATOM   8255  N N   . LYS E 1 19  ? 37.759  20.061  -8.038  1.00 61.01  ? 17   LYS E N   1 
ATOM   8256  C CA  . LYS E 1 19  ? 37.709  20.101  -9.496  1.00 61.54  ? 17   LYS E CA  1 
ATOM   8257  C C   . LYS E 1 19  ? 38.415  21.304  -10.082 1.00 59.80  ? 17   LYS E C   1 
ATOM   8258  O O   . LYS E 1 19  ? 39.392  21.156  -10.819 1.00 58.08  ? 17   LYS E O   1 
ATOM   8259  C CB  . LYS E 1 19  ? 36.271  20.084  -9.983  1.00 70.41  ? 17   LYS E CB  1 
ATOM   8260  C CG  . LYS E 1 19  ? 36.161  19.810  -11.459 1.00 77.40  ? 17   LYS E CG  1 
ATOM   8261  C CD  . LYS E 1 19  ? 34.811  19.207  -11.785 1.00 85.61  ? 17   LYS E CD  1 
ATOM   8262  C CE  . LYS E 1 19  ? 34.575  17.934  -10.980 1.00 88.51  ? 17   LYS E CE  1 
ATOM   8263  N NZ  . LYS E 1 19  ? 33.266  17.293  -11.296 1.00 89.44  ? 17   LYS E NZ  1 
ATOM   8264  N N   . GLY E 1 20  ? 37.911  22.492  -9.761  1.00 46.64  ? 18   GLY E N   1 
ATOM   8265  C CA  . GLY E 1 20  ? 38.526  23.698  -10.273 1.00 46.49  ? 18   GLY E CA  1 
ATOM   8266  C C   . GLY E 1 20  ? 40.010  23.465  -10.485 1.00 47.71  ? 18   GLY E C   1 
ATOM   8267  O O   . GLY E 1 20  ? 40.485  23.384  -11.616 1.00 45.15  ? 18   GLY E O   1 
ATOM   8268  N N   . PHE E 1 21  ? 40.723  23.312  -9.375  1.00 54.00  ? 19   PHE E N   1 
ATOM   8269  C CA  . PHE E 1 21  ? 42.165  23.094  -9.361  1.00 52.92  ? 19   PHE E CA  1 
ATOM   8270  C C   . PHE E 1 21  ? 42.682  22.045  -10.323 1.00 51.07  ? 19   PHE E C   1 
ATOM   8271  O O   . PHE E 1 21  ? 43.617  22.297  -11.081 1.00 50.03  ? 19   PHE E O   1 
ATOM   8272  C CB  . PHE E 1 21  ? 42.588  22.727  -7.950  1.00 58.59  ? 19   PHE E CB  1 
ATOM   8273  C CG  . PHE E 1 21  ? 42.403  23.836  -6.965  1.00 60.51  ? 19   PHE E CG  1 
ATOM   8274  C CD1 . PHE E 1 21  ? 41.833  23.587  -5.722  1.00 60.91  ? 19   PHE E CD1 1 
ATOM   8275  C CD2 . PHE E 1 21  ? 42.835  25.130  -7.265  1.00 63.31  ? 19   PHE E CD2 1 
ATOM   8276  C CE1 . PHE E 1 21  ? 41.696  24.607  -4.779  1.00 63.21  ? 19   PHE E CE1 1 
ATOM   8277  C CE2 . PHE E 1 21  ? 42.704  26.159  -6.331  1.00 63.66  ? 19   PHE E CE2 1 
ATOM   8278  C CZ  . PHE E 1 21  ? 42.132  25.895  -5.082  1.00 62.94  ? 19   PHE E CZ  1 
ATOM   8279  N N   . THR E 1 22  ? 42.087  20.860  -10.274 1.00 39.40  ? 20   THR E N   1 
ATOM   8280  C CA  . THR E 1 22  ? 42.505  19.777  -11.154 1.00 39.98  ? 20   THR E CA  1 
ATOM   8281  C C   . THR E 1 22  ? 42.080  20.130  -12.558 1.00 41.24  ? 20   THR E C   1 
ATOM   8282  O O   . THR E 1 22  ? 42.876  20.079  -13.489 1.00 41.20  ? 20   THR E O   1 
ATOM   8283  C CB  . THR E 1 22  ? 41.833  18.468  -10.784 1.00 46.97  ? 20   THR E CB  1 
ATOM   8284  O OG1 . THR E 1 22  ? 40.434  18.560  -11.072 1.00 45.24  ? 20   THR E OG1 1 
ATOM   8285  C CG2 . THR E 1 22  ? 42.023  18.189  -9.307  1.00 48.00  ? 20   THR E CG2 1 
ATOM   8286  N N   . ALA E 1 23  ? 40.810  20.488  -12.697 1.00 60.74  ? 21   ALA E N   1 
ATOM   8287  C CA  . ALA E 1 23  ? 40.265  20.872  -13.987 1.00 62.67  ? 21   ALA E CA  1 
ATOM   8288  C C   . ALA E 1 23  ? 41.067  22.056  -14.518 1.00 64.19  ? 21   ALA E C   1 
ATOM   8289  O O   . ALA E 1 23  ? 41.159  22.270  -15.723 1.00 64.59  ? 21   ALA E O   1 
ATOM   8290  C CB  . ALA E 1 23  ? 38.805  21.246  -13.837 1.00 57.64  ? 21   ALA E CB  1 
ATOM   8291  N N   . ALA E 1 24  ? 41.656  22.822  -13.610 1.00 54.87  ? 22   ALA E N   1 
ATOM   8292  C CA  . ALA E 1 24  ? 42.454  23.971  -14.002 1.00 56.81  ? 22   ALA E CA  1 
ATOM   8293  C C   . ALA E 1 24  ? 43.830  23.475  -14.416 1.00 58.27  ? 22   ALA E C   1 
ATOM   8294  O O   . ALA E 1 24  ? 44.579  24.176  -15.100 1.00 57.79  ? 22   ALA E O   1 
ATOM   8295  C CB  . ALA E 1 24  ? 42.574  24.950  -12.841 1.00 115.91 ? 22   ALA E CB  1 
ATOM   8296  N N   . GLY E 1 25  ? 44.155  22.255  -14.000 1.00 81.06  ? 23   GLY E N   1 
ATOM   8297  C CA  . GLY E 1 25  ? 45.446  21.683  -14.329 1.00 83.01  ? 23   GLY E CA  1 
ATOM   8298  C C   . GLY E 1 25  ? 46.540  22.321  -13.499 1.00 83.67  ? 23   GLY E C   1 
ATOM   8299  O O   . GLY E 1 25  ? 47.668  22.501  -13.963 1.00 83.87  ? 23   GLY E O   1 
ATOM   8300  N N   . VAL E 1 26  ? 46.201  22.672  -12.263 1.00 79.83  ? 24   VAL E N   1 
ATOM   8301  C CA  . VAL E 1 26  ? 47.161  23.295  -11.367 1.00 81.12  ? 24   VAL E CA  1 
ATOM   8302  C C   . VAL E 1 26  ? 47.969  22.197  -10.691 1.00 81.52  ? 24   VAL E C   1 
ATOM   8303  O O   . VAL E 1 26  ? 49.178  22.330  -10.493 1.00 81.76  ? 24   VAL E O   1 
ATOM   8304  C CB  . VAL E 1 26  ? 46.458  24.120  -10.277 1.00 78.67  ? 24   VAL E CB  1 
ATOM   8305  C CG1 . VAL E 1 26  ? 47.416  25.164  -9.734  1.00 78.99  ? 24   VAL E CG1 1 
ATOM   8306  C CG2 . VAL E 1 26  ? 45.198  24.760  -10.828 1.00 77.49  ? 24   VAL E CG2 1 
ATOM   8307  N N   . LEU E 1 27  ? 47.278  21.115  -10.343 1.00 78.84  ? 25   LEU E N   1 
ATOM   8308  C CA  . LEU E 1 27  ? 47.887  19.963  -9.691  1.00 78.83  ? 25   LEU E CA  1 
ATOM   8309  C C   . LEU E 1 27  ? 47.004  18.743  -9.912  1.00 78.89  ? 25   LEU E C   1 
ATOM   8310  O O   . LEU E 1 27  ? 45.780  18.855  -10.006 1.00 79.91  ? 25   LEU E O   1 
ATOM   8311  C CB  . LEU E 1 27  ? 48.038  20.208  -8.190  1.00 77.36  ? 25   LEU E CB  1 
ATOM   8312  C CG  . LEU E 1 27  ? 46.739  20.239  -7.382  1.00 77.79  ? 25   LEU E CG  1 
ATOM   8313  C CD1 . LEU E 1 27  ? 47.062  20.283  -5.896  1.00 78.75  ? 25   LEU E CD1 1 
ATOM   8314  C CD2 . LEU E 1 27  ? 45.901  21.440  -7.794  1.00 77.29  ? 25   LEU E CD2 1 
ATOM   8315  N N   . ALA E 1 28  ? 47.635  17.579  -9.988  1.00 68.71  ? 26   ALA E N   1 
ATOM   8316  C CA  . ALA E 1 28  ? 46.917  16.335  -10.205 1.00 69.17  ? 26   ALA E CA  1 
ATOM   8317  C C   . ALA E 1 28  ? 45.940  16.070  -9.076  1.00 68.78  ? 26   ALA E C   1 
ATOM   8318  O O   . ALA E 1 28  ? 46.085  16.605  -7.978  1.00 67.38  ? 26   ALA E O   1 
ATOM   8319  C CB  . ALA E 1 28  ? 47.899  15.185  -10.316 1.00 126.17 ? 26   ALA E CB  1 
ATOM   8320  N N   . ALA E 1 29  ? 44.943  15.239  -9.359  1.00 63.22  ? 27   ALA E N   1 
ATOM   8321  C CA  . ALA E 1 29  ? 43.941  14.885  -8.364  1.00 66.19  ? 27   ALA E CA  1 
ATOM   8322  C C   . ALA E 1 29  ? 44.598  13.978  -7.344  1.00 67.77  ? 27   ALA E C   1 
ATOM   8323  O O   . ALA E 1 29  ? 44.318  14.057  -6.151  1.00 68.16  ? 27   ALA E O   1 
ATOM   8324  C CB  . ALA E 1 29  ? 42.774  14.163  -9.023  1.00 108.59 ? 27   ALA E CB  1 
ATOM   8325  N N   . HIS E 1 30  ? 45.488  13.119  -7.826  1.00 98.85  ? 28   HIS E N   1 
ATOM   8326  C CA  . HIS E 1 30  ? 46.181  12.191  -6.954  1.00 100.47 ? 28   HIS E CA  1 
ATOM   8327  C C   . HIS E 1 30  ? 47.051  12.934  -5.950  1.00 99.34  ? 28   HIS E C   1 
ATOM   8328  O O   . HIS E 1 30  ? 47.750  12.315  -5.157  1.00 100.21 ? 28   HIS E O   1 
ATOM   8329  C CB  . HIS E 1 30  ? 47.034  11.218  -7.783  1.00 109.37 ? 28   HIS E CB  1 
ATOM   8330  C CG  . HIS E 1 30  ? 48.356  11.772  -8.226  1.00 113.76 ? 28   HIS E CG  1 
ATOM   8331  N ND1 . HIS E 1 30  ? 49.221  11.061  -9.030  1.00 115.69 ? 28   HIS E ND1 1 
ATOM   8332  C CD2 . HIS E 1 30  ? 48.980  12.943  -7.951  1.00 115.97 ? 28   HIS E CD2 1 
ATOM   8333  C CE1 . HIS E 1 30  ? 50.320  11.767  -9.229  1.00 117.29 ? 28   HIS E CE1 1 
ATOM   8334  N NE2 . HIS E 1 30  ? 50.199  12.913  -8.583  1.00 118.75 ? 28   HIS E NE2 1 
ATOM   8335  N N   . LYS E 1 31  ? 47.020  14.262  -5.990  1.00 62.84  ? 29   LYS E N   1 
ATOM   8336  C CA  . LYS E 1 31  ? 47.826  15.045  -5.067  1.00 60.65  ? 29   LYS E CA  1 
ATOM   8337  C C   . LYS E 1 31  ? 46.954  15.897  -4.154  1.00 58.34  ? 29   LYS E C   1 
ATOM   8338  O O   . LYS E 1 31  ? 47.322  17.017  -3.789  1.00 57.80  ? 29   LYS E O   1 
ATOM   8339  C CB  . LYS E 1 31  ? 48.782  15.942  -5.839  1.00 118.49 ? 29   LYS E CB  1 
ATOM   8340  C CG  . LYS E 1 31  ? 49.939  16.435  -4.996  1.00 124.43 ? 29   LYS E CG  1 
ATOM   8341  C CD  . LYS E 1 31  ? 50.686  17.556  -5.682  1.00 129.40 ? 29   LYS E CD  1 
ATOM   8342  C CE  . LYS E 1 31  ? 51.159  17.153  -7.067  1.00 132.05 ? 29   LYS E CE  1 
ATOM   8343  N NZ  . LYS E 1 31  ? 51.832  18.287  -7.764  1.00 133.74 ? 29   LYS E NZ  1 
ATOM   8344  N N   . ILE E 1 32  ? 45.805  15.351  -3.771  1.00 57.63  ? 30   ILE E N   1 
ATOM   8345  C CA  . ILE E 1 32  ? 44.863  16.065  -2.921  1.00 56.01  ? 30   ILE E CA  1 
ATOM   8346  C C   . ILE E 1 32  ? 44.262  15.148  -1.867  1.00 56.19  ? 30   ILE E C   1 
ATOM   8347  O O   . ILE E 1 32  ? 43.881  14.023  -2.169  1.00 55.25  ? 30   ILE E O   1 
ATOM   8348  C CB  . ILE E 1 32  ? 43.705  16.614  -3.761  1.00 66.98  ? 30   ILE E CB  1 
ATOM   8349  C CG1 . ILE E 1 32  ? 44.254  17.356  -4.978  1.00 66.52  ? 30   ILE E CG1 1 
ATOM   8350  C CG2 . ILE E 1 32  ? 42.831  17.514  -2.911  1.00 64.24  ? 30   ILE E CG2 1 
ATOM   8351  C CD1 . ILE E 1 32  ? 43.203  17.688  -6.004  1.00 66.76  ? 30   ILE E CD1 1 
ATOM   8352  N N   . MET E 1 33  ? 44.166  15.625  -0.633  1.00 68.73  ? 31   MET E N   1 
ATOM   8353  C CA  . MET E 1 33  ? 43.573  14.817  0.428   1.00 72.22  ? 31   MET E CA  1 
ATOM   8354  C C   . MET E 1 33  ? 42.403  15.544  1.046   1.00 72.98  ? 31   MET E C   1 
ATOM   8355  O O   . MET E 1 33  ? 42.375  16.774  1.083   1.00 73.85  ? 31   MET E O   1 
ATOM   8356  C CB  . MET E 1 33  ? 44.577  14.504  1.534   1.00 101.50 ? 31   MET E CB  1 
ATOM   8357  C CG  . MET E 1 33  ? 45.590  13.441  1.190   1.00 108.00 ? 31   MET E CG  1 
ATOM   8358  S SD  . MET E 1 33  ? 46.054  12.486  2.646   1.00 113.63 ? 31   MET E SD  1 
ATOM   8359  C CE  . MET E 1 33  ? 45.507  10.852  2.125   1.00 113.32 ? 31   MET E CE  1 
ATOM   8360  N N   . ALA E 1 34  ? 41.446  14.773  1.545   1.00 59.54  ? 32   ALA E N   1 
ATOM   8361  C CA  . ALA E 1 34  ? 40.265  15.335  2.173   1.00 61.61  ? 32   ALA E CA  1 
ATOM   8362  C C   . ALA E 1 34  ? 39.902  14.511  3.391   1.00 63.86  ? 32   ALA E C   1 
ATOM   8363  O O   . ALA E 1 34  ? 39.698  13.303  3.286   1.00 65.22  ? 32   ALA E O   1 
ATOM   8364  C CB  . ALA E 1 34  ? 39.110  15.340  1.191   1.00 64.55  ? 32   ALA E CB  1 
ATOM   8365  N N   . SER E 1 35  ? 39.829  15.157  4.550   1.00 65.50  ? 33   SER E N   1 
ATOM   8366  C CA  . SER E 1 35  ? 39.471  14.450  5.768   1.00 68.28  ? 33   SER E CA  1 
ATOM   8367  C C   . SER E 1 35  ? 38.089  13.855  5.546   1.00 70.25  ? 33   SER E C   1 
ATOM   8368  O O   . SER E 1 35  ? 37.144  14.567  5.211   1.00 69.34  ? 33   SER E O   1 
ATOM   8369  C CB  . SER E 1 35  ? 39.454  15.409  6.956   1.00 103.74 ? 33   SER E CB  1 
ATOM   8370  O OG  . SER E 1 35  ? 40.727  16.006  7.136   1.00 103.41 ? 33   SER E OG  1 
ATOM   8371  N N   . SER E 1 36  ? 37.989  12.543  5.715   1.00 122.07 ? 34   SER E N   1 
ATOM   8372  C CA  . SER E 1 36  ? 36.739  11.823  5.522   1.00 125.14 ? 34   SER E CA  1 
ATOM   8373  C C   . SER E 1 36  ? 36.011  11.613  6.845   1.00 126.42 ? 34   SER E C   1 
ATOM   8374  O O   . SER E 1 36  ? 35.913  10.486  7.333   1.00 127.09 ? 34   SER E O   1 
ATOM   8375  C CB  . SER E 1 36  ? 37.027  10.466  4.857   1.00 115.44 ? 34   SER E CB  1 
ATOM   8376  O OG  . SER E 1 36  ? 35.867  9.653   4.786   1.00 116.66 ? 34   SER E OG  1 
ATOM   8377  N N   . PRO E 1 37  ? 35.488  12.695  7.448   1.00 103.94 ? 35   PRO E N   1 
ATOM   8378  C CA  . PRO E 1 37  ? 34.794  12.471  8.715   1.00 105.67 ? 35   PRO E CA  1 
ATOM   8379  C C   . PRO E 1 37  ? 33.559  11.600  8.507   1.00 108.56 ? 35   PRO E C   1 
ATOM   8380  O O   . PRO E 1 37  ? 32.969  11.117  9.470   1.00 108.58 ? 35   PRO E O   1 
ATOM   8381  C CB  . PRO E 1 37  ? 34.453  13.888  9.175   1.00 94.19  ? 35   PRO E CB  1 
ATOM   8382  C CG  . PRO E 1 37  ? 34.211  14.597  7.885   1.00 93.14  ? 35   PRO E CG  1 
ATOM   8383  C CD  . PRO E 1 37  ? 35.341  14.096  7.012   1.00 91.87  ? 35   PRO E CD  1 
ATOM   8384  N N   . ASP E 1 38  ? 33.168  11.393  7.250   1.00 103.11 ? 36   ASP E N   1 
ATOM   8385  C CA  . ASP E 1 38  ? 32.002  10.563  6.972   1.00 106.06 ? 36   ASP E CA  1 
ATOM   8386  C C   . ASP E 1 38  ? 32.126  9.677   5.732   1.00 107.27 ? 36   ASP E C   1 
ATOM   8387  O O   . ASP E 1 38  ? 33.139  9.000   5.547   1.00 106.92 ? 36   ASP E O   1 
ATOM   8388  C CB  . ASP E 1 38  ? 30.747  11.426  6.863   1.00 139.35 ? 36   ASP E CB  1 
ATOM   8389  C CG  . ASP E 1 38  ? 29.485  10.643  7.170   1.00 141.22 ? 36   ASP E CG  1 
ATOM   8390  O OD1 . ASP E 1 38  ? 29.205  9.655   6.461   1.00 140.02 ? 36   ASP E OD1 1 
ATOM   8391  O OD2 . ASP E 1 38  ? 28.776  11.009  8.131   1.00 143.75 ? 36   ASP E OD2 1 
ATOM   8392  N N   . MET E 1 39  ? 31.090  9.677   4.891   1.00 160.55 ? 37   MET E N   1 
ATOM   8393  C CA  . MET E 1 39  ? 31.085  8.843   3.690   1.00 162.77 ? 37   MET E CA  1 
ATOM   8394  C C   . MET E 1 39  ? 29.825  8.980   2.831   1.00 162.35 ? 37   MET E C   1 
ATOM   8395  O O   . MET E 1 39  ? 28.802  8.355   3.121   1.00 162.08 ? 37   MET E O   1 
ATOM   8396  C CB  . MET E 1 39  ? 31.233  7.377   4.090   1.00 152.65 ? 37   MET E CB  1 
ATOM   8397  C CG  . MET E 1 39  ? 31.574  6.484   2.931   1.00 155.50 ? 37   MET E CG  1 
ATOM   8398  S SD  . MET E 1 39  ? 33.066  7.126   2.179   1.00 158.37 ? 37   MET E SD  1 
ATOM   8399  C CE  . MET E 1 39  ? 34.170  7.127   3.593   1.00 156.95 ? 37   MET E CE  1 
ATOM   8400  N N   . ASP E 1 40  ? 29.896  9.761   1.758   1.00 97.52  ? 38   ASP E N   1 
ATOM   8401  C CA  . ASP E 1 40  ? 28.725  9.927   0.911   1.00 97.23  ? 38   ASP E CA  1 
ATOM   8402  C C   . ASP E 1 40  ? 28.955  10.144  -0.564  1.00 96.74  ? 38   ASP E C   1 
ATOM   8403  O O   . ASP E 1 40  ? 29.998  10.627  -1.003  1.00 95.47  ? 38   ASP E O   1 
ATOM   8404  C CB  . ASP E 1 40  ? 27.870  11.090  1.396   1.00 137.39 ? 38   ASP E CB  1 
ATOM   8405  C CG  . ASP E 1 40  ? 27.308  10.860  2.761   1.00 140.47 ? 38   ASP E CG  1 
ATOM   8406  O OD1 . ASP E 1 40  ? 26.608  9.842   2.943   1.00 141.91 ? 38   ASP E OD1 1 
ATOM   8407  O OD2 . ASP E 1 40  ? 27.567  11.699  3.648   1.00 142.14 ? 38   ASP E OD2 1 
ATOM   8408  N N   . LEU E 1 41  ? 27.928  9.784   -1.321  1.00 144.30 ? 39   LEU E N   1 
ATOM   8409  C CA  . LEU E 1 41  ? 27.910  9.969   -2.756  1.00 144.31 ? 39   LEU E CA  1 
ATOM   8410  C C   . LEU E 1 41  ? 27.670  11.470  -2.870  1.00 144.12 ? 39   LEU E C   1 
ATOM   8411  O O   . LEU E 1 41  ? 27.818  12.070  -3.933  1.00 143.82 ? 39   LEU E O   1 
ATOM   8412  C CB  . LEU E 1 41  ? 26.746  9.178   -3.370  1.00 115.78 ? 39   LEU E CB  1 
ATOM   8413  C CG  . LEU E 1 41  ? 25.342  9.345   -2.758  1.00 114.92 ? 39   LEU E CG  1 
ATOM   8414  C CD1 . LEU E 1 41  ? 24.336  8.633   -3.644  1.00 113.37 ? 39   LEU E CD1 1 
ATOM   8415  C CD2 . LEU E 1 41  ? 25.282  8.785   -1.333  1.00 113.22 ? 39   LEU E CD2 1 
ATOM   8416  N N   . ALA E 1 42  ? 27.305  12.059  -1.734  1.00 158.14 ? 40   ALA E N   1 
ATOM   8417  C CA  . ALA E 1 42  ? 27.036  13.482  -1.631  1.00 156.96 ? 40   ALA E CA  1 
ATOM   8418  C C   . ALA E 1 42  ? 28.326  14.248  -1.862  1.00 156.25 ? 40   ALA E C   1 
ATOM   8419  O O   . ALA E 1 42  ? 28.301  15.422  -2.229  1.00 157.80 ? 40   ALA E O   1 
ATOM   8420  C CB  . ALA E 1 42  ? 26.474  13.804  -0.249  1.00 62.88  ? 40   ALA E CB  1 
ATOM   8421  N N   . THR E 1 43  ? 29.453  13.572  -1.652  1.00 116.49 ? 41   THR E N   1 
ATOM   8422  C CA  . THR E 1 43  ? 30.760  14.195  -1.828  1.00 113.86 ? 41   THR E CA  1 
ATOM   8423  C C   . THR E 1 43  ? 31.869  13.163  -2.013  1.00 111.97 ? 41   THR E C   1 
ATOM   8424  O O   . THR E 1 43  ? 32.407  12.984  -3.108  1.00 112.00 ? 41   THR E O   1 
ATOM   8425  C CB  . THR E 1 43  ? 31.135  15.050  -0.607  1.00 115.16 ? 41   THR E CB  1 
ATOM   8426  O OG1 . THR E 1 43  ? 30.088  15.986  -0.328  1.00 114.95 ? 41   THR E OG1 1 
ATOM   8427  C CG2 . THR E 1 43  ? 32.426  15.798  -0.874  1.00 115.89 ? 41   THR E CG2 1 
ATOM   8428  N N   . VAL E 1 44  ? 32.207  12.505  -0.912  1.00 86.71  ? 42   VAL E N   1 
ATOM   8429  C CA  . VAL E 1 44  ? 33.245  11.484  -0.865  1.00 84.39  ? 42   VAL E CA  1 
ATOM   8430  C C   . VAL E 1 44  ? 33.461  10.728  -2.179  1.00 83.19  ? 42   VAL E C   1 
ATOM   8431  O O   . VAL E 1 44  ? 34.481  10.900  -2.850  1.00 81.23  ? 42   VAL E O   1 
ATOM   8432  C CB  . VAL E 1 44  ? 32.925  10.458  0.236   1.00 122.79 ? 42   VAL E CB  1 
ATOM   8433  C CG1 . VAL E 1 44  ? 34.124  9.563   0.477   1.00 123.39 ? 42   VAL E CG1 1 
ATOM   8434  C CG2 . VAL E 1 44  ? 32.521  11.175  1.509   1.00 121.86 ? 42   VAL E CG2 1 
ATOM   8435  N N   . SER E 1 45  ? 32.499  9.881   -2.527  1.00 111.68 ? 43   SER E N   1 
ATOM   8436  C CA  . SER E 1 45  ? 32.571  9.082   -3.743  1.00 111.95 ? 43   SER E CA  1 
ATOM   8437  C C   . SER E 1 45  ? 33.142  9.867   -4.922  1.00 111.49 ? 43   SER E C   1 
ATOM   8438  O O   . SER E 1 45  ? 34.084  9.414   -5.575  1.00 111.30 ? 43   SER E O   1 
ATOM   8439  C CB  . SER E 1 45  ? 31.182  8.552   -4.085  1.00 95.42  ? 43   SER E CB  1 
ATOM   8440  O OG  . SER E 1 45  ? 30.678  7.769   -3.017  1.00 97.23  ? 43   SER E OG  1 
ATOM   8441  N N   . ALA E 1 46  ? 32.570  11.040  -5.188  1.00 94.06  ? 44   ALA E N   1 
ATOM   8442  C CA  . ALA E 1 46  ? 33.025  11.898  -6.282  1.00 92.31  ? 44   ALA E CA  1 
ATOM   8443  C C   . ALA E 1 46  ? 34.511  12.160  -6.112  1.00 91.71  ? 44   ALA E C   1 
ATOM   8444  O O   . ALA E 1 46  ? 35.310  11.961  -7.029  1.00 90.83  ? 44   ALA E O   1 
ATOM   8445  C CB  . ALA E 1 46  ? 32.267  13.216  -6.260  1.00 63.95  ? 44   ALA E CB  1 
ATOM   8446  N N   . LEU E 1 47  ? 34.864  12.613  -4.916  1.00 100.40 ? 45   LEU E N   1 
ATOM   8447  C CA  . LEU E 1 47  ? 36.242  12.904  -4.578  1.00 99.70  ? 45   LEU E CA  1 
ATOM   8448  C C   . LEU E 1 47  ? 37.124  11.700  -4.848  1.00 100.30 ? 45   LEU E C   1 
ATOM   8449  O O   . LEU E 1 47  ? 38.339  11.793  -4.740  1.00 101.08 ? 45   LEU E O   1 
ATOM   8450  C CB  . LEU E 1 47  ? 36.341  13.302  -3.111  1.00 90.04  ? 45   LEU E CB  1 
ATOM   8451  C CG  . LEU E 1 47  ? 35.527  14.541  -2.747  1.00 88.92  ? 45   LEU E CG  1 
ATOM   8452  C CD1 . LEU E 1 47  ? 35.609  14.796  -1.249  1.00 88.52  ? 45   LEU E CD1 1 
ATOM   8453  C CD2 . LEU E 1 47  ? 36.055  15.728  -3.537  1.00 88.18  ? 45   LEU E CD2 1 
ATOM   8454  N N   . ARG E 1 48  ? 36.508  10.567  -5.175  1.00 73.17  ? 46   ARG E N   1 
ATOM   8455  C CA  . ARG E 1 48  ? 37.260  9.356   -5.491  1.00 74.23  ? 46   ARG E CA  1 
ATOM   8456  C C   . ARG E 1 48  ? 37.368  9.239   -6.992  1.00 74.02  ? 46   ARG E C   1 
ATOM   8457  O O   . ARG E 1 48  ? 38.441  9.413   -7.564  1.00 73.16  ? 46   ARG E O   1 
ATOM   8458  C CB  . ARG E 1 48  ? 36.564  8.104   -4.975  1.00 123.63 ? 46   ARG E CB  1 
ATOM   8459  C CG  . ARG E 1 48  ? 36.699  7.869   -3.508  1.00 125.44 ? 46   ARG E CG  1 
ATOM   8460  C CD  . ARG E 1 48  ? 36.436  6.414   -3.209  1.00 127.51 ? 46   ARG E CD  1 
ATOM   8461  N NE  . ARG E 1 48  ? 36.263  6.196   -1.780  1.00 130.84 ? 46   ARG E NE  1 
ATOM   8462  C CZ  . ARG E 1 48  ? 35.257  6.697   -1.072  1.00 132.87 ? 46   ARG E CZ  1 
ATOM   8463  N NH1 . ARG E 1 48  ? 34.330  7.443   -1.666  1.00 134.21 ? 46   ARG E NH1 1 
ATOM   8464  N NH2 . ARG E 1 48  ? 35.178  6.457   0.231   1.00 132.84 ? 46   ARG E NH2 1 
ATOM   8465  N N   . LYS E 1 49  ? 36.241  8.919   -7.619  1.00 91.59  ? 47   LYS E N   1 
ATOM   8466  C CA  . LYS E 1 49  ? 36.177  8.781   -9.065  1.00 93.59  ? 47   LYS E CA  1 
ATOM   8467  C C   . LYS E 1 49  ? 37.121  9.825   -9.645  1.00 93.84  ? 47   LYS E C   1 
ATOM   8468  O O   . LYS E 1 49  ? 38.019  9.534   -10.434 1.00 92.94  ? 47   LYS E O   1 
ATOM   8469  C CB  . LYS E 1 49  ? 34.753  9.065   -9.546  1.00 163.06 ? 47   LYS E CB  1 
ATOM   8470  C CG  . LYS E 1 49  ? 33.681  8.182   -8.925  1.00 165.67 ? 47   LYS E CG  1 
ATOM   8471  C CD  . LYS E 1 49  ? 33.678  6.790   -9.539  1.00 168.62 ? 47   LYS E CD  1 
ATOM   8472  C CE  . LYS E 1 49  ? 32.557  5.933   -8.967  1.00 169.73 ? 47   LYS E CE  1 
ATOM   8473  N NZ  . LYS E 1 49  ? 32.479  4.599   -9.627  1.00 168.90 ? 47   LYS E NZ  1 
ATOM   8474  N N   . MET E 1 50  ? 36.905  11.048  -9.197  1.00 101.32 ? 48   MET E N   1 
ATOM   8475  C CA  . MET E 1 50  ? 37.667  12.203  -9.619  1.00 103.21 ? 48   MET E CA  1 
ATOM   8476  C C   . MET E 1 50  ? 39.080  12.235  -9.016  1.00 103.72 ? 48   MET E C   1 
ATOM   8477  O O   . MET E 1 50  ? 39.639  13.301  -8.780  1.00 105.03 ? 48   MET E O   1 
ATOM   8478  C CB  . MET E 1 50  ? 36.842  13.429  -9.228  1.00 109.25 ? 48   MET E CB  1 
ATOM   8479  C CG  . MET E 1 50  ? 37.515  14.768  -9.255  1.00 109.97 ? 48   MET E CG  1 
ATOM   8480  S SD  . MET E 1 50  ? 37.312  15.494  -7.623  1.00 112.79 ? 48   MET E SD  1 
ATOM   8481  C CE  . MET E 1 50  ? 35.680  14.879  -7.143  1.00 111.26 ? 48   MET E CE  1 
ATOM   8482  N N   . GLY E 1 51  ? 39.671  11.065  -8.793  1.00 102.58 ? 49   GLY E N   1 
ATOM   8483  C CA  . GLY E 1 51  ? 41.002  11.025  -8.206  1.00 101.26 ? 49   GLY E CA  1 
ATOM   8484  C C   . GLY E 1 51  ? 40.924  11.450  -6.749  1.00 100.56 ? 49   GLY E C   1 
ATOM   8485  O O   . GLY E 1 51  ? 40.027  11.008  -6.039  1.00 100.62 ? 49   GLY E O   1 
ATOM   8486  N N   . VAL E 1 52  ? 41.851  12.295  -6.302  1.00 97.85  ? 50   VAL E N   1 
ATOM   8487  C CA  . VAL E 1 52  ? 41.861  12.792  -4.919  1.00 97.32  ? 50   VAL E CA  1 
ATOM   8488  C C   . VAL E 1 52  ? 41.859  11.727  -3.818  1.00 97.99  ? 50   VAL E C   1 
ATOM   8489  O O   . VAL E 1 52  ? 41.042  10.806  -3.829  1.00 99.58  ? 50   VAL E O   1 
ATOM   8490  C CB  . VAL E 1 52  ? 40.666  13.745  -4.664  1.00 83.91  ? 50   VAL E CB  1 
ATOM   8491  C CG1 . VAL E 1 52  ? 40.470  13.959  -3.170  1.00 82.99  ? 50   VAL E CG1 1 
ATOM   8492  C CG2 . VAL E 1 52  ? 40.918  15.077  -5.342  1.00 83.12  ? 50   VAL E CG2 1 
ATOM   8493  N N   . LYS E 1 53  ? 42.766  11.886  -2.854  1.00 80.70  ? 51   LYS E N   1 
ATOM   8494  C CA  . LYS E 1 53  ? 42.902  10.958  -1.728  1.00 79.49  ? 51   LYS E CA  1 
ATOM   8495  C C   . LYS E 1 53  ? 41.949  11.318  -0.586  1.00 77.73  ? 51   LYS E C   1 
ATOM   8496  O O   . LYS E 1 53  ? 41.688  12.498  -0.336  1.00 76.16  ? 51   LYS E O   1 
ATOM   8497  C CB  . LYS E 1 53  ? 44.343  10.967  -1.201  1.00 142.62 ? 51   LYS E CB  1 
ATOM   8498  C CG  . LYS E 1 53  ? 45.417  10.600  -2.222  1.00 143.92 ? 51   LYS E CG  1 
ATOM   8499  C CD  . LYS E 1 53  ? 46.800  10.605  -1.570  1.00 146.36 ? 51   LYS E CD  1 
ATOM   8500  C CE  . LYS E 1 53  ? 47.921  10.326  -2.568  1.00 148.00 ? 51   LYS E CE  1 
ATOM   8501  N NZ  . LYS E 1 53  ? 49.273  10.326  -1.922  1.00 147.38 ? 51   LYS E NZ  1 
ATOM   8502  N N   . LEU E 1 54  ? 41.451  10.296  0.111   1.00 88.21  ? 52   LEU E N   1 
ATOM   8503  C CA  . LEU E 1 54  ? 40.520  10.494  1.220   1.00 88.47  ? 52   LEU E CA  1 
ATOM   8504  C C   . LEU E 1 54  ? 40.978  9.849   2.521   1.00 88.22  ? 52   LEU E C   1 
ATOM   8505  O O   . LEU E 1 54  ? 41.218  8.641   2.584   1.00 87.98  ? 52   LEU E O   1 
ATOM   8506  C CB  . LEU E 1 54  ? 39.146  9.948   0.845   1.00 84.58  ? 52   LEU E CB  1 
ATOM   8507  C CG  . LEU E 1 54  ? 38.632  10.527  -0.469  1.00 85.19  ? 52   LEU E CG  1 
ATOM   8508  C CD1 . LEU E 1 54  ? 37.310  9.889   -0.826  1.00 86.54  ? 52   LEU E CD1 1 
ATOM   8509  C CD2 . LEU E 1 54  ? 38.494  12.037  -0.337  1.00 86.43  ? 52   LEU E CD2 1 
ATOM   8510  N N   . THR E 1 55  ? 41.082  10.667  3.563   1.00 98.31  ? 53   THR E N   1 
ATOM   8511  C CA  . THR E 1 55  ? 41.517  10.199  4.869   1.00 98.12  ? 53   THR E CA  1 
ATOM   8512  C C   . THR E 1 55  ? 40.465  10.468  5.914   1.00 98.27  ? 53   THR E C   1 
ATOM   8513  O O   . THR E 1 55  ? 40.214  11.620  6.265   1.00 99.65  ? 53   THR E O   1 
ATOM   8514  C CB  . THR E 1 55  ? 42.767  10.930  5.360   1.00 82.09  ? 53   THR E CB  1 
ATOM   8515  O OG1 . THR E 1 55  ? 43.761  10.936  4.333   1.00 82.79  ? 53   THR E OG1 1 
ATOM   8516  C CG2 . THR E 1 55  ? 43.315  10.246  6.602   1.00 81.85  ? 53   THR E CG2 1 
ATOM   8517  N N   . PRO E 1 56  ? 39.838  9.415   6.441   1.00 66.02  ? 54   PRO E N   1 
ATOM   8518  C CA  . PRO E 1 56  ? 38.823  9.672   7.467   1.00 65.86  ? 54   PRO E CA  1 
ATOM   8519  C C   . PRO E 1 56  ? 39.487  10.407  8.645   1.00 65.88  ? 54   PRO E C   1 
ATOM   8520  O O   . PRO E 1 56  ? 38.831  10.827  9.603   1.00 63.14  ? 54   PRO E O   1 
ATOM   8521  C CB  . PRO E 1 56  ? 38.335  8.266   7.824   1.00 69.63  ? 54   PRO E CB  1 
ATOM   8522  C CG  . PRO E 1 56  ? 39.538  7.392   7.516   1.00 68.74  ? 54   PRO E CG  1 
ATOM   8523  C CD  . PRO E 1 56  ? 40.039  7.973   6.223   1.00 68.91  ? 54   PRO E CD  1 
ATOM   8524  N N   . HIS E 1 57  ? 40.801  10.578  8.530   1.00 82.18  ? 55   HIS E N   1 
ATOM   8525  C CA  . HIS E 1 57  ? 41.605  11.230  9.550   1.00 84.52  ? 55   HIS E CA  1 
ATOM   8526  C C   . HIS E 1 57  ? 42.160  12.571  9.121   1.00 84.63  ? 55   HIS E C   1 
ATOM   8527  O O   . HIS E 1 57  ? 43.020  12.651  8.243   1.00 84.27  ? 55   HIS E O   1 
ATOM   8528  C CB  . HIS E 1 57  ? 42.748  10.306  9.946   1.00 137.24 ? 55   HIS E CB  1 
ATOM   8529  C CG  . HIS E 1 57  ? 42.279  8.980   10.441  1.00 140.87 ? 55   HIS E CG  1 
ATOM   8530  N ND1 . HIS E 1 57  ? 41.367  8.858   11.466  1.00 143.45 ? 55   HIS E ND1 1 
ATOM   8531  C CD2 . HIS E 1 57  ? 42.549  7.722   10.023  1.00 141.89 ? 55   HIS E CD2 1 
ATOM   8532  C CE1 . HIS E 1 57  ? 41.093  7.580   11.657  1.00 144.11 ? 55   HIS E CE1 1 
ATOM   8533  N NE2 . HIS E 1 57  ? 41.796  6.870   10.793  1.00 143.56 ? 55   HIS E NE2 1 
ATOM   8534  N N   . ASN E 1 58  ? 41.666  13.621  9.766   1.00 133.98 ? 56   ASN E N   1 
ATOM   8535  C CA  . ASN E 1 58  ? 42.086  14.985  9.482   1.00 135.47 ? 56   ASN E CA  1 
ATOM   8536  C C   . ASN E 1 58  ? 43.603  15.120  9.623   1.00 135.09 ? 56   ASN E C   1 
ATOM   8537  O O   . ASN E 1 58  ? 44.213  16.035  9.069   1.00 136.18 ? 56   ASN E O   1 
ATOM   8538  C CB  . ASN E 1 58  ? 41.379  15.944  10.444  1.00 119.60 ? 56   ASN E CB  1 
ATOM   8539  C CG  . ASN E 1 58  ? 39.931  15.547  10.704  1.00 120.60 ? 56   ASN E CG  1 
ATOM   8540  O OD1 . ASN E 1 58  ? 39.122  15.453  9.782   1.00 120.10 ? 56   ASN E OD1 1 
ATOM   8541  N ND2 . ASN E 1 58  ? 39.602  15.308  11.968  1.00 121.46 ? 56   ASN E ND2 1 
ATOM   8542  N N   . LYS E 1 59  ? 44.205  14.196  10.362  1.00 85.96  ? 57   LYS E N   1 
ATOM   8543  C CA  . LYS E 1 59  ? 45.647  14.194  10.587  1.00 83.99  ? 57   LYS E CA  1 
ATOM   8544  C C   . LYS E 1 59  ? 46.441  13.968  9.300   1.00 81.21  ? 57   LYS E C   1 
ATOM   8545  O O   . LYS E 1 59  ? 47.117  14.878  8.806   1.00 79.85  ? 57   LYS E O   1 
ATOM   8546  C CB  . LYS E 1 59  ? 46.015  13.120  11.622  1.00 153.78 ? 57   LYS E CB  1 
ATOM   8547  C CG  . LYS E 1 59  ? 44.984  11.997  11.804  1.00 156.57 ? 57   LYS E CG  1 
ATOM   8548  C CD  . LYS E 1 59  ? 43.731  12.496  12.529  1.00 157.89 ? 57   LYS E CD  1 
ATOM   8549  C CE  . LYS E 1 59  ? 42.782  11.363  12.895  1.00 157.18 ? 57   LYS E CE  1 
ATOM   8550  N NZ  . LYS E 1 59  ? 41.526  11.862  13.525  1.00 156.78 ? 57   LYS E NZ  1 
ATOM   8551  N N   . GLU E 1 60  ? 46.358  12.750  8.769   1.00 76.56  ? 58   GLU E N   1 
ATOM   8552  C CA  . GLU E 1 60  ? 47.055  12.377  7.541   1.00 74.90  ? 58   GLU E CA  1 
ATOM   8553  C C   . GLU E 1 60  ? 46.968  13.505  6.533   1.00 71.65  ? 58   GLU E C   1 
ATOM   8554  O O   . GLU E 1 60  ? 47.967  13.887  5.917   1.00 69.60  ? 58   GLU E O   1 
ATOM   8555  C CB  . GLU E 1 60  ? 46.423  11.125  6.943   1.00 130.62 ? 58   GLU E CB  1 
ATOM   8556  C CG  . GLU E 1 60  ? 47.325  9.915   6.926   1.00 136.49 ? 58   GLU E CG  1 
ATOM   8557  C CD  . GLU E 1 60  ? 46.672  8.732   6.247   1.00 140.42 ? 58   GLU E CD  1 
ATOM   8558  O OE1 . GLU E 1 60  ? 45.617  8.275   6.738   1.00 142.57 ? 58   GLU E OE1 1 
ATOM   8559  O OE2 . GLU E 1 60  ? 47.209  8.262   5.222   1.00 142.35 ? 58   GLU E OE2 1 
ATOM   8560  N N   . THR E 1 61  ? 45.751  14.019  6.372   1.00 80.53  ? 59   THR E N   1 
ATOM   8561  C CA  . THR E 1 61  ? 45.470  15.116  5.460   1.00 77.21  ? 59   THR E CA  1 
ATOM   8562  C C   . THR E 1 61  ? 46.522  16.186  5.672   1.00 75.10  ? 59   THR E C   1 
ATOM   8563  O O   . THR E 1 61  ? 47.320  16.475  4.783   1.00 75.18  ? 59   THR E O   1 
ATOM   8564  C CB  . THR E 1 61  ? 44.076  15.730  5.739   1.00 80.24  ? 59   THR E CB  1 
ATOM   8565  O OG1 . THR E 1 61  ? 43.055  14.774  5.422   1.00 78.11  ? 59   THR E OG1 1 
ATOM   8566  C CG2 . THR E 1 61  ? 43.867  16.988  4.912   1.00 80.19  ? 59   THR E CG2 1 
ATOM   8567  N N   . VAL E 1 62  ? 46.522  16.757  6.870   1.00 64.57  ? 60   VAL E N   1 
ATOM   8568  C CA  . VAL E 1 62  ? 47.464  17.803  7.225   1.00 62.28  ? 60   VAL E CA  1 
ATOM   8569  C C   . VAL E 1 62  ? 48.889  17.482  6.832   1.00 63.83  ? 60   VAL E C   1 
ATOM   8570  O O   . VAL E 1 62  ? 49.473  18.170  5.998   1.00 64.89  ? 60   VAL E O   1 
ATOM   8571  C CB  . VAL E 1 62  ? 47.456  18.068  8.721   1.00 51.44  ? 60   VAL E CB  1 
ATOM   8572  C CG1 . VAL E 1 62  ? 48.480  19.139  9.059   1.00 48.86  ? 60   VAL E CG1 1 
ATOM   8573  C CG2 . VAL E 1 62  ? 46.073  18.492  9.154   1.00 50.08  ? 60   VAL E CG2 1 
ATOM   8574  N N   . GLN E 1 63  ? 49.454  16.454  7.455   1.00 63.13  ? 61   GLN E N   1 
ATOM   8575  C CA  . GLN E 1 63  ? 50.825  16.051  7.165   1.00 65.76  ? 61   GLN E CA  1 
ATOM   8576  C C   . GLN E 1 63  ? 51.048  16.163  5.674   1.00 65.32  ? 61   GLN E C   1 
ATOM   8577  O O   . GLN E 1 63  ? 51.883  16.934  5.196   1.00 65.84  ? 61   GLN E O   1 
ATOM   8578  C CB  . GLN E 1 63  ? 51.055  14.598  7.554   1.00 120.46 ? 61   GLN E CB  1 
ATOM   8579  C CG  . GLN E 1 63  ? 50.818  14.263  8.997   1.00 125.36 ? 61   GLN E CG  1 
ATOM   8580  C CD  . GLN E 1 63  ? 51.096  12.803  9.266   1.00 128.38 ? 61   GLN E CD  1 
ATOM   8581  O OE1 . GLN E 1 63  ? 52.212  12.327  9.059   1.00 131.51 ? 61   GLN E OE1 1 
ATOM   8582  N NE2 . GLN E 1 63  ? 50.081  12.079  9.718   1.00 130.84 ? 61   GLN E NE2 1 
ATOM   8583  N N   . HIS E 1 64  ? 50.274  15.367  4.953   1.00 75.74  ? 62   HIS E N   1 
ATOM   8584  C CA  . HIS E 1 64  ? 50.327  15.307  3.505   1.00 75.04  ? 62   HIS E CA  1 
ATOM   8585  C C   . HIS E 1 64  ? 50.163  16.649  2.793   1.00 71.23  ? 62   HIS E C   1 
ATOM   8586  O O   . HIS E 1 64  ? 50.680  16.845  1.690   1.00 69.55  ? 62   HIS E O   1 
ATOM   8587  C CB  . HIS E 1 64  ? 49.254  14.331  3.015   1.00 94.31  ? 62   HIS E CB  1 
ATOM   8588  C CG  . HIS E 1 64  ? 48.782  14.606  1.624   1.00 97.43  ? 62   HIS E CG  1 
ATOM   8589  N ND1 . HIS E 1 64  ? 48.045  15.724  1.298   1.00 98.29  ? 62   HIS E ND1 1 
ATOM   8590  C CD2 . HIS E 1 64  ? 48.976  13.932  0.466   1.00 98.24  ? 62   HIS E CD2 1 
ATOM   8591  C CE1 . HIS E 1 64  ? 47.805  15.728  -0.001  1.00 100.28 ? 62   HIS E CE1 1 
ATOM   8592  N NE2 . HIS E 1 64  ? 48.360  14.651  -0.529  1.00 100.11 ? 62   HIS E NE2 1 
ATOM   8593  N N   . SER E 1 65  ? 49.458  17.573  3.432   1.00 56.22  ? 63   SER E N   1 
ATOM   8594  C CA  . SER E 1 65  ? 49.177  18.868  2.829   1.00 54.04  ? 63   SER E CA  1 
ATOM   8595  C C   . SER E 1 65  ? 50.118  20.027  3.101   1.00 53.32  ? 63   SER E C   1 
ATOM   8596  O O   . SER E 1 65  ? 50.498  20.287  4.250   1.00 50.93  ? 63   SER E O   1 
ATOM   8597  C CB  . SER E 1 65  ? 47.775  19.324  3.231   1.00 64.38  ? 63   SER E CB  1 
ATOM   8598  O OG  . SER E 1 65  ? 47.775  19.788  4.572   1.00 64.80  ? 63   SER E OG  1 
ATOM   8599  N N   . ASP E 1 66  ? 50.472  20.728  2.025   1.00 71.49  ? 64   ASP E N   1 
ATOM   8600  C CA  . ASP E 1 66  ? 51.291  21.926  2.125   1.00 72.26  ? 64   ASP E CA  1 
ATOM   8601  C C   . ASP E 1 66  ? 50.243  22.978  2.502   1.00 71.57  ? 64   ASP E C   1 
ATOM   8602  O O   . ASP E 1 66  ? 50.268  23.521  3.609   1.00 73.46  ? 64   ASP E O   1 
ATOM   8603  C CB  . ASP E 1 66  ? 51.931  22.294  0.779   1.00 78.97  ? 64   ASP E CB  1 
ATOM   8604  C CG  . ASP E 1 66  ? 53.067  21.365  0.389   1.00 81.95  ? 64   ASP E CG  1 
ATOM   8605  O OD1 . ASP E 1 66  ? 52.798  20.185  0.091   1.00 85.12  ? 64   ASP E OD1 1 
ATOM   8606  O OD2 . ASP E 1 66  ? 54.231  21.820  0.377   1.00 82.75  ? 64   ASP E OD2 1 
ATOM   8607  N N   . VAL E 1 67  ? 49.311  23.237  1.579   1.00 54.97  ? 65   VAL E N   1 
ATOM   8608  C CA  . VAL E 1 67  ? 48.219  24.195  1.802   1.00 52.69  ? 65   VAL E CA  1 
ATOM   8609  C C   . VAL E 1 67  ? 47.007  23.477  2.378   1.00 52.26  ? 65   VAL E C   1 
ATOM   8610  O O   . VAL E 1 67  ? 46.486  22.516  1.801   1.00 50.19  ? 65   VAL E O   1 
ATOM   8611  C CB  . VAL E 1 67  ? 47.777  24.905  0.502   1.00 58.66  ? 65   VAL E CB  1 
ATOM   8612  C CG1 . VAL E 1 67  ? 46.482  25.672  0.743   1.00 57.44  ? 65   VAL E CG1 1 
ATOM   8613  C CG2 . VAL E 1 67  ? 48.854  25.866  0.042   1.00 57.42  ? 65   VAL E CG2 1 
ATOM   8614  N N   . LEU E 1 68  ? 46.541  23.963  3.515   1.00 75.10  ? 66   LEU E N   1 
ATOM   8615  C CA  . LEU E 1 68  ? 45.423  23.321  4.155   1.00 76.96  ? 66   LEU E CA  1 
ATOM   8616  C C   . LEU E 1 68  ? 44.172  24.174  4.198   1.00 78.58  ? 66   LEU E C   1 
ATOM   8617  O O   . LEU E 1 68  ? 44.135  25.221  4.850   1.00 79.67  ? 66   LEU E O   1 
ATOM   8618  C CB  . LEU E 1 68  ? 45.827  22.919  5.564   1.00 59.01  ? 66   LEU E CB  1 
ATOM   8619  C CG  . LEU E 1 68  ? 44.864  21.974  6.262   1.00 58.03  ? 66   LEU E CG  1 
ATOM   8620  C CD1 . LEU E 1 68  ? 44.687  20.689  5.461   1.00 57.49  ? 66   LEU E CD1 1 
ATOM   8621  C CD2 . LEU E 1 68  ? 45.423  21.683  7.625   1.00 60.15  ? 66   LEU E CD2 1 
ATOM   8622  N N   . PHE E 1 69  ? 43.143  23.719  3.493   1.00 66.77  ? 67   PHE E N   1 
ATOM   8623  C CA  . PHE E 1 69  ? 41.882  24.434  3.480   1.00 66.85  ? 67   PHE E CA  1 
ATOM   8624  C C   . PHE E 1 69  ? 41.057  23.940  4.642   1.00 67.76  ? 67   PHE E C   1 
ATOM   8625  O O   . PHE E 1 69  ? 41.312  22.863  5.177   1.00 66.85  ? 67   PHE E O   1 
ATOM   8626  C CB  . PHE E 1 69  ? 41.121  24.190  2.179   1.00 68.98  ? 67   PHE E CB  1 
ATOM   8627  C CG  . PHE E 1 69  ? 41.738  24.853  0.987   1.00 68.64  ? 67   PHE E CG  1 
ATOM   8628  C CD1 . PHE E 1 69  ? 42.751  24.228  0.270   1.00 68.02  ? 67   PHE E CD1 1 
ATOM   8629  C CD2 . PHE E 1 69  ? 41.329  26.126  0.602   1.00 67.76  ? 67   PHE E CD2 1 
ATOM   8630  C CE1 . PHE E 1 69  ? 43.352  24.864  -0.815  1.00 68.78  ? 67   PHE E CE1 1 
ATOM   8631  C CE2 . PHE E 1 69  ? 41.922  26.771  -0.478  1.00 67.98  ? 67   PHE E CE2 1 
ATOM   8632  C CZ  . PHE E 1 69  ? 42.936  26.140  -1.189  1.00 68.60  ? 67   PHE E CZ  1 
ATOM   8633  N N   . LEU E 1 70  ? 40.067  24.733  5.024   1.00 96.22  ? 68   LEU E N   1 
ATOM   8634  C CA  . LEU E 1 70  ? 39.191  24.374  6.120   1.00 99.40  ? 68   LEU E CA  1 
ATOM   8635  C C   . LEU E 1 70  ? 37.735  24.496  5.699   1.00 102.65 ? 68   LEU E C   1 
ATOM   8636  O O   . LEU E 1 70  ? 37.086  25.504  5.971   1.00 104.86 ? 68   LEU E O   1 
ATOM   8637  C CB  . LEU E 1 70  ? 39.479  25.274  7.311   1.00 91.76  ? 68   LEU E CB  1 
ATOM   8638  C CG  . LEU E 1 70  ? 40.907  25.107  7.816   1.00 90.74  ? 68   LEU E CG  1 
ATOM   8639  C CD1 . LEU E 1 70  ? 41.096  25.919  9.081   1.00 90.98  ? 68   LEU E CD1 1 
ATOM   8640  C CD2 . LEU E 1 70  ? 41.169  23.635  8.088   1.00 91.22  ? 68   LEU E CD2 1 
ATOM   8641  N N   . ALA E 1 71  ? 37.225  23.458  5.041   1.00 78.93  ? 69   ALA E N   1 
ATOM   8642  C CA  . ALA E 1 71  ? 35.848  23.447  4.553   1.00 80.05  ? 69   ALA E CA  1 
ATOM   8643  C C   . ALA E 1 71  ? 34.945  22.482  5.309   1.00 81.16  ? 69   ALA E C   1 
ATOM   8644  O O   . ALA E 1 71  ? 34.623  21.402  4.809   1.00 80.61  ? 69   ALA E O   1 
ATOM   8645  C CB  . ALA E 1 71  ? 35.837  23.104  3.069   1.00 80.10  ? 69   ALA E CB  1 
ATOM   8646  N N   . VAL E 1 72  ? 34.523  22.872  6.506   1.00 92.71  ? 70   VAL E N   1 
ATOM   8647  C CA  . VAL E 1 72  ? 33.667  22.013  7.304   1.00 97.31  ? 70   VAL E CA  1 
ATOM   8648  C C   . VAL E 1 72  ? 32.776  22.797  8.255   1.00 99.83  ? 70   VAL E C   1 
ATOM   8649  O O   . VAL E 1 72  ? 32.558  22.382  9.391   1.00 102.35 ? 70   VAL E O   1 
ATOM   8650  C CB  . VAL E 1 72  ? 34.498  21.008  8.130   1.00 111.02 ? 70   VAL E CB  1 
ATOM   8651  C CG1 . VAL E 1 72  ? 33.607  19.939  8.704   1.00 111.54 ? 70   VAL E CG1 1 
ATOM   8652  C CG2 . VAL E 1 72  ? 35.532  20.363  7.271   1.00 112.12 ? 70   VAL E CG2 1 
ATOM   8653  N N   . LYS E 1 73  ? 32.270  23.936  7.801   1.00 99.26  ? 71   LYS E N   1 
ATOM   8654  C CA  . LYS E 1 73  ? 31.369  24.737  8.629   1.00 100.39 ? 71   LYS E CA  1 
ATOM   8655  C C   . LYS E 1 73  ? 32.052  25.385  9.826   1.00 100.95 ? 71   LYS E C   1 
ATOM   8656  O O   . LYS E 1 73  ? 33.091  24.918  10.286  1.00 101.23 ? 71   LYS E O   1 
ATOM   8657  C CB  . LYS E 1 73  ? 30.218  23.860  9.124   1.00 94.06  ? 71   LYS E CB  1 
ATOM   8658  C CG  . LYS E 1 73  ? 29.616  23.005  8.022   1.00 94.04  ? 71   LYS E CG  1 
ATOM   8659  C CD  . LYS E 1 73  ? 28.571  22.057  8.555   1.00 93.50  ? 71   LYS E CD  1 
ATOM   8660  C CE  . LYS E 1 73  ? 27.975  21.237  7.428   1.00 92.89  ? 71   LYS E CE  1 
ATOM   8661  N NZ  . LYS E 1 73  ? 26.974  20.267  7.939   1.00 92.61  ? 71   LYS E NZ  1 
ATOM   8662  N N   . PRO E 1 74  ? 31.472  26.481  10.340  1.00 93.02  ? 72   PRO E N   1 
ATOM   8663  C CA  . PRO E 1 74  ? 32.023  27.200  11.493  1.00 93.98  ? 72   PRO E CA  1 
ATOM   8664  C C   . PRO E 1 74  ? 31.800  26.416  12.783  1.00 95.07  ? 72   PRO E C   1 
ATOM   8665  O O   . PRO E 1 74  ? 32.642  26.411  13.681  1.00 95.10  ? 72   PRO E O   1 
ATOM   8666  C CB  . PRO E 1 74  ? 31.245  28.518  11.486  1.00 97.75  ? 72   PRO E CB  1 
ATOM   8667  C CG  . PRO E 1 74  ? 30.825  28.674  10.050  1.00 96.66  ? 72   PRO E CG  1 
ATOM   8668  C CD  . PRO E 1 74  ? 30.411  27.274  9.697   1.00 96.95  ? 72   PRO E CD  1 
ATOM   8669  N N   . HIS E 1 75  ? 30.654  25.749  12.857  1.00 115.48 ? 73   HIS E N   1 
ATOM   8670  C CA  . HIS E 1 75  ? 30.291  24.964  14.027  1.00 116.70 ? 73   HIS E CA  1 
ATOM   8671  C C   . HIS E 1 75  ? 31.200  23.756  14.166  1.00 114.84 ? 73   HIS E C   1 
ATOM   8672  O O   . HIS E 1 75  ? 30.817  22.748  14.753  1.00 115.94 ? 73   HIS E O   1 
ATOM   8673  C CB  . HIS E 1 75  ? 28.841  24.500  13.905  1.00 156.14 ? 73   HIS E CB  1 
ATOM   8674  C CG  . HIS E 1 75  ? 27.882  25.607  13.598  1.00 163.10 ? 73   HIS E CG  1 
ATOM   8675  N ND1 . HIS E 1 75  ? 27.703  26.691  14.431  1.00 165.80 ? 73   HIS E ND1 1 
ATOM   8676  C CD2 . HIS E 1 75  ? 27.059  25.805  12.542  1.00 165.43 ? 73   HIS E CD2 1 
ATOM   8677  C CE1 . HIS E 1 75  ? 26.810  27.508  13.901  1.00 165.78 ? 73   HIS E CE1 1 
ATOM   8678  N NE2 . HIS E 1 75  ? 26.404  26.994  12.754  1.00 166.18 ? 73   HIS E NE2 1 
ATOM   8679  N N   . ILE E 1 76  ? 32.407  23.860  13.627  1.00 79.54  ? 74   ILE E N   1 
ATOM   8680  C CA  . ILE E 1 76  ? 33.351  22.761  13.686  1.00 75.47  ? 74   ILE E CA  1 
ATOM   8681  C C   . ILE E 1 76  ? 34.761  23.299  13.837  1.00 75.99  ? 74   ILE E C   1 
ATOM   8682  O O   . ILE E 1 76  ? 35.542  22.775  14.625  1.00 77.16  ? 74   ILE E O   1 
ATOM   8683  C CB  . ILE E 1 76  ? 33.282  21.917  12.409  1.00 75.69  ? 74   ILE E CB  1 
ATOM   8684  C CG1 . ILE E 1 76  ? 31.828  21.568  12.093  1.00 72.96  ? 74   ILE E CG1 1 
ATOM   8685  C CG2 . ILE E 1 76  ? 34.079  20.641  12.594  1.00 75.49  ? 74   ILE E CG2 1 
ATOM   8686  C CD1 . ILE E 1 76  ? 31.203  20.621  13.089  1.00 71.50  ? 74   ILE E CD1 1 
ATOM   8687  N N   . ILE E 1 77  ? 35.074  24.347  13.080  1.00 88.37  ? 75   ILE E N   1 
ATOM   8688  C CA  . ILE E 1 77  ? 36.389  24.986  13.114  1.00 89.32  ? 75   ILE E CA  1 
ATOM   8689  C C   . ILE E 1 77  ? 37.074  24.865  14.472  1.00 90.88  ? 75   ILE E C   1 
ATOM   8690  O O   . ILE E 1 77  ? 38.236  24.462  14.559  1.00 90.85  ? 75   ILE E O   1 
ATOM   8691  C CB  . ILE E 1 77  ? 36.286  26.483  12.755  1.00 79.39  ? 75   ILE E CB  1 
ATOM   8692  C CG1 . ILE E 1 77  ? 35.856  26.634  11.297  1.00 79.28  ? 75   ILE E CG1 1 
ATOM   8693  C CG2 . ILE E 1 77  ? 37.621  27.178  12.999  1.00 79.25  ? 75   ILE E CG2 1 
ATOM   8694  C CD1 . ILE E 1 77  ? 36.859  26.081  10.308  1.00 79.92  ? 75   ILE E CD1 1 
ATOM   8695  N N   . PRO E 1 78  ? 36.365  25.228  15.552  1.00 78.93  ? 76   PRO E N   1 
ATOM   8696  C CA  . PRO E 1 78  ? 36.930  25.144  16.900  1.00 79.80  ? 76   PRO E CA  1 
ATOM   8697  C C   . PRO E 1 78  ? 37.530  23.764  17.158  1.00 80.89  ? 76   PRO E C   1 
ATOM   8698  O O   . PRO E 1 78  ? 38.730  23.638  17.397  1.00 81.13  ? 76   PRO E O   1 
ATOM   8699  C CB  . PRO E 1 78  ? 35.727  25.427  17.785  1.00 94.04  ? 76   PRO E CB  1 
ATOM   8700  C CG  . PRO E 1 78  ? 34.955  26.408  16.958  1.00 94.41  ? 76   PRO E CG  1 
ATOM   8701  C CD  . PRO E 1 78  ? 34.998  25.779  15.595  1.00 93.33  ? 76   PRO E CD  1 
ATOM   8702  N N   . PHE E 1 79  ? 36.685  22.737  17.112  1.00 93.46  ? 77   PHE E N   1 
ATOM   8703  C CA  . PHE E 1 79  ? 37.120  21.357  17.311  1.00 94.88  ? 77   PHE E CA  1 
ATOM   8704  C C   . PHE E 1 79  ? 38.423  21.195  16.560  1.00 94.67  ? 77   PHE E C   1 
ATOM   8705  O O   . PHE E 1 79  ? 39.492  21.040  17.148  1.00 95.26  ? 77   PHE E O   1 
ATOM   8706  C CB  . PHE E 1 79  ? 36.106  20.388  16.707  1.00 119.80 ? 77   PHE E CB  1 
ATOM   8707  C CG  . PHE E 1 79  ? 34.766  20.402  17.377  1.00 124.07 ? 77   PHE E CG  1 
ATOM   8708  C CD1 . PHE E 1 79  ? 34.283  21.552  17.994  1.00 125.36 ? 77   PHE E CD1 1 
ATOM   8709  C CD2 . PHE E 1 79  ? 33.966  19.263  17.362  1.00 126.65 ? 77   PHE E CD2 1 
ATOM   8710  C CE1 . PHE E 1 79  ? 33.022  21.568  18.585  1.00 127.58 ? 77   PHE E CE1 1 
ATOM   8711  C CE2 . PHE E 1 79  ? 32.702  19.267  17.950  1.00 127.97 ? 77   PHE E CE2 1 
ATOM   8712  C CZ  . PHE E 1 79  ? 32.229  20.422  18.562  1.00 128.72 ? 77   PHE E CZ  1 
ATOM   8713  N N   . ILE E 1 80  ? 38.291  21.239  15.240  1.00 92.25  ? 78   ILE E N   1 
ATOM   8714  C CA  . ILE E 1 80  ? 39.396  21.120  14.304  1.00 92.25  ? 78   ILE E CA  1 
ATOM   8715  C C   . ILE E 1 80  ? 40.706  21.683  14.837  1.00 92.40  ? 78   ILE E C   1 
ATOM   8716  O O   . ILE E 1 80  ? 41.657  20.936  15.062  1.00 92.90  ? 78   ILE E O   1 
ATOM   8717  C CB  . ILE E 1 80  ? 39.038  21.829  12.984  1.00 96.59  ? 78   ILE E CB  1 
ATOM   8718  C CG1 . ILE E 1 80  ? 37.872  21.096  12.322  1.00 95.97  ? 78   ILE E CG1 1 
ATOM   8719  C CG2 . ILE E 1 80  ? 40.239  21.886  12.059  1.00 96.40  ? 78   ILE E CG2 1 
ATOM   8720  C CD1 . ILE E 1 80  ? 38.151  19.634  12.020  1.00 93.45  ? 78   ILE E CD1 1 
ATOM   8721  N N   . LEU E 1 81  ? 40.751  22.997  15.031  1.00 86.49  ? 79   LEU E N   1 
ATOM   8722  C CA  . LEU E 1 81  ? 41.949  23.660  15.538  1.00 87.17  ? 79   LEU E CA  1 
ATOM   8723  C C   . LEU E 1 81  ? 42.617  22.858  16.666  1.00 87.94  ? 79   LEU E C   1 
ATOM   8724  O O   . LEU E 1 81  ? 43.839  22.675  16.678  1.00 87.75  ? 79   LEU E O   1 
ATOM   8725  C CB  . LEU E 1 81  ? 41.593  25.065  16.038  1.00 89.86  ? 79   LEU E CB  1 
ATOM   8726  C CG  . LEU E 1 81  ? 40.930  25.997  15.022  1.00 88.98  ? 79   LEU E CG  1 
ATOM   8727  C CD1 . LEU E 1 81  ? 40.572  27.323  15.676  1.00 89.18  ? 79   LEU E CD1 1 
ATOM   8728  C CD2 . LEU E 1 81  ? 41.876  26.219  13.864  1.00 88.97  ? 79   LEU E CD2 1 
ATOM   8729  N N   . ASP E 1 82  ? 41.807  22.378  17.606  1.00 100.18 ? 80   ASP E N   1 
ATOM   8730  C CA  . ASP E 1 82  ? 42.311  21.597  18.731  1.00 101.17 ? 80   ASP E CA  1 
ATOM   8731  C C   . ASP E 1 82  ? 42.443  20.135  18.346  1.00 99.66  ? 80   ASP E C   1 
ATOM   8732  O O   . ASP E 1 82  ? 41.953  19.249  19.048  1.00 99.58  ? 80   ASP E O   1 
ATOM   8733  C CB  . ASP E 1 82  ? 41.370  21.712  19.931  1.00 143.34 ? 80   ASP E CB  1 
ATOM   8734  C CG  . ASP E 1 82  ? 41.237  23.131  20.434  1.00 146.34 ? 80   ASP E CG  1 
ATOM   8735  O OD1 . ASP E 1 82  ? 42.273  23.809  20.588  1.00 148.68 ? 80   ASP E OD1 1 
ATOM   8736  O OD2 . ASP E 1 82  ? 40.094  23.563  20.688  1.00 147.49 ? 80   ASP E OD2 1 
ATOM   8737  N N   . GLU E 1 83  ? 43.105  19.892  17.224  1.00 96.86  ? 81   GLU E N   1 
ATOM   8738  C CA  . GLU E 1 83  ? 43.307  18.544  16.717  1.00 96.96  ? 81   GLU E CA  1 
ATOM   8739  C C   . GLU E 1 83  ? 44.430  18.593  15.694  1.00 95.98  ? 81   GLU E C   1 
ATOM   8740  O O   . GLU E 1 83  ? 44.863  17.559  15.186  1.00 96.04  ? 81   GLU E O   1 
ATOM   8741  C CB  . GLU E 1 83  ? 42.036  18.030  16.023  1.00 136.01 ? 81   GLU E CB  1 
ATOM   8742  C CG  . GLU E 1 83  ? 40.800  17.913  16.909  1.00 142.66 ? 81   GLU E CG  1 
ATOM   8743  C CD  . GLU E 1 83  ? 39.554  17.510  16.131  1.00 145.98 ? 81   GLU E CD  1 
ATOM   8744  O OE1 . GLU E 1 83  ? 39.598  16.471  15.437  1.00 147.66 ? 81   GLU E OE1 1 
ATOM   8745  O OE2 . GLU E 1 83  ? 38.532  18.229  16.215  1.00 147.55 ? 81   GLU E OE2 1 
ATOM   8746  N N   . ILE E 1 84  ? 44.908  19.797  15.399  1.00 105.73 ? 82   ILE E N   1 
ATOM   8747  C CA  . ILE E 1 84  ? 45.947  19.951  14.393  1.00 106.14 ? 82   ILE E CA  1 
ATOM   8748  C C   . ILE E 1 84  ? 47.070  20.910  14.770  1.00 105.33 ? 82   ILE E C   1 
ATOM   8749  O O   . ILE E 1 84  ? 48.168  20.825  14.218  1.00 106.35 ? 82   ILE E O   1 
ATOM   8750  C CB  . ILE E 1 84  ? 45.316  20.419  13.070  1.00 146.52 ? 82   ILE E CB  1 
ATOM   8751  C CG1 . ILE E 1 84  ? 44.131  19.513  12.726  1.00 147.22 ? 82   ILE E CG1 1 
ATOM   8752  C CG2 . ILE E 1 84  ? 46.346  20.384  11.953  1.00 147.60 ? 82   ILE E CG2 1 
ATOM   8753  C CD1 . ILE E 1 84  ? 43.174  20.104  11.731  1.00 149.53 ? 82   ILE E CD1 1 
ATOM   8754  N N   . GLY E 1 85  ? 46.802  21.821  15.700  1.00 79.77  ? 83   GLY E N   1 
ATOM   8755  C CA  . GLY E 1 85  ? 47.828  22.772  16.100  1.00 78.52  ? 83   GLY E CA  1 
ATOM   8756  C C   . GLY E 1 85  ? 49.163  22.102  16.380  1.00 78.07  ? 83   GLY E C   1 
ATOM   8757  O O   . GLY E 1 85  ? 50.235  22.698  16.210  1.00 76.44  ? 83   GLY E O   1 
ATOM   8758  N N   . ALA E 1 86  ? 49.086  20.849  16.818  1.00 100.72 ? 84   ALA E N   1 
ATOM   8759  C CA  . ALA E 1 86  ? 50.263  20.054  17.137  1.00 99.80  ? 84   ALA E CA  1 
ATOM   8760  C C   . ALA E 1 86  ? 50.917  19.575  15.855  1.00 99.36  ? 84   ALA E C   1 
ATOM   8761  O O   . ALA E 1 86  ? 52.122  19.318  15.808  1.00 99.24  ? 84   ALA E O   1 
ATOM   8762  C CB  . ALA E 1 86  ? 49.857  18.863  17.984  1.00 93.14  ? 84   ALA E CB  1 
ATOM   8763  N N   . ASP E 1 87  ? 50.098  19.463  14.816  1.00 57.82  ? 85   ASP E N   1 
ATOM   8764  C CA  . ASP E 1 87  ? 50.539  19.004  13.510  1.00 58.01  ? 85   ASP E CA  1 
ATOM   8765  C C   . ASP E 1 87  ? 50.975  20.173  12.634  1.00 56.90  ? 85   ASP E C   1 
ATOM   8766  O O   . ASP E 1 87  ? 51.696  20.006  11.652  1.00 55.78  ? 85   ASP E O   1 
ATOM   8767  C CB  . ASP E 1 87  ? 49.402  18.226  12.869  1.00 138.25 ? 85   ASP E CB  1 
ATOM   8768  C CG  . ASP E 1 87  ? 48.745  17.276  13.850  1.00 142.34 ? 85   ASP E CG  1 
ATOM   8769  O OD1 . ASP E 1 87  ? 49.459  16.421  14.420  1.00 144.64 ? 85   ASP E OD1 1 
ATOM   8770  O OD2 . ASP E 1 87  ? 47.520  17.389  14.063  1.00 144.25 ? 85   ASP E OD2 1 
ATOM   8771  N N   . ILE E 1 88  ? 50.530  21.364  13.005  1.00 97.43  ? 86   ILE E N   1 
ATOM   8772  C CA  . ILE E 1 88  ? 50.895  22.580  12.295  1.00 100.26 ? 86   ILE E CA  1 
ATOM   8773  C C   . ILE E 1 88  ? 52.419  22.636  12.326  1.00 100.83 ? 86   ILE E C   1 
ATOM   8774  O O   . ILE E 1 88  ? 53.028  22.109  13.257  1.00 101.28 ? 86   ILE E O   1 
ATOM   8775  C CB  . ILE E 1 88  ? 50.320  23.800  13.040  1.00 139.12 ? 86   ILE E CB  1 
ATOM   8776  C CG1 . ILE E 1 88  ? 48.809  23.653  13.140  1.00 139.15 ? 86   ILE E CG1 1 
ATOM   8777  C CG2 . ILE E 1 88  ? 50.621  25.079  12.307  1.00 139.78 ? 86   ILE E CG2 1 
ATOM   8778  C CD1 . ILE E 1 88  ? 48.150  23.538  11.791  1.00 139.83 ? 86   ILE E CD1 1 
ATOM   8779  N N   . GLU E 1 89  ? 53.046  23.245  11.323  1.00 88.24  ? 87   GLU E N   1 
ATOM   8780  C CA  . GLU E 1 89  ? 54.500  23.324  11.349  1.00 88.92  ? 87   GLU E CA  1 
ATOM   8781  C C   . GLU E 1 89  ? 55.216  24.253  10.378  1.00 89.08  ? 87   GLU E C   1 
ATOM   8782  O O   . GLU E 1 89  ? 55.786  23.815  9.380   1.00 88.13  ? 87   GLU E O   1 
ATOM   8783  C CB  . GLU E 1 89  ? 55.103  21.923  11.246  1.00 91.70  ? 87   GLU E CB  1 
ATOM   8784  C CG  . GLU E 1 89  ? 54.480  21.041  10.196  1.00 92.09  ? 87   GLU E CG  1 
ATOM   8785  C CD  . GLU E 1 89  ? 55.118  19.667  10.169  1.00 91.93  ? 87   GLU E CD  1 
ATOM   8786  O OE1 . GLU E 1 89  ? 56.318  19.571  9.828   1.00 91.40  ? 87   GLU E OE1 1 
ATOM   8787  O OE2 . GLU E 1 89  ? 54.422  18.684  10.497  1.00 91.19  ? 87   GLU E OE2 1 
ATOM   8788  N N   . ASP E 1 90  ? 55.197  25.540  10.711  1.00 91.47  ? 88   ASP E N   1 
ATOM   8789  C CA  . ASP E 1 90  ? 55.868  26.579  9.945   1.00 93.12  ? 88   ASP E CA  1 
ATOM   8790  C C   . ASP E 1 90  ? 55.532  26.597  8.466   1.00 92.24  ? 88   ASP E C   1 
ATOM   8791  O O   . ASP E 1 90  ? 54.961  27.564  7.970   1.00 94.58  ? 88   ASP E O   1 
ATOM   8792  C CB  . ASP E 1 90  ? 57.368  26.416  10.132  1.00 115.72 ? 88   ASP E CB  1 
ATOM   8793  C CG  . ASP E 1 90  ? 57.700  25.672  11.406  1.00 117.92 ? 88   ASP E CG  1 
ATOM   8794  O OD1 . ASP E 1 90  ? 57.405  26.204  12.500  1.00 118.06 ? 88   ASP E OD1 1 
ATOM   8795  O OD2 . ASP E 1 90  ? 58.232  24.544  11.311  1.00 119.56 ? 88   ASP E OD2 1 
ATOM   8796  N N   . ARG E 1 91  ? 55.894  25.532  7.762   1.00 102.91 ? 89   ARG E N   1 
ATOM   8797  C CA  . ARG E 1 91  ? 55.631  25.449  6.333   1.00 100.89 ? 89   ARG E CA  1 
ATOM   8798  C C   . ARG E 1 91  ? 54.145  25.562  6.004   1.00 100.62 ? 89   ARG E C   1 
ATOM   8799  O O   . ARG E 1 91  ? 53.770  26.191  5.016   1.00 101.60 ? 89   ARG E O   1 
ATOM   8800  C CB  . ARG E 1 91  ? 56.171  24.133  5.757   1.00 92.97  ? 89   ARG E CB  1 
ATOM   8801  C CG  . ARG E 1 91  ? 55.179  22.965  5.752   1.00 88.98  ? 89   ARG E CG  1 
ATOM   8802  C CD  . ARG E 1 91  ? 55.619  21.893  4.757   1.00 87.39  ? 89   ARG E CD  1 
ATOM   8803  N NE  . ARG E 1 91  ? 54.612  20.856  4.539   1.00 85.51  ? 89   ARG E NE  1 
ATOM   8804  C CZ  . ARG E 1 91  ? 54.275  19.937  5.436   1.00 84.99  ? 89   ARG E CZ  1 
ATOM   8805  N NH1 . ARG E 1 91  ? 54.867  19.920  6.620   1.00 84.93  ? 89   ARG E NH1 1 
ATOM   8806  N NH2 . ARG E 1 91  ? 53.343  19.038  5.151   1.00 84.51  ? 89   ARG E NH2 1 
ATOM   8807  N N   . HIS E 1 92  ? 53.303  24.953  6.832   1.00 80.31  ? 90   HIS E N   1 
ATOM   8808  C CA  . HIS E 1 92  ? 51.863  24.972  6.604   1.00 76.59  ? 90   HIS E CA  1 
ATOM   8809  C C   . HIS E 1 92  ? 51.234  26.363  6.482   1.00 75.43  ? 90   HIS E C   1 
ATOM   8810  O O   . HIS E 1 92  ? 51.569  27.294  7.230   1.00 73.44  ? 90   HIS E O   1 
ATOM   8811  C CB  . HIS E 1 92  ? 51.139  24.185  7.706   1.00 80.76  ? 90   HIS E CB  1 
ATOM   8812  C CG  . HIS E 1 92  ? 51.176  22.698  7.523   1.00 79.77  ? 90   HIS E CG  1 
ATOM   8813  N ND1 . HIS E 1 92  ? 52.345  21.970  7.554   1.00 79.98  ? 90   HIS E ND1 1 
ATOM   8814  C CD2 . HIS E 1 92  ? 50.182  21.801  7.318   1.00 79.90  ? 90   HIS E CD2 1 
ATOM   8815  C CE1 . HIS E 1 92  ? 52.069  20.690  7.379   1.00 78.54  ? 90   HIS E CE1 1 
ATOM   8816  N NE2 . HIS E 1 92  ? 50.764  20.560  7.233   1.00 78.17  ? 90   HIS E NE2 1 
ATOM   8817  N N   . ILE E 1 93  ? 50.321  26.477  5.514   1.00 90.34  ? 91   ILE E N   1 
ATOM   8818  C CA  . ILE E 1 93  ? 49.561  27.698  5.237   1.00 87.02  ? 91   ILE E CA  1 
ATOM   8819  C C   . ILE E 1 93  ? 48.098  27.289  5.325   1.00 83.05  ? 91   ILE E C   1 
ATOM   8820  O O   . ILE E 1 93  ? 47.594  26.560  4.467   1.00 82.26  ? 91   ILE E O   1 
ATOM   8821  C CB  . ILE E 1 93  ? 49.799  28.232  3.813   1.00 104.43 ? 91   ILE E CB  1 
ATOM   8822  C CG1 . ILE E 1 93  ? 51.284  28.512  3.580   1.00 105.87 ? 91   ILE E CG1 1 
ATOM   8823  C CG2 . ILE E 1 93  ? 49.001  29.509  3.618   1.00 104.82 ? 91   ILE E CG2 1 
ATOM   8824  C CD1 . ILE E 1 93  ? 51.813  29.694  4.358   1.00 111.49 ? 91   ILE E CD1 1 
ATOM   8825  N N   . VAL E 1 94  ? 47.411  27.754  6.357   1.00 66.71  ? 92   VAL E N   1 
ATOM   8826  C CA  . VAL E 1 94  ? 46.022  27.380  6.520   1.00 66.01  ? 92   VAL E CA  1 
ATOM   8827  C C   . VAL E 1 94  ? 45.039  28.338  5.882   1.00 65.46  ? 92   VAL E C   1 
ATOM   8828  O O   . VAL E 1 94  ? 44.930  29.503  6.282   1.00 64.13  ? 92   VAL E O   1 
ATOM   8829  C CB  . VAL E 1 94  ? 45.657  27.240  7.993   1.00 68.97  ? 92   VAL E CB  1 
ATOM   8830  C CG1 . VAL E 1 94  ? 44.221  26.773  8.127   1.00 67.58  ? 92   VAL E CG1 1 
ATOM   8831  C CG2 . VAL E 1 94  ? 46.594  26.260  8.652   1.00 70.41  ? 92   VAL E CG2 1 
ATOM   8832  N N   . VAL E 1 95  ? 44.325  27.829  4.882   1.00 54.78  ? 93   VAL E N   1 
ATOM   8833  C CA  . VAL E 1 95  ? 43.316  28.605  4.184   1.00 52.40  ? 93   VAL E CA  1 
ATOM   8834  C C   . VAL E 1 95  ? 41.967  28.224  4.765   1.00 51.86  ? 93   VAL E C   1 
ATOM   8835  O O   . VAL E 1 95  ? 41.430  27.136  4.531   1.00 48.14  ? 93   VAL E O   1 
ATOM   8836  C CB  . VAL E 1 95  ? 43.324  28.330  2.677   1.00 63.01  ? 93   VAL E CB  1 
ATOM   8837  C CG1 . VAL E 1 95  ? 42.146  29.018  2.022   1.00 62.25  ? 93   VAL E CG1 1 
ATOM   8838  C CG2 . VAL E 1 95  ? 44.618  28.840  2.074   1.00 63.34  ? 93   VAL E CG2 1 
ATOM   8839  N N   . SER E 1 96  ? 41.437  29.144  5.547   1.00 58.25  ? 94   SER E N   1 
ATOM   8840  C CA  . SER E 1 96  ? 40.171  28.942  6.197   1.00 61.34  ? 94   SER E CA  1 
ATOM   8841  C C   . SER E 1 96  ? 39.091  29.755  5.515   1.00 63.82  ? 94   SER E C   1 
ATOM   8842  O O   . SER E 1 96  ? 39.071  30.984  5.610   1.00 64.40  ? 94   SER E O   1 
ATOM   8843  C CB  . SER E 1 96  ? 40.294  29.352  7.659   1.00 60.04  ? 94   SER E CB  1 
ATOM   8844  O OG  . SER E 1 96  ? 39.027  29.412  8.283   1.00 62.14  ? 94   SER E OG  1 
ATOM   8845  N N   . CYS E 1 97  ? 38.202  29.067  4.811   1.00 68.00  ? 95   CYS E N   1 
ATOM   8846  C CA  . CYS E 1 97  ? 37.104  29.737  4.140   1.00 70.76  ? 95   CYS E CA  1 
ATOM   8847  C C   . CYS E 1 97  ? 35.804  29.201  4.718   1.00 71.17  ? 95   CYS E C   1 
ATOM   8848  O O   . CYS E 1 97  ? 35.142  28.348  4.127   1.00 69.73  ? 95   CYS E O   1 
ATOM   8849  C CB  . CYS E 1 97  ? 37.150  29.480  2.641   1.00 102.28 ? 95   CYS E CB  1 
ATOM   8850  S SG  . CYS E 1 97  ? 38.817  29.546  1.920   1.00 108.25 ? 95   CYS E SG  1 
ATOM   8851  N N   . ALA E 1 98  ? 35.465  29.692  5.901   1.00 73.07  ? 96   ALA E N   1 
ATOM   8852  C CA  . ALA E 1 98  ? 34.241  29.296  6.567   1.00 73.67  ? 96   ALA E CA  1 
ATOM   8853  C C   . ALA E 1 98  ? 33.441  30.563  6.823   1.00 74.08  ? 96   ALA E C   1 
ATOM   8854  O O   . ALA E 1 98  ? 33.955  31.681  6.692   1.00 73.02  ? 96   ALA E O   1 
ATOM   8855  C CB  . ALA E 1 98  ? 34.550  28.587  7.880   1.00 87.48  ? 96   ALA E CB  1 
ATOM   8856  N N   . ALA E 1 99  ? 32.182  30.380  7.190   1.00 87.94  ? 97   ALA E N   1 
ATOM   8857  C CA  . ALA E 1 99  ? 31.301  31.499  7.456   1.00 90.03  ? 97   ALA E CA  1 
ATOM   8858  C C   . ALA E 1 99  ? 31.532  32.117  8.835   1.00 91.47  ? 97   ALA E C   1 
ATOM   8859  O O   . ALA E 1 99  ? 31.495  31.421  9.856   1.00 91.72  ? 97   ALA E O   1 
ATOM   8860  C CB  . ALA E 1 99  ? 29.849  31.048  7.320   1.00 130.66 ? 97   ALA E CB  1 
ATOM   8861  N N   . GLY E 1 100 ? 31.778  33.426  8.851   1.00 96.60  ? 98   GLY E N   1 
ATOM   8862  C CA  . GLY E 1 100 ? 31.982  34.140  10.102  1.00 96.82  ? 98   GLY E CA  1 
ATOM   8863  C C   . GLY E 1 100 ? 33.330  33.975  10.776  1.00 96.38  ? 98   GLY E C   1 
ATOM   8864  O O   . GLY E 1 100 ? 33.970  34.960  11.145  1.00 95.94  ? 98   GLY E O   1 
ATOM   8865  N N   . VAL E 1 101 ? 33.752  32.725  10.945  1.00 75.50  ? 99   VAL E N   1 
ATOM   8866  C CA  . VAL E 1 101 ? 35.025  32.396  11.582  1.00 73.04  ? 99   VAL E CA  1 
ATOM   8867  C C   . VAL E 1 101 ? 36.130  33.434  11.357  1.00 72.22  ? 99   VAL E C   1 
ATOM   8868  O O   . VAL E 1 101 ? 36.696  33.537  10.269  1.00 71.91  ? 99   VAL E O   1 
ATOM   8869  C CB  . VAL E 1 101 ? 35.520  31.027  11.100  1.00 53.84  ? 99   VAL E CB  1 
ATOM   8870  C CG1 . VAL E 1 101 ? 36.795  30.656  11.827  1.00 54.61  ? 99   VAL E CG1 1 
ATOM   8871  C CG2 . VAL E 1 101 ? 34.439  29.981  11.334  1.00 54.14  ? 99   VAL E CG2 1 
ATOM   8872  N N   . THR E 1 102 ? 36.433  34.187  12.411  1.00 63.15  ? 100  THR E N   1 
ATOM   8873  C CA  . THR E 1 102 ? 37.449  35.235  12.379  1.00 62.78  ? 100  THR E CA  1 
ATOM   8874  C C   . THR E 1 102 ? 38.858  34.705  12.191  1.00 62.09  ? 100  THR E C   1 
ATOM   8875  O O   . THR E 1 102 ? 39.134  33.522  12.393  1.00 61.04  ? 100  THR E O   1 
ATOM   8876  C CB  . THR E 1 102 ? 37.470  36.037  13.689  1.00 73.74  ? 100  THR E CB  1 
ATOM   8877  O OG1 . THR E 1 102 ? 36.130  36.285  14.126  1.00 76.58  ? 100  THR E OG1 1 
ATOM   8878  C CG2 . THR E 1 102 ? 38.194  37.361  13.486  1.00 73.60  ? 100  THR E CG2 1 
ATOM   8879  N N   . ILE E 1 103 ? 39.754  35.607  11.816  1.00 75.79  ? 101  ILE E N   1 
ATOM   8880  C CA  . ILE E 1 103 ? 41.142  35.248  11.630  1.00 77.75  ? 101  ILE E CA  1 
ATOM   8881  C C   . ILE E 1 103 ? 41.664  34.928  13.028  1.00 78.80  ? 101  ILE E C   1 
ATOM   8882  O O   . ILE E 1 103 ? 42.210  33.851  13.262  1.00 80.14  ? 101  ILE E O   1 
ATOM   8883  C CB  . ILE E 1 103 ? 41.935  36.428  10.987  1.00 80.66  ? 101  ILE E CB  1 
ATOM   8884  C CG1 . ILE E 1 103 ? 42.624  35.957  9.700   1.00 79.91  ? 101  ILE E CG1 1 
ATOM   8885  C CG2 . ILE E 1 103 ? 42.970  36.980  11.957  1.00 82.00  ? 101  ILE E CG2 1 
ATOM   8886  C CD1 . ILE E 1 103 ? 43.275  37.077  8.889   1.00 79.17  ? 101  ILE E CD1 1 
ATOM   8887  N N   . SER E 1 104 ? 41.453  35.854  13.962  1.00 76.26  ? 102  SER E N   1 
ATOM   8888  C CA  . SER E 1 104 ? 41.908  35.686  15.338  1.00 75.34  ? 102  SER E CA  1 
ATOM   8889  C C   . SER E 1 104 ? 41.337  34.442  15.984  1.00 75.47  ? 102  SER E C   1 
ATOM   8890  O O   . SER E 1 104 ? 42.034  33.743  16.715  1.00 76.18  ? 102  SER E O   1 
ATOM   8891  C CB  . SER E 1 104 ? 41.533  36.905  16.170  1.00 84.74  ? 102  SER E CB  1 
ATOM   8892  O OG  . SER E 1 104 ? 42.188  38.054  15.671  1.00 85.87  ? 102  SER E OG  1 
ATOM   8893  N N   . SER E 1 105 ? 40.067  34.166  15.716  1.00 83.99  ? 103  SER E N   1 
ATOM   8894  C CA  . SER E 1 105 ? 39.416  32.989  16.274  1.00 86.42  ? 103  SER E CA  1 
ATOM   8895  C C   . SER E 1 105 ? 40.260  31.752  15.987  1.00 87.33  ? 103  SER E C   1 
ATOM   8896  O O   . SER E 1 105 ? 40.044  30.687  16.564  1.00 89.60  ? 103  SER E O   1 
ATOM   8897  C CB  . SER E 1 105 ? 38.021  32.825  15.668  1.00 116.74 ? 103  SER E CB  1 
ATOM   8898  O OG  . SER E 1 105 ? 37.211  33.954  15.958  1.00 119.95 ? 103  SER E OG  1 
ATOM   8899  N N   . ILE E 1 106 ? 41.229  31.913  15.093  1.00 72.22  ? 104  ILE E N   1 
ATOM   8900  C CA  . ILE E 1 106 ? 42.130  30.840  14.705  1.00 72.63  ? 104  ILE E CA  1 
ATOM   8901  C C   . ILE E 1 106 ? 43.565  31.189  15.085  1.00 71.16  ? 104  ILE E C   1 
ATOM   8902  O O   . ILE E 1 106 ? 44.288  30.361  15.635  1.00 69.45  ? 104  ILE E O   1 
ATOM   8903  C CB  . ILE E 1 106 ? 42.025  30.586  13.191  1.00 110.29 ? 104  ILE E CB  1 
ATOM   8904  C CG1 . ILE E 1 106 ? 40.865  29.627  12.930  1.00 111.03 ? 104  ILE E CG1 1 
ATOM   8905  C CG2 . ILE E 1 106 ? 43.337  30.065  12.639  1.00 111.93 ? 104  ILE E CG2 1 
ATOM   8906  C CD1 . ILE E 1 106 ? 40.562  29.423  11.480  1.00 112.73 ? 104  ILE E CD1 1 
ATOM   8907  N N   . GLU E 1 107 ? 43.973  32.417  14.790  1.00 111.89 ? 105  GLU E N   1 
ATOM   8908  C CA  . GLU E 1 107 ? 45.315  32.865  15.126  1.00 112.48 ? 105  GLU E CA  1 
ATOM   8909  C C   . GLU E 1 107 ? 45.582  32.551  16.598  1.00 113.84 ? 105  GLU E C   1 
ATOM   8910  O O   . GLU E 1 107 ? 46.726  32.338  16.997  1.00 116.46 ? 105  GLU E O   1 
ATOM   8911  C CB  . GLU E 1 107 ? 45.448  34.370  14.877  1.00 76.26  ? 105  GLU E CB  1 
ATOM   8912  C CG  . GLU E 1 107 ? 45.362  34.777  13.411  1.00 76.51  ? 105  GLU E CG  1 
ATOM   8913  C CD  . GLU E 1 107 ? 46.724  34.938  12.757  1.00 76.26  ? 105  GLU E CD  1 
ATOM   8914  O OE1 . GLU E 1 107 ? 47.512  35.770  13.250  1.00 76.64  ? 105  GLU E OE1 1 
ATOM   8915  O OE2 . GLU E 1 107 ? 47.005  34.244  11.753  1.00 74.40  ? 105  GLU E OE2 1 
ATOM   8916  N N   . LYS E 1 108 ? 44.519  32.521  17.401  1.00 79.44  ? 106  LYS E N   1 
ATOM   8917  C CA  . LYS E 1 108 ? 44.643  32.217  18.823  1.00 78.11  ? 106  LYS E CA  1 
ATOM   8918  C C   . LYS E 1 108 ? 44.802  30.721  19.047  1.00 76.64  ? 106  LYS E C   1 
ATOM   8919  O O   . LYS E 1 108 ? 45.845  30.261  19.512  1.00 76.29  ? 106  LYS E O   1 
ATOM   8920  C CB  . LYS E 1 108 ? 43.423  32.715  19.595  1.00 101.19 ? 106  LYS E CB  1 
ATOM   8921  C CG  . LYS E 1 108 ? 43.578  34.108  20.163  1.00 105.32 ? 106  LYS E CG  1 
ATOM   8922  C CD  . LYS E 1 108 ? 42.559  34.353  21.267  1.00 110.03 ? 106  LYS E CD  1 
ATOM   8923  C CE  . LYS E 1 108 ? 42.835  35.657  22.010  1.00 112.95 ? 106  LYS E CE  1 
ATOM   8924  N NZ  . LYS E 1 108 ? 41.902  35.873  23.158  1.00 113.65 ? 106  LYS E NZ  1 
ATOM   8925  N N   . LYS E 1 109 ? 43.769  29.959  18.712  1.00 65.58  ? 107  LYS E N   1 
ATOM   8926  C CA  . LYS E 1 109 ? 43.830  28.519  18.884  1.00 66.49  ? 107  LYS E CA  1 
ATOM   8927  C C   . LYS E 1 109 ? 45.029  27.870  18.196  1.00 67.97  ? 107  LYS E C   1 
ATOM   8928  O O   . LYS E 1 109 ? 45.286  26.693  18.394  1.00 68.87  ? 107  LYS E O   1 
ATOM   8929  C CB  . LYS E 1 109 ? 42.551  27.856  18.374  1.00 77.55  ? 107  LYS E CB  1 
ATOM   8930  C CG  . LYS E 1 109 ? 41.475  27.707  19.427  1.00 78.86  ? 107  LYS E CG  1 
ATOM   8931  C CD  . LYS E 1 109 ? 40.438  26.680  19.003  1.00 80.68  ? 107  LYS E CD  1 
ATOM   8932  C CE  . LYS E 1 109 ? 39.450  26.380  20.126  1.00 83.36  ? 107  LYS E CE  1 
ATOM   8933  N NZ  . LYS E 1 109 ? 38.461  25.315  19.752  1.00 85.64  ? 107  LYS E NZ  1 
ATOM   8934  N N   . LEU E 1 110 ? 45.768  28.615  17.385  1.00 77.83  ? 108  LEU E N   1 
ATOM   8935  C CA  . LEU E 1 110 ? 46.912  28.013  16.715  1.00 79.70  ? 108  LEU E CA  1 
ATOM   8936  C C   . LEU E 1 110 ? 48.227  28.465  17.297  1.00 81.27  ? 108  LEU E C   1 
ATOM   8937  O O   . LEU E 1 110 ? 49.209  27.726  17.273  1.00 82.19  ? 108  LEU E O   1 
ATOM   8938  C CB  . LEU E 1 110 ? 46.879  28.310  15.221  1.00 87.18  ? 108  LEU E CB  1 
ATOM   8939  C CG  . LEU E 1 110 ? 45.624  27.772  14.541  1.00 88.19  ? 108  LEU E CG  1 
ATOM   8940  C CD1 . LEU E 1 110 ? 45.799  27.890  13.047  1.00 88.31  ? 108  LEU E CD1 1 
ATOM   8941  C CD2 . LEU E 1 110 ? 45.380  26.319  14.941  1.00 86.36  ? 108  LEU E CD2 1 
ATOM   8942  N N   . SER E 1 111 ? 48.259  29.689  17.806  1.00 116.94 ? 109  SER E N   1 
ATOM   8943  C CA  . SER E 1 111 ? 49.475  30.185  18.420  1.00 118.90 ? 109  SER E CA  1 
ATOM   8944  C C   . SER E 1 111 ? 49.584  29.426  19.735  1.00 120.35 ? 109  SER E C   1 
ATOM   8945  O O   . SER E 1 111 ? 50.589  29.514  20.440  1.00 121.09 ? 109  SER E O   1 
ATOM   8946  C CB  . SER E 1 111 ? 49.384  31.693  18.666  1.00 91.50  ? 109  SER E CB  1 
ATOM   8947  O OG  . SER E 1 111 ? 49.458  32.420  17.449  1.00 89.83  ? 109  SER E OG  1 
ATOM   8948  N N   . ALA E 1 112 ? 48.529  28.674  20.046  1.00 120.98 ? 110  ALA E N   1 
ATOM   8949  C CA  . ALA E 1 112 ? 48.471  27.858  21.256  1.00 120.32 ? 110  ALA E CA  1 
ATOM   8950  C C   . ALA E 1 112 ? 49.361  26.625  21.058  1.00 120.41 ? 110  ALA E C   1 
ATOM   8951  O O   . ALA E 1 112 ? 49.435  25.741  21.916  1.00 121.31 ? 110  ALA E O   1 
ATOM   8952  C CB  . ALA E 1 112 ? 47.028  27.443  21.538  1.00 42.62  ? 110  ALA E CB  1 
ATOM   8953  N N   . PHE E 1 113 ? 50.015  26.580  19.899  1.00 84.75  ? 111  PHE E N   1 
ATOM   8954  C CA  . PHE E 1 113 ? 50.950  25.523  19.524  1.00 83.54  ? 111  PHE E CA  1 
ATOM   8955  C C   . PHE E 1 113 ? 52.084  26.305  18.885  1.00 84.28  ? 111  PHE E C   1 
ATOM   8956  O O   . PHE E 1 113 ? 52.746  27.100  19.553  1.00 85.32  ? 111  PHE E O   1 
ATOM   8957  C CB  . PHE E 1 113 ? 50.349  24.577  18.489  1.00 93.27  ? 111  PHE E CB  1 
ATOM   8958  C CG  . PHE E 1 113 ? 49.004  24.050  18.861  1.00 96.28  ? 111  PHE E CG  1 
ATOM   8959  C CD1 . PHE E 1 113 ? 47.871  24.840  18.715  1.00 98.70  ? 111  PHE E CD1 1 
ATOM   8960  C CD2 . PHE E 1 113 ? 48.862  22.760  19.353  1.00 97.42  ? 111  PHE E CD2 1 
ATOM   8961  C CE1 . PHE E 1 113 ? 46.612  24.349  19.051  1.00 100.29 ? 111  PHE E CE1 1 
ATOM   8962  C CE2 . PHE E 1 113 ? 47.607  22.259  19.693  1.00 99.30  ? 111  PHE E CE2 1 
ATOM   8963  C CZ  . PHE E 1 113 ? 46.479  23.056  19.541  1.00 99.94  ? 111  PHE E CZ  1 
ATOM   8964  N N   . ARG E 1 114 ? 52.302  26.109  17.590  1.00 96.37  ? 112  ARG E N   1 
ATOM   8965  C CA  . ARG E 1 114 ? 53.354  26.853  16.915  1.00 96.04  ? 112  ARG E CA  1 
ATOM   8966  C C   . ARG E 1 114 ? 53.170  28.336  17.257  1.00 94.70  ? 112  ARG E C   1 
ATOM   8967  O O   . ARG E 1 114 ? 52.049  28.849  17.286  1.00 93.75  ? 112  ARG E O   1 
ATOM   8968  C CB  . ARG E 1 114 ? 53.268  26.658  15.399  1.00 90.88  ? 112  ARG E CB  1 
ATOM   8969  C CG  . ARG E 1 114 ? 54.537  26.110  14.768  1.00 91.82  ? 112  ARG E CG  1 
ATOM   8970  C CD  . ARG E 1 114 ? 54.707  24.629  15.069  1.00 94.70  ? 112  ARG E CD  1 
ATOM   8971  N NE  . ARG E 1 114 ? 55.861  24.056  14.377  1.00 96.70  ? 112  ARG E NE  1 
ATOM   8972  C CZ  . ARG E 1 114 ? 56.106  22.751  14.271  1.00 96.61  ? 112  ARG E CZ  1 
ATOM   8973  N NH1 . ARG E 1 114 ? 55.277  21.866  14.814  1.00 95.76  ? 112  ARG E NH1 1 
ATOM   8974  N NH2 . ARG E 1 114 ? 57.182  22.327  13.617  1.00 94.92  ? 112  ARG E NH2 1 
ATOM   8975  N N   . PRO E 1 115 ? 54.274  29.036  17.541  1.00 88.12  ? 113  PRO E N   1 
ATOM   8976  C CA  . PRO E 1 115 ? 54.268  30.461  17.888  1.00 86.52  ? 113  PRO E CA  1 
ATOM   8977  C C   . PRO E 1 115 ? 53.439  31.352  16.950  1.00 84.68  ? 113  PRO E C   1 
ATOM   8978  O O   . PRO E 1 115 ? 52.414  31.918  17.347  1.00 83.97  ? 113  PRO E O   1 
ATOM   8979  C CB  . PRO E 1 115 ? 55.750  30.819  17.848  1.00 98.65  ? 113  PRO E CB  1 
ATOM   8980  C CG  . PRO E 1 115 ? 56.398  29.562  18.328  1.00 99.73  ? 113  PRO E CG  1 
ATOM   8981  C CD  . PRO E 1 115 ? 55.642  28.488  17.585  1.00 99.75  ? 113  PRO E CD  1 
ATOM   8982  N N   . ALA E 1 116 ? 53.904  31.470  15.707  1.00 74.41  ? 114  ALA E N   1 
ATOM   8983  C CA  . ALA E 1 116 ? 53.259  32.293  14.689  1.00 71.31  ? 114  ALA E CA  1 
ATOM   8984  C C   . ALA E 1 116 ? 52.765  31.498  13.480  1.00 70.40  ? 114  ALA E C   1 
ATOM   8985  O O   . ALA E 1 116 ? 53.501  31.280  12.516  1.00 68.57  ? 114  ALA E O   1 
ATOM   8986  C CB  . ALA E 1 116 ? 54.222  33.380  14.223  1.00 69.70  ? 114  ALA E CB  1 
ATOM   8987  N N   . PRO E 1 117 ? 51.504  31.051  13.522  1.00 91.25  ? 115  PRO E N   1 
ATOM   8988  C CA  . PRO E 1 117 ? 50.899  30.283  12.430  1.00 91.77  ? 115  PRO E CA  1 
ATOM   8989  C C   . PRO E 1 117 ? 50.394  31.208  11.318  1.00 92.57  ? 115  PRO E C   1 
ATOM   8990  O O   . PRO E 1 117 ? 49.823  32.267  11.587  1.00 92.96  ? 115  PRO E O   1 
ATOM   8991  C CB  . PRO E 1 117 ? 49.770  29.537  13.130  1.00 71.35  ? 115  PRO E CB  1 
ATOM   8992  C CG  . PRO E 1 117 ? 49.333  30.523  14.167  1.00 70.91  ? 115  PRO E CG  1 
ATOM   8993  C CD  . PRO E 1 117 ? 50.643  31.030  14.719  1.00 71.63  ? 115  PRO E CD  1 
ATOM   8994  N N   . ARG E 1 118 ? 50.605  30.810  10.069  1.00 86.48  ? 116  ARG E N   1 
ATOM   8995  C CA  . ARG E 1 118 ? 50.173  31.621  8.937   1.00 85.17  ? 116  ARG E CA  1 
ATOM   8996  C C   . ARG E 1 118 ? 48.765  31.250  8.494   1.00 84.31  ? 116  ARG E C   1 
ATOM   8997  O O   . ARG E 1 118 ? 48.551  30.217  7.856   1.00 84.41  ? 116  ARG E O   1 
ATOM   8998  C CB  . ARG E 1 118 ? 51.165  31.454  7.791   1.00 88.11  ? 116  ARG E CB  1 
ATOM   8999  C CG  . ARG E 1 118 ? 52.567  31.861  8.199   1.00 89.98  ? 116  ARG E CG  1 
ATOM   9000  C CD  . ARG E 1 118 ? 53.569  31.724  7.075   1.00 91.48  ? 116  ARG E CD  1 
ATOM   9001  N NE  . ARG E 1 118 ? 53.722  30.343  6.635   1.00 93.19  ? 116  ARG E NE  1 
ATOM   9002  C CZ  . ARG E 1 118 ? 54.602  29.955  5.719   1.00 95.08  ? 116  ARG E CZ  1 
ATOM   9003  N NH1 . ARG E 1 118 ? 55.406  30.848  5.153   1.00 96.25  ? 116  ARG E NH1 1 
ATOM   9004  N NH2 . ARG E 1 118 ? 54.672  28.680  5.362   1.00 94.45  ? 116  ARG E NH2 1 
ATOM   9005  N N   . VAL E 1 119 ? 47.805  32.109  8.831   1.00 72.84  ? 117  VAL E N   1 
ATOM   9006  C CA  . VAL E 1 119 ? 46.412  31.855  8.491   1.00 70.86  ? 117  VAL E CA  1 
ATOM   9007  C C   . VAL E 1 119 ? 45.821  32.860  7.515   1.00 70.07  ? 117  VAL E C   1 
ATOM   9008  O O   . VAL E 1 119 ? 45.967  34.070  7.688   1.00 70.34  ? 117  VAL E O   1 
ATOM   9009  C CB  . VAL E 1 119 ? 45.534  31.865  9.748   1.00 73.60  ? 117  VAL E CB  1 
ATOM   9010  C CG1 . VAL E 1 119 ? 44.209  31.202  9.454   1.00 71.59  ? 117  VAL E CG1 1 
ATOM   9011  C CG2 . VAL E 1 119 ? 46.243  31.168  10.879  1.00 74.79  ? 117  VAL E CG2 1 
ATOM   9012  N N   . ILE E 1 120 ? 45.141  32.347  6.494   1.00 74.29  ? 118  ILE E N   1 
ATOM   9013  C CA  . ILE E 1 120 ? 44.501  33.192  5.494   1.00 72.19  ? 118  ILE E CA  1 
ATOM   9014  C C   . ILE E 1 120 ? 43.010  32.917  5.455   1.00 72.13  ? 118  ILE E C   1 
ATOM   9015  O O   . ILE E 1 120 ? 42.595  31.790  5.185   1.00 73.18  ? 118  ILE E O   1 
ATOM   9016  C CB  . ILE E 1 120 ? 45.046  32.926  4.088   1.00 60.10  ? 118  ILE E CB  1 
ATOM   9017  C CG1 . ILE E 1 120 ? 46.533  33.243  4.043   1.00 60.02  ? 118  ILE E CG1 1 
ATOM   9018  C CG2 . ILE E 1 120 ? 44.331  33.821  3.082   1.00 58.67  ? 118  ILE E CG2 1 
ATOM   9019  C CD1 . ILE E 1 120 ? 46.814  34.712  4.262   1.00 62.72  ? 118  ILE E CD1 1 
ATOM   9020  N N   . ARG E 1 121 ? 42.204  33.941  5.724   1.00 66.71  ? 119  ARG E N   1 
ATOM   9021  C CA  . ARG E 1 121 ? 40.759  33.769  5.691   1.00 64.22  ? 119  ARG E CA  1 
ATOM   9022  C C   . ARG E 1 121 ? 40.267  33.963  4.274   1.00 63.53  ? 119  ARG E C   1 
ATOM   9023  O O   . ARG E 1 121 ? 40.853  34.718  3.495   1.00 62.05  ? 119  ARG E O   1 
ATOM   9024  C CB  . ARG E 1 121 ? 40.039  34.761  6.598   1.00 65.35  ? 119  ARG E CB  1 
ATOM   9025  C CG  . ARG E 1 121 ? 38.556  34.484  6.613   1.00 64.73  ? 119  ARG E CG  1 
ATOM   9026  C CD  . ARG E 1 121 ? 37.763  35.392  7.517   1.00 63.99  ? 119  ARG E CD  1 
ATOM   9027  N NE  . ARG E 1 121 ? 36.369  34.965  7.499   1.00 66.46  ? 119  ARG E NE  1 
ATOM   9028  C CZ  . ARG E 1 121 ? 35.374  35.597  8.107   1.00 66.91  ? 119  ARG E CZ  1 
ATOM   9029  N NH1 . ARG E 1 121 ? 35.610  36.707  8.798   1.00 65.14  ? 119  ARG E NH1 1 
ATOM   9030  N NH2 . ARG E 1 121 ? 34.140  35.110  8.017   1.00 67.20  ? 119  ARG E NH2 1 
ATOM   9031  N N   . CYS E 1 122 ? 39.177  33.295  3.933   1.00 60.41  ? 120  CYS E N   1 
ATOM   9032  C CA  . CYS E 1 122 ? 38.688  33.420  2.584   1.00 62.38  ? 120  CYS E CA  1 
ATOM   9033  C C   . CYS E 1 122 ? 37.207  33.131  2.400   1.00 61.64  ? 120  CYS E C   1 
ATOM   9034  O O   . CYS E 1 122 ? 36.523  32.640  3.309   1.00 61.97  ? 120  CYS E O   1 
ATOM   9035  C CB  . CYS E 1 122 ? 39.563  32.539  1.683   1.00 72.11  ? 120  CYS E CB  1 
ATOM   9036  S SG  . CYS E 1 122 ? 38.807  31.188  0.716   1.00 77.91  ? 120  CYS E SG  1 
ATOM   9037  N N   . MET E 1 123 ? 36.725  33.482  1.213   1.00 73.74  ? 121  MET E N   1 
ATOM   9038  C CA  . MET E 1 123 ? 35.339  33.295  0.825   1.00 71.55  ? 121  MET E CA  1 
ATOM   9039  C C   . MET E 1 123 ? 35.312  32.948  -0.659  1.00 69.96  ? 121  MET E C   1 
ATOM   9040  O O   . MET E 1 123 ? 36.016  33.564  -1.462  1.00 69.19  ? 121  MET E O   1 
ATOM   9041  C CB  . MET E 1 123 ? 34.547  34.582  1.062   1.00 61.80  ? 121  MET E CB  1 
ATOM   9042  C CG  . MET E 1 123 ? 33.111  34.536  0.557   1.00 63.87  ? 121  MET E CG  1 
ATOM   9043  S SD  . MET E 1 123 ? 32.028  33.447  1.509   1.00 65.46  ? 121  MET E SD  1 
ATOM   9044  C CE  . MET E 1 123 ? 32.661  31.779  1.057   1.00 63.98  ? 121  MET E CE  1 
ATOM   9045  N N   . THR E 1 124 ? 34.513  31.953  -1.021  1.00 62.06  ? 122  THR E N   1 
ATOM   9046  C CA  . THR E 1 124 ? 34.392  31.545  -2.415  1.00 60.86  ? 122  THR E CA  1 
ATOM   9047  C C   . THR E 1 124 ? 33.000  30.983  -2.663  1.00 59.00  ? 122  THR E C   1 
ATOM   9048  O O   . THR E 1 124 ? 32.202  30.832  -1.732  1.00 59.13  ? 122  THR E O   1 
ATOM   9049  C CB  . THR E 1 124 ? 35.422  30.467  -2.782  1.00 73.77  ? 122  THR E CB  1 
ATOM   9050  O OG1 . THR E 1 124 ? 35.207  29.306  -1.973  1.00 78.39  ? 122  THR E OG1 1 
ATOM   9051  C CG2 . THR E 1 124 ? 36.815  30.967  -2.541  1.00 73.55  ? 122  THR E CG2 1 
ATOM   9052  N N   . ASN E 1 125 ? 32.715  30.659  -3.918  1.00 47.26  ? 123  ASN E N   1 
ATOM   9053  C CA  . ASN E 1 125 ? 31.410  30.123  -4.276  1.00 42.65  ? 123  ASN E CA  1 
ATOM   9054  C C   . ASN E 1 125 ? 31.526  28.795  -4.989  1.00 39.43  ? 123  ASN E C   1 
ATOM   9055  O O   . ASN E 1 125 ? 32.613  28.372  -5.379  1.00 35.43  ? 123  ASN E O   1 
ATOM   9056  C CB  . ASN E 1 125 ? 30.676  31.116  -5.167  1.00 54.79  ? 123  ASN E CB  1 
ATOM   9057  C CG  . ASN E 1 125 ? 31.583  31.718  -6.209  1.00 56.14  ? 123  ASN E CG  1 
ATOM   9058  O OD1 . ASN E 1 125 ? 32.161  31.008  -7.029  1.00 58.57  ? 123  ASN E OD1 1 
ATOM   9059  N ND2 . ASN E 1 125 ? 31.732  33.031  -6.174  1.00 59.49  ? 123  ASN E ND2 1 
ATOM   9060  N N   . THR E 1 126 ? 30.383  28.150  -5.166  1.00 35.86  ? 124  THR E N   1 
ATOM   9061  C CA  . THR E 1 126 ? 30.315  26.857  -5.822  1.00 37.31  ? 124  THR E CA  1 
ATOM   9062  C C   . THR E 1 126 ? 30.831  26.851  -7.263  1.00 37.61  ? 124  THR E C   1 
ATOM   9063  O O   . THR E 1 126 ? 31.628  25.991  -7.631  1.00 38.90  ? 124  THR E O   1 
ATOM   9064  C CB  . THR E 1 126 ? 28.883  26.344  -5.830  1.00 63.13  ? 124  THR E CB  1 
ATOM   9065  O OG1 . THR E 1 126 ? 28.166  26.920  -4.730  1.00 63.65  ? 124  THR E OG1 1 
ATOM   9066  C CG2 . THR E 1 126 ? 28.875  24.829  -5.703  1.00 66.05  ? 124  THR E CG2 1 
ATOM   9067  N N   . PRO E 1 127 ? 30.378  27.802  -8.102  1.00 39.50  ? 125  PRO E N   1 
ATOM   9068  C CA  . PRO E 1 127 ? 30.834  27.844  -9.494  1.00 39.57  ? 125  PRO E CA  1 
ATOM   9069  C C   . PRO E 1 127 ? 32.347  27.782  -9.665  1.00 39.83  ? 125  PRO E C   1 
ATOM   9070  O O   . PRO E 1 127 ? 32.863  27.828  -10.778 1.00 39.31  ? 125  PRO E O   1 
ATOM   9071  C CB  . PRO E 1 127 ? 30.212  29.137  -10.031 1.00 61.74  ? 125  PRO E CB  1 
ATOM   9072  C CG  . PRO E 1 127 ? 29.988  29.957  -8.808  1.00 62.48  ? 125  PRO E CG  1 
ATOM   9073  C CD  . PRO E 1 127 ? 29.492  28.942  -7.821  1.00 62.46  ? 125  PRO E CD  1 
ATOM   9074  N N   . VAL E 1 128 ? 33.060  27.685  -8.555  1.00 48.78  ? 126  VAL E N   1 
ATOM   9075  C CA  . VAL E 1 128 ? 34.503  27.550  -8.619  1.00 52.43  ? 126  VAL E CA  1 
ATOM   9076  C C   . VAL E 1 128 ? 34.712  26.153  -9.226  1.00 53.34  ? 126  VAL E C   1 
ATOM   9077  O O   . VAL E 1 128 ? 35.823  25.760  -9.567  1.00 53.02  ? 126  VAL E O   1 
ATOM   9078  C CB  . VAL E 1 128 ? 35.114  27.645  -7.203  1.00 52.05  ? 126  VAL E CB  1 
ATOM   9079  C CG1 . VAL E 1 128 ? 36.569  27.273  -7.228  1.00 52.26  ? 126  VAL E CG1 1 
ATOM   9080  C CG2 . VAL E 1 128 ? 34.965  29.063  -6.681  1.00 54.33  ? 126  VAL E CG2 1 
ATOM   9081  N N   . VAL E 1 129 ? 33.610  25.416  -9.365  1.00 55.39  ? 127  VAL E N   1 
ATOM   9082  C CA  . VAL E 1 129 ? 33.624  24.076  -9.946  1.00 55.23  ? 127  VAL E CA  1 
ATOM   9083  C C   . VAL E 1 129 ? 33.860  24.186  -11.447 1.00 58.93  ? 127  VAL E C   1 
ATOM   9084  O O   . VAL E 1 129 ? 34.226  23.210  -12.099 1.00 59.37  ? 127  VAL E O   1 
ATOM   9085  C CB  . VAL E 1 129 ? 32.271  23.356  -9.758  1.00 39.31  ? 127  VAL E CB  1 
ATOM   9086  C CG1 . VAL E 1 129 ? 32.325  21.978  -10.398 1.00 37.23  ? 127  VAL E CG1 1 
ATOM   9087  C CG2 . VAL E 1 129 ? 31.932  23.243  -8.287  1.00 40.51  ? 127  VAL E CG2 1 
ATOM   9088  N N   . VAL E 1 130 ? 33.627  25.378  -11.988 1.00 64.74  ? 128  VAL E N   1 
ATOM   9089  C CA  . VAL E 1 130 ? 33.800  25.629  -13.412 1.00 68.92  ? 128  VAL E CA  1 
ATOM   9090  C C   . VAL E 1 130 ? 34.597  26.913  -13.601 1.00 73.13  ? 128  VAL E C   1 
ATOM   9091  O O   . VAL E 1 130 ? 34.234  27.765  -14.415 1.00 74.05  ? 128  VAL E O   1 
ATOM   9092  C CB  . VAL E 1 130 ? 32.435  25.792  -14.120 1.00 58.68  ? 128  VAL E CB  1 
ATOM   9093  C CG1 . VAL E 1 130 ? 32.637  25.863  -15.614 1.00 61.19  ? 128  VAL E CG1 1 
ATOM   9094  C CG2 . VAL E 1 130 ? 31.519  24.633  -13.776 1.00 57.80  ? 128  VAL E CG2 1 
ATOM   9095  N N   . ARG E 1 131 ? 35.682  27.044  -12.841 1.00 85.79  ? 129  ARG E N   1 
ATOM   9096  C CA  . ARG E 1 131 ? 36.534  28.229  -12.908 1.00 87.50  ? 129  ARG E CA  1 
ATOM   9097  C C   . ARG E 1 131 ? 35.768  29.379  -12.264 1.00 86.02  ? 129  ARG E C   1 
ATOM   9098  O O   . ARG E 1 131 ? 35.915  29.641  -11.066 1.00 86.87  ? 129  ARG E O   1 
ATOM   9099  C CB  . ARG E 1 131 ? 36.850  28.557  -14.364 1.00 102.89 ? 129  ARG E CB  1 
ATOM   9100  C CG  . ARG E 1 131 ? 37.933  29.581  -14.599 1.00 112.31 ? 129  ARG E CG  1 
ATOM   9101  C CD  . ARG E 1 131 ? 37.900  29.951  -16.070 1.00 121.56 ? 129  ARG E CD  1 
ATOM   9102  N NE  . ARG E 1 131 ? 39.171  30.440  -16.586 1.00 128.17 ? 129  ARG E NE  1 
ATOM   9103  C CZ  . ARG E 1 131 ? 39.379  30.758  -17.859 1.00 131.12 ? 129  ARG E CZ  1 
ATOM   9104  N NH1 . ARG E 1 131 ? 38.395  30.635  -18.741 1.00 131.33 ? 129  ARG E NH1 1 
ATOM   9105  N NH2 . ARG E 1 131 ? 40.567  31.197  -18.254 1.00 133.76 ? 129  ARG E NH2 1 
ATOM   9106  N N   . GLU E 1 132 ? 34.931  30.038  -13.064 1.00 75.17  ? 130  GLU E N   1 
ATOM   9107  C CA  . GLU E 1 132 ? 34.116  31.164  -12.615 1.00 72.36  ? 130  GLU E CA  1 
ATOM   9108  C C   . GLU E 1 132 ? 33.737  31.064  -11.141 1.00 69.51  ? 130  GLU E C   1 
ATOM   9109  O O   . GLU E 1 132 ? 32.759  30.411  -10.774 1.00 69.18  ? 130  GLU E O   1 
ATOM   9110  C CB  . GLU E 1 132 ? 32.837  31.258  -13.446 1.00 74.89  ? 130  GLU E CB  1 
ATOM   9111  C CG  . GLU E 1 132 ? 33.038  31.126  -14.939 1.00 76.44  ? 130  GLU E CG  1 
ATOM   9112  C CD  . GLU E 1 132 ? 34.095  32.058  -15.468 1.00 77.71  ? 130  GLU E CD  1 
ATOM   9113  O OE1 . GLU E 1 132 ? 34.077  33.253  -15.095 1.00 77.81  ? 130  GLU E OE1 1 
ATOM   9114  O OE2 . GLU E 1 132 ? 34.935  31.591  -16.264 1.00 77.68  ? 130  GLU E OE2 1 
ATOM   9115  N N   . GLY E 1 133 ? 34.526  31.713  -10.299 1.00 50.43  ? 131  GLY E N   1 
ATOM   9116  C CA  . GLY E 1 133 ? 34.259  31.699  -8.883  1.00 45.48  ? 131  GLY E CA  1 
ATOM   9117  C C   . GLY E 1 133 ? 34.745  33.023  -8.360  1.00 44.81  ? 131  GLY E C   1 
ATOM   9118  O O   . GLY E 1 133 ? 35.762  33.535  -8.818  1.00 45.47  ? 131  GLY E O   1 
ATOM   9119  N N   . ALA E 1 134 ? 34.006  33.596  -7.424  1.00 43.40  ? 132  ALA E N   1 
ATOM   9120  C CA  . ALA E 1 134 ? 34.393  34.864  -6.837  1.00 43.92  ? 132  ALA E CA  1 
ATOM   9121  C C   . ALA E 1 134 ? 35.032  34.504  -5.514  1.00 44.53  ? 132  ALA E C   1 
ATOM   9122  O O   . ALA E 1 134 ? 34.366  33.994  -4.609  1.00 44.02  ? 132  ALA E O   1 
ATOM   9123  C CB  . ALA E 1 134 ? 33.174  35.733  -6.614  1.00 83.27  ? 132  ALA E CB  1 
ATOM   9124  N N   . THR E 1 135 ? 36.330  34.751  -5.405  1.00 66.52  ? 133  THR E N   1 
ATOM   9125  C CA  . THR E 1 135 ? 37.041  34.429  -4.182  1.00 69.37  ? 133  THR E CA  1 
ATOM   9126  C C   . THR E 1 135 ? 37.800  35.638  -3.649  1.00 69.88  ? 133  THR E C   1 
ATOM   9127  O O   . THR E 1 135 ? 38.540  36.309  -4.372  1.00 70.63  ? 133  THR E O   1 
ATOM   9128  C CB  . THR E 1 135 ? 38.020  33.263  -4.411  1.00 78.13  ? 133  THR E CB  1 
ATOM   9129  O OG1 . THR E 1 135 ? 39.172  33.729  -5.125  1.00 82.72  ? 133  THR E OG1 1 
ATOM   9130  C CG2 . THR E 1 135 ? 37.344  32.172  -5.231  1.00 76.82  ? 133  THR E CG2 1 
ATOM   9131  N N   . VAL E 1 136 ? 37.592  35.909  -2.370  1.00 62.07  ? 134  VAL E N   1 
ATOM   9132  C CA  . VAL E 1 136 ? 38.232  37.021  -1.699  1.00 62.23  ? 134  VAL E CA  1 
ATOM   9133  C C   . VAL E 1 136 ? 38.965  36.436  -0.493  1.00 64.26  ? 134  VAL E C   1 
ATOM   9134  O O   . VAL E 1 136 ? 38.520  35.436  0.077   1.00 64.73  ? 134  VAL E O   1 
ATOM   9135  C CB  . VAL E 1 136 ? 37.171  38.029  -1.237  1.00 46.98  ? 134  VAL E CB  1 
ATOM   9136  C CG1 . VAL E 1 136 ? 37.832  39.225  -0.607  1.00 48.20  ? 134  VAL E CG1 1 
ATOM   9137  C CG2 . VAL E 1 136 ? 36.330  38.460  -2.415  1.00 45.13  ? 134  VAL E CG2 1 
ATOM   9138  N N   . TYR E 1 137 ? 40.083  37.039  -0.097  1.00 55.66  ? 135  TYR E N   1 
ATOM   9139  C CA  . TYR E 1 137 ? 40.826  36.505  1.038   1.00 53.95  ? 135  TYR E CA  1 
ATOM   9140  C C   . TYR E 1 137 ? 41.567  37.544  1.862   1.00 55.21  ? 135  TYR E C   1 
ATOM   9141  O O   . TYR E 1 137 ? 42.224  38.440  1.331   1.00 53.45  ? 135  TYR E O   1 
ATOM   9142  C CB  . TYR E 1 137 ? 41.826  35.464  0.549   1.00 55.53  ? 135  TYR E CB  1 
ATOM   9143  C CG  . TYR E 1 137 ? 42.880  36.054  -0.353  1.00 52.37  ? 135  TYR E CG  1 
ATOM   9144  C CD1 . TYR E 1 137 ? 44.070  36.559  0.164   1.00 51.87  ? 135  TYR E CD1 1 
ATOM   9145  C CD2 . TYR E 1 137 ? 42.675  36.131  -1.725  1.00 51.02  ? 135  TYR E CD2 1 
ATOM   9146  C CE1 . TYR E 1 137 ? 45.032  37.126  -0.670  1.00 51.77  ? 135  TYR E CE1 1 
ATOM   9147  C CE2 . TYR E 1 137 ? 43.626  36.694  -2.566  1.00 50.48  ? 135  TYR E CE2 1 
ATOM   9148  C CZ  . TYR E 1 137 ? 44.802  37.190  -2.038  1.00 50.28  ? 135  TYR E CZ  1 
ATOM   9149  O OH  . TYR E 1 137 ? 45.743  37.742  -2.884  1.00 51.29  ? 135  TYR E OH  1 
ATOM   9150  N N   . ALA E 1 138 ? 41.444  37.413  3.175   1.00 56.45  ? 136  ALA E N   1 
ATOM   9151  C CA  . ALA E 1 138 ? 42.122  38.304  4.094   1.00 57.79  ? 136  ALA E CA  1 
ATOM   9152  C C   . ALA E 1 138 ? 43.365  37.559  4.558   1.00 58.68  ? 136  ALA E C   1 
ATOM   9153  O O   . ALA E 1 138 ? 43.284  36.412  5.000   1.00 57.41  ? 136  ALA E O   1 
ATOM   9154  C CB  . ALA E 1 138 ? 41.226  38.623  5.276   1.00 92.09  ? 136  ALA E CB  1 
ATOM   9155  N N   . THR E 1 139 ? 44.515  38.210  4.441   1.00 73.51  ? 137  THR E N   1 
ATOM   9156  C CA  . THR E 1 139 ? 45.776  37.616  4.843   1.00 75.14  ? 137  THR E CA  1 
ATOM   9157  C C   . THR E 1 139 ? 45.962  37.695  6.366   1.00 77.35  ? 137  THR E C   1 
ATOM   9158  O O   . THR E 1 139 ? 45.637  38.706  6.986   1.00 78.24  ? 137  THR E O   1 
ATOM   9159  C CB  . THR E 1 139 ? 46.939  38.321  4.124   1.00 71.97  ? 137  THR E CB  1 
ATOM   9160  O OG1 . THR E 1 139 ? 48.141  37.582  4.338   1.00 76.05  ? 137  THR E OG1 1 
ATOM   9161  C CG2 . THR E 1 139 ? 47.122  39.748  4.640   1.00 71.77  ? 137  THR E CG2 1 
ATOM   9162  N N   . GLY E 1 140 ? 46.477  36.622  6.964   1.00 70.33  ? 138  GLY E N   1 
ATOM   9163  C CA  . GLY E 1 140 ? 46.680  36.594  8.407   1.00 71.49  ? 138  GLY E CA  1 
ATOM   9164  C C   . GLY E 1 140 ? 47.757  37.515  8.964   1.00 73.17  ? 138  GLY E C   1 
ATOM   9165  O O   . GLY E 1 140 ? 48.339  38.326  8.247   1.00 73.09  ? 138  GLY E O   1 
ATOM   9166  N N   . THR E 1 141 ? 48.020  37.388  10.261  1.00 89.54  ? 139  THR E N   1 
ATOM   9167  C CA  . THR E 1 141 ? 49.025  38.210  10.934  1.00 88.33  ? 139  THR E CA  1 
ATOM   9168  C C   . THR E 1 141 ? 50.415  37.770  10.535  1.00 88.92  ? 139  THR E C   1 
ATOM   9169  O O   . THR E 1 141 ? 51.269  38.581  10.174  1.00 88.52  ? 139  THR E O   1 
ATOM   9170  C CB  . THR E 1 141 ? 48.953  38.065  12.459  1.00 60.98  ? 139  THR E CB  1 
ATOM   9171  O OG1 . THR E 1 141 ? 47.612  38.283  12.913  1.00 59.14  ? 139  THR E OG1 1 
ATOM   9172  C CG2 . THR E 1 141 ? 49.880  39.065  13.116  1.00 60.86  ? 139  THR E CG2 1 
ATOM   9173  N N   . HIS E 1 142 ? 50.624  36.463  10.631  1.00 79.82  ? 140  HIS E N   1 
ATOM   9174  C CA  . HIS E 1 142 ? 51.898  35.848  10.314  1.00 80.20  ? 140  HIS E CA  1 
ATOM   9175  C C   . HIS E 1 142 ? 51.976  35.563  8.834   1.00 80.49  ? 140  HIS E C   1 
ATOM   9176  O O   . HIS E 1 142 ? 53.062  35.437  8.273   1.00 81.45  ? 140  HIS E O   1 
ATOM   9177  C CB  . HIS E 1 142 ? 52.039  34.562  11.114  1.00 78.03  ? 140  HIS E CB  1 
ATOM   9178  C CG  . HIS E 1 142 ? 51.719  34.738  12.563  1.00 76.39  ? 140  HIS E CG  1 
ATOM   9179  N ND1 . HIS E 1 142 ? 52.407  35.616  13.370  1.00 76.06  ? 140  HIS E ND1 1 
ATOM   9180  C CD2 . HIS E 1 142 ? 50.755  34.189  13.338  1.00 76.36  ? 140  HIS E CD2 1 
ATOM   9181  C CE1 . HIS E 1 142 ? 51.880  35.601  14.582  1.00 77.09  ? 140  HIS E CE1 1 
ATOM   9182  N NE2 . HIS E 1 142 ? 50.876  34.743  14.588  1.00 75.77  ? 140  HIS E NE2 1 
ATOM   9183  N N   . ALA E 1 143 ? 50.813  35.466  8.205   1.00 61.72  ? 141  ALA E N   1 
ATOM   9184  C CA  . ALA E 1 143 ? 50.747  35.214  6.773   1.00 63.30  ? 141  ALA E CA  1 
ATOM   9185  C C   . ALA E 1 143 ? 51.719  36.149  6.044   1.00 65.08  ? 141  ALA E C   1 
ATOM   9186  O O   . ALA E 1 143 ? 51.510  37.359  5.992   1.00 65.02  ? 141  ALA E O   1 
ATOM   9187  C CB  . ALA E 1 143 ? 49.334  35.443  6.287   1.00 97.03  ? 141  ALA E CB  1 
ATOM   9188  N N   . GLN E 1 144 ? 52.787  35.589  5.489   1.00 95.41  ? 142  GLN E N   1 
ATOM   9189  C CA  . GLN E 1 144 ? 53.775  36.398  4.784   1.00 99.34  ? 142  GLN E CA  1 
ATOM   9190  C C   . GLN E 1 144 ? 53.277  37.016  3.484   1.00 100.40 ? 142  GLN E C   1 
ATOM   9191  O O   . GLN E 1 144 ? 52.385  36.484  2.820   1.00 100.82 ? 142  GLN E O   1 
ATOM   9192  C CB  . GLN E 1 144 ? 55.022  35.578  4.486   1.00 94.31  ? 142  GLN E CB  1 
ATOM   9193  C CG  . GLN E 1 144 ? 55.814  35.203  5.702   1.00 97.36  ? 142  GLN E CG  1 
ATOM   9194  C CD  . GLN E 1 144 ? 57.174  34.682  5.328   1.00 100.42 ? 142  GLN E CD  1 
ATOM   9195  O OE1 . GLN E 1 144 ? 57.969  35.389  4.703   1.00 101.64 ? 142  GLN E OE1 1 
ATOM   9196  N NE2 . GLN E 1 144 ? 57.454  33.437  5.698   1.00 101.44 ? 142  GLN E NE2 1 
ATOM   9197  N N   . VAL E 1 145 ? 53.886  38.140  3.120   1.00 87.39  ? 143  VAL E N   1 
ATOM   9198  C CA  . VAL E 1 145 ? 53.535  38.861  1.902   1.00 88.22  ? 143  VAL E CA  1 
ATOM   9199  C C   . VAL E 1 145 ? 53.773  37.971  0.688   1.00 85.92  ? 143  VAL E C   1 
ATOM   9200  O O   . VAL E 1 145 ? 53.416  38.318  -0.436  1.00 83.67  ? 143  VAL E O   1 
ATOM   9201  C CB  . VAL E 1 145 ? 54.391  40.146  1.749   1.00 200.00 ? 143  VAL E CB  1 
ATOM   9202  C CG1 . VAL E 1 145 ? 53.900  40.969  0.569   1.00 200.00 ? 143  VAL E CG1 1 
ATOM   9203  C CG2 . VAL E 1 145 ? 54.336  40.969  3.028   1.00 200.00 ? 143  VAL E CG2 1 
ATOM   9204  N N   . GLU E 1 146 ? 54.380  36.816  0.927   1.00 77.51  ? 144  GLU E N   1 
ATOM   9205  C CA  . GLU E 1 146 ? 54.679  35.878  -0.144  1.00 78.41  ? 144  GLU E CA  1 
ATOM   9206  C C   . GLU E 1 146 ? 53.600  34.825  -0.275  1.00 74.71  ? 144  GLU E C   1 
ATOM   9207  O O   . GLU E 1 146 ? 53.357  34.283  -1.355  1.00 71.65  ? 144  GLU E O   1 
ATOM   9208  C CB  . GLU E 1 146 ? 56.025  35.217  0.124   1.00 157.74 ? 144  GLU E CB  1 
ATOM   9209  C CG  . GLU E 1 146 ? 57.155  36.214  0.151   1.00 166.22 ? 144  GLU E CG  1 
ATOM   9210  C CD  . GLU E 1 146 ? 57.261  36.981  -1.152  1.00 171.76 ? 144  GLU E CD  1 
ATOM   9211  O OE1 . GLU E 1 146 ? 56.261  37.607  -1.569  1.00 174.43 ? 144  GLU E OE1 1 
ATOM   9212  O OE2 . GLU E 1 146 ? 58.348  36.957  -1.763  1.00 173.71 ? 144  GLU E OE2 1 
ATOM   9213  N N   . ASP E 1 147 ? 52.955  34.538  0.843   1.00 92.50  ? 145  ASP E N   1 
ATOM   9214  C CA  . ASP E 1 147 ? 51.900  33.553  0.857   1.00 91.59  ? 145  ASP E CA  1 
ATOM   9215  C C   . ASP E 1 147 ? 50.716  34.128  0.093   1.00 89.91  ? 145  ASP E C   1 
ATOM   9216  O O   . ASP E 1 147 ? 49.991  33.401  -0.583  1.00 91.20  ? 145  ASP E O   1 
ATOM   9217  C CB  . ASP E 1 147 ? 51.541  33.229  2.304   1.00 97.86  ? 145  ASP E CB  1 
ATOM   9218  C CG  . ASP E 1 147 ? 52.756  32.796  3.113   1.00 97.07  ? 145  ASP E CG  1 
ATOM   9219  O OD1 . ASP E 1 147 ? 53.409  31.805  2.719   1.00 96.73  ? 145  ASP E OD1 1 
ATOM   9220  O OD2 . ASP E 1 147 ? 53.063  33.447  4.133   1.00 96.20  ? 145  ASP E OD2 1 
ATOM   9221  N N   . GLY E 1 148 ? 50.535  35.440  0.191   1.00 70.93  ? 146  GLY E N   1 
ATOM   9222  C CA  . GLY E 1 148 ? 49.448  36.073  -0.531  1.00 66.92  ? 146  GLY E CA  1 
ATOM   9223  C C   . GLY E 1 148 ? 49.533  35.675  -1.992  1.00 64.72  ? 146  GLY E C   1 
ATOM   9224  O O   . GLY E 1 148 ? 48.628  35.032  -2.523  1.00 63.83  ? 146  GLY E O   1 
ATOM   9225  N N   . ARG E 1 149 ? 50.634  36.042  -2.639  1.00 71.14  ? 147  ARG E N   1 
ATOM   9226  C CA  . ARG E 1 149 ? 50.831  35.708  -4.039  1.00 71.50  ? 147  ARG E CA  1 
ATOM   9227  C C   . ARG E 1 149 ? 50.471  34.263  -4.354  1.00 70.08  ? 147  ARG E C   1 
ATOM   9228  O O   . ARG E 1 149 ? 49.905  33.982  -5.409  1.00 72.62  ? 147  ARG E O   1 
ATOM   9229  C CB  . ARG E 1 149 ? 52.276  35.973  -4.449  1.00 95.07  ? 147  ARG E CB  1 
ATOM   9230  C CG  . ARG E 1 149 ? 52.595  37.440  -4.565  1.00 101.58 ? 147  ARG E CG  1 
ATOM   9231  C CD  . ARG E 1 149 ? 54.002  37.648  -5.068  1.00 108.44 ? 147  ARG E CD  1 
ATOM   9232  N NE  . ARG E 1 149 ? 54.249  39.049  -5.393  1.00 115.82 ? 147  ARG E NE  1 
ATOM   9233  C CZ  . ARG E 1 149 ? 55.421  39.522  -5.804  1.00 118.62 ? 147  ARG E CZ  1 
ATOM   9234  N NH1 . ARG E 1 149 ? 56.454  38.701  -5.938  1.00 120.83 ? 147  ARG E NH1 1 
ATOM   9235  N NH2 . ARG E 1 149 ? 55.561  40.813  -6.085  1.00 119.14 ? 147  ARG E NH2 1 
ATOM   9236  N N   . LEU E 1 150 ? 50.789  33.345  -3.448  1.00 58.91  ? 148  LEU E N   1 
ATOM   9237  C CA  . LEU E 1 150 ? 50.475  31.946  -3.689  1.00 57.09  ? 148  LEU E CA  1 
ATOM   9238  C C   . LEU E 1 150 ? 48.984  31.693  -3.547  1.00 56.86  ? 148  LEU E C   1 
ATOM   9239  O O   . LEU E 1 150 ? 48.354  31.130  -4.449  1.00 57.56  ? 148  LEU E O   1 
ATOM   9240  C CB  . LEU E 1 150 ? 51.236  31.035  -2.730  1.00 69.53  ? 148  LEU E CB  1 
ATOM   9241  C CG  . LEU E 1 150 ? 50.946  29.554  -3.011  1.00 69.67  ? 148  LEU E CG  1 
ATOM   9242  C CD1 . LEU E 1 150 ? 51.349  29.206  -4.447  1.00 71.16  ? 148  LEU E CD1 1 
ATOM   9243  C CD2 . LEU E 1 150 ? 51.692  28.685  -2.024  1.00 67.71  ? 148  LEU E CD2 1 
ATOM   9244  N N   . MET E 1 151 ? 48.423  32.094  -2.410  1.00 54.88  ? 149  MET E N   1 
ATOM   9245  C CA  . MET E 1 151 ? 46.997  31.923  -2.170  1.00 54.97  ? 149  MET E CA  1 
ATOM   9246  C C   . MET E 1 151 ? 46.277  32.381  -3.428  1.00 54.64  ? 149  MET E C   1 
ATOM   9247  O O   . MET E 1 151 ? 45.545  31.615  -4.056  1.00 54.16  ? 149  MET E O   1 
ATOM   9248  C CB  . MET E 1 151 ? 46.556  32.777  -0.983  1.00 72.20  ? 149  MET E CB  1 
ATOM   9249  C CG  . MET E 1 151 ? 45.060  33.011  -0.909  1.00 75.60  ? 149  MET E CG  1 
ATOM   9250  S SD  . MET E 1 151 ? 44.105  31.484  -0.876  1.00 80.48  ? 149  MET E SD  1 
ATOM   9251  C CE  . MET E 1 151 ? 42.605  32.027  0.026   1.00 74.98  ? 149  MET E CE  1 
ATOM   9252  N N   . GLU E 1 152 ? 46.524  33.634  -3.801  1.00 52.03  ? 150  GLU E N   1 
ATOM   9253  C CA  . GLU E 1 152 ? 45.912  34.216  -4.982  1.00 52.36  ? 150  GLU E CA  1 
ATOM   9254  C C   . GLU E 1 152 ? 46.190  33.392  -6.223  1.00 51.53  ? 150  GLU E C   1 
ATOM   9255  O O   . GLU E 1 152 ? 45.292  32.728  -6.730  1.00 52.50  ? 150  GLU E O   1 
ATOM   9256  C CB  . GLU E 1 152 ? 46.401  35.646  -5.194  1.00 90.62  ? 150  GLU E CB  1 
ATOM   9257  C CG  . GLU E 1 152 ? 45.631  36.377  -6.278  1.00 97.23  ? 150  GLU E CG  1 
ATOM   9258  C CD  . GLU E 1 152 ? 45.775  37.883  -6.185  1.00 101.35 ? 150  GLU E CD  1 
ATOM   9259  O OE1 . GLU E 1 152 ? 46.922  38.372  -6.228  1.00 106.67 ? 150  GLU E OE1 1 
ATOM   9260  O OE2 . GLU E 1 152 ? 44.742  38.579  -6.071  1.00 102.66 ? 150  GLU E OE2 1 
ATOM   9261  N N   . GLN E 1 153 ? 47.424  33.432  -6.716  1.00 58.27  ? 151  GLN E N   1 
ATOM   9262  C CA  . GLN E 1 153 ? 47.779  32.664  -7.906  1.00 58.95  ? 151  GLN E CA  1 
ATOM   9263  C C   . GLN E 1 153 ? 47.012  31.361  -7.948  1.00 56.57  ? 151  GLN E C   1 
ATOM   9264  O O   . GLN E 1 153 ? 46.624  30.897  -9.014  1.00 56.26  ? 151  GLN E O   1 
ATOM   9265  C CB  . GLN E 1 153 ? 49.267  32.331  -7.932  1.00 100.81 ? 151  GLN E CB  1 
ATOM   9266  C CG  . GLN E 1 153 ? 50.158  33.410  -8.495  1.00 108.75 ? 151  GLN E CG  1 
ATOM   9267  C CD  . GLN E 1 153 ? 51.519  32.863  -8.873  1.00 112.57 ? 151  GLN E CD  1 
ATOM   9268  O OE1 . GLN E 1 153 ? 52.204  32.254  -8.048  1.00 114.59 ? 151  GLN E OE1 1 
ATOM   9269  N NE2 . GLN E 1 153 ? 51.916  33.069  -10.126 1.00 114.38 ? 151  GLN E NE2 1 
ATOM   9270  N N   . LEU E 1 154 ? 46.796  30.778  -6.775  1.00 52.47  ? 152  LEU E N   1 
ATOM   9271  C CA  . LEU E 1 154 ? 46.089  29.514  -6.663  1.00 49.40  ? 152  LEU E CA  1 
ATOM   9272  C C   . LEU E 1 154 ? 44.616  29.550  -7.070  1.00 47.63  ? 152  LEU E C   1 
ATOM   9273  O O   . LEU E 1 154 ? 44.218  28.924  -8.052  1.00 46.38  ? 152  LEU E O   1 
ATOM   9274  C CB  . LEU E 1 154 ? 46.205  28.986  -5.234  1.00 69.08  ? 152  LEU E CB  1 
ATOM   9275  C CG  . LEU E 1 154 ? 45.513  27.641  -5.002  1.00 68.56  ? 152  LEU E CG  1 
ATOM   9276  C CD1 . LEU E 1 154 ? 46.087  26.613  -5.965  1.00 64.57  ? 152  LEU E CD1 1 
ATOM   9277  C CD2 . LEU E 1 154 ? 45.693  27.199  -3.552  1.00 68.06  ? 152  LEU E CD2 1 
ATOM   9278  N N   . LEU E 1 155 ? 43.799  30.273  -6.318  1.00 64.34  ? 153  LEU E N   1 
ATOM   9279  C CA  . LEU E 1 155 ? 42.381  30.321  -6.638  1.00 64.74  ? 153  LEU E CA  1 
ATOM   9280  C C   . LEU E 1 155 ? 42.064  31.229  -7.818  1.00 64.62  ? 153  LEU E C   1 
ATOM   9281  O O   . LEU E 1 155 ? 41.018  31.081  -8.454  1.00 65.65  ? 153  LEU E O   1 
ATOM   9282  C CB  . LEU E 1 155 ? 41.570  30.702  -5.397  1.00 58.39  ? 153  LEU E CB  1 
ATOM   9283  C CG  . LEU E 1 155 ? 41.700  29.635  -4.296  1.00 58.36  ? 153  LEU E CG  1 
ATOM   9284  C CD1 . LEU E 1 155 ? 43.029  29.800  -3.557  1.00 57.48  ? 153  LEU E CD1 1 
ATOM   9285  C CD2 . LEU E 1 155 ? 40.552  29.742  -3.322  1.00 55.34  ? 153  LEU E CD2 1 
ATOM   9286  N N   . SER E 1 156 ? 42.966  32.163  -8.111  1.00 50.48  ? 154  SER E N   1 
ATOM   9287  C CA  . SER E 1 156 ? 42.790  33.036  -9.263  1.00 50.04  ? 154  SER E CA  1 
ATOM   9288  C C   . SER E 1 156 ? 42.622  32.074  -10.430 1.00 50.78  ? 154  SER E C   1 
ATOM   9289  O O   . SER E 1 156 ? 41.858  32.313  -11.353 1.00 52.33  ? 154  SER E O   1 
ATOM   9290  C CB  . SER E 1 156 ? 44.038  33.889  -9.481  1.00 62.12  ? 154  SER E CB  1 
ATOM   9291  O OG  . SER E 1 156 ? 44.023  35.036  -8.657  1.00 65.38  ? 154  SER E OG  1 
ATOM   9292  N N   . SER E 1 157 ? 43.349  30.967  -10.350 1.00 63.43  ? 155  SER E N   1 
ATOM   9293  C CA  . SER E 1 157 ? 43.324  29.919  -11.358 1.00 64.32  ? 155  SER E CA  1 
ATOM   9294  C C   . SER E 1 157 ? 41.932  29.367  -11.564 1.00 62.88  ? 155  SER E C   1 
ATOM   9295  O O   . SER E 1 157 ? 41.663  28.677  -12.544 1.00 64.77  ? 155  SER E O   1 
ATOM   9296  C CB  . SER E 1 157 ? 44.238  28.773  -10.935 1.00 92.89  ? 155  SER E CB  1 
ATOM   9297  O OG  . SER E 1 157 ? 45.570  29.229  -10.799 1.00 100.22 ? 155  SER E OG  1 
ATOM   9298  N N   . VAL E 1 158 ? 41.044  29.665  -10.632 1.00 48.62  ? 156  VAL E N   1 
ATOM   9299  C CA  . VAL E 1 158 ? 39.696  29.160  -10.728 1.00 47.95  ? 156  VAL E CA  1 
ATOM   9300  C C   . VAL E 1 158 ? 38.702  30.219  -10.296 1.00 49.42  ? 156  VAL E C   1 
ATOM   9301  O O   . VAL E 1 158 ? 38.212  30.205  -9.167  1.00 53.25  ? 156  VAL E O   1 
ATOM   9302  C CB  . VAL E 1 158 ? 39.532  27.916  -9.847  1.00 39.37  ? 156  VAL E CB  1 
ATOM   9303  C CG1 . VAL E 1 158 ? 38.146  27.351  -10.011 1.00 40.29  ? 156  VAL E CG1 1 
ATOM   9304  C CG2 . VAL E 1 158 ? 40.587  26.875  -10.213 1.00 41.31  ? 156  VAL E CG2 1 
ATOM   9305  N N   . GLY E 1 159 ? 38.405  31.140  -11.203 1.00 40.14  ? 157  GLY E N   1 
ATOM   9306  C CA  . GLY E 1 159 ? 37.468  32.199  -10.889 1.00 38.12  ? 157  GLY E CA  1 
ATOM   9307  C C   . GLY E 1 159 ? 38.197  33.487  -10.585 1.00 37.78  ? 157  GLY E C   1 
ATOM   9308  O O   . GLY E 1 159 ? 39.426  33.552  -10.654 1.00 34.63  ? 157  GLY E O   1 
ATOM   9309  N N   . PHE E 1 160 ? 37.430  34.520  -10.261 1.00 65.60  ? 158  PHE E N   1 
ATOM   9310  C CA  . PHE E 1 160 ? 37.988  35.822  -9.923  1.00 66.33  ? 158  PHE E CA  1 
ATOM   9311  C C   . PHE E 1 160 ? 38.514  35.749  -8.510  1.00 66.84  ? 158  PHE E C   1 
ATOM   9312  O O   . PHE E 1 160 ? 37.889  35.152  -7.636  1.00 66.32  ? 158  PHE E O   1 
ATOM   9313  C CB  . PHE E 1 160 ? 36.913  36.905  -9.995  1.00 48.40  ? 158  PHE E CB  1 
ATOM   9314  C CG  . PHE E 1 160 ? 37.264  38.158  -9.240  1.00 44.37  ? 158  PHE E CG  1 
ATOM   9315  C CD1 . PHE E 1 160 ? 38.361  38.931  -9.614  1.00 41.56  ? 158  PHE E CD1 1 
ATOM   9316  C CD2 . PHE E 1 160 ? 36.491  38.565  -8.155  1.00 42.83  ? 158  PHE E CD2 1 
ATOM   9317  C CE1 . PHE E 1 160 ? 38.681  40.094  -8.918  1.00 41.35  ? 158  PHE E CE1 1 
ATOM   9318  C CE2 . PHE E 1 160 ? 36.805  39.727  -7.453  1.00 41.21  ? 158  PHE E CE2 1 
ATOM   9319  C CZ  . PHE E 1 160 ? 37.902  40.494  -7.836  1.00 40.33  ? 158  PHE E CZ  1 
ATOM   9320  N N   . CYS E 1 161 ? 39.646  36.395  -8.285  1.00 44.22  ? 159  CYS E N   1 
ATOM   9321  C CA  . CYS E 1 161 ? 40.269  36.380  -6.980  1.00 47.67  ? 159  CYS E CA  1 
ATOM   9322  C C   . CYS E 1 161 ? 40.983  37.688  -6.639  1.00 47.94  ? 159  CYS E C   1 
ATOM   9323  O O   . CYS E 1 161 ? 41.656  38.280  -7.489  1.00 48.38  ? 159  CYS E O   1 
ATOM   9324  C CB  . CYS E 1 161 ? 41.258  35.221  -6.936  1.00 77.62  ? 159  CYS E CB  1 
ATOM   9325  S SG  . CYS E 1 161 ? 41.970  34.966  -5.334  1.00 86.99  ? 159  CYS E SG  1 
ATOM   9326  N N   . THR E 1 162 ? 40.828  38.127  -5.391  1.00 59.38  ? 160  THR E N   1 
ATOM   9327  C CA  . THR E 1 162 ? 41.466  39.347  -4.886  1.00 63.07  ? 160  THR E CA  1 
ATOM   9328  C C   . THR E 1 162 ? 41.361  39.427  -3.359  1.00 63.35  ? 160  THR E C   1 
ATOM   9329  O O   . THR E 1 162 ? 40.390  38.943  -2.768  1.00 62.85  ? 160  THR E O   1 
ATOM   9330  C CB  . THR E 1 162 ? 40.844  40.629  -5.502  1.00 79.82  ? 160  THR E CB  1 
ATOM   9331  O OG1 . THR E 1 162 ? 41.156  40.685  -6.898  1.00 83.91  ? 160  THR E OG1 1 
ATOM   9332  C CG2 . THR E 1 162 ? 41.406  41.880  -4.830  1.00 81.97  ? 160  THR E CG2 1 
ATOM   9333  N N   . GLU E 1 163 ? 42.363  40.028  -2.720  1.00 70.26  ? 161  GLU E N   1 
ATOM   9334  C CA  . GLU E 1 163 ? 42.350  40.146  -1.267  1.00 72.53  ? 161  GLU E CA  1 
ATOM   9335  C C   . GLU E 1 163 ? 41.587  41.383  -0.816  1.00 71.57  ? 161  GLU E C   1 
ATOM   9336  O O   . GLU E 1 163 ? 41.492  42.373  -1.545  1.00 71.79  ? 161  GLU E O   1 
ATOM   9337  C CB  . GLU E 1 163 ? 43.772  40.205  -0.709  1.00 89.58  ? 161  GLU E CB  1 
ATOM   9338  C CG  . GLU E 1 163 ? 44.471  41.530  -0.911  1.00 95.16  ? 161  GLU E CG  1 
ATOM   9339  C CD  . GLU E 1 163 ? 45.737  41.634  -0.088  1.00 98.34  ? 161  GLU E CD  1 
ATOM   9340  O OE1 . GLU E 1 163 ? 45.653  41.511  1.155   1.00 98.15  ? 161  GLU E OE1 1 
ATOM   9341  O OE2 . GLU E 1 163 ? 46.814  41.836  -0.687  1.00 102.04 ? 161  GLU E OE2 1 
ATOM   9342  N N   . VAL E 1 164 ? 41.060  41.321  0.401   1.00 67.00  ? 162  VAL E N   1 
ATOM   9343  C CA  . VAL E 1 164 ? 40.289  42.418  0.965   1.00 66.52  ? 162  VAL E CA  1 
ATOM   9344  C C   . VAL E 1 164 ? 40.478  42.546  2.468   1.00 66.19  ? 162  VAL E C   1 
ATOM   9345  O O   . VAL E 1 164 ? 40.806  41.570  3.150   1.00 66.03  ? 162  VAL E O   1 
ATOM   9346  C CB  . VAL E 1 164 ? 38.798  42.212  0.698   1.00 84.27  ? 162  VAL E CB  1 
ATOM   9347  C CG1 . VAL E 1 164 ? 37.988  43.254  1.432   1.00 85.86  ? 162  VAL E CG1 1 
ATOM   9348  C CG2 . VAL E 1 164 ? 38.538  42.288  -0.783  1.00 87.38  ? 162  VAL E CG2 1 
ATOM   9349  N N   . GLU E 1 165 ? 40.275  43.756  2.979   1.00 51.62  ? 163  GLU E N   1 
ATOM   9350  C CA  . GLU E 1 165 ? 40.390  43.987  4.408   1.00 53.53  ? 163  GLU E CA  1 
ATOM   9351  C C   . GLU E 1 165 ? 39.330  43.054  4.999   1.00 52.73  ? 163  GLU E C   1 
ATOM   9352  O O   . GLU E 1 165 ? 38.150  43.154  4.667   1.00 53.82  ? 163  GLU E O   1 
ATOM   9353  C CB  . GLU E 1 165 ? 40.082  45.453  4.731   1.00 94.59  ? 163  GLU E CB  1 
ATOM   9354  C CG  . GLU E 1 165 ? 40.745  45.973  6.005   1.00 98.04  ? 163  GLU E CG  1 
ATOM   9355  C CD  . GLU E 1 165 ? 42.265  45.904  5.946   1.00 100.07 ? 163  GLU E CD  1 
ATOM   9356  O OE1 . GLU E 1 165 ? 42.854  46.477  5.005   1.00 101.12 ? 163  GLU E OE1 1 
ATOM   9357  O OE2 . GLU E 1 165 ? 42.875  45.279  6.841   1.00 99.68  ? 163  GLU E OE2 1 
ATOM   9358  N N   . GLU E 1 166 ? 39.756  42.134  5.856   1.00 60.36  ? 164  GLU E N   1 
ATOM   9359  C CA  . GLU E 1 166 ? 38.844  41.162  6.446   1.00 59.48  ? 164  GLU E CA  1 
ATOM   9360  C C   . GLU E 1 166 ? 37.494  41.682  6.918   1.00 58.59  ? 164  GLU E C   1 
ATOM   9361  O O   . GLU E 1 166 ? 36.528  40.932  6.967   1.00 57.99  ? 164  GLU E O   1 
ATOM   9362  C CB  . GLU E 1 166 ? 39.519  40.431  7.608   1.00 68.55  ? 164  GLU E CB  1 
ATOM   9363  C CG  . GLU E 1 166 ? 38.593  39.425  8.285   1.00 72.27  ? 164  GLU E CG  1 
ATOM   9364  C CD  . GLU E 1 166 ? 39.299  38.571  9.309   1.00 72.63  ? 164  GLU E CD  1 
ATOM   9365  O OE1 . GLU E 1 166 ? 38.625  37.737  9.957   1.00 72.93  ? 164  GLU E OE1 1 
ATOM   9366  O OE2 . GLU E 1 166 ? 40.528  38.735  9.459   1.00 72.47  ? 164  GLU E OE2 1 
ATOM   9367  N N   . ASP E 1 167 ? 37.416  42.953  7.278   1.00 80.69  ? 165  ASP E N   1 
ATOM   9368  C CA  . ASP E 1 167 ? 36.156  43.500  7.754   1.00 79.79  ? 165  ASP E CA  1 
ATOM   9369  C C   . ASP E 1 167 ? 35.064  43.598  6.676   1.00 78.89  ? 165  ASP E C   1 
ATOM   9370  O O   . ASP E 1 167 ? 33.963  44.069  6.957   1.00 81.40  ? 165  ASP E O   1 
ATOM   9371  C CB  . ASP E 1 167 ? 36.405  44.867  8.405   1.00 77.51  ? 165  ASP E CB  1 
ATOM   9372  C CG  . ASP E 1 167 ? 37.180  45.817  7.502   1.00 79.20  ? 165  ASP E CG  1 
ATOM   9373  O OD1 . ASP E 1 167 ? 38.037  45.340  6.730   1.00 80.21  ? 165  ASP E OD1 1 
ATOM   9374  O OD2 . ASP E 1 167 ? 36.946  47.043  7.573   1.00 80.11  ? 165  ASP E OD2 1 
ATOM   9375  N N   . LEU E 1 168 ? 35.359  43.148  5.455   1.00 53.86  ? 166  LEU E N   1 
ATOM   9376  C CA  . LEU E 1 168 ? 34.375  43.192  4.369   1.00 47.13  ? 166  LEU E CA  1 
ATOM   9377  C C   . LEU E 1 168 ? 33.871  41.790  4.001   1.00 44.73  ? 166  LEU E C   1 
ATOM   9378  O O   . LEU E 1 168 ? 32.794  41.638  3.422   1.00 43.99  ? 166  LEU E O   1 
ATOM   9379  C CB  . LEU E 1 168 ? 34.971  43.845  3.114   1.00 48.34  ? 166  LEU E CB  1 
ATOM   9380  C CG  . LEU E 1 168 ? 35.685  45.201  3.187   1.00 47.39  ? 166  LEU E CG  1 
ATOM   9381  C CD1 . LEU E 1 168 ? 36.008  45.674  1.768   1.00 43.40  ? 166  LEU E CD1 1 
ATOM   9382  C CD2 . LEU E 1 168 ? 34.813  46.227  3.889   1.00 46.67  ? 166  LEU E CD2 1 
ATOM   9383  N N   . ILE E 1 169 ? 34.653  40.773  4.348   1.00 38.34  ? 167  ILE E N   1 
ATOM   9384  C CA  . ILE E 1 169 ? 34.327  39.380  4.049   1.00 38.92  ? 167  ILE E CA  1 
ATOM   9385  C C   . ILE E 1 169 ? 32.902  38.938  4.382   1.00 39.27  ? 167  ILE E C   1 
ATOM   9386  O O   . ILE E 1 169 ? 32.289  38.192  3.620   1.00 38.69  ? 167  ILE E O   1 
ATOM   9387  C CB  . ILE E 1 169 ? 35.318  38.417  4.758   1.00 58.06  ? 167  ILE E CB  1 
ATOM   9388  C CG1 . ILE E 1 169 ? 36.704  38.544  4.132   1.00 57.95  ? 167  ILE E CG1 1 
ATOM   9389  C CG2 . ILE E 1 169 ? 34.846  36.970  4.630   1.00 57.31  ? 167  ILE E CG2 1 
ATOM   9390  C CD1 . ILE E 1 169 ? 36.709  38.279  2.655   1.00 63.77  ? 167  ILE E CD1 1 
ATOM   9391  N N   . ASP E 1 170 ? 32.385  39.368  5.525   1.00 49.02  ? 168  ASP E N   1 
ATOM   9392  C CA  . ASP E 1 170 ? 31.031  38.999  5.911   1.00 49.60  ? 168  ASP E CA  1 
ATOM   9393  C C   . ASP E 1 170 ? 30.087  39.422  4.797   1.00 49.22  ? 168  ASP E C   1 
ATOM   9394  O O   . ASP E 1 170 ? 29.165  38.696  4.444   1.00 50.74  ? 168  ASP E O   1 
ATOM   9395  C CB  . ASP E 1 170 ? 30.620  39.704  7.205   1.00 71.63  ? 168  ASP E CB  1 
ATOM   9396  C CG  . ASP E 1 170 ? 31.273  39.110  8.434   1.00 73.00  ? 168  ASP E CG  1 
ATOM   9397  O OD1 . ASP E 1 170 ? 32.499  39.266  8.615   1.00 73.71  ? 168  ASP E OD1 1 
ATOM   9398  O OD2 . ASP E 1 170 ? 30.545  38.480  9.225   1.00 75.86  ? 168  ASP E OD2 1 
ATOM   9399  N N   . ALA E 1 171 ? 30.324  40.608  4.247   1.00 47.88  ? 169  ALA E N   1 
ATOM   9400  C CA  . ALA E 1 171 ? 29.489  41.127  3.173   1.00 45.54  ? 169  ALA E CA  1 
ATOM   9401  C C   . ALA E 1 171 ? 29.702  40.309  1.923   1.00 44.54  ? 169  ALA E C   1 
ATOM   9402  O O   . ALA E 1 171 ? 28.751  39.800  1.330   1.00 46.32  ? 169  ALA E O   1 
ATOM   9403  C CB  . ALA E 1 171 ? 29.828  42.574  2.893   1.00 40.05  ? 169  ALA E CB  1 
ATOM   9404  N N   . VAL E 1 172 ? 30.960  40.175  1.525   1.00 37.29  ? 170  VAL E N   1 
ATOM   9405  C CA  . VAL E 1 172 ? 31.291  39.426  0.326   1.00 33.17  ? 170  VAL E CA  1 
ATOM   9406  C C   . VAL E 1 172 ? 30.709  38.024  0.351   1.00 33.73  ? 170  VAL E C   1 
ATOM   9407  O O   . VAL E 1 172 ? 30.967  37.212  -0.529  1.00 36.94  ? 170  VAL E O   1 
ATOM   9408  C CB  . VAL E 1 172 ? 32.797  39.348  0.145   1.00 19.12  ? 170  VAL E CB  1 
ATOM   9409  C CG1 . VAL E 1 172 ? 33.127  38.690  -1.173  1.00 21.70  ? 170  VAL E CG1 1 
ATOM   9410  C CG2 . VAL E 1 172 ? 33.381  40.745  0.178   1.00 17.85  ? 170  VAL E CG2 1 
ATOM   9411  N N   . THR E 1 173 ? 29.909  37.746  1.365   1.00 37.25  ? 171  THR E N   1 
ATOM   9412  C CA  . THR E 1 173 ? 29.284  36.448  1.499   1.00 38.63  ? 171  THR E CA  1 
ATOM   9413  C C   . THR E 1 173 ? 27.814  36.649  1.140   1.00 39.22  ? 171  THR E C   1 
ATOM   9414  O O   . THR E 1 173 ? 27.208  35.832  0.435   1.00 37.16  ? 171  THR E O   1 
ATOM   9415  C CB  . THR E 1 173 ? 29.412  35.948  2.953   1.00 43.90  ? 171  THR E CB  1 
ATOM   9416  O OG1 . THR E 1 173 ? 30.749  36.175  3.419   1.00 46.02  ? 171  THR E OG1 1 
ATOM   9417  C CG2 . THR E 1 173 ? 29.106  34.462  3.039   1.00 45.40  ? 171  THR E CG2 1 
ATOM   9418  N N   . GLY E 1 174 ? 27.255  37.757  1.633   1.00 40.14  ? 172  GLY E N   1 
ATOM   9419  C CA  . GLY E 1 174 ? 25.864  38.088  1.380   1.00 38.02  ? 172  GLY E CA  1 
ATOM   9420  C C   . GLY E 1 174 ? 25.660  38.299  -0.098  1.00 38.61  ? 172  GLY E C   1 
ATOM   9421  O O   . GLY E 1 174 ? 24.548  38.185  -0.623  1.00 37.44  ? 172  GLY E O   1 
ATOM   9422  N N   . LEU E 1 175 ? 26.760  38.595  -0.777  1.00 39.81  ? 173  LEU E N   1 
ATOM   9423  C CA  . LEU E 1 175 ? 26.708  38.829  -2.204  1.00 40.29  ? 173  LEU E CA  1 
ATOM   9424  C C   . LEU E 1 175 ? 27.107  37.589  -2.989  1.00 40.47  ? 173  LEU E C   1 
ATOM   9425  O O   . LEU E 1 175 ? 26.284  36.711  -3.231  1.00 39.38  ? 173  LEU E O   1 
ATOM   9426  C CB  . LEU E 1 175 ? 27.628  39.989  -2.582  1.00 34.20  ? 173  LEU E CB  1 
ATOM   9427  C CG  . LEU E 1 175 ? 27.470  40.402  -4.045  1.00 29.60  ? 173  LEU E CG  1 
ATOM   9428  C CD1 . LEU E 1 175 ? 26.084  40.992  -4.230  1.00 28.52  ? 173  LEU E CD1 1 
ATOM   9429  C CD2 . LEU E 1 175 ? 28.541  41.400  -4.442  1.00 31.17  ? 173  LEU E CD2 1 
ATOM   9430  N N   . SER E 1 176 ? 28.380  37.538  -3.377  1.00 38.70  ? 174  SER E N   1 
ATOM   9431  C CA  . SER E 1 176 ? 28.931  36.437  -4.149  1.00 41.00  ? 174  SER E CA  1 
ATOM   9432  C C   . SER E 1 176 ? 28.964  35.156  -3.340  1.00 41.82  ? 174  SER E C   1 
ATOM   9433  O O   . SER E 1 176 ? 29.151  34.076  -3.895  1.00 44.25  ? 174  SER E O   1 
ATOM   9434  C CB  . SER E 1 176 ? 30.344  36.769  -4.590  1.00 51.13  ? 174  SER E CB  1 
ATOM   9435  O OG  . SER E 1 176 ? 31.186  36.844  -3.458  1.00 57.22  ? 174  SER E OG  1 
ATOM   9436  N N   . GLY E 1 177 ? 28.805  35.270  -2.026  1.00 42.70  ? 175  GLY E N   1 
ATOM   9437  C CA  . GLY E 1 177 ? 28.815  34.074  -1.209  1.00 42.47  ? 175  GLY E CA  1 
ATOM   9438  C C   . GLY E 1 177 ? 27.601  33.222  -1.545  1.00 43.10  ? 175  GLY E C   1 
ATOM   9439  O O   . GLY E 1 177 ? 27.695  32.171  -2.178  1.00 41.79  ? 175  GLY E O   1 
ATOM   9440  N N   . SER E 1 178 ? 26.444  33.697  -1.116  1.00 47.57  ? 176  SER E N   1 
ATOM   9441  C CA  . SER E 1 178 ? 25.189  33.008  -1.355  1.00 47.42  ? 176  SER E CA  1 
ATOM   9442  C C   . SER E 1 178 ? 24.574  33.509  -2.665  1.00 46.44  ? 176  SER E C   1 
ATOM   9443  O O   . SER E 1 178 ? 23.407  33.243  -2.965  1.00 45.64  ? 176  SER E O   1 
ATOM   9444  C CB  . SER E 1 178 ? 24.265  33.290  -0.181  1.00 42.22  ? 176  SER E CB  1 
ATOM   9445  O OG  . SER E 1 178 ? 24.531  34.588  0.328   1.00 39.19  ? 176  SER E OG  1 
ATOM   9446  N N   . GLY E 1 179 ? 25.385  34.229  -3.437  1.00 48.79  ? 177  GLY E N   1 
ATOM   9447  C CA  . GLY E 1 179 ? 24.940  34.786  -4.703  1.00 47.68  ? 177  GLY E CA  1 
ATOM   9448  C C   . GLY E 1 179 ? 24.367  33.762  -5.654  1.00 47.85  ? 177  GLY E C   1 
ATOM   9449  O O   . GLY E 1 179 ? 23.212  33.866  -6.046  1.00 46.74  ? 177  GLY E O   1 
ATOM   9450  N N   . PRO E 1 180 ? 25.160  32.763  -6.056  1.00 41.47  ? 178  PRO E N   1 
ATOM   9451  C CA  . PRO E 1 180 ? 24.691  31.728  -6.971  1.00 41.05  ? 178  PRO E CA  1 
ATOM   9452  C C   . PRO E 1 180 ? 23.279  31.266  -6.630  1.00 40.52  ? 178  PRO E C   1 
ATOM   9453  O O   . PRO E 1 180 ? 22.390  31.263  -7.484  1.00 43.08  ? 178  PRO E O   1 
ATOM   9454  C CB  . PRO E 1 180 ? 25.727  30.632  -6.787  1.00 57.56  ? 178  PRO E CB  1 
ATOM   9455  C CG  . PRO E 1 180 ? 26.975  31.419  -6.621  1.00 55.30  ? 178  PRO E CG  1 
ATOM   9456  C CD  . PRO E 1 180 ? 26.551  32.501  -5.648  1.00 58.05  ? 178  PRO E CD  1 
ATOM   9457  N N   . ALA E 1 181 ? 23.073  30.879  -5.380  1.00 33.75  ? 179  ALA E N   1 
ATOM   9458  C CA  . ALA E 1 181 ? 21.761  30.431  -4.953  1.00 30.68  ? 179  ALA E CA  1 
ATOM   9459  C C   . ALA E 1 181 ? 20.737  31.415  -5.519  1.00 29.30  ? 179  ALA E C   1 
ATOM   9460  O O   . ALA E 1 181 ? 19.697  31.018  -6.053  1.00 31.95  ? 179  ALA E O   1 
ATOM   9461  C CB  . ALA E 1 181 ? 21.700  30.403  -3.438  1.00 63.59  ? 179  ALA E CB  1 
ATOM   9462  N N   . TYR E 1 182 ? 21.055  32.702  -5.408  1.00 27.63  ? 180  TYR E N   1 
ATOM   9463  C CA  . TYR E 1 182 ? 20.196  33.767  -5.918  1.00 24.58  ? 180  TYR E CA  1 
ATOM   9464  C C   . TYR E 1 182 ? 19.925  33.483  -7.390  1.00 23.13  ? 180  TYR E C   1 
ATOM   9465  O O   . TYR E 1 182 ? 18.795  33.199  -7.775  1.00 20.79  ? 180  TYR E O   1 
ATOM   9466  C CB  . TYR E 1 182 ? 20.882  35.131  -5.771  1.00 34.53  ? 180  TYR E CB  1 
ATOM   9467  C CG  . TYR E 1 182 ? 21.213  35.565  -4.352  1.00 37.89  ? 180  TYR E CG  1 
ATOM   9468  C CD1 . TYR E 1 182 ? 22.246  36.476  -4.107  1.00 38.49  ? 180  TYR E CD1 1 
ATOM   9469  C CD2 . TYR E 1 182 ? 20.474  35.105  -3.263  1.00 38.49  ? 180  TYR E CD2 1 
ATOM   9470  C CE1 . TYR E 1 182 ? 22.534  36.917  -2.815  1.00 40.15  ? 180  TYR E CE1 1 
ATOM   9471  C CE2 . TYR E 1 182 ? 20.752  35.542  -1.966  1.00 39.47  ? 180  TYR E CE2 1 
ATOM   9472  C CZ  . TYR E 1 182 ? 21.780  36.449  -1.748  1.00 39.79  ? 180  TYR E CZ  1 
ATOM   9473  O OH  . TYR E 1 182 ? 22.038  36.902  -0.470  1.00 37.22  ? 180  TYR E OH  1 
ATOM   9474  N N   . ALA E 1 183 ? 20.976  33.545  -8.205  1.00 23.30  ? 181  ALA E N   1 
ATOM   9475  C CA  . ALA E 1 183 ? 20.850  33.290  -9.631  1.00 22.59  ? 181  ALA E CA  1 
ATOM   9476  C C   . ALA E 1 183 ? 19.984  32.072  -9.870  1.00 25.94  ? 181  ALA E C   1 
ATOM   9477  O O   . ALA E 1 183 ? 18.932  32.169  -10.496 1.00 30.75  ? 181  ALA E O   1 
ATOM   9478  C CB  . ALA E 1 183 ? 22.206  33.074  -10.244 1.00 1.00   ? 181  ALA E CB  1 
ATOM   9479  N N   . PHE E 1 184 ? 20.426  30.923  -9.372  1.00 26.76  ? 182  PHE E N   1 
ATOM   9480  C CA  . PHE E 1 184 ? 19.673  29.691  -9.543  1.00 27.45  ? 182  PHE E CA  1 
ATOM   9481  C C   . PHE E 1 184 ? 18.182  29.919  -9.402  1.00 27.76  ? 182  PHE E C   1 
ATOM   9482  O O   . PHE E 1 184 ? 17.421  29.720  -10.354 1.00 30.87  ? 182  PHE E O   1 
ATOM   9483  C CB  . PHE E 1 184 ? 20.137  28.654  -8.532  1.00 37.16  ? 182  PHE E CB  1 
ATOM   9484  C CG  . PHE E 1 184 ? 21.482  28.087  -8.846  1.00 41.88  ? 182  PHE E CG  1 
ATOM   9485  C CD1 . PHE E 1 184 ? 22.270  27.518  -7.846  1.00 45.66  ? 182  PHE E CD1 1 
ATOM   9486  C CD2 . PHE E 1 184 ? 21.966  28.118  -10.157 1.00 43.17  ? 182  PHE E CD2 1 
ATOM   9487  C CE1 . PHE E 1 184 ? 23.523  26.989  -8.150  1.00 48.82  ? 182  PHE E CE1 1 
ATOM   9488  C CE2 . PHE E 1 184 ? 23.211  27.595  -10.476 1.00 44.94  ? 182  PHE E CE2 1 
ATOM   9489  C CZ  . PHE E 1 184 ? 23.994  27.028  -9.475  1.00 48.27  ? 182  PHE E CZ  1 
ATOM   9490  N N   . THR E 1 185 ? 17.755  30.351  -8.225  1.00 25.94  ? 183  THR E N   1 
ATOM   9491  C CA  . THR E 1 185 ? 16.339  30.589  -8.032  1.00 27.33  ? 183  THR E CA  1 
ATOM   9492  C C   . THR E 1 185 ? 15.736  31.455  -9.123  1.00 29.72  ? 183  THR E C   1 
ATOM   9493  O O   . THR E 1 185 ? 14.566  31.298  -9.447  1.00 32.42  ? 183  THR E O   1 
ATOM   9494  C CB  . THR E 1 185 ? 16.056  31.255  -6.696  1.00 28.59  ? 183  THR E CB  1 
ATOM   9495  O OG1 . THR E 1 185 ? 16.418  30.362  -5.636  1.00 33.54  ? 183  THR E OG1 1 
ATOM   9496  C CG2 . THR E 1 185 ? 14.585  31.602  -6.589  1.00 26.95  ? 183  THR E CG2 1 
ATOM   9497  N N   . ALA E 1 186 ? 16.525  32.370  -9.681  1.00 37.48  ? 184  ALA E N   1 
ATOM   9498  C CA  . ALA E 1 186 ? 16.043  33.253  -10.741 1.00 38.42  ? 184  ALA E CA  1 
ATOM   9499  C C   . ALA E 1 186 ? 15.809  32.452  -12.001 1.00 38.51  ? 184  ALA E C   1 
ATOM   9500  O O   . ALA E 1 186 ? 14.673  32.316  -12.458 1.00 40.34  ? 184  ALA E O   1 
ATOM   9501  C CB  . ALA E 1 186 ? 17.050  34.338  -11.021 1.00 30.00  ? 184  ALA E CB  1 
ATOM   9502  N N   . LEU E 1 187 ? 16.899  31.932  -12.560 1.00 32.07  ? 185  LEU E N   1 
ATOM   9503  C CA  . LEU E 1 187 ? 16.841  31.123  -13.774 1.00 31.61  ? 185  LEU E CA  1 
ATOM   9504  C C   . LEU E 1 187 ? 15.650  30.183  -13.753 1.00 32.74  ? 185  LEU E C   1 
ATOM   9505  O O   . LEU E 1 187 ? 14.870  30.111  -14.708 1.00 36.50  ? 185  LEU E O   1 
ATOM   9506  C CB  . LEU E 1 187 ? 18.112  30.304  -13.919 1.00 29.15  ? 185  LEU E CB  1 
ATOM   9507  C CG  . LEU E 1 187 ? 19.375  31.152  -14.044 1.00 28.73  ? 185  LEU E CG  1 
ATOM   9508  C CD1 . LEU E 1 187 ? 20.185  31.079  -12.756 1.00 27.14  ? 185  LEU E CD1 1 
ATOM   9509  C CD2 . LEU E 1 187 ? 20.195  30.653  -15.211 1.00 25.32  ? 185  LEU E CD2 1 
ATOM   9510  N N   . ASP E 1 188 ? 15.522  29.450  -12.661 1.00 28.03  ? 186  ASP E N   1 
ATOM   9511  C CA  . ASP E 1 188 ? 14.410  28.541  -12.517 1.00 29.40  ? 186  ASP E CA  1 
ATOM   9512  C C   . ASP E 1 188 ? 13.122  29.337  -12.758 1.00 29.11  ? 186  ASP E C   1 
ATOM   9513  O O   . ASP E 1 188 ? 12.286  28.946  -13.570 1.00 28.71  ? 186  ASP E O   1 
ATOM   9514  C CB  . ASP E 1 188 ? 14.422  27.949  -11.115 1.00 55.31  ? 186  ASP E CB  1 
ATOM   9515  C CG  . ASP E 1 188 ? 13.384  26.881  -10.930 1.00 60.04  ? 186  ASP E CG  1 
ATOM   9516  O OD1 . ASP E 1 188 ? 13.486  25.825  -11.592 1.00 66.29  ? 186  ASP E OD1 1 
ATOM   9517  O OD2 . ASP E 1 188 ? 12.462  27.103  -10.123 1.00 64.14  ? 186  ASP E OD2 1 
ATOM   9518  N N   . ALA E 1 189 ? 12.970  30.462  -12.064 1.00 30.71  ? 187  ALA E N   1 
ATOM   9519  C CA  . ALA E 1 189 ? 11.782  31.301  -12.231 1.00 32.15  ? 187  ALA E CA  1 
ATOM   9520  C C   . ALA E 1 189 ? 11.599  31.660  -13.699 1.00 33.09  ? 187  ALA E C   1 
ATOM   9521  O O   . ALA E 1 189 ? 10.529  31.468  -14.260 1.00 34.15  ? 187  ALA E O   1 
ATOM   9522  C CB  . ALA E 1 189 ? 11.903  32.572  -11.401 1.00 62.40  ? 187  ALA E CB  1 
ATOM   9523  N N   . LEU E 1 190 ? 12.647  32.178  -14.327 1.00 38.98  ? 188  LEU E N   1 
ATOM   9524  C CA  . LEU E 1 190 ? 12.563  32.536  -15.735 1.00 39.11  ? 188  LEU E CA  1 
ATOM   9525  C C   . LEU E 1 190 ? 12.085  31.383  -16.602 1.00 42.12  ? 188  LEU E C   1 
ATOM   9526  O O   . LEU E 1 190 ? 11.217  31.572  -17.456 1.00 43.22  ? 188  LEU E O   1 
ATOM   9527  C CB  . LEU E 1 190 ? 13.914  33.017  -16.237 1.00 26.12  ? 188  LEU E CB  1 
ATOM   9528  C CG  . LEU E 1 190 ? 14.319  34.324  -15.568 1.00 23.99  ? 188  LEU E CG  1 
ATOM   9529  C CD1 . LEU E 1 190 ? 15.557  34.845  -16.253 1.00 18.80  ? 188  LEU E CD1 1 
ATOM   9530  C CD2 . LEU E 1 190 ? 13.175  35.348  -15.653 1.00 22.62  ? 188  LEU E CD2 1 
ATOM   9531  N N   . ALA E 1 191 ? 12.651  30.196  -16.388 1.00 40.04  ? 189  ALA E N   1 
ATOM   9532  C CA  . ALA E 1 191 ? 12.259  29.016  -17.155 1.00 39.90  ? 189  ALA E CA  1 
ATOM   9533  C C   . ALA E 1 191 ? 10.738  28.920  -17.175 1.00 40.67  ? 189  ALA E C   1 
ATOM   9534  O O   . ALA E 1 191 ? 10.130  28.727  -18.221 1.00 40.40  ? 189  ALA E O   1 
ATOM   9535  C CB  . ALA E 1 191 ? 12.847  27.775  -16.531 1.00 13.47  ? 189  ALA E CB  1 
ATOM   9536  N N   . ASP E 1 192 ? 10.133  29.063  -16.005 1.00 38.21  ? 190  ASP E N   1 
ATOM   9537  C CA  . ASP E 1 192 ? 8.689   29.020  -15.881 1.00 40.00  ? 190  ASP E CA  1 
ATOM   9538  C C   . ASP E 1 192 ? 8.097   30.052  -16.822 1.00 39.41  ? 190  ASP E C   1 
ATOM   9539  O O   . ASP E 1 192 ? 7.245   29.730  -17.645 1.00 41.07  ? 190  ASP E O   1 
ATOM   9540  C CB  . ASP E 1 192 ? 8.295   29.309  -14.438 1.00 56.73  ? 190  ASP E CB  1 
ATOM   9541  C CG  . ASP E 1 192 ? 8.734   28.207  -13.496 1.00 65.08  ? 190  ASP E CG  1 
ATOM   9542  O OD1 . ASP E 1 192 ? 8.756   28.427  -12.263 1.00 69.58  ? 190  ASP E OD1 1 
ATOM   9543  O OD2 . ASP E 1 192 ? 9.050   27.106  -14.000 1.00 70.21  ? 190  ASP E OD2 1 
ATOM   9544  N N   . GLY E 1 193 ? 8.558   31.293  -16.710 1.00 41.77  ? 191  GLY E N   1 
ATOM   9545  C CA  . GLY E 1 193 ? 8.059   32.326  -17.594 1.00 40.62  ? 191  GLY E CA  1 
ATOM   9546  C C   . GLY E 1 193 ? 8.073   31.809  -19.021 1.00 38.40  ? 191  GLY E C   1 
ATOM   9547  O O   . GLY E 1 193 ? 7.022   31.681  -19.650 1.00 37.68  ? 191  GLY E O   1 
ATOM   9548  N N   . GLY E 1 194 ? 9.268   31.488  -19.514 1.00 39.04  ? 192  GLY E N   1 
ATOM   9549  C CA  . GLY E 1 194 ? 9.425   30.978  -20.868 1.00 39.28  ? 192  GLY E CA  1 
ATOM   9550  C C   . GLY E 1 194 ? 8.497   29.827  -21.192 1.00 39.06  ? 192  GLY E C   1 
ATOM   9551  O O   . GLY E 1 194 ? 8.038   29.676  -22.323 1.00 42.72  ? 192  GLY E O   1 
ATOM   9552  N N   . VAL E 1 195 ? 8.219   29.003  -20.195 1.00 30.09  ? 193  VAL E N   1 
ATOM   9553  C CA  . VAL E 1 195 ? 7.328   27.886  -20.398 1.00 28.50  ? 193  VAL E CA  1 
ATOM   9554  C C   . VAL E 1 195 ? 5.896   28.398  -20.463 1.00 31.20  ? 193  VAL E C   1 
ATOM   9555  O O   . VAL E 1 195 ? 5.144   27.987  -21.338 1.00 35.22  ? 193  VAL E O   1 
ATOM   9556  C CB  . VAL E 1 195 ? 7.490   26.836  -19.279 1.00 28.31  ? 193  VAL E CB  1 
ATOM   9557  C CG1 . VAL E 1 195 ? 6.412   25.782  -19.376 1.00 25.33  ? 193  VAL E CG1 1 
ATOM   9558  C CG2 . VAL E 1 195 ? 8.850   26.169  -19.412 1.00 26.28  ? 193  VAL E CG2 1 
ATOM   9559  N N   . LYS E 1 196 ? 5.505   29.302  -19.569 1.00 36.18  ? 194  LYS E N   1 
ATOM   9560  C CA  . LYS E 1 196 ? 4.137   29.805  -19.634 1.00 35.58  ? 194  LYS E CA  1 
ATOM   9561  C C   . LYS E 1 196 ? 3.872   30.333  -21.047 1.00 38.34  ? 194  LYS E C   1 
ATOM   9562  O O   . LYS E 1 196 ? 2.783   30.162  -21.596 1.00 38.52  ? 194  LYS E O   1 
ATOM   9563  C CB  . LYS E 1 196 ? 3.900   30.935  -18.634 1.00 18.96  ? 194  LYS E CB  1 
ATOM   9564  C CG  . LYS E 1 196 ? 2.450   30.996  -18.163 1.00 15.60  ? 194  LYS E CG  1 
ATOM   9565  C CD  . LYS E 1 196 ? 2.024   32.396  -17.754 1.00 6.28   ? 194  LYS E CD  1 
ATOM   9566  C CE  . LYS E 1 196 ? 0.607   32.411  -17.163 1.00 7.29   ? 194  LYS E CE  1 
ATOM   9567  N NZ  . LYS E 1 196 ? 0.049   33.804  -16.893 1.00 8.44   ? 194  LYS E NZ  1 
ATOM   9568  N N   . MET E 1 197 ? 4.882   30.976  -21.627 1.00 35.20  ? 195  MET E N   1 
ATOM   9569  C CA  . MET E 1 197 ? 4.761   31.521  -22.964 1.00 34.75  ? 195  MET E CA  1 
ATOM   9570  C C   . MET E 1 197 ? 4.844   30.405  -23.981 1.00 38.25  ? 195  MET E C   1 
ATOM   9571  O O   . MET E 1 197 ? 4.862   30.640  -25.191 1.00 40.77  ? 195  MET E O   1 
ATOM   9572  C CB  . MET E 1 197 ? 5.830   32.588  -23.195 1.00 27.64  ? 195  MET E CB  1 
ATOM   9573  C CG  . MET E 1 197 ? 5.480   33.894  -22.492 1.00 27.93  ? 195  MET E CG  1 
ATOM   9574  S SD  . MET E 1 197 ? 3.977   33.677  -21.474 1.00 34.90  ? 195  MET E SD  1 
ATOM   9575  C CE  . MET E 1 197 ? 2.874   34.929  -22.097 1.00 37.21  ? 195  MET E CE  1 
ATOM   9576  N N   . GLY E 1 198 ? 4.898   29.183  -23.467 1.00 42.53  ? 196  GLY E N   1 
ATOM   9577  C CA  . GLY E 1 198 ? 4.908   28.012  -24.319 1.00 46.12  ? 196  GLY E CA  1 
ATOM   9578  C C   . GLY E 1 198 ? 6.203   27.412  -24.811 1.00 47.41  ? 196  GLY E C   1 
ATOM   9579  O O   . GLY E 1 198 ? 6.180   26.619  -25.750 1.00 52.14  ? 196  GLY E O   1 
ATOM   9580  N N   . LEU E 1 199 ? 7.330   27.762  -24.213 1.00 33.78  ? 197  LEU E N   1 
ATOM   9581  C CA  . LEU E 1 199 ? 8.584   27.184  -24.672 1.00 32.73  ? 197  LEU E CA  1 
ATOM   9582  C C   . LEU E 1 199 ? 8.812   25.816  -24.047 1.00 34.13  ? 197  LEU E C   1 
ATOM   9583  O O   . LEU E 1 199 ? 8.323   25.524  -22.954 1.00 32.90  ? 197  LEU E O   1 
ATOM   9584  C CB  . LEU E 1 199 ? 9.761   28.091  -24.315 1.00 36.62  ? 197  LEU E CB  1 
ATOM   9585  C CG  . LEU E 1 199 ? 9.843   29.456  -25.003 1.00 40.55  ? 197  LEU E CG  1 
ATOM   9586  C CD1 . LEU E 1 199 ? 10.981  30.267  -24.420 1.00 38.76  ? 197  LEU E CD1 1 
ATOM   9587  C CD2 . LEU E 1 199 ? 10.052  29.267  -26.495 1.00 43.26  ? 197  LEU E CD2 1 
ATOM   9588  N N   . PRO E 1 200 ? 9.534   24.940  -24.751 1.00 46.27  ? 198  PRO E N   1 
ATOM   9589  C CA  . PRO E 1 200 ? 9.795   23.620  -24.184 1.00 47.36  ? 198  PRO E CA  1 
ATOM   9590  C C   . PRO E 1 200 ? 10.715  23.868  -22.994 1.00 48.66  ? 198  PRO E C   1 
ATOM   9591  O O   . PRO E 1 200 ? 11.587  24.739  -23.048 1.00 52.15  ? 198  PRO E O   1 
ATOM   9592  C CB  . PRO E 1 200 ? 10.495  22.894  -25.324 1.00 37.02  ? 198  PRO E CB  1 
ATOM   9593  C CG  . PRO E 1 200 ? 11.227  24.001  -26.017 1.00 34.45  ? 198  PRO E CG  1 
ATOM   9594  C CD  . PRO E 1 200 ? 10.175  25.082  -26.067 1.00 36.60  ? 198  PRO E CD  1 
ATOM   9595  N N   . ARG E 1 201 ? 10.517  23.111  -21.923 1.00 44.67  ? 199  ARG E N   1 
ATOM   9596  C CA  . ARG E 1 201 ? 11.310  23.280  -20.711 1.00 43.51  ? 199  ARG E CA  1 
ATOM   9597  C C   . ARG E 1 201 ? 12.801  23.466  -20.921 1.00 42.23  ? 199  ARG E C   1 
ATOM   9598  O O   . ARG E 1 201 ? 13.319  24.560  -20.753 1.00 42.03  ? 199  ARG E O   1 
ATOM   9599  C CB  . ARG E 1 201 ? 11.108  22.104  -19.771 1.00 49.91  ? 199  ARG E CB  1 
ATOM   9600  C CG  . ARG E 1 201 ? 11.629  22.399  -18.388 1.00 50.98  ? 199  ARG E CG  1 
ATOM   9601  C CD  . ARG E 1 201 ? 10.815  23.502  -17.759 1.00 51.17  ? 199  ARG E CD  1 
ATOM   9602  N NE  . ARG E 1 201 ? 11.374  23.929  -16.486 1.00 53.28  ? 199  ARG E NE  1 
ATOM   9603  C CZ  . ARG E 1 201 ? 10.736  24.702  -15.613 1.00 54.92  ? 199  ARG E CZ  1 
ATOM   9604  N NH1 . ARG E 1 201 ? 9.504   25.135  -15.872 1.00 48.81  ? 199  ARG E NH1 1 
ATOM   9605  N NH2 . ARG E 1 201 ? 11.334  25.041  -14.479 1.00 55.70  ? 199  ARG E NH2 1 
ATOM   9606  N N   . ARG E 1 202 ? 13.493  22.391  -21.267 1.00 37.40  ? 200  ARG E N   1 
ATOM   9607  C CA  . ARG E 1 202 ? 14.922  22.468  -21.481 1.00 40.51  ? 200  ARG E CA  1 
ATOM   9608  C C   . ARG E 1 202 ? 15.267  23.749  -22.220 1.00 39.34  ? 200  ARG E C   1 
ATOM   9609  O O   . ARG E 1 202 ? 15.784  24.665  -21.607 1.00 41.22  ? 200  ARG E O   1 
ATOM   9610  C CB  . ARG E 1 202 ? 15.396  21.220  -22.213 1.00 93.09  ? 200  ARG E CB  1 
ATOM   9611  C CG  . ARG E 1 202 ? 14.972  19.984  -21.445 1.00 107.04 ? 200  ARG E CG  1 
ATOM   9612  C CD  . ARG E 1 202 ? 15.389  18.690  -22.095 1.00 119.20 ? 200  ARG E CD  1 
ATOM   9613  N NE  . ARG E 1 202 ? 14.888  17.540  -21.344 1.00 127.63 ? 200  ARG E NE  1 
ATOM   9614  C CZ  . ARG E 1 202 ? 15.266  16.285  -21.559 1.00 132.42 ? 200  ARG E CZ  1 
ATOM   9615  N NH1 . ARG E 1 202 ? 16.157  16.015  -22.507 1.00 134.81 ? 200  ARG E NH1 1 
ATOM   9616  N NH2 . ARG E 1 202 ? 14.752  15.299  -20.833 1.00 135.25 ? 200  ARG E NH2 1 
ATOM   9617  N N   . LEU E 1 203 ? 14.946  23.860  -23.501 1.00 42.97  ? 201  LEU E N   1 
ATOM   9618  C CA  . LEU E 1 203 ? 15.269  25.085  -24.241 1.00 42.72  ? 201  LEU E CA  1 
ATOM   9619  C C   . LEU E 1 203 ? 15.232  26.375  -23.414 1.00 42.23  ? 201  LEU E C   1 
ATOM   9620  O O   . LEU E 1 203 ? 16.200  27.140  -23.409 1.00 41.83  ? 201  LEU E O   1 
ATOM   9621  C CB  . LEU E 1 203 ? 14.332  25.251  -25.437 1.00 36.21  ? 201  LEU E CB  1 
ATOM   9622  C CG  . LEU E 1 203 ? 14.442  26.598  -26.169 1.00 34.10  ? 201  LEU E CG  1 
ATOM   9623  C CD1 . LEU E 1 203 ? 15.818  26.757  -26.820 1.00 26.76  ? 201  LEU E CD1 1 
ATOM   9624  C CD2 . LEU E 1 203 ? 13.338  26.682  -27.204 1.00 33.53  ? 201  LEU E CD2 1 
ATOM   9625  N N   . ALA E 1 204 ? 14.109  26.619  -22.737 1.00 45.89  ? 202  ALA E N   1 
ATOM   9626  C CA  . ALA E 1 204 ? 13.934  27.819  -21.906 1.00 46.24  ? 202  ALA E CA  1 
ATOM   9627  C C   . ALA E 1 204 ? 14.984  27.912  -20.796 1.00 47.13  ? 202  ALA E C   1 
ATOM   9628  O O   . ALA E 1 204 ? 15.842  28.806  -20.798 1.00 48.62  ? 202  ALA E O   1 
ATOM   9629  C CB  . ALA E 1 204 ? 12.537  27.824  -21.292 1.00 33.99  ? 202  ALA E CB  1 
ATOM   9630  N N   . VAL E 1 205 ? 14.876  26.994  -19.838 1.00 46.79  ? 203  VAL E N   1 
ATOM   9631  C CA  . VAL E 1 205 ? 15.799  26.883  -18.707 1.00 47.62  ? 203  VAL E CA  1 
ATOM   9632  C C   . VAL E 1 205 ? 17.197  27.235  -19.175 1.00 48.23  ? 203  VAL E C   1 
ATOM   9633  O O   . VAL E 1 205 ? 18.005  27.837  -18.472 1.00 50.45  ? 203  VAL E O   1 
ATOM   9634  C CB  . VAL E 1 205 ? 15.840  25.411  -18.192 1.00 47.79  ? 203  VAL E CB  1 
ATOM   9635  C CG1 . VAL E 1 205 ? 17.133  25.139  -17.449 1.00 44.64  ? 203  VAL E CG1 1 
ATOM   9636  C CG2 . VAL E 1 205 ? 14.647  25.137  -17.287 1.00 51.43  ? 203  VAL E CG2 1 
ATOM   9637  N N   . ARG E 1 206 ? 17.433  26.864  -20.413 1.00 45.83  ? 204  ARG E N   1 
ATOM   9638  C CA  . ARG E 1 206 ? 18.704  27.001  -21.073 1.00 48.25  ? 204  ARG E CA  1 
ATOM   9639  C C   . ARG E 1 206 ? 19.051  28.335  -21.748 1.00 44.78  ? 204  ARG E C   1 
ATOM   9640  O O   . ARG E 1 206 ? 20.223  28.641  -21.994 1.00 42.57  ? 204  ARG E O   1 
ATOM   9641  C CB  . ARG E 1 206 ? 18.750  25.868  -22.072 1.00 84.58  ? 204  ARG E CB  1 
ATOM   9642  C CG  . ARG E 1 206 ? 18.184  24.515  -21.555 1.00 92.93  ? 204  ARG E CG  1 
ATOM   9643  C CD  . ARG E 1 206 ? 18.699  23.992  -20.187 1.00 102.21 ? 204  ARG E CD  1 
ATOM   9644  N NE  . ARG E 1 206 ? 18.183  22.641  -19.886 1.00 107.65 ? 204  ARG E NE  1 
ATOM   9645  C CZ  . ARG E 1 206 ? 18.357  21.978  -18.737 1.00 108.04 ? 204  ARG E CZ  1 
ATOM   9646  N NH1 . ARG E 1 206 ? 19.037  22.518  -17.735 1.00 110.26 ? 204  ARG E NH1 1 
ATOM   9647  N NH2 . ARG E 1 206 ? 17.852  20.759  -18.587 1.00 105.95 ? 204  ARG E NH2 1 
ATOM   9648  N N   . LEU E 1 207 ? 18.033  29.116  -22.066 1.00 45.51  ? 205  LEU E N   1 
ATOM   9649  C CA  . LEU E 1 207 ? 18.261  30.395  -22.703 1.00 44.95  ? 205  LEU E CA  1 
ATOM   9650  C C   . LEU E 1 207 ? 18.461  31.465  -21.636 1.00 44.75  ? 205  LEU E C   1 
ATOM   9651  O O   . LEU E 1 207 ? 19.315  32.351  -21.782 1.00 43.36  ? 205  LEU E O   1 
ATOM   9652  C CB  . LEU E 1 207 ? 17.078  30.733  -23.611 1.00 45.81  ? 205  LEU E CB  1 
ATOM   9653  C CG  . LEU E 1 207 ? 17.034  29.886  -24.881 1.00 45.54  ? 205  LEU E CG  1 
ATOM   9654  C CD1 . LEU E 1 207 ? 15.785  30.195  -25.693 1.00 46.55  ? 205  LEU E CD1 1 
ATOM   9655  C CD2 . LEU E 1 207 ? 18.291  30.177  -25.695 1.00 43.87  ? 205  LEU E CD2 1 
ATOM   9656  N N   . GLY E 1 208 ? 17.677  31.375  -20.561 1.00 40.08  ? 206  GLY E N   1 
ATOM   9657  C CA  . GLY E 1 208 ? 17.807  32.338  -19.479 1.00 38.61  ? 206  GLY E CA  1 
ATOM   9658  C C   . GLY E 1 208 ? 19.240  32.308  -18.988 1.00 37.09  ? 206  GLY E C   1 
ATOM   9659  O O   . GLY E 1 208 ? 19.919  33.336  -18.883 1.00 34.28  ? 206  GLY E O   1 
ATOM   9660  N N   . ALA E 1 209 ? 19.701  31.098  -18.697 1.00 29.98  ? 207  ALA E N   1 
ATOM   9661  C CA  . ALA E 1 209 ? 21.059  30.888  -18.237 1.00 29.93  ? 207  ALA E CA  1 
ATOM   9662  C C   . ALA E 1 209 ? 22.000  31.626  -19.165 1.00 31.07  ? 207  ALA E C   1 
ATOM   9663  O O   . ALA E 1 209 ? 22.757  32.500  -18.731 1.00 29.84  ? 207  ALA E O   1 
ATOM   9664  C CB  . ALA E 1 209 ? 21.375  29.412  -18.245 1.00 19.23  ? 207  ALA E CB  1 
ATOM   9665  N N   . GLN E 1 210 ? 21.931  31.270  -20.448 1.00 36.90  ? 208  GLN E N   1 
ATOM   9666  C CA  . GLN E 1 210 ? 22.775  31.881  -21.470 1.00 39.10  ? 208  GLN E CA  1 
ATOM   9667  C C   . GLN E 1 210 ? 22.697  33.393  -21.399 1.00 38.57  ? 208  GLN E C   1 
ATOM   9668  O O   . GLN E 1 210 ? 23.664  34.085  -21.686 1.00 36.79  ? 208  GLN E O   1 
ATOM   9669  C CB  . GLN E 1 210 ? 22.366  31.416  -22.874 1.00 34.60  ? 208  GLN E CB  1 
ATOM   9670  C CG  . GLN E 1 210 ? 23.220  32.032  -23.983 1.00 38.09  ? 208  GLN E CG  1 
ATOM   9671  C CD  . GLN E 1 210 ? 24.708  31.897  -23.706 1.00 40.90  ? 208  GLN E CD  1 
ATOM   9672  O OE1 . GLN E 1 210 ? 25.169  30.826  -23.379 1.00 44.06  ? 208  GLN E OE1 1 
ATOM   9673  N NE2 . GLN E 1 210 ? 25.460  32.985  -23.836 1.00 42.71  ? 208  GLN E NE2 1 
ATOM   9674  N N   . ALA E 1 211 ? 21.540  33.907  -21.014 1.00 50.89  ? 209  ALA E N   1 
ATOM   9675  C CA  . ALA E 1 211 ? 21.392  35.342  -20.912 1.00 53.32  ? 209  ALA E CA  1 
ATOM   9676  C C   . ALA E 1 211 ? 22.214  35.875  -19.730 1.00 54.39  ? 209  ALA E C   1 
ATOM   9677  O O   . ALA E 1 211 ? 23.180  36.616  -19.934 1.00 53.97  ? 209  ALA E O   1 
ATOM   9678  C CB  . ALA E 1 211 ? 19.928  35.706  -20.767 1.00 33.99  ? 209  ALA E CB  1 
ATOM   9679  N N   . LEU E 1 212 ? 21.852  35.498  -18.502 1.00 42.42  ? 210  LEU E N   1 
ATOM   9680  C CA  . LEU E 1 212 ? 22.599  35.959  -17.326 1.00 42.38  ? 210  LEU E CA  1 
ATOM   9681  C C   . LEU E 1 212 ? 24.092  35.782  -17.578 1.00 42.52  ? 210  LEU E C   1 
ATOM   9682  O O   . LEU E 1 212 ? 24.890  36.690  -17.325 1.00 41.47  ? 210  LEU E O   1 
ATOM   9683  C CB  . LEU E 1 212 ? 22.215  35.153  -16.097 1.00 48.77  ? 210  LEU E CB  1 
ATOM   9684  C CG  . LEU E 1 212 ? 20.712  35.034  -15.913 1.00 50.60  ? 210  LEU E CG  1 
ATOM   9685  C CD1 . LEU E 1 212 ? 20.438  34.059  -14.799 1.00 50.00  ? 210  LEU E CD1 1 
ATOM   9686  C CD2 . LEU E 1 212 ? 20.111  36.394  -15.622 1.00 51.28  ? 210  LEU E CD2 1 
ATOM   9687  N N   . LEU E 1 213 ? 24.458  34.601  -18.073 1.00 41.80  ? 211  LEU E N   1 
ATOM   9688  C CA  . LEU E 1 213 ? 25.843  34.290  -18.382 1.00 41.62  ? 211  LEU E CA  1 
ATOM   9689  C C   . LEU E 1 213 ? 26.405  35.411  -19.258 1.00 43.10  ? 211  LEU E C   1 
ATOM   9690  O O   . LEU E 1 213 ? 27.492  35.937  -19.000 1.00 44.26  ? 211  LEU E O   1 
ATOM   9691  C CB  . LEU E 1 213 ? 25.914  32.949  -19.123 1.00 41.30  ? 211  LEU E CB  1 
ATOM   9692  C CG  . LEU E 1 213 ? 27.265  32.337  -19.538 1.00 42.24  ? 211  LEU E CG  1 
ATOM   9693  C CD1 . LEU E 1 213 ? 28.022  33.283  -20.469 1.00 40.70  ? 211  LEU E CD1 1 
ATOM   9694  C CD2 . LEU E 1 213 ? 28.095  32.036  -18.303 1.00 43.02  ? 211  LEU E CD2 1 
ATOM   9695  N N   . GLY E 1 214 ? 25.644  35.777  -20.287 1.00 46.25  ? 212  GLY E N   1 
ATOM   9696  C CA  . GLY E 1 214 ? 26.073  36.812  -21.208 1.00 46.24  ? 212  GLY E CA  1 
ATOM   9697  C C   . GLY E 1 214 ? 26.098  38.213  -20.633 1.00 46.50  ? 212  GLY E C   1 
ATOM   9698  O O   . GLY E 1 214 ? 27.142  38.869  -20.629 1.00 47.05  ? 212  GLY E O   1 
ATOM   9699  N N   . ALA E 1 215 ? 24.953  38.684  -20.154 1.00 44.72  ? 213  ALA E N   1 
ATOM   9700  C CA  . ALA E 1 215 ? 24.869  40.027  -19.584 1.00 44.81  ? 213  ALA E CA  1 
ATOM   9701  C C   . ALA E 1 215 ? 26.037  40.302  -18.648 1.00 47.13  ? 213  ALA E C   1 
ATOM   9702  O O   . ALA E 1 215 ? 26.700  41.332  -18.756 1.00 49.15  ? 213  ALA E O   1 
ATOM   9703  C CB  . ALA E 1 215 ? 23.557  40.197  -18.828 1.00 15.95  ? 213  ALA E CB  1 
ATOM   9704  N N   . ALA E 1 216 ? 26.277  39.366  -17.731 1.00 39.71  ? 214  ALA E N   1 
ATOM   9705  C CA  . ALA E 1 216 ? 27.346  39.465  -16.747 1.00 34.55  ? 214  ALA E CA  1 
ATOM   9706  C C   . ALA E 1 216 ? 28.710  39.674  -17.401 1.00 33.84  ? 214  ALA E C   1 
ATOM   9707  O O   . ALA E 1 216 ? 29.360  40.699  -17.179 1.00 30.30  ? 214  ALA E O   1 
ATOM   9708  C CB  . ALA E 1 216 ? 27.356  38.212  -15.896 1.00 23.61  ? 214  ALA E CB  1 
ATOM   9709  N N   . LYS E 1 217 ? 29.133  38.702  -18.208 1.00 34.87  ? 215  LYS E N   1 
ATOM   9710  C CA  . LYS E 1 217 ? 30.421  38.780  -18.900 1.00 37.27  ? 215  LYS E CA  1 
ATOM   9711  C C   . LYS E 1 217 ? 30.483  40.137  -19.556 1.00 38.34  ? 215  LYS E C   1 
ATOM   9712  O O   . LYS E 1 217 ? 31.512  40.814  -19.566 1.00 36.99  ? 215  LYS E O   1 
ATOM   9713  C CB  . LYS E 1 217 ? 30.528  37.688  -19.968 1.00 47.15  ? 215  LYS E CB  1 
ATOM   9714  C CG  . LYS E 1 217 ? 31.910  37.565  -20.619 1.00 50.82  ? 215  LYS E CG  1 
ATOM   9715  C CD  . LYS E 1 217 ? 31.951  36.379  -21.592 1.00 57.87  ? 215  LYS E CD  1 
ATOM   9716  C CE  . LYS E 1 217 ? 33.306  36.205  -22.289 1.00 61.88  ? 215  LYS E CE  1 
ATOM   9717  N NZ  . LYS E 1 217 ? 33.321  35.038  -23.241 1.00 61.19  ? 215  LYS E NZ  1 
ATOM   9718  N N   . MET E 1 218 ? 29.344  40.529  -20.101 1.00 49.40  ? 216  MET E N   1 
ATOM   9719  C CA  . MET E 1 218 ? 29.228  41.804  -20.759 1.00 51.31  ? 216  MET E CA  1 
ATOM   9720  C C   . MET E 1 218 ? 29.541  42.920  -19.769 1.00 51.82  ? 216  MET E C   1 
ATOM   9721  O O   . MET E 1 218 ? 30.495  43.667  -19.965 1.00 53.38  ? 216  MET E O   1 
ATOM   9722  C CB  . MET E 1 218 ? 27.816  41.971  -21.302 1.00 54.89  ? 216  MET E CB  1 
ATOM   9723  C CG  . MET E 1 218 ? 27.749  42.245  -22.781 1.00 57.66  ? 216  MET E CG  1 
ATOM   9724  S SD  . MET E 1 218 ? 26.067  42.629  -23.226 1.00 62.20  ? 216  MET E SD  1 
ATOM   9725  C CE  . MET E 1 218 ? 26.065  44.437  -23.183 1.00 64.28  ? 216  MET E CE  1 
ATOM   9726  N N   . LEU E 1 219 ? 28.759  43.018  -18.697 1.00 54.12  ? 217  LEU E N   1 
ATOM   9727  C CA  . LEU E 1 219 ? 28.964  44.081  -17.719 1.00 55.47  ? 217  LEU E CA  1 
ATOM   9728  C C   . LEU E 1 219 ? 30.407  44.160  -17.258 1.00 56.22  ? 217  LEU E C   1 
ATOM   9729  O O   . LEU E 1 219 ? 30.990  45.240  -17.209 1.00 58.41  ? 217  LEU E O   1 
ATOM   9730  C CB  . LEU E 1 219 ? 28.029  43.907  -16.514 1.00 50.85  ? 217  LEU E CB  1 
ATOM   9731  C CG  . LEU E 1 219 ? 27.851  45.099  -15.545 1.00 51.56  ? 217  LEU E CG  1 
ATOM   9732  C CD1 . LEU E 1 219 ? 27.667  46.428  -16.295 1.00 51.91  ? 217  LEU E CD1 1 
ATOM   9733  C CD2 . LEU E 1 219 ? 26.641  44.838  -14.660 1.00 51.07  ? 217  LEU E CD2 1 
ATOM   9734  N N   . LEU E 1 220 ? 30.993  43.020  -16.937 1.00 51.47  ? 218  LEU E N   1 
ATOM   9735  C CA  . LEU E 1 220 ? 32.379  42.989  -16.484 1.00 51.62  ? 218  LEU E CA  1 
ATOM   9736  C C   . LEU E 1 220 ? 33.301  43.662  -17.486 1.00 55.19  ? 218  LEU E C   1 
ATOM   9737  O O   . LEU E 1 220 ? 33.995  44.633  -17.176 1.00 58.13  ? 218  LEU E O   1 
ATOM   9738  C CB  . LEU E 1 220 ? 32.795  41.545  -16.311 1.00 53.74  ? 218  LEU E CB  1 
ATOM   9739  C CG  . LEU E 1 220 ? 31.692  40.878  -15.500 1.00 51.45  ? 218  LEU E CG  1 
ATOM   9740  C CD1 . LEU E 1 220 ? 31.642  39.381  -15.754 1.00 47.78  ? 218  LEU E CD1 1 
ATOM   9741  C CD2 . LEU E 1 220 ? 31.913  41.225  -14.045 1.00 50.63  ? 218  LEU E CD2 1 
ATOM   9742  N N   . HIS E 1 221 ? 33.281  43.132  -18.701 1.00 56.60  ? 219  HIS E N   1 
ATOM   9743  C CA  . HIS E 1 221 ? 34.105  43.613  -19.798 1.00 60.23  ? 219  HIS E CA  1 
ATOM   9744  C C   . HIS E 1 221 ? 33.821  45.030  -20.297 1.00 61.33  ? 219  HIS E C   1 
ATOM   9745  O O   . HIS E 1 221 ? 34.706  45.686  -20.837 1.00 61.63  ? 219  HIS E O   1 
ATOM   9746  C CB  . HIS E 1 221 ? 33.991  42.619  -20.954 1.00 63.64  ? 219  HIS E CB  1 
ATOM   9747  C CG  . HIS E 1 221 ? 34.484  41.250  -20.607 1.00 67.07  ? 219  HIS E CG  1 
ATOM   9748  N ND1 . HIS E 1 221 ? 35.511  40.635  -21.288 1.00 68.71  ? 219  HIS E ND1 1 
ATOM   9749  C CD2 . HIS E 1 221 ? 34.127  40.397  -19.617 1.00 68.30  ? 219  HIS E CD2 1 
ATOM   9750  C CE1 . HIS E 1 221 ? 35.767  39.463  -20.732 1.00 69.57  ? 219  HIS E CE1 1 
ATOM   9751  N NE2 . HIS E 1 221 ? 34.941  39.295  -19.715 1.00 69.25  ? 219  HIS E NE2 1 
ATOM   9752  N N   . SER E 1 222 ? 32.600  45.508  -20.101 1.00 65.73  ? 220  SER E N   1 
ATOM   9753  C CA  . SER E 1 222 ? 32.214  46.831  -20.582 1.00 70.97  ? 220  SER E CA  1 
ATOM   9754  C C   . SER E 1 222 ? 32.358  47.948  -19.576 1.00 70.93  ? 220  SER E C   1 
ATOM   9755  O O   . SER E 1 222 ? 32.650  49.092  -19.933 1.00 69.77  ? 220  SER E O   1 
ATOM   9756  C CB  . SER E 1 222 ? 30.761  46.808  -21.051 1.00 161.97 ? 220  SER E CB  1 
ATOM   9757  O OG  . SER E 1 222 ? 29.890  46.520  -19.969 1.00 167.71 ? 220  SER E OG  1 
ATOM   9758  N N   . GLU E 1 223 ? 32.142  47.615  -18.315 1.00 106.57 ? 221  GLU E N   1 
ATOM   9759  C CA  . GLU E 1 223 ? 32.196  48.618  -17.275 1.00 108.85 ? 221  GLU E CA  1 
ATOM   9760  C C   . GLU E 1 223 ? 30.918  49.419  -17.448 1.00 106.90 ? 221  GLU E C   1 
ATOM   9761  O O   . GLU E 1 223 ? 29.902  49.110  -16.824 1.00 106.65 ? 221  GLU E O   1 
ATOM   9762  C CB  . GLU E 1 223 ? 33.430  49.499  -17.446 1.00 129.77 ? 221  GLU E CB  1 
ATOM   9763  C CG  . GLU E 1 223 ? 34.714  48.700  -17.454 1.00 136.33 ? 221  GLU E CG  1 
ATOM   9764  C CD  . GLU E 1 223 ? 35.925  49.559  -17.199 1.00 141.43 ? 221  GLU E CD  1 
ATOM   9765  O OE1 . GLU E 1 223 ? 35.891  50.365  -16.243 1.00 143.23 ? 221  GLU E OE1 1 
ATOM   9766  O OE2 . GLU E 1 223 ? 36.915  49.424  -17.947 1.00 144.17 ? 221  GLU E OE2 1 
ATOM   9767  N N   . GLN E 1 224 ? 30.959  50.434  -18.305 1.00 74.45  ? 222  GLN E N   1 
ATOM   9768  C CA  . GLN E 1 224 ? 29.767  51.226  -18.552 1.00 69.35  ? 222  GLN E CA  1 
ATOM   9769  C C   . GLN E 1 224 ? 29.078  51.575  -17.253 1.00 64.30  ? 222  GLN E C   1 
ATOM   9770  O O   . GLN E 1 224 ? 29.317  52.625  -16.663 1.00 66.70  ? 222  GLN E O   1 
ATOM   9771  C CB  . GLN E 1 224 ? 28.810  50.422  -19.421 1.00 93.21  ? 222  GLN E CB  1 
ATOM   9772  C CG  . GLN E 1 224 ? 29.408  50.120  -20.744 1.00 97.56  ? 222  GLN E CG  1 
ATOM   9773  C CD  . GLN E 1 224 ? 29.947  51.378  -21.340 1.00 102.20 ? 222  GLN E CD  1 
ATOM   9774  O OE1 . GLN E 1 224 ? 29.197  52.330  -21.567 1.00 103.62 ? 222  GLN E OE1 1 
ATOM   9775  N NE2 . GLN E 1 224 ? 31.256  51.417  -21.571 1.00 105.29 ? 222  GLN E NE2 1 
ATOM   9776  N N   . HIS E 1 225 ? 28.223  50.659  -16.825 1.00 32.77  ? 223  HIS E N   1 
ATOM   9777  C CA  . HIS E 1 225 ? 27.457  50.782  -15.605 1.00 29.52  ? 223  HIS E CA  1 
ATOM   9778  C C   . HIS E 1 225 ? 26.194  49.977  -15.855 1.00 30.51  ? 223  HIS E C   1 
ATOM   9779  O O   . HIS E 1 225 ? 25.587  50.095  -16.915 1.00 29.75  ? 223  HIS E O   1 
ATOM   9780  C CB  . HIS E 1 225 ? 27.091  52.240  -15.338 1.00 36.06  ? 223  HIS E CB  1 
ATOM   9781  C CG  . HIS E 1 225 ? 26.202  52.427  -14.153 1.00 35.55  ? 223  HIS E CG  1 
ATOM   9782  N ND1 . HIS E 1 225 ? 25.062  51.678  -13.954 1.00 36.91  ? 223  HIS E ND1 1 
ATOM   9783  C CD2 . HIS E 1 225 ? 26.267  53.293  -13.116 1.00 35.42  ? 223  HIS E CD2 1 
ATOM   9784  C CE1 . HIS E 1 225 ? 24.463  52.075  -12.845 1.00 34.88  ? 223  HIS E CE1 1 
ATOM   9785  N NE2 . HIS E 1 225 ? 25.173  53.055  -12.317 1.00 34.29  ? 223  HIS E NE2 1 
ATOM   9786  N N   . PRO E 1 226 ? 25.791  49.132  -14.892 1.00 53.75  ? 224  PRO E N   1 
ATOM   9787  C CA  . PRO E 1 226 ? 24.583  48.326  -15.059 1.00 54.72  ? 224  PRO E CA  1 
ATOM   9788  C C   . PRO E 1 226 ? 23.481  49.112  -15.750 1.00 55.47  ? 224  PRO E C   1 
ATOM   9789  O O   . PRO E 1 226 ? 22.925  48.676  -16.760 1.00 55.92  ? 224  PRO E O   1 
ATOM   9790  C CB  . PRO E 1 226 ? 24.224  47.960  -13.626 1.00 48.42  ? 224  PRO E CB  1 
ATOM   9791  C CG  . PRO E 1 226 ? 25.553  47.746  -13.026 1.00 47.60  ? 224  PRO E CG  1 
ATOM   9792  C CD  . PRO E 1 226 ? 26.381  48.908  -13.561 1.00 49.22  ? 224  PRO E CD  1 
ATOM   9793  N N   . GLY E 1 227 ? 23.187  50.283  -15.196 1.00 52.61  ? 225  GLY E N   1 
ATOM   9794  C CA  . GLY E 1 227 ? 22.154  51.137  -15.746 1.00 53.16  ? 225  GLY E CA  1 
ATOM   9795  C C   . GLY E 1 227 ? 22.457  51.609  -17.153 1.00 52.79  ? 225  GLY E C   1 
ATOM   9796  O O   . GLY E 1 227 ? 21.588  51.586  -18.018 1.00 51.58  ? 225  GLY E O   1 
ATOM   9797  N N   . GLN E 1 228 ? 23.691  52.040  -17.389 1.00 55.52  ? 226  GLN E N   1 
ATOM   9798  C CA  . GLN E 1 228 ? 24.087  52.506  -18.710 1.00 55.80  ? 226  GLN E CA  1 
ATOM   9799  C C   . GLN E 1 228 ? 23.851  51.447  -19.780 1.00 53.55  ? 226  GLN E C   1 
ATOM   9800  O O   . GLN E 1 228 ? 23.881  51.739  -20.973 1.00 53.27  ? 226  GLN E O   1 
ATOM   9801  C CB  . GLN E 1 228 ? 25.566  52.890  -18.729 1.00 73.07  ? 226  GLN E CB  1 
ATOM   9802  C CG  . GLN E 1 228 ? 26.004  53.355  -20.101 1.00 76.88  ? 226  GLN E CG  1 
ATOM   9803  C CD  . GLN E 1 228 ? 25.194  54.548  -20.551 1.00 79.90  ? 226  GLN E CD  1 
ATOM   9804  O OE1 . GLN E 1 228 ? 24.985  54.765  -21.744 1.00 80.93  ? 226  GLN E OE1 1 
ATOM   9805  N NE2 . GLN E 1 228 ? 24.734  55.340  -19.586 1.00 80.01  ? 226  GLN E NE2 1 
ATOM   9806  N N   . LEU E 1 229 ? 23.624  50.213  -19.350 1.00 49.20  ? 227  LEU E N   1 
ATOM   9807  C CA  . LEU E 1 229 ? 23.406  49.128  -20.285 1.00 46.54  ? 227  LEU E CA  1 
ATOM   9808  C C   . LEU E 1 229 ? 21.927  48.853  -20.514 1.00 48.32  ? 227  LEU E C   1 
ATOM   9809  O O   . LEU E 1 229 ? 21.469  48.902  -21.650 1.00 51.20  ? 227  LEU E O   1 
ATOM   9810  C CB  . LEU E 1 229 ? 24.130  47.865  -19.799 1.00 30.15  ? 227  LEU E CB  1 
ATOM   9811  C CG  . LEU E 1 229 ? 25.657  48.012  -19.660 1.00 25.95  ? 227  LEU E CG  1 
ATOM   9812  C CD1 . LEU E 1 229 ? 26.333  46.679  -19.413 1.00 21.74  ? 227  LEU E CD1 1 
ATOM   9813  C CD2 . LEU E 1 229 ? 26.210  48.597  -20.934 1.00 29.79  ? 227  LEU E CD2 1 
ATOM   9814  N N   . LYS E 1 230 ? 21.180  48.588  -19.443 1.00 42.02  ? 228  LYS E N   1 
ATOM   9815  C CA  . LYS E 1 230 ? 19.744  48.306  -19.547 1.00 43.61  ? 228  LYS E CA  1 
ATOM   9816  C C   . LYS E 1 230 ? 19.044  49.343  -20.432 1.00 44.88  ? 228  LYS E C   1 
ATOM   9817  O O   . LYS E 1 230 ? 17.917  49.138  -20.898 1.00 43.90  ? 228  LYS E O   1 
ATOM   9818  C CB  . LYS E 1 230 ? 19.109  48.228  -18.134 1.00 56.12  ? 228  LYS E CB  1 
ATOM   9819  C CG  . LYS E 1 230 ? 18.080  49.310  -17.733 1.00 57.58  ? 228  LYS E CG  1 
ATOM   9820  C CD  . LYS E 1 230 ? 17.339  48.891  -16.443 1.00 60.10  ? 228  LYS E CD  1 
ATOM   9821  C CE  . LYS E 1 230 ? 16.361  49.954  -15.933 1.00 63.44  ? 228  LYS E CE  1 
ATOM   9822  N NZ  . LYS E 1 230 ? 15.343  49.426  -14.965 1.00 60.80  ? 228  LYS E NZ  1 
ATOM   9823  N N   . ASP E 1 231 ? 19.737  50.450  -20.671 1.00 51.30  ? 229  ASP E N   1 
ATOM   9824  C CA  . ASP E 1 231 ? 19.226  51.514  -21.518 1.00 50.87  ? 229  ASP E CA  1 
ATOM   9825  C C   . ASP E 1 231 ? 19.399  51.028  -22.945 1.00 48.56  ? 229  ASP E C   1 
ATOM   9826  O O   . ASP E 1 231 ? 18.440  50.819  -23.683 1.00 46.63  ? 229  ASP E O   1 
ATOM   9827  C CB  . ASP E 1 231 ? 20.043  52.788  -21.295 1.00 81.47  ? 229  ASP E CB  1 
ATOM   9828  C CG  . ASP E 1 231 ? 19.703  53.480  -19.983 1.00 85.88  ? 229  ASP E CG  1 
ATOM   9829  O OD1 . ASP E 1 231 ? 19.138  52.825  -19.078 1.00 86.71  ? 229  ASP E OD1 1 
ATOM   9830  O OD2 . ASP E 1 231 ? 20.009  54.684  -19.854 1.00 88.19  ? 229  ASP E OD2 1 
ATOM   9831  N N   . ASN E 1 232 ? 20.650  50.830  -23.314 1.00 40.02  ? 230  ASN E N   1 
ATOM   9832  C CA  . ASN E 1 232 ? 20.990  50.359  -24.638 1.00 40.98  ? 230  ASN E CA  1 
ATOM   9833  C C   . ASN E 1 232 ? 20.307  49.036  -24.990 1.00 41.98  ? 230  ASN E C   1 
ATOM   9834  O O   . ASN E 1 232 ? 20.406  48.573  -26.124 1.00 43.74  ? 230  ASN E O   1 
ATOM   9835  C CB  . ASN E 1 232 ? 22.494  50.162  -24.718 1.00 55.64  ? 230  ASN E CB  1 
ATOM   9836  C CG  . ASN E 1 232 ? 23.249  51.372  -24.266 1.00 58.03  ? 230  ASN E CG  1 
ATOM   9837  O OD1 . ASN E 1 232 ? 22.741  52.185  -23.491 1.00 58.97  ? 230  ASN E OD1 1 
ATOM   9838  N ND2 . ASN E 1 232 ? 24.481  51.501  -24.734 1.00 61.70  ? 230  ASN E ND2 1 
ATOM   9839  N N   . VAL E 1 233 ? 19.611  48.423  -24.039 1.00 51.02  ? 231  VAL E N   1 
ATOM   9840  C CA  . VAL E 1 233 ? 19.001  47.133  -24.326 1.00 54.24  ? 231  VAL E CA  1 
ATOM   9841  C C   . VAL E 1 233 ? 17.507  47.186  -24.564 1.00 55.89  ? 231  VAL E C   1 
ATOM   9842  O O   . VAL E 1 233 ? 16.963  46.358  -25.298 1.00 55.84  ? 231  VAL E O   1 
ATOM   9843  C CB  . VAL E 1 233 ? 19.291  46.113  -23.195 1.00 82.16  ? 231  VAL E CB  1 
ATOM   9844  C CG1 . VAL E 1 233 ? 18.993  44.695  -23.671 1.00 82.28  ? 231  VAL E CG1 1 
ATOM   9845  C CG2 . VAL E 1 233 ? 20.747  46.219  -22.764 1.00 82.89  ? 231  VAL E CG2 1 
ATOM   9846  N N   . SER E 1 234 ? 16.832  48.140  -23.940 1.00 62.34  ? 232  SER E N   1 
ATOM   9847  C CA  . SER E 1 234 ? 15.402  48.240  -24.147 1.00 61.68  ? 232  SER E CA  1 
ATOM   9848  C C   . SER E 1 234 ? 15.167  49.265  -25.238 1.00 61.66  ? 232  SER E C   1 
ATOM   9849  O O   . SER E 1 234 ? 15.941  50.214  -25.384 1.00 60.62  ? 232  SER E O   1 
ATOM   9850  C CB  . SER E 1 234 ? 14.699  48.656  -22.859 1.00 53.17  ? 232  SER E CB  1 
ATOM   9851  O OG  . SER E 1 234 ? 13.302  48.761  -23.055 1.00 56.58  ? 232  SER E OG  1 
ATOM   9852  N N   . SER E 1 235 ? 14.115  49.045  -26.020 1.00 59.60  ? 233  SER E N   1 
ATOM   9853  C CA  . SER E 1 235 ? 13.750  49.935  -27.109 1.00 58.29  ? 233  SER E CA  1 
ATOM   9854  C C   . SER E 1 235 ? 12.510  50.730  -26.705 1.00 56.85  ? 233  SER E C   1 
ATOM   9855  O O   . SER E 1 235 ? 11.565  50.167  -26.139 1.00 58.22  ? 233  SER E O   1 
ATOM   9856  C CB  . SER E 1 235 ? 13.462  49.118  -28.360 1.00 88.99  ? 233  SER E CB  1 
ATOM   9857  O OG  . SER E 1 235 ? 13.361  49.960  -29.489 1.00 94.43  ? 233  SER E OG  1 
ATOM   9858  N N   . PRO E 1 236 ? 12.498  52.050  -26.997 1.00 38.26  ? 234  PRO E N   1 
ATOM   9859  C CA  . PRO E 1 236 ? 11.402  52.975  -26.682 1.00 35.76  ? 234  PRO E CA  1 
ATOM   9860  C C   . PRO E 1 236 ? 10.062  52.310  -26.839 1.00 36.09  ? 234  PRO E C   1 
ATOM   9861  O O   . PRO E 1 236 ? 9.198   52.441  -25.984 1.00 33.97  ? 234  PRO E O   1 
ATOM   9862  C CB  . PRO E 1 236 ? 11.608  54.099  -27.679 1.00 46.87  ? 234  PRO E CB  1 
ATOM   9863  C CG  . PRO E 1 236 ? 13.082  54.188  -27.731 1.00 47.66  ? 234  PRO E CG  1 
ATOM   9864  C CD  . PRO E 1 236 ? 13.488  52.721  -27.858 1.00 49.33  ? 234  PRO E CD  1 
ATOM   9865  N N   . GLY E 1 237 ? 9.905   51.587  -27.943 1.00 55.25  ? 235  GLY E N   1 
ATOM   9866  C CA  . GLY E 1 237 ? 8.667   50.878  -28.188 1.00 55.34  ? 235  GLY E CA  1 
ATOM   9867  C C   . GLY E 1 237 ? 8.271   50.143  -26.926 1.00 53.41  ? 235  GLY E C   1 
ATOM   9868  O O   . GLY E 1 237 ? 7.474   50.651  -26.145 1.00 51.84  ? 235  GLY E O   1 
ATOM   9869  N N   . GLY E 1 238 ? 8.840   48.961  -26.713 1.00 49.26  ? 236  GLY E N   1 
ATOM   9870  C CA  . GLY E 1 238 ? 8.495   48.216  -25.523 1.00 49.65  ? 236  GLY E CA  1 
ATOM   9871  C C   . GLY E 1 238 ? 9.056   46.822  -25.373 1.00 49.82  ? 236  GLY E C   1 
ATOM   9872  O O   . GLY E 1 238 ? 10.207  46.547  -25.715 1.00 52.11  ? 236  GLY E O   1 
ATOM   9873  N N   . ALA E 1 239 ? 8.211   45.932  -24.865 1.00 52.87  ? 237  ALA E N   1 
ATOM   9874  C CA  . ALA E 1 239 ? 8.595   44.555  -24.607 1.00 49.28  ? 237  ALA E CA  1 
ATOM   9875  C C   . ALA E 1 239 ? 9.573   44.626  -23.433 1.00 46.95  ? 237  ALA E C   1 
ATOM   9876  O O   . ALA E 1 239 ? 9.162   44.420  -22.292 1.00 46.29  ? 237  ALA E O   1 
ATOM   9877  C CB  . ALA E 1 239 ? 9.237   43.935  -25.840 1.00 34.55  ? 237  ALA E CB  1 
ATOM   9878  N N   . THR E 1 240 ? 10.840  44.952  -23.680 1.00 34.09  ? 238  THR E N   1 
ATOM   9879  C CA  . THR E 1 240 ? 11.792  45.046  -22.570 1.00 33.07  ? 238  THR E CA  1 
ATOM   9880  C C   . THR E 1 240 ? 11.354  46.089  -21.539 1.00 32.09  ? 238  THR E C   1 
ATOM   9881  O O   . THR E 1 240 ? 11.209  45.785  -20.354 1.00 34.27  ? 238  THR E O   1 
ATOM   9882  C CB  . THR E 1 240 ? 13.208  45.452  -23.018 1.00 45.21  ? 238  THR E CB  1 
ATOM   9883  O OG1 . THR E 1 240 ? 13.731  44.477  -23.922 1.00 43.65  ? 238  THR E OG1 1 
ATOM   9884  C CG2 . THR E 1 240 ? 14.130  45.553  -21.801 1.00 41.68  ? 238  THR E CG2 1 
ATOM   9885  N N   . ILE E 1 241 ? 11.161  47.321  -21.998 1.00 31.86  ? 239  ILE E N   1 
ATOM   9886  C CA  . ILE E 1 241 ? 10.759  48.403  -21.113 1.00 34.57  ? 239  ILE E CA  1 
ATOM   9887  C C   . ILE E 1 241 ? 9.464   48.042  -20.380 1.00 34.17  ? 239  ILE E C   1 
ATOM   9888  O O   . ILE E 1 241 ? 9.265   48.429  -19.226 1.00 33.07  ? 239  ILE E O   1 
ATOM   9889  C CB  . ILE E 1 241 ? 10.576  49.718  -21.907 1.00 48.10  ? 239  ILE E CB  1 
ATOM   9890  C CG1 . ILE E 1 241 ? 10.266  50.878  -20.962 1.00 50.48  ? 239  ILE E CG1 1 
ATOM   9891  C CG2 . ILE E 1 241 ? 9.460   49.563  -22.894 1.00 52.16  ? 239  ILE E CG2 1 
ATOM   9892  C CD1 . ILE E 1 241 ? 11.368  51.189  -19.977 1.00 50.09  ? 239  ILE E CD1 1 
ATOM   9893  N N   . HIS E 1 242 ? 8.588   47.297  -21.047 1.00 38.72  ? 240  HIS E N   1 
ATOM   9894  C CA  . HIS E 1 242 ? 7.339   46.881  -20.427 1.00 37.67  ? 240  HIS E CA  1 
ATOM   9895  C C   . HIS E 1 242 ? 7.657   45.817  -19.428 1.00 36.30  ? 240  HIS E C   1 
ATOM   9896  O O   . HIS E 1 242 ? 7.080   45.777  -18.342 1.00 37.37  ? 240  HIS E O   1 
ATOM   9897  C CB  . HIS E 1 242 ? 6.372   46.333  -21.460 1.00 49.73  ? 240  HIS E CB  1 
ATOM   9898  C CG  . HIS E 1 242 ? 5.572   47.398  -22.121 1.00 55.59  ? 240  HIS E CG  1 
ATOM   9899  N ND1 . HIS E 1 242 ? 4.284   47.705  -21.743 1.00 57.12  ? 240  HIS E ND1 1 
ATOM   9900  C CD2 . HIS E 1 242 ? 5.920   48.309  -23.056 1.00 57.19  ? 240  HIS E CD2 1 
ATOM   9901  C CE1 . HIS E 1 242 ? 3.874   48.765  -22.417 1.00 58.27  ? 240  HIS E CE1 1 
ATOM   9902  N NE2 . HIS E 1 242 ? 4.849   49.152  -23.220 1.00 58.21  ? 240  HIS E NE2 1 
ATOM   9903  N N   . ALA E 1 243 ? 8.575   44.939  -19.811 1.00 32.07  ? 241  ALA E N   1 
ATOM   9904  C CA  . ALA E 1 243 ? 9.003   43.883  -18.918 1.00 25.77  ? 241  ALA E CA  1 
ATOM   9905  C C   . ALA E 1 243 ? 9.558   44.620  -17.689 1.00 25.46  ? 241  ALA E C   1 
ATOM   9906  O O   . ALA E 1 243 ? 8.972   44.547  -16.606 1.00 24.71  ? 241  ALA E O   1 
ATOM   9907  C CB  . ALA E 1 243 ? 10.072  43.051  -19.585 1.00 30.45  ? 241  ALA E CB  1 
ATOM   9908  N N   . LEU E 1 244 ? 10.663  45.350  -17.858 1.00 18.93  ? 242  LEU E N   1 
ATOM   9909  C CA  . LEU E 1 244 ? 11.238  46.110  -16.753 1.00 14.94  ? 242  LEU E CA  1 
ATOM   9910  C C   . LEU E 1 244 ? 10.131  46.703  -15.906 1.00 18.13  ? 242  LEU E C   1 
ATOM   9911  O O   . LEU E 1 244 ? 9.998   46.392  -14.719 1.00 20.45  ? 242  LEU E O   1 
ATOM   9912  C CB  . LEU E 1 244 ? 12.095  47.244  -17.278 1.00 11.07  ? 242  LEU E CB  1 
ATOM   9913  C CG  . LEU E 1 244 ? 13.262  46.692  -18.082 1.00 14.59  ? 242  LEU E CG  1 
ATOM   9914  C CD1 . LEU E 1 244 ? 14.121  47.796  -18.648 1.00 14.22  ? 242  LEU E CD1 1 
ATOM   9915  C CD2 . LEU E 1 244 ? 14.081  45.822  -17.182 1.00 18.61  ? 242  LEU E CD2 1 
ATOM   9916  N N   . HIS E 1 245 ? 9.313   47.542  -16.523 1.00 19.50  ? 243  HIS E N   1 
ATOM   9917  C CA  . HIS E 1 245 ? 8.244   48.177  -15.781 1.00 23.64  ? 243  HIS E CA  1 
ATOM   9918  C C   . HIS E 1 245 ? 7.592   47.273  -14.739 1.00 21.06  ? 243  HIS E C   1 
ATOM   9919  O O   . HIS E 1 245 ? 7.377   47.686  -13.601 1.00 21.78  ? 243  HIS E O   1 
ATOM   9920  C CB  . HIS E 1 245 ? 7.177   48.736  -16.721 1.00 39.68  ? 243  HIS E CB  1 
ATOM   9921  C CG  . HIS E 1 245 ? 6.131   49.543  -16.014 1.00 41.09  ? 243  HIS E CG  1 
ATOM   9922  N ND1 . HIS E 1 245 ? 6.440   50.411  -14.989 1.00 43.86  ? 243  HIS E ND1 1 
ATOM   9923  C CD2 . HIS E 1 245 ? 4.786   49.591  -16.154 1.00 40.84  ? 243  HIS E CD2 1 
ATOM   9924  C CE1 . HIS E 1 245 ? 5.331   50.955  -14.523 1.00 39.80  ? 243  HIS E CE1 1 
ATOM   9925  N NE2 . HIS E 1 245 ? 4.313   50.474  -15.212 1.00 43.64  ? 243  HIS E NE2 1 
ATOM   9926  N N   . VAL E 1 246 ? 7.284   46.040  -15.106 1.00 22.69  ? 244  VAL E N   1 
ATOM   9927  C CA  . VAL E 1 246 ? 6.653   45.163  -14.142 1.00 26.26  ? 244  VAL E CA  1 
ATOM   9928  C C   . VAL E 1 246 ? 7.599   44.792  -12.996 1.00 23.99  ? 244  VAL E C   1 
ATOM   9929  O O   . VAL E 1 246 ? 7.177   44.765  -11.836 1.00 22.37  ? 244  VAL E O   1 
ATOM   9930  C CB  . VAL E 1 246 ? 6.117   43.881  -14.808 1.00 26.24  ? 244  VAL E CB  1 
ATOM   9931  C CG1 . VAL E 1 246 ? 7.242   42.911  -15.092 1.00 26.24  ? 244  VAL E CG1 1 
ATOM   9932  C CG2 . VAL E 1 246 ? 5.082   43.244  -13.907 1.00 30.08  ? 244  VAL E CG2 1 
ATOM   9933  N N   . LEU E 1 247 ? 8.867   44.506  -13.303 1.00 22.40  ? 245  LEU E N   1 
ATOM   9934  C CA  . LEU E 1 247 ? 9.814   44.160  -12.244 1.00 23.42  ? 245  LEU E CA  1 
ATOM   9935  C C   . LEU E 1 247 ? 9.704   45.260  -11.213 1.00 29.42  ? 245  LEU E C   1 
ATOM   9936  O O   . LEU E 1 247 ? 9.312   45.029  -10.069 1.00 31.09  ? 245  LEU E O   1 
ATOM   9937  C CB  . LEU E 1 247 ? 11.253  44.117  -12.757 1.00 1.00   ? 245  LEU E CB  1 
ATOM   9938  C CG  . LEU E 1 247 ? 11.630  42.949  -13.676 1.00 1.00   ? 245  LEU E CG  1 
ATOM   9939  C CD1 . LEU E 1 247 ? 13.108  43.024  -14.005 1.00 1.00   ? 245  LEU E CD1 1 
ATOM   9940  C CD2 . LEU E 1 247 ? 11.250  41.595  -13.018 1.00 1.00   ? 245  LEU E CD2 1 
ATOM   9941  N N   . GLU E 1 248 ? 10.038  46.470  -11.642 1.00 35.31  ? 246  GLU E N   1 
ATOM   9942  C CA  . GLU E 1 248 ? 9.974   47.624  -10.768 1.00 35.39  ? 246  GLU E CA  1 
ATOM   9943  C C   . GLU E 1 248 ? 8.647   47.627  -10.022 1.00 35.23  ? 246  GLU E C   1 
ATOM   9944  O O   . GLU E 1 248 ? 8.609   47.771  -8.801  1.00 38.94  ? 246  GLU E O   1 
ATOM   9945  C CB  . GLU E 1 248 ? 10.088  48.896  -11.593 1.00 38.02  ? 246  GLU E CB  1 
ATOM   9946  C CG  . GLU E 1 248 ? 11.150  48.822  -12.659 1.00 42.97  ? 246  GLU E CG  1 
ATOM   9947  C CD  . GLU E 1 248 ? 12.539  48.721  -12.087 1.00 46.02  ? 246  GLU E CD  1 
ATOM   9948  O OE1 . GLU E 1 248 ? 13.504  48.683  -12.887 1.00 48.55  ? 246  GLU E OE1 1 
ATOM   9949  O OE2 . GLU E 1 248 ? 12.664  48.686  -10.843 1.00 48.30  ? 246  GLU E OE2 1 
ATOM   9950  N N   . SER E 1 249 ? 7.561   47.458  -10.769 1.00 22.71  ? 247  SER E N   1 
ATOM   9951  C CA  . SER E 1 249 ? 6.222   47.466  -10.199 1.00 22.12  ? 247  SER E CA  1 
ATOM   9952  C C   . SER E 1 249 ? 6.135   46.588  -8.965  1.00 22.44  ? 247  SER E C   1 
ATOM   9953  O O   . SER E 1 249 ? 5.322   46.846  -8.071  1.00 20.28  ? 247  SER E O   1 
ATOM   9954  C CB  . SER E 1 249 ? 5.198   46.985  -11.232 1.00 34.58  ? 247  SER E CB  1 
ATOM   9955  O OG  . SER E 1 249 ? 5.171   47.818  -12.377 1.00 37.61  ? 247  SER E OG  1 
ATOM   9956  N N   . GLY E 1 250 ? 6.979   45.558  -8.918  1.00 40.69  ? 248  GLY E N   1 
ATOM   9957  C CA  . GLY E 1 250 ? 6.969   44.635  -7.792  1.00 42.96  ? 248  GLY E CA  1 
ATOM   9958  C C   . GLY E 1 250 ? 8.143   44.738  -6.826  1.00 45.23  ? 248  GLY E C   1 
ATOM   9959  O O   . GLY E 1 250 ? 8.409   43.808  -6.061  1.00 45.51  ? 248  GLY E O   1 
ATOM   9960  N N   . GLY E 1 251 ? 8.852   45.860  -6.855  1.00 42.90  ? 249  GLY E N   1 
ATOM   9961  C CA  . GLY E 1 251 ? 9.975   46.038  -5.954  1.00 40.38  ? 249  GLY E CA  1 
ATOM   9962  C C   . GLY E 1 251 ? 11.085  45.028  -6.146  1.00 40.59  ? 249  GLY E C   1 
ATOM   9963  O O   . GLY E 1 251 ? 11.804  44.696  -5.206  1.00 43.98  ? 249  GLY E O   1 
ATOM   9964  N N   . PHE E 1 252 ? 11.215  44.538  -7.372  1.00 27.03  ? 250  PHE E N   1 
ATOM   9965  C CA  . PHE E 1 252 ? 12.239  43.572  -7.737  1.00 23.79  ? 250  PHE E CA  1 
ATOM   9966  C C   . PHE E 1 252 ? 13.599  43.957  -7.160  1.00 23.95  ? 250  PHE E C   1 
ATOM   9967  O O   . PHE E 1 252 ? 14.124  43.234  -6.310  1.00 27.88  ? 250  PHE E O   1 
ATOM   9968  C CB  . PHE E 1 252 ? 12.330  43.484  -9.261  1.00 24.58  ? 250  PHE E CB  1 
ATOM   9969  C CG  . PHE E 1 252 ? 13.388  42.535  -9.775  1.00 14.18  ? 250  PHE E CG  1 
ATOM   9970  C CD1 . PHE E 1 252 ? 13.179  41.154  -9.766  1.00 11.92  ? 250  PHE E CD1 1 
ATOM   9971  C CD2 . PHE E 1 252 ? 14.565  43.029  -10.339 1.00 8.75   ? 250  PHE E CD2 1 
ATOM   9972  C CE1 . PHE E 1 252 ? 14.131  40.275  -10.324 1.00 5.69   ? 250  PHE E CE1 1 
ATOM   9973  C CE2 . PHE E 1 252 ? 15.528  42.159  -10.900 1.00 10.17  ? 250  PHE E CE2 1 
ATOM   9974  C CZ  . PHE E 1 252 ? 15.305  40.781  -10.892 1.00 8.05   ? 250  PHE E CZ  1 
ATOM   9975  N N   . ARG E 1 253 ? 14.172  45.086  -7.594  1.00 27.56  ? 251  ARG E N   1 
ATOM   9976  C CA  . ARG E 1 253 ? 15.494  45.488  -7.085  1.00 28.17  ? 251  ARG E CA  1 
ATOM   9977  C C   . ARG E 1 253 ? 15.574  45.414  -5.562  1.00 27.64  ? 251  ARG E C   1 
ATOM   9978  O O   . ARG E 1 253 ? 16.549  44.902  -5.020  1.00 30.46  ? 251  ARG E O   1 
ATOM   9979  C CB  . ARG E 1 253 ? 15.894  46.888  -7.571  1.00 31.12  ? 251  ARG E CB  1 
ATOM   9980  C CG  . ARG E 1 253 ? 14.797  47.673  -8.260  1.00 33.63  ? 251  ARG E CG  1 
ATOM   9981  C CD  . ARG E 1 253 ? 15.372  48.882  -8.971  1.00 33.34  ? 251  ARG E CD  1 
ATOM   9982  N NE  . ARG E 1 253 ? 16.522  48.508  -9.791  1.00 35.75  ? 251  ARG E NE  1 
ATOM   9983  C CZ  . ARG E 1 253 ? 17.063  49.286  -10.722 1.00 38.91  ? 251  ARG E CZ  1 
ATOM   9984  N NH1 . ARG E 1 253 ? 16.556  50.487  -10.958 1.00 43.99  ? 251  ARG E NH1 1 
ATOM   9985  N NH2 . ARG E 1 253 ? 18.105  48.865  -11.426 1.00 33.94  ? 251  ARG E NH2 1 
ATOM   9986  N N   . SER E 1 254 ? 14.547  45.910  -4.878  1.00 19.95  ? 252  SER E N   1 
ATOM   9987  C CA  . SER E 1 254 ? 14.507  45.855  -3.421  1.00 18.09  ? 252  SER E CA  1 
ATOM   9988  C C   . SER E 1 254 ? 14.782  44.433  -2.922  1.00 19.34  ? 252  SER E C   1 
ATOM   9989  O O   . SER E 1 254 ? 15.685  44.213  -2.116  1.00 21.31  ? 252  SER E O   1 
ATOM   9990  C CB  . SER E 1 254 ? 13.135  46.303  -2.921  1.00 23.03  ? 252  SER E CB  1 
ATOM   9991  O OG  . SER E 1 254 ? 12.739  45.554  -1.784  1.00 19.92  ? 252  SER E OG  1 
ATOM   9992  N N   . LEU E 1 255 ? 14.000  43.470  -3.401  1.00 23.77  ? 253  LEU E N   1 
ATOM   9993  C CA  . LEU E 1 255 ? 14.159  42.073  -3.000  1.00 24.64  ? 253  LEU E CA  1 
ATOM   9994  C C   . LEU E 1 255 ? 15.589  41.585  -2.963  1.00 25.31  ? 253  LEU E C   1 
ATOM   9995  O O   . LEU E 1 255 ? 16.026  40.970  -1.996  1.00 24.03  ? 253  LEU E O   1 
ATOM   9996  C CB  . LEU E 1 255 ? 13.393  41.158  -3.938  1.00 26.51  ? 253  LEU E CB  1 
ATOM   9997  C CG  . LEU E 1 255 ? 11.886  41.330  -3.913  1.00 30.13  ? 253  LEU E CG  1 
ATOM   9998  C CD1 . LEU E 1 255 ? 11.229  39.981  -4.216  1.00 31.49  ? 253  LEU E CD1 1 
ATOM   9999  C CD2 . LEU E 1 255 ? 11.463  41.832  -2.551  1.00 27.37  ? 253  LEU E CD2 1 
ATOM   10000 N N   . LEU E 1 256 ? 16.309  41.833  -4.043  1.00 26.78  ? 254  LEU E N   1 
ATOM   10001 C CA  . LEU E 1 256 ? 17.681  41.395  -4.114  1.00 28.87  ? 254  LEU E CA  1 
ATOM   10002 C C   . LEU E 1 256 ? 18.442  41.996  -2.959  1.00 30.80  ? 254  LEU E C   1 
ATOM   10003 O O   . LEU E 1 256 ? 19.277  41.337  -2.347  1.00 34.46  ? 254  LEU E O   1 
ATOM   10004 C CB  . LEU E 1 256 ? 18.302  41.808  -5.448  1.00 37.53  ? 254  LEU E CB  1 
ATOM   10005 C CG  . LEU E 1 256 ? 17.721  41.080  -6.668  1.00 38.90  ? 254  LEU E CG  1 
ATOM   10006 C CD1 . LEU E 1 256 ? 18.375  41.595  -7.951  1.00 40.11  ? 254  LEU E CD1 1 
ATOM   10007 C CD2 . LEU E 1 256 ? 17.945  39.579  -6.508  1.00 35.76  ? 254  LEU E CD2 1 
ATOM   10008 N N   . ILE E 1 257 ? 18.151  43.249  -2.649  1.00 33.54  ? 255  ILE E N   1 
ATOM   10009 C CA  . ILE E 1 257 ? 18.832  43.895  -1.544  1.00 33.17  ? 255  ILE E CA  1 
ATOM   10010 C C   . ILE E 1 257 ? 18.641  43.054  -0.304  1.00 32.15  ? 255  ILE E C   1 
ATOM   10011 O O   . ILE E 1 257 ? 19.590  42.523  0.264   1.00 32.06  ? 255  ILE E O   1 
ATOM   10012 C CB  . ILE E 1 257 ? 18.238  45.256  -1.218  1.00 33.59  ? 255  ILE E CB  1 
ATOM   10013 C CG1 . ILE E 1 257 ? 18.344  46.187  -2.423  1.00 34.63  ? 255  ILE E CG1 1 
ATOM   10014 C CG2 . ILE E 1 257 ? 18.935  45.814  -0.011  1.00 28.09  ? 255  ILE E CG2 1 
ATOM   10015 C CD1 . ILE E 1 257 ? 19.728  46.276  -2.973  1.00 36.24  ? 255  ILE E CD1 1 
ATOM   10016 N N   . ASN E 1 258 ? 17.388  42.955  0.108   1.00 23.83  ? 256  ASN E N   1 
ATOM   10017 C CA  . ASN E 1 258 ? 17.021  42.204  1.287   1.00 25.44  ? 256  ASN E CA  1 
ATOM   10018 C C   . ASN E 1 258 ? 17.802  40.917  1.368   1.00 26.79  ? 256  ASN E C   1 
ATOM   10019 O O   . ASN E 1 258 ? 18.233  40.516  2.445   1.00 32.14  ? 256  ASN E O   1 
ATOM   10020 C CB  . ASN E 1 258 ? 15.533  41.912  1.251   1.00 35.24  ? 256  ASN E CB  1 
ATOM   10021 C CG  . ASN E 1 258 ? 14.725  43.157  1.024   1.00 36.33  ? 256  ASN E CG  1 
ATOM   10022 O OD1 . ASN E 1 258 ? 15.267  44.164  0.571   1.00 40.54  ? 256  ASN E OD1 1 
ATOM   10023 N ND2 . ASN E 1 258 ? 13.425  43.107  1.325   1.00 32.71  ? 256  ASN E ND2 1 
ATOM   10024 N N   . ALA E 1 259 ? 17.989  40.271  0.227   1.00 22.69  ? 257  ALA E N   1 
ATOM   10025 C CA  . ALA E 1 259 ? 18.734  39.030  0.196   1.00 21.67  ? 257  ALA E CA  1 
ATOM   10026 C C   . ALA E 1 259 ? 20.137  39.281  0.742   1.00 22.09  ? 257  ALA E C   1 
ATOM   10027 O O   . ALA E 1 259 ? 20.447  38.875  1.863   1.00 21.72  ? 257  ALA E O   1 
ATOM   10028 C CB  . ALA E 1 259 ? 18.805  38.506  -1.217  1.00 27.39  ? 257  ALA E CB  1 
ATOM   10029 N N   . VAL E 1 260 ? 20.975  39.949  -0.052  1.00 33.75  ? 258  VAL E N   1 
ATOM   10030 C CA  . VAL E 1 260 ? 22.345  40.278  0.344   1.00 31.25  ? 258  VAL E CA  1 
ATOM   10031 C C   . VAL E 1 260 ? 22.448  40.639  1.825   1.00 35.33  ? 258  VAL E C   1 
ATOM   10032 O O   . VAL E 1 260 ? 23.297  40.126  2.552   1.00 39.34  ? 258  VAL E O   1 
ATOM   10033 C CB  . VAL E 1 260 ? 22.866  41.461  -0.474  1.00 13.85  ? 258  VAL E CB  1 
ATOM   10034 C CG1 . VAL E 1 260 ? 24.040  42.130  0.242   1.00 10.04  ? 258  VAL E CG1 1 
ATOM   10035 C CG2 . VAL E 1 260 ? 23.297  40.975  -1.828  1.00 11.63  ? 258  VAL E CG2 1 
ATOM   10036 N N   . GLU E 1 261 ? 21.585  41.544  2.254   1.00 29.60  ? 259  GLU E N   1 
ATOM   10037 C CA  . GLU E 1 261 ? 21.541  41.968  3.640   1.00 30.03  ? 259  GLU E CA  1 
ATOM   10038 C C   . GLU E 1 261 ? 21.369  40.738  4.525   1.00 30.49  ? 259  GLU E C   1 
ATOM   10039 O O   . GLU E 1 261 ? 22.289  40.329  5.230   1.00 29.29  ? 259  GLU E O   1 
ATOM   10040 C CB  . GLU E 1 261 ? 20.351  42.894  3.835   1.00 34.87  ? 259  GLU E CB  1 
ATOM   10041 C CG  . GLU E 1 261 ? 20.230  43.498  5.203   1.00 36.98  ? 259  GLU E CG  1 
ATOM   10042 C CD  . GLU E 1 261 ? 18.990  44.364  5.304   1.00 40.83  ? 259  GLU E CD  1 
ATOM   10043 O OE1 . GLU E 1 261 ? 19.106  45.556  5.675   1.00 44.69  ? 259  GLU E OE1 1 
ATOM   10044 O OE2 . GLU E 1 261 ? 17.895  43.842  5.003   1.00 42.31  ? 259  GLU E OE2 1 
ATOM   10045 N N   . ALA E 1 262 ? 20.173  40.160  4.471   1.00 38.91  ? 260  ALA E N   1 
ATOM   10046 C CA  . ALA E 1 262 ? 19.821  38.972  5.246   1.00 40.47  ? 260  ALA E CA  1 
ATOM   10047 C C   . ALA E 1 262 ? 20.954  37.949  5.290   1.00 40.76  ? 260  ALA E C   1 
ATOM   10048 O O   . ALA E 1 262 ? 21.258  37.387  6.338   1.00 41.83  ? 260  ALA E O   1 
ATOM   10049 C CB  . ALA E 1 262 ? 18.570  38.334  4.656   1.00 53.38  ? 260  ALA E CB  1 
ATOM   10050 N N   . SER E 1 263 ? 21.558  37.689  4.139   1.00 31.65  ? 261  SER E N   1 
ATOM   10051 C CA  . SER E 1 263 ? 22.665  36.756  4.077   1.00 29.86  ? 261  SER E CA  1 
ATOM   10052 C C   . SER E 1 263 ? 23.701  37.264  5.054   1.00 30.61  ? 261  SER E C   1 
ATOM   10053 O O   . SER E 1 263 ? 24.044  36.597  6.025   1.00 32.29  ? 261  SER E O   1 
ATOM   10054 C CB  . SER E 1 263 ? 23.273  36.761  2.682   1.00 41.38  ? 261  SER E CB  1 
ATOM   10055 O OG  . SER E 1 263 ? 24.483  36.017  2.654   1.00 45.55  ? 261  SER E OG  1 
ATOM   10056 N N   . CYS E 1 264 ? 24.179  38.473  4.768   1.00 34.77  ? 262  CYS E N   1 
ATOM   10057 C CA  . CYS E 1 264 ? 25.192  39.158  5.562   1.00 34.16  ? 262  CYS E CA  1 
ATOM   10058 C C   . CYS E 1 264 ? 24.927  39.137  7.065   1.00 32.60  ? 262  CYS E C   1 
ATOM   10059 O O   . CYS E 1 264 ? 25.753  38.661  7.840   1.00 35.35  ? 262  CYS E O   1 
ATOM   10060 C CB  . CYS E 1 264 ? 25.308  40.596  5.087   1.00 37.03  ? 262  CYS E CB  1 
ATOM   10061 S SG  . CYS E 1 264 ? 26.639  41.452  5.871   1.00 44.53  ? 262  CYS E SG  1 
ATOM   10062 N N   . ILE E 1 265 ? 23.787  39.680  7.470   1.00 28.05  ? 263  ILE E N   1 
ATOM   10063 C CA  . ILE E 1 265 ? 23.406  39.685  8.872   1.00 28.22  ? 263  ILE E CA  1 
ATOM   10064 C C   . ILE E 1 265 ? 23.652  38.295  9.430   1.00 30.67  ? 263  ILE E C   1 
ATOM   10065 O O   . ILE E 1 265 ? 24.488  38.093  10.307  1.00 36.53  ? 263  ILE E O   1 
ATOM   10066 C CB  . ILE E 1 265 ? 21.906  39.938  9.055   1.00 27.11  ? 263  ILE E CB  1 
ATOM   10067 C CG1 . ILE E 1 265 ? 21.509  41.276  8.429   1.00 24.12  ? 263  ILE E CG1 1 
ATOM   10068 C CG2 . ILE E 1 265 ? 21.549  39.839  10.536  1.00 23.87  ? 263  ILE E CG2 1 
ATOM   10069 C CD1 . ILE E 1 265 ? 22.084  42.467  9.139   1.00 29.80  ? 263  ILE E CD1 1 
ATOM   10070 N N   . ARG E 1 266 ? 22.900  37.337  8.909   1.00 19.89  ? 264  ARG E N   1 
ATOM   10071 C CA  . ARG E 1 266 ? 23.007  35.964  9.358   1.00 22.00  ? 264  ARG E CA  1 
ATOM   10072 C C   . ARG E 1 266 ? 24.432  35.466  9.434   1.00 22.75  ? 264  ARG E C   1 
ATOM   10073 O O   . ARG E 1 266 ? 24.770  34.729  10.346  1.00 27.03  ? 264  ARG E O   1 
ATOM   10074 C CB  . ARG E 1 266 ? 22.211  35.034  8.457   1.00 36.56  ? 264  ARG E CB  1 
ATOM   10075 C CG  . ARG E 1 266 ? 22.226  33.614  8.947   1.00 39.04  ? 264  ARG E CG  1 
ATOM   10076 C CD  . ARG E 1 266 ? 21.666  33.521  10.356  1.00 42.40  ? 264  ARG E CD  1 
ATOM   10077 N NE  . ARG E 1 266 ? 21.524  32.133  10.793  1.00 48.07  ? 264  ARG E NE  1 
ATOM   10078 C CZ  . ARG E 1 266 ? 20.864  31.754  11.885  1.00 48.95  ? 264  ARG E CZ  1 
ATOM   10079 N NH1 . ARG E 1 266 ? 20.284  32.666  12.659  1.00 51.32  ? 264  ARG E NH1 1 
ATOM   10080 N NH2 . ARG E 1 266 ? 20.770  30.464  12.193  1.00 49.39  ? 264  ARG E NH2 1 
ATOM   10081 N N   . THR E 1 267 ? 25.271  35.834  8.478   1.00 31.24  ? 265  THR E N   1 
ATOM   10082 C CA  . THR E 1 267 ? 26.642  35.377  8.549   1.00 33.52  ? 265  THR E CA  1 
ATOM   10083 C C   . THR E 1 267 ? 27.233  35.957  9.820   1.00 37.00  ? 265  THR E C   1 
ATOM   10084 O O   . THR E 1 267 ? 28.071  35.331  10.474  1.00 38.95  ? 265  THR E O   1 
ATOM   10085 C CB  . THR E 1 267 ? 27.457  35.836  7.337   1.00 32.47  ? 265  THR E CB  1 
ATOM   10086 O OG1 . THR E 1 267 ? 27.267  34.900  6.271   1.00 38.59  ? 265  THR E OG1 1 
ATOM   10087 C CG2 . THR E 1 267 ? 28.944  35.922  7.678   1.00 34.06  ? 265  THR E CG2 1 
ATOM   10088 N N   . ARG E 1 268 ? 26.777  37.149  10.182  1.00 37.11  ? 266  ARG E N   1 
ATOM   10089 C CA  . ARG E 1 268 ? 27.273  37.803  11.376  1.00 41.77  ? 266  ARG E CA  1 
ATOM   10090 C C   . ARG E 1 268 ? 26.670  37.235  12.656  1.00 44.39  ? 266  ARG E C   1 
ATOM   10091 O O   . ARG E 1 268 ? 27.375  37.047  13.650  1.00 44.67  ? 266  ARG E O   1 
ATOM   10092 C CB  . ARG E 1 268 ? 27.028  39.307  11.280  1.00 57.36  ? 266  ARG E CB  1 
ATOM   10093 C CG  . ARG E 1 268 ? 28.268  40.065  10.832  1.00 60.84  ? 266  ARG E CG  1 
ATOM   10094 C CD  . ARG E 1 268 ? 28.010  41.009  9.670   1.00 63.61  ? 266  ARG E CD  1 
ATOM   10095 N NE  . ARG E 1 268 ? 26.932  41.955  9.944   1.00 65.23  ? 266  ARG E NE  1 
ATOM   10096 C CZ  . ARG E 1 268 ? 26.820  43.152  9.372   1.00 66.84  ? 266  ARG E CZ  1 
ATOM   10097 N NH1 . ARG E 1 268 ? 27.727  43.568  8.491   1.00 66.07  ? 266  ARG E NH1 1 
ATOM   10098 N NH2 . ARG E 1 268 ? 25.788  43.930  9.677   1.00 66.61  ? 266  ARG E NH2 1 
ATOM   10099 N N   . GLU E 1 269 ? 25.374  36.948  12.635  1.00 47.20  ? 267  GLU E N   1 
ATOM   10100 C CA  . GLU E 1 269 ? 24.723  36.399  13.813  1.00 51.91  ? 267  GLU E CA  1 
ATOM   10101 C C   . GLU E 1 269 ? 25.345  35.074  14.219  1.00 55.47  ? 267  GLU E C   1 
ATOM   10102 O O   . GLU E 1 269 ? 25.084  34.577  15.305  1.00 55.96  ? 267  GLU E O   1 
ATOM   10103 C CB  . GLU E 1 269 ? 23.239  36.169  13.562  1.00 81.08  ? 267  GLU E CB  1 
ATOM   10104 C CG  . GLU E 1 269 ? 22.475  37.380  13.109  1.00 87.42  ? 267  GLU E CG  1 
ATOM   10105 C CD  . GLU E 1 269 ? 20.980  37.133  13.146  1.00 93.26  ? 267  GLU E CD  1 
ATOM   10106 O OE1 . GLU E 1 269 ? 20.564  36.000  12.814  1.00 93.46  ? 267  GLU E OE1 1 
ATOM   10107 O OE2 . GLU E 1 269 ? 20.222  38.067  13.501  1.00 97.03  ? 267  GLU E OE2 1 
ATOM   10108 N N   . LEU E 1 270 ? 26.159  34.491  13.351  1.00 64.07  ? 268  LEU E N   1 
ATOM   10109 C CA  . LEU E 1 270 ? 26.774  33.214  13.677  1.00 71.49  ? 268  LEU E CA  1 
ATOM   10110 C C   . LEU E 1 270 ? 28.063  33.366  14.470  1.00 76.94  ? 268  LEU E C   1 
ATOM   10111 O O   . LEU E 1 270 ? 28.170  32.849  15.581  1.00 79.50  ? 268  LEU E O   1 
ATOM   10112 C CB  . LEU E 1 270 ? 27.020  32.402  12.404  1.00 63.89  ? 268  LEU E CB  1 
ATOM   10113 C CG  . LEU E 1 270 ? 25.725  32.035  11.673  1.00 60.82  ? 268  LEU E CG  1 
ATOM   10114 C CD1 . LEU E 1 270 ? 26.021  31.095  10.523  1.00 59.83  ? 268  LEU E CD1 1 
ATOM   10115 C CD2 . LEU E 1 270 ? 24.764  31.386  12.652  1.00 59.17  ? 268  LEU E CD2 1 
ATOM   10116 N N   . GLN E 1 271 ? 29.039  34.073  13.913  1.00 70.42  ? 269  GLN E N   1 
ATOM   10117 C CA  . GLN E 1 271 ? 30.301  34.277  14.611  1.00 75.93  ? 269  GLN E CA  1 
ATOM   10118 C C   . GLN E 1 271 ? 30.032  34.991  15.934  1.00 79.05  ? 269  GLN E C   1 
ATOM   10119 O O   . GLN E 1 271 ? 30.848  34.950  16.857  1.00 80.34  ? 269  GLN E O   1 
ATOM   10120 C CB  . GLN E 1 271 ? 31.236  35.129  13.773  1.00 97.52  ? 269  GLN E CB  1 
ATOM   10121 C CG  . GLN E 1 271 ? 30.727  36.535  13.597  1.00 100.83 ? 269  GLN E CG  1 
ATOM   10122 C CD  . GLN E 1 271 ? 31.807  37.469  13.132  1.00 103.94 ? 269  GLN E CD  1 
ATOM   10123 O OE1 . GLN E 1 271 ? 32.389  37.281  12.062  1.00 105.43 ? 269  GLN E OE1 1 
ATOM   10124 N NE2 . GLN E 1 271 ? 32.093  38.486  13.938  1.00 104.29 ? 269  GLN E NE2 1 
ATOM   10125 N N   . SER E 1 272 ? 28.886  35.660  16.011  1.00 96.93  ? 270  SER E N   1 
ATOM   10126 C CA  . SER E 1 272 ? 28.494  36.375  17.217  1.00 100.53 ? 270  SER E CA  1 
ATOM   10127 C C   . SER E 1 272 ? 27.885  35.385  18.202  1.00 102.23 ? 270  SER E C   1 
ATOM   10128 O O   . SER E 1 272 ? 27.001  35.725  18.988  1.00 102.32 ? 270  SER E O   1 
ATOM   10129 C CB  . SER E 1 272 ? 27.485  37.468  16.873  1.00 137.14 ? 270  SER E CB  1 
ATOM   10130 O OG  . SER E 1 272 ? 28.038  38.378  15.939  1.00 140.03 ? 270  SER E OG  1 
ATOM   10131 N N   . MET E 1 273 ? 28.366  34.148  18.126  1.00 109.27 ? 271  MET E N   1 
ATOM   10132 C CA  . MET E 1 273 ? 27.931  33.057  18.989  1.00 112.87 ? 271  MET E CA  1 
ATOM   10133 C C   . MET E 1 273 ? 29.098  32.091  19.061  1.00 115.62 ? 271  MET E C   1 
ATOM   10134 O O   . MET E 1 273 ? 29.375  31.500  20.105  1.00 116.46 ? 271  MET E O   1 
ATOM   10135 C CB  . MET E 1 273 ? 26.716  32.348  18.399  1.00 147.25 ? 271  MET E CB  1 
ATOM   10136 C CG  . MET E 1 273 ? 25.552  33.270  18.134  1.00 148.91 ? 271  MET E CG  1 
ATOM   10137 S SD  . MET E 1 273 ? 24.021  32.373  17.925  1.00 152.80 ? 271  MET E SD  1 
ATOM   10138 C CE  . MET E 1 273 ? 23.460  32.311  19.639  1.00 152.15 ? 271  MET E CE  1 
ATOM   10139 N N   . ALA E 1 274 ? 29.781  31.944  17.928  1.00 122.90 ? 272  ALA E N   1 
ATOM   10140 C CA  . ALA E 1 274 ? 30.948  31.079  17.827  1.00 126.64 ? 272  ALA E CA  1 
ATOM   10141 C C   . ALA E 1 274 ? 32.039  31.716  18.676  1.00 129.81 ? 272  ALA E C   1 
ATOM   10142 O O   . ALA E 1 274 ? 33.135  31.173  18.827  1.00 130.47 ? 272  ALA E O   1 
ATOM   10143 C CB  . ALA E 1 274 ? 31.403  30.977  16.373  1.00 109.53 ? 272  ALA E CB  1 
ATOM   10144 N N   . ASP E 1 275 ? 31.722  32.884  19.222  1.00 141.85 ? 273  ASP E N   1 
ATOM   10145 C CA  . ASP E 1 275 ? 32.648  33.616  20.067  1.00 145.48 ? 273  ASP E CA  1 
ATOM   10146 C C   . ASP E 1 275 ? 32.066  33.776  21.466  1.00 146.89 ? 273  ASP E C   1 
ATOM   10147 O O   . ASP E 1 275 ? 32.015  34.880  22.008  1.00 147.26 ? 273  ASP E O   1 
ATOM   10148 C CB  . ASP E 1 275 ? 32.950  34.987  19.454  1.00 163.52 ? 273  ASP E CB  1 
ATOM   10149 C CG  . ASP E 1 275 ? 33.746  34.886  18.160  1.00 165.50 ? 273  ASP E CG  1 
ATOM   10150 O OD1 . ASP E 1 275 ? 34.830  34.264  18.175  1.00 166.89 ? 273  ASP E OD1 1 
ATOM   10151 O OD2 . ASP E 1 275 ? 33.292  35.432  17.130  1.00 165.42 ? 273  ASP E OD2 1 
ATOM   10152 N N   . GLN E 1 276 ? 31.621  32.659  22.038  1.00 172.39 ? 274  GLN E N   1 
ATOM   10153 C CA  . GLN E 1 276 ? 31.051  32.639  23.382  1.00 174.03 ? 274  GLN E CA  1 
ATOM   10154 C C   . GLN E 1 276 ? 30.632  31.227  23.780  1.00 175.75 ? 274  GLN E C   1 
ATOM   10155 O O   . GLN E 1 276 ? 31.258  30.597  24.633  1.00 176.00 ? 274  GLN E O   1 
ATOM   10156 C CB  . GLN E 1 276 ? 29.841  33.583  23.480  1.00 175.05 ? 274  GLN E CB  1 
ATOM   10157 C CG  . GLN E 1 276 ? 28.687  33.280  22.526  1.00 173.99 ? 274  GLN E CG  1 
ATOM   10158 C CD  . GLN E 1 276 ? 27.399  33.992  22.920  1.00 173.56 ? 274  GLN E CD  1 
ATOM   10159 O OE1 . GLN E 1 276 ? 26.878  33.798  24.021  1.00 173.58 ? 274  GLN E OE1 1 
ATOM   10160 N NE2 . GLN E 1 276 ? 26.879  34.819  22.019  1.00 173.57 ? 274  GLN E NE2 1 
ATOM   10161 N N   . GLU E 1 277 ? 29.569  30.743  23.146  1.00 141.37 ? 275  GLU E N   1 
ATOM   10162 C CA  . GLU E 1 277 ? 29.026  29.418  23.409  1.00 143.99 ? 275  GLU E CA  1 
ATOM   10163 C C   . GLU E 1 277 ? 29.219  28.510  22.202  1.00 144.52 ? 275  GLU E C   1 
ATOM   10164 O O   . GLU E 1 277 ? 28.322  28.373  21.371  1.00 145.58 ? 275  GLU E O   1 
ATOM   10165 C CB  . GLU E 1 277 ? 27.537  29.534  23.739  1.00 200.00 ? 275  GLU E CB  1 
ATOM   10166 C CG  . GLU E 1 277 ? 26.802  30.526  22.850  1.00 200.00 ? 275  GLU E CG  1 
ATOM   10167 C CD  . GLU E 1 277 ? 25.354  30.707  23.246  1.00 200.00 ? 275  GLU E CD  1 
ATOM   10168 O OE1 . GLU E 1 277 ? 24.545  29.794  22.977  1.00 200.00 ? 275  GLU E OE1 1 
ATOM   10169 O OE2 . GLU E 1 277 ? 25.026  31.760  23.835  1.00 200.00 ? 275  GLU E OE2 1 
HETATM 10170 P PA  . NAP F 2 .   ? 18.103  79.097  -1.746  1.00 82.81  ? 1300 NAP A PA  1 
HETATM 10171 O O1A . NAP F 2 .   ? 16.681  79.793  -2.186  1.00 86.24  ? 1300 NAP A O1A 1 
HETATM 10172 O O2A . NAP F 2 .   ? 17.936  77.366  -1.845  1.00 83.08  ? 1300 NAP A O2A 1 
HETATM 10173 O O5B . NAP F 2 .   ? 18.529  79.431  -0.242  1.00 81.07  ? 1300 NAP A O5B 1 
HETATM 10174 C C5B . NAP F 2 .   ? 17.557  78.691  0.649   1.00 80.16  ? 1300 NAP A C5B 1 
HETATM 10175 C C4B . NAP F 2 .   ? 16.179  78.808  1.399   1.00 84.60  ? 1300 NAP A C4B 1 
HETATM 10176 O O4B . NAP F 2 .   ? 15.905  79.974  2.126   1.00 84.22  ? 1300 NAP A O4B 1 
HETATM 10177 C C3B . NAP F 2 .   ? 15.249  79.081  0.229   1.00 85.51  ? 1300 NAP A C3B 1 
HETATM 10178 O O3B . NAP F 2 .   ? 14.599  77.919  -0.292  1.00 87.05  ? 1300 NAP A O3B 1 
HETATM 10179 C C2B . NAP F 2 .   ? 14.279  80.235  0.487   1.00 84.96  ? 1300 NAP A C2B 1 
HETATM 10180 O O2B . NAP F 2 .   ? 13.004  79.882  -0.101  1.00 82.85  ? 1300 NAP A O2B 1 
HETATM 10181 C C1B . NAP F 2 .   ? 14.525  80.023  2.018   1.00 82.09  ? 1300 NAP A C1B 1 
HETATM 10182 N N9A . NAP F 2 .   ? 13.945  80.923  3.086   1.00 78.22  ? 1300 NAP A N9A 1 
HETATM 10183 C C8A . NAP F 2 .   ? 13.170  82.151  2.918   1.00 76.80  ? 1300 NAP A C8A 1 
HETATM 10184 N N7A . NAP F 2 .   ? 12.779  82.631  4.521   1.00 76.46  ? 1300 NAP A N7A 1 
HETATM 10185 C C5A . NAP F 2 .   ? 13.416  81.606  5.356   1.00 75.86  ? 1300 NAP A C5A 1 
HETATM 10186 C C6A . NAP F 2 .   ? 13.444  81.457  6.797   1.00 73.72  ? 1300 NAP A C6A 1 
HETATM 10187 N N6A . NAP F 2 .   ? 12.714  82.462  7.568   1.00 71.14  ? 1300 NAP A N6A 1 
HETATM 10188 N N1A . NAP F 2 .   ? 14.119  80.372  7.393   1.00 71.74  ? 1300 NAP A N1A 1 
HETATM 10189 C C2A . NAP F 2 .   ? 14.742  79.509  6.543   1.00 70.28  ? 1300 NAP A C2A 1 
HETATM 10190 N N3A . NAP F 2 .   ? 14.776  79.558  5.166   1.00 73.16  ? 1300 NAP A N3A 1 
HETATM 10191 C C4A . NAP F 2 .   ? 14.095  80.626  4.547   1.00 76.83  ? 1300 NAP A C4A 1 
HETATM 10192 O O3  . NAP F 2 .   ? 19.071  79.811  -2.834  1.00 79.54  ? 1300 NAP A O3  1 
HETATM 10193 P PN  . NAP F 2 .   ? 18.703  79.301  -4.368  1.00 84.43  ? 1300 NAP A PN  1 
HETATM 10194 O O1N . NAP F 2 .   ? 17.209  78.632  -4.926  1.00 82.43  ? 1300 NAP A O1N 1 
HETATM 10195 O O2N . NAP F 2 .   ? 19.877  78.163  -4.357  1.00 82.12  ? 1300 NAP A O2N 1 
HETATM 10196 O O5D . NAP F 2 .   ? 19.052  80.476  -5.408  1.00 80.18  ? 1300 NAP A O5D 1 
HETATM 10197 C C5D . NAP F 2 .   ? 18.782  79.176  -6.587  1.00 76.11  ? 1300 NAP A C5D 1 
HETATM 10198 C C4D . NAP F 2 .   ? 19.728  79.769  -7.353  1.00 75.58  ? 1300 NAP A C4D 1 
HETATM 10199 O O4D . NAP F 2 .   ? 20.696  79.463  -6.435  1.00 74.01  ? 1300 NAP A O4D 1 
HETATM 10200 C C3D . NAP F 2 .   ? 20.121  79.221  -8.551  1.00 74.47  ? 1300 NAP A C3D 1 
HETATM 10201 O O3D . NAP F 2 .   ? 19.382  80.184  -9.445  1.00 73.36  ? 1300 NAP A O3D 1 
HETATM 10202 C C2D . NAP F 2 .   ? 21.673  79.182  -8.448  1.00 73.37  ? 1300 NAP A C2D 1 
HETATM 10203 O O2D . NAP F 2 .   ? 22.089  80.036  -9.611  1.00 74.02  ? 1300 NAP A O2D 1 
HETATM 10204 C C1D . NAP F 2 .   ? 21.940  79.691  -7.157  1.00 72.10  ? 1300 NAP A C1D 1 
HETATM 10205 N N1N . NAP F 2 .   ? 22.521  80.067  -5.839  1.00 69.15  ? 1300 NAP A N1N 1 
HETATM 10206 C C2N . NAP F 2 .   ? 23.843  80.213  -6.213  1.00 66.41  ? 1300 NAP A C2N 1 
HETATM 10207 C C3N . NAP F 2 .   ? 24.742  80.617  -5.248  1.00 63.50  ? 1300 NAP A C3N 1 
HETATM 10208 C C7N . NAP F 2 .   ? 26.036  80.772  -5.632  1.00 61.76  ? 1300 NAP A C7N 1 
HETATM 10209 O O7N . NAP F 2 .   ? 26.564  80.512  -6.950  1.00 55.91  ? 1300 NAP A O7N 1 
HETATM 10210 N N7N . NAP F 2 .   ? 27.099  81.114  -4.862  1.00 59.63  ? 1300 NAP A N7N 1 
HETATM 10211 C C4N . NAP F 2 .   ? 24.475  80.897  -3.931  1.00 65.98  ? 1300 NAP A C4N 1 
HETATM 10212 C C5N . NAP F 2 .   ? 23.041  80.746  -3.531  1.00 66.80  ? 1300 NAP A C5N 1 
HETATM 10213 C C6N . NAP F 2 .   ? 22.024  80.344  -4.424  1.00 67.25  ? 1300 NAP A C6N 1 
HETATM 10214 P P2B . NAP F 2 .   ? 11.843  80.769  -0.309  1.00 88.14  ? 1300 NAP A P2B 1 
HETATM 10215 O O1X . NAP F 2 .   ? 12.272  82.202  -1.185  1.00 83.58  ? 1300 NAP A O1X 1 
HETATM 10216 O O2X . NAP F 2 .   ? 10.450  80.088  -1.137  1.00 86.93  ? 1300 NAP A O2X 1 
HETATM 10217 O O3X . NAP F 2 .   ? 11.415  81.688  1.095   1.00 85.06  ? 1300 NAP A O3X 1 
HETATM 10218 N N   . GLU G 3 .   ? 23.963  84.275  -3.638  1.00 124.92 ? 1301 GLU A N   1 
HETATM 10219 C CA  . GLU G 3 .   ? 22.792  84.264  -4.509  1.00 125.31 ? 1301 GLU A CA  1 
HETATM 10220 C C   . GLU G 3 .   ? 21.588  83.542  -3.901  1.00 125.94 ? 1301 GLU A C   1 
HETATM 10221 O O   . GLU G 3 .   ? 20.446  83.894  -4.265  1.00 126.92 ? 1301 GLU A O   1 
HETATM 10222 C CB  . GLU G 3 .   ? 23.141  83.634  -5.858  1.00 122.58 ? 1301 GLU A CB  1 
HETATM 10223 C CG  . GLU G 3 .   ? 21.932  83.097  -6.609  1.00 121.58 ? 1301 GLU A CG  1 
HETATM 10224 C CD  . GLU G 3 .   ? 22.259  82.719  -8.031  1.00 121.44 ? 1301 GLU A CD  1 
HETATM 10225 O OE1 . GLU G 3 .   ? 23.462  82.555  -8.331  1.00 120.71 ? 1301 GLU A OE1 1 
HETATM 10226 O OE2 . GLU G 3 .   ? 21.315  82.580  -8.842  1.00 122.17 ? 1301 GLU A OE2 1 
HETATM 10227 O OXT . GLU G 3 .   ? 21.792  82.621  -3.086  1.00 124.76 ? 1301 GLU A OXT 1 
HETATM 10228 P PA  . NAP H 2 .   ? 10.329  7.495   3.112   1.00 91.75  ? 2300 NAP B PA  1 
HETATM 10229 O O1A . NAP H 2 .   ? 10.760  7.606   1.526   1.00 91.05  ? 2300 NAP B O1A 1 
HETATM 10230 O O2A . NAP H 2 .   ? 9.377   8.898   3.549   1.00 88.64  ? 2300 NAP B O2A 1 
HETATM 10231 O O5B . NAP H 2 .   ? 11.683  7.653   4.074   1.00 88.56  ? 2300 NAP B O5B 1 
HETATM 10232 C C5B . NAP H 2 .   ? 12.153  9.109   3.986   1.00 86.96  ? 2300 NAP B C5B 1 
HETATM 10233 C C4B . NAP H 2 .   ? 13.278  9.725   3.242   1.00 86.82  ? 2300 NAP B C4B 1 
HETATM 10234 O O4B . NAP H 2 .   ? 14.562  9.204   3.026   1.00 84.59  ? 2300 NAP B O4B 1 
HETATM 10235 C C3B . NAP H 2 .   ? 12.794  9.615   1.803   1.00 87.02  ? 2300 NAP B C3B 1 
HETATM 10236 O O3B . NAP H 2 .   ? 11.896  10.662  1.418   1.00 90.25  ? 2300 NAP B O3B 1 
HETATM 10237 C C2B . NAP H 2 .   ? 13.932  9.344   0.793   1.00 84.62  ? 2300 NAP B C2B 1 
HETATM 10238 O O2B . NAP H 2 .   ? 13.690  10.096  -0.453  1.00 83.95  ? 2300 NAP B O2B 1 
HETATM 10239 C C1B . NAP H 2 .   ? 14.946  9.884   1.871   1.00 80.89  ? 2300 NAP B C1B 1 
HETATM 10240 N N9A . NAP H 2 .   ? 16.445  9.799   1.734   1.00 73.69  ? 2300 NAP B N9A 1 
HETATM 10241 C C8A . NAP H 2 .   ? 17.208  9.148   0.676   1.00 72.38  ? 2300 NAP B C8A 1 
HETATM 10242 N N7A . NAP H 2 .   ? 18.852  9.456   1.093   1.00 70.29  ? 2300 NAP B N7A 1 
HETATM 10243 C C5A . NAP H 2 .   ? 18.767  10.224  2.350   1.00 68.94  ? 2300 NAP B C5A 1 
HETATM 10244 C C6A . NAP H 2 .   ? 19.821  10.775  3.197   1.00 66.13  ? 2300 NAP B C6A 1 
HETATM 10245 N N6A . NAP H 2 .   ? 21.185  10.561  2.741   1.00 61.38  ? 2300 NAP B N6A 1 
HETATM 10246 N N1A . NAP H 2 .   ? 19.517  11.497  4.368   1.00 65.59  ? 2300 NAP B N1A 1 
HETATM 10247 C C2A . NAP H 2 .   ? 18.198  11.623  4.656   1.00 65.60  ? 2300 NAP B C2A 1 
HETATM 10248 N N3A . NAP H 2 .   ? 17.113  11.143  3.928   1.00 67.54  ? 2300 NAP B N3A 1 
HETATM 10249 C C4A . NAP H 2 .   ? 17.396  10.426  2.735   1.00 71.38  ? 2300 NAP B C4A 1 
HETATM 10250 O O3  . NAP H 2 .   ? 9.534   6.102   3.068   1.00 88.65  ? 2300 NAP B O3  1 
HETATM 10251 P PN  . NAP H 2 .   ? 8.200   6.292   2.118   1.00 92.47  ? 2300 NAP B PN  1 
HETATM 10252 O O1N . NAP H 2 .   ? 7.946   7.480   0.906   1.00 94.22  ? 2300 NAP B O1N 1 
HETATM 10253 O O2N . NAP H 2 .   ? 7.233   6.580   3.385   1.00 90.73  ? 2300 NAP B O2N 1 
HETATM 10254 O O5D . NAP H 2 .   ? 7.580   4.913   1.601   1.00 90.92  ? 2300 NAP B O5D 1 
HETATM 10255 C C5D . NAP H 2 .   ? 6.356   5.122   0.912   1.00 88.07  ? 2300 NAP B C5D 1 
HETATM 10256 C C4D . NAP H 2 .   ? 5.614   4.205   1.701   1.00 88.45  ? 2300 NAP B C4D 1 
HETATM 10257 O O4D . NAP H 2 .   ? 5.791   4.591   2.936   1.00 87.58  ? 2300 NAP B O4D 1 
HETATM 10258 C C3D . NAP H 2 .   ? 4.147   4.040   1.581   1.00 87.27  ? 2300 NAP B C3D 1 
HETATM 10259 O O3D . NAP H 2 .   ? 3.869   3.133   0.493   1.00 86.34  ? 2300 NAP B O3D 1 
HETATM 10260 C C2D . NAP H 2 .   ? 3.973   3.364   2.992   1.00 86.66  ? 2300 NAP B C2D 1 
HETATM 10261 O O2D . NAP H 2 .   ? 3.557   2.069   2.773   1.00 86.54  ? 2300 NAP B O2D 1 
HETATM 10262 C C1D . NAP H 2 .   ? 5.498   3.377   3.391   1.00 87.20  ? 2300 NAP B C1D 1 
HETATM 10263 N N1N . NAP H 2 .   ? 6.402   3.275   4.276   1.00 86.31  ? 2300 NAP B N1N 1 
HETATM 10264 C C2N . NAP H 2 .   ? 5.755   2.306   5.161   1.00 83.42  ? 2300 NAP B C2N 1 
HETATM 10265 C C3N . NAP H 2 .   ? 6.474   1.809   6.280   1.00 81.26  ? 2300 NAP B C3N 1 
HETATM 10266 C C7N . NAP H 2 .   ? 5.872   0.792   7.231   1.00 79.39  ? 2300 NAP B C7N 1 
HETATM 10267 O O7N . NAP H 2 .   ? 4.588   0.434   6.879   1.00 78.53  ? 2300 NAP B O7N 1 
HETATM 10268 N N7N . NAP H 2 .   ? 6.470   0.348   8.215   1.00 76.29  ? 2300 NAP B N7N 1 
HETATM 10269 C C4N . NAP H 2 .   ? 7.876   2.337   6.462   1.00 83.92  ? 2300 NAP B C4N 1 
HETATM 10270 C C5N . NAP H 2 .   ? 8.475   3.335   5.508   1.00 85.93  ? 2300 NAP B C5N 1 
HETATM 10271 C C6N . NAP H 2 .   ? 7.762   3.776   4.469   1.00 86.38  ? 2300 NAP B C6N 1 
HETATM 10272 P P2B . NAP H 2 .   ? 14.572  9.896   -1.931  1.00 90.78  ? 2300 NAP B P2B 1 
HETATM 10273 O O1X . NAP H 2 .   ? 14.381  8.305   -2.337  1.00 89.82  ? 2300 NAP B O1X 1 
HETATM 10274 O O2X . NAP H 2 .   ? 13.860  10.908  -3.146  1.00 87.76  ? 2300 NAP B O2X 1 
HETATM 10275 O O3X . NAP H 2 .   ? 16.134  9.923   -1.612  1.00 89.04  ? 2300 NAP B O3X 1 
HETATM 10276 N N   . GLU I 3 .   ? 8.551   -0.805  5.669   1.00 132.13 ? 2301 GLU B N   1 
HETATM 10277 C CA  . GLU I 3 .   ? 8.130   -1.035  4.291   1.00 133.14 ? 2301 GLU B CA  1 
HETATM 10278 C C   . GLU I 3 .   ? 8.807   -0.091  3.288   1.00 133.63 ? 2301 GLU B C   1 
HETATM 10279 O O   . GLU I 3 .   ? 9.754   -0.542  2.607   1.00 133.83 ? 2301 GLU B O   1 
HETATM 10280 C CB  . GLU I 3 .   ? 6.604   -0.912  4.203   1.00 200.00 ? 2301 GLU B CB  1 
HETATM 10281 C CG  . GLU I 3 .   ? 6.065   -0.243  2.951   1.00 200.00 ? 2301 GLU B CG  1 
HETATM 10282 C CD  . GLU I 3 .   ? 4.558   -0.174  2.952   1.00 200.00 ? 2301 GLU B CD  1 
HETATM 10283 O OE1 . GLU I 3 .   ? 3.982   0.144   4.019   1.00 200.00 ? 2301 GLU B OE1 1 
HETATM 10284 O OE2 . GLU I 3 .   ? 3.947   -0.418  1.889   1.00 200.00 ? 2301 GLU B OE2 1 
HETATM 10285 O OXT . GLU I 3 .   ? 8.404   1.085   3.191   1.00 200.00 ? 2301 GLU B OXT 1 
HETATM 10286 P PA  . NAP J 2 .   ? -19.279 70.533  21.552  1.00 101.71 ? 3300 NAP C PA  1 
HETATM 10287 O O1A . NAP J 2 .   ? -20.681 69.818  21.077  1.00 102.92 ? 3300 NAP C O1A 1 
HETATM 10288 O O2A . NAP J 2 .   ? -17.955 69.935  20.584  1.00 97.68  ? 3300 NAP C O2A 1 
HETATM 10289 O O5B . NAP J 2 .   ? -18.881 70.015  23.073  1.00 97.13  ? 3300 NAP C O5B 1 
HETATM 10290 C C5B . NAP J 2 .   ? -18.780 68.783  23.417  1.00 95.40  ? 3300 NAP C C5B 1 
HETATM 10291 C C4B . NAP J 2 .   ? -19.096 67.309  23.262  1.00 96.51  ? 3300 NAP C C4B 1 
HETATM 10292 O O4B . NAP J 2 .   ? -19.919 67.002  24.355  1.00 96.48  ? 3300 NAP C O4B 1 
HETATM 10293 C C3B . NAP J 2 .   ? -20.189 67.246  22.211  1.00 96.00  ? 3300 NAP C C3B 1 
HETATM 10294 O O3B . NAP J 2 .   ? -19.736 66.790  20.935  1.00 97.15  ? 3300 NAP C O3B 1 
HETATM 10295 C C2B . NAP J 2 .   ? -21.452 66.549  22.696  1.00 95.35  ? 3300 NAP C C2B 1 
HETATM 10296 O O2B . NAP J 2 .   ? -21.968 65.725  21.611  1.00 94.43  ? 3300 NAP C O2B 1 
HETATM 10297 C C1B . NAP J 2 .   ? -20.619 65.902  23.855  1.00 93.07  ? 3300 NAP C C1B 1 
HETATM 10298 N N9A . NAP J 2 .   ? -21.244 65.167  25.006  1.00 89.00  ? 3300 NAP C N9A 1 
HETATM 10299 C C8A . NAP J 2 .   ? -22.665 65.014  25.298  1.00 87.46  ? 3300 NAP C C8A 1 
HETATM 10300 N N7A . NAP J 2 .   ? -22.695 64.039  26.710  1.00 86.43  ? 3300 NAP C N7A 1 
HETATM 10301 C C5A . NAP J 2 .   ? -21.279 63.806  27.015  1.00 85.81  ? 3300 NAP C C5A 1 
HETATM 10302 C C6A . NAP J 2 .   ? -20.673 63.056  28.091  1.00 84.07  ? 3300 NAP C C6A 1 
HETATM 10303 N N6A . NAP J 2 .   ? -21.601 62.415  29.008  1.00 79.86  ? 3300 NAP C N6A 1 
HETATM 10304 N N1A . NAP J 2 .   ? -19.271 62.941  28.202  1.00 84.09  ? 3300 NAP C N1A 1 
HETATM 10305 C C2A . NAP J 2 .   ? -18.543 63.592  27.255  1.00 84.14  ? 3300 NAP C C2A 1 
HETATM 10306 N N3A . NAP J 2 .   ? -19.023 64.339  26.188  1.00 85.26  ? 3300 NAP C N3A 1 
HETATM 10307 C C4A . NAP J 2 .   ? -20.429 64.448  26.054  1.00 88.10  ? 3300 NAP C C4A 1 
HETATM 10308 O O3  . NAP J 2 .   ? -19.686 72.045  21.297  1.00 99.26  ? 3300 NAP C O3  1 
HETATM 10309 P PN  . NAP J 2 .   ? -19.883 72.289  19.681  1.00 103.45 ? 3300 NAP C PN  1 
HETATM 10310 O O1N . NAP J 2 .   ? -20.243 71.121  18.484  1.00 106.13 ? 3300 NAP C O1N 1 
HETATM 10311 O O2N . NAP J 2 .   ? -18.396 72.911  19.458  1.00 100.06 ? 3300 NAP C O2N 1 
HETATM 10312 O O5D . NAP J 2 .   ? -20.736 73.574  19.388  1.00 99.68  ? 3300 NAP C O5D 1 
HETATM 10313 C C5D . NAP J 2 .   ? -20.915 73.820  18.000  1.00 96.93  ? 3300 NAP C C5D 1 
HETATM 10314 C C4D . NAP J 2 .   ? -20.567 75.071  18.051  1.00 97.46  ? 3300 NAP C C4D 1 
HETATM 10315 O O4D . NAP J 2 .   ? -19.310 75.207  18.653  1.00 97.12  ? 3300 NAP C O4D 1 
HETATM 10316 C C3D . NAP J 2 .   ? -20.420 76.128  16.969  1.00 94.78  ? 3300 NAP C C3D 1 
HETATM 10317 O O3D . NAP J 2 .   ? -21.754 76.516  16.587  1.00 92.04  ? 3300 NAP C O3D 1 
HETATM 10318 C C2D . NAP J 2 .   ? -19.664 77.215  17.810  1.00 94.00  ? 3300 NAP C C2D 1 
HETATM 10319 O O2D . NAP J 2 .   ? -20.525 78.321  17.958  1.00 91.66  ? 3300 NAP C O2D 1 
HETATM 10320 C C1D . NAP J 2 .   ? -19.638 76.576  19.167  1.00 95.26  ? 3300 NAP C C1D 1 
HETATM 10321 N N1N . NAP J 2 .   ? -19.390 76.342  20.330  1.00 94.57  ? 3300 NAP C N1N 1 
HETATM 10322 C C2N . NAP J 2 .   ? -18.971 77.723  20.572  1.00 92.81  ? 3300 NAP C C2N 1 
HETATM 10323 C C3N . NAP J 2 .   ? -18.549 78.095  21.876  1.00 89.89  ? 3300 NAP C C3N 1 
HETATM 10324 C C7N . NAP J 2 .   ? -18.115 79.511  22.203  1.00 88.71  ? 3300 NAP C C7N 1 
HETATM 10325 O O7N . NAP J 2 .   ? -18.181 80.350  21.111  1.00 86.33  ? 3300 NAP C O7N 1 
HETATM 10326 N N7N . NAP J 2 .   ? -17.737 79.861  23.324  1.00 86.96  ? 3300 NAP C N7N 1 
HETATM 10327 C C4N . NAP J 2 .   ? -18.570 77.006  22.921  1.00 91.10  ? 3300 NAP C C4N 1 
HETATM 10328 C C5N . NAP J 2 .   ? -19.014 75.606  22.596  1.00 90.81  ? 3300 NAP C C5N 1 
HETATM 10329 C C6N . NAP J 2 .   ? -19.402 75.301  21.355  1.00 93.32  ? 3300 NAP C C6N 1 
HETATM 10330 P P2B . NAP J 2 .   ? -23.497 64.961  21.628  1.00 101.27 ? 3300 NAP C P2B 1 
HETATM 10331 O O1X . NAP J 2 .   ? -24.558 66.211  21.807  1.00 97.17  ? 3300 NAP C O1X 1 
HETATM 10332 O O2X . NAP J 2 .   ? -23.770 64.167  20.105  1.00 96.28  ? 3300 NAP C O2X 1 
HETATM 10333 O O3X . NAP J 2 .   ? -23.671 64.221  23.029  1.00 96.37  ? 3300 NAP C O3X 1 
HETATM 10334 N N   . GLU K 3 .   ? -21.223 78.663  22.254  1.00 145.80 ? 3301 GLU C N   1 
HETATM 10335 C CA  . GLU K 3 .   ? -22.550 78.250  22.765  1.00 145.39 ? 3301 GLU C CA  1 
HETATM 10336 C C   . GLU K 3 .   ? -22.667 76.708  22.968  1.00 145.50 ? 3301 GLU C C   1 
HETATM 10337 O O   . GLU K 3 .   ? -23.560 76.277  23.727  1.00 144.90 ? 3301 GLU C O   1 
HETATM 10338 C CB  . GLU K 3 .   ? -23.656 78.706  21.813  1.00 198.20 ? 3301 GLU C CB  1 
HETATM 10339 C CG  . GLU K 3 .   ? -23.681 77.961  20.489  1.00 197.01 ? 3301 GLU C CG  1 
HETATM 10340 C CD  . GLU K 3 .   ? -24.622 78.594  19.483  1.00 196.53 ? 3301 GLU C CD  1 
HETATM 10341 O OE1 . GLU K 3 .   ? -25.255 79.614  19.821  1.00 196.96 ? 3301 GLU C OE1 1 
HETATM 10342 O OE2 . GLU K 3 .   ? -24.726 78.068  18.356  1.00 195.48 ? 3301 GLU C OE2 1 
HETATM 10343 O OXT . GLU K 3 .   ? -21.839 75.964  22.344  1.00 199.01 ? 3301 GLU C OXT 1 
HETATM 10344 P PA  . NAP L 2 .   ? -24.145 26.533  24.017  1.00 92.77  ? 4300 NAP D PA  1 
HETATM 10345 O O1A . NAP L 2 .   ? -24.399 25.423  22.835  1.00 95.48  ? 4300 NAP D O1A 1 
HETATM 10346 O O2A . NAP L 2 .   ? -23.269 27.897  23.360  1.00 93.08  ? 4300 NAP D O2A 1 
HETATM 10347 O O5B . NAP L 2 .   ? -23.074 25.914  25.126  1.00 91.54  ? 4300 NAP D O5B 1 
HETATM 10348 C C5B . NAP L 2 .   ? -21.750 25.948  24.547  1.00 91.83  ? 4300 NAP D C5B 1 
HETATM 10349 C C4B . NAP L 2 .   ? -20.886 24.836  23.921  1.00 97.13  ? 4300 NAP D C4B 1 
HETATM 10350 O O4B . NAP L 2 .   ? -20.774 23.523  24.385  1.00 99.28  ? 4300 NAP D O4B 1 
HETATM 10351 C C3B . NAP L 2 .   ? -21.662 24.521  22.650  1.00 96.94  ? 4300 NAP D C3B 1 
HETATM 10352 O O3B . NAP L 2 .   ? -21.337 25.366  21.540  1.00 97.48  ? 4300 NAP D O3B 1 
HETATM 10353 C C2B . NAP L 2 .   ? -21.667 23.025  22.304  1.00 96.83  ? 4300 NAP D C2B 1 
HETATM 10354 O O2B . NAP L 2 .   ? -21.552 22.866  20.852  1.00 95.59  ? 4300 NAP D O2B 1 
HETATM 10355 C C1B . NAP L 2 .   ? -20.405 22.868  23.221  1.00 95.78  ? 4300 NAP D C1B 1 
HETATM 10356 N N9A . NAP L 2 .   ? -19.793 21.546  23.577  1.00 93.22  ? 4300 NAP D N9A 1 
HETATM 10357 C C8A . NAP L 2 .   ? -20.282 20.217  23.243  1.00 91.49  ? 4300 NAP D C8A 1 
HETATM 10358 N N7A . NAP L 2 .   ? -19.103 19.161  23.901  1.00 90.20  ? 4300 NAP D N7A 1 
HETATM 10359 C C5A . NAP L 2 .   ? -18.132 20.063  24.531  1.00 91.21  ? 4300 NAP D C5A 1 
HETATM 10360 C C6A . NAP L 2 .   ? -16.912 19.764  25.254  1.00 90.17  ? 4300 NAP D C6A 1 
HETATM 10361 N N6A . NAP L 2 .   ? -16.565 18.350  25.367  1.00 88.56  ? 4300 NAP D N6A 1 
HETATM 10362 N N1A . NAP L 2 .   ? -16.110 20.801  25.777  1.00 90.32  ? 4300 NAP D N1A 1 
HETATM 10363 C C2A . NAP L 2 .   ? -16.561 22.071  25.578  1.00 89.09  ? 4300 NAP D C2A 1 
HETATM 10364 N N3A . NAP L 2 .   ? -17.704 22.465  24.906  1.00 91.48  ? 4300 NAP D N3A 1 
HETATM 10365 C C4A . NAP L 2 .   ? -18.515 21.437  24.360  1.00 93.37  ? 4300 NAP D C4A 1 
HETATM 10366 O O3  . NAP L 2 .   ? -25.679 26.791  24.435  1.00 87.63  ? 4300 NAP D O3  1 
HETATM 10367 P PN  . NAP L 2 .   ? -26.481 27.524  23.192  1.00 90.55  ? 4300 NAP D PN  1 
HETATM 10368 O O1N . NAP L 2 .   ? -26.074 27.488  21.520  1.00 90.06  ? 4300 NAP D O1N 1 
HETATM 10369 O O2N . NAP L 2 .   ? -26.282 29.023  23.802  1.00 88.14  ? 4300 NAP D O2N 1 
HETATM 10370 O O5D . NAP L 2 .   ? -28.056 27.412  23.307  1.00 85.35  ? 4300 NAP D O5D 1 
HETATM 10371 C C5D . NAP L 2 .   ? -28.716 28.074  22.224  1.00 81.15  ? 4300 NAP D C5D 1 
HETATM 10372 C C4D . NAP L 2 .   ? -29.581 28.842  23.064  1.00 79.55  ? 4300 NAP D C4D 1 
HETATM 10373 O O4D . NAP L 2 .   ? -28.796 29.493  23.901  1.00 78.40  ? 4300 NAP D O4D 1 
HETATM 10374 C C3D . NAP L 2 .   ? -30.526 29.862  22.579  1.00 77.99  ? 4300 NAP D C3D 1 
HETATM 10375 O O3D . NAP L 2 .   ? -31.659 29.181  21.999  1.00 75.20  ? 4300 NAP D O3D 1 
HETATM 10376 C C2D . NAP L 2 .   ? -30.782 30.435  24.022  1.00 77.46  ? 4300 NAP D C2D 1 
HETATM 10377 O O2D . NAP L 2 .   ? -32.108 30.126  24.377  1.00 77.94  ? 4300 NAP D O2D 1 
HETATM 10378 C C1D . NAP L 2 .   ? -29.809 29.486  24.789  1.00 76.86  ? 4300 NAP D C1D 1 
HETATM 10379 N N1N . NAP L 2 .   ? -29.190 29.075  25.854  1.00 75.52  ? 4300 NAP D N1N 1 
HETATM 10380 C C2N . NAP L 2 .   ? -30.016 29.748  26.857  1.00 71.43  ? 4300 NAP D C2N 1 
HETATM 10381 C C3N . NAP L 2 .   ? -29.723 29.555  28.233  1.00 67.89  ? 4300 NAP D C3N 1 
HETATM 10382 C C7N . NAP L 2 .   ? -30.546 30.210  29.326  1.00 66.40  ? 4300 NAP D C7N 1 
HETATM 10383 O O7N . NAP L 2 .   ? -31.570 30.986  28.825  1.00 63.12  ? 4300 NAP D O7N 1 
HETATM 10384 N N7N . NAP L 2 .   ? -30.311 30.066  30.529  1.00 66.09  ? 4300 NAP D N7N 1 
HETATM 10385 C C4N . NAP L 2 .   ? -28.557 28.651  28.546  1.00 69.13  ? 4300 NAP D C4N 1 
HETATM 10386 C C5N . NAP L 2 .   ? -27.751 27.992  27.460  1.00 72.09  ? 4300 NAP D C5N 1 
HETATM 10387 C C6N . NAP L 2 .   ? -28.063 28.203  26.178  1.00 73.80  ? 4300 NAP D C6N 1 
HETATM 10388 P P2B . NAP L 2 .   ? -21.765 21.381  20.003  1.00 99.74  ? 4300 NAP D P2B 1 
HETATM 10389 O O1X . NAP L 2 .   ? -23.286 20.892  20.396  1.00 95.13  ? 4300 NAP D O1X 1 
HETATM 10390 O O2X . NAP L 2 .   ? -21.655 21.683  18.297  1.00 95.45  ? 4300 NAP D O2X 1 
HETATM 10391 O O3X . NAP L 2 .   ? -20.908 20.246  20.716  1.00 98.29  ? 4300 NAP D O3X 1 
HETATM 10392 N N   . GLU M 3 .   ? -30.520 26.277  29.013  1.00 142.03 ? 4301 GLU D N   1 
HETATM 10393 C CA  . GLU M 3 .   ? -30.527 25.190  28.041  1.00 142.30 ? 4301 GLU D CA  1 
HETATM 10394 C C   . GLU M 3 .   ? -29.114 24.974  27.484  1.00 142.59 ? 4301 GLU D C   1 
HETATM 10395 O O   . GLU M 3 .   ? -28.954 24.873  26.249  1.00 142.47 ? 4301 GLU D O   1 
HETATM 10396 C CB  . GLU M 3 .   ? -31.527 25.508  26.911  1.00 156.46 ? 4301 GLU D CB  1 
HETATM 10397 C CG  . GLU M 3 .   ? -31.037 26.482  25.841  1.00 157.25 ? 4301 GLU D CG  1 
HETATM 10398 C CD  . GLU M 3 .   ? -32.161 27.269  25.182  1.00 157.58 ? 4301 GLU D CD  1 
HETATM 10399 O OE1 . GLU M 3 .   ? -32.758 28.128  25.867  1.00 157.88 ? 4301 GLU D OE1 1 
HETATM 10400 O OE2 . GLU M 3 .   ? -32.442 27.038  23.984  1.00 158.24 ? 4301 GLU D OE2 1 
HETATM 10401 O OXT . GLU M 3 .   ? -28.170 24.897  28.301  1.00 157.04 ? 4301 GLU D OXT 1 
HETATM 10402 P PA  . NAP N 2 .   ? 36.139  40.538  -12.709 1.00 93.94  ? 5300 NAP E PA  1 
HETATM 10403 O O1A . NAP N 2 .   ? 35.790  41.675  -13.836 1.00 98.83  ? 5300 NAP E O1A 1 
HETATM 10404 O O2A . NAP N 2 .   ? 34.655  39.999  -11.950 1.00 90.00  ? 5300 NAP E O2A 1 
HETATM 10405 O O5B . NAP N 2 .   ? 36.969  41.265  -11.452 1.00 91.47  ? 5300 NAP E O5B 1 
HETATM 10406 C C5B . NAP N 2 .   ? 36.137  42.152  -10.626 1.00 91.36  ? 5300 NAP E C5B 1 
HETATM 10407 C C4B . NAP N 2 .   ? 35.781  43.575  -10.589 1.00 94.95  ? 5300 NAP E C4B 1 
HETATM 10408 O O4B . NAP N 2 .   ? 36.764  44.580  -10.665 1.00 96.60  ? 5300 NAP E O4B 1 
HETATM 10409 C C3B . NAP N 2 .   ? 35.166  43.801  -11.948 1.00 93.80  ? 5300 NAP E C3B 1 
HETATM 10410 O O3B . NAP N 2 .   ? 33.756  43.571  -11.996 1.00 94.55  ? 5300 NAP E O3B 1 
HETATM 10411 C C2B . NAP N 2 .   ? 35.609  45.115  -12.597 1.00 94.75  ? 5300 NAP E C2B 1 
HETATM 10412 O O2B . NAP N 2 .   ? 34.485  45.708  -13.294 1.00 93.34  ? 5300 NAP E O2B 1 
HETATM 10413 C C1B . NAP N 2 .   ? 36.036  45.645  -11.191 1.00 93.45  ? 5300 NAP E C1B 1 
HETATM 10414 N N9A . NAP N 2 .   ? 36.809  46.932  -10.977 1.00 92.47  ? 5300 NAP E N9A 1 
HETATM 10415 C C8A . NAP N 2 .   ? 37.373  47.854  -11.970 1.00 92.31  ? 5300 NAP E C8A 1 
HETATM 10416 N N7A . NAP N 2 .   ? 38.067  49.120  -11.031 1.00 90.89  ? 5300 NAP E N7A 1 
HETATM 10417 C C5A . NAP N 2 .   ? 37.806  48.704  -9.646  1.00 91.97  ? 5300 NAP E C5A 1 
HETATM 10418 C C6A . NAP N 2 .   ? 38.146  49.350  -8.390  1.00 91.48  ? 5300 NAP E C6A 1 
HETATM 10419 N N6A . NAP N 2 .   ? 38.842  50.630  -8.490  1.00 90.22  ? 5300 NAP E N6A 1 
HETATM 10420 N N1A . NAP N 2 .   ? 37.781  48.763  -7.157  1.00 91.80  ? 5300 NAP E N1A 1 
HETATM 10421 C C2A . NAP N 2 .   ? 37.124  47.570  -7.227  1.00 90.81  ? 5300 NAP E C2A 1 
HETATM 10422 N N3A . NAP N 2 .   ? 36.754  46.877  -8.361  1.00 91.04  ? 5300 NAP E N3A 1 
HETATM 10423 C C4A . NAP N 2 .   ? 37.093  47.452  -9.604  1.00 93.30  ? 5300 NAP E C4A 1 
HETATM 10424 O O3  . NAP N 2 .   ? 36.887  39.471  -13.671 1.00 90.80  ? 5300 NAP E O3  1 
HETATM 10425 P PN  . NAP N 2 .   ? 35.808  38.804  -14.741 1.00 92.46  ? 5300 NAP E PN  1 
HETATM 10426 O O1N . NAP N 2 .   ? 34.300  39.447  -15.258 1.00 94.05  ? 5300 NAP E O1N 1 
HETATM 10427 O O2N . NAP N 2 .   ? 35.543  37.499  -13.811 1.00 88.88  ? 5300 NAP E O2N 1 
HETATM 10428 O O5D . NAP N 2 .   ? 36.496  38.120  -16.007 1.00 89.21  ? 5300 NAP E O5D 1 
HETATM 10429 C C5D . NAP N 2 .   ? 35.510  37.623  -16.935 1.00 86.85  ? 5300 NAP E C5D 1 
HETATM 10430 C C4D . NAP N 2 .   ? 35.924  36.371  -17.057 1.00 87.86  ? 5300 NAP E C4D 1 
HETATM 10431 O O4D . NAP N 2 .   ? 36.119  35.883  -15.744 1.00 88.22  ? 5300 NAP E O4D 1 
HETATM 10432 C C3D . NAP N 2 .   ? 35.465  35.159  -17.724 1.00 86.41  ? 5300 NAP E C3D 1 
HETATM 10433 O O3D . NAP N 2 .   ? 35.721  35.347  -19.127 1.00 83.82  ? 5300 NAP E O3D 1 
HETATM 10434 C C2D . NAP N 2 .   ? 36.420  34.121  -17.024 1.00 86.46  ? 5300 NAP E C2D 1 
HETATM 10435 O O2D . NAP N 2 .   ? 37.307  33.639  -18.017 1.00 84.60  ? 5300 NAP E O2D 1 
HETATM 10436 C C1D . NAP N 2 .   ? 37.220  35.043  -16.124 1.00 86.13  ? 5300 NAP E C1D 1 
HETATM 10437 N N1N . NAP N 2 .   ? 38.103  35.481  -15.195 1.00 84.71  ? 5300 NAP E N1N 1 
HETATM 10438 C C2N . NAP N 2 .   ? 38.861  34.230  -15.157 1.00 82.02  ? 5300 NAP E C2N 1 
HETATM 10439 C C3N . NAP N 2 .   ? 39.975  34.126  -14.283 1.00 79.08  ? 5300 NAP E C3N 1 
HETATM 10440 C C7N . NAP N 2 .   ? 40.814  32.865  -14.202 1.00 76.37  ? 5300 NAP E C7N 1 
HETATM 10441 O O7N . NAP N 2 .   ? 40.367  31.876  -15.052 1.00 71.07  ? 5300 NAP E O7N 1 
HETATM 10442 N N7N . NAP N 2 .   ? 41.783  32.744  -13.447 1.00 74.97  ? 5300 NAP E N7N 1 
HETATM 10443 C C4N . NAP N 2 .   ? 40.286  35.346  -13.450 1.00 80.61  ? 5300 NAP E C4N 1 
HETATM 10444 C C5N . NAP N 2 .   ? 39.460  36.599  -13.544 1.00 81.64  ? 5300 NAP E C5N 1 
HETATM 10445 C C6N . NAP N 2 .   ? 38.420  36.652  -14.380 1.00 83.27  ? 5300 NAP E C6N 1 
HETATM 10446 P P2B . NAP N 2 .   ? 34.624  47.041  -14.350 1.00 99.09  ? 5300 NAP E P2B 1 
HETATM 10447 O O1X . NAP N 2 .   ? 35.710  46.555  -15.498 1.00 91.84  ? 5300 NAP E O1X 1 
HETATM 10448 O O2X . NAP N 2 .   ? 33.080  47.335  -15.056 1.00 92.92  ? 5300 NAP E O2X 1 
HETATM 10449 O O3X . NAP N 2 .   ? 35.450  48.186  -13.627 1.00 95.34  ? 5300 NAP E O3X 1 
HETATM 10450 N N   . GLU O 3 .   ? 42.043  36.828  -15.671 1.00 158.08 ? 5301 GLU E N   1 
HETATM 10451 C CA  . GLU O 3 .   ? 41.954  38.002  -16.533 1.00 157.40 ? 5301 GLU E CA  1 
HETATM 10452 C C   . GLU O 3 .   ? 41.309  39.188  -15.820 1.00 157.75 ? 5301 GLU E C   1 
HETATM 10453 O O   . GLU O 3 .   ? 41.915  40.281  -15.848 1.00 157.88 ? 5301 GLU E O   1 
HETATM 10454 C CB  . GLU O 3 .   ? 41.155  37.679  -17.796 1.00 190.22 ? 5301 GLU E CB  1 
HETATM 10455 C CG  . GLU O 3 .   ? 41.752  36.567  -18.641 1.00 189.43 ? 5301 GLU E CG  1 
HETATM 10456 C CD  . GLU O 3 .   ? 40.934  36.276  -19.883 1.00 189.21 ? 5301 GLU E CD  1 
HETATM 10457 O OE1 . GLU O 3 .   ? 39.899  36.944  -20.083 1.00 188.56 ? 5301 GLU E OE1 1 
HETATM 10458 O OE2 . GLU O 3 .   ? 41.328  35.379  -20.656 1.00 189.98 ? 5301 GLU E OE2 1 
HETATM 10459 O OXT . GLU O 3 .   ? 40.212  39.019  -15.247 1.00 191.74 ? 5301 GLU E OXT 1 
HETATM 10460 O O   . HOH P 4 .   ? -4.269  68.362  -15.045 1.00 16.33  ? 1302 HOH A O   1 
HETATM 10461 O O   . HOH P 4 .   ? 16.728  53.691  -21.906 1.00 26.95  ? 1303 HOH A O   1 
HETATM 10462 O O   . HOH P 4 .   ? 31.113  83.885  -11.448 1.00 41.18  ? 1304 HOH A O   1 
HETATM 10463 O O   . HOH P 4 .   ? 46.782  79.267  -1.411  1.00 67.99  ? 1305 HOH A O   1 
HETATM 10464 O O   . HOH P 4 .   ? 49.414  80.298  1.984   1.00 54.29  ? 1306 HOH A O   1 
HETATM 10465 O O   . HOH P 4 .   ? 44.882  80.937  6.996   1.00 36.04  ? 1307 HOH A O   1 
HETATM 10466 O O   . HOH P 4 .   ? 41.152  64.517  18.203  1.00 107.19 ? 1308 HOH A O   1 
HETATM 10467 O O   . HOH P 4 .   ? 2.358   59.031  0.629   1.00 48.79  ? 1309 HOH A O   1 
HETATM 10468 O O   . HOH P 4 .   ? 34.793  63.319  5.828   1.00 82.36  ? 1310 HOH A O   1 
HETATM 10469 O O   . HOH P 4 .   ? 11.941  55.748  7.579   1.00 31.29  ? 1311 HOH A O   1 
HETATM 10470 O O   . HOH P 4 .   ? 28.937  78.592  17.617  1.00 49.82  ? 1312 HOH A O   1 
HETATM 10471 O O   . HOH P 4 .   ? 14.459  57.901  -21.930 1.00 84.57  ? 1313 HOH A O   1 
HETATM 10472 O O   . HOH P 4 .   ? -1.915  68.167  -17.817 1.00 40.77  ? 1314 HOH A O   1 
HETATM 10473 O O   . HOH P 4 .   ? 8.818   57.539  -14.255 1.00 67.61  ? 1315 HOH A O   1 
HETATM 10474 O O   . HOH P 4 .   ? 30.032  77.502  -9.998  1.00 38.90  ? 1316 HOH A O   1 
HETATM 10475 O O   . HOH P 4 .   ? 24.968  65.968  16.183  1.00 51.37  ? 1317 HOH A O   1 
HETATM 10476 O O   . HOH P 4 .   ? 37.647  88.883  0.426   1.00 53.30  ? 1318 HOH A O   1 
HETATM 10477 O O   . HOH P 4 .   ? 26.259  76.696  5.452   1.00 94.11  ? 1319 HOH A O   1 
HETATM 10478 O O   . HOH P 4 .   ? 17.762  80.668  -14.939 1.00 59.66  ? 1320 HOH A O   1 
HETATM 10479 O O   . HOH P 4 .   ? -9.038  65.616  -13.692 1.00 93.97  ? 1321 HOH A O   1 
HETATM 10480 O O   . HOH P 4 .   ? 54.713  72.278  -4.281  1.00 39.40  ? 1322 HOH A O   1 
HETATM 10481 O O   . HOH P 4 .   ? -4.201  72.501  -19.343 1.00 45.76  ? 1323 HOH A O   1 
HETATM 10482 O O   . HOH P 4 .   ? 25.137  68.673  19.423  1.00 82.30  ? 1324 HOH A O   1 
HETATM 10483 O O   . HOH P 4 .   ? 32.978  83.619  -6.842  1.00 43.94  ? 1325 HOH A O   1 
HETATM 10484 O O   . HOH P 4 .   ? 17.212  52.817  -16.858 1.00 56.51  ? 1326 HOH A O   1 
HETATM 10485 O O   . HOH P 4 .   ? 4.660   53.809  1.955   1.00 67.56  ? 1327 HOH A O   1 
HETATM 10486 O O   . HOH P 4 .   ? 48.450  74.247  6.842   1.00 80.49  ? 1328 HOH A O   1 
HETATM 10487 O O   . HOH P 4 .   ? 29.821  69.516  19.541  1.00 65.49  ? 1329 HOH A O   1 
HETATM 10488 O O   . HOH P 4 .   ? 11.561  85.875  -4.872  1.00 137.85 ? 1330 HOH A O   1 
HETATM 10489 O O   . HOH P 4 .   ? 46.539  82.925  -7.829  1.00 43.38  ? 1331 HOH A O   1 
HETATM 10490 O O   . HOH P 4 .   ? 14.910  73.610  -15.536 1.00 141.31 ? 1332 HOH A O   1 
HETATM 10491 O O   . HOH P 4 .   ? 22.077  70.777  -4.459  1.00 47.08  ? 1333 HOH A O   1 
HETATM 10492 O O   . HOH P 4 .   ? -5.158  54.456  -4.824  1.00 55.96  ? 1334 HOH A O   1 
HETATM 10493 O O   . HOH P 4 .   ? 16.946  62.164  -21.991 1.00 76.59  ? 1335 HOH A O   1 
HETATM 10494 O O   . HOH P 4 .   ? 34.813  62.600  -1.136  1.00 51.60  ? 1336 HOH A O   1 
HETATM 10495 O O   . HOH P 4 .   ? 18.924  57.210  -15.582 1.00 86.59  ? 1337 HOH A O   1 
HETATM 10496 O O   . HOH P 4 .   ? 25.098  72.025  -8.907  1.00 95.05  ? 1338 HOH A O   1 
HETATM 10497 O O   . HOH P 4 .   ? 48.759  77.165  -6.000  1.00 61.20  ? 1339 HOH A O   1 
HETATM 10498 O O   . HOH P 4 .   ? 30.731  78.332  -14.228 1.00 86.32  ? 1340 HOH A O   1 
HETATM 10499 O O   . HOH P 4 .   ? 21.677  59.425  -19.041 1.00 70.57  ? 1341 HOH A O   1 
HETATM 10500 O O   . HOH P 4 .   ? -2.639  70.502  -16.065 1.00 48.76  ? 1342 HOH A O   1 
HETATM 10501 O O   . HOH P 4 .   ? 14.703  53.518  -19.782 1.00 49.38  ? 1343 HOH A O   1 
HETATM 10502 O O   . HOH P 4 .   ? 39.792  49.292  6.393   1.00 43.13  ? 1344 HOH A O   1 
HETATM 10503 O O   . HOH P 4 .   ? 23.132  62.876  -2.178  1.00 109.98 ? 1345 HOH A O   1 
HETATM 10504 O O   . HOH P 4 .   ? 0.006   60.565  -1.115  1.00 41.70  ? 1346 HOH A O   1 
HETATM 10505 O O   . HOH P 4 .   ? 23.859  59.390  -21.729 1.00 59.43  ? 1347 HOH A O   1 
HETATM 10506 O O   . HOH P 4 .   ? 21.929  67.115  14.401  1.00 50.41  ? 1348 HOH A O   1 
HETATM 10507 O O   . HOH P 4 .   ? 0.459   70.066  -16.543 1.00 61.90  ? 1349 HOH A O   1 
HETATM 10508 O O   . HOH P 4 .   ? 18.211  58.144  -26.617 1.00 48.25  ? 1350 HOH A O   1 
HETATM 10509 O O   . HOH P 4 .   ? 49.690  80.231  -1.031  1.00 72.91  ? 1351 HOH A O   1 
HETATM 10510 O O   . HOH P 4 .   ? 24.321  70.872  5.317   1.00 103.45 ? 1352 HOH A O   1 
HETATM 10511 O O   . HOH P 4 .   ? 0.249   69.374  -19.653 1.00 57.06  ? 1353 HOH A O   1 
HETATM 10512 O O   . HOH P 4 .   ? 39.721  86.771  0.984   1.00 89.31  ? 1354 HOH A O   1 
HETATM 10513 O O   . HOH P 4 .   ? 23.025  67.911  5.434   1.00 125.18 ? 1355 HOH A O   1 
HETATM 10514 O O   . HOH P 4 .   ? 34.611  78.487  -4.327  1.00 103.14 ? 1356 HOH A O   1 
HETATM 10515 O O   . HOH P 4 .   ? 29.138  76.191  -13.467 1.00 76.98  ? 1357 HOH A O   1 
HETATM 10516 O O   . HOH P 4 .   ? 47.543  82.217  -2.044  1.00 92.61  ? 1358 HOH A O   1 
HETATM 10517 O O   . HOH P 4 .   ? 1.771   71.393  -10.258 1.00 80.58  ? 1359 HOH A O   1 
HETATM 10518 O O   . HOH P 4 .   ? 21.578  89.331  10.919  1.00 55.29  ? 1360 HOH A O   1 
HETATM 10519 O O   . HOH P 4 .   ? 11.937  73.847  -5.570  1.00 171.95 ? 1361 HOH A O   1 
HETATM 10520 O O   . HOH P 4 .   ? 24.470  84.754  2.860   1.00 46.83  ? 1362 HOH A O   1 
HETATM 10521 O O   . HOH P 4 .   ? 15.120  52.162  -13.703 1.00 35.08  ? 1363 HOH A O   1 
HETATM 10522 O O   . HOH P 4 .   ? 4.222   50.845  1.319   1.00 34.84  ? 1364 HOH A O   1 
HETATM 10523 O O   . HOH P 4 .   ? 21.869  83.027  13.465  1.00 99.69  ? 1365 HOH A O   1 
HETATM 10524 O O   . HOH P 4 .   ? 40.447  59.779  -3.573  1.00 121.64 ? 1366 HOH A O   1 
HETATM 10525 O O   . HOH P 4 .   ? -6.483  51.819  -3.619  1.00 144.57 ? 1367 HOH A O   1 
HETATM 10526 O O   . HOH P 4 .   ? -7.824  65.357  -18.640 1.00 160.57 ? 1368 HOH A O   1 
HETATM 10527 O O   . HOH P 4 .   ? 24.638  66.808  13.147  1.00 172.82 ? 1369 HOH A O   1 
HETATM 10528 O O   . HOH P 4 .   ? 44.790  55.061  -8.361  1.00 87.67  ? 1370 HOH A O   1 
HETATM 10529 O O   . HOH P 4 .   ? -6.282  75.248  -12.828 1.00 56.33  ? 1371 HOH A O   1 
HETATM 10530 O O   . HOH P 4 .   ? 33.011  69.474  -22.235 1.00 94.24  ? 1372 HOH A O   1 
HETATM 10531 O O   . HOH P 4 .   ? 43.806  65.429  18.595  1.00 114.39 ? 1373 HOH A O   1 
HETATM 10532 O O   . HOH P 4 .   ? 25.341  75.219  -9.989  1.00 126.81 ? 1374 HOH A O   1 
HETATM 10533 O O   . HOH P 4 .   ? 30.601  60.980  16.516  1.00 49.25  ? 1375 HOH A O   1 
HETATM 10534 O O   . HOH P 4 .   ? 18.197  78.350  9.649   1.00 86.65  ? 1376 HOH A O   1 
HETATM 10535 O O   . HOH P 4 .   ? 31.571  66.034  11.324  1.00 70.63  ? 1377 HOH A O   1 
HETATM 10536 O O   . HOH P 4 .   ? 26.548  78.357  19.603  1.00 64.80  ? 1378 HOH A O   1 
HETATM 10537 O O   . HOH P 4 .   ? 32.789  72.952  -19.543 1.00 90.85  ? 1379 HOH A O   1 
HETATM 10538 O O   . HOH P 4 .   ? 42.631  87.233  2.158   1.00 81.82  ? 1380 HOH A O   1 
HETATM 10539 O O   . HOH P 4 .   ? 8.518   55.417  9.724   1.00 71.32  ? 1381 HOH A O   1 
HETATM 10540 O O   . HOH P 4 .   ? 20.945  58.077  -22.610 1.00 72.68  ? 1382 HOH A O   1 
HETATM 10541 O O   . HOH P 4 .   ? 38.143  50.823  8.436   1.00 58.63  ? 1383 HOH A O   1 
HETATM 10542 O O   . HOH P 4 .   ? 29.494  67.313  4.076   1.00 67.82  ? 1384 HOH A O   1 
HETATM 10543 O O   . HOH P 4 .   ? 19.108  66.134  13.373  1.00 55.40  ? 1385 HOH A O   1 
HETATM 10544 O O   . HOH P 4 .   ? 30.626  57.961  15.266  1.00 170.46 ? 1386 HOH A O   1 
HETATM 10545 O O   . HOH P 4 .   ? 3.258   72.157  3.438   1.00 171.01 ? 1387 HOH A O   1 
HETATM 10546 O O   . HOH P 4 .   ? 15.393  51.023  -18.491 1.00 132.85 ? 1388 HOH A O   1 
HETATM 10547 O O   . HOH P 4 .   ? 33.778  87.498  3.942   1.00 54.34  ? 1389 HOH A O   1 
HETATM 10548 O O   . HOH P 4 .   ? 51.086  75.720  -4.254  1.00 110.55 ? 1390 HOH A O   1 
HETATM 10549 O O   . HOH P 4 .   ? 33.914  57.415  -9.123  1.00 53.19  ? 1391 HOH A O   1 
HETATM 10550 O O   . HOH P 4 .   ? 26.020  64.505  -2.337  1.00 113.85 ? 1392 HOH A O   1 
HETATM 10551 O O   . HOH P 4 .   ? -4.252  69.267  -19.570 1.00 74.23  ? 1393 HOH A O   1 
HETATM 10552 O O   . HOH P 4 .   ? 37.577  79.855  14.792  1.00 120.63 ? 1394 HOH A O   1 
HETATM 10553 O O   . HOH P 4 .   ? 33.226  61.518  -9.969  1.00 80.36  ? 1395 HOH A O   1 
HETATM 10554 O O   . HOH P 4 .   ? 26.224  61.139  -29.441 1.00 69.35  ? 1396 HOH A O   1 
HETATM 10555 O O   . HOH P 4 .   ? 6.123   77.495  -3.506  1.00 111.78 ? 1397 HOH A O   1 
HETATM 10556 O O   . HOH P 4 .   ? 20.784  61.504  -17.121 1.00 193.37 ? 1398 HOH A O   1 
HETATM 10557 O O   . HOH P 4 .   ? 35.177  90.369  1.630   1.00 57.19  ? 1399 HOH A O   1 
HETATM 10558 O O   . HOH P 4 .   ? 48.567  64.149  15.919  1.00 90.63  ? 1400 HOH A O   1 
HETATM 10559 O O   . HOH P 4 .   ? 32.120  71.854  -5.991  1.00 88.42  ? 1401 HOH A O   1 
HETATM 10560 O O   . HOH P 4 .   ? 27.476  71.472  8.590   1.00 121.87 ? 1402 HOH A O   1 
HETATM 10561 O O   . HOH P 4 .   ? 2.219   59.752  -2.714  1.00 168.02 ? 1403 HOH A O   1 
HETATM 10562 O O   . HOH P 4 .   ? 44.892  76.477  20.078  1.00 100.46 ? 1404 HOH A O   1 
HETATM 10563 O O   . HOH P 4 .   ? 22.843  58.483  7.802   1.00 193.37 ? 1405 HOH A O   1 
HETATM 10564 O O   . HOH P 4 .   ? -6.086  77.990  -10.739 1.00 40.93  ? 1406 HOH A O   1 
HETATM 10565 O O   . HOH P 4 .   ? 3.121   48.496  -0.026  1.00 74.41  ? 1407 HOH A O   1 
HETATM 10566 O O   . HOH P 4 .   ? -3.499  58.661  -14.089 1.00 147.06 ? 1408 HOH A O   1 
HETATM 10567 O O   . HOH P 4 .   ? 38.670  51.722  5.398   1.00 61.47  ? 1409 HOH A O   1 
HETATM 10568 O O   . HOH P 4 .   ? -3.553  75.525  -13.806 1.00 49.58  ? 1410 HOH A O   1 
HETATM 10569 O O   . HOH P 4 .   ? 52.440  74.103  16.146  1.00 55.18  ? 1411 HOH A O   1 
HETATM 10570 O O   . HOH P 4 .   ? 26.401  59.547  10.538  1.00 125.52 ? 1412 HOH A O   1 
HETATM 10571 O O   . HOH P 4 .   ? 40.637  61.647  16.931  1.00 105.40 ? 1413 HOH A O   1 
HETATM 10572 O O   . HOH P 4 .   ? 6.641   51.542  0.016   1.00 146.17 ? 1414 HOH A O   1 
HETATM 10573 O O   . HOH P 4 .   ? 11.342  59.913  -19.534 1.00 176.98 ? 1415 HOH A O   1 
HETATM 10574 O O   . HOH P 4 .   ? 42.588  53.060  -7.936  1.00 83.93  ? 1416 HOH A O   1 
HETATM 10575 O O   . HOH P 4 .   ? 19.716  57.203  -18.978 1.00 139.92 ? 1417 HOH A O   1 
HETATM 10576 O O   . HOH P 4 .   ? 0.935   68.845  -2.410  1.00 73.74  ? 1418 HOH A O   1 
HETATM 10577 O O   . HOH P 4 .   ? -7.434  69.875  -19.255 1.00 50.75  ? 1419 HOH A O   1 
HETATM 10578 O O   . HOH P 4 .   ? 40.395  52.324  10.022  1.00 50.07  ? 1420 HOH A O   1 
HETATM 10579 O O   . HOH P 4 .   ? 34.535  66.379  4.014   1.00 89.78  ? 1421 HOH A O   1 
HETATM 10580 O O   . HOH P 4 .   ? 35.924  59.842  -9.906  1.00 137.20 ? 1422 HOH A O   1 
HETATM 10581 O O   . HOH P 4 .   ? 35.347  82.784  1.539   1.00 132.97 ? 1423 HOH A O   1 
HETATM 10582 O O   . HOH P 4 .   ? 46.166  75.577  16.184  1.00 127.52 ? 1424 HOH A O   1 
HETATM 10583 O O   . HOH P 4 .   ? 32.397  80.754  20.602  1.00 68.17  ? 1425 HOH A O   1 
HETATM 10584 O O   . HOH P 4 .   ? 4.265   81.020  -9.460  1.00 66.57  ? 1426 HOH A O   1 
HETATM 10585 O O   . HOH P 4 .   ? 47.008  54.028  -9.853  1.00 52.75  ? 1427 HOH A O   1 
HETATM 10586 O O   . HOH P 4 .   ? 42.738  82.791  5.258   1.00 72.83  ? 1428 HOH A O   1 
HETATM 10587 O O   . HOH Q 4 .   ? 5.336   31.014  -3.990  1.00 41.73  ? 2302 HOH B O   1 
HETATM 10588 O O   . HOH Q 4 .   ? 11.271  12.472  -8.226  1.00 88.57  ? 2303 HOH B O   1 
HETATM 10589 O O   . HOH Q 4 .   ? -8.326  24.597  4.607   1.00 72.57  ? 2304 HOH B O   1 
HETATM 10590 O O   . HOH Q 4 .   ? 16.500  12.979  14.857  1.00 59.74  ? 2305 HOH B O   1 
HETATM 10591 O O   . HOH Q 4 .   ? 14.017  22.335  -16.584 1.00 79.35  ? 2306 HOH B O   1 
HETATM 10592 O O   . HOH Q 4 .   ? 18.320  9.076   7.482   1.00 71.78  ? 2307 HOH B O   1 
HETATM 10593 O O   . HOH Q 4 .   ? 1.503   23.212  -17.842 1.00 29.26  ? 2308 HOH B O   1 
HETATM 10594 O O   . HOH Q 4 .   ? -16.248 25.815  -3.927  1.00 142.55 ? 2309 HOH B O   1 
HETATM 10595 O O   . HOH Q 4 .   ? 1.861   -8.571  26.293  1.00 101.99 ? 2310 HOH B O   1 
HETATM 10596 O O   . HOH Q 4 .   ? 10.050  23.522  -7.541  1.00 48.90  ? 2311 HOH B O   1 
HETATM 10597 O O   . HOH Q 4 .   ? 7.432   33.357  -5.926  1.00 41.68  ? 2312 HOH B O   1 
HETATM 10598 O O   . HOH Q 4 .   ? 1.599   5.337   10.191  1.00 114.84 ? 2313 HOH B O   1 
HETATM 10599 O O   . HOH Q 4 .   ? -1.093  35.393  -12.938 1.00 15.02  ? 2314 HOH B O   1 
HETATM 10600 O O   . HOH Q 4 .   ? 13.400  1.256   7.174   1.00 74.13  ? 2315 HOH B O   1 
HETATM 10601 O O   . HOH Q 4 .   ? -2.624  21.926  -20.313 1.00 49.25  ? 2316 HOH B O   1 
HETATM 10602 O O   . HOH Q 4 .   ? 2.238   25.467  22.118  1.00 134.88 ? 2317 HOH B O   1 
HETATM 10603 O O   . HOH Q 4 .   ? -2.194  31.048  -13.175 1.00 74.96  ? 2318 HOH B O   1 
HETATM 10604 O O   . HOH Q 4 .   ? 4.510   4.851   -1.606  1.00 121.09 ? 2319 HOH B O   1 
HETATM 10605 O O   . HOH Q 4 .   ? 9.222   30.080  0.588   1.00 90.83  ? 2320 HOH B O   1 
HETATM 10606 O O   . HOH Q 4 .   ? 11.362  21.031  22.931  1.00 59.29  ? 2321 HOH B O   1 
HETATM 10607 O O   . HOH Q 4 .   ? 4.498   15.846  26.725  1.00 77.94  ? 2322 HOH B O   1 
HETATM 10608 O O   . HOH Q 4 .   ? 10.577  -2.071  11.517  1.00 63.99  ? 2323 HOH B O   1 
HETATM 10609 O O   . HOH Q 4 .   ? 11.759  34.342  8.643   1.00 105.31 ? 2324 HOH B O   1 
HETATM 10610 O O   . HOH Q 4 .   ? -20.499 16.318  -1.446  1.00 43.30  ? 2325 HOH B O   1 
HETATM 10611 O O   . HOH Q 4 .   ? -19.443 14.682  -4.571  1.00 58.14  ? 2326 HOH B O   1 
HETATM 10612 O O   . HOH Q 4 .   ? -5.469  -5.100  26.667  1.00 91.66  ? 2327 HOH B O   1 
HETATM 10613 O O   . HOH Q 4 .   ? 14.479  19.721  -15.431 1.00 69.83  ? 2328 HOH B O   1 
HETATM 10614 O O   . HOH Q 4 .   ? -0.851  22.129  -22.952 1.00 58.43  ? 2329 HOH B O   1 
HETATM 10615 O O   . HOH Q 4 .   ? 18.806  11.539  9.549   1.00 72.96  ? 2330 HOH B O   1 
HETATM 10616 O O   . HOH Q 4 .   ? 6.666   32.928  -9.012  1.00 119.29 ? 2331 HOH B O   1 
HETATM 10617 O O   . HOH Q 4 .   ? 18.400  6.097   11.624  1.00 52.49  ? 2332 HOH B O   1 
HETATM 10618 O O   . HOH Q 4 .   ? -0.296  20.945  -18.130 1.00 40.11  ? 2333 HOH B O   1 
HETATM 10619 O O   . HOH Q 4 .   ? -17.252 23.517  -0.076  1.00 55.14  ? 2334 HOH B O   1 
HETATM 10620 O O   . HOH Q 4 .   ? 0.183   14.986  13.794  1.00 48.94  ? 2335 HOH B O   1 
HETATM 10621 O O   . HOH Q 4 .   ? -3.266  -3.295  11.729  1.00 99.56  ? 2336 HOH B O   1 
HETATM 10622 O O   . HOH Q 4 .   ? 5.284   23.815  28.261  1.00 39.59  ? 2337 HOH B O   1 
HETATM 10623 O O   . HOH Q 4 .   ? 10.786  2.926   7.367   1.00 56.27  ? 2338 HOH B O   1 
HETATM 10624 O O   . HOH Q 4 .   ? -15.999 14.466  4.423   1.00 54.27  ? 2339 HOH B O   1 
HETATM 10625 O O   . HOH Q 4 .   ? -8.311  7.769   24.303  1.00 89.31  ? 2340 HOH B O   1 
HETATM 10626 O O   . HOH Q 4 .   ? 14.298  20.433  -9.262  1.00 124.87 ? 2341 HOH B O   1 
HETATM 10627 O O   . HOH Q 4 .   ? 2.059   28.001  2.889   1.00 192.17 ? 2342 HOH B O   1 
HETATM 10628 O O   . HOH Q 4 .   ? -14.104 7.670   23.606  1.00 63.61  ? 2343 HOH B O   1 
HETATM 10629 O O   . HOH Q 4 .   ? 12.697  3.706   9.895   1.00 81.44  ? 2344 HOH B O   1 
HETATM 10630 O O   . HOH Q 4 .   ? 16.482  8.266   5.002   1.00 51.77  ? 2345 HOH B O   1 
HETATM 10631 O O   . HOH Q 4 .   ? 2.865   34.663  6.423   1.00 42.88  ? 2346 HOH B O   1 
HETATM 10632 O O   . HOH Q 4 .   ? 6.344   22.793  8.744   1.00 57.06  ? 2347 HOH B O   1 
HETATM 10633 O O   . HOH Q 4 .   ? -23.294 16.092  -0.647  1.00 80.30  ? 2348 HOH B O   1 
HETATM 10634 O O   . HOH Q 4 .   ? 16.067  15.510  -10.854 1.00 50.63  ? 2349 HOH B O   1 
HETATM 10635 O O   . HOH Q 4 .   ? 2.458   12.031  -8.670  1.00 130.31 ? 2350 HOH B O   1 
HETATM 10636 O O   . HOH Q 4 .   ? 18.814  6.258   8.023   1.00 63.64  ? 2351 HOH B O   1 
HETATM 10637 O O   . HOH Q 4 .   ? -17.849 4.718   25.517  1.00 74.64  ? 2352 HOH B O   1 
HETATM 10638 O O   . HOH Q 4 .   ? 6.275   35.439  2.860   1.00 72.44  ? 2353 HOH B O   1 
HETATM 10639 O O   . HOH Q 4 .   ? 10.834  14.114  20.142  1.00 142.74 ? 2354 HOH B O   1 
HETATM 10640 O O   . HOH Q 4 .   ? -18.252 15.353  2.121   1.00 53.85  ? 2355 HOH B O   1 
HETATM 10641 O O   . HOH Q 4 .   ? 3.088   33.911  -15.982 1.00 193.37 ? 2356 HOH B O   1 
HETATM 10642 O O   . HOH Q 4 .   ? 7.752   27.417  1.664   1.00 163.12 ? 2357 HOH B O   1 
HETATM 10643 O O   . HOH Q 4 .   ? 2.065   -0.933  11.427  1.00 165.08 ? 2358 HOH B O   1 
HETATM 10644 O O   . HOH Q 4 .   ? 7.115   8.099   7.890   1.00 167.25 ? 2359 HOH B O   1 
HETATM 10645 O O   . HOH Q 4 .   ? -5.689  6.305   23.277  1.00 193.37 ? 2360 HOH B O   1 
HETATM 10646 O O   . HOH Q 4 .   ? 15.223  19.400  19.212  1.00 97.78  ? 2361 HOH B O   1 
HETATM 10647 O O   . HOH Q 4 .   ? 15.937  10.763  6.714   1.00 119.02 ? 2362 HOH B O   1 
HETATM 10648 O O   . HOH Q 4 .   ? 14.251  4.065   7.349   1.00 146.05 ? 2363 HOH B O   1 
HETATM 10649 O O   . HOH Q 4 .   ? 20.741  10.727  6.930   1.00 81.73  ? 2364 HOH B O   1 
HETATM 10650 O O   . HOH Q 4 .   ? 15.062  23.793  17.234  1.00 98.06  ? 2365 HOH B O   1 
HETATM 10651 O O   . HOH Q 4 .   ? 5.860   22.277  20.113  1.00 121.12 ? 2366 HOH B O   1 
HETATM 10652 O O   . HOH Q 4 .   ? 15.160  -2.325  42.340  1.00 50.84  ? 2367 HOH B O   1 
HETATM 10653 O O   . HOH Q 4 .   ? 20.526  14.255  29.407  1.00 76.17  ? 2368 HOH B O   1 
HETATM 10654 O O   . HOH Q 4 .   ? 12.025  9.951   -10.509 1.00 120.63 ? 2369 HOH B O   1 
HETATM 10655 O O   . HOH Q 4 .   ? 4.531   -1.420  37.853  1.00 81.53  ? 2370 HOH B O   1 
HETATM 10656 O O   . HOH Q 4 .   ? -0.203  19.909  12.582  1.00 127.17 ? 2371 HOH B O   1 
HETATM 10657 O O   . HOH Q 4 .   ? 23.619  10.249  21.261  1.00 61.10  ? 2372 HOH B O   1 
HETATM 10658 O O   . HOH Q 4 .   ? -1.308  -1.406  12.947  1.00 127.22 ? 2373 HOH B O   1 
HETATM 10659 O O   . HOH Q 4 .   ? -14.472 16.455  2.714   1.00 80.15  ? 2374 HOH B O   1 
HETATM 10660 O O   . HOH Q 4 .   ? -2.861  19.968  -16.662 1.00 81.71  ? 2375 HOH B O   1 
HETATM 10661 O O   . HOH Q 4 .   ? -12.386 22.145  6.583   1.00 163.87 ? 2376 HOH B O   1 
HETATM 10662 O O   . HOH Q 4 .   ? 17.078  10.640  26.486  1.00 97.25  ? 2377 HOH B O   1 
HETATM 10663 O O   . HOH Q 4 .   ? -7.400  24.558  7.818   1.00 140.65 ? 2378 HOH B O   1 
HETATM 10664 O O   . HOH Q 4 .   ? 3.651   36.831  2.121   1.00 50.34  ? 2379 HOH B O   1 
HETATM 10665 O O   . HOH Q 4 .   ? 16.179  5.572   5.788   1.00 99.92  ? 2380 HOH B O   1 
HETATM 10666 O O   . HOH Q 4 .   ? 13.874  20.092  21.717  1.00 124.67 ? 2381 HOH B O   1 
HETATM 10667 O O   . HOH Q 4 .   ? 20.953  5.443   31.240  1.00 93.38  ? 2382 HOH B O   1 
HETATM 10668 O O   . HOH Q 4 .   ? 23.516  7.018   20.880  1.00 62.51  ? 2383 HOH B O   1 
HETATM 10669 O O   . HOH Q 4 .   ? 10.646  27.445  -1.814  1.00 45.84  ? 2384 HOH B O   1 
HETATM 10670 O O   . HOH Q 4 .   ? 19.966  8.743   10.124  1.00 127.83 ? 2385 HOH B O   1 
HETATM 10671 O O   . HOH Q 4 .   ? -26.076 16.771  1.036   1.00 96.10  ? 2386 HOH B O   1 
HETATM 10672 O O   . HOH Q 4 .   ? 21.458  6.118   10.604  1.00 69.40  ? 2387 HOH B O   1 
HETATM 10673 O O   . HOH Q 4 .   ? 0.153   0.792   9.874   1.00 80.12  ? 2388 HOH B O   1 
HETATM 10674 O O   . HOH Q 4 .   ? 11.013  3.298   -2.741  1.00 47.39  ? 2389 HOH B O   1 
HETATM 10675 O O   . HOH Q 4 .   ? -15.135 34.935  -6.912  1.00 50.07  ? 2390 HOH B O   1 
HETATM 10676 O O   . HOH Q 4 .   ? -3.149  17.575  10.509  1.00 156.64 ? 2391 HOH B O   1 
HETATM 10677 O O   . HOH Q 4 .   ? 16.287  18.074  -12.155 1.00 129.31 ? 2392 HOH B O   1 
HETATM 10678 O O   . HOH Q 4 .   ? 7.058   6.640   40.769  1.00 115.35 ? 2393 HOH B O   1 
HETATM 10679 O O   . HOH Q 4 .   ? -1.038  35.008  -9.834  1.00 83.47  ? 2394 HOH B O   1 
HETATM 10680 O O   . HOH Q 4 .   ? 4.317   7.056   3.134   1.00 107.84 ? 2395 HOH B O   1 
HETATM 10681 O O   . HOH Q 4 .   ? 16.597  22.834  14.731  1.00 67.82  ? 2396 HOH B O   1 
HETATM 10682 O O   . HOH Q 4 .   ? 2.756   15.067  11.022  1.00 187.02 ? 2397 HOH B O   1 
HETATM 10683 O O   . HOH Q 4 .   ? 13.320  19.975  -3.434  1.00 74.62  ? 2398 HOH B O   1 
HETATM 10684 O O   . HOH Q 4 .   ? 8.013   35.267  23.661  1.00 62.94  ? 2399 HOH B O   1 
HETATM 10685 O O   . HOH Q 4 .   ? 4.676   18.383  -19.581 1.00 78.61  ? 2400 HOH B O   1 
HETATM 10686 O O   . HOH Q 4 .   ? -10.610 7.001   30.734  1.00 189.90 ? 2401 HOH B O   1 
HETATM 10687 O O   . HOH R 4 .   ? -1.514  59.304  18.840  1.00 28.66  ? 3302 HOH C O   1 
HETATM 10688 O O   . HOH R 4 .   ? -12.929 48.501  5.932   1.00 26.98  ? 3303 HOH C O   1 
HETATM 10689 O O   . HOH R 4 .   ? -10.686 49.688  8.652   1.00 33.67  ? 3304 HOH C O   1 
HETATM 10690 O O   . HOH R 4 .   ? -9.133  52.613  -1.916  1.00 28.17  ? 3305 HOH C O   1 
HETATM 10691 O O   . HOH R 4 .   ? 0.820   54.869  26.191  1.00 68.11  ? 3306 HOH C O   1 
HETATM 10692 O O   . HOH R 4 .   ? -11.669 51.483  6.325   1.00 40.19  ? 3307 HOH C O   1 
HETATM 10693 O O   . HOH R 4 .   ? -27.205 68.045  13.913  1.00 82.79  ? 3308 HOH C O   1 
HETATM 10694 O O   . HOH R 4 .   ? 9.000   85.766  6.120   1.00 48.63  ? 3309 HOH C O   1 
HETATM 10695 O O   . HOH R 4 .   ? -27.336 57.288  16.315  1.00 39.31  ? 3310 HOH C O   1 
HETATM 10696 O O   . HOH R 4 .   ? -25.456 56.302  -1.510  1.00 32.73  ? 3311 HOH C O   1 
HETATM 10697 O O   . HOH R 4 .   ? 0.050   55.415  13.279  1.00 89.48  ? 3312 HOH C O   1 
HETATM 10698 O O   . HOH R 4 .   ? -6.363  93.086  31.692  1.00 66.40  ? 3313 HOH C O   1 
HETATM 10699 O O   . HOH R 4 .   ? -11.617 73.338  16.587  1.00 66.48  ? 3314 HOH C O   1 
HETATM 10700 O O   . HOH R 4 .   ? -5.763  96.582  19.727  1.00 55.98  ? 3315 HOH C O   1 
HETATM 10701 O O   . HOH R 4 .   ? -6.871  67.895  40.476  1.00 33.82  ? 3316 HOH C O   1 
HETATM 10702 O O   . HOH R 4 .   ? -16.068 69.864  32.973  1.00 59.61  ? 3317 HOH C O   1 
HETATM 10703 O O   . HOH R 4 .   ? -25.031 78.508  10.974  1.00 60.32  ? 3318 HOH C O   1 
HETATM 10704 O O   . HOH R 4 .   ? -2.267  69.131  13.939  1.00 127.39 ? 3319 HOH C O   1 
HETATM 10705 O O   . HOH R 4 .   ? -21.373 75.592  14.109  1.00 57.19  ? 3320 HOH C O   1 
HETATM 10706 O O   . HOH R 4 .   ? 1.427   88.438  36.403  1.00 48.77  ? 3321 HOH C O   1 
HETATM 10707 O O   . HOH R 4 .   ? -8.076  67.868  -11.808 1.00 53.74  ? 3322 HOH C O   1 
HETATM 10708 O O   . HOH R 4 .   ? -18.529 72.911  27.943  1.00 45.05  ? 3323 HOH C O   1 
HETATM 10709 O O   . HOH R 4 .   ? -9.565  66.346  22.231  1.00 95.50  ? 3324 HOH C O   1 
HETATM 10710 O O   . HOH R 4 .   ? -5.825  58.089  -12.379 1.00 28.42  ? 3325 HOH C O   1 
HETATM 10711 O O   . HOH R 4 .   ? -5.628  73.574  -2.239  1.00 87.39  ? 3326 HOH C O   1 
HETATM 10712 O O   . HOH R 4 .   ? -13.914 50.935  11.335  1.00 71.87  ? 3327 HOH C O   1 
HETATM 10713 O O   . HOH R 4 .   ? -2.206  66.536  36.642  1.00 73.15  ? 3328 HOH C O   1 
HETATM 10714 O O   . HOH R 4 .   ? 5.368   74.938  41.078  1.00 126.29 ? 3329 HOH C O   1 
HETATM 10715 O O   . HOH R 4 .   ? -0.933  59.958  30.347  1.00 52.75  ? 3330 HOH C O   1 
HETATM 10716 O O   . HOH R 4 .   ? -8.572  77.889  -8.085  1.00 56.18  ? 3331 HOH C O   1 
HETATM 10717 O O   . HOH R 4 .   ? -27.120 53.763  4.513   1.00 45.77  ? 3332 HOH C O   1 
HETATM 10718 O O   . HOH R 4 .   ? -2.161  52.850  21.617  1.00 40.74  ? 3333 HOH C O   1 
HETATM 10719 O O   . HOH R 4 .   ? -17.746 74.659  25.428  1.00 77.20  ? 3334 HOH C O   1 
HETATM 10720 O O   . HOH R 4 .   ? 2.074   62.173  26.763  1.00 93.65  ? 3335 HOH C O   1 
HETATM 10721 O O   . HOH R 4 .   ? -7.346  49.111  -2.082  1.00 53.04  ? 3336 HOH C O   1 
HETATM 10722 O O   . HOH R 4 .   ? -18.375 75.362  29.755  1.00 50.77  ? 3337 HOH C O   1 
HETATM 10723 O O   . HOH R 4 .   ? 8.290   80.702  36.054  1.00 94.94  ? 3338 HOH C O   1 
HETATM 10724 O O   . HOH R 4 .   ? -7.058  57.694  7.813   1.00 140.00 ? 3339 HOH C O   1 
HETATM 10725 O O   . HOH R 4 .   ? -2.977  59.773  27.357  1.00 52.50  ? 3340 HOH C O   1 
HETATM 10726 O O   . HOH R 4 .   ? -8.632  75.250  -10.897 1.00 44.99  ? 3341 HOH C O   1 
HETATM 10727 O O   . HOH R 4 .   ? 15.145  68.009  32.675  1.00 52.69  ? 3342 HOH C O   1 
HETATM 10728 O O   . HOH R 4 .   ? 4.521   90.468  19.016  1.00 85.56  ? 3343 HOH C O   1 
HETATM 10729 O O   . HOH R 4 .   ? 4.394   87.004  18.897  1.00 122.51 ? 3344 HOH C O   1 
HETATM 10730 O O   . HOH R 4 .   ? 3.896   55.894  24.782  1.00 67.63  ? 3345 HOH C O   1 
HETATM 10731 O O   . HOH R 4 .   ? -7.032  97.557  27.453  1.00 62.05  ? 3346 HOH C O   1 
HETATM 10732 O O   . HOH R 4 .   ? -11.104 71.593  -8.597  1.00 62.16  ? 3347 HOH C O   1 
HETATM 10733 O O   . HOH R 4 .   ? -9.417  50.824  -4.475  1.00 77.45  ? 3348 HOH C O   1 
HETATM 10734 O O   . HOH R 4 .   ? -2.519  91.475  12.562  1.00 62.89  ? 3349 HOH C O   1 
HETATM 10735 O O   . HOH R 4 .   ? 9.386   90.646  21.774  1.00 88.69  ? 3350 HOH C O   1 
HETATM 10736 O O   . HOH R 4 .   ? -7.116  65.207  28.902  1.00 87.78  ? 3351 HOH C O   1 
HETATM 10737 O O   . HOH R 4 .   ? -27.363 77.806  12.862  1.00 43.50  ? 3352 HOH C O   1 
HETATM 10738 O O   . HOH R 4 .   ? -4.471  51.611  2.596   1.00 43.92  ? 3353 HOH C O   1 
HETATM 10739 O O   . HOH R 4 .   ? -19.812 52.106  12.603  1.00 66.76  ? 3354 HOH C O   1 
HETATM 10740 O O   . HOH R 4 .   ? -8.274  56.330  -12.701 1.00 55.37  ? 3355 HOH C O   1 
HETATM 10741 O O   . HOH R 4 .   ? -23.504 60.161  5.823   1.00 70.45  ? 3356 HOH C O   1 
HETATM 10742 O O   . HOH R 4 .   ? -18.353 66.333  28.739  1.00 65.35  ? 3357 HOH C O   1 
HETATM 10743 O O   . HOH R 4 .   ? -11.192 68.495  -5.935  1.00 106.63 ? 3358 HOH C O   1 
HETATM 10744 O O   . HOH R 4 .   ? -7.686  71.244  -2.537  1.00 114.31 ? 3359 HOH C O   1 
HETATM 10745 O O   . HOH R 4 .   ? -9.597  47.310  3.136   1.00 87.39  ? 3360 HOH C O   1 
HETATM 10746 O O   . HOH R 4 .   ? -4.432  50.146  9.337   1.00 53.61  ? 3361 HOH C O   1 
HETATM 10747 O O   . HOH R 4 .   ? -30.226 78.726  12.731  1.00 69.41  ? 3362 HOH C O   1 
HETATM 10748 O O   . HOH R 4 .   ? -18.493 52.808  -7.180  1.00 84.18  ? 3363 HOH C O   1 
HETATM 10749 O O   . HOH R 4 .   ? -17.998 68.212  30.997  1.00 65.48  ? 3364 HOH C O   1 
HETATM 10750 O O   . HOH R 4 .   ? 0.665   74.165  41.123  1.00 119.78 ? 3365 HOH C O   1 
HETATM 10751 O O   . HOH R 4 .   ? -29.950 64.382  16.655  1.00 44.66  ? 3366 HOH C O   1 
HETATM 10752 O O   . HOH R 4 .   ? -20.365 54.978  11.211  1.00 53.22  ? 3367 HOH C O   1 
HETATM 10753 O O   . HOH R 4 .   ? -6.533  69.349  27.269  1.00 143.12 ? 3368 HOH C O   1 
HETATM 10754 O O   . HOH R 4 .   ? -6.436  56.513  17.064  1.00 90.13  ? 3369 HOH C O   1 
HETATM 10755 O O   . HOH R 4 .   ? -0.646  66.174  5.294   1.00 90.27  ? 3370 HOH C O   1 
HETATM 10756 O O   . HOH R 4 .   ? -29.814 66.537  12.877  1.00 60.75  ? 3371 HOH C O   1 
HETATM 10757 O O   . HOH R 4 .   ? -7.060  76.618  -1.473  1.00 42.29  ? 3372 HOH C O   1 
HETATM 10758 O O   . HOH R 4 .   ? -1.465  70.642  -1.737  1.00 131.48 ? 3373 HOH C O   1 
HETATM 10759 O O   . HOH R 4 .   ? -10.089 69.111  30.616  1.00 132.72 ? 3374 HOH C O   1 
HETATM 10760 O O   . HOH R 4 .   ? -3.724  56.506  27.890  1.00 108.11 ? 3375 HOH C O   1 
HETATM 10761 O O   . HOH R 4 .   ? -18.543 49.757  7.501   1.00 39.83  ? 3376 HOH C O   1 
HETATM 10762 O O   . HOH R 4 .   ? 6.840   65.125  34.217  1.00 80.42  ? 3377 HOH C O   1 
HETATM 10763 O O   . HOH R 4 .   ? -2.202  82.929  15.385  1.00 102.70 ? 3378 HOH C O   1 
HETATM 10764 O O   . HOH R 4 .   ? -4.127  81.784  -7.838  1.00 47.58  ? 3379 HOH C O   1 
HETATM 10765 O O   . HOH R 4 .   ? -17.194 77.159  35.608  1.00 61.21  ? 3380 HOH C O   1 
HETATM 10766 O O   . HOH R 4 .   ? 16.312  79.986  16.149  1.00 71.76  ? 3381 HOH C O   1 
HETATM 10767 O O   . HOH R 4 .   ? 0.808   52.472  13.386  1.00 57.50  ? 3382 HOH C O   1 
HETATM 10768 O O   . HOH R 4 .   ? 2.985   88.415  21.413  1.00 150.26 ? 3383 HOH C O   1 
HETATM 10769 O O   . HOH R 4 .   ? -18.527 52.829  5.894   1.00 62.60  ? 3384 HOH C O   1 
HETATM 10770 O O   . HOH R 4 .   ? -3.938  66.053  1.972   1.00 193.37 ? 3385 HOH C O   1 
HETATM 10771 O O   . HOH R 4 .   ? -5.633  90.975  12.448  1.00 80.68  ? 3386 HOH C O   1 
HETATM 10772 O O   . HOH R 4 .   ? -8.608  74.909  21.173  1.00 162.67 ? 3387 HOH C O   1 
HETATM 10773 O O   . HOH R 4 .   ? 8.071   79.371  32.222  1.00 143.18 ? 3388 HOH C O   1 
HETATM 10774 O O   . HOH R 4 .   ? -19.543 48.655  -0.424  1.00 193.37 ? 3389 HOH C O   1 
HETATM 10775 O O   . HOH R 4 .   ? -10.244 93.626  29.330  1.00 92.99  ? 3390 HOH C O   1 
HETATM 10776 O O   . HOH R 4 .   ? -20.215 76.172  11.592  1.00 76.83  ? 3391 HOH C O   1 
HETATM 10777 O O   . HOH R 4 .   ? -18.743 54.856  8.609   1.00 100.99 ? 3392 HOH C O   1 
HETATM 10778 O O   . HOH R 4 .   ? -3.898  49.610  6.387   1.00 52.55  ? 3393 HOH C O   1 
HETATM 10779 O O   . HOH R 4 .   ? -17.189 66.315  25.917  1.00 46.76  ? 3394 HOH C O   1 
HETATM 10780 O O   . HOH R 4 .   ? -17.263 54.293  -9.714  1.00 81.39  ? 3395 HOH C O   1 
HETATM 10781 O O   . HOH R 4 .   ? -31.579 75.818  12.030  1.00 132.97 ? 3396 HOH C O   1 
HETATM 10782 O O   . HOH R 4 .   ? -1.455  49.564  17.550  1.00 127.14 ? 3397 HOH C O   1 
HETATM 10783 O O   . HOH R 4 .   ? 5.995   78.641  41.911  1.00 160.90 ? 3398 HOH C O   1 
HETATM 10784 O O   . HOH R 4 .   ? -3.669  72.624  16.293  1.00 47.16  ? 3399 HOH C O   1 
HETATM 10785 O O   . HOH R 4 .   ? -30.023 55.863  16.580  1.00 138.38 ? 3400 HOH C O   1 
HETATM 10786 O O   . HOH R 4 .   ? 17.115  65.409  34.001  1.00 63.61  ? 3401 HOH C O   1 
HETATM 10787 O O   . HOH R 4 .   ? -6.109  60.564  39.715  1.00 53.32  ? 3402 HOH C O   1 
HETATM 10788 O O   . HOH R 4 .   ? 0.858   63.991  31.558  1.00 58.47  ? 3403 HOH C O   1 
HETATM 10789 O O   . HOH R 4 .   ? -2.430  52.735  0.470   1.00 99.24  ? 3404 HOH C O   1 
HETATM 10790 O O   . HOH R 4 .   ? -15.327 65.424  29.499  1.00 71.21  ? 3405 HOH C O   1 
HETATM 10791 O O   . HOH S 4 .   ? -28.459 34.453  50.351  1.00 23.07  ? 4302 HOH D O   1 
HETATM 10792 O O   . HOH S 4 .   ? -10.706 38.575  20.680  1.00 68.76  ? 4303 HOH D O   1 
HETATM 10793 O O   . HOH S 4 .   ? -3.155  39.671  16.859  1.00 17.78  ? 4304 HOH D O   1 
HETATM 10794 O O   . HOH S 4 .   ? 4.654   46.283  33.119  1.00 50.78  ? 4305 HOH D O   1 
HETATM 10795 O O   . HOH S 4 .   ? -29.926 51.036  12.696  1.00 32.65  ? 4306 HOH D O   1 
HETATM 10796 O O   . HOH S 4 .   ? -13.066 27.333  38.382  1.00 33.72  ? 4307 HOH D O   1 
HETATM 10797 O O   . HOH S 4 .   ? -25.217 28.768  -3.490  1.00 23.65  ? 4308 HOH D O   1 
HETATM 10798 O O   . HOH S 4 .   ? -10.193 33.693  4.748   1.00 14.42  ? 4309 HOH D O   1 
HETATM 10799 O O   . HOH S 4 .   ? -2.947  43.900  22.063  1.00 22.13  ? 4310 HOH D O   1 
HETATM 10800 O O   . HOH S 4 .   ? -11.908 23.067  11.972  1.00 64.91  ? 4311 HOH D O   1 
HETATM 10801 O O   . HOH S 4 .   ? -25.771 43.053  54.936  1.00 81.75  ? 4312 HOH D O   1 
HETATM 10802 O O   . HOH S 4 .   ? -20.462 28.673  -0.834  1.00 121.05 ? 4313 HOH D O   1 
HETATM 10803 O O   . HOH S 4 .   ? -19.902 22.326  -0.349  1.00 39.00  ? 4314 HOH D O   1 
HETATM 10804 O O   . HOH S 4 .   ? -32.686 33.377  29.649  1.00 65.42  ? 4315 HOH D O   1 
HETATM 10805 O O   . HOH S 4 .   ? -4.709  42.355  10.726  1.00 42.22  ? 4316 HOH D O   1 
HETATM 10806 O O   . HOH S 4 .   ? -11.065 54.667  33.600  1.00 62.48  ? 4317 HOH D O   1 
HETATM 10807 O O   . HOH S 4 .   ? -4.130  36.576  15.857  1.00 108.69 ? 4318 HOH D O   1 
HETATM 10808 O O   . HOH S 4 .   ? -8.520  37.921  32.185  1.00 88.55  ? 4319 HOH D O   1 
HETATM 10809 O O   . HOH S 4 .   ? -5.197  33.261  28.156  1.00 62.89  ? 4320 HOH D O   1 
HETATM 10810 O O   . HOH S 4 .   ? -20.723 25.365  9.742   1.00 108.37 ? 4321 HOH D O   1 
HETATM 10811 O O   . HOH S 4 .   ? -23.261 35.623  23.896  1.00 54.89  ? 4322 HOH D O   1 
HETATM 10812 O O   . HOH S 4 .   ? -13.246 26.889  48.805  1.00 62.41  ? 4323 HOH D O   1 
HETATM 10813 O O   . HOH S 4 .   ? -8.773  45.059  49.762  1.00 119.88 ? 4324 HOH D O   1 
HETATM 10814 O O   . HOH S 4 .   ? -29.862 37.765  14.411  1.00 86.21  ? 4325 HOH D O   1 
HETATM 10815 O O   . HOH S 4 .   ? -26.965 44.161  4.652   1.00 170.41 ? 4326 HOH D O   1 
HETATM 10816 O O   . HOH S 4 .   ? -22.466 45.501  -1.398  1.00 123.95 ? 4327 HOH D O   1 
HETATM 10817 O O   . HOH S 4 .   ? -19.846 54.503  45.392  1.00 92.50  ? 4328 HOH D O   1 
HETATM 10818 O O   . HOH S 4 .   ? -30.290 46.827  33.668  1.00 100.43 ? 4329 HOH D O   1 
HETATM 10819 O O   . HOH S 4 .   ? -23.044 28.656  14.318  1.00 89.00  ? 4330 HOH D O   1 
HETATM 10820 O O   . HOH S 4 .   ? -35.571 29.625  18.300  1.00 43.19  ? 4331 HOH D O   1 
HETATM 10821 O O   . HOH S 4 .   ? 2.055   35.456  16.599  1.00 72.49  ? 4332 HOH D O   1 
HETATM 10822 O O   . HOH S 4 .   ? -15.356 43.990  15.546  1.00 84.85  ? 4333 HOH D O   1 
HETATM 10823 O O   . HOH S 4 .   ? -20.280 51.021  56.536  1.00 33.30  ? 4334 HOH D O   1 
HETATM 10824 O O   . HOH S 4 .   ? -2.079  48.502  36.787  1.00 108.13 ? 4335 HOH D O   1 
HETATM 10825 O O   . HOH S 4 .   ? -20.056 21.633  15.300  1.00 67.64  ? 4336 HOH D O   1 
HETATM 10826 O O   . HOH S 4 .   ? -7.724  32.153  2.823   1.00 46.90  ? 4337 HOH D O   1 
HETATM 10827 O O   . HOH S 4 .   ? -22.151 28.756  -3.723  1.00 56.21  ? 4338 HOH D O   1 
HETATM 10828 O O   . HOH S 4 .   ? -11.057 24.959  9.840   1.00 85.89  ? 4339 HOH D O   1 
HETATM 10829 O O   . HOH S 4 .   ? -26.010 59.003  41.862  1.00 64.49  ? 4340 HOH D O   1 
HETATM 10830 O O   . HOH S 4 .   ? -28.699 42.315  9.337   1.00 70.97  ? 4341 HOH D O   1 
HETATM 10831 O O   . HOH S 4 .   ? -22.783 34.240  -2.144  1.00 145.80 ? 4342 HOH D O   1 
HETATM 10832 O O   . HOH S 4 .   ? -26.203 31.028  -6.251  1.00 70.89  ? 4343 HOH D O   1 
HETATM 10833 O O   . HOH S 4 .   ? -22.513 56.345  30.331  1.00 59.88  ? 4344 HOH D O   1 
HETATM 10834 O O   . HOH S 4 .   ? -2.512  39.350  9.262   1.00 55.67  ? 4345 HOH D O   1 
HETATM 10835 O O   . HOH S 4 .   ? -21.608 47.642  0.924   1.00 170.78 ? 4346 HOH D O   1 
HETATM 10836 O O   . HOH S 4 .   ? -30.980 36.036  35.018  1.00 92.34  ? 4347 HOH D O   1 
HETATM 10837 O O   . HOH S 4 .   ? -18.472 17.083  9.491   1.00 52.42  ? 4348 HOH D O   1 
HETATM 10838 O O   . HOH S 4 .   ? -27.637 30.476  -2.913  1.00 31.83  ? 4349 HOH D O   1 
HETATM 10839 O O   . HOH S 4 .   ? -35.516 36.657  47.506  1.00 50.01  ? 4350 HOH D O   1 
HETATM 10840 O O   . HOH S 4 .   ? -15.311 35.601  56.287  1.00 37.67  ? 4351 HOH D O   1 
HETATM 10841 O O   . HOH S 4 .   ? -11.336 37.945  -3.328  1.00 130.48 ? 4352 HOH D O   1 
HETATM 10842 O O   . HOH S 4 .   ? -33.771 38.995  48.162  1.00 75.68  ? 4353 HOH D O   1 
HETATM 10843 O O   . HOH S 4 .   ? -8.981  39.109  25.785  1.00 166.16 ? 4354 HOH D O   1 
HETATM 10844 O O   . HOH S 4 .   ? -12.619 32.064  47.120  1.00 57.88  ? 4355 HOH D O   1 
HETATM 10845 O O   . HOH S 4 .   ? 2.060   38.604  16.882  1.00 47.04  ? 4356 HOH D O   1 
HETATM 10846 O O   . HOH S 4 .   ? -24.209 17.498  14.959  1.00 38.92  ? 4357 HOH D O   1 
HETATM 10847 O O   . HOH S 4 .   ? -6.791  48.382  28.658  1.00 115.26 ? 4358 HOH D O   1 
HETATM 10848 O O   . HOH S 4 .   ? -0.268  45.945  22.967  1.00 31.22  ? 4359 HOH D O   1 
HETATM 10849 O O   . HOH S 4 .   ? -25.709 48.988  9.741   1.00 45.10  ? 4360 HOH D O   1 
HETATM 10850 O O   . HOH S 4 .   ? -19.871 42.253  25.792  1.00 66.26  ? 4361 HOH D O   1 
HETATM 10851 O O   . HOH S 4 .   ? -27.316 56.234  41.710  1.00 99.69  ? 4362 HOH D O   1 
HETATM 10852 O O   . HOH S 4 .   ? 0.598   36.574  26.507  1.00 46.61  ? 4363 HOH D O   1 
HETATM 10853 O O   . HOH S 4 .   ? -15.008 23.317  3.382   1.00 40.43  ? 4364 HOH D O   1 
HETATM 10854 O O   . HOH S 4 .   ? -3.962  38.099  6.855   1.00 52.40  ? 4365 HOH D O   1 
HETATM 10855 O O   . HOH S 4 .   ? -11.241 39.125  37.633  1.00 50.71  ? 4366 HOH D O   1 
HETATM 10856 O O   . HOH S 4 .   ? -12.225 31.444  5.232   1.00 118.46 ? 4367 HOH D O   1 
HETATM 10857 O O   . HOH S 4 .   ? -15.416 53.996  37.536  1.00 68.36  ? 4368 HOH D O   1 
HETATM 10858 O O   . HOH S 4 .   ? -27.446 28.085  -6.045  1.00 80.48  ? 4369 HOH D O   1 
HETATM 10859 O O   . HOH S 4 .   ? -8.962  35.240  50.659  1.00 120.42 ? 4370 HOH D O   1 
HETATM 10860 O O   . HOH S 4 .   ? 0.469   40.697  18.143  1.00 43.92  ? 4371 HOH D O   1 
HETATM 10861 O O   . HOH S 4 .   ? -24.906 52.018  3.416   1.00 158.14 ? 4372 HOH D O   1 
HETATM 10862 O O   . HOH S 4 .   ? -16.361 36.181  50.813  1.00 113.24 ? 4373 HOH D O   1 
HETATM 10863 O O   . HOH S 4 .   ? -0.238  40.313  7.335   1.00 43.59  ? 4374 HOH D O   1 
HETATM 10864 O O   . HOH S 4 .   ? -11.065 35.581  -5.705  1.00 81.23  ? 4375 HOH D O   1 
HETATM 10865 O O   . HOH S 4 .   ? 4.534   39.158  15.337  1.00 85.21  ? 4376 HOH D O   1 
HETATM 10866 O O   . HOH S 4 .   ? -35.625 37.630  44.484  1.00 68.21  ? 4377 HOH D O   1 
HETATM 10867 O O   . HOH S 4 .   ? -16.862 55.691  44.926  1.00 85.48  ? 4378 HOH D O   1 
HETATM 10868 O O   . HOH S 4 .   ? -4.075  47.999  39.024  1.00 84.62  ? 4379 HOH D O   1 
HETATM 10869 O O   . HOH S 4 .   ? -18.186 42.452  37.459  1.00 60.19  ? 4380 HOH D O   1 
HETATM 10870 O O   . HOH S 4 .   ? -27.739 49.633  51.881  1.00 77.48  ? 4381 HOH D O   1 
HETATM 10871 O O   . HOH S 4 .   ? -16.032 30.925  -5.559  1.00 116.61 ? 4382 HOH D O   1 
HETATM 10872 O O   . HOH S 4 .   ? -20.152 30.131  33.525  1.00 120.19 ? 4383 HOH D O   1 
HETATM 10873 O O   . HOH S 4 .   ? -17.236 51.770  43.750  1.00 158.36 ? 4384 HOH D O   1 
HETATM 10874 O O   . HOH S 4 .   ? -16.765 16.633  6.063   1.00 153.85 ? 4385 HOH D O   1 
HETATM 10875 O O   . HOH S 4 .   ? -9.943  51.821  50.307  1.00 69.77  ? 4386 HOH D O   1 
HETATM 10876 O O   . HOH S 4 .   ? -12.309 41.175  53.131  1.00 97.20  ? 4387 HOH D O   1 
HETATM 10877 O O   . HOH S 4 .   ? -13.227 21.670  24.926  1.00 67.79  ? 4388 HOH D O   1 
HETATM 10878 O O   . HOH S 4 .   ? -25.331 47.388  27.235  1.00 50.37  ? 4389 HOH D O   1 
HETATM 10879 O O   . HOH S 4 .   ? -26.395 45.490  47.256  1.00 193.37 ? 4390 HOH D O   1 
HETATM 10880 O O   . HOH S 4 .   ? -5.773  49.085  25.609  1.00 193.37 ? 4391 HOH D O   1 
HETATM 10881 O O   . HOH S 4 .   ? -21.090 56.733  34.728  1.00 70.02  ? 4392 HOH D O   1 
HETATM 10882 O O   . HOH S 4 .   ? -0.138  37.379  15.019  1.00 76.17  ? 4393 HOH D O   1 
HETATM 10883 O O   . HOH S 4 .   ? -17.316 52.628  41.133  1.00 39.81  ? 4394 HOH D O   1 
HETATM 10884 O O   . HOH S 4 .   ? -3.622  40.939  5.960   1.00 47.20  ? 4395 HOH D O   1 
HETATM 10885 O O   . HOH S 4 .   ? 2.213   47.303  22.166  1.00 40.22  ? 4396 HOH D O   1 
HETATM 10886 O O   . HOH S 4 .   ? -1.273  39.951  14.360  1.00 43.75  ? 4397 HOH D O   1 
HETATM 10887 O O   . HOH S 4 .   ? -1.581  48.293  33.790  1.00 76.66  ? 4398 HOH D O   1 
HETATM 10888 O O   . HOH S 4 .   ? -19.101 14.558  5.135   1.00 66.12  ? 4399 HOH D O   1 
HETATM 10889 O O   . HOH S 4 .   ? -26.621 61.744  35.531  1.00 71.00  ? 4400 HOH D O   1 
HETATM 10890 O O   . HOH S 4 .   ? -17.116 35.178  53.838  1.00 92.83  ? 4401 HOH D O   1 
HETATM 10891 O O   . HOH S 4 .   ? -2.260  40.775  19.430  1.00 132.49 ? 4402 HOH D O   1 
HETATM 10892 O O   . HOH S 4 .   ? -14.218 37.540  53.189  1.00 176.84 ? 4403 HOH D O   1 
HETATM 10893 O O   . HOH S 4 .   ? -25.730 47.077  29.951  1.00 151.11 ? 4404 HOH D O   1 
HETATM 10894 O O   . HOH S 4 .   ? -13.278 35.786  29.100  1.00 142.21 ? 4405 HOH D O   1 
HETATM 10895 O O   . HOH S 4 .   ? -2.459  45.739  24.614  1.00 126.50 ? 4406 HOH D O   1 
HETATM 10896 O O   . HOH S 4 .   ? -17.965 18.091  3.571   1.00 107.34 ? 4407 HOH D O   1 
HETATM 10897 O O   . HOH S 4 .   ? -26.289 32.578  49.558  1.00 100.56 ? 4408 HOH D O   1 
HETATM 10898 O O   . HOH S 4 .   ? -30.105 51.721  51.562  1.00 73.14  ? 4409 HOH D O   1 
HETATM 10899 O O   . HOH S 4 .   ? -27.591 34.856  33.982  1.00 112.68 ? 4410 HOH D O   1 
HETATM 10900 O O   . HOH S 4 .   ? -22.552 52.223  10.018  1.00 76.71  ? 4411 HOH D O   1 
HETATM 10901 O O   . HOH S 4 .   ? -17.837 17.948  15.893  1.00 54.10  ? 4412 HOH D O   1 
HETATM 10902 O O   . HOH S 4 .   ? -13.223 41.195  37.806  1.00 114.87 ? 4413 HOH D O   1 
HETATM 10903 O O   . HOH S 4 .   ? -7.317  34.571  53.946  1.00 54.99  ? 4414 HOH D O   1 
HETATM 10904 O O   . HOH S 4 .   ? -32.351 43.789  26.968  1.00 111.62 ? 4415 HOH D O   1 
HETATM 10905 O O   . HOH S 4 .   ? -7.579  30.000  43.444  1.00 51.90  ? 4416 HOH D O   1 
HETATM 10906 O O   . HOH S 4 .   ? -19.263 34.764  35.095  1.00 109.37 ? 4417 HOH D O   1 
HETATM 10907 O O   . HOH S 4 .   ? -21.353 30.908  29.069  1.00 155.31 ? 4418 HOH D O   1 
HETATM 10908 O O   . HOH S 4 .   ? -3.204  36.595  24.610  1.00 177.94 ? 4419 HOH D O   1 
HETATM 10909 O O   . HOH S 4 .   ? -25.318 24.462  33.164  1.00 51.55  ? 4420 HOH D O   1 
HETATM 10910 O O   . HOH S 4 .   ? -13.693 37.758  36.486  1.00 108.52 ? 4421 HOH D O   1 
HETATM 10911 O O   . HOH S 4 .   ? -17.513 51.494  57.923  1.00 67.77  ? 4422 HOH D O   1 
HETATM 10912 O O   . HOH S 4 .   ? -22.933 51.466  57.956  1.00 87.07  ? 4423 HOH D O   1 
HETATM 10913 O O   . HOH S 4 .   ? -20.561 47.866  33.416  1.00 46.71  ? 4424 HOH D O   1 
HETATM 10914 O O   . HOH S 4 .   ? -27.379 26.112  0.996   1.00 113.42 ? 4425 HOH D O   1 
HETATM 10915 O O   . HOH S 4 .   ? -21.102 38.031  58.930  1.00 43.04  ? 4426 HOH D O   1 
HETATM 10916 O O   . HOH T 4 .   ? 12.261  47.687  -25.077 1.00 21.30  ? 5302 HOH E O   1 
HETATM 10917 O O   . HOH T 4 .   ? 37.212  26.808  3.799   1.00 74.24  ? 5303 HOH E O   1 
HETATM 10918 O O   . HOH T 4 .   ? 31.076  32.742  -9.869  1.00 42.75  ? 5304 HOH E O   1 
HETATM 10919 O O   . HOH T 4 .   ? 16.902  21.133  -16.125 1.00 19.42  ? 5305 HOH E O   1 
HETATM 10920 O O   . HOH T 4 .   ? 54.659  24.436  -0.054  1.00 30.09  ? 5306 HOH E O   1 
HETATM 10921 O O   . HOH T 4 .   ? 18.734  32.839  -4.099  1.00 54.85  ? 5307 HOH E O   1 
HETATM 10922 O O   . HOH T 4 .   ? 44.837  32.832  -12.068 1.00 68.81  ? 5308 HOH E O   1 
HETATM 10923 O O   . HOH T 4 .   ? 13.877  24.357  -14.292 1.00 50.46  ? 5309 HOH E O   1 
HETATM 10924 O O   . HOH T 4 .   ? 18.885  29.779  -4.042  1.00 165.41 ? 5310 HOH E O   1 
HETATM 10925 O O   . HOH T 4 .   ? 30.627  22.002  -5.091  1.00 61.03  ? 5311 HOH E O   1 
HETATM 10926 O O   . HOH T 4 .   ? 28.614  29.235  -3.481  1.00 45.87  ? 5312 HOH E O   1 
HETATM 10927 O O   . HOH T 4 .   ? 38.409  32.447  -7.971  1.00 85.61  ? 5313 HOH E O   1 
HETATM 10928 O O   . HOH T 4 .   ? 24.350  58.299  -19.054 1.00 55.28  ? 5314 HOH E O   1 
HETATM 10929 O O   . HOH T 4 .   ? 24.598  46.582  -17.135 1.00 159.99 ? 5315 HOH E O   1 
HETATM 10930 O O   . HOH T 4 .   ? 16.697  33.905  -7.058  1.00 74.74  ? 5316 HOH E O   1 
HETATM 10931 O O   . HOH T 4 .   ? 7.960   22.644  -16.734 1.00 62.97  ? 5317 HOH E O   1 
HETATM 10932 O O   . HOH T 4 .   ? 17.942  19.489  -20.887 1.00 54.50  ? 5318 HOH E O   1 
HETATM 10933 O O   . HOH T 4 .   ? 10.084  45.244  -0.496  1.00 19.68  ? 5319 HOH E O   1 
HETATM 10934 O O   . HOH T 4 .   ? 26.644  37.110  4.147   1.00 121.22 ? 5320 HOH E O   1 
HETATM 10935 O O   . HOH T 4 .   ? 49.826  41.166  8.449   1.00 61.46  ? 5321 HOH E O   1 
HETATM 10936 O O   . HOH T 4 .   ? 9.207   20.516  -22.185 1.00 32.26  ? 5322 HOH E O   1 
HETATM 10937 O O   . HOH T 4 .   ? 7.033   52.874  -24.982 1.00 57.30  ? 5323 HOH E O   1 
HETATM 10938 O O   . HOH T 4 .   ? 5.191   47.696  -18.513 1.00 49.64  ? 5324 HOH E O   1 
HETATM 10939 O O   . HOH T 4 .   ? 14.570  52.053  -24.651 1.00 47.23  ? 5325 HOH E O   1 
HETATM 10940 O O   . HOH T 4 .   ? 35.394  24.194  8.443   1.00 85.69  ? 5326 HOH E O   1 
HETATM 10941 O O   . HOH T 4 .   ? 32.173  19.881  4.926   1.00 44.25  ? 5327 HOH E O   1 
HETATM 10942 O O   . HOH T 4 .   ? 29.198  33.596  -6.594  1.00 186.86 ? 5328 HOH E O   1 
HETATM 10943 O O   . HOH T 4 .   ? 39.745  39.486  1.592   1.00 117.98 ? 5329 HOH E O   1 
HETATM 10944 O O   . HOH T 4 .   ? 11.505  40.470  1.375   1.00 45.33  ? 5330 HOH E O   1 
HETATM 10945 O O   . HOH T 4 .   ? 35.156  39.760  9.872   1.00 41.42  ? 5331 HOH E O   1 
HETATM 10946 O O   . HOH T 4 .   ? 3.833   46.923  -14.982 1.00 60.39  ? 5332 HOH E O   1 
HETATM 10947 O O   . HOH T 4 .   ? 24.001  29.827  -8.889  1.00 62.76  ? 5333 HOH E O   1 
HETATM 10948 O O   . HOH T 4 .   ? 18.135  35.777  11.912  1.00 51.74  ? 5334 HOH E O   1 
HETATM 10949 O O   . HOH T 4 .   ? 30.323  11.340  -3.677  1.00 64.68  ? 5335 HOH E O   1 
HETATM 10950 O O   . HOH T 4 .   ? 12.130  20.378  -22.432 1.00 26.92  ? 5336 HOH E O   1 
HETATM 10951 O O   . HOH T 4 .   ? 30.361  42.828  8.814   1.00 62.42  ? 5337 HOH E O   1 
HETATM 10952 O O   . HOH T 4 .   ? 34.358  20.352  -8.063  1.00 76.96  ? 5338 HOH E O   1 
HETATM 10953 O O   . HOH T 4 .   ? 16.233  44.262  -23.655 1.00 87.80  ? 5339 HOH E O   1 
HETATM 10954 O O   . HOH T 4 .   ? 36.369  31.767  8.114   1.00 35.68  ? 5340 HOH E O   1 
HETATM 10955 O O   . HOH T 4 .   ? 7.019   29.737  -26.159 1.00 105.95 ? 5341 HOH E O   1 
HETATM 10956 O O   . HOH T 4 .   ? 33.071  53.196  -22.940 1.00 61.72  ? 5342 HOH E O   1 
HETATM 10957 O O   . HOH T 4 .   ? 39.831  26.979  -13.258 1.00 75.02  ? 5343 HOH E O   1 
HETATM 10958 O O   . HOH T 4 .   ? 36.230  49.538  6.080   1.00 46.51  ? 5344 HOH E O   1 
HETATM 10959 O O   . HOH T 4 .   ? 54.299  17.044  3.624   1.00 73.38  ? 5345 HOH E O   1 
HETATM 10960 O O   . HOH T 4 .   ? 32.723  36.877  9.158   1.00 86.40  ? 5346 HOH E O   1 
HETATM 10961 O O   . HOH T 4 .   ? 16.434  50.813  -22.416 1.00 69.89  ? 5347 HOH E O   1 
HETATM 10962 O O   . HOH T 4 .   ? 46.427  41.170  7.188   1.00 84.40  ? 5348 HOH E O   1 
HETATM 10963 O O   . HOH T 4 .   ? 9.843   42.340  0.038   1.00 60.79  ? 5349 HOH E O   1 
HETATM 10964 O O   . HOH T 4 .   ? 7.242   44.635  -1.707  1.00 58.61  ? 5350 HOH E O   1 
HETATM 10965 O O   . HOH T 4 .   ? 15.406  36.655  13.160  1.00 61.84  ? 5351 HOH E O   1 
HETATM 10966 O O   . HOH T 4 .   ? 15.890  48.110  -12.885 1.00 78.51  ? 5352 HOH E O   1 
HETATM 10967 O O   . HOH T 4 .   ? 29.158  42.757  5.930   1.00 81.13  ? 5353 HOH E O   1 
HETATM 10968 O O   . HOH T 4 .   ? 26.813  58.333  -20.662 1.00 64.74  ? 5354 HOH E O   1 
HETATM 10969 O O   . HOH T 4 .   ? 10.437  41.013  4.397   1.00 43.11  ? 5355 HOH E O   1 
HETATM 10970 O O   . HOH T 4 .   ? 16.040  18.875  -18.227 1.00 67.48  ? 5356 HOH E O   1 
HETATM 10971 O O   . HOH T 4 .   ? 22.970  29.882  10.560  1.00 101.99 ? 5357 HOH E O   1 
HETATM 10972 O O   . HOH T 4 .   ? 11.129  26.783  -12.532 1.00 154.71 ? 5358 HOH E O   1 
HETATM 10973 O O   . HOH T 4 .   ? 3.475   45.611  -19.144 1.00 66.09  ? 5359 HOH E O   1 
HETATM 10974 O O   . HOH T 4 .   ? 28.410  32.680  9.561   1.00 109.69 ? 5360 HOH E O   1 
HETATM 10975 O O   . HOH T 4 .   ? 34.229  40.281  7.054   1.00 69.09  ? 5361 HOH E O   1 
HETATM 10976 O O   . HOH T 4 .   ? 33.701  16.789  5.718   1.00 83.33  ? 5362 HOH E O   1 
HETATM 10977 O O   . HOH T 4 .   ? 13.058  46.039  -27.389 1.00 47.57  ? 5363 HOH E O   1 
HETATM 10978 O O   . HOH T 4 .   ? 22.594  56.226  -20.516 1.00 60.68  ? 5364 HOH E O   1 
HETATM 10979 O O   . HOH T 4 .   ? 30.823  19.871  7.582   1.00 46.66  ? 5365 HOH E O   1 
HETATM 10980 O O   . HOH T 4 .   ? 31.474  44.562  -23.162 1.00 57.33  ? 5366 HOH E O   1 
HETATM 10981 O O   . HOH T 4 .   ? 39.246  17.587  -8.716  1.00 53.93  ? 5367 HOH E O   1 
HETATM 10982 O O   . HOH T 4 .   ? 42.877  39.397  -9.588  1.00 42.99  ? 5368 HOH E O   1 
HETATM 10983 O O   . HOH T 4 .   ? 51.011  29.849  -9.461  1.00 69.55  ? 5369 HOH E O   1 
HETATM 10984 O O   . HOH T 4 .   ? 32.141  42.259  6.177   1.00 61.83  ? 5370 HOH E O   1 
HETATM 10985 O O   . HOH T 4 .   ? 51.969  39.880  4.803   1.00 64.00  ? 5371 HOH E O   1 
HETATM 10986 O O   . HOH T 4 .   ? 13.641  25.071  -7.680  1.00 90.39  ? 5372 HOH E O   1 
HETATM 10987 O O   . HOH T 4 .   ? 55.848  26.747  -5.639  1.00 69.52  ? 5373 HOH E O   1 
HETATM 10988 O O   . HOH T 4 .   ? 53.851  28.405  12.507  1.00 70.70  ? 5374 HOH E O   1 
HETATM 10989 O O   . HOH T 4 .   ? 27.695  16.988  -5.739  1.00 50.38  ? 5375 HOH E O   1 
HETATM 10990 O O   . HOH T 4 .   ? 47.784  32.287  -11.241 1.00 70.13  ? 5376 HOH E O   1 
HETATM 10991 O O   . HOH T 4 .   ? 39.090  21.675  5.266   1.00 38.35  ? 5377 HOH E O   1 
HETATM 10992 O O   . HOH T 4 .   ? 38.002  26.637  1.090   1.00 58.14  ? 5378 HOH E O   1 
HETATM 10993 O O   . HOH T 4 .   ? 28.913  13.737  1.683   1.00 48.03  ? 5379 HOH E O   1 
HETATM 10994 O O   . HOH T 4 .   ? 41.246  26.805  -16.050 1.00 61.56  ? 5380 HOH E O   1 
HETATM 10995 O O   . HOH T 4 .   ? 31.715  16.630  7.987   1.00 82.34  ? 5381 HOH E O   1 
HETATM 10996 O O   . HOH T 4 .   ? 13.549  41.036  3.895   1.00 140.67 ? 5382 HOH E O   1 
HETATM 10997 O O   . HOH T 4 .   ? 28.620  45.111  -22.369 1.00 193.37 ? 5383 HOH E O   1 
HETATM 10998 O O   . HOH T 4 .   ? 46.658  44.409  6.036   1.00 61.53  ? 5384 HOH E O   1 
HETATM 10999 O O   . HOH T 4 .   ? 14.193  42.768  -27.760 1.00 39.47  ? 5385 HOH E O   1 
HETATM 11000 O O   . HOH T 4 .   ? 3.757   26.860  -19.733 1.00 115.44 ? 5386 HOH E O   1 
HETATM 11001 O O   . HOH T 4 .   ? 12.103  46.801  -8.391  1.00 63.76  ? 5387 HOH E O   1 
HETATM 11002 O O   . HOH T 4 .   ? 36.815  41.322  3.167   1.00 117.73 ? 5388 HOH E O   1 
HETATM 11003 O O   . HOH T 4 .   ? 36.076  17.857  -8.137  1.00 137.75 ? 5389 HOH E O   1 
HETATM 11004 O O   . HOH T 4 .   ? 7.521   39.893  4.807   1.00 64.73  ? 5390 HOH E O   1 
HETATM 11005 O O   . HOH T 4 .   ? 36.916  48.565  -4.049  1.00 70.05  ? 5391 HOH E O   1 
HETATM 11006 O O   . HOH T 4 .   ? 28.021  54.586  -18.527 1.00 57.57  ? 5392 HOH E O   1 
HETATM 11007 O O   . HOH T 4 .   ? 24.905  16.430  -5.064  1.00 58.46  ? 5393 HOH E O   1 
HETATM 11008 O O   . HOH T 4 .   ? 4.290   43.602  -0.956  1