data_2GTP
# 
_entry.id   2GTP 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2GTP         
RCSB  RCSB037537   
WWPDB D_1000037537 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2GTP 
_pdbx_database_status.recvd_initial_deposition_date   2006-04-28 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Soundararajan, M.'                    1  
'Turnbull, A.P.'                       2  
'Ugochukwu, E.'                        3  
'Gorrec, F.'                           4  
'von Delft, F.'                        5  
'Weigelt, J.'                          6  
'Edwards, A.'                          7  
'Arrowsmith, C.'                       8  
'Sundstrom, M.'                        9  
'Doyle, D.A.'                          10 
'Structural Genomics Consortium (SGC)' 11 
# 
_citation.id                        primary 
_citation.title                     
'Structural diversity in the RGS domain and its interaction with heterotrimeric G protein alpha-subunits.' 
_citation.journal_abbrev            Proc.Natl.Acad.Sci.Usa 
_citation.journal_volume            105 
_citation.page_first                6457 
_citation.page_last                 6462 
_citation.year                      2008 
_citation.journal_id_ASTM           PNASA6 
_citation.country                   US 
_citation.journal_id_ISSN           0027-8424 
_citation.journal_id_CSD            0040 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   18434541 
_citation.pdbx_database_id_DOI      10.1073/pnas.0801508105 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Soundararajan, M.' 1  
primary 'Willard, F.S.'     2  
primary 'Kimple, A.J.'      3  
primary 'Turnbull, A.P.'    4  
primary 'Ball, L.J.'        5  
primary 'Schoch, G.A.'      6  
primary 'Gileadi, C.'       7  
primary 'Fedorov, O.Y.'     8  
primary 'Dowler, E.F.'      9  
primary 'Higman, V.A.'      10 
primary 'Hutsell, S.Q.'     11 
primary 'Sundstrom, M.'     12 
primary 'Doyle, D.A.'       13 
primary 'Siderovski, D.P.'  14 
# 
_cell.entry_id           2GTP 
_cell.length_a           90.451 
_cell.length_b           102.904 
_cell.length_c           128.761 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         2GTP 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Guanine nucleotide-binding protein G(i), alpha-1 subunit' 37031.219 2   ? ? ? ? 
2 polymer     man 'Regulator of G-protein signaling 1'                       16575.793 2   ? ? ? ? 
3 non-polymer syn 'TETRAFLUOROALUMINATE ION'                                 102.975   2   ? ? ? ? 
4 non-polymer syn 'MAGNESIUM ION'                                            24.305    2   ? ? ? ? 
5 non-polymer syn "GUANOSINE-5'-DIPHOSPHATE"                                 443.201   2   ? ? ? ? 
6 water       nat water                                                      18.015    134 ? ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'Adenylate cyclase-inhibiting G alpha protein'                      
2 'RGS1, Early response protein 1R20, B-cell activation protein BL34' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;REVKLLLLGAGESGKSTIVKQMKIIHEAGYSEEECKQYKAVVYSNTIQSIIAIIRAMGRLKIDFGDSARADDARQLFVLA
GAAEEGFMTAELAGVIKRLWKDSGVQACFNRSREYQLNDSAAYYLNDLDRIAQPNYIPTQQDVLRTRVKTTGIVETHFTF
KDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILFLNKK
DLFEEKIKKSPLTICYPEYAGSNTYEEAAAYIQCQFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKDC
GLF
;
;REVKLLLLGAGESGKSTIVKQMKIIHEAGYSEEECKQYKAVVYSNTIQSIIAIIRAMGRLKIDFGDSARADDARQLFVLA
GAAEEGFMTAELAGVIKRLWKDSGVQACFNRSREYQLNDSAAYYLNDLDRIAQPNYIPTQQDVLRTRVKTTGIVETHFTF
KDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILFLNKK
DLFEEKIKKSPLTICYPEYAGSNTYEEAAAYIQCQFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKDC
GLF
;
A,B ? 
2 'polypeptide(L)' no no 
;SMSGMKSSKSKDVLSAAEVMQWSQSLEKLLANQTGQNVFGSFLKSEFSEENIEFWLACEDYKKTESDLLPCKAEEIYKAF
VHSDAAKQINIDFRTRESTAKKIKAPTPTCFDEAQKVIYTLMEKDSYPRFLKSDIYLNLLNDLQA
;
;SMSGMKSSKSKDVLSAAEVMQWSQSLEKLLANQTGQNVFGSFLKSEFSEENIEFWLACEDYKKTESDLLPCKAEEIYKAF
VHSDAAKQINIDFRTRESTAKKIKAPTPTCFDEAQKVIYTLMEKDSYPRFLKSDIYLNLLNDLQA
;
C,D ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ARG n 
1 2   GLU n 
1 3   VAL n 
1 4   LYS n 
1 5   LEU n 
1 6   LEU n 
1 7   LEU n 
1 8   LEU n 
1 9   GLY n 
1 10  ALA n 
1 11  GLY n 
1 12  GLU n 
1 13  SER n 
1 14  GLY n 
1 15  LYS n 
1 16  SER n 
1 17  THR n 
1 18  ILE n 
1 19  VAL n 
1 20  LYS n 
1 21  GLN n 
1 22  MET n 
1 23  LYS n 
1 24  ILE n 
1 25  ILE n 
1 26  HIS n 
1 27  GLU n 
1 28  ALA n 
1 29  GLY n 
1 30  TYR n 
1 31  SER n 
1 32  GLU n 
1 33  GLU n 
1 34  GLU n 
1 35  CYS n 
1 36  LYS n 
1 37  GLN n 
1 38  TYR n 
1 39  LYS n 
1 40  ALA n 
1 41  VAL n 
1 42  VAL n 
1 43  TYR n 
1 44  SER n 
1 45  ASN n 
1 46  THR n 
1 47  ILE n 
1 48  GLN n 
1 49  SER n 
1 50  ILE n 
1 51  ILE n 
1 52  ALA n 
1 53  ILE n 
1 54  ILE n 
1 55  ARG n 
1 56  ALA n 
1 57  MET n 
1 58  GLY n 
1 59  ARG n 
1 60  LEU n 
1 61  LYS n 
1 62  ILE n 
1 63  ASP n 
1 64  PHE n 
1 65  GLY n 
1 66  ASP n 
1 67  SER n 
1 68  ALA n 
1 69  ARG n 
1 70  ALA n 
1 71  ASP n 
1 72  ASP n 
1 73  ALA n 
1 74  ARG n 
1 75  GLN n 
1 76  LEU n 
1 77  PHE n 
1 78  VAL n 
1 79  LEU n 
1 80  ALA n 
1 81  GLY n 
1 82  ALA n 
1 83  ALA n 
1 84  GLU n 
1 85  GLU n 
1 86  GLY n 
1 87  PHE n 
1 88  MET n 
1 89  THR n 
1 90  ALA n 
1 91  GLU n 
1 92  LEU n 
1 93  ALA n 
1 94  GLY n 
1 95  VAL n 
1 96  ILE n 
1 97  LYS n 
1 98  ARG n 
1 99  LEU n 
1 100 TRP n 
1 101 LYS n 
1 102 ASP n 
1 103 SER n 
1 104 GLY n 
1 105 VAL n 
1 106 GLN n 
1 107 ALA n 
1 108 CYS n 
1 109 PHE n 
1 110 ASN n 
1 111 ARG n 
1 112 SER n 
1 113 ARG n 
1 114 GLU n 
1 115 TYR n 
1 116 GLN n 
1 117 LEU n 
1 118 ASN n 
1 119 ASP n 
1 120 SER n 
1 121 ALA n 
1 122 ALA n 
1 123 TYR n 
1 124 TYR n 
1 125 LEU n 
1 126 ASN n 
1 127 ASP n 
1 128 LEU n 
1 129 ASP n 
1 130 ARG n 
1 131 ILE n 
1 132 ALA n 
1 133 GLN n 
1 134 PRO n 
1 135 ASN n 
1 136 TYR n 
1 137 ILE n 
1 138 PRO n 
1 139 THR n 
1 140 GLN n 
1 141 GLN n 
1 142 ASP n 
1 143 VAL n 
1 144 LEU n 
1 145 ARG n 
1 146 THR n 
1 147 ARG n 
1 148 VAL n 
1 149 LYS n 
1 150 THR n 
1 151 THR n 
1 152 GLY n 
1 153 ILE n 
1 154 VAL n 
1 155 GLU n 
1 156 THR n 
1 157 HIS n 
1 158 PHE n 
1 159 THR n 
1 160 PHE n 
1 161 LYS n 
1 162 ASP n 
1 163 LEU n 
1 164 HIS n 
1 165 PHE n 
1 166 LYS n 
1 167 MET n 
1 168 PHE n 
1 169 ASP n 
1 170 VAL n 
1 171 GLY n 
1 172 GLY n 
1 173 GLN n 
1 174 ARG n 
1 175 SER n 
1 176 GLU n 
1 177 ARG n 
1 178 LYS n 
1 179 LYS n 
1 180 TRP n 
1 181 ILE n 
1 182 HIS n 
1 183 CYS n 
1 184 PHE n 
1 185 GLU n 
1 186 GLY n 
1 187 VAL n 
1 188 THR n 
1 189 ALA n 
1 190 ILE n 
1 191 ILE n 
1 192 PHE n 
1 193 CYS n 
1 194 VAL n 
1 195 ALA n 
1 196 LEU n 
1 197 SER n 
1 198 ASP n 
1 199 TYR n 
1 200 ASP n 
1 201 LEU n 
1 202 VAL n 
1 203 LEU n 
1 204 ALA n 
1 205 GLU n 
1 206 ASP n 
1 207 GLU n 
1 208 GLU n 
1 209 MET n 
1 210 ASN n 
1 211 ARG n 
1 212 MET n 
1 213 HIS n 
1 214 GLU n 
1 215 SER n 
1 216 MET n 
1 217 LYS n 
1 218 LEU n 
1 219 PHE n 
1 220 ASP n 
1 221 SER n 
1 222 ILE n 
1 223 CYS n 
1 224 ASN n 
1 225 ASN n 
1 226 LYS n 
1 227 TRP n 
1 228 PHE n 
1 229 THR n 
1 230 ASP n 
1 231 THR n 
1 232 SER n 
1 233 ILE n 
1 234 ILE n 
1 235 LEU n 
1 236 PHE n 
1 237 LEU n 
1 238 ASN n 
1 239 LYS n 
1 240 LYS n 
1 241 ASP n 
1 242 LEU n 
1 243 PHE n 
1 244 GLU n 
1 245 GLU n 
1 246 LYS n 
1 247 ILE n 
1 248 LYS n 
1 249 LYS n 
1 250 SER n 
1 251 PRO n 
1 252 LEU n 
1 253 THR n 
1 254 ILE n 
1 255 CYS n 
1 256 TYR n 
1 257 PRO n 
1 258 GLU n 
1 259 TYR n 
1 260 ALA n 
1 261 GLY n 
1 262 SER n 
1 263 ASN n 
1 264 THR n 
1 265 TYR n 
1 266 GLU n 
1 267 GLU n 
1 268 ALA n 
1 269 ALA n 
1 270 ALA n 
1 271 TYR n 
1 272 ILE n 
1 273 GLN n 
1 274 CYS n 
1 275 GLN n 
1 276 PHE n 
1 277 GLU n 
1 278 ASP n 
1 279 LEU n 
1 280 ASN n 
1 281 LYS n 
1 282 ARG n 
1 283 LYS n 
1 284 ASP n 
1 285 THR n 
1 286 LYS n 
1 287 GLU n 
1 288 ILE n 
1 289 TYR n 
1 290 THR n 
1 291 HIS n 
1 292 PHE n 
1 293 THR n 
1 294 CYS n 
1 295 ALA n 
1 296 THR n 
1 297 ASP n 
1 298 THR n 
1 299 LYS n 
1 300 ASN n 
1 301 VAL n 
1 302 GLN n 
1 303 PHE n 
1 304 VAL n 
1 305 PHE n 
1 306 ASP n 
1 307 ALA n 
1 308 VAL n 
1 309 THR n 
1 310 ASP n 
1 311 VAL n 
1 312 ILE n 
1 313 ILE n 
1 314 LYS n 
1 315 ASN n 
1 316 ASN n 
1 317 LEU n 
1 318 LYS n 
1 319 ASP n 
1 320 CYS n 
1 321 GLY n 
1 322 LEU n 
1 323 PHE n 
2 1   SER n 
2 2   MET n 
2 3   SER n 
2 4   GLY n 
2 5   MET n 
2 6   LYS n 
2 7   SER n 
2 8   SER n 
2 9   LYS n 
2 10  SER n 
2 11  LYS n 
2 12  ASP n 
2 13  VAL n 
2 14  LEU n 
2 15  SER n 
2 16  ALA n 
2 17  ALA n 
2 18  GLU n 
2 19  VAL n 
2 20  MET n 
2 21  GLN n 
2 22  TRP n 
2 23  SER n 
2 24  GLN n 
2 25  SER n 
2 26  LEU n 
2 27  GLU n 
2 28  LYS n 
2 29  LEU n 
2 30  LEU n 
2 31  ALA n 
2 32  ASN n 
2 33  GLN n 
2 34  THR n 
2 35  GLY n 
2 36  GLN n 
2 37  ASN n 
2 38  VAL n 
2 39  PHE n 
2 40  GLY n 
2 41  SER n 
2 42  PHE n 
2 43  LEU n 
2 44  LYS n 
2 45  SER n 
2 46  GLU n 
2 47  PHE n 
2 48  SER n 
2 49  GLU n 
2 50  GLU n 
2 51  ASN n 
2 52  ILE n 
2 53  GLU n 
2 54  PHE n 
2 55  TRP n 
2 56  LEU n 
2 57  ALA n 
2 58  CYS n 
2 59  GLU n 
2 60  ASP n 
2 61  TYR n 
2 62  LYS n 
2 63  LYS n 
2 64  THR n 
2 65  GLU n 
2 66  SER n 
2 67  ASP n 
2 68  LEU n 
2 69  LEU n 
2 70  PRO n 
2 71  CYS n 
2 72  LYS n 
2 73  ALA n 
2 74  GLU n 
2 75  GLU n 
2 76  ILE n 
2 77  TYR n 
2 78  LYS n 
2 79  ALA n 
2 80  PHE n 
2 81  VAL n 
2 82  HIS n 
2 83  SER n 
2 84  ASP n 
2 85  ALA n 
2 86  ALA n 
2 87  LYS n 
2 88  GLN n 
2 89  ILE n 
2 90  ASN n 
2 91  ILE n 
2 92  ASP n 
2 93  PHE n 
2 94  ARG n 
2 95  THR n 
2 96  ARG n 
2 97  GLU n 
2 98  SER n 
2 99  THR n 
2 100 ALA n 
2 101 LYS n 
2 102 LYS n 
2 103 ILE n 
2 104 LYS n 
2 105 ALA n 
2 106 PRO n 
2 107 THR n 
2 108 PRO n 
2 109 THR n 
2 110 CYS n 
2 111 PHE n 
2 112 ASP n 
2 113 GLU n 
2 114 ALA n 
2 115 GLN n 
2 116 LYS n 
2 117 VAL n 
2 118 ILE n 
2 119 TYR n 
2 120 THR n 
2 121 LEU n 
2 122 MET n 
2 123 GLU n 
2 124 LYS n 
2 125 ASP n 
2 126 SER n 
2 127 TYR n 
2 128 PRO n 
2 129 ARG n 
2 130 PHE n 
2 131 LEU n 
2 132 LYS n 
2 133 SER n 
2 134 ASP n 
2 135 ILE n 
2 136 TYR n 
2 137 LEU n 
2 138 ASN n 
2 139 LEU n 
2 140 LEU n 
2 141 ASN n 
2 142 ASP n 
2 143 LEU n 
2 144 GLN n 
2 145 ALA n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? human Homo GNAI1 ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 Escherichia ? ? ? ? ? 
'BL21(DE3)R3' ? ? ? ? ? ? ? PLASMID ? ? ? pNIC28-Bsa4 ? ? 
2 1 sample ? ? ? human Homo RGS1  ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 Escherichia ? ? ? ? ? 
'BL21(DE3)R3' ? ? ? ? ? ? ? PLASMID ? ? ? pNIC28-Bsa4 ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP GNAI1_HUMAN P63096 1 
;REVKLLLLGAGESGKSTIVKQMKIIHEAGYSEEECKQYKAVVYSNTIQSIIAIIRAMGRLKIDFGDSARADDARQLFVLA
GAAEEGFMTAELAGVIKRLWKDSGVQACFNRSREYQLNDSAAYYLNDLDRIAQPNYIPTQQDVLRTRVKTTGIVETHFTF
KDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILFLNKK
DLFEEKIKKSPLTICYPEYAGSNTYEEAAAYIQCQFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKDC
GLF
;
31 ? 
2 UNP RGS1_HUMAN  Q08116 2 
;SGMKSSKSKDVLSAAEVMQWSQSLEKLLANQTGQNVFGSFLKSEFSEENIEFWLACEDYKKTESDLLPCKAEEIYKAFVH
SDAAKQINIDFRTRESTAKKIKAPTPTCFDEAQKVIYTLMEKDSYPRFLKSDIYLNLLNDLQA
;
50 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2GTP A 1 ? 323 ? P63096 31 ? 353 ? 32 354 
2 1 2GTP B 1 ? 323 ? P63096 31 ? 353 ? 32 354 
3 2 2GTP C 3 ? 145 ? Q08116 50 ? 192 ? 50 192 
4 2 2GTP D 3 ? 145 ? Q08116 50 ? 192 ? 50 192 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
3 2GTP SER C 1 ? UNP Q08116 ? ? 'CLONING ARTIFACT' 48 1 
3 2GTP MET C 2 ? UNP Q08116 ? ? 'CLONING ARTIFACT' 49 2 
4 2GTP SER D 1 ? UNP Q08116 ? ? 'CLONING ARTIFACT' 48 3 
4 2GTP MET D 2 ? UNP Q08116 ? ? 'CLONING ARTIFACT' 49 4 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                    ? 'C3 H7 N O2'        89.093  
ALF non-polymer         . 'TETRAFLUOROALUMINATE ION' ? 'Al F4 -1'          102.975 
ARG 'L-peptide linking' y ARGININE                   ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                 ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'            ? 'C4 H7 N O4'        133.103 
CYS 'L-peptide linking' y CYSTEINE                   ? 'C3 H7 N O2 S'      121.158 
GDP 'RNA linking'       n "GUANOSINE-5'-DIPHOSPHATE" ? 'C10 H15 N5 O11 P2' 443.201 
GLN 'L-peptide linking' y GLUTAMINE                  ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'            ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                    ? 'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                  ? 'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                      ? 'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                 ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                    ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                     ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                 ? 'C5 H11 N O2 S'     149.211 
MG  non-polymer         . 'MAGNESIUM ION'            ? 'Mg 2'              24.305  
PHE 'L-peptide linking' y PHENYLALANINE              ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                    ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                     ? 'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                  ? 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                 ? 'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                   ? 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                     ? 'C5 H11 N O2'       117.146 
# 
_exptl.entry_id          2GTP 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.79 
_exptl_crystal.density_percent_sol   55.98 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pdbx_details    
'0.2M NaNO3, 0.1M bis-Tris propane, pH 6.5, 20 % PEG3350, 10 % Ethylene glycol, VAPOR DIFFUSION, SITTING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 225 mm CCD' 
_diffrn_detector.pdbx_collection_date   2006-03-04 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Si (111)' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9789 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SLS BEAMLINE X10SA' 
_diffrn_source.pdbx_synchrotron_site       SLS 
_diffrn_source.pdbx_synchrotron_beamline   X10SA 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.9789 
# 
_reflns.entry_id                     2GTP 
_reflns.observed_criterion_sigma_I   0 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             50 
_reflns.d_resolution_high            2.55 
_reflns.number_obs                   39406 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         98.5 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.550 
_reflns_shell.d_res_low              2.64 
_reflns_shell.percent_possible_all   99 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 2GTP 
_refine.ls_number_reflns_obs                     37274 
_refine.ls_number_reflns_all                     37274 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             46.7 
_refine.ls_d_res_high                            2.55 
_refine.ls_percent_reflns_obs                    98.42 
_refine.ls_R_factor_obs                          0.22839 
_refine.ls_R_factor_all                          0.22839 
_refine.ls_R_factor_R_work                       0.2259 
_refine.ls_R_factor_R_free                       0.27562 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  1976 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.922 
_refine.correlation_coeff_Fo_to_Fc_free          0.903 
_refine.B_iso_mean                               27.466 
_refine.aniso_B[1][1]                            1.52 
_refine.aniso_B[2][2]                            -0.44 
_refine.aniso_B[3][3]                            -1.08 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      'PDB IDs 2BV1 and 1Y3A used as starting models for RGS1 and GNAI1 respectively.' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.545 
_refine.pdbx_overall_ESU_R_Free                  0.316 
_refine.overall_SU_ML                            0.223 
_refine.overall_SU_B                             19.661 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        7007 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         68 
_refine_hist.number_atoms_solvent             134 
_refine_hist.number_atoms_total               7209 
_refine_hist.d_res_high                       2.55 
_refine_hist.d_res_low                        46.7 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d         0.012  0.022  ? 7207  'X-RAY DIFFRACTION' ? 
r_bond_other_d           0.003  0.020  ? 4720  'X-RAY DIFFRACTION' ? 
r_angle_refined_deg      1.354  1.956  ? 9772  'X-RAY DIFFRACTION' ? 
r_angle_other_deg        0.964  3.000  ? 11517 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg   5.606  5.000  ? 886   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg   38.469 24.809 ? 341   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg   15.847 15.000 ? 1215  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg   19.067 15.000 ? 33    'X-RAY DIFFRACTION' ? 
r_chiral_restr           0.075  0.200  ? 1104  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined     0.004  0.020  ? 8028  'X-RAY DIFFRACTION' ? 
r_gen_planes_other       0.002  0.020  ? 1491  'X-RAY DIFFRACTION' ? 
r_nbd_refined            0.215  0.200  ? 1614  'X-RAY DIFFRACTION' ? 
r_nbd_other              0.186  0.200  ? 4817  'X-RAY DIFFRACTION' ? 
r_nbtor_refined          0.185  0.200  ? 3645  'X-RAY DIFFRACTION' ? 
r_nbtor_other            0.088  0.200  ? 3714  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined    0.135  0.200  ? 215   'X-RAY DIFFRACTION' ? 
r_metal_ion_refined      0.211  0.200  ? 2     'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined   0.108  0.200  ? 13    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other     0.236  0.200  ? 34    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined 0.214  0.200  ? 3     'X-RAY DIFFRACTION' ? 
r_mcbond_it              0.391  1.500  ? 4571  'X-RAY DIFFRACTION' ? 
r_mcbond_other           0.105  1.500  ? 1794  'X-RAY DIFFRACTION' ? 
r_mcangle_it             0.663  2.000  ? 7128  'X-RAY DIFFRACTION' ? 
r_scbond_it              1.164  3.000  ? 3052  'X-RAY DIFFRACTION' ? 
r_scangle_it             1.720  4.500  ? 2644  'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_restr_ncs.dom_id 
_refine_ls_restr_ncs.pdbx_auth_asym_id 
_refine_ls_restr_ncs.pdbx_number 
_refine_ls_restr_ncs.rms_dev_position 
_refine_ls_restr_ncs.weight_position 
_refine_ls_restr_ncs.pdbx_type 
_refine_ls_restr_ncs.pdbx_ens_id 
_refine_ls_restr_ncs.pdbx_refine_id 
_refine_ls_restr_ncs.pdbx_ordinal 
_refine_ls_restr_ncs.ncs_model_details 
_refine_ls_restr_ncs.rms_dev_B_iso 
_refine_ls_restr_ncs.weight_B_iso 
1 A 1842 0.07 0.05 'tight positional'  1 'X-RAY DIFFRACTION' 1 ? ? ? 
1 C 732  0.03 0.05 'tight positional'  2 'X-RAY DIFFRACTION' 2 ? ? ? 
1 A 2204 0.49 0.50 'medium positional' 1 'X-RAY DIFFRACTION' 3 ? ? ? 
1 C 846  0.27 0.50 'medium positional' 2 'X-RAY DIFFRACTION' 4 ? ? ? 
1 A 1842 0.17 0.50 'tight thermal'     1 'X-RAY DIFFRACTION' 5 ? ? ? 
1 C 732  0.15 0.50 'tight thermal'     2 'X-RAY DIFFRACTION' 6 ? ? ? 
1 A 2204 0.45 2.00 'medium thermal'    1 'X-RAY DIFFRACTION' 7 ? ? ? 
1 C 846  0.29 2.00 'medium thermal'    2 'X-RAY DIFFRACTION' 8 ? ? ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.550 
_refine_ls_shell.d_res_low                        2.61 
_refine_ls_shell.number_reflns_R_work             2741 
_refine_ls_shell.R_factor_R_work                  0.292 
_refine_ls_shell.percent_reflns_obs               98.76 
_refine_ls_shell.R_factor_R_free                  0.356 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             136 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
loop_
_struct_ncs_dom.pdbx_ens_id 
_struct_ncs_dom.id 
_struct_ncs_dom.details 
1 1 A 
1 2 B 
2 1 C 
2 2 D 
# 
loop_
_struct_ncs_dom_lim.dom_id 
_struct_ncs_dom_lim.beg_auth_asym_id 
_struct_ncs_dom_lim.beg_auth_seq_id 
_struct_ncs_dom_lim.end_auth_asym_id 
_struct_ncs_dom_lim.end_auth_seq_id 
_struct_ncs_dom_lim.pdbx_component_id 
_struct_ncs_dom_lim.pdbx_refine_code 
_struct_ncs_dom_lim.beg_label_asym_id 
_struct_ncs_dom_lim.beg_label_comp_id 
_struct_ncs_dom_lim.beg_label_seq_id 
_struct_ncs_dom_lim.beg_label_alt_id 
_struct_ncs_dom_lim.end_label_asym_id 
_struct_ncs_dom_lim.end_label_comp_id 
_struct_ncs_dom_lim.end_label_seq_id 
_struct_ncs_dom_lim.end_label_alt_id 
_struct_ncs_dom_lim.pdbx_ens_id 
_struct_ncs_dom_lim.selection_details 
1 A 32 A 348 1 2 A ARG 1  ? A LEU 317 ? 1 ? 
2 B 32 B 348 1 2 B ARG 1  ? B LEU 317 ? 1 ? 
1 C 69 C 191 1 2 C TRP 22 ? C GLN 144 ? 2 ? 
2 D 69 D 191 1 2 D TRP 22 ? D GLN 144 ? 2 ? 
# 
loop_
_struct_ncs_ens.id 
_struct_ncs_ens.details 
1 ? 
2 ? 
# 
_struct.entry_id                  2GTP 
_struct.title                     'Crystal structure of the heterodimeric complex of human RGS1 and activated Gi alpha 1' 
_struct.pdbx_descriptor           'Guanine nucleotide-binding protein G(i), alpha-1 subunit, Regulator of G-protein signaling 1' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2GTP 
_struct_keywords.pdbx_keywords   'SIGNALING PROTEIN' 
_struct_keywords.text            
;G protein signalling, RGS, heterotrimeric G protein, signalling complex, Structural Genomics, Structural Genomics Consortium, SGC, SIGNALING PROTEIN
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 4 ? 
G N N 5 ? 
H N N 3 ? 
I N N 4 ? 
J N N 5 ? 
K N N 6 ? 
L N N 6 ? 
M N N 6 ? 
N N N 6 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLY A 14  ? GLU A 27  ? GLY A 45  GLU A 58  1 ? 14 
HELX_P HELX_P2  2  SER A 31  ? GLN A 37  ? SER A 62  GLN A 68  1 ? 7  
HELX_P HELX_P3  3  TYR A 38  ? LYS A 61  ? TYR A 69  LYS A 92  1 ? 24 
HELX_P HELX_P4  4  ALA A 68  ? ALA A 80  ? ALA A 99  ALA A 111 1 ? 13 
HELX_P HELX_P5  5  THR A 89  ? ASP A 102 ? THR A 120 ASP A 133 1 ? 14 
HELX_P HELX_P6  6  ASP A 102 ? ARG A 111 ? ASP A 133 ARG A 142 1 ? 10 
HELX_P HELX_P7  7  SER A 112 ? TYR A 115 ? SER A 143 TYR A 146 5 ? 4  
HELX_P HELX_P8  8  SER A 120 ? ASP A 127 ? SER A 151 ASP A 158 1 ? 8  
HELX_P HELX_P9  9  ASP A 127 ? ALA A 132 ? ASP A 158 ALA A 163 1 ? 6  
HELX_P HELX_P10 10 THR A 139 ? ARG A 145 ? THR A 170 ARG A 176 1 ? 7  
HELX_P HELX_P11 11 GLN A 173 ? LYS A 178 ? GLN A 204 LYS A 209 1 ? 6  
HELX_P HELX_P12 12 LYS A 179 ? PHE A 184 ? LYS A 210 PHE A 215 5 ? 6  
HELX_P HELX_P13 13 SER A 197 ? ASP A 200 ? SER A 228 ASP A 231 5 ? 4  
HELX_P HELX_P14 14 ARG A 211 ? ASN A 224 ? ARG A 242 ASN A 255 1 ? 14 
HELX_P HELX_P15 15 ASN A 225 ? THR A 229 ? ASN A 256 THR A 260 5 ? 5  
HELX_P HELX_P16 16 LYS A 239 ? ILE A 247 ? LYS A 270 ILE A 278 1 ? 9  
HELX_P HELX_P17 17 PRO A 251 ? CYS A 255 ? PRO A 282 CYS A 286 5 ? 5  
HELX_P HELX_P18 18 THR A 264 ? ASP A 278 ? THR A 295 ASP A 309 1 ? 15 
HELX_P HELX_P19 19 ASP A 297 ? ASN A 316 ? ASP A 328 ASN A 347 1 ? 20 
HELX_P HELX_P20 20 GLY B 14  ? GLU B 27  ? GLY B 45  GLU B 58  1 ? 14 
HELX_P HELX_P21 21 SER B 31  ? GLN B 37  ? SER B 62  GLN B 68  1 ? 7  
HELX_P HELX_P22 22 TYR B 38  ? LEU B 60  ? TYR B 69  LEU B 91  1 ? 23 
HELX_P HELX_P23 23 ALA B 68  ? GLY B 81  ? ALA B 99  GLY B 112 1 ? 14 
HELX_P HELX_P24 24 THR B 89  ? ASP B 102 ? THR B 120 ASP B 133 1 ? 14 
HELX_P HELX_P25 25 ASP B 102 ? ARG B 111 ? ASP B 133 ARG B 142 1 ? 10 
HELX_P HELX_P26 26 SER B 112 ? TYR B 115 ? SER B 143 TYR B 146 5 ? 4  
HELX_P HELX_P27 27 SER B 120 ? ASP B 127 ? SER B 151 ASP B 158 1 ? 8  
HELX_P HELX_P28 28 ASP B 127 ? ALA B 132 ? ASP B 158 ALA B 163 1 ? 6  
HELX_P HELX_P29 29 THR B 139 ? ARG B 145 ? THR B 170 ARG B 176 1 ? 7  
HELX_P HELX_P30 30 GLN B 173 ? LYS B 178 ? GLN B 204 LYS B 209 1 ? 6  
HELX_P HELX_P31 31 LYS B 179 ? PHE B 184 ? LYS B 210 PHE B 215 5 ? 6  
HELX_P HELX_P32 32 SER B 197 ? LEU B 201 ? SER B 228 LEU B 232 5 ? 5  
HELX_P HELX_P33 33 ASN B 210 ? ASN B 224 ? ASN B 241 ASN B 255 1 ? 15 
HELX_P HELX_P34 34 ASN B 225 ? THR B 229 ? ASN B 256 THR B 260 5 ? 5  
HELX_P HELX_P35 35 LYS B 239 ? ILE B 247 ? LYS B 270 ILE B 278 1 ? 9  
HELX_P HELX_P36 36 PRO B 251 ? CYS B 255 ? PRO B 282 CYS B 286 5 ? 5  
HELX_P HELX_P37 37 THR B 264 ? ASP B 278 ? THR B 295 ASP B 309 1 ? 15 
HELX_P HELX_P38 38 ASP B 297 ? ASN B 316 ? ASP B 328 ASN B 347 1 ? 20 
HELX_P HELX_P39 39 SER C 15  ? TRP C 22  ? SER C 62  TRP C 69  1 ? 8  
HELX_P HELX_P40 40 SER C 25  ? ASN C 32  ? SER C 72  ASN C 79  1 ? 8  
HELX_P HELX_P41 41 ASN C 32  ? GLU C 46  ? ASN C 79  GLU C 93  1 ? 15 
HELX_P HELX_P42 42 GLU C 49  ? THR C 64  ? GLU C 96  THR C 111 1 ? 16 
HELX_P HELX_P43 43 GLU C 65  ? ASP C 67  ? GLU C 112 ASP C 114 5 ? 3  
HELX_P HELX_P44 44 LEU C 68  ? VAL C 81  ? LEU C 115 VAL C 128 1 ? 14 
HELX_P HELX_P45 45 ASP C 92  ? LYS C 104 ? ASP C 139 LYS C 151 1 ? 13 
HELX_P HELX_P46 46 PHE C 111 ? ASP C 125 ? PHE C 158 ASP C 172 1 ? 15 
HELX_P HELX_P47 47 ASP C 125 ? LEU C 131 ? ASP C 172 LEU C 178 1 ? 7  
HELX_P HELX_P48 48 SER C 133 ? LEU C 143 ? SER C 180 LEU C 190 1 ? 11 
HELX_P HELX_P49 49 ALA D 16  ? GLN D 21  ? ALA D 63  GLN D 68  1 ? 6  
HELX_P HELX_P50 50 TRP D 22  ? GLN D 24  ? TRP D 69  GLN D 71  5 ? 3  
HELX_P HELX_P51 51 SER D 25  ? ASN D 32  ? SER D 72  ASN D 79  1 ? 8  
HELX_P HELX_P52 52 ASN D 32  ? GLU D 46  ? ASN D 79  GLU D 93  1 ? 15 
HELX_P HELX_P53 53 GLU D 49  ? THR D 64  ? GLU D 96  THR D 111 1 ? 16 
HELX_P HELX_P54 54 GLU D 65  ? ASP D 67  ? GLU D 112 ASP D 114 5 ? 3  
HELX_P HELX_P55 55 LEU D 68  ? VAL D 81  ? LEU D 115 VAL D 128 1 ? 14 
HELX_P HELX_P56 56 ASP D 92  ? ILE D 103 ? ASP D 139 ILE D 150 1 ? 12 
HELX_P HELX_P57 57 PHE D 111 ? ASP D 125 ? PHE D 158 ASP D 172 1 ? 15 
HELX_P HELX_P58 58 ASP D 125 ? LEU D 131 ? ASP D 172 LEU D 178 1 ? 7  
HELX_P HELX_P59 59 SER D 133 ? LEU D 143 ? SER D 180 LEU D 190 1 ? 11 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? E ALF . AL ? ? ? 1_555 G GDP .   O2B ? ? A ALF 355 A GDP 402 1_555 ? ? ? ? ? ? ? 1.947 ? 
metalc2  metalc ? ? E ALF . AL ? ? ? 1_555 A ARG 147 NH2 ? ? A ALF 355 A ARG 178 1_555 ? ? ? ? ? ? ? 3.644 ? 
metalc3  metalc ? ? E ALF . AL ? ? ? 1_555 A ARG 147 NH1 ? ? A ALF 355 A ARG 178 1_555 ? ? ? ? ? ? ? 3.649 ? 
metalc4  metalc ? ? E ALF . AL ? ? ? 1_555 F MG  .   MG  ? ? A ALF 355 A MG  401 1_555 ? ? ? ? ? ? ? 3.565 ? 
metalc5  metalc ? ? E ALF . AL ? ? ? 1_555 A GLU 12  N   ? ? A ALF 355 A GLU 43  1_555 ? ? ? ? ? ? ? 3.553 ? 
metalc6  metalc ? ? E ALF . AL ? ? ? 1_555 K HOH .   O   ? ? A ALF 355 A HOH 405 1_555 ? ? ? ? ? ? ? 2.093 ? 
metalc7  metalc ? ? F MG  . MG ? ? ? 1_555 A THR 150 OG1 ? ? A MG  401 A THR 181 1_555 ? ? ? ? ? ? ? 2.203 ? 
metalc8  metalc ? ? F MG  . MG ? ? ? 1_555 G GDP .   O1B ? ? A MG  401 A GDP 402 1_555 ? ? ? ? ? ? ? 1.814 ? 
metalc9  metalc ? ? F MG  . MG ? ? ? 1_555 E ALF .   F1  ? ? A MG  401 A ALF 355 1_555 ? ? ? ? ? ? ? 2.117 ? 
metalc10 metalc ? ? F MG  . MG ? ? ? 1_555 K HOH .   O   ? ? A MG  401 A HOH 403 1_555 ? ? ? ? ? ? ? 2.179 ? 
metalc11 metalc ? ? F MG  . MG ? ? ? 1_555 K HOH .   O   ? ? A MG  401 A HOH 404 1_555 ? ? ? ? ? ? ? 1.996 ? 
metalc12 metalc ? ? F MG  . MG ? ? ? 1_555 A SER 16  OG  ? ? A MG  401 A SER 47  1_555 ? ? ? ? ? ? ? 1.998 ? 
metalc13 metalc ? ? H ALF . AL ? ? ? 1_555 J GDP .   O2B ? ? B ALF 355 B GDP 403 1_555 ? ? ? ? ? ? ? 1.881 ? 
metalc14 metalc ? ? H ALF . AL ? ? ? 1_555 I MG  .   MG  ? ? B ALF 355 B MG  402 1_555 ? ? ? ? ? ? ? 3.290 ? 
metalc15 metalc ? ? H ALF . AL ? ? ? 1_555 L HOH .   O   ? ? B ALF 355 B HOH 406 1_555 ? ? ? ? ? ? ? 2.191 ? 
metalc16 metalc ? ? I MG  . MG ? ? ? 1_555 B SER 16  OG  ? ? B MG  402 B SER 47  1_555 ? ? ? ? ? ? ? 2.494 ? 
metalc17 metalc ? ? I MG  . MG ? ? ? 1_555 B THR 150 OG1 ? ? B MG  402 B THR 181 1_555 ? ? ? ? ? ? ? 2.333 ? 
metalc18 metalc ? ? I MG  . MG ? ? ? 1_555 L HOH .   O   ? ? B MG  402 B HOH 404 1_555 ? ? ? ? ? ? ? 2.083 ? 
metalc19 metalc ? ? I MG  . MG ? ? ? 1_555 L HOH .   O   ? ? B MG  402 B HOH 405 1_555 ? ? ? ? ? ? ? 2.140 ? 
metalc20 metalc ? ? I MG  . MG ? ? ? 1_555 J GDP .   O2B ? ? B MG  402 B GDP 403 1_555 ? ? ? ? ? ? ? 2.856 ? 
metalc21 metalc ? ? I MG  . MG ? ? ? 1_555 J GDP .   O1B ? ? B MG  402 B GDP 403 1_555 ? ? ? ? ? ? ? 1.748 ? 
metalc22 metalc ? ? I MG  . MG ? ? ? 1_555 H ALF .   F3  ? ? B MG  402 B ALF 355 1_555 ? ? ? ? ? ? ? 2.067 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          ALA 
_struct_mon_prot_cis.label_seq_id           83 
_struct_mon_prot_cis.label_asym_id          B 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           ALA 
_struct_mon_prot_cis.auth_seq_id            114 
_struct_mon_prot_cis.auth_asym_id           B 
_struct_mon_prot_cis.pdbx_label_comp_id_2   GLU 
_struct_mon_prot_cis.pdbx_label_seq_id_2    84 
_struct_mon_prot_cis.pdbx_label_asym_id_2   B 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    GLU 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     115 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    B 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       13.42 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 6 ? 
B ? 2 ? 
C ? 6 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? parallel      
A 3 4 ? parallel      
A 4 5 ? parallel      
A 5 6 ? parallel      
B 1 2 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? parallel      
C 3 4 ? parallel      
C 4 5 ? parallel      
C 5 6 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ILE A 153 ? PHE A 160 ? ILE A 184 PHE A 191 
A 2 LEU A 163 ? VAL A 170 ? LEU A 194 VAL A 201 
A 3 GLU A 2   ? GLY A 9   ? GLU A 33  GLY A 40  
A 4 ALA A 189 ? ALA A 195 ? ALA A 220 ALA A 226 
A 5 SER A 232 ? ASN A 238 ? SER A 263 ASN A 269 
A 6 ILE A 288 ? PHE A 292 ? ILE A 319 PHE A 323 
B 1 VAL A 202 ? LEU A 203 ? VAL A 233 LEU A 234 
B 2 ASP A 206 ? ASN A 210 ? ASP A 237 ASN A 241 
C 1 ILE B 153 ? PHE B 160 ? ILE B 184 PHE B 191 
C 2 LEU B 163 ? VAL B 170 ? LEU B 194 VAL B 201 
C 3 GLU B 2   ? GLY B 9   ? GLU B 33  GLY B 40  
C 4 ALA B 189 ? ALA B 195 ? ALA B 220 ALA B 226 
C 5 SER B 232 ? ASN B 238 ? SER B 263 ASN B 269 
C 6 ILE B 288 ? PHE B 292 ? ILE B 319 PHE B 323 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N PHE A 158 ? N PHE A 189 O PHE A 165 ? O PHE A 196 
A 2 3 O PHE A 168 ? O PHE A 199 N LEU A 7   ? N LEU A 38  
A 3 4 N LEU A 8   ? N LEU A 39  O CYS A 193 ? O CYS A 224 
A 4 5 N PHE A 192 ? N PHE A 223 O ILE A 234 ? O ILE A 265 
A 5 6 N LEU A 235 ? N LEU A 266 O HIS A 291 ? O HIS A 322 
B 1 2 N LEU A 203 ? N LEU A 234 O MET A 209 ? O MET A 240 
C 1 2 N THR B 156 ? N THR B 187 O MET B 167 ? O MET B 198 
C 2 3 O PHE B 168 ? O PHE B 199 N LEU B 7   ? N LEU B 38  
C 3 4 N LEU B 8   ? N LEU B 39  O CYS B 193 ? O CYS B 224 
C 4 5 N PHE B 192 ? N PHE B 223 O ILE B 234 ? O ILE B 265 
C 5 6 N LEU B 237 ? N LEU B 268 O HIS B 291 ? O HIS B 322 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE ALF A 355' 
AC2 Software ? ? ? ? 15 'BINDING SITE FOR RESIDUE ALF B 355' 
AC3 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG A 401'  
AC4 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG B 402'  
AC5 Software ? ? ? ? 21 'BINDING SITE FOR RESIDUE GDP A 402' 
AC6 Software ? ? ? ? 21 'BINDING SITE FOR RESIDUE GDP B 403' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 12 GLY A 11  ? GLY A 42  . ? 1_555 ? 
2  AC1 12 GLU A 12  ? GLU A 43  . ? 1_555 ? 
3  AC1 12 LYS A 15  ? LYS A 46  . ? 1_555 ? 
4  AC1 12 ARG A 147 ? ARG A 178 . ? 1_555 ? 
5  AC1 12 LYS A 149 ? LYS A 180 . ? 1_555 ? 
6  AC1 12 THR A 150 ? THR A 181 . ? 1_555 ? 
7  AC1 12 GLY A 172 ? GLY A 203 . ? 1_555 ? 
8  AC1 12 GLN A 173 ? GLN A 204 . ? 1_555 ? 
9  AC1 12 MG  F .   ? MG  A 401 . ? 1_555 ? 
10 AC1 12 GDP G .   ? GDP A 402 . ? 1_555 ? 
11 AC1 12 HOH K .   ? HOH A 404 . ? 1_555 ? 
12 AC1 12 HOH K .   ? HOH A 405 . ? 1_555 ? 
13 AC2 15 GLY B 11  ? GLY B 42  . ? 1_555 ? 
14 AC2 15 GLU B 12  ? GLU B 43  . ? 1_555 ? 
15 AC2 15 LYS B 15  ? LYS B 46  . ? 1_555 ? 
16 AC2 15 ARG B 147 ? ARG B 178 . ? 1_555 ? 
17 AC2 15 VAL B 148 ? VAL B 179 . ? 1_555 ? 
18 AC2 15 LYS B 149 ? LYS B 180 . ? 1_555 ? 
19 AC2 15 THR B 150 ? THR B 181 . ? 1_555 ? 
20 AC2 15 VAL B 170 ? VAL B 201 . ? 1_555 ? 
21 AC2 15 GLY B 172 ? GLY B 203 . ? 1_555 ? 
22 AC2 15 GLN B 173 ? GLN B 204 . ? 1_555 ? 
23 AC2 15 MG  I .   ? MG  B 402 . ? 1_555 ? 
24 AC2 15 GDP J .   ? GDP B 403 . ? 1_555 ? 
25 AC2 15 HOH L .   ? HOH B 404 . ? 1_555 ? 
26 AC2 15 HOH L .   ? HOH B 405 . ? 1_555 ? 
27 AC2 15 HOH L .   ? HOH B 406 . ? 1_555 ? 
28 AC3 6  SER A 16  ? SER A 47  . ? 1_555 ? 
29 AC3 6  THR A 150 ? THR A 181 . ? 1_555 ? 
30 AC3 6  ALF E .   ? ALF A 355 . ? 1_555 ? 
31 AC3 6  GDP G .   ? GDP A 402 . ? 1_555 ? 
32 AC3 6  HOH K .   ? HOH A 403 . ? 1_555 ? 
33 AC3 6  HOH K .   ? HOH A 404 . ? 1_555 ? 
34 AC4 6  SER B 16  ? SER B 47  . ? 1_555 ? 
35 AC4 6  THR B 150 ? THR B 181 . ? 1_555 ? 
36 AC4 6  ALF H .   ? ALF B 355 . ? 1_555 ? 
37 AC4 6  GDP J .   ? GDP B 403 . ? 1_555 ? 
38 AC4 6  HOH L .   ? HOH B 404 . ? 1_555 ? 
39 AC4 6  HOH L .   ? HOH B 405 . ? 1_555 ? 
40 AC5 21 GLU A 12  ? GLU A 43  . ? 1_555 ? 
41 AC5 21 SER A 13  ? SER A 44  . ? 1_555 ? 
42 AC5 21 GLY A 14  ? GLY A 45  . ? 1_555 ? 
43 AC5 21 LYS A 15  ? LYS A 46  . ? 1_555 ? 
44 AC5 21 SER A 16  ? SER A 47  . ? 1_555 ? 
45 AC5 21 THR A 17  ? THR A 48  . ? 1_555 ? 
46 AC5 21 LEU A 144 ? LEU A 175 . ? 1_555 ? 
47 AC5 21 ARG A 145 ? ARG A 176 . ? 1_555 ? 
48 AC5 21 THR A 146 ? THR A 177 . ? 1_555 ? 
49 AC5 21 ARG A 147 ? ARG A 178 . ? 1_555 ? 
50 AC5 21 ASN A 238 ? ASN A 269 . ? 1_555 ? 
51 AC5 21 LYS A 239 ? LYS A 270 . ? 1_555 ? 
52 AC5 21 ASP A 241 ? ASP A 272 . ? 1_555 ? 
53 AC5 21 LEU A 242 ? LEU A 273 . ? 1_555 ? 
54 AC5 21 CYS A 294 ? CYS A 325 . ? 1_555 ? 
55 AC5 21 ALA A 295 ? ALA A 326 . ? 1_555 ? 
56 AC5 21 THR A 296 ? THR A 327 . ? 1_555 ? 
57 AC5 21 ALF E .   ? ALF A 355 . ? 1_555 ? 
58 AC5 21 MG  F .   ? MG  A 401 . ? 1_555 ? 
59 AC5 21 HOH K .   ? HOH A 403 . ? 1_555 ? 
60 AC5 21 HOH K .   ? HOH A 404 . ? 1_555 ? 
61 AC6 21 GLU B 12  ? GLU B 43  . ? 1_555 ? 
62 AC6 21 SER B 13  ? SER B 44  . ? 1_555 ? 
63 AC6 21 GLY B 14  ? GLY B 45  . ? 1_555 ? 
64 AC6 21 LYS B 15  ? LYS B 46  . ? 1_555 ? 
65 AC6 21 SER B 16  ? SER B 47  . ? 1_555 ? 
66 AC6 21 THR B 17  ? THR B 48  . ? 1_555 ? 
67 AC6 21 LEU B 144 ? LEU B 175 . ? 1_555 ? 
68 AC6 21 ARG B 145 ? ARG B 176 . ? 1_555 ? 
69 AC6 21 THR B 146 ? THR B 177 . ? 1_555 ? 
70 AC6 21 ARG B 147 ? ARG B 178 . ? 1_555 ? 
71 AC6 21 ASN B 238 ? ASN B 269 . ? 1_555 ? 
72 AC6 21 LYS B 239 ? LYS B 270 . ? 1_555 ? 
73 AC6 21 ASP B 241 ? ASP B 272 . ? 1_555 ? 
74 AC6 21 LEU B 242 ? LEU B 273 . ? 1_555 ? 
75 AC6 21 CYS B 294 ? CYS B 325 . ? 1_555 ? 
76 AC6 21 ALA B 295 ? ALA B 326 . ? 1_555 ? 
77 AC6 21 THR B 296 ? THR B 327 . ? 1_555 ? 
78 AC6 21 ALF H .   ? ALF B 355 . ? 1_555 ? 
79 AC6 21 MG  I .   ? MG  B 402 . ? 1_555 ? 
80 AC6 21 HOH L .   ? HOH B 404 . ? 1_555 ? 
81 AC6 21 HOH L .   ? HOH B 405 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2GTP 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2GTP 
_atom_sites.fract_transf_matrix[1][1]   0.011056 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009718 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007766 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
AL 
C  
F  
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . ARG A 1 1   ? 11.276  56.939  31.984  1.00 35.60 ? 32  ARG A N     1 
ATOM   2    C  CA    . ARG A 1 1   ? 12.045  55.838  32.642  1.00 35.96 ? 32  ARG A CA    1 
ATOM   3    C  C     . ARG A 1 1   ? 11.866  54.492  31.913  1.00 35.67 ? 32  ARG A C     1 
ATOM   4    O  O     . ARG A 1 1   ? 11.435  53.485  32.501  1.00 35.62 ? 32  ARG A O     1 
ATOM   5    C  CB    . ARG A 1 1   ? 11.622  55.689  34.113  1.00 35.96 ? 32  ARG A CB    1 
ATOM   6    C  CG    . ARG A 1 1   ? 11.844  56.930  34.981  1.00 36.89 ? 32  ARG A CG    1 
ATOM   7    C  CD    . ARG A 1 1   ? 11.040  56.874  36.280  1.00 37.78 ? 32  ARG A CD    1 
ATOM   8    N  NE    . ARG A 1 1   ? 11.194  55.594  36.979  1.00 40.03 ? 32  ARG A NE    1 
ATOM   9    C  CZ    . ARG A 1 1   ? 12.134  55.316  37.887  1.00 41.14 ? 32  ARG A CZ    1 
ATOM   10   N  NH1   . ARG A 1 1   ? 13.043  56.224  38.233  1.00 42.30 ? 32  ARG A NH1   1 
ATOM   11   N  NH2   . ARG A 1 1   ? 12.172  54.111  38.454  1.00 40.68 ? 32  ARG A NH2   1 
ATOM   12   N  N     . GLU A 1 2   ? 12.219  54.472  30.632  1.00 35.68 ? 33  GLU A N     1 
ATOM   13   C  CA    . GLU A 1 2   ? 12.059  53.271  29.798  1.00 35.78 ? 33  GLU A CA    1 
ATOM   14   C  C     . GLU A 1 2   ? 13.262  52.315  29.899  1.00 35.40 ? 33  GLU A C     1 
ATOM   15   O  O     . GLU A 1 2   ? 14.394  52.748  30.055  1.00 35.48 ? 33  GLU A O     1 
ATOM   16   C  CB    . GLU A 1 2   ? 11.859  53.658  28.321  1.00 35.74 ? 33  GLU A CB    1 
ATOM   17   C  CG    . GLU A 1 2   ? 10.840  54.791  28.073  1.00 36.51 ? 33  GLU A CG    1 
ATOM   18   C  CD    . GLU A 1 2   ? 10.350  54.865  26.624  1.00 36.34 ? 33  GLU A CD    1 
ATOM   19   O  OE1   . GLU A 1 2   ? 10.977  54.243  25.740  1.00 36.16 ? 33  GLU A OE1   1 
ATOM   20   O  OE2   . GLU A 1 2   ? 9.322   55.541  26.376  1.00 36.96 ? 33  GLU A OE2   1 
ATOM   21   N  N     . VAL A 1 3   ? 13.004  51.012  29.799  1.00 34.86 ? 34  VAL A N     1 
ATOM   22   C  CA    . VAL A 1 3   ? 14.070  50.009  29.757  1.00 34.32 ? 34  VAL A CA    1 
ATOM   23   C  C     . VAL A 1 3   ? 13.908  49.159  28.503  1.00 34.11 ? 34  VAL A C     1 
ATOM   24   O  O     . VAL A 1 3   ? 12.912  48.462  28.335  1.00 34.32 ? 34  VAL A O     1 
ATOM   25   C  CB    . VAL A 1 3   ? 14.083  49.091  31.003  1.00 34.38 ? 34  VAL A CB    1 
ATOM   26   C  CG1   . VAL A 1 3   ? 15.124  47.956  30.854  1.00 32.27 ? 34  VAL A CG1   1 
ATOM   27   C  CG2   . VAL A 1 3   ? 14.363  49.917  32.243  1.00 34.73 ? 34  VAL A CG2   1 
ATOM   28   N  N     . LYS A 1 4   ? 14.878  49.230  27.608  1.00 33.97 ? 35  LYS A N     1 
ATOM   29   C  CA    . LYS A 1 4   ? 14.844  48.400  26.400  1.00 34.08 ? 35  LYS A CA    1 
ATOM   30   C  C     . LYS A 1 4   ? 15.583  47.103  26.677  1.00 34.26 ? 35  LYS A C     1 
ATOM   31   O  O     . LYS A 1 4   ? 16.791  47.103  26.891  1.00 34.13 ? 35  LYS A O     1 
ATOM   32   C  CB    . LYS A 1 4   ? 15.458  49.126  25.198  1.00 33.75 ? 35  LYS A CB    1 
ATOM   33   C  CG    . LYS A 1 4   ? 15.162  48.422  23.894  1.00 33.84 ? 35  LYS A CG    1 
ATOM   34   C  CD    . LYS A 1 4   ? 16.017  48.906  22.743  1.00 32.50 ? 35  LYS A CD    1 
ATOM   35   C  CE    . LYS A 1 4   ? 15.578  48.228  21.454  1.00 31.90 ? 35  LYS A CE    1 
ATOM   36   N  NZ    . LYS A 1 4   ? 16.076  48.921  20.239  1.00 30.08 ? 35  LYS A NZ    1 
ATOM   37   N  N     . LEU A 1 5   ? 14.828  46.009  26.671  1.00 34.98 ? 36  LEU A N     1 
ATOM   38   C  CA    . LEU A 1 5   ? 15.288  44.703  27.094  1.00 35.37 ? 36  LEU A CA    1 
ATOM   39   C  C     . LEU A 1 5   ? 15.242  43.742  25.934  1.00 35.39 ? 36  LEU A C     1 
ATOM   40   O  O     . LEU A 1 5   ? 14.216  43.610  25.275  1.00 35.36 ? 36  LEU A O     1 
ATOM   41   C  CB    . LEU A 1 5   ? 14.379  44.184  28.190  1.00 35.71 ? 36  LEU A CB    1 
ATOM   42   C  CG    . LEU A 1 5   ? 14.608  42.777  28.763  1.00 37.68 ? 36  LEU A CG    1 
ATOM   43   C  CD1   . LEU A 1 5   ? 16.077  42.505  29.066  1.00 38.63 ? 36  LEU A CD1   1 
ATOM   44   C  CD2   . LEU A 1 5   ? 13.745  42.614  30.049  1.00 36.32 ? 36  LEU A CD2   1 
ATOM   45   N  N     . LEU A 1 6   ? 16.366  43.069  25.686  1.00 35.48 ? 37  LEU A N     1 
ATOM   46   C  CA    . LEU A 1 6   ? 16.451  42.053  24.653  1.00 34.96 ? 37  LEU A CA    1 
ATOM   47   C  C     . LEU A 1 6   ? 16.557  40.650  25.267  1.00 35.72 ? 37  LEU A C     1 
ATOM   48   O  O     . LEU A 1 6   ? 17.433  40.362  26.111  1.00 35.50 ? 37  LEU A O     1 
ATOM   49   C  CB    . LEU A 1 6   ? 17.670  42.301  23.782  1.00 34.77 ? 37  LEU A CB    1 
ATOM   50   C  CG    . LEU A 1 6   ? 17.563  43.076  22.469  1.00 34.78 ? 37  LEU A CG    1 
ATOM   51   C  CD1   . LEU A 1 6   ? 16.579  44.242  22.488  1.00 34.28 ? 37  LEU A CD1   1 
ATOM   52   C  CD2   . LEU A 1 6   ? 18.959  43.541  22.088  1.00 33.98 ? 37  LEU A CD2   1 
ATOM   53   N  N     . LEU A 1 7   ? 15.659  39.773  24.837  1.00 35.87 ? 38  LEU A N     1 
ATOM   54   C  CA    . LEU A 1 7   ? 15.782  38.380  25.141  1.00 36.76 ? 38  LEU A CA    1 
ATOM   55   C  C     . LEU A 1 7   ? 16.459  37.687  23.959  1.00 36.02 ? 38  LEU A C     1 
ATOM   56   O  O     . LEU A 1 7   ? 15.836  37.499  22.911  1.00 36.47 ? 38  LEU A O     1 
ATOM   57   C  CB    . LEU A 1 7   ? 14.404  37.769  25.442  1.00 37.14 ? 38  LEU A CB    1 
ATOM   58   C  CG    . LEU A 1 7   ? 14.111  37.604  26.926  1.00 38.99 ? 38  LEU A CG    1 
ATOM   59   C  CD1   . LEU A 1 7   ? 13.804  38.961  27.553  1.00 39.62 ? 38  LEU A CD1   1 
ATOM   60   C  CD2   . LEU A 1 7   ? 12.926  36.596  27.106  1.00 39.17 ? 38  LEU A CD2   1 
ATOM   61   N  N     . LEU A 1 8   ? 17.720  37.300  24.149  1.00 35.38 ? 39  LEU A N     1 
ATOM   62   C  CA    . LEU A 1 8   ? 18.521  36.690  23.094  1.00 35.09 ? 39  LEU A CA    1 
ATOM   63   C  C     . LEU A 1 8   ? 19.069  35.364  23.576  1.00 35.03 ? 39  LEU A C     1 
ATOM   64   O  O     . LEU A 1 8   ? 19.096  35.068  24.773  1.00 36.14 ? 39  LEU A O     1 
ATOM   65   C  CB    . LEU A 1 8   ? 19.676  37.612  22.700  1.00 35.43 ? 39  LEU A CB    1 
ATOM   66   C  CG    . LEU A 1 8   ? 19.350  39.039  22.189  1.00 35.09 ? 39  LEU A CG    1 
ATOM   67   C  CD1   . LEU A 1 8   ? 20.653  39.811  21.932  1.00 33.22 ? 39  LEU A CD1   1 
ATOM   68   C  CD2   . LEU A 1 8   ? 18.491  39.006  20.924  1.00 33.33 ? 39  LEU A CD2   1 
ATOM   69   N  N     . GLY A 1 9   ? 19.528  34.575  22.637  1.00 34.66 ? 40  GLY A N     1 
ATOM   70   C  CA    . GLY A 1 9   ? 20.048  33.239  22.903  1.00 34.46 ? 40  GLY A CA    1 
ATOM   71   C  C     . GLY A 1 9   ? 19.811  32.399  21.663  1.00 33.34 ? 40  GLY A C     1 
ATOM   72   O  O     . GLY A 1 9   ? 19.039  32.803  20.821  1.00 33.48 ? 40  GLY A O     1 
ATOM   73   N  N     . ALA A 1 10  ? 20.468  31.253  21.552  1.00 33.25 ? 41  ALA A N     1 
ATOM   74   C  CA    . ALA A 1 10  ? 20.224  30.303  20.421  1.00 33.47 ? 41  ALA A CA    1 
ATOM   75   C  C     . ALA A 1 10  ? 18.822  29.656  20.459  1.00 33.50 ? 41  ALA A C     1 
ATOM   76   O  O     . ALA A 1 10  ? 18.093  29.744  21.454  1.00 33.20 ? 41  ALA A O     1 
ATOM   77   C  CB    . ALA A 1 10  ? 21.273  29.212  20.405  1.00 32.48 ? 41  ALA A CB    1 
ATOM   78   N  N     . GLY A 1 11  ? 18.462  29.002  19.366  1.00 33.95 ? 42  GLY A N     1 
ATOM   79   C  CA    . GLY A 1 11  ? 17.196  28.288  19.268  1.00 34.46 ? 42  GLY A CA    1 
ATOM   80   C  C     . GLY A 1 11  ? 16.943  27.404  20.478  1.00 34.96 ? 42  GLY A C     1 
ATOM   81   O  O     . GLY A 1 11  ? 17.840  26.695  20.913  1.00 35.19 ? 42  GLY A O     1 
ATOM   82   N  N     . GLU A 1 12  ? 15.729  27.457  21.019  1.00 35.26 ? 43  GLU A N     1 
ATOM   83   C  CA    . GLU A 1 12  ? 15.313  26.571  22.114  1.00 36.11 ? 43  GLU A CA    1 
ATOM   84   C  C     . GLU A 1 12  ? 16.053  26.750  23.450  1.00 35.85 ? 43  GLU A C     1 
ATOM   85   O  O     . GLU A 1 12  ? 16.158  25.800  24.225  1.00 36.48 ? 43  GLU A O     1 
ATOM   86   C  CB    . GLU A 1 12  ? 15.424  25.105  21.680  1.00 36.04 ? 43  GLU A CB    1 
ATOM   87   C  CG    . GLU A 1 12  ? 14.777  24.793  20.336  1.00 36.76 ? 43  GLU A CG    1 
ATOM   88   C  CD    . GLU A 1 12  ? 15.033  23.365  19.900  1.00 36.96 ? 43  GLU A CD    1 
ATOM   89   O  OE1   . GLU A 1 12  ? 15.078  22.474  20.791  1.00 37.43 ? 43  GLU A OE1   1 
ATOM   90   O  OE2   . GLU A 1 12  ? 15.195  23.149  18.674  1.00 36.92 ? 43  GLU A OE2   1 
ATOM   91   N  N     . SER A 1 13  ? 16.540  27.952  23.730  1.00 35.13 ? 44  SER A N     1 
ATOM   92   C  CA    . SER A 1 13  ? 17.261  28.189  24.965  1.00 34.74 ? 44  SER A CA    1 
ATOM   93   C  C     . SER A 1 13  ? 16.345  28.691  26.087  1.00 34.51 ? 44  SER A C     1 
ATOM   94   O  O     . SER A 1 13  ? 16.740  28.677  27.238  1.00 34.29 ? 44  SER A O     1 
ATOM   95   C  CB    . SER A 1 13  ? 18.495  29.111  24.751  1.00 34.90 ? 44  SER A CB    1 
ATOM   96   O  OG    . SER A 1 13  ? 18.313  30.138  23.786  1.00 35.28 ? 44  SER A OG    1 
ATOM   97   N  N     . GLY A 1 14  ? 15.127  29.117  25.751  1.00 34.47 ? 45  GLY A N     1 
ATOM   98   C  CA    . GLY A 1 14  ? 14.091  29.440  26.757  1.00 34.19 ? 45  GLY A CA    1 
ATOM   99   C  C     . GLY A 1 14  ? 13.568  30.863  26.757  1.00 34.43 ? 45  GLY A C     1 
ATOM   100  O  O     . GLY A 1 14  ? 12.910  31.289  27.710  1.00 34.53 ? 45  GLY A O     1 
ATOM   101  N  N     . LYS A 1 15  ? 13.833  31.598  25.677  1.00 34.46 ? 46  LYS A N     1 
ATOM   102  C  CA    . LYS A 1 15  ? 13.550  33.015  25.632  1.00 34.29 ? 46  LYS A CA    1 
ATOM   103  C  C     . LYS A 1 15  ? 12.048  33.240  25.727  1.00 33.57 ? 46  LYS A C     1 
ATOM   104  O  O     . LYS A 1 15  ? 11.597  34.051  26.517  1.00 33.62 ? 46  LYS A O     1 
ATOM   105  C  CB    . LYS A 1 15  ? 14.107  33.622  24.338  1.00 34.75 ? 46  LYS A CB    1 
ATOM   106  C  CG    . LYS A 1 15  ? 15.628  33.448  24.136  1.00 35.01 ? 46  LYS A CG    1 
ATOM   107  C  CD    . LYS A 1 15  ? 16.084  33.920  22.722  1.00 34.78 ? 46  LYS A CD    1 
ATOM   108  C  CE    . LYS A 1 15  ? 15.570  33.022  21.578  1.00 34.48 ? 46  LYS A CE    1 
ATOM   109  N  NZ    . LYS A 1 15  ? 16.251  31.686  21.515  1.00 34.38 ? 46  LYS A NZ    1 
ATOM   110  N  N     . SER A 1 16  ? 11.283  32.530  24.913  1.00 32.97 ? 47  SER A N     1 
ATOM   111  C  CA    . SER A 1 16  ? 9.816   32.680  24.911  1.00 33.01 ? 47  SER A CA    1 
ATOM   112  C  C     . SER A 1 16  ? 9.210   32.254  26.247  1.00 32.49 ? 47  SER A C     1 
ATOM   113  O  O     . SER A 1 16  ? 8.199   32.796  26.667  1.00 32.66 ? 47  SER A O     1 
ATOM   114  C  CB    . SER A 1 16  ? 9.139   31.878  23.761  1.00 32.79 ? 47  SER A CB    1 
ATOM   115  O  OG    . SER A 1 16  ? 9.663   32.281  22.438  1.00 32.74 ? 47  SER A OG    1 
ATOM   116  N  N     . THR A 1 17  ? 9.834   31.300  26.925  1.00 32.00 ? 48  THR A N     1 
ATOM   117  C  CA    . THR A 1 17  ? 9.343   30.885  28.230  1.00 31.66 ? 48  THR A CA    1 
ATOM   118  C  C     . THR A 1 17  ? 9.524   32.020  29.256  1.00 31.75 ? 48  THR A C     1 
ATOM   119  O  O     . THR A 1 17  ? 8.632   32.259  30.069  1.00 32.07 ? 48  THR A O     1 
ATOM   120  C  CB    . THR A 1 17  ? 10.034  29.599  28.699  1.00 31.92 ? 48  THR A CB    1 
ATOM   121  O  OG1   . THR A 1 17  ? 9.936   28.604  27.674  1.00 31.51 ? 48  THR A OG1   1 
ATOM   122  C  CG2   . THR A 1 17  ? 9.400   29.064  29.956  1.00 31.04 ? 48  THR A CG2   1 
ATOM   123  N  N     . ILE A 1 18  ? 10.658  32.733  29.227  1.00 31.22 ? 49  ILE A N     1 
ATOM   124  C  CA    . ILE A 1 18  ? 10.812  33.880  30.112  1.00 30.67 ? 49  ILE A CA    1 
ATOM   125  C  C     . ILE A 1 18  ? 9.793   34.941  29.790  1.00 30.59 ? 49  ILE A C     1 
ATOM   126  O  O     . ILE A 1 18  ? 9.238   35.551  30.712  1.00 30.94 ? 49  ILE A O     1 
ATOM   127  C  CB    . ILE A 1 18  ? 12.188  34.521  30.062  1.00 30.97 ? 49  ILE A CB    1 
ATOM   128  C  CG1   . ILE A 1 18  ? 13.237  33.549  30.597  1.00 30.58 ? 49  ILE A CG1   1 
ATOM   129  C  CG2   . ILE A 1 18  ? 12.206  35.825  30.880  1.00 29.84 ? 49  ILE A CG2   1 
ATOM   130  C  CD1   . ILE A 1 18  ? 14.034  32.940  29.479  1.00 32.55 ? 49  ILE A CD1   1 
ATOM   131  N  N     . VAL A 1 19  ? 9.511   35.141  28.501  1.00 29.77 ? 50  VAL A N     1 
ATOM   132  C  CA    . VAL A 1 19  ? 8.482   36.100  28.112  1.00 29.08 ? 50  VAL A CA    1 
ATOM   133  C  C     . VAL A 1 19  ? 7.151   35.690  28.747  1.00 29.12 ? 50  VAL A C     1 
ATOM   134  O  O     . VAL A 1 19  ? 6.468   36.539  29.324  1.00 29.13 ? 50  VAL A O     1 
ATOM   135  C  CB    . VAL A 1 19  ? 8.371   36.277  26.574  1.00 29.05 ? 50  VAL A CB    1 
ATOM   136  C  CG1   . VAL A 1 19  ? 7.110   37.013  26.195  1.00 27.71 ? 50  VAL A CG1   1 
ATOM   137  C  CG2   . VAL A 1 19  ? 9.590   37.016  26.028  1.00 27.83 ? 50  VAL A CG2   1 
ATOM   138  N  N     . LYS A 1 20  ? 6.798   34.406  28.686  1.00 28.81 ? 51  LYS A N     1 
ATOM   139  C  CA    . LYS A 1 20  ? 5.592   33.922  29.374  1.00 28.95 ? 51  LYS A CA    1 
ATOM   140  C  C     . LYS A 1 20  ? 5.616   34.238  30.861  1.00 28.76 ? 51  LYS A C     1 
ATOM   141  O  O     . LYS A 1 20  ? 4.611   34.702  31.404  1.00 28.23 ? 51  LYS A O     1 
ATOM   142  C  CB    . LYS A 1 20  ? 5.369   32.421  29.179  1.00 29.14 ? 51  LYS A CB    1 
ATOM   143  C  CG    . LYS A 1 20  ? 4.882   32.075  27.800  1.00 29.86 ? 51  LYS A CG    1 
ATOM   144  C  CD    . LYS A 1 20  ? 4.532   30.604  27.643  1.00 31.11 ? 51  LYS A CD    1 
ATOM   145  C  CE    . LYS A 1 20  ? 4.348   30.260  26.159  1.00 32.37 ? 51  LYS A CE    1 
ATOM   146  N  NZ    . LYS A 1 20  ? 5.285   29.163  25.753  1.00 34.70 ? 51  LYS A NZ    1 
ATOM   147  N  N     . GLN A 1 21  ? 6.749   34.008  31.523  1.00 28.99 ? 52  GLN A N     1 
ATOM   148  C  CA    . GLN A 1 21  ? 6.845   34.349  32.958  1.00 29.33 ? 52  GLN A CA    1 
ATOM   149  C  C     . GLN A 1 21  ? 6.605   35.846  33.197  1.00 29.50 ? 52  GLN A C     1 
ATOM   150  O  O     . GLN A 1 21  ? 5.955   36.237  34.165  1.00 29.67 ? 52  GLN A O     1 
ATOM   151  C  CB    . GLN A 1 21  ? 8.188   33.951  33.586  1.00 29.27 ? 52  GLN A CB    1 
ATOM   152  C  CG    . GLN A 1 21  ? 8.491   32.449  33.580  1.00 30.50 ? 52  GLN A CG    1 
ATOM   153  C  CD    . GLN A 1 21  ? 7.692   31.638  34.580  1.00 30.46 ? 52  GLN A CD    1 
ATOM   154  O  OE1   . GLN A 1 21  ? 6.720   32.105  35.170  1.00 30.82 ? 52  GLN A OE1   1 
ATOM   155  N  NE2   . GLN A 1 21  ? 8.103   30.407  34.772  1.00 31.27 ? 52  GLN A NE2   1 
ATOM   156  N  N     . MET A 1 22  ? 7.119   36.686  32.318  1.00 29.76 ? 53  MET A N     1 
ATOM   157  C  CA    . MET A 1 22  ? 6.844   38.113  32.432  1.00 30.53 ? 53  MET A CA    1 
ATOM   158  C  C     . MET A 1 22  ? 5.341   38.421  32.402  1.00 30.51 ? 53  MET A C     1 
ATOM   159  O  O     . MET A 1 22  ? 4.888   39.244  33.190  1.00 30.41 ? 53  MET A O     1 
ATOM   160  C  CB    . MET A 1 22  ? 7.584   38.918  31.349  1.00 30.93 ? 53  MET A CB    1 
ATOM   161  C  CG    . MET A 1 22  ? 9.120   38.900  31.457  1.00 31.65 ? 53  MET A CG    1 
ATOM   162  S  SD    . MET A 1 22  ? 9.801   39.108  33.125  1.00 37.76 ? 53  MET A SD    1 
ATOM   163  C  CE    . MET A 1 22  ? 9.730   37.451  33.784  1.00 33.35 ? 53  MET A CE    1 
ATOM   164  N  N     . LYS A 1 23  ? 4.577   37.752  31.533  1.00 30.86 ? 54  LYS A N     1 
ATOM   165  C  CA    . LYS A 1 23  ? 3.102   37.896  31.532  1.00 31.46 ? 54  LYS A CA    1 
ATOM   166  C  C     . LYS A 1 23  ? 2.497   37.429  32.862  1.00 31.57 ? 54  LYS A C     1 
ATOM   167  O  O     . LYS A 1 23  ? 1.634   38.100  33.410  1.00 32.01 ? 54  LYS A O     1 
ATOM   168  C  CB    . LYS A 1 23  ? 2.451   37.148  30.341  1.00 31.69 ? 54  LYS A CB    1 
ATOM   169  C  CG    . LYS A 1 23  ? 0.921   36.941  30.435  1.00 30.91 ? 54  LYS A CG    1 
ATOM   170  N  N     . ILE A 1 24  ? 2.981   36.312  33.392  1.00 31.84 ? 55  ILE A N     1 
ATOM   171  C  CA    . ILE A 1 24  ? 2.467   35.768  34.654  1.00 32.26 ? 55  ILE A CA    1 
ATOM   172  C  C     . ILE A 1 24  ? 2.790   36.683  35.857  1.00 32.46 ? 55  ILE A C     1 
ATOM   173  O  O     . ILE A 1 24  ? 1.904   37.081  36.598  1.00 32.56 ? 55  ILE A O     1 
ATOM   174  C  CB    . ILE A 1 24  ? 2.982   34.309  34.884  1.00 32.50 ? 55  ILE A CB    1 
ATOM   175  C  CG1   . ILE A 1 24  ? 2.436   33.360  33.795  1.00 32.52 ? 55  ILE A CG1   1 
ATOM   176  C  CG2   . ILE A 1 24  ? 2.559   33.773  36.243  1.00 31.65 ? 55  ILE A CG2   1 
ATOM   177  C  CD1   . ILE A 1 24  ? 3.157   32.029  33.735  1.00 32.24 ? 55  ILE A CD1   1 
ATOM   178  N  N     . ILE A 1 25  ? 4.050   37.049  36.023  1.00 32.78 ? 56  ILE A N     1 
ATOM   179  C  CA    . ILE A 1 25  ? 4.474   37.770  37.212  1.00 32.91 ? 56  ILE A CA    1 
ATOM   180  C  C     . ILE A 1 25  ? 3.941   39.209  37.205  1.00 33.95 ? 56  ILE A C     1 
ATOM   181  O  O     . ILE A 1 25  ? 3.389   39.686  38.195  1.00 33.42 ? 56  ILE A O     1 
ATOM   182  C  CB    . ILE A 1 25  ? 6.017   37.820  37.301  1.00 33.21 ? 56  ILE A CB    1 
ATOM   183  C  CG1   . ILE A 1 25  ? 6.611   36.406  37.421  1.00 33.03 ? 56  ILE A CG1   1 
ATOM   184  C  CG2   . ILE A 1 25  ? 6.467   38.670  38.479  1.00 33.01 ? 56  ILE A CG2   1 
ATOM   185  C  CD1   . ILE A 1 25  ? 8.131   36.385  37.343  1.00 32.23 ? 56  ILE A CD1   1 
ATOM   186  N  N     . HIS A 1 26  ? 4.099   39.887  36.069  1.00 35.18 ? 57  HIS A N     1 
ATOM   187  C  CA    . HIS A 1 26  ? 3.834   41.320  35.977  1.00 35.96 ? 57  HIS A CA    1 
ATOM   188  C  C     . HIS A 1 26  ? 2.448   41.672  35.442  1.00 37.15 ? 57  HIS A C     1 
ATOM   189  O  O     . HIS A 1 26  ? 1.929   42.727  35.774  1.00 36.88 ? 57  HIS A O     1 
ATOM   190  C  CB    . HIS A 1 26  ? 4.878   42.010  35.104  1.00 35.68 ? 57  HIS A CB    1 
ATOM   191  C  CG    . HIS A 1 26  ? 6.282   41.764  35.539  1.00 35.57 ? 57  HIS A CG    1 
ATOM   192  N  ND1   . HIS A 1 26  ? 6.706   41.958  36.835  1.00 36.22 ? 57  HIS A ND1   1 
ATOM   193  C  CD2   . HIS A 1 26  ? 7.363   41.342  34.850  1.00 36.45 ? 57  HIS A CD2   1 
ATOM   194  C  CE1   . HIS A 1 26  ? 7.984   41.651  36.931  1.00 36.11 ? 57  HIS A CE1   1 
ATOM   195  N  NE2   . HIS A 1 26  ? 8.406   41.272  35.738  1.00 37.79 ? 57  HIS A NE2   1 
ATOM   196  N  N     . GLU A 1 27  ? 1.868   40.817  34.597  1.00 38.65 ? 58  GLU A N     1 
ATOM   197  C  CA    . GLU A 1 27  ? 0.540   41.078  34.024  1.00 39.81 ? 58  GLU A CA    1 
ATOM   198  C  C     . GLU A 1 27  ? -0.502  40.066  34.510  1.00 40.75 ? 58  GLU A C     1 
ATOM   199  O  O     . GLU A 1 27  ? -1.490  39.798  33.823  1.00 41.26 ? 58  GLU A O     1 
ATOM   200  C  CB    . GLU A 1 27  ? 0.593   41.094  32.483  1.00 39.77 ? 58  GLU A CB    1 
ATOM   201  N  N     . ALA A 1 28  ? -0.274  39.502  35.693  1.00 41.64 ? 59  ALA A N     1 
ATOM   202  C  CA    . ALA A 1 28  ? -1.289  38.716  36.384  1.00 42.28 ? 59  ALA A CA    1 
ATOM   203  C  C     . ALA A 1 28  ? -1.842  37.478  35.669  1.00 42.81 ? 59  ALA A C     1 
ATOM   204  O  O     . ALA A 1 28  ? -3.001  37.460  35.285  1.00 42.98 ? 59  ALA A O     1 
ATOM   205  N  N     . GLY A 1 29  ? -1.006  36.464  35.475  1.00 43.15 ? 60  GLY A N     1 
ATOM   206  C  CA    . GLY A 1 29  ? -1.480  35.081  35.307  1.00 43.49 ? 60  GLY A CA    1 
ATOM   207  C  C     . GLY A 1 29  ? -2.160  34.705  33.994  1.00 43.78 ? 60  GLY A C     1 
ATOM   208  O  O     . GLY A 1 29  ? -2.441  35.574  33.158  1.00 44.60 ? 60  GLY A O     1 
ATOM   209  N  N     . TYR A 1 30  ? -2.399  33.402  33.812  1.00 43.29 ? 61  TYR A N     1 
ATOM   210  C  CA    . TYR A 1 30  ? -3.140  32.878  32.660  1.00 43.10 ? 61  TYR A CA    1 
ATOM   211  C  C     . TYR A 1 30  ? -4.517  32.461  33.152  1.00 43.00 ? 61  TYR A C     1 
ATOM   212  O  O     . TYR A 1 30  ? -4.625  31.693  34.099  1.00 43.04 ? 61  TYR A O     1 
ATOM   213  C  CB    . TYR A 1 30  ? -2.437  31.654  32.040  1.00 42.96 ? 61  TYR A CB    1 
ATOM   214  C  CG    . TYR A 1 30  ? -1.279  31.981  31.104  1.00 42.69 ? 61  TYR A CG    1 
ATOM   215  C  CD1   . TYR A 1 30  ? 0.029   31.662  31.443  1.00 41.80 ? 61  TYR A CD1   1 
ATOM   216  C  CD2   . TYR A 1 30  ? -1.501  32.607  29.877  1.00 42.74 ? 61  TYR A CD2   1 
ATOM   217  C  CE1   . TYR A 1 30  ? 1.079   31.968  30.600  1.00 42.38 ? 61  TYR A CE1   1 
ATOM   218  C  CE2   . TYR A 1 30  ? -0.451  32.917  29.026  1.00 42.62 ? 61  TYR A CE2   1 
ATOM   219  C  CZ    . TYR A 1 30  ? 0.836   32.596  29.397  1.00 42.48 ? 61  TYR A CZ    1 
ATOM   220  O  OH    . TYR A 1 30  ? 1.886   32.900  28.567  1.00 42.67 ? 61  TYR A OH    1 
ATOM   221  N  N     . SER A 1 31  ? -5.570  32.967  32.522  1.00 42.82 ? 62  SER A N     1 
ATOM   222  C  CA    . SER A 1 31  ? -6.921  32.618  32.929  1.00 42.62 ? 62  SER A CA    1 
ATOM   223  C  C     . SER A 1 31  ? -7.279  31.217  32.432  1.00 42.46 ? 62  SER A C     1 
ATOM   224  O  O     . SER A 1 31  ? -6.522  30.588  31.694  1.00 42.19 ? 62  SER A O     1 
ATOM   225  C  CB    . SER A 1 31  ? -7.931  33.648  32.413  1.00 42.79 ? 62  SER A CB    1 
ATOM   226  O  OG    . SER A 1 31  ? -8.283  33.400  31.063  1.00 43.22 ? 62  SER A OG    1 
ATOM   227  N  N     . GLU A 1 32  ? -8.445  30.739  32.843  1.00 42.35 ? 63  GLU A N     1 
ATOM   228  C  CA    . GLU A 1 32  ? -8.939  29.438  32.424  1.00 42.27 ? 63  GLU A CA    1 
ATOM   229  C  C     . GLU A 1 32  ? -9.200  29.422  30.905  1.00 42.18 ? 63  GLU A C     1 
ATOM   230  O  O     . GLU A 1 32  ? -8.854  28.447  30.225  1.00 42.25 ? 63  GLU A O     1 
ATOM   231  C  CB    . GLU A 1 32  ? -10.210 29.095  33.210  1.00 42.40 ? 63  GLU A CB    1 
ATOM   232  C  CG    . GLU A 1 32  ? -10.683 27.650  33.118  1.00 42.57 ? 63  GLU A CG    1 
ATOM   233  C  CD    . GLU A 1 32  ? -12.082 27.455  33.703  1.00 42.37 ? 63  GLU A CD    1 
ATOM   234  O  OE1   . GLU A 1 32  ? -12.225 27.455  34.946  1.00 42.55 ? 63  GLU A OE1   1 
ATOM   235  O  OE2   . GLU A 1 32  ? -13.038 27.291  32.917  1.00 42.04 ? 63  GLU A OE2   1 
ATOM   236  N  N     . GLU A 1 33  ? -9.777  30.498  30.367  1.00 41.81 ? 64  GLU A N     1 
ATOM   237  C  CA    . GLU A 1 33  ? -10.072 30.556  28.929  1.00 41.54 ? 64  GLU A CA    1 
ATOM   238  C  C     . GLU A 1 33  ? -8.788  30.619  28.105  1.00 40.98 ? 64  GLU A C     1 
ATOM   239  O  O     . GLU A 1 33  ? -8.731  30.023  27.038  1.00 41.37 ? 64  GLU A O     1 
ATOM   240  C  CB    . GLU A 1 33  ? -10.997 31.726  28.580  1.00 41.38 ? 64  GLU A CB    1 
ATOM   241  N  N     . GLU A 1 34  ? -7.767  31.327  28.597  1.00 40.28 ? 65  GLU A N     1 
ATOM   242  C  CA    . GLU A 1 34  ? -6.470  31.416  27.908  1.00 39.65 ? 65  GLU A CA    1 
ATOM   243  C  C     . GLU A 1 34  ? -5.755  30.080  27.915  1.00 39.19 ? 65  GLU A C     1 
ATOM   244  O  O     . GLU A 1 34  ? -5.150  29.685  26.921  1.00 39.37 ? 65  GLU A O     1 
ATOM   245  C  CB    . GLU A 1 34  ? -5.561  32.436  28.579  1.00 39.46 ? 65  GLU A CB    1 
ATOM   246  C  CG    . GLU A 1 34  ? -6.018  33.849  28.424  1.00 39.64 ? 65  GLU A CG    1 
ATOM   247  C  CD    . GLU A 1 34  ? -5.188  34.805  29.237  1.00 40.52 ? 65  GLU A CD    1 
ATOM   248  O  OE1   . GLU A 1 34  ? -4.586  35.709  28.627  1.00 41.82 ? 65  GLU A OE1   1 
ATOM   249  O  OE2   . GLU A 1 34  ? -5.118  34.647  30.478  1.00 40.23 ? 65  GLU A OE2   1 
ATOM   250  N  N     . CYS A 1 35  ? -5.812  29.406  29.057  1.00 38.59 ? 66  CYS A N     1 
ATOM   251  C  CA    . CYS A 1 35  ? -5.240  28.073  29.204  1.00 38.16 ? 66  CYS A CA    1 
ATOM   252  C  C     . CYS A 1 35  ? -5.850  27.068  28.264  1.00 37.90 ? 66  CYS A C     1 
ATOM   253  O  O     . CYS A 1 35  ? -5.156  26.181  27.789  1.00 38.46 ? 66  CYS A O     1 
ATOM   254  C  CB    . CYS A 1 35  ? -5.467  27.535  30.617  1.00 38.49 ? 66  CYS A CB    1 
ATOM   255  S  SG    . CYS A 1 35  ? -4.290  28.042  31.844  1.00 36.81 ? 66  CYS A SG    1 
ATOM   256  N  N     . LYS A 1 36  ? -7.150  27.180  28.025  1.00 37.50 ? 67  LYS A N     1 
ATOM   257  C  CA    . LYS A 1 36  ? -7.859  26.224  27.177  1.00 37.27 ? 67  LYS A CA    1 
ATOM   258  C  C     . LYS A 1 36  ? -7.440  26.369  25.706  1.00 37.11 ? 67  LYS A C     1 
ATOM   259  O  O     . LYS A 1 36  ? -7.540  25.405  24.937  1.00 36.89 ? 67  LYS A O     1 
ATOM   260  C  CB    . LYS A 1 36  ? -9.380  26.368  27.354  1.00 37.14 ? 67  LYS A CB    1 
ATOM   261  N  N     . GLN A 1 37  ? -6.939  27.554  25.332  1.00 36.86 ? 68  GLN A N     1 
ATOM   262  C  CA    . GLN A 1 37  ? -6.425  27.794  23.980  1.00 36.81 ? 68  GLN A CA    1 
ATOM   263  C  C     . GLN A 1 37  ? -5.093  27.094  23.734  1.00 36.29 ? 68  GLN A C     1 
ATOM   264  O  O     . GLN A 1 37  ? -4.696  26.932  22.574  1.00 36.41 ? 68  GLN A O     1 
ATOM   265  C  CB    . GLN A 1 37  ? -6.284  29.293  23.712  1.00 36.90 ? 68  GLN A CB    1 
ATOM   266  C  CG    . GLN A 1 37  ? -7.629  30.026  23.652  1.00 37.65 ? 68  GLN A CG    1 
ATOM   267  C  CD    . GLN A 1 37  ? -7.474  31.519  23.357  1.00 38.15 ? 68  GLN A CD    1 
ATOM   268  O  OE1   . GLN A 1 37  ? -6.647  32.223  23.972  1.00 38.79 ? 68  GLN A OE1   1 
ATOM   269  N  NE2   . GLN A 1 37  ? -8.278  32.013  22.413  1.00 39.62 ? 68  GLN A NE2   1 
ATOM   270  N  N     . TYR A 1 38  ? -4.426  26.677  24.815  1.00 35.57 ? 69  TYR A N     1 
ATOM   271  C  CA    . TYR A 1 38  ? -3.164  25.937  24.734  1.00 35.18 ? 69  TYR A CA    1 
ATOM   272  C  C     . TYR A 1 38  ? -3.322  24.417  24.703  1.00 34.33 ? 69  TYR A C     1 
ATOM   273  O  O     . TYR A 1 38  ? -2.337  23.701  24.539  1.00 34.09 ? 69  TYR A O     1 
ATOM   274  C  CB    . TYR A 1 38  ? -2.263  26.323  25.916  1.00 35.34 ? 69  TYR A CB    1 
ATOM   275  C  CG    . TYR A 1 38  ? -1.492  27.595  25.690  1.00 35.23 ? 69  TYR A CG    1 
ATOM   276  C  CD1   . TYR A 1 38  ? -1.937  28.805  26.196  1.00 34.62 ? 69  TYR A CD1   1 
ATOM   277  C  CD2   . TYR A 1 38  ? -0.307  27.583  24.954  1.00 35.38 ? 69  TYR A CD2   1 
ATOM   278  C  CE1   . TYR A 1 38  ? -1.206  29.972  25.970  1.00 35.39 ? 69  TYR A CE1   1 
ATOM   279  C  CE2   . TYR A 1 38  ? 0.421   28.740  24.728  1.00 33.80 ? 69  TYR A CE2   1 
ATOM   280  C  CZ    . TYR A 1 38  ? -0.033  29.920  25.228  1.00 34.11 ? 69  TYR A CZ    1 
ATOM   281  O  OH    . TYR A 1 38  ? 0.703   31.044  25.007  1.00 35.37 ? 69  TYR A OH    1 
ATOM   282  N  N     . LYS A 1 39  ? -4.547  23.925  24.865  1.00 33.55 ? 70  LYS A N     1 
ATOM   283  C  CA    . LYS A 1 39  ? -4.828  22.484  24.774  1.00 33.00 ? 70  LYS A CA    1 
ATOM   284  C  C     . LYS A 1 39  ? -4.262  21.890  23.474  1.00 32.41 ? 70  LYS A C     1 
ATOM   285  O  O     . LYS A 1 39  ? -3.449  20.965  23.519  1.00 32.37 ? 70  LYS A O     1 
ATOM   286  C  CB    . LYS A 1 39  ? -6.337  22.233  24.899  1.00 33.28 ? 70  LYS A CB    1 
ATOM   287  C  CG    . LYS A 1 39  ? -6.794  20.757  24.993  1.00 33.96 ? 70  LYS A CG    1 
ATOM   288  C  CD    . LYS A 1 39  ? -8.334  20.617  25.174  1.00 33.13 ? 70  LYS A CD    1 
ATOM   289  N  N     . ALA A 1 40  ? -4.658  22.465  22.335  1.00 31.58 ? 71  ALA A N     1 
ATOM   290  C  CA    . ALA A 1 40  ? -4.210  22.033  21.019  1.00 30.91 ? 71  ALA A CA    1 
ATOM   291  C  C     . ALA A 1 40  ? -2.682  21.992  20.915  1.00 30.63 ? 71  ALA A C     1 
ATOM   292  O  O     . ALA A 1 40  ? -2.135  21.071  20.306  1.00 30.10 ? 71  ALA A O     1 
ATOM   293  C  CB    . ALA A 1 40  ? -4.811  22.932  19.939  1.00 30.35 ? 71  ALA A CB    1 
ATOM   294  N  N     . VAL A 1 41  ? -2.005  22.966  21.530  1.00 30.24 ? 72  VAL A N     1 
ATOM   295  C  CA    . VAL A 1 41  ? -0.532  23.019  21.521  1.00 30.06 ? 72  VAL A CA    1 
ATOM   296  C  C     . VAL A 1 41  ? 0.093   21.869  22.314  1.00 29.89 ? 72  VAL A C     1 
ATOM   297  O  O     . VAL A 1 41  ? 0.994   21.171  21.840  1.00 30.09 ? 72  VAL A O     1 
ATOM   298  C  CB    . VAL A 1 41  ? -0.011  24.349  22.101  1.00 29.75 ? 72  VAL A CB    1 
ATOM   299  C  CG1   . VAL A 1 41  ? 1.487   24.383  22.011  1.00 29.09 ? 72  VAL A CG1   1 
ATOM   300  C  CG2   . VAL A 1 41  ? -0.641  25.543  21.361  1.00 29.31 ? 72  VAL A CG2   1 
ATOM   301  N  N     . VAL A 1 42  ? -0.411  21.658  23.515  1.00 29.96 ? 73  VAL A N     1 
ATOM   302  C  CA    . VAL A 1 42  ? 0.013   20.518  24.325  1.00 30.01 ? 73  VAL A CA    1 
ATOM   303  C  C     . VAL A 1 42  ? -0.171  19.200  23.560  1.00 29.94 ? 73  VAL A C     1 
ATOM   304  O  O     . VAL A 1 42  ? 0.749   18.379  23.522  1.00 29.53 ? 73  VAL A O     1 
ATOM   305  C  CB    . VAL A 1 42  ? -0.744  20.486  25.684  1.00 29.80 ? 73  VAL A CB    1 
ATOM   306  C  CG1   . VAL A 1 42  ? -0.415  19.237  26.471  1.00 30.29 ? 73  VAL A CG1   1 
ATOM   307  C  CG2   . VAL A 1 42  ? -0.380  21.685  26.503  1.00 30.27 ? 73  VAL A CG2   1 
ATOM   308  N  N     . TYR A 1 43  ? -1.329  19.019  22.919  1.00 29.97 ? 74  TYR A N     1 
ATOM   309  C  CA    . TYR A 1 43  ? -1.570  17.798  22.139  1.00 30.48 ? 74  TYR A CA    1 
ATOM   310  C  C     . TYR A 1 43  ? -0.599  17.696  20.976  1.00 30.17 ? 74  TYR A C     1 
ATOM   311  O  O     . TYR A 1 43  ? 0.059   16.689  20.809  1.00 30.57 ? 74  TYR A O     1 
ATOM   312  C  CB    . TYR A 1 43  ? -3.033  17.696  21.670  1.00 30.57 ? 74  TYR A CB    1 
ATOM   313  C  CG    . TYR A 1 43  ? -4.040  17.465  22.781  1.00 30.43 ? 74  TYR A CG    1 
ATOM   314  C  CD1   . TYR A 1 43  ? -3.680  16.842  23.974  1.00 31.41 ? 74  TYR A CD1   1 
ATOM   315  C  CD2   . TYR A 1 43  ? -5.360  17.832  22.620  1.00 30.70 ? 74  TYR A CD2   1 
ATOM   316  C  CE1   . TYR A 1 43  ? -4.610  16.626  24.988  1.00 31.57 ? 74  TYR A CE1   1 
ATOM   317  C  CE2   . TYR A 1 43  ? -6.293  17.611  23.616  1.00 31.66 ? 74  TYR A CE2   1 
ATOM   318  C  CZ    . TYR A 1 43  ? -5.914  17.010  24.806  1.00 31.77 ? 74  TYR A CZ    1 
ATOM   319  O  OH    . TYR A 1 43  ? -6.849  16.778  25.807  1.00 30.97 ? 74  TYR A OH    1 
ATOM   320  N  N     . SER A 1 44  ? -0.472  18.762  20.215  1.00 30.22 ? 75  SER A N     1 
ATOM   321  C  CA    . SER A 1 44  ? 0.481   18.824  19.113  1.00 30.32 ? 75  SER A CA    1 
ATOM   322  C  C     . SER A 1 44  ? 1.921   18.485  19.563  1.00 30.11 ? 75  SER A C     1 
ATOM   323  O  O     . SER A 1 44  ? 2.619   17.717  18.889  1.00 29.94 ? 75  SER A O     1 
ATOM   324  C  CB    . SER A 1 44  ? 0.396   20.205  18.478  1.00 30.23 ? 75  SER A CB    1 
ATOM   325  O  OG    . SER A 1 44  ? 1.167   20.237  17.320  1.00 32.04 ? 75  SER A OG    1 
ATOM   326  N  N     . ASN A 1 45  ? 2.342   19.033  20.706  1.00 29.93 ? 76  ASN A N     1 
ATOM   327  C  CA    . ASN A 1 45  ? 3.666   18.729  21.289  1.00 30.24 ? 76  ASN A CA    1 
ATOM   328  C  C     . ASN A 1 45  ? 3.848   17.262  21.650  1.00 30.60 ? 76  ASN A C     1 
ATOM   329  O  O     . ASN A 1 45  ? 4.880   16.643  21.335  1.00 30.92 ? 76  ASN A O     1 
ATOM   330  C  CB    . ASN A 1 45  ? 3.876   19.490  22.596  1.00 29.98 ? 76  ASN A CB    1 
ATOM   331  C  CG    . ASN A 1 45  ? 4.413   20.869  22.397  1.00 29.48 ? 76  ASN A CG    1 
ATOM   332  O  OD1   . ASN A 1 45  ? 4.733   21.540  23.384  1.00 29.14 ? 76  ASN A OD1   1 
ATOM   333  N  ND2   . ASN A 1 45  ? 4.505   21.323  21.138  1.00 24.20 ? 76  ASN A ND2   1 
ATOM   334  N  N     . THR A 1 46  ? 2.860   16.730  22.370  1.00 30.51 ? 77  THR A N     1 
ATOM   335  C  CA    . THR A 1 46  ? 2.897   15.345  22.794  1.00 30.45 ? 77  THR A CA    1 
ATOM   336  C  C     . THR A 1 46  ? 2.962   14.451  21.554  1.00 30.79 ? 77  THR A C     1 
ATOM   337  O  O     . THR A 1 46  ? 3.810   13.582  21.455  1.00 31.18 ? 77  THR A O     1 
ATOM   338  C  CB    . THR A 1 46  ? 1.651   14.978  23.673  1.00 31.18 ? 77  THR A CB    1 
ATOM   339  O  OG1   . THR A 1 46  ? 1.575   15.832  24.831  1.00 29.18 ? 77  THR A OG1   1 
ATOM   340  C  CG2   . THR A 1 46  ? 1.693   13.510  24.118  1.00 30.50 ? 77  THR A CG2   1 
ATOM   341  N  N     . ILE A 1 47  ? 2.095   14.711  20.588  1.00 30.89 ? 78  ILE A N     1 
ATOM   342  C  CA    . ILE A 1 47  ? 2.002   13.882  19.400  1.00 31.18 ? 78  ILE A CA    1 
ATOM   343  C  C     . ILE A 1 47  ? 3.256   13.955  18.534  1.00 31.56 ? 78  ILE A C     1 
ATOM   344  O  O     . ILE A 1 47  ? 3.771   12.912  18.109  1.00 32.62 ? 78  ILE A O     1 
ATOM   345  C  CB    . ILE A 1 47  ? 0.746   14.249  18.560  1.00 31.41 ? 78  ILE A CB    1 
ATOM   346  C  CG1   . ILE A 1 47  ? -0.535  13.883  19.331  1.00 29.50 ? 78  ILE A CG1   1 
ATOM   347  C  CG2   . ILE A 1 47  ? 0.798   13.540  17.178  1.00 31.15 ? 78  ILE A CG2   1 
ATOM   348  C  CD1   . ILE A 1 47  ? -1.780  14.557  18.802  1.00 28.63 ? 78  ILE A CD1   1 
ATOM   349  N  N     . GLN A 1 48  ? 3.747   15.163  18.251  1.00 31.32 ? 79  GLN A N     1 
ATOM   350  C  CA    . GLN A 1 48  ? 4.955   15.296  17.451  1.00 30.83 ? 79  GLN A CA    1 
ATOM   351  C  C     . GLN A 1 48  ? 6.156   14.697  18.220  1.00 30.90 ? 79  GLN A C     1 
ATOM   352  O  O     . GLN A 1 48  ? 7.080   14.191  17.606  1.00 31.32 ? 79  GLN A O     1 
ATOM   353  C  CB    . GLN A 1 48  ? 5.140   16.747  16.984  1.00 30.58 ? 79  GLN A CB    1 
ATOM   354  N  N     . SER A 1 49  ? 6.109   14.700  19.557  1.00 31.08 ? 80  SER A N     1 
ATOM   355  C  CA    . SER A 1 49  ? 7.180   14.095  20.390  1.00 31.10 ? 80  SER A CA    1 
ATOM   356  C  C     . SER A 1 49  ? 7.297   12.570  20.289  1.00 30.76 ? 80  SER A C     1 
ATOM   357  O  O     . SER A 1 49  ? 8.398   12.060  20.050  1.00 30.85 ? 80  SER A O     1 
ATOM   358  C  CB    . SER A 1 49  ? 7.008   14.480  21.857  1.00 30.89 ? 80  SER A CB    1 
ATOM   359  O  OG    . SER A 1 49  ? 7.603   15.735  22.099  1.00 33.48 ? 80  SER A OG    1 
ATOM   360  N  N     . ILE A 1 50  ? 6.183   11.848  20.486  1.00 30.13 ? 81  ILE A N     1 
ATOM   361  C  CA    . ILE A 1 50  ? 6.202   10.388  20.376  1.00 29.98 ? 81  ILE A CA    1 
ATOM   362  C  C     . ILE A 1 50  ? 6.491   9.952   18.918  1.00 29.99 ? 81  ILE A C     1 
ATOM   363  O  O     . ILE A 1 50  ? 7.235   9.006   18.689  1.00 29.69 ? 81  ILE A O     1 
ATOM   364  C  CB    . ILE A 1 50  ? 4.918   9.733   20.985  1.00 29.76 ? 81  ILE A CB    1 
ATOM   365  C  CG1   . ILE A 1 50  ? 5.035   8.212   21.036  1.00 28.94 ? 81  ILE A CG1   1 
ATOM   366  C  CG2   . ILE A 1 50  ? 3.666   10.126  20.213  1.00 30.51 ? 81  ILE A CG2   1 
ATOM   367  C  CD1   . ILE A 1 50  ? 6.168   7.712   21.878  1.00 28.46 ? 81  ILE A CD1   1 
ATOM   368  N  N     . ILE A 1 51  ? 5.981   10.698  17.949  1.00 30.37 ? 82  ILE A N     1 
ATOM   369  C  CA    . ILE A 1 51  ? 6.340   10.473  16.544  1.00 31.05 ? 82  ILE A CA    1 
ATOM   370  C  C     . ILE A 1 51  ? 7.843   10.609  16.306  1.00 31.26 ? 82  ILE A C     1 
ATOM   371  O  O     . ILE A 1 51  ? 8.420   9.727   15.661  1.00 32.35 ? 82  ILE A O     1 
ATOM   372  C  CB    . ILE A 1 51  ? 5.532   11.384  15.593  1.00 31.26 ? 82  ILE A CB    1 
ATOM   373  C  CG1   . ILE A 1 51  ? 4.083   10.890  15.523  1.00 31.69 ? 82  ILE A CG1   1 
ATOM   374  C  CG2   . ILE A 1 51  ? 6.116   11.383  14.199  1.00 31.34 ? 82  ILE A CG2   1 
ATOM   375  C  CD1   . ILE A 1 51  ? 3.207   11.658  14.543  1.00 31.56 ? 82  ILE A CD1   1 
ATOM   376  N  N     . ALA A 1 52  ? 8.475   11.651  16.834  1.00 30.76 ? 83  ALA A N     1 
ATOM   377  C  CA    . ALA A 1 52  ? 9.915   11.819  16.686  1.00 31.22 ? 83  ALA A CA    1 
ATOM   378  C  C     . ALA A 1 52  ? 10.712  10.626  17.227  1.00 31.50 ? 83  ALA A C     1 
ATOM   379  O  O     . ALA A 1 52  ? 11.685  10.209  16.592  1.00 32.06 ? 83  ALA A O     1 
ATOM   380  C  CB    . ALA A 1 52  ? 10.372  13.126  17.362  1.00 30.89 ? 83  ALA A CB    1 
ATOM   381  N  N     . ILE A 1 53  ? 10.307  10.086  18.379  1.00 31.58 ? 84  ILE A N     1 
ATOM   382  C  CA    . ILE A 1 53  ? 11.001  8.931   18.973  1.00 31.64 ? 84  ILE A CA    1 
ATOM   383  C  C     . ILE A 1 53  ? 10.833  7.717   18.049  1.00 31.39 ? 84  ILE A C     1 
ATOM   384  O  O     . ILE A 1 53  ? 11.796  7.039   17.728  1.00 31.37 ? 84  ILE A O     1 
ATOM   385  C  CB    . ILE A 1 53  ? 10.522  8.605   20.421  1.00 31.90 ? 84  ILE A CB    1 
ATOM   386  C  CG1   . ILE A 1 53  ? 10.707  9.832   21.334  1.00 32.67 ? 84  ILE A CG1   1 
ATOM   387  C  CG2   . ILE A 1 53  ? 11.299  7.394   21.000  1.00 30.44 ? 84  ILE A CG2   1 
ATOM   388  C  CD1   . ILE A 1 53  ? 10.227  9.642   22.779  1.00 31.69 ? 84  ILE A CD1   1 
ATOM   389  N  N     . ILE A 1 54  ? 9.613   7.485   17.586  1.00 31.12 ? 85  ILE A N     1 
ATOM   390  C  CA    . ILE A 1 54  ? 9.316   6.322   16.733  1.00 31.22 ? 85  ILE A CA    1 
ATOM   391  C  C     . ILE A 1 54  ? 10.069  6.355   15.384  1.00 30.83 ? 85  ILE A C     1 
ATOM   392  O  O     . ILE A 1 54  ? 10.568  5.347   14.918  1.00 30.69 ? 85  ILE A O     1 
ATOM   393  C  CB    . ILE A 1 54  ? 7.774   6.170   16.482  1.00 31.44 ? 85  ILE A CB    1 
ATOM   394  C  CG1   . ILE A 1 54  ? 6.983   6.030   17.793  1.00 31.62 ? 85  ILE A CG1   1 
ATOM   395  C  CG2   . ILE A 1 54  ? 7.468   4.954   15.610  1.00 31.89 ? 85  ILE A CG2   1 
ATOM   396  C  CD1   . ILE A 1 54  ? 7.490   4.970   18.757  1.00 32.67 ? 85  ILE A CD1   1 
ATOM   397  N  N     . ARG A 1 55  ? 10.161  7.526   14.775  1.00 30.78 ? 86  ARG A N     1 
ATOM   398  C  CA    . ARG A 1 55  ? 10.929  7.707   13.553  1.00 30.55 ? 86  ARG A CA    1 
ATOM   399  C  C     . ARG A 1 55  ? 12.426  7.510   13.803  1.00 30.19 ? 86  ARG A C     1 
ATOM   400  O  O     . ARG A 1 55  ? 13.110  6.904   12.987  1.00 30.21 ? 86  ARG A O     1 
ATOM   401  C  CB    . ARG A 1 55  ? 10.642  9.087   12.953  1.00 30.69 ? 86  ARG A CB    1 
ATOM   402  C  CG    . ARG A 1 55  ? 9.221   9.219   12.438  1.00 32.35 ? 86  ARG A CG    1 
ATOM   403  C  CD    . ARG A 1 55  ? 8.895   10.607  11.928  1.00 35.24 ? 86  ARG A CD    1 
ATOM   404  N  NE    . ARG A 1 55  ? 7.841   10.586  10.898  1.00 37.84 ? 86  ARG A NE    1 
ATOM   405  C  CZ    . ARG A 1 55  ? 7.031   11.612  10.571  1.00 38.70 ? 86  ARG A CZ    1 
ATOM   406  N  NH1   . ARG A 1 55  ? 7.104   12.802  11.181  1.00 39.47 ? 86  ARG A NH1   1 
ATOM   407  N  NH2   . ARG A 1 55  ? 6.111   11.439  9.628   1.00 37.69 ? 86  ARG A NH2   1 
ATOM   408  N  N     . ALA A 1 56  ? 12.926  7.982   14.936  1.00 29.90 ? 87  ALA A N     1 
ATOM   409  C  CA    . ALA A 1 56  ? 14.309  7.710   15.307  1.00 30.11 ? 87  ALA A CA    1 
ATOM   410  C  C     . ALA A 1 56  ? 14.591  6.187   15.321  1.00 30.09 ? 87  ALA A C     1 
ATOM   411  O  O     . ALA A 1 56  ? 15.583  5.719   14.766  1.00 29.85 ? 87  ALA A O     1 
ATOM   412  C  CB    . ALA A 1 56  ? 14.623  8.376   16.643  1.00 29.62 ? 87  ALA A CB    1 
ATOM   413  N  N     . MET A 1 57  ? 13.685  5.426   15.902  1.00 30.61 ? 88  MET A N     1 
ATOM   414  C  CA    . MET A 1 57  ? 13.820  3.983   15.970  1.00 31.63 ? 88  MET A CA    1 
ATOM   415  C  C     . MET A 1 57  ? 14.098  3.309   14.603  1.00 32.48 ? 88  MET A C     1 
ATOM   416  O  O     . MET A 1 57  ? 14.905  2.373   14.496  1.00 32.08 ? 88  MET A O     1 
ATOM   417  C  CB    . MET A 1 57  ? 12.543  3.411   16.592  1.00 31.67 ? 88  MET A CB    1 
ATOM   418  C  CG    . MET A 1 57  ? 12.396  3.743   18.090  1.00 31.23 ? 88  MET A CG    1 
ATOM   419  S  SD    . MET A 1 57  ? 11.024  2.833   18.792  1.00 31.98 ? 88  MET A SD    1 
ATOM   420  C  CE    . MET A 1 57  ? 11.765  1.206   18.984  1.00 28.08 ? 88  MET A CE    1 
ATOM   421  N  N     . GLY A 1 58  ? 13.399  3.784   13.576  1.00 33.45 ? 89  GLY A N     1 
ATOM   422  C  CA    . GLY A 1 58  ? 13.602  3.334   12.210  1.00 34.03 ? 89  GLY A CA    1 
ATOM   423  C  C     . GLY A 1 58  ? 14.993  3.634   11.693  1.00 34.90 ? 89  GLY A C     1 
ATOM   424  O  O     . GLY A 1 58  ? 15.649  2.774   11.094  1.00 35.35 ? 89  GLY A O     1 
ATOM   425  N  N     . ARG A 1 59  ? 15.461  4.846   11.956  1.00 35.56 ? 90  ARG A N     1 
ATOM   426  C  CA    . ARG A 1 59  ? 16.757  5.280   11.472  1.00 36.26 ? 90  ARG A CA    1 
ATOM   427  C  C     . ARG A 1 59  ? 17.921  4.670   12.278  1.00 35.85 ? 90  ARG A C     1 
ATOM   428  O  O     . ARG A 1 59  ? 18.944  4.310   11.681  1.00 35.71 ? 90  ARG A O     1 
ATOM   429  C  CB    . ARG A 1 59  ? 16.802  6.808   11.408  1.00 36.48 ? 90  ARG A CB    1 
ATOM   430  C  CG    . ARG A 1 59  ? 15.611  7.431   10.626  1.00 37.77 ? 90  ARG A CG    1 
ATOM   431  C  CD    . ARG A 1 59  ? 15.795  8.942   10.263  1.00 39.18 ? 90  ARG A CD    1 
ATOM   432  N  NE    . ARG A 1 59  ? 16.436  9.740   11.319  1.00 42.13 ? 90  ARG A NE    1 
ATOM   433  C  CZ    . ARG A 1 59  ? 15.804  10.453  12.266  1.00 43.04 ? 90  ARG A CZ    1 
ATOM   434  N  NH1   . ARG A 1 59  ? 14.480  10.532  12.315  1.00 43.73 ? 90  ARG A NH1   1 
ATOM   435  N  NH2   . ARG A 1 59  ? 16.519  11.112  13.178  1.00 42.42 ? 90  ARG A NH2   1 
ATOM   436  N  N     . LEU A 1 60  ? 17.747  4.530   13.603  1.00 35.56 ? 91  LEU A N     1 
ATOM   437  C  CA    . LEU A 1 60  ? 18.765  3.970   14.506  1.00 35.32 ? 91  LEU A CA    1 
ATOM   438  C  C     . LEU A 1 60  ? 18.715  2.450   14.589  1.00 35.21 ? 91  LEU A C     1 
ATOM   439  O  O     . LEU A 1 60  ? 19.560  1.827   15.230  1.00 35.23 ? 91  LEU A O     1 
ATOM   440  C  CB    . LEU A 1 60  ? 18.573  4.557   15.903  1.00 35.15 ? 91  LEU A CB    1 
ATOM   441  C  CG    . LEU A 1 60  ? 18.616  6.082   16.004  1.00 34.66 ? 91  LEU A CG    1 
ATOM   442  C  CD1   . LEU A 1 60  ? 18.409  6.463   17.439  1.00 33.34 ? 91  LEU A CD1   1 
ATOM   443  C  CD2   . LEU A 1 60  ? 19.928  6.668   15.453  1.00 33.78 ? 91  LEU A CD2   1 
ATOM   444  N  N     . LYS A 1 61  ? 17.708  1.875   13.940  1.00 35.55 ? 92  LYS A N     1 
ATOM   445  C  CA    . LYS A 1 61  ? 17.388  0.430   13.974  1.00 35.48 ? 92  LYS A CA    1 
ATOM   446  C  C     . LYS A 1 61  ? 17.313  -0.158  15.395  1.00 35.30 ? 92  LYS A C     1 
ATOM   447  O  O     . LYS A 1 61  ? 18.014  -1.124  15.732  1.00 35.23 ? 92  LYS A O     1 
ATOM   448  C  CB    . LYS A 1 61  ? 18.324  -0.348  13.046  1.00 35.60 ? 92  LYS A CB    1 
ATOM   449  C  CG    . LYS A 1 61  ? 18.119  -0.025  11.564  1.00 36.34 ? 92  LYS A CG    1 
ATOM   450  C  CD    . LYS A 1 61  ? 19.376  -0.309  10.753  1.00 39.25 ? 92  LYS A CD    1 
ATOM   451  C  CE    . LYS A 1 61  ? 19.087  -0.873  9.356   1.00 41.53 ? 92  LYS A CE    1 
ATOM   452  N  NZ    . LYS A 1 61  ? 18.295  0.071   8.490   1.00 43.94 ? 92  LYS A NZ    1 
ATOM   453  N  N     . ILE A 1 62  ? 16.445  0.447   16.209  1.00 34.87 ? 93  ILE A N     1 
ATOM   454  C  CA    . ILE A 1 62  ? 16.148  -0.028  17.548  1.00 34.95 ? 93  ILE A CA    1 
ATOM   455  C  C     . ILE A 1 62  ? 14.879  -0.860  17.487  1.00 35.00 ? 93  ILE A C     1 
ATOM   456  O  O     . ILE A 1 62  ? 13.895  -0.421  16.892  1.00 35.08 ? 93  ILE A O     1 
ATOM   457  C  CB    . ILE A 1 62  ? 15.923  1.152   18.500  1.00 34.93 ? 93  ILE A CB    1 
ATOM   458  C  CG1   . ILE A 1 62  ? 17.241  1.931   18.680  1.00 35.07 ? 93  ILE A CG1   1 
ATOM   459  C  CG2   . ILE A 1 62  ? 15.382  0.633   19.814  1.00 34.14 ? 93  ILE A CG2   1 
ATOM   460  C  CD1   . ILE A 1 62  ? 17.082  3.372   19.217  1.00 34.89 ? 93  ILE A CD1   1 
ATOM   461  N  N     . ASP A 1 63  ? 14.887  -2.049  18.089  1.00 35.03 ? 94  ASP A N     1 
ATOM   462  C  CA    . ASP A 1 63  ? 13.675  -2.887  18.095  1.00 34.99 ? 94  ASP A CA    1 
ATOM   463  C  C     . ASP A 1 63  ? 12.726  -2.424  19.180  1.00 34.53 ? 94  ASP A C     1 
ATOM   464  O  O     . ASP A 1 63  ? 13.155  -1.839  20.180  1.00 34.90 ? 94  ASP A O     1 
ATOM   465  C  CB    . ASP A 1 63  ? 13.988  -4.375  18.312  1.00 34.98 ? 94  ASP A CB    1 
ATOM   466  C  CG    . ASP A 1 63  ? 14.573  -5.043  17.091  1.00 35.54 ? 94  ASP A CG    1 
ATOM   467  O  OD1   . ASP A 1 63  ? 14.605  -4.406  16.011  1.00 37.36 ? 94  ASP A OD1   1 
ATOM   468  O  OD2   . ASP A 1 63  ? 15.008  -6.213  17.220  1.00 35.23 ? 94  ASP A OD2   1 
ATOM   469  N  N     . PHE A 1 64  ? 11.445  -2.709  18.972  1.00 33.91 ? 95  PHE A N     1 
ATOM   470  C  CA    . PHE A 1 64  ? 10.442  -2.593  20.024  1.00 33.57 ? 95  PHE A CA    1 
ATOM   471  C  C     . PHE A 1 64  ? 10.697  -3.708  21.032  1.00 33.19 ? 95  PHE A C     1 
ATOM   472  O  O     . PHE A 1 64  ? 11.164  -4.784  20.657  1.00 32.80 ? 95  PHE A O     1 
ATOM   473  C  CB    . PHE A 1 64  ? 9.016   -2.750  19.462  1.00 33.48 ? 95  PHE A CB    1 
ATOM   474  C  CG    . PHE A 1 64  ? 8.548   -1.593  18.581  1.00 33.65 ? 95  PHE A CG    1 
ATOM   475  C  CD1   . PHE A 1 64  ? 8.308   -0.332  19.125  1.00 33.22 ? 95  PHE A CD1   1 
ATOM   476  C  CD2   . PHE A 1 64  ? 8.310   -1.784  17.220  1.00 33.29 ? 95  PHE A CD2   1 
ATOM   477  C  CE1   . PHE A 1 64  ? 7.874   0.718   18.331  1.00 33.00 ? 95  PHE A CE1   1 
ATOM   478  C  CE2   . PHE A 1 64  ? 7.865   -0.741  16.414  1.00 33.24 ? 95  PHE A CE2   1 
ATOM   479  C  CZ    . PHE A 1 64  ? 7.652   0.515   16.970  1.00 33.88 ? 95  PHE A CZ    1 
ATOM   480  N  N     . GLY A 1 65  ? 10.406  -3.446  22.306  1.00 32.87 ? 96  GLY A N     1 
ATOM   481  C  CA    . GLY A 1 65  ? 10.458  -4.486  23.328  1.00 32.68 ? 96  GLY A CA    1 
ATOM   482  C  C     . GLY A 1 65  ? 9.511   -5.610  22.932  1.00 32.62 ? 96  GLY A C     1 
ATOM   483  O  O     . GLY A 1 65  ? 9.880   -6.792  22.959  1.00 32.61 ? 96  GLY A O     1 
ATOM   484  N  N     . ASP A 1 66  ? 8.292   -5.217  22.555  1.00 32.24 ? 97  ASP A N     1 
ATOM   485  C  CA    . ASP A 1 66  ? 7.226   -6.134  22.174  1.00 31.97 ? 97  ASP A CA    1 
ATOM   486  C  C     . ASP A 1 66  ? 6.809   -5.778  20.749  1.00 31.73 ? 97  ASP A C     1 
ATOM   487  O  O     . ASP A 1 66  ? 6.472   -4.621  20.447  1.00 31.63 ? 97  ASP A O     1 
ATOM   488  C  CB    . ASP A 1 66  ? 6.050   -5.946  23.134  1.00 32.07 ? 97  ASP A CB    1 
ATOM   489  C  CG    . ASP A 1 66  ? 4.836   -6.786  22.778  1.00 33.32 ? 97  ASP A CG    1 
ATOM   490  O  OD1   . ASP A 1 66  ? 3.889   -6.803  23.606  1.00 34.93 ? 97  ASP A OD1   1 
ATOM   491  O  OD2   . ASP A 1 66  ? 4.814   -7.441  21.707  1.00 34.59 ? 97  ASP A OD2   1 
ATOM   492  N  N     . SER A 1 67  ? 6.814   -6.769  19.871  1.00 31.08 ? 98  SER A N     1 
ATOM   493  C  CA    . SER A 1 67  ? 6.511   -6.528  18.458  1.00 31.04 ? 98  SER A CA    1 
ATOM   494  C  C     . SER A 1 67  ? 5.039   -6.161  18.126  1.00 30.95 ? 98  SER A C     1 
ATOM   495  O  O     . SER A 1 67  ? 4.745   -5.754  16.990  1.00 31.01 ? 98  SER A O     1 
ATOM   496  C  CB    . SER A 1 67  ? 6.922   -7.737  17.609  1.00 30.88 ? 98  SER A CB    1 
ATOM   497  O  OG    . SER A 1 67  ? 6.152   -8.871  17.962  1.00 30.36 ? 98  SER A OG    1 
ATOM   498  N  N     . ALA A 1 68  ? 4.119   -6.335  19.077  1.00 30.62 ? 99  ALA A N     1 
ATOM   499  C  CA    . ALA A 1 68  ? 2.744   -5.845  18.903  1.00 30.27 ? 99  ALA A CA    1 
ATOM   500  C  C     . ALA A 1 68  ? 2.731   -4.301  18.808  1.00 30.01 ? 99  ALA A C     1 
ATOM   501  O  O     . ALA A 1 68  ? 1.796   -3.716  18.278  1.00 29.99 ? 99  ALA A O     1 
ATOM   502  C  CB    . ALA A 1 68  ? 1.829   -6.340  20.024  1.00 29.69 ? 99  ALA A CB    1 
ATOM   503  N  N     . ARG A 1 69  ? 3.775   -3.647  19.311  1.00 29.73 ? 100 ARG A N     1 
ATOM   504  C  CA    . ARG A 1 69  ? 3.886   -2.191  19.216  1.00 29.63 ? 100 ARG A CA    1 
ATOM   505  C  C     . ARG A 1 69  ? 4.043   -1.677  17.782  1.00 29.72 ? 100 ARG A C     1 
ATOM   506  O  O     . ARG A 1 69  ? 3.801   -0.500  17.515  1.00 29.51 ? 100 ARG A O     1 
ATOM   507  C  CB    . ARG A 1 69  ? 5.064   -1.700  20.052  1.00 29.63 ? 100 ARG A CB    1 
ATOM   508  C  CG    . ARG A 1 69  ? 4.957   -1.989  21.555  1.00 29.49 ? 100 ARG A CG    1 
ATOM   509  C  CD    . ARG A 1 69  ? 3.791   -1.256  22.196  1.00 28.88 ? 100 ARG A CD    1 
ATOM   510  N  NE    . ARG A 1 69  ? 2.532   -1.919  21.889  1.00 27.76 ? 100 ARG A NE    1 
ATOM   511  C  CZ    . ARG A 1 69  ? 2.068   -2.978  22.529  1.00 26.51 ? 100 ARG A CZ    1 
ATOM   512  N  NH1   . ARG A 1 69  ? 2.744   -3.498  23.537  1.00 26.71 ? 100 ARG A NH1   1 
ATOM   513  N  NH2   . ARG A 1 69  ? 0.922   -3.510  22.156  1.00 26.92 ? 100 ARG A NH2   1 
ATOM   514  N  N     . ALA A 1 70  ? 4.431   -2.564  16.866  1.00 30.02 ? 101 ALA A N     1 
ATOM   515  C  CA    . ALA A 1 70  ? 4.559   -2.219  15.449  1.00 30.08 ? 101 ALA A CA    1 
ATOM   516  C  C     . ALA A 1 70  ? 3.234   -1.718  14.904  1.00 30.06 ? 101 ALA A C     1 
ATOM   517  O  O     . ALA A 1 70  ? 3.189   -0.687  14.257  1.00 29.72 ? 101 ALA A O     1 
ATOM   518  C  CB    . ALA A 1 70  ? 5.056   -3.420  14.638  1.00 29.77 ? 101 ALA A CB    1 
ATOM   519  N  N     . ASP A 1 71  ? 2.150   -2.427  15.201  1.00 30.41 ? 102 ASP A N     1 
ATOM   520  C  CA    . ASP A 1 71  ? 0.841   -1.964  14.774  1.00 30.64 ? 102 ASP A CA    1 
ATOM   521  C  C     . ASP A 1 71  ? 0.396   -0.660  15.478  1.00 30.62 ? 102 ASP A C     1 
ATOM   522  O  O     . ASP A 1 71  ? -0.295  0.158   14.875  1.00 30.21 ? 102 ASP A O     1 
ATOM   523  C  CB    . ASP A 1 71  ? -0.227  -3.036  14.933  1.00 30.82 ? 102 ASP A CB    1 
ATOM   524  C  CG    . ASP A 1 71  ? -1.442  -2.744  14.070  1.00 32.17 ? 102 ASP A CG    1 
ATOM   525  O  OD1   . ASP A 1 71  ? -2.564  -2.627  14.621  1.00 32.21 ? 102 ASP A OD1   1 
ATOM   526  O  OD2   . ASP A 1 71  ? -1.240  -2.569  12.840  1.00 33.62 ? 102 ASP A OD2   1 
ATOM   527  N  N     . ASP A 1 72  ? 0.778   -0.472  16.742  1.00 30.45 ? 103 ASP A N     1 
ATOM   528  C  CA    . ASP A 1 72  ? 0.522   0.794   17.416  1.00 30.22 ? 103 ASP A CA    1 
ATOM   529  C  C     . ASP A 1 72  ? 1.235   1.944   16.721  1.00 30.41 ? 103 ASP A C     1 
ATOM   530  O  O     . ASP A 1 72  ? 0.674   3.040   16.574  1.00 30.31 ? 103 ASP A O     1 
ATOM   531  C  CB    . ASP A 1 72  ? 0.905   0.720   18.898  1.00 29.96 ? 103 ASP A CB    1 
ATOM   532  C  CG    . ASP A 1 72  ? -0.124  -0.062  19.728  1.00 28.38 ? 103 ASP A CG    1 
ATOM   533  O  OD1   . ASP A 1 72  ? -1.259  -0.262  19.267  1.00 26.76 ? 103 ASP A OD1   1 
ATOM   534  O  OD2   . ASP A 1 72  ? 0.187   -0.468  20.849  1.00 25.90 ? 103 ASP A OD2   1 
ATOM   535  N  N     . ALA A 1 73  ? 2.461   1.692   16.268  1.00 30.49 ? 104 ALA A N     1 
ATOM   536  C  CA    . ALA A 1 73  ? 3.270   2.738   15.632  1.00 30.06 ? 104 ALA A CA    1 
ATOM   537  C  C     . ALA A 1 73  ? 2.658   3.138   14.287  1.00 30.16 ? 104 ALA A C     1 
ATOM   538  O  O     . ALA A 1 73  ? 2.665   4.317   13.905  1.00 29.55 ? 104 ALA A O     1 
ATOM   539  C  CB    . ALA A 1 73  ? 4.682   2.263   15.441  1.00 29.75 ? 104 ALA A CB    1 
ATOM   540  N  N     . ARG A 1 74  ? 2.134   2.156   13.566  1.00 29.98 ? 105 ARG A N     1 
ATOM   541  C  CA    . ARG A 1 74  ? 1.507   2.415   12.297  1.00 30.47 ? 105 ARG A CA    1 
ATOM   542  C  C     . ARG A 1 74  ? 0.233   3.245   12.520  1.00 30.44 ? 105 ARG A C     1 
ATOM   543  O  O     . ARG A 1 74  ? -0.002  4.270   11.862  1.00 29.71 ? 105 ARG A O     1 
ATOM   544  C  CB    . ARG A 1 74  ? 1.184   1.063   11.687  1.00 30.67 ? 105 ARG A CB    1 
ATOM   545  C  CG    . ARG A 1 74  ? 0.581   1.074   10.323  1.00 31.74 ? 105 ARG A CG    1 
ATOM   546  C  CD    . ARG A 1 74  ? -0.598  0.152   10.290  1.00 32.46 ? 105 ARG A CD    1 
ATOM   547  N  NE    . ARG A 1 74  ? -1.822  0.914   10.514  1.00 33.02 ? 105 ARG A NE    1 
ATOM   548  C  CZ    . ARG A 1 74  ? -2.942  0.421   11.037  1.00 32.99 ? 105 ARG A CZ    1 
ATOM   549  N  NH1   . ARG A 1 74  ? -3.990  1.214   11.162  1.00 32.58 ? 105 ARG A NH1   1 
ATOM   550  N  NH2   . ARG A 1 74  ? -3.021  -0.842  11.454  1.00 32.80 ? 105 ARG A NH2   1 
ATOM   551  N  N     . GLN A 1 75  ? -0.571  2.785   13.470  1.00 30.43 ? 106 GLN A N     1 
ATOM   552  C  CA    . GLN A 1 75  ? -1.778  3.483   13.901  1.00 30.68 ? 106 GLN A CA    1 
ATOM   553  C  C     . GLN A 1 75  ? -1.427  4.927   14.321  1.00 30.24 ? 106 GLN A C     1 
ATOM   554  O  O     . GLN A 1 75  ? -2.110  5.877   13.926  1.00 30.03 ? 106 GLN A O     1 
ATOM   555  C  CB    . GLN A 1 75  ? -2.448  2.713   15.058  1.00 30.81 ? 106 GLN A CB    1 
ATOM   556  C  CG    . GLN A 1 75  ? -3.918  2.407   14.898  1.00 31.66 ? 106 GLN A CG    1 
ATOM   557  C  CD    . GLN A 1 75  ? -4.436  1.447   15.980  1.00 31.82 ? 106 GLN A CD    1 
ATOM   558  O  OE1   . GLN A 1 75  ? -5.113  1.865   16.917  1.00 32.83 ? 106 GLN A OE1   1 
ATOM   559  N  NE2   . GLN A 1 75  ? -4.102  0.158   15.857  1.00 33.01 ? 106 GLN A NE2   1 
ATOM   560  N  N     . LEU A 1 76  ? -0.358  5.107   15.089  1.00 29.93 ? 107 LEU A N     1 
ATOM   561  C  CA    . LEU A 1 76  ? 0.068   6.471   15.461  1.00 29.64 ? 107 LEU A CA    1 
ATOM   562  C  C     . LEU A 1 76  ? 0.221   7.380   14.247  1.00 29.78 ? 107 LEU A C     1 
ATOM   563  O  O     . LEU A 1 76  ? -0.316  8.487   14.238  1.00 30.27 ? 107 LEU A O     1 
ATOM   564  C  CB    . LEU A 1 76  ? 1.373   6.471   16.264  1.00 29.55 ? 107 LEU A CB    1 
ATOM   565  C  CG    . LEU A 1 76  ? 1.985   7.844   16.604  1.00 29.71 ? 107 LEU A CG    1 
ATOM   566  C  CD1   . LEU A 1 76  ? 0.975   8.757   17.338  1.00 27.85 ? 107 LEU A CD1   1 
ATOM   567  C  CD2   . LEU A 1 76  ? 3.274   7.659   17.401  1.00 28.67 ? 107 LEU A CD2   1 
ATOM   568  N  N     . PHE A 1 77  ? 0.937   6.922   13.225  1.00 29.75 ? 108 PHE A N     1 
ATOM   569  C  CA    . PHE A 1 77  ? 1.141   7.736   12.024  1.00 29.83 ? 108 PHE A CA    1 
ATOM   570  C  C     . PHE A 1 77  ? -0.166  8.038   11.302  1.00 29.80 ? 108 PHE A C     1 
ATOM   571  O  O     . PHE A 1 77  ? -0.337  9.144   10.812  1.00 30.46 ? 108 PHE A O     1 
ATOM   572  C  CB    . PHE A 1 77  ? 2.114   7.074   11.046  1.00 29.90 ? 108 PHE A CB    1 
ATOM   573  C  CG    . PHE A 1 77  ? 3.540   7.006   11.538  1.00 31.10 ? 108 PHE A CG    1 
ATOM   574  C  CD1   . PHE A 1 77  ? 4.307   8.154   11.654  1.00 32.16 ? 108 PHE A CD1   1 
ATOM   575  C  CD2   . PHE A 1 77  ? 4.137   5.782   11.839  1.00 31.57 ? 108 PHE A CD2   1 
ATOM   576  C  CE1   . PHE A 1 77  ? 5.635   8.086   12.097  1.00 32.74 ? 108 PHE A CE1   1 
ATOM   577  C  CE2   . PHE A 1 77  ? 5.462   5.713   12.283  1.00 32.00 ? 108 PHE A CE2   1 
ATOM   578  C  CZ    . PHE A 1 77  ? 6.205   6.869   12.422  1.00 31.77 ? 108 PHE A CZ    1 
ATOM   579  N  N     . VAL A 1 78  ? -1.077  7.073   11.212  1.00 29.81 ? 109 VAL A N     1 
ATOM   580  C  CA    . VAL A 1 78  ? -2.318  7.312   10.485  1.00 29.79 ? 109 VAL A CA    1 
ATOM   581  C  C     . VAL A 1 78  ? -3.208  8.227   11.318  1.00 30.22 ? 109 VAL A C     1 
ATOM   582  O  O     . VAL A 1 78  ? -3.808  9.159   10.797  1.00 30.08 ? 109 VAL A O     1 
ATOM   583  C  CB    . VAL A 1 78  ? -3.064  6.050   10.132  1.00 29.67 ? 109 VAL A CB    1 
ATOM   584  C  CG1   . VAL A 1 78  ? -4.473  6.420   9.695   1.00 28.01 ? 109 VAL A CG1   1 
ATOM   585  C  CG2   . VAL A 1 78  ? -2.286  5.295   9.037   1.00 29.72 ? 109 VAL A CG2   1 
ATOM   586  N  N     . LEU A 1 79  ? -3.296  7.955   12.614  1.00 30.69 ? 110 LEU A N     1 
ATOM   587  C  CA    . LEU A 1 79  ? -4.130  8.776   13.480  1.00 31.19 ? 110 LEU A CA    1 
ATOM   588  C  C     . LEU A 1 79  ? -3.643  10.219  13.466  1.00 32.10 ? 110 LEU A C     1 
ATOM   589  O  O     . LEU A 1 79  ? -4.456  11.129  13.263  1.00 32.44 ? 110 LEU A O     1 
ATOM   590  C  CB    . LEU A 1 79  ? -4.160  8.243   14.916  1.00 30.65 ? 110 LEU A CB    1 
ATOM   591  C  CG    . LEU A 1 79  ? -5.076  7.035   15.105  1.00 30.26 ? 110 LEU A CG    1 
ATOM   592  C  CD1   . LEU A 1 79  ? -4.914  6.497   16.521  1.00 28.69 ? 110 LEU A CD1   1 
ATOM   593  C  CD2   . LEU A 1 79  ? -6.540  7.370   14.789  1.00 28.00 ? 110 LEU A CD2   1 
ATOM   594  N  N     . ALA A 1 80  ? -2.329  10.417  13.642  1.00 32.70 ? 111 ALA A N     1 
ATOM   595  C  CA    . ALA A 1 80  ? -1.734  11.774  13.751  1.00 33.50 ? 111 ALA A CA    1 
ATOM   596  C  C     . ALA A 1 80  ? -1.676  12.590  12.452  1.00 34.23 ? 111 ALA A C     1 
ATOM   597  O  O     . ALA A 1 80  ? -2.741  13.003  11.917  1.00 35.46 ? 111 ALA A O     1 
ATOM   598  C  CB    . ALA A 1 80  ? -0.309  11.695  14.324  1.00 33.42 ? 111 ALA A CB    1 
ATOM   599  N  N     . MET A 1 88  ? -7.602  14.953  21.152  1.00 37.53 ? 119 MET A N     1 
ATOM   600  C  CA    . MET A 1 88  ? -6.948  13.654  21.275  1.00 37.19 ? 119 MET A CA    1 
ATOM   601  C  C     . MET A 1 88  ? -7.993  12.599  21.572  1.00 35.81 ? 119 MET A C     1 
ATOM   602  O  O     . MET A 1 88  ? -8.697  12.720  22.556  1.00 36.00 ? 119 MET A O     1 
ATOM   603  C  CB    . MET A 1 88  ? -5.926  13.677  22.426  1.00 37.22 ? 119 MET A CB    1 
ATOM   604  C  CG    . MET A 1 88  ? -5.610  12.300  23.032  1.00 37.72 ? 119 MET A CG    1 
ATOM   605  S  SD    . MET A 1 88  ? -3.834  12.007  23.156  1.00 39.36 ? 119 MET A SD    1 
ATOM   606  C  CE    . MET A 1 88  ? -3.418  12.822  24.692  1.00 40.64 ? 119 MET A CE    1 
ATOM   607  N  N     . THR A 1 89  ? -8.088  11.559  20.740  1.00 34.78 ? 120 THR A N     1 
ATOM   608  C  CA    . THR A 1 89  ? -9.017  10.447  21.020  1.00 33.63 ? 120 THR A CA    1 
ATOM   609  C  C     . THR A 1 89  ? -8.524  9.515   22.122  1.00 32.76 ? 120 THR A C     1 
ATOM   610  O  O     . THR A 1 89  ? -7.334  9.475   22.461  1.00 32.66 ? 120 THR A O     1 
ATOM   611  C  CB    . THR A 1 89  ? -9.288  9.560   19.789  1.00 33.52 ? 120 THR A CB    1 
ATOM   612  O  OG1   . THR A 1 89  ? -8.042  9.164   19.204  1.00 33.51 ? 120 THR A OG1   1 
ATOM   613  C  CG2   . THR A 1 89  ? -10.149 10.294  18.773  1.00 33.49 ? 120 THR A CG2   1 
ATOM   614  N  N     . ALA A 1 90  ? -9.459  8.733   22.653  1.00 31.87 ? 121 ALA A N     1 
ATOM   615  C  CA    . ALA A 1 90  ? -9.132  7.677   23.597  1.00 30.95 ? 121 ALA A CA    1 
ATOM   616  C  C     . ALA A 1 90  ? -8.279  6.621   22.914  1.00 30.36 ? 121 ALA A C     1 
ATOM   617  O  O     . ALA A 1 90  ? -7.349  6.091   23.523  1.00 30.27 ? 121 ALA A O     1 
ATOM   618  C  CB    . ALA A 1 90  ? -10.390 7.066   24.148  1.00 30.98 ? 121 ALA A CB    1 
ATOM   619  N  N     . GLU A 1 91  ? -8.590  6.338   21.645  1.00 29.58 ? 122 GLU A N     1 
ATOM   620  C  CA    . GLU A 1 91  ? -7.808  5.421   20.838  1.00 29.08 ? 122 GLU A CA    1 
ATOM   621  C  C     . GLU A 1 91  ? -6.374  5.920   20.654  1.00 28.63 ? 122 GLU A C     1 
ATOM   622  O  O     . GLU A 1 91  ? -5.420  5.164   20.846  1.00 28.58 ? 122 GLU A O     1 
ATOM   623  C  CB    . GLU A 1 91  ? -8.476  5.225   19.482  1.00 29.24 ? 122 GLU A CB    1 
ATOM   624  C  CG    . GLU A 1 91  ? -7.668  4.334   18.516  1.00 30.19 ? 122 GLU A CG    1 
ATOM   625  C  CD    . GLU A 1 91  ? -8.321  4.156   17.145  1.00 29.92 ? 122 GLU A CD    1 
ATOM   626  O  OE1   . GLU A 1 91  ? -8.756  5.152   16.530  1.00 30.26 ? 122 GLU A OE1   1 
ATOM   627  O  OE2   . GLU A 1 91  ? -8.373  3.004   16.681  1.00 31.60 ? 122 GLU A OE2   1 
ATOM   628  N  N     . LEU A 1 92  ? -6.214  7.184   20.279  1.00 28.02 ? 123 LEU A N     1 
ATOM   629  C  CA    . LEU A 1 92  ? -4.878  7.717   20.068  1.00 27.68 ? 123 LEU A CA    1 
ATOM   630  C  C     . LEU A 1 92  ? -4.131  7.733   21.398  1.00 27.94 ? 123 LEU A C     1 
ATOM   631  O  O     . LEU A 1 92  ? -2.951  7.391   21.445  1.00 27.91 ? 123 LEU A O     1 
ATOM   632  C  CB    . LEU A 1 92  ? -4.902  9.113   19.438  1.00 27.45 ? 123 LEU A CB    1 
ATOM   633  C  CG    . LEU A 1 92  ? -3.559  9.849   19.387  1.00 26.72 ? 123 LEU A CG    1 
ATOM   634  C  CD1   . LEU A 1 92  ? -2.513  8.993   18.738  1.00 25.25 ? 123 LEU A CD1   1 
ATOM   635  C  CD2   . LEU A 1 92  ? -3.682  11.183  18.652  1.00 27.50 ? 123 LEU A CD2   1 
ATOM   636  N  N     . ALA A 1 93  ? -4.816  8.126   22.473  1.00 28.04 ? 124 ALA A N     1 
ATOM   637  C  CA    . ALA A 1 93  ? -4.217  8.133   23.823  1.00 28.07 ? 124 ALA A CA    1 
ATOM   638  C  C     . ALA A 1 93  ? -3.618  6.778   24.154  1.00 27.98 ? 124 ALA A C     1 
ATOM   639  O  O     . ALA A 1 93  ? -2.485  6.665   24.592  1.00 28.02 ? 124 ALA A O     1 
ATOM   640  C  CB    . ALA A 1 93  ? -5.295  8.482   24.899  1.00 27.72 ? 124 ALA A CB    1 
ATOM   641  N  N     . GLY A 1 94  ? -4.409  5.744   23.946  1.00 28.37 ? 125 GLY A N     1 
ATOM   642  C  CA    . GLY A 1 94  ? -3.994  4.380   24.257  1.00 28.68 ? 125 GLY A CA    1 
ATOM   643  C  C     . GLY A 1 94  ? -2.837  3.889   23.405  1.00 29.00 ? 125 GLY A C     1 
ATOM   644  O  O     . GLY A 1 94  ? -2.001  3.107   23.865  1.00 28.91 ? 125 GLY A O     1 
ATOM   645  N  N     . VAL A 1 95  ? -2.817  4.330   22.148  1.00 29.22 ? 126 VAL A N     1 
ATOM   646  C  CA    . VAL A 1 95  ? -1.700  4.089   21.265  1.00 29.13 ? 126 VAL A CA    1 
ATOM   647  C  C     . VAL A 1 95  ? -0.455  4.750   21.830  1.00 29.74 ? 126 VAL A C     1 
ATOM   648  O  O     . VAL A 1 95  ? 0.620   4.150   21.846  1.00 30.05 ? 126 VAL A O     1 
ATOM   649  C  CB    . VAL A 1 95  ? -2.033  4.578   19.818  1.00 29.35 ? 126 VAL A CB    1 
ATOM   650  C  CG1   . VAL A 1 95  ? -0.774  4.985   19.040  1.00 27.84 ? 126 VAL A CG1   1 
ATOM   651  C  CG2   . VAL A 1 95  ? -2.862  3.496   19.077  1.00 27.57 ? 126 VAL A CG2   1 
ATOM   652  N  N     . ILE A 1 96  ? -0.591  5.982   22.306  1.00 30.20 ? 127 ILE A N     1 
ATOM   653  C  CA    . ILE A 1 96  ? 0.576   6.720   22.762  1.00 30.49 ? 127 ILE A CA    1 
ATOM   654  C  C     . ILE A 1 96  ? 1.110   6.126   24.059  1.00 31.12 ? 127 ILE A C     1 
ATOM   655  O  O     . ILE A 1 96  ? 2.322   5.998   24.237  1.00 31.33 ? 127 ILE A O     1 
ATOM   656  C  CB    . ILE A 1 96  ? 0.266   8.192   22.963  1.00 30.30 ? 127 ILE A CB    1 
ATOM   657  C  CG1   . ILE A 1 96  ? 0.030   8.867   21.612  1.00 29.51 ? 127 ILE A CG1   1 
ATOM   658  C  CG2   . ILE A 1 96  ? 1.426   8.890   23.664  1.00 30.43 ? 127 ILE A CG2   1 
ATOM   659  C  CD1   . ILE A 1 96  ? -0.348  10.329  21.743  1.00 28.06 ? 127 ILE A CD1   1 
ATOM   660  N  N     . LYS A 1 97  ? 0.199   5.762   24.961  1.00 31.63 ? 128 LYS A N     1 
ATOM   661  C  CA    . LYS A 1 97  ? 0.577   5.166   26.260  1.00 31.64 ? 128 LYS A CA    1 
ATOM   662  C  C     . LYS A 1 97  ? 1.335   3.874   26.059  1.00 31.29 ? 128 LYS A C     1 
ATOM   663  O  O     . LYS A 1 97  ? 2.286   3.580   26.777  1.00 31.59 ? 128 LYS A O     1 
ATOM   664  C  CB    . LYS A 1 97  ? -0.649  4.839   27.135  1.00 31.60 ? 128 LYS A CB    1 
ATOM   665  C  CG    . LYS A 1 97  ? -1.304  6.040   27.827  1.00 32.44 ? 128 LYS A CG    1 
ATOM   666  C  CD    . LYS A 1 97  ? -2.434  5.614   28.783  1.00 32.33 ? 128 LYS A CD    1 
ATOM   667  C  CE    . LYS A 1 97  ? -3.737  6.419   28.565  1.00 33.48 ? 128 LYS A CE    1 
ATOM   668  N  NZ    . LYS A 1 97  ? -4.952  5.505   28.533  1.00 33.45 ? 128 LYS A NZ    1 
ATOM   669  N  N     . ARG A 1 98  ? 0.889   3.074   25.109  1.00 30.87 ? 129 ARG A N     1 
ATOM   670  C  CA    . ARG A 1 98  ? 1.480   1.749   24.955  1.00 31.02 ? 129 ARG A CA    1 
ATOM   671  C  C     . ARG A 1 98  ? 2.850   1.873   24.324  1.00 31.01 ? 129 ARG A C     1 
ATOM   672  O  O     . ARG A 1 98  ? 3.796   1.214   24.759  1.00 30.90 ? 129 ARG A O     1 
ATOM   673  C  CB    . ARG A 1 98  ? 0.569   0.785   24.176  1.00 30.91 ? 129 ARG A CB    1 
ATOM   674  C  CG    . ARG A 1 98  ? -0.447  0.066   25.055  1.00 30.93 ? 129 ARG A CG    1 
ATOM   675  C  CD    . ARG A 1 98  ? -1.478  -0.788  24.246  1.00 31.62 ? 129 ARG A CD    1 
ATOM   676  N  NE    . ARG A 1 98  ? -2.588  0.040   23.741  1.00 32.89 ? 129 ARG A NE    1 
ATOM   677  C  CZ    . ARG A 1 98  ? -2.980  0.123   22.472  1.00 32.03 ? 129 ARG A CZ    1 
ATOM   678  N  NH1   . ARG A 1 98  ? -3.973  0.928   22.130  1.00 31.29 ? 129 ARG A NH1   1 
ATOM   679  N  NH2   . ARG A 1 98  ? -2.397  -0.595  21.539  1.00 33.43 ? 129 ARG A NH2   1 
ATOM   680  N  N     . LEU A 1 99  ? 2.975   2.749   23.332  1.00 31.12 ? 130 LEU A N     1 
ATOM   681  C  CA    . LEU A 1 99  ? 4.282   3.021   22.749  1.00 31.07 ? 130 LEU A CA    1 
ATOM   682  C  C     . LEU A 1 99  ? 5.251   3.537   23.805  1.00 31.44 ? 130 LEU A C     1 
ATOM   683  O  O     . LEU A 1 99  ? 6.352   3.021   23.931  1.00 31.53 ? 130 LEU A O     1 
ATOM   684  C  CB    . LEU A 1 99  ? 4.150   3.979   21.565  1.00 30.59 ? 130 LEU A CB    1 
ATOM   685  C  CG    . LEU A 1 99  ? 3.601   3.317   20.298  1.00 28.83 ? 130 LEU A CG    1 
ATOM   686  C  CD1   . LEU A 1 99  ? 3.270   4.335   19.247  1.00 27.10 ? 130 LEU A CD1   1 
ATOM   687  C  CD2   . LEU A 1 99  ? 4.580   2.315   19.756  1.00 26.56 ? 130 LEU A CD2   1 
ATOM   688  N  N     . TRP A 1 100 ? 4.804   4.505   24.597  1.00 32.14 ? 131 TRP A N     1 
ATOM   689  C  CA    . TRP A 1 100 ? 5.658   5.184   25.593  1.00 32.53 ? 131 TRP A CA    1 
ATOM   690  C  C     . TRP A 1 100 ? 6.202   4.252   26.676  1.00 32.68 ? 131 TRP A C     1 
ATOM   691  O  O     . TRP A 1 100 ? 7.305   4.438   27.163  1.00 33.17 ? 131 TRP A O     1 
ATOM   692  C  CB    . TRP A 1 100 ? 4.868   6.319   26.246  1.00 32.40 ? 131 TRP A CB    1 
ATOM   693  C  CG    . TRP A 1 100 ? 5.622   7.113   27.229  1.00 32.48 ? 131 TRP A CG    1 
ATOM   694  C  CD1   . TRP A 1 100 ? 5.264   7.362   28.518  1.00 32.12 ? 131 TRP A CD1   1 
ATOM   695  C  CD2   . TRP A 1 100 ? 6.864   7.797   27.011  1.00 31.88 ? 131 TRP A CD2   1 
ATOM   696  N  NE1   . TRP A 1 100 ? 6.202   8.149   29.122  1.00 32.60 ? 131 TRP A NE1   1 
ATOM   697  C  CE2   . TRP A 1 100 ? 7.202   8.427   28.223  1.00 32.60 ? 131 TRP A CE2   1 
ATOM   698  C  CE3   . TRP A 1 100 ? 7.730   7.916   25.918  1.00 32.22 ? 131 TRP A CE3   1 
ATOM   699  C  CZ2   . TRP A 1 100 ? 8.372   9.175   28.380  1.00 32.60 ? 131 TRP A CZ2   1 
ATOM   700  C  CZ3   . TRP A 1 100 ? 8.888   8.669   26.059  1.00 33.06 ? 131 TRP A CZ3   1 
ATOM   701  C  CH2   . TRP A 1 100 ? 9.205   9.287   27.291  1.00 33.12 ? 131 TRP A CH2   1 
ATOM   702  N  N     . LYS A 1 101 ? 5.421   3.252   27.045  1.00 32.73 ? 132 LYS A N     1 
ATOM   703  C  CA    . LYS A 1 101 ? 5.800   2.313   28.094  1.00 32.75 ? 132 LYS A CA    1 
ATOM   704  C  C     . LYS A 1 101 ? 6.678   1.159   27.581  1.00 32.51 ? 132 LYS A C     1 
ATOM   705  O  O     . LYS A 1 101 ? 7.201   0.376   28.367  1.00 32.22 ? 132 LYS A O     1 
ATOM   706  C  CB    . LYS A 1 101 ? 4.518   1.755   28.753  1.00 32.69 ? 132 LYS A CB    1 
ATOM   707  C  CG    . LYS A 1 101 ? 4.674   0.458   29.550  1.00 33.12 ? 132 LYS A CG    1 
ATOM   708  N  N     . ASP A 1 102 ? 6.818   1.056   26.257  1.00 32.50 ? 133 ASP A N     1 
ATOM   709  C  CA    . ASP A 1 102 ? 7.577   -0.028  25.602  1.00 31.89 ? 133 ASP A CA    1 
ATOM   710  C  C     . ASP A 1 102 ? 9.078   0.145   25.773  1.00 31.85 ? 133 ASP A C     1 
ATOM   711  O  O     . ASP A 1 102 ? 9.635   1.214   25.500  1.00 31.82 ? 133 ASP A O     1 
ATOM   712  C  CB    . ASP A 1 102 ? 7.243   -0.055  24.096  1.00 32.02 ? 133 ASP A CB    1 
ATOM   713  C  CG    . ASP A 1 102 ? 7.941   -1.207  23.305  1.00 30.99 ? 133 ASP A CG    1 
ATOM   714  O  OD1   . ASP A 1 102 ? 7.509   -2.373  23.387  1.00 30.81 ? 133 ASP A OD1   1 
ATOM   715  O  OD2   . ASP A 1 102 ? 8.879   -0.934  22.529  1.00 29.47 ? 133 ASP A OD2   1 
ATOM   716  N  N     . SER A 1 103 ? 9.721   -0.929  26.206  1.00 31.61 ? 134 SER A N     1 
ATOM   717  C  CA    . SER A 1 103 ? 11.158  -0.980  26.471  1.00 31.68 ? 134 SER A CA    1 
ATOM   718  C  C     . SER A 1 103 ? 12.067  -0.360  25.399  1.00 31.14 ? 134 SER A C     1 
ATOM   719  O  O     . SER A 1 103 ? 13.087  0.251   25.711  1.00 31.49 ? 134 SER A O     1 
ATOM   720  C  CB    . SER A 1 103 ? 11.538  -2.461  26.597  1.00 31.99 ? 134 SER A CB    1 
ATOM   721  O  OG    . SER A 1 103 ? 12.871  -2.618  27.028  1.00 33.47 ? 134 SER A OG    1 
ATOM   722  N  N     . GLY A 1 104 ? 11.702  -0.565  24.139  1.00 30.75 ? 135 GLY A N     1 
ATOM   723  C  CA    . GLY A 1 104 ? 12.485  -0.114  22.978  1.00 30.16 ? 135 GLY A CA    1 
ATOM   724  C  C     . GLY A 1 104 ? 12.293  1.352   22.623  1.00 30.12 ? 135 GLY A C     1 
ATOM   725  O  O     . GLY A 1 104 ? 13.238  2.055   22.237  1.00 30.03 ? 135 GLY A O     1 
ATOM   726  N  N     . VAL A 1 105 ? 11.060  1.824   22.753  1.00 29.77 ? 136 VAL A N     1 
ATOM   727  C  CA    . VAL A 1 105 ? 10.773  3.248   22.594  1.00 29.10 ? 136 VAL A CA    1 
ATOM   728  C  C     . VAL A 1 105 ? 11.528  4.015   23.683  1.00 28.94 ? 136 VAL A C     1 
ATOM   729  O  O     . VAL A 1 105 ? 12.190  5.004   23.399  1.00 28.92 ? 136 VAL A O     1 
ATOM   730  C  CB    . VAL A 1 105 ? 9.244   3.469   22.637  1.00 29.19 ? 136 VAL A CB    1 
ATOM   731  C  CG1   . VAL A 1 105 ? 8.902   4.906   22.807  1.00 27.72 ? 136 VAL A CG1   1 
ATOM   732  C  CG2   . VAL A 1 105 ? 8.608   2.887   21.363  1.00 28.51 ? 136 VAL A CG2   1 
ATOM   733  N  N     . GLN A 1 106 ? 11.458  3.518   24.914  1.00 29.02 ? 137 GLN A N     1 
ATOM   734  C  CA    . GLN A 1 106 ? 12.254  4.053   26.025  1.00 28.96 ? 137 GLN A CA    1 
ATOM   735  C  C     . GLN A 1 106 ? 13.743  4.040   25.715  1.00 28.99 ? 137 GLN A C     1 
ATOM   736  O  O     . GLN A 1 106 ? 14.427  5.035   25.929  1.00 28.74 ? 137 GLN A O     1 
ATOM   737  C  CB    . GLN A 1 106 ? 11.979  3.259   27.295  1.00 28.54 ? 137 GLN A CB    1 
ATOM   738  C  CG    . GLN A 1 106 ? 10.681  3.677   27.921  1.00 28.93 ? 137 GLN A CG    1 
ATOM   739  C  CD    . GLN A 1 106 ? 10.628  5.171   28.170  1.00 30.13 ? 137 GLN A CD    1 
ATOM   740  O  OE1   . GLN A 1 106 ? 11.579  5.744   28.741  1.00 31.49 ? 137 GLN A OE1   1 
ATOM   741  N  NE2   . GLN A 1 106 ? 9.523   5.820   27.754  1.00 26.08 ? 137 GLN A NE2   1 
ATOM   742  N  N     . ALA A 1 107 ? 14.243  2.925   25.193  1.00 29.05 ? 138 ALA A N     1 
ATOM   743  C  CA    . ALA A 1 107 ? 15.652  2.862   24.794  1.00 29.58 ? 138 ALA A CA    1 
ATOM   744  C  C     . ALA A 1 107 ? 15.994  4.016   23.837  1.00 29.85 ? 138 ALA A C     1 
ATOM   745  O  O     . ALA A 1 107 ? 16.953  4.774   24.052  1.00 29.61 ? 138 ALA A O     1 
ATOM   746  C  CB    . ALA A 1 107 ? 15.988  1.514   24.144  1.00 29.30 ? 138 ALA A CB    1 
ATOM   747  N  N     . CYS A 1 108 ? 15.173  4.173   22.805  1.00 30.26 ? 139 CYS A N     1 
ATOM   748  C  CA    . CYS A 1 108 ? 15.353  5.267   21.835  1.00 30.74 ? 139 CYS A CA    1 
ATOM   749  C  C     . CYS A 1 108 ? 15.206  6.650   22.487  1.00 31.46 ? 139 CYS A C     1 
ATOM   750  O  O     . CYS A 1 108 ? 15.932  7.587   22.125  1.00 31.43 ? 139 CYS A O     1 
ATOM   751  C  CB    . CYS A 1 108 ? 14.406  5.128   20.643  1.00 30.70 ? 139 CYS A CB    1 
ATOM   752  S  SG    . CYS A 1 108 ? 14.776  6.159   19.168  1.00 29.31 ? 139 CYS A SG    1 
ATOM   753  N  N     . PHE A 1 109 ? 14.319  6.770   23.478  1.00 31.61 ? 140 PHE A N     1 
ATOM   754  C  CA    . PHE A 1 109 ? 14.184  8.021   24.207  1.00 31.41 ? 140 PHE A CA    1 
ATOM   755  C  C     . PHE A 1 109 ? 15.473  8.419   24.905  1.00 31.39 ? 140 PHE A C     1 
ATOM   756  O  O     . PHE A 1 109 ? 15.880  9.567   24.832  1.00 31.39 ? 140 PHE A O     1 
ATOM   757  C  CB    . PHE A 1 109 ? 13.061  7.918   25.203  1.00 31.12 ? 140 PHE A CB    1 
ATOM   758  C  CG    . PHE A 1 109 ? 12.992  9.063   26.153  1.00 31.55 ? 140 PHE A CG    1 
ATOM   759  C  CD1   . PHE A 1 109 ? 12.686  10.337  25.697  1.00 30.89 ? 140 PHE A CD1   1 
ATOM   760  C  CD2   . PHE A 1 109 ? 13.204  8.857   27.530  1.00 31.58 ? 140 PHE A CD2   1 
ATOM   761  C  CE1   . PHE A 1 109 ? 12.593  11.391  26.592  1.00 32.58 ? 140 PHE A CE1   1 
ATOM   762  C  CE2   . PHE A 1 109 ? 13.111  9.897   28.422  1.00 30.27 ? 140 PHE A CE2   1 
ATOM   763  C  CZ    . PHE A 1 109 ? 12.796  11.173  27.962  1.00 30.98 ? 140 PHE A CZ    1 
ATOM   764  N  N     . ASN A 1 110 ? 16.116  7.469   25.572  1.00 31.61 ? 141 ASN A N     1 
ATOM   765  C  CA    . ASN A 1 110 ? 17.367  7.749   26.298  1.00 31.66 ? 141 ASN A CA    1 
ATOM   766  C  C     . ASN A 1 110 ? 18.536  8.094   25.378  1.00 31.45 ? 141 ASN A C     1 
ATOM   767  O  O     . ASN A 1 110 ? 19.572  8.547   25.821  1.00 31.81 ? 141 ASN A O     1 
ATOM   768  C  CB    . ASN A 1 110 ? 17.742  6.567   27.186  1.00 31.52 ? 141 ASN A CB    1 
ATOM   769  C  CG    . ASN A 1 110 ? 16.862  6.475   28.377  1.00 31.89 ? 141 ASN A CG    1 
ATOM   770  O  OD1   . ASN A 1 110 ? 16.727  7.454   29.104  1.00 33.59 ? 141 ASN A OD1   1 
ATOM   771  N  ND2   . ASN A 1 110 ? 16.229  5.310   28.589  1.00 30.76 ? 141 ASN A ND2   1 
ATOM   772  N  N     . ARG A 1 111 ? 18.336  7.873   24.093  1.00 31.55 ? 142 ARG A N     1 
ATOM   773  C  CA    . ARG A 1 111 ? 19.291  8.227   23.072  1.00 31.62 ? 142 ARG A CA    1 
ATOM   774  C  C     . ARG A 1 111 ? 18.857  9.474   22.290  1.00 31.60 ? 142 ARG A C     1 
ATOM   775  O  O     . ARG A 1 111 ? 19.367  9.728   21.190  1.00 31.16 ? 142 ARG A O     1 
ATOM   776  C  CB    . ARG A 1 111 ? 19.467  7.044   22.097  1.00 31.77 ? 142 ARG A CB    1 
ATOM   777  C  CG    . ARG A 1 111 ? 20.103  5.764   22.722  1.00 31.91 ? 142 ARG A CG    1 
ATOM   778  C  CD    . ARG A 1 111 ? 20.154  4.549   21.759  1.00 31.92 ? 142 ARG A CD    1 
ATOM   779  N  NE    . ARG A 1 111 ? 20.766  4.850   20.460  1.00 32.51 ? 142 ARG A NE    1 
ATOM   780  C  CZ    . ARG A 1 111 ? 21.013  3.952   19.505  1.00 32.79 ? 142 ARG A CZ    1 
ATOM   781  N  NH1   . ARG A 1 111 ? 20.717  2.669   19.667  1.00 32.91 ? 142 ARG A NH1   1 
ATOM   782  N  NH2   . ARG A 1 111 ? 21.559  4.343   18.366  1.00 32.85 ? 142 ARG A NH2   1 
ATOM   783  N  N     . SER A 1 112 ? 17.967  10.282  22.868  1.00 31.66 ? 143 SER A N     1 
ATOM   784  C  CA    . SER A 1 112 ? 17.455  11.473  22.178  1.00 31.97 ? 143 SER A CA    1 
ATOM   785  C  C     . SER A 1 112 ? 18.532  12.473  21.694  1.00 32.52 ? 143 SER A C     1 
ATOM   786  O  O     . SER A 1 112 ? 18.272  13.269  20.795  1.00 33.27 ? 143 SER A O     1 
ATOM   787  C  CB    . SER A 1 112 ? 16.458  12.223  23.054  1.00 32.34 ? 143 SER A CB    1 
ATOM   788  O  OG    . SER A 1 112 ? 17.129  13.094  23.945  1.00 32.03 ? 143 SER A OG    1 
ATOM   789  N  N     . ARG A 1 113 ? 19.727  12.456  22.284  1.00 32.40 ? 144 ARG A N     1 
ATOM   790  C  CA    . ARG A 1 113 ? 20.850  13.252  21.748  1.00 32.31 ? 144 ARG A CA    1 
ATOM   791  C  C     . ARG A 1 113 ? 21.246  12.892  20.290  1.00 31.96 ? 144 ARG A C     1 
ATOM   792  O  O     . ARG A 1 113 ? 21.976  13.640  19.642  1.00 31.87 ? 144 ARG A O     1 
ATOM   793  C  CB    . ARG A 1 113 ? 22.100  13.146  22.655  1.00 32.09 ? 144 ARG A CB    1 
ATOM   794  C  CG    . ARG A 1 113 ? 22.896  11.831  22.518  1.00 32.36 ? 144 ARG A CG    1 
ATOM   795  C  CD    . ARG A 1 113 ? 24.143  11.814  23.379  1.00 33.24 ? 144 ARG A CD    1 
ATOM   796  N  NE    . ARG A 1 113 ? 25.091  12.865  22.988  1.00 34.82 ? 144 ARG A NE    1 
ATOM   797  C  CZ    . ARG A 1 113 ? 25.993  12.781  21.996  1.00 36.33 ? 144 ARG A CZ    1 
ATOM   798  N  NH1   . ARG A 1 113 ? 26.129  11.677  21.248  1.00 36.51 ? 144 ARG A NH1   1 
ATOM   799  N  NH2   . ARG A 1 113 ? 26.785  13.827  21.744  1.00 36.90 ? 144 ARG A NH2   1 
ATOM   800  N  N     . GLU A 1 114 ? 20.805  11.744  19.787  1.00 31.61 ? 145 GLU A N     1 
ATOM   801  C  CA    . GLU A 1 114 ? 21.142  11.349  18.406  1.00 31.73 ? 145 GLU A CA    1 
ATOM   802  C  C     . GLU A 1 114 ? 20.132  11.858  17.361  1.00 31.67 ? 145 GLU A C     1 
ATOM   803  O  O     . GLU A 1 114 ? 20.354  11.712  16.158  1.00 31.44 ? 145 GLU A O     1 
ATOM   804  C  CB    . GLU A 1 114 ? 21.236  9.830   18.273  1.00 31.71 ? 145 GLU A CB    1 
ATOM   805  C  CG    . GLU A 1 114 ? 22.436  9.229   18.952  1.00 32.15 ? 145 GLU A CG    1 
ATOM   806  C  CD    . GLU A 1 114 ? 22.507  7.740   18.772  1.00 32.09 ? 145 GLU A CD    1 
ATOM   807  O  OE1   . GLU A 1 114 ? 22.483  7.274   17.597  1.00 33.49 ? 145 GLU A OE1   1 
ATOM   808  O  OE2   . GLU A 1 114 ? 22.598  7.038   19.805  1.00 31.64 ? 145 GLU A OE2   1 
ATOM   809  N  N     . TYR A 1 115 ? 19.023  12.437  17.820  1.00 31.48 ? 146 TYR A N     1 
ATOM   810  C  CA    . TYR A 1 115 ? 18.057  13.087  16.920  1.00 31.30 ? 146 TYR A CA    1 
ATOM   811  C  C     . TYR A 1 115 ? 17.513  14.341  17.638  1.00 31.39 ? 146 TYR A C     1 
ATOM   812  O  O     . TYR A 1 115 ? 18.143  14.818  18.568  1.00 31.81 ? 146 TYR A O     1 
ATOM   813  C  CB    . TYR A 1 115 ? 16.949  12.114  16.493  1.00 30.81 ? 146 TYR A CB    1 
ATOM   814  C  CG    . TYR A 1 115 ? 16.277  11.408  17.648  1.00 30.23 ? 146 TYR A CG    1 
ATOM   815  C  CD1   . TYR A 1 115 ? 16.879  10.314  18.255  1.00 29.71 ? 146 TYR A CD1   1 
ATOM   816  C  CD2   . TYR A 1 115 ? 15.036  11.818  18.121  1.00 29.98 ? 146 TYR A CD2   1 
ATOM   817  C  CE1   . TYR A 1 115 ? 16.284  9.657   19.311  1.00 28.02 ? 146 TYR A CE1   1 
ATOM   818  C  CE2   . TYR A 1 115 ? 14.434  11.166  19.171  1.00 29.77 ? 146 TYR A CE2   1 
ATOM   819  C  CZ    . TYR A 1 115 ? 15.075  10.086  19.768  1.00 28.66 ? 146 TYR A CZ    1 
ATOM   820  O  OH    . TYR A 1 115 ? 14.491  9.430   20.819  1.00 29.71 ? 146 TYR A OH    1 
ATOM   821  N  N     . GLN A 1 116 ? 16.378  14.877  17.191  1.00 31.31 ? 147 GLN A N     1 
ATOM   822  C  CA    . GLN A 1 116 ? 15.821  16.130  17.702  1.00 30.80 ? 147 GLN A CA    1 
ATOM   823  C  C     . GLN A 1 116 ? 14.516  15.825  18.432  1.00 31.10 ? 147 GLN A C     1 
ATOM   824  O  O     . GLN A 1 116 ? 13.549  15.356  17.804  1.00 31.63 ? 147 GLN A O     1 
ATOM   825  C  CB    . GLN A 1 116 ? 15.558  17.110  16.531  1.00 30.43 ? 147 GLN A CB    1 
ATOM   826  C  CG    . GLN A 1 116 ? 16.802  17.767  15.915  1.00 29.01 ? 147 GLN A CG    1 
ATOM   827  C  CD    . GLN A 1 116 ? 17.535  18.631  16.944  1.00 29.94 ? 147 GLN A CD    1 
ATOM   828  O  OE1   . GLN A 1 116 ? 16.902  19.471  17.638  1.00 30.19 ? 147 GLN A OE1   1 
ATOM   829  N  NE2   . GLN A 1 116 ? 18.848  18.406  17.094  1.00 25.29 ? 147 GLN A NE2   1 
ATOM   830  N  N     . LEU A 1 117 ? 14.496  16.073  19.742  1.00 31.07 ? 148 LEU A N     1 
ATOM   831  C  CA    . LEU A 1 117 ? 13.320  15.829  20.574  1.00 30.98 ? 148 LEU A CA    1 
ATOM   832  C  C     . LEU A 1 117 ? 13.056  16.980  21.520  1.00 31.29 ? 148 LEU A C     1 
ATOM   833  O  O     . LEU A 1 117 ? 13.961  17.463  22.192  1.00 31.82 ? 148 LEU A O     1 
ATOM   834  C  CB    . LEU A 1 117 ? 13.508  14.569  21.406  1.00 30.91 ? 148 LEU A CB    1 
ATOM   835  C  CG    . LEU A 1 117 ? 12.287  13.987  22.114  1.00 29.77 ? 148 LEU A CG    1 
ATOM   836  C  CD1   . LEU A 1 117 ? 11.133  13.705  21.173  1.00 26.94 ? 148 LEU A CD1   1 
ATOM   837  C  CD2   . LEU A 1 117 ? 12.703  12.711  22.815  1.00 31.09 ? 148 LEU A CD2   1 
ATOM   838  N  N     . ASN A 1 118 ? 11.800  17.399  21.597  1.00 31.47 ? 149 ASN A N     1 
ATOM   839  C  CA    . ASN A 1 118 ? 11.395  18.423  22.552  1.00 31.62 ? 149 ASN A CA    1 
ATOM   840  C  C     . ASN A 1 118 ? 11.735  18.014  23.974  1.00 31.29 ? 149 ASN A C     1 
ATOM   841  O  O     . ASN A 1 118 ? 11.418  16.910  24.384  1.00 30.92 ? 149 ASN A O     1 
ATOM   842  C  CB    . ASN A 1 118 ? 9.877   18.620  22.541  1.00 32.22 ? 149 ASN A CB    1 
ATOM   843  C  CG    . ASN A 1 118 ? 9.352   19.045  21.212  1.00 33.01 ? 149 ASN A CG    1 
ATOM   844  O  OD1   . ASN A 1 118 ? 10.023  19.753  20.464  1.00 34.10 ? 149 ASN A OD1   1 
ATOM   845  N  ND2   . ASN A 1 118 ? 8.129   18.609  20.898  1.00 33.14 ? 149 ASN A ND2   1 
ATOM   846  N  N     . ASP A 1 119 ? 12.303  18.944  24.733  1.00 31.43 ? 150 ASP A N     1 
ATOM   847  C  CA    . ASP A 1 119 ? 12.616  18.735  26.143  1.00 31.42 ? 150 ASP A CA    1 
ATOM   848  C  C     . ASP A 1 119 ? 11.376  18.473  27.008  1.00 31.26 ? 150 ASP A C     1 
ATOM   849  O  O     . ASP A 1 119 ? 11.501  17.848  28.053  1.00 31.80 ? 150 ASP A O     1 
ATOM   850  C  CB    . ASP A 1 119 ? 13.435  19.916  26.715  1.00 31.82 ? 150 ASP A CB    1 
ATOM   851  C  CG    . ASP A 1 119 ? 14.939  19.901  26.282  1.00 32.89 ? 150 ASP A CG    1 
ATOM   852  O  OD1   . ASP A 1 119 ? 15.421  18.868  25.772  1.00 33.03 ? 150 ASP A OD1   1 
ATOM   853  O  OD2   . ASP A 1 119 ? 15.652  20.933  26.480  1.00 33.55 ? 150 ASP A OD2   1 
ATOM   854  N  N     . SER A 1 120 ? 10.185  18.897  26.586  1.00 30.82 ? 151 SER A N     1 
ATOM   855  C  CA    . SER A 1 120 ? 8.981   18.644  27.381  1.00 30.45 ? 151 SER A CA    1 
ATOM   856  C  C     . SER A 1 120 ? 8.314   17.296  27.088  1.00 30.83 ? 151 SER A C     1 
ATOM   857  O  O     . SER A 1 120 ? 7.247   16.968  27.650  1.00 31.34 ? 151 SER A O     1 
ATOM   858  C  CB    . SER A 1 120 ? 7.990   19.800  27.247  1.00 30.51 ? 151 SER A CB    1 
ATOM   859  O  OG    . SER A 1 120 ? 8.424   20.916  28.019  1.00 30.22 ? 151 SER A OG    1 
ATOM   860  N  N     . ALA A 1 121 ? 8.963   16.481  26.263  1.00 30.89 ? 152 ALA A N     1 
ATOM   861  C  CA    . ALA A 1 121 ? 8.378   15.210  25.814  1.00 30.90 ? 152 ALA A CA    1 
ATOM   862  C  C     . ALA A 1 121 ? 7.970   14.395  27.012  1.00 30.60 ? 152 ALA A C     1 
ATOM   863  O  O     . ALA A 1 121 ? 6.821   13.989  27.129  1.00 31.60 ? 152 ALA A O     1 
ATOM   864  C  CB    . ALA A 1 121 ? 9.366   14.407  24.940  1.00 30.28 ? 152 ALA A CB    1 
ATOM   865  N  N     . ALA A 1 122 ? 8.928   14.157  27.891  1.00 30.27 ? 153 ALA A N     1 
ATOM   866  C  CA    . ALA A 1 122 ? 8.706   13.321  29.057  1.00 30.16 ? 153 ALA A CA    1 
ATOM   867  C  C     . ALA A 1 122 ? 7.632   13.900  29.957  1.00 30.00 ? 153 ALA A C     1 
ATOM   868  O  O     . ALA A 1 122 ? 6.701   13.187  30.349  1.00 30.09 ? 153 ALA A O     1 
ATOM   869  C  CB    . ALA A 1 122 ? 9.990   13.140  29.822  1.00 29.92 ? 153 ALA A CB    1 
ATOM   870  N  N     . TYR A 1 123 ? 7.748   15.189  30.270  1.00 29.99 ? 154 TYR A N     1 
ATOM   871  C  CA    . TYR A 1 123 ? 6.764   15.864  31.122  1.00 30.05 ? 154 TYR A CA    1 
ATOM   872  C  C     . TYR A 1 123 ? 5.341   15.542  30.661  1.00 29.93 ? 154 TYR A C     1 
ATOM   873  O  O     . TYR A 1 123 ? 4.503   15.165  31.477  1.00 30.46 ? 154 TYR A O     1 
ATOM   874  C  CB    . TYR A 1 123 ? 7.021   17.365  31.132  1.00 30.22 ? 154 TYR A CB    1 
ATOM   875  C  CG    . TYR A 1 123 ? 5.962   18.189  31.828  1.00 29.83 ? 154 TYR A CG    1 
ATOM   876  C  CD1   . TYR A 1 123 ? 6.080   18.520  33.182  1.00 30.23 ? 154 TYR A CD1   1 
ATOM   877  C  CD2   . TYR A 1 123 ? 4.852   18.662  31.122  1.00 29.13 ? 154 TYR A CD2   1 
ATOM   878  C  CE1   . TYR A 1 123 ? 5.088   19.286  33.817  1.00 30.44 ? 154 TYR A CE1   1 
ATOM   879  C  CE2   . TYR A 1 123 ? 3.878   19.424  31.731  1.00 29.34 ? 154 TYR A CE2   1 
ATOM   880  C  CZ    . TYR A 1 123 ? 3.995   19.736  33.072  1.00 30.10 ? 154 TYR A CZ    1 
ATOM   881  O  OH    . TYR A 1 123 ? 3.035   20.502  33.657  1.00 29.79 ? 154 TYR A OH    1 
ATOM   882  N  N     . TYR A 1 124 ? 5.099   15.631  29.361  1.00 29.59 ? 155 TYR A N     1 
ATOM   883  C  CA    . TYR A 1 124 ? 3.779   15.406  28.816  1.00 29.56 ? 155 TYR A CA    1 
ATOM   884  C  C     . TYR A 1 124 ? 3.449   13.935  28.747  1.00 29.66 ? 155 TYR A C     1 
ATOM   885  O  O     . TYR A 1 124 ? 2.373   13.522  29.160  1.00 29.66 ? 155 TYR A O     1 
ATOM   886  C  CB    . TYR A 1 124 ? 3.675   16.001  27.416  1.00 29.48 ? 155 TYR A CB    1 
ATOM   887  C  CG    . TYR A 1 124 ? 3.613   17.486  27.403  1.00 29.09 ? 155 TYR A CG    1 
ATOM   888  C  CD1   . TYR A 1 124 ? 2.714   18.171  28.212  1.00 29.76 ? 155 TYR A CD1   1 
ATOM   889  C  CD2   . TYR A 1 124 ? 4.447   18.225  26.578  1.00 29.94 ? 155 TYR A CD2   1 
ATOM   890  C  CE1   . TYR A 1 124 ? 2.661   19.571  28.199  1.00 30.34 ? 155 TYR A CE1   1 
ATOM   891  C  CE2   . TYR A 1 124 ? 4.400   19.617  26.560  1.00 29.68 ? 155 TYR A CE2   1 
ATOM   892  C  CZ    . TYR A 1 124 ? 3.507   20.281  27.362  1.00 29.26 ? 155 TYR A CZ    1 
ATOM   893  O  OH    . TYR A 1 124 ? 3.457   21.644  27.335  1.00 28.74 ? 155 TYR A OH    1 
ATOM   894  N  N     . LEU A 1 125 ? 4.380   13.152  28.206  1.00 30.06 ? 156 LEU A N     1 
ATOM   895  C  CA    . LEU A 1 125 ? 4.151   11.719  27.977  1.00 30.02 ? 156 LEU A CA    1 
ATOM   896  C  C     . LEU A 1 125 ? 3.974   10.955  29.297  1.00 30.64 ? 156 LEU A C     1 
ATOM   897  O  O     . LEU A 1 125 ? 3.216   9.991   29.335  1.00 31.02 ? 156 LEU A O     1 
ATOM   898  C  CB    . LEU A 1 125 ? 5.274   11.088  27.146  1.00 29.58 ? 156 LEU A CB    1 
ATOM   899  C  CG    . LEU A 1 125 ? 5.293   11.402  25.644  1.00 28.82 ? 156 LEU A CG    1 
ATOM   900  C  CD1   . LEU A 1 125 ? 6.720   11.375  25.031  1.00 27.88 ? 156 LEU A CD1   1 
ATOM   901  C  CD2   . LEU A 1 125 ? 4.393   10.471  24.885  1.00 25.77 ? 156 LEU A CD2   1 
ATOM   902  N  N     . ASN A 1 126 ? 4.641   11.383  30.373  1.00 30.92 ? 157 ASN A N     1 
ATOM   903  C  CA    . ASN A 1 126 ? 4.438   10.754  31.686  1.00 31.34 ? 157 ASN A CA    1 
ATOM   904  C  C     . ASN A 1 126 ? 3.109   11.172  32.365  1.00 32.02 ? 157 ASN A C     1 
ATOM   905  O  O     . ASN A 1 126 ? 2.645   10.483  33.269  1.00 32.02 ? 157 ASN A O     1 
ATOM   906  C  CB    . ASN A 1 126 ? 5.635   10.990  32.640  1.00 31.18 ? 157 ASN A CB    1 
ATOM   907  C  CG    . ASN A 1 126 ? 6.955   10.272  32.193  1.00 31.03 ? 157 ASN A CG    1 
ATOM   908  O  OD1   . ASN A 1 126 ? 6.969   9.081   31.829  1.00 27.26 ? 157 ASN A OD1   1 
ATOM   909  N  ND2   . ASN A 1 126 ? 8.078   11.012  32.276  1.00 29.09 ? 157 ASN A ND2   1 
ATOM   910  N  N     . ASP A 1 127 ? 2.491   12.271  31.923  1.00 32.89 ? 158 ASP A N     1 
ATOM   911  C  CA    . ASP A 1 127 ? 1.173   12.701  32.445  1.00 33.44 ? 158 ASP A CA    1 
ATOM   912  C  C     . ASP A 1 127 ? 0.027   12.529  31.440  1.00 33.61 ? 158 ASP A C     1 
ATOM   913  O  O     . ASP A 1 127 ? -0.945  13.298  31.463  1.00 32.87 ? 158 ASP A O     1 
ATOM   914  C  CB    . ASP A 1 127 ? 1.230   14.169  32.859  1.00 33.92 ? 158 ASP A CB    1 
ATOM   915  C  CG    . ASP A 1 127 ? 1.450   14.355  34.318  1.00 35.18 ? 158 ASP A CG    1 
ATOM   916  O  OD1   . ASP A 1 127 ? 0.885   13.595  35.130  1.00 40.14 ? 158 ASP A OD1   1 
ATOM   917  O  OD2   . ASP A 1 127 ? 2.173   15.294  34.664  1.00 38.28 ? 158 ASP A OD2   1 
ATOM   918  N  N     . LEU A 1 128 ? 0.142   11.538  30.557  1.00 34.05 ? 159 LEU A N     1 
ATOM   919  C  CA    . LEU A 1 128 ? -0.858  11.342  29.508  1.00 34.76 ? 159 LEU A CA    1 
ATOM   920  C  C     . LEU A 1 128 ? -2.252  11.103  30.059  1.00 34.92 ? 159 LEU A C     1 
ATOM   921  O  O     . LEU A 1 128 ? -3.228  11.522  29.454  1.00 35.14 ? 159 LEU A O     1 
ATOM   922  C  CB    . LEU A 1 128 ? -0.518  10.141  28.628  1.00 34.91 ? 159 LEU A CB    1 
ATOM   923  C  CG    . LEU A 1 128 ? -0.102  10.414  27.189  1.00 35.32 ? 159 LEU A CG    1 
ATOM   924  C  CD1   . LEU A 1 128 ? -0.026  9.077   26.519  1.00 36.69 ? 159 LEU A CD1   1 
ATOM   925  C  CD2   . LEU A 1 128 ? -1.055  11.320  26.439  1.00 35.05 ? 159 LEU A CD2   1 
ATOM   926  N  N     . ASP A 1 129 ? -2.343  10.402  31.182  1.00 35.22 ? 160 ASP A N     1 
ATOM   927  C  CA    . ASP A 1 129 ? -3.651  10.148  31.810  1.00 35.79 ? 160 ASP A CA    1 
ATOM   928  C  C     . ASP A 1 129 ? -4.379  11.452  32.081  1.00 35.20 ? 160 ASP A C     1 
ATOM   929  O  O     . ASP A 1 129 ? -5.560  11.587  31.765  1.00 35.60 ? 160 ASP A O     1 
ATOM   930  C  CB    . ASP A 1 129 ? -3.524  9.371   33.130  1.00 35.96 ? 160 ASP A CB    1 
ATOM   931  C  CG    . ASP A 1 129 ? -3.242  7.900   32.917  1.00 37.79 ? 160 ASP A CG    1 
ATOM   932  O  OD1   . ASP A 1 129 ? -3.801  7.303   31.961  1.00 39.99 ? 160 ASP A OD1   1 
ATOM   933  O  OD2   . ASP A 1 129 ? -2.465  7.332   33.721  1.00 40.47 ? 160 ASP A OD2   1 
ATOM   934  N  N     . ARG A 1 130 ? -3.663  12.400  32.665  1.00 34.29 ? 161 ARG A N     1 
ATOM   935  C  CA    . ARG A 1 130 ? -4.231  13.704  32.975  1.00 33.85 ? 161 ARG A CA    1 
ATOM   936  C  C     . ARG A 1 130 ? -4.548  14.484  31.683  1.00 33.72 ? 161 ARG A C     1 
ATOM   937  O  O     . ARG A 1 130 ? -5.648  15.016  31.534  1.00 33.48 ? 161 ARG A O     1 
ATOM   938  C  CB    . ARG A 1 130 ? -3.261  14.481  33.886  1.00 33.61 ? 161 ARG A CB    1 
ATOM   939  C  CG    . ARG A 1 130 ? -3.797  15.790  34.439  1.00 33.45 ? 161 ARG A CG    1 
ATOM   940  C  CD    . ARG A 1 130 ? -2.843  16.404  35.455  1.00 33.07 ? 161 ARG A CD    1 
ATOM   941  N  NE    . ARG A 1 130 ? -1.494  16.589  34.907  1.00 33.75 ? 161 ARG A NE    1 
ATOM   942  C  CZ    . ARG A 1 130 ? -1.109  17.599  34.124  1.00 32.31 ? 161 ARG A CZ    1 
ATOM   943  N  NH1   . ARG A 1 130 ? -1.951  18.555  33.754  1.00 31.91 ? 161 ARG A NH1   1 
ATOM   944  N  NH2   . ARG A 1 130 ? 0.138   17.649  33.699  1.00 32.25 ? 161 ARG A NH2   1 
ATOM   945  N  N     . ILE A 1 131 ? -3.595  14.513  30.750  1.00 33.66 ? 162 ILE A N     1 
ATOM   946  C  CA    . ILE A 1 131 ? -3.723  15.309  29.521  1.00 34.04 ? 162 ILE A CA    1 
ATOM   947  C  C     . ILE A 1 131 ? -4.835  14.761  28.594  1.00 33.84 ? 162 ILE A C     1 
ATOM   948  O  O     . ILE A 1 131 ? -5.574  15.529  27.978  1.00 34.05 ? 162 ILE A O     1 
ATOM   949  C  CB    . ILE A 1 131 ? -2.372  15.378  28.763  1.00 34.27 ? 162 ILE A CB    1 
ATOM   950  C  CG1   . ILE A 1 131 ? -1.249  15.890  29.659  1.00 34.93 ? 162 ILE A CG1   1 
ATOM   951  C  CG2   . ILE A 1 131 ? -2.459  16.314  27.611  1.00 35.37 ? 162 ILE A CG2   1 
ATOM   952  C  CD1   . ILE A 1 131 ? -1.504  17.245  30.264  1.00 34.95 ? 162 ILE A CD1   1 
ATOM   953  N  N     . ALA A 1 132 ? -4.977  13.444  28.540  1.00 33.62 ? 163 ALA A N     1 
ATOM   954  C  CA    . ALA A 1 132 ? -5.927  12.794  27.640  1.00 33.90 ? 163 ALA A CA    1 
ATOM   955  C  C     . ALA A 1 132 ? -7.383  12.760  28.123  1.00 33.99 ? 163 ALA A C     1 
ATOM   956  O  O     . ALA A 1 132 ? -8.221  12.172  27.464  1.00 34.10 ? 163 ALA A O     1 
ATOM   957  C  CB    . ALA A 1 132 ? -5.442  11.354  27.334  1.00 33.56 ? 163 ALA A CB    1 
ATOM   958  N  N     . GLN A 1 133 ? -7.694  13.366  29.261  1.00 34.34 ? 164 GLN A N     1 
ATOM   959  C  CA    . GLN A 1 133 ? -9.082  13.388  29.746  1.00 34.42 ? 164 GLN A CA    1 
ATOM   960  C  C     . GLN A 1 133 ? -9.901  14.371  28.907  1.00 34.30 ? 164 GLN A C     1 
ATOM   961  O  O     . GLN A 1 133 ? -9.390  15.431  28.545  1.00 34.35 ? 164 GLN A O     1 
ATOM   962  C  CB    . GLN A 1 133 ? -9.171  13.810  31.221  1.00 34.68 ? 164 GLN A CB    1 
ATOM   963  C  CG    . GLN A 1 133 ? -8.277  13.056  32.199  1.00 35.30 ? 164 GLN A CG    1 
ATOM   964  C  CD    . GLN A 1 133 ? -8.802  11.694  32.551  1.00 37.07 ? 164 GLN A CD    1 
ATOM   965  O  OE1   . GLN A 1 133 ? -9.769  11.567  33.309  1.00 39.28 ? 164 GLN A OE1   1 
ATOM   966  N  NE2   . GLN A 1 133 ? -8.168  10.654  32.012  1.00 37.84 ? 164 GLN A NE2   1 
ATOM   967  N  N     . PRO A 1 134 ? -11.165 14.026  28.593  1.00 34.26 ? 165 PRO A N     1 
ATOM   968  C  CA    . PRO A 1 134 ? -12.049 14.887  27.790  1.00 34.13 ? 165 PRO A CA    1 
ATOM   969  C  C     . PRO A 1 134 ? -12.136 16.339  28.283  1.00 33.90 ? 165 PRO A C     1 
ATOM   970  O  O     . PRO A 1 134 ? -12.089 17.266  27.470  1.00 33.85 ? 165 PRO A O     1 
ATOM   971  C  CB    . PRO A 1 134 ? -13.424 14.216  27.932  1.00 34.14 ? 165 PRO A CB    1 
ATOM   972  C  CG    . PRO A 1 134 ? -13.146 12.811  28.277  1.00 34.07 ? 165 PRO A CG    1 
ATOM   973  C  CD    . PRO A 1 134 ? -11.827 12.764  28.983  1.00 34.34 ? 165 PRO A CD    1 
ATOM   974  N  N     . ASN A 1 135 ? -12.268 16.528  29.595  1.00 33.61 ? 166 ASN A N     1 
ATOM   975  C  CA    . ASN A 1 135 ? -12.402 17.872  30.171  1.00 33.72 ? 166 ASN A CA    1 
ATOM   976  C  C     . ASN A 1 135 ? -11.045 18.456  30.623  1.00 33.48 ? 166 ASN A C     1 
ATOM   977  O  O     . ASN A 1 135 ? -10.969 19.222  31.588  1.00 33.66 ? 166 ASN A O     1 
ATOM   978  C  CB    . ASN A 1 135 ? -13.391 17.864  31.360  1.00 33.73 ? 166 ASN A CB    1 
ATOM   979  C  CG    . ASN A 1 135 ? -14.864 17.659  30.935  1.00 34.61 ? 166 ASN A CG    1 
ATOM   980  O  OD1   . ASN A 1 135 ? -15.181 16.804  30.104  1.00 34.55 ? 166 ASN A OD1   1 
ATOM   981  N  ND2   . ASN A 1 135 ? -15.771 18.433  31.546  1.00 35.44 ? 166 ASN A ND2   1 
ATOM   982  N  N     . TYR A 1 136 ? -9.981  18.103  29.906  1.00 32.90 ? 167 TYR A N     1 
ATOM   983  C  CA    . TYR A 1 136 ? -8.632  18.542  30.240  1.00 32.30 ? 167 TYR A CA    1 
ATOM   984  C  C     . TYR A 1 136 ? -8.425  20.046  29.999  1.00 32.36 ? 167 TYR A C     1 
ATOM   985  O  O     . TYR A 1 136 ? -8.619  20.569  28.882  1.00 32.49 ? 167 TYR A O     1 
ATOM   986  C  CB    . TYR A 1 136 ? -7.577  17.738  29.445  1.00 31.98 ? 167 TYR A CB    1 
ATOM   987  C  CG    . TYR A 1 136 ? -6.208  18.368  29.475  1.00 30.91 ? 167 TYR A CG    1 
ATOM   988  C  CD1   . TYR A 1 136 ? -5.583  18.658  30.686  1.00 30.49 ? 167 TYR A CD1   1 
ATOM   989  C  CD2   . TYR A 1 136 ? -5.547  18.692  28.305  1.00 30.54 ? 167 TYR A CD2   1 
ATOM   990  C  CE1   . TYR A 1 136 ? -4.329  19.261  30.719  1.00 31.54 ? 167 TYR A CE1   1 
ATOM   991  C  CE2   . TYR A 1 136 ? -4.290  19.283  28.329  1.00 30.63 ? 167 TYR A CE2   1 
ATOM   992  C  CZ    . TYR A 1 136 ? -3.690  19.563  29.529  1.00 30.44 ? 167 TYR A CZ    1 
ATOM   993  O  OH    . TYR A 1 136 ? -2.458  20.148  29.552  1.00 30.40 ? 167 TYR A OH    1 
ATOM   994  N  N     . ILE A 1 137 ? -8.005  20.718  31.068  1.00 32.08 ? 168 ILE A N     1 
ATOM   995  C  CA    . ILE A 1 137 ? -7.662  22.123  31.043  1.00 31.56 ? 168 ILE A CA    1 
ATOM   996  C  C     . ILE A 1 137 ? -6.193  22.205  31.402  1.00 30.99 ? 168 ILE A C     1 
ATOM   997  O  O     . ILE A 1 137 ? -5.815  21.815  32.506  1.00 30.91 ? 168 ILE A O     1 
ATOM   998  C  CB    . ILE A 1 137 ? -8.503  22.900  32.081  1.00 31.56 ? 168 ILE A CB    1 
ATOM   999  C  CG1   . ILE A 1 137 ? -9.991  22.599  31.873  1.00 31.16 ? 168 ILE A CG1   1 
ATOM   1000 C  CG2   . ILE A 1 137 ? -8.200  24.397  31.994  1.00 32.27 ? 168 ILE A CG2   1 
ATOM   1001 C  CD1   . ILE A 1 137 ? -10.905 23.768  32.127  1.00 32.50 ? 168 ILE A CD1   1 
ATOM   1002 N  N     . PRO A 1 138 ? -5.351  22.669  30.468  1.00 30.38 ? 169 PRO A N     1 
ATOM   1003 C  CA    . PRO A 1 138 ? -3.948  22.885  30.786  1.00 30.00 ? 169 PRO A CA    1 
ATOM   1004 C  C     . PRO A 1 138 ? -3.726  23.713  32.044  1.00 29.54 ? 169 PRO A C     1 
ATOM   1005 O  O     . PRO A 1 138 ? -4.353  24.755  32.211  1.00 29.86 ? 169 PRO A O     1 
ATOM   1006 C  CB    . PRO A 1 138 ? -3.434  23.652  29.567  1.00 29.87 ? 169 PRO A CB    1 
ATOM   1007 C  CG    . PRO A 1 138 ? -4.256  23.157  28.460  1.00 29.79 ? 169 PRO A CG    1 
ATOM   1008 C  CD    . PRO A 1 138 ? -5.631  23.002  29.060  1.00 30.73 ? 169 PRO A CD    1 
ATOM   1009 N  N     . THR A 1 139 ? -2.844  23.237  32.918  1.00 28.99 ? 170 THR A N     1 
ATOM   1010 C  CA    . THR A 1 139 ? -2.379  24.035  34.037  1.00 28.70 ? 170 THR A CA    1 
ATOM   1011 C  C     . THR A 1 139 ? -1.442  25.102  33.513  1.00 28.63 ? 170 THR A C     1 
ATOM   1012 O  O     . THR A 1 139 ? -0.928  25.004  32.421  1.00 28.79 ? 170 THR A O     1 
ATOM   1013 C  CB    . THR A 1 139 ? -1.558  23.216  35.087  1.00 28.96 ? 170 THR A CB    1 
ATOM   1014 O  OG1   . THR A 1 139 ? -0.394  22.640  34.458  1.00 28.66 ? 170 THR A OG1   1 
ATOM   1015 C  CG2   . THR A 1 139 ? -2.408  22.139  35.759  1.00 26.63 ? 170 THR A CG2   1 
ATOM   1016 N  N     . GLN A 1 140 ? -1.194  26.105  34.330  1.00 29.00 ? 171 GLN A N     1 
ATOM   1017 C  CA    . GLN A 1 140 ? -0.201  27.111  34.024  1.00 29.09 ? 171 GLN A CA    1 
ATOM   1018 C  C     . GLN A 1 140 ? 1.154   26.478  33.648  1.00 28.57 ? 171 GLN A C     1 
ATOM   1019 O  O     . GLN A 1 140 ? 1.794   26.915  32.703  1.00 28.87 ? 171 GLN A O     1 
ATOM   1020 C  CB    . GLN A 1 140 ? -0.068  28.060  35.220  1.00 29.12 ? 171 GLN A CB    1 
ATOM   1021 C  CG    . GLN A 1 140 ? 0.816   29.284  34.935  1.00 30.32 ? 171 GLN A CG    1 
ATOM   1022 C  CD    . GLN A 1 140 ? 0.359   30.522  35.675  1.00 30.00 ? 171 GLN A CD    1 
ATOM   1023 O  OE1   . GLN A 1 140 ? -0.435  31.302  35.146  1.00 29.61 ? 171 GLN A OE1   1 
ATOM   1024 N  NE2   . GLN A 1 140 ? 0.846   30.704  36.904  1.00 28.99 ? 171 GLN A NE2   1 
ATOM   1025 N  N     . GLN A 1 141 ? 1.562   25.433  34.360  1.00 28.17 ? 172 GLN A N     1 
ATOM   1026 C  CA    . GLN A 1 141 ? 2.835   24.757  34.085  1.00 28.02 ? 172 GLN A CA    1 
ATOM   1027 C  C     . GLN A 1 141 ? 2.829   24.070  32.707  1.00 27.81 ? 172 GLN A C     1 
ATOM   1028 O  O     . GLN A 1 141 ? 3.826   24.115  31.967  1.00 27.48 ? 172 GLN A O     1 
ATOM   1029 C  CB    . GLN A 1 141 ? 3.139   23.745  35.210  1.00 28.15 ? 172 GLN A CB    1 
ATOM   1030 C  CG    . GLN A 1 141 ? 4.530   23.059  35.138  1.00 28.05 ? 172 GLN A CG    1 
ATOM   1031 C  CD    . GLN A 1 141 ? 5.715   24.041  35.178  1.00 27.74 ? 172 GLN A CD    1 
ATOM   1032 O  OE1   . GLN A 1 141 ? 6.740   23.812  34.515  1.00 27.85 ? 172 GLN A OE1   1 
ATOM   1033 N  NE2   . GLN A 1 141 ? 5.582   25.119  35.952  1.00 22.95 ? 172 GLN A NE2   1 
ATOM   1034 N  N     . ASP A 1 142 ? 1.693   23.464  32.359  1.00 27.76 ? 173 ASP A N     1 
ATOM   1035 C  CA    . ASP A 1 142 ? 1.501   22.876  31.029  1.00 27.46 ? 173 ASP A CA    1 
ATOM   1036 C  C     . ASP A 1 142 ? 1.703   23.906  29.927  1.00 27.09 ? 173 ASP A C     1 
ATOM   1037 O  O     . ASP A 1 142 ? 2.286   23.600  28.885  1.00 27.05 ? 173 ASP A O     1 
ATOM   1038 C  CB    . ASP A 1 142 ? 0.110   22.274  30.897  1.00 27.73 ? 173 ASP A CB    1 
ATOM   1039 C  CG    . ASP A 1 142 ? -0.081  21.059  31.763  1.00 28.40 ? 173 ASP A CG    1 
ATOM   1040 O  OD1   . ASP A 1 142 ? 0.938   20.455  32.172  1.00 28.30 ? 173 ASP A OD1   1 
ATOM   1041 O  OD2   . ASP A 1 142 ? -1.258  20.718  32.022  1.00 28.42 ? 173 ASP A OD2   1 
ATOM   1042 N  N     . VAL A 1 143 ? 1.214   25.117  30.162  1.00 26.57 ? 174 VAL A N     1 
ATOM   1043 C  CA    . VAL A 1 143 ? 1.394   26.198  29.213  1.00 26.30 ? 174 VAL A CA    1 
ATOM   1044 C  C     . VAL A 1 143 ? 2.876   26.576  29.125  1.00 26.20 ? 174 VAL A C     1 
ATOM   1045 O  O     . VAL A 1 143 ? 3.434   26.690  28.039  1.00 26.72 ? 174 VAL A O     1 
ATOM   1046 C  CB    . VAL A 1 143 ? 0.521   27.413  29.616  1.00 26.41 ? 174 VAL A CB    1 
ATOM   1047 C  CG1   . VAL A 1 143 ? 0.800   28.612  28.686  1.00 24.89 ? 174 VAL A CG1   1 
ATOM   1048 C  CG2   . VAL A 1 143 ? -0.959  27.010  29.609  1.00 24.32 ? 174 VAL A CG2   1 
ATOM   1049 N  N     . LEU A 1 144 ? 3.518   26.737  30.266  1.00 26.02 ? 175 LEU A N     1 
ATOM   1050 C  CA    . LEU A 1 144 ? 4.944   27.093  30.292  1.00 26.23 ? 175 LEU A CA    1 
ATOM   1051 C  C     . LEU A 1 144 ? 5.816   26.050  29.581  1.00 26.44 ? 175 LEU A C     1 
ATOM   1052 O  O     . LEU A 1 144 ? 6.850   26.382  29.031  1.00 26.08 ? 175 LEU A O     1 
ATOM   1053 C  CB    . LEU A 1 144 ? 5.419   27.278  31.749  1.00 26.00 ? 175 LEU A CB    1 
ATOM   1054 C  CG    . LEU A 1 144 ? 4.943   28.553  32.460  1.00 24.79 ? 175 LEU A CG    1 
ATOM   1055 C  CD1   . LEU A 1 144 ? 4.817   28.384  33.997  1.00 23.00 ? 175 LEU A CD1   1 
ATOM   1056 C  CD2   . LEU A 1 144 ? 5.916   29.687  32.121  1.00 25.04 ? 175 LEU A CD2   1 
ATOM   1057 N  N     . ARG A 1 145 ? 5.401   24.792  29.616  1.00 26.93 ? 176 ARG A N     1 
ATOM   1058 C  CA    . ARG A 1 145 ? 6.179   23.700  29.037  1.00 27.34 ? 176 ARG A CA    1 
ATOM   1059 C  C     . ARG A 1 145 ? 5.951   23.537  27.542  1.00 27.46 ? 176 ARG A C     1 
ATOM   1060 O  O     . ARG A 1 145 ? 6.613   22.703  26.895  1.00 27.61 ? 176 ARG A O     1 
ATOM   1061 C  CB    . ARG A 1 145 ? 5.816   22.379  29.726  1.00 27.63 ? 176 ARG A CB    1 
ATOM   1062 C  CG    . ARG A 1 145 ? 6.261   22.302  31.171  1.00 28.51 ? 176 ARG A CG    1 
ATOM   1063 C  CD    . ARG A 1 145 ? 7.702   21.815  31.302  1.00 28.81 ? 176 ARG A CD    1 
ATOM   1064 N  NE    . ARG A 1 145 ? 8.064   21.562  32.700  1.00 27.98 ? 176 ARG A NE    1 
ATOM   1065 C  CZ    . ARG A 1 145 ? 8.892   20.603  33.121  1.00 28.40 ? 176 ARG A CZ    1 
ATOM   1066 N  NH1   . ARG A 1 145 ? 9.472   19.764  32.267  1.00 28.29 ? 176 ARG A NH1   1 
ATOM   1067 N  NH2   . ARG A 1 145 ? 9.123   20.461  34.425  1.00 28.60 ? 176 ARG A NH2   1 
ATOM   1068 N  N     . THR A 1 146 ? 5.015   24.287  26.973  1.00 27.22 ? 177 THR A N     1 
ATOM   1069 C  CA    . THR A 1 146 ? 4.730   24.120  25.553  1.00 27.04 ? 177 THR A CA    1 
ATOM   1070 C  C     . THR A 1 146 ? 5.841   24.703  24.671  1.00 27.48 ? 177 THR A C     1 
ATOM   1071 O  O     . THR A 1 146 ? 6.591   25.580  25.076  1.00 26.76 ? 177 THR A O     1 
ATOM   1072 C  CB    . THR A 1 146 ? 3.410   24.750  25.167  1.00 26.49 ? 177 THR A CB    1 
ATOM   1073 O  OG1   . THR A 1 146 ? 3.446   26.124  25.519  1.00 25.11 ? 177 THR A OG1   1 
ATOM   1074 C  CG2   . THR A 1 146 ? 2.265   24.070  25.893  1.00 26.82 ? 177 THR A CG2   1 
ATOM   1075 N  N     . ARG A 1 147 ? 5.903   24.201  23.442  1.00 28.19 ? 178 ARG A N     1 
ATOM   1076 C  CA    . ARG A 1 147 ? 6.920   24.551  22.485  1.00 28.54 ? 178 ARG A CA    1 
ATOM   1077 C  C     . ARG A 1 147 ? 6.248   25.171  21.246  1.00 28.73 ? 178 ARG A C     1 
ATOM   1078 O  O     . ARG A 1 147 ? 5.376   24.571  20.630  1.00 28.87 ? 178 ARG A O     1 
ATOM   1079 C  CB    . ARG A 1 147 ? 7.741   23.293  22.115  1.00 28.40 ? 178 ARG A CB    1 
ATOM   1080 C  CG    . ARG A 1 147 ? 8.691   23.448  20.875  1.00 28.57 ? 178 ARG A CG    1 
ATOM   1081 C  CD    . ARG A 1 147 ? 9.634   24.607  21.067  1.00 28.23 ? 178 ARG A CD    1 
ATOM   1082 N  NE    . ARG A 1 147 ? 10.486  24.885  19.933  1.00 27.02 ? 178 ARG A NE    1 
ATOM   1083 C  CZ    . ARG A 1 147 ? 11.271  25.954  19.849  1.00 27.19 ? 178 ARG A CZ    1 
ATOM   1084 N  NH1   . ARG A 1 147 ? 11.323  26.829  20.854  1.00 26.19 ? 178 ARG A NH1   1 
ATOM   1085 N  NH2   . ARG A 1 147 ? 12.017  26.140  18.767  1.00 26.31 ? 178 ARG A NH2   1 
ATOM   1086 N  N     . VAL A 1 148 ? 6.670   26.382  20.910  1.00 28.90 ? 179 VAL A N     1 
ATOM   1087 C  CA    . VAL A 1 148 ? 6.273   27.052  19.697  1.00 28.99 ? 179 VAL A CA    1 
ATOM   1088 C  C     . VAL A 1 148 ? 7.487   27.830  19.195  1.00 29.29 ? 179 VAL A C     1 
ATOM   1089 O  O     . VAL A 1 148 ? 7.994   28.716  19.885  1.00 29.47 ? 179 VAL A O     1 
ATOM   1090 C  CB    . VAL A 1 148 ? 5.070   27.997  19.948  1.00 28.95 ? 179 VAL A CB    1 
ATOM   1091 C  CG1   . VAL A 1 148 ? 4.761   28.805  18.690  1.00 28.70 ? 179 VAL A CG1   1 
ATOM   1092 C  CG2   . VAL A 1 148 ? 3.825   27.183  20.405  1.00 27.70 ? 179 VAL A CG2   1 
ATOM   1093 N  N     . LYS A 1 149 ? 7.971   27.450  18.016  1.00 29.38 ? 180 LYS A N     1 
ATOM   1094 C  CA    . LYS A 1 149 ? 9.150   28.057  17.428  1.00 29.15 ? 180 LYS A CA    1 
ATOM   1095 C  C     . LYS A 1 149 ? 8.794   29.504  17.128  1.00 29.03 ? 180 LYS A C     1 
ATOM   1096 O  O     . LYS A 1 149 ? 7.782   29.783  16.473  1.00 28.56 ? 180 LYS A O     1 
ATOM   1097 C  CB    . LYS A 1 149 ? 9.589   27.305  16.150  1.00 29.30 ? 180 LYS A CB    1 
ATOM   1098 C  CG    . LYS A 1 149 ? 10.942  27.762  15.543  1.00 29.44 ? 180 LYS A CG    1 
ATOM   1099 C  CD    . LYS A 1 149 ? 11.498  26.764  14.493  1.00 28.92 ? 180 LYS A CD    1 
ATOM   1100 N  N     . THR A 1 150 ? 9.616   30.413  17.640  1.00 28.73 ? 181 THR A N     1 
ATOM   1101 C  CA    . THR A 1 150 ? 9.466   31.816  17.363  1.00 28.65 ? 181 THR A CA    1 
ATOM   1102 C  C     . THR A 1 150 ? 10.242  32.172  16.112  1.00 28.77 ? 181 THR A C     1 
ATOM   1103 O  O     . THR A 1 150 ? 11.407  31.816  16.012  1.00 28.07 ? 181 THR A O     1 
ATOM   1104 C  CB    . THR A 1 150 ? 10.055  32.642  18.506  1.00 28.95 ? 181 THR A CB    1 
ATOM   1105 O  OG1   . THR A 1 150 ? 9.667   32.050  19.764  1.00 29.12 ? 181 THR A OG1   1 
ATOM   1106 C  CG2   . THR A 1 150 ? 9.609   34.104  18.379  1.00 27.11 ? 181 THR A CG2   1 
ATOM   1107 N  N     . THR A 1 151 ? 9.598   32.900  15.195  1.00 29.09 ? 182 THR A N     1 
ATOM   1108 C  CA    . THR A 1 151 ? 10.262  33.543  14.069  1.00 29.15 ? 182 THR A CA    1 
ATOM   1109 C  C     . THR A 1 151 ? 10.021  35.053  14.103  1.00 29.36 ? 182 THR A C     1 
ATOM   1110 O  O     . THR A 1 151 ? 8.919   35.495  14.365  1.00 29.49 ? 182 THR A O     1 
ATOM   1111 C  CB    . THR A 1 151 ? 9.774   32.928  12.726  1.00 29.11 ? 182 THR A CB    1 
ATOM   1112 O  OG1   . THR A 1 151 ? 10.592  33.408  11.650  1.00 29.32 ? 182 THR A OG1   1 
ATOM   1113 C  CG2   . THR A 1 151 ? 8.303   33.253  12.469  1.00 28.07 ? 182 THR A CG2   1 
ATOM   1114 N  N     . GLY A 1 152 ? 11.065  35.839  13.860  1.00 29.86 ? 183 GLY A N     1 
ATOM   1115 C  CA    . GLY A 1 152 ? 10.946  37.294  13.799  1.00 30.19 ? 183 GLY A CA    1 
ATOM   1116 C  C     . GLY A 1 152 ? 11.271  37.969  15.123  1.00 30.55 ? 183 GLY A C     1 
ATOM   1117 O  O     . GLY A 1 152 ? 12.009  37.414  15.939  1.00 30.82 ? 183 GLY A O     1 
ATOM   1118 N  N     . ILE A 1 153 ? 10.734  39.172  15.319  1.00 30.38 ? 184 ILE A N     1 
ATOM   1119 C  CA    . ILE A 1 153 ? 10.954  39.925  16.539  1.00 30.55 ? 184 ILE A CA    1 
ATOM   1120 C  C     . ILE A 1 153 ? 9.625   40.404  17.079  1.00 30.27 ? 184 ILE A C     1 
ATOM   1121 O  O     . ILE A 1 153 ? 8.853   41.031  16.365  1.00 30.32 ? 184 ILE A O     1 
ATOM   1122 C  CB    . ILE A 1 153 ? 11.834  41.161  16.279  1.00 31.43 ? 184 ILE A CB    1 
ATOM   1123 C  CG1   . ILE A 1 153 ? 13.205  40.726  15.723  1.00 31.71 ? 184 ILE A CG1   1 
ATOM   1124 C  CG2   . ILE A 1 153 ? 11.962  42.023  17.569  1.00 29.41 ? 184 ILE A CG2   1 
ATOM   1125 C  CD1   . ILE A 1 153 ? 13.970  41.866  15.063  1.00 32.62 ? 184 ILE A CD1   1 
ATOM   1126 N  N     . VAL A 1 154 ? 9.373   40.112  18.345  1.00 30.32 ? 185 VAL A N     1 
ATOM   1127 C  CA    . VAL A 1 154 ? 8.108   40.440  18.992  1.00 30.45 ? 185 VAL A CA    1 
ATOM   1128 C  C     . VAL A 1 154 ? 8.347   41.346  20.196  1.00 30.81 ? 185 VAL A C     1 
ATOM   1129 O  O     . VAL A 1 154 ? 9.122   41.011  21.063  1.00 30.37 ? 185 VAL A O     1 
ATOM   1130 C  CB    . VAL A 1 154 ? 7.391   39.168  19.468  1.00 30.34 ? 185 VAL A CB    1 
ATOM   1131 C  CG1   . VAL A 1 154 ? 6.113   39.529  20.177  1.00 29.69 ? 185 VAL A CG1   1 
ATOM   1132 C  CG2   . VAL A 1 154 ? 7.129   38.249  18.297  1.00 29.90 ? 185 VAL A CG2   1 
ATOM   1133 N  N     . GLU A 1 155 ? 7.649   42.477  20.226  1.00 32.07 ? 186 GLU A N     1 
ATOM   1134 C  CA    . GLU A 1 155 ? 7.748   43.512  21.265  1.00 33.13 ? 186 GLU A CA    1 
ATOM   1135 C  C     . GLU A 1 155 ? 6.586   43.410  22.257  1.00 32.96 ? 186 GLU A C     1 
ATOM   1136 O  O     . GLU A 1 155 ? 5.434   43.351  21.852  1.00 32.89 ? 186 GLU A O     1 
ATOM   1137 C  CB    . GLU A 1 155 ? 7.700   44.894  20.593  1.00 33.24 ? 186 GLU A CB    1 
ATOM   1138 C  CG    . GLU A 1 155 ? 8.209   46.055  21.454  1.00 35.02 ? 186 GLU A CG    1 
ATOM   1139 C  CD    . GLU A 1 155 ? 7.981   47.436  20.806  1.00 35.22 ? 186 GLU A CD    1 
ATOM   1140 O  OE1   . GLU A 1 155 ? 7.330   47.492  19.740  1.00 37.77 ? 186 GLU A OE1   1 
ATOM   1141 O  OE2   . GLU A 1 155 ? 8.441   48.469  21.369  1.00 37.50 ? 186 GLU A OE2   1 
ATOM   1142 N  N     . THR A 1 156 ? 6.912   43.423  23.547  1.00 33.55 ? 187 THR A N     1 
ATOM   1143 C  CA    . THR A 1 156 ? 5.950   43.308  24.650  1.00 33.52 ? 187 THR A CA    1 
ATOM   1144 C  C     . THR A 1 156 ? 6.223   44.473  25.581  1.00 32.97 ? 187 THR A C     1 
ATOM   1145 O  O     . THR A 1 156 ? 7.367   44.899  25.705  1.00 33.06 ? 187 THR A O     1 
ATOM   1146 C  CB    . THR A 1 156 ? 6.177   42.011  25.467  1.00 33.82 ? 187 THR A CB    1 
ATOM   1147 O  OG1   . THR A 1 156 ? 6.555   40.928  24.596  1.00 36.33 ? 187 THR A OG1   1 
ATOM   1148 C  CG2   . THR A 1 156 ? 4.940   41.638  26.247  1.00 33.93 ? 187 THR A CG2   1 
ATOM   1149 N  N     . HIS A 1 157 ? 5.190   44.982  26.241  1.00 32.74 ? 188 HIS A N     1 
ATOM   1150 C  CA    . HIS A 1 157 ? 5.358   46.044  27.253  1.00 32.44 ? 188 HIS A CA    1 
ATOM   1151 C  C     . HIS A 1 157 ? 4.848   45.606  28.608  1.00 32.17 ? 188 HIS A C     1 
ATOM   1152 O  O     . HIS A 1 157 ? 3.856   44.873  28.705  1.00 32.25 ? 188 HIS A O     1 
ATOM   1153 C  CB    . HIS A 1 157 ? 4.644   47.341  26.854  1.00 32.47 ? 188 HIS A CB    1 
ATOM   1154 C  CG    . HIS A 1 157 ? 5.177   47.967  25.602  1.00 32.98 ? 188 HIS A CG    1 
ATOM   1155 N  ND1   . HIS A 1 157 ? 6.355   47.561  25.010  1.00 32.90 ? 188 HIS A ND1   1 
ATOM   1156 C  CD2   . HIS A 1 157 ? 4.702   48.980  24.838  1.00 33.97 ? 188 HIS A CD2   1 
ATOM   1157 C  CE1   . HIS A 1 157 ? 6.576   48.289  23.929  1.00 33.12 ? 188 HIS A CE1   1 
ATOM   1158 N  NE2   . HIS A 1 157 ? 5.596   49.165  23.807  1.00 33.89 ? 188 HIS A NE2   1 
ATOM   1159 N  N     . PHE A 1 158 ? 5.539   46.054  29.652  1.00 31.71 ? 189 PHE A N     1 
ATOM   1160 C  CA    . PHE A 1 158 ? 5.109   45.840  31.024  1.00 31.31 ? 189 PHE A CA    1 
ATOM   1161 C  C     . PHE A 1 158 ? 5.877   46.783  31.909  1.00 31.20 ? 189 PHE A C     1 
ATOM   1162 O  O     . PHE A 1 158 ? 6.979   47.212  31.558  1.00 31.33 ? 189 PHE A O     1 
ATOM   1163 C  CB    . PHE A 1 158 ? 5.354   44.399  31.484  1.00 31.56 ? 189 PHE A CB    1 
ATOM   1164 C  CG    . PHE A 1 158 ? 6.821   43.996  31.542  1.00 31.71 ? 189 PHE A CG    1 
ATOM   1165 C  CD1   . PHE A 1 158 ? 7.588   44.257  32.668  1.00 31.50 ? 189 PHE A CD1   1 
ATOM   1166 C  CD2   . PHE A 1 158 ? 7.410   43.322  30.478  1.00 31.56 ? 189 PHE A CD2   1 
ATOM   1167 C  CE1   . PHE A 1 158 ? 8.919   43.875  32.717  1.00 31.65 ? 189 PHE A CE1   1 
ATOM   1168 C  CE2   . PHE A 1 158 ? 8.736   42.934  30.522  1.00 30.59 ? 189 PHE A CE2   1 
ATOM   1169 C  CZ    . PHE A 1 158 ? 9.492   43.214  31.635  1.00 31.39 ? 189 PHE A CZ    1 
ATOM   1170 N  N     . THR A 1 159 ? 5.313   47.054  33.078  1.00 31.00 ? 190 THR A N     1 
ATOM   1171 C  CA    . THR A 1 159 ? 5.882   47.989  34.023  1.00 30.75 ? 190 THR A CA    1 
ATOM   1172 C  C     . THR A 1 159 ? 6.212   47.265  35.327  1.00 30.88 ? 190 THR A C     1 
ATOM   1173 O  O     . THR A 1 159 ? 5.397   46.482  35.841  1.00 30.46 ? 190 THR A O     1 
ATOM   1174 C  CB    . THR A 1 159 ? 4.899   49.140  34.245  1.00 31.05 ? 190 THR A CB    1 
ATOM   1175 O  OG1   . THR A 1 159 ? 4.623   49.751  32.972  1.00 32.07 ? 190 THR A OG1   1 
ATOM   1176 C  CG2   . THR A 1 159 ? 5.454   50.188  35.229  1.00 30.04 ? 190 THR A CG2   1 
ATOM   1177 N  N     . PHE A 1 160 ? 7.410   47.528  35.848  1.00 31.03 ? 191 PHE A N     1 
ATOM   1178 C  CA    . PHE A 1 160 ? 7.922   46.859  37.054  1.00 31.40 ? 191 PHE A CA    1 
ATOM   1179 C  C     . PHE A 1 160 ? 8.827   47.828  37.818  1.00 31.54 ? 191 PHE A C     1 
ATOM   1180 O  O     . PHE A 1 160 ? 9.709   48.465  37.218  1.00 31.48 ? 191 PHE A O     1 
ATOM   1181 C  CB    . PHE A 1 160 ? 8.714   45.620  36.642  1.00 31.67 ? 191 PHE A CB    1 
ATOM   1182 C  CG    . PHE A 1 160 ? 9.249   44.807  37.789  1.00 32.14 ? 191 PHE A CG    1 
ATOM   1183 C  CD1   . PHE A 1 160 ? 8.445   44.470  38.870  1.00 31.86 ? 191 PHE A CD1   1 
ATOM   1184 C  CD2   . PHE A 1 160 ? 10.556  44.314  37.752  1.00 33.48 ? 191 PHE A CD2   1 
ATOM   1185 C  CE1   . PHE A 1 160 ? 8.938   43.688  39.925  1.00 31.99 ? 191 PHE A CE1   1 
ATOM   1186 C  CE2   . PHE A 1 160 ? 11.069  43.525  38.823  1.00 33.19 ? 191 PHE A CE2   1 
ATOM   1187 C  CZ    . PHE A 1 160 ? 10.256  43.216  39.900  1.00 32.04 ? 191 PHE A CZ    1 
ATOM   1188 N  N     . LYS A 1 161 ? 8.624   47.927  39.132  1.00 31.78 ? 192 LYS A N     1 
ATOM   1189 C  CA    . LYS A 1 161 ? 9.367   48.865  39.970  1.00 32.24 ? 192 LYS A CA    1 
ATOM   1190 C  C     . LYS A 1 161 ? 9.379   50.260  39.321  1.00 32.04 ? 192 LYS A C     1 
ATOM   1191 O  O     . LYS A 1 161 ? 10.396  50.947  39.289  1.00 31.72 ? 192 LYS A O     1 
ATOM   1192 C  CB    . LYS A 1 161 ? 10.808  48.367  40.212  1.00 32.46 ? 192 LYS A CB    1 
ATOM   1193 C  CG    . LYS A 1 161 ? 10.890  47.037  40.959  1.00 33.32 ? 192 LYS A CG    1 
ATOM   1194 C  CD    . LYS A 1 161 ? 12.320  46.689  41.380  1.00 33.96 ? 192 LYS A CD    1 
ATOM   1195 C  CE    . LYS A 1 161 ? 12.354  45.546  42.415  1.00 35.36 ? 192 LYS A CE    1 
ATOM   1196 N  NZ    . LYS A 1 161 ? 13.672  44.827  42.461  1.00 35.50 ? 192 LYS A NZ    1 
ATOM   1197 N  N     . ASP A 1 162 ? 8.229   50.661  38.790  1.00 32.05 ? 193 ASP A N     1 
ATOM   1198 C  CA    . ASP A 1 162 ? 8.073   51.962  38.125  1.00 31.77 ? 193 ASP A CA    1 
ATOM   1199 C  C     . ASP A 1 162 ? 8.943   52.145  36.882  1.00 31.27 ? 193 ASP A C     1 
ATOM   1200 O  O     . ASP A 1 162 ? 9.214   53.269  36.473  1.00 31.44 ? 193 ASP A O     1 
ATOM   1201 C  CB    . ASP A 1 162 ? 8.349   53.123  39.095  1.00 31.75 ? 193 ASP A CB    1 
ATOM   1202 C  CG    . ASP A 1 162 ? 7.451   53.097  40.306  1.00 32.08 ? 193 ASP A CG    1 
ATOM   1203 O  OD1   . ASP A 1 162 ? 6.246   52.799  40.139  1.00 31.34 ? 193 ASP A OD1   1 
ATOM   1204 O  OD2   . ASP A 1 162 ? 7.951   53.394  41.420  1.00 33.62 ? 193 ASP A OD2   1 
ATOM   1205 N  N     . LEU A 1 163 ? 9.370   51.047  36.281  1.00 31.00 ? 194 LEU A N     1 
ATOM   1206 C  CA    . LEU A 1 163 ? 10.129  51.091  35.033  1.00 30.85 ? 194 LEU A CA    1 
ATOM   1207 C  C     . LEU A 1 163 ? 9.295   50.481  33.919  1.00 30.75 ? 194 LEU A C     1 
ATOM   1208 O  O     . LEU A 1 163 ? 8.648   49.443  34.084  1.00 30.52 ? 194 LEU A O     1 
ATOM   1209 C  CB    . LEU A 1 163 ? 11.467  50.348  35.145  1.00 30.83 ? 194 LEU A CB    1 
ATOM   1210 C  CG    . LEU A 1 163 ? 12.545  51.041  35.992  1.00 31.04 ? 194 LEU A CG    1 
ATOM   1211 C  CD1   . LEU A 1 163 ? 13.691  50.089  36.286  1.00 27.87 ? 194 LEU A CD1   1 
ATOM   1212 C  CD2   . LEU A 1 163 ? 13.054  52.323  35.327  1.00 30.15 ? 194 LEU A CD2   1 
ATOM   1213 N  N     . HIS A 1 164 ? 9.304   51.146  32.781  1.00 30.76 ? 195 HIS A N     1 
ATOM   1214 C  CA    . HIS A 1 164 ? 8.503   50.713  31.664  1.00 31.26 ? 195 HIS A CA    1 
ATOM   1215 C  C     . HIS A 1 164 ? 9.379   49.915  30.725  1.00 30.75 ? 195 HIS A C     1 
ATOM   1216 O  O     . HIS A 1 164 ? 10.256  50.453  30.077  1.00 30.53 ? 195 HIS A O     1 
ATOM   1217 C  CB    . HIS A 1 164 ? 7.875   51.927  31.017  1.00 31.66 ? 195 HIS A CB    1 
ATOM   1218 C  CG    . HIS A 1 164 ? 7.048   52.696  31.984  1.00 33.36 ? 195 HIS A CG    1 
ATOM   1219 N  ND1   . HIS A 1 164 ? 5.747   52.346  32.284  1.00 35.51 ? 195 HIS A ND1   1 
ATOM   1220 C  CD2   . HIS A 1 164 ? 7.363   53.730  32.800  1.00 35.02 ? 195 HIS A CD2   1 
ATOM   1221 C  CE1   . HIS A 1 164 ? 5.275   53.175  33.199  1.00 36.58 ? 195 HIS A CE1   1 
ATOM   1222 N  NE2   . HIS A 1 164 ? 6.239   54.018  33.538  1.00 36.45 ? 195 HIS A NE2   1 
ATOM   1223 N  N     . PHE A 1 165 ? 9.167   48.603  30.725  1.00 30.44 ? 196 PHE A N     1 
ATOM   1224 C  CA    . PHE A 1 165 ? 9.977   47.705  29.917  1.00 30.13 ? 196 PHE A CA    1 
ATOM   1225 C  C     . PHE A 1 165 ? 9.401   47.576  28.524  1.00 29.67 ? 196 PHE A C     1 
ATOM   1226 O  O     . PHE A 1 165 ? 8.243   47.245  28.345  1.00 29.51 ? 196 PHE A O     1 
ATOM   1227 C  CB    . PHE A 1 165 ? 10.076  46.316  30.549  1.00 29.93 ? 196 PHE A CB    1 
ATOM   1228 C  CG    . PHE A 1 165 ? 10.968  46.266  31.737  1.00 29.97 ? 196 PHE A CG    1 
ATOM   1229 C  CD1   . PHE A 1 165 ? 10.537  46.767  32.962  1.00 29.78 ? 196 PHE A CD1   1 
ATOM   1230 C  CD2   . PHE A 1 165 ? 12.243  45.726  31.645  1.00 29.89 ? 196 PHE A CD2   1 
ATOM   1231 C  CE1   . PHE A 1 165 ? 11.359  46.719  34.072  1.00 29.21 ? 196 PHE A CE1   1 
ATOM   1232 C  CE2   . PHE A 1 165 ? 13.084  45.684  32.765  1.00 29.09 ? 196 PHE A CE2   1 
ATOM   1233 C  CZ    . PHE A 1 165 ? 12.640  46.182  33.969  1.00 28.46 ? 196 PHE A CZ    1 
ATOM   1234 N  N     . LYS A 1 166 ? 10.231  47.850  27.539  1.00 29.80 ? 197 LYS A N     1 
ATOM   1235 C  CA    . LYS A 1 166 ? 9.923   47.498  26.174  1.00 30.22 ? 197 LYS A CA    1 
ATOM   1236 C  C     . LYS A 1 166 ? 10.779  46.267  25.927  1.00 30.29 ? 197 LYS A C     1 
ATOM   1237 O  O     . LYS A 1 166 ? 12.012  46.376  25.824  1.00 30.53 ? 197 LYS A O     1 
ATOM   1238 C  CB    . LYS A 1 166 ? 10.269  48.643  25.209  1.00 30.06 ? 197 LYS A CB    1 
ATOM   1239 C  CG    . LYS A 1 166 ? 10.001  50.059  25.746  1.00 30.71 ? 197 LYS A CG    1 
ATOM   1240 C  CD    . LYS A 1 166 ? 8.525   50.341  26.022  1.00 32.22 ? 197 LYS A CD    1 
ATOM   1241 C  CE    . LYS A 1 166 ? 8.355   51.514  27.007  1.00 33.50 ? 197 LYS A CE    1 
ATOM   1242 N  NZ    . LYS A 1 166 ? 6.950   51.699  27.476  1.00 32.59 ? 197 LYS A NZ    1 
ATOM   1243 N  N     . MET A 1 167 ? 10.133  45.102  25.901  1.00 30.25 ? 198 MET A N     1 
ATOM   1244 C  CA    . MET A 1 167 ? 10.837  43.831  25.797  1.00 30.49 ? 198 MET A CA    1 
ATOM   1245 C  C     . MET A 1 167 ? 10.720  43.210  24.402  1.00 30.68 ? 198 MET A C     1 
ATOM   1246 O  O     . MET A 1 167 ? 9.623   43.060  23.834  1.00 30.62 ? 198 MET A O     1 
ATOM   1247 C  CB    . MET A 1 167 ? 10.318  42.852  26.837  1.00 30.48 ? 198 MET A CB    1 
ATOM   1248 C  CG    . MET A 1 167 ? 10.950  41.482  26.740  1.00 30.27 ? 198 MET A CG    1 
ATOM   1249 S  SD    . MET A 1 167 ? 10.292  40.385  28.007  1.00 30.80 ? 198 MET A SD    1 
ATOM   1250 C  CE    . MET A 1 167 ? 11.297  40.945  29.366  1.00 32.39 ? 198 MET A CE    1 
ATOM   1251 N  N     . PHE A 1 168 ? 11.868  42.816  23.878  1.00 30.80 ? 199 PHE A N     1 
ATOM   1252 C  CA    . PHE A 1 168 ? 11.950  42.227  22.555  1.00 30.70 ? 199 PHE A CA    1 
ATOM   1253 C  C     . PHE A 1 168 ? 12.391  40.779  22.638  1.00 30.60 ? 199 PHE A C     1 
ATOM   1254 O  O     . PHE A 1 168 ? 13.482  40.486  23.108  1.00 30.56 ? 199 PHE A O     1 
ATOM   1255 C  CB    . PHE A 1 168 ? 12.930  42.998  21.682  1.00 30.66 ? 199 PHE A CB    1 
ATOM   1256 C  CG    . PHE A 1 168 ? 12.511  44.415  21.408  1.00 30.83 ? 199 PHE A CG    1 
ATOM   1257 C  CD1   . PHE A 1 168 ? 11.846  44.742  20.237  1.00 30.07 ? 199 PHE A CD1   1 
ATOM   1258 C  CD2   . PHE A 1 168 ? 12.790  45.421  22.323  1.00 30.92 ? 199 PHE A CD2   1 
ATOM   1259 C  CE1   . PHE A 1 168 ? 11.460  46.042  19.980  1.00 30.73 ? 199 PHE A CE1   1 
ATOM   1260 C  CE2   . PHE A 1 168 ? 12.406  46.725  22.065  1.00 31.56 ? 199 PHE A CE2   1 
ATOM   1261 C  CZ    . PHE A 1 168 ? 11.736  47.033  20.891  1.00 30.77 ? 199 PHE A CZ    1 
ATOM   1262 N  N     . ASP A 1 169 ? 11.534  39.898  22.137  1.00 30.65 ? 200 ASP A N     1 
ATOM   1263 C  CA    . ASP A 1 169 ? 11.775  38.469  22.080  1.00 31.07 ? 200 ASP A CA    1 
ATOM   1264 C  C     . ASP A 1 169 ? 12.104  38.092  20.617  1.00 30.83 ? 200 ASP A C     1 
ATOM   1265 O  O     . ASP A 1 169 ? 11.413  38.538  19.694  1.00 30.86 ? 200 ASP A O     1 
ATOM   1266 C  CB    . ASP A 1 169 ? 10.497  37.768  22.552  1.00 31.17 ? 200 ASP A CB    1 
ATOM   1267 C  CG    . ASP A 1 169 ? 10.617  36.253  22.591  1.00 33.38 ? 200 ASP A CG    1 
ATOM   1268 O  OD1   . ASP A 1 169 ? 11.754  35.697  22.624  1.00 35.28 ? 200 ASP A OD1   1 
ATOM   1269 O  OD2   . ASP A 1 169 ? 9.541   35.609  22.599  1.00 36.21 ? 200 ASP A OD2   1 
ATOM   1270 N  N     . VAL A 1 170 ? 13.148  37.290  20.401  1.00 30.23 ? 201 VAL A N     1 
ATOM   1271 C  CA    . VAL A 1 170 ? 13.593  36.962  19.044  1.00 29.77 ? 201 VAL A CA    1 
ATOM   1272 C  C     . VAL A 1 170 ? 13.690  35.465  18.818  1.00 29.86 ? 201 VAL A C     1 
ATOM   1273 O  O     . VAL A 1 170 ? 13.640  34.700  19.778  1.00 29.93 ? 201 VAL A O     1 
ATOM   1274 C  CB    . VAL A 1 170 ? 14.982  37.569  18.766  1.00 29.61 ? 201 VAL A CB    1 
ATOM   1275 C  CG1   . VAL A 1 170 ? 14.993  39.015  19.138  1.00 28.10 ? 201 VAL A CG1   1 
ATOM   1276 C  CG2   . VAL A 1 170 ? 16.069  36.802  19.530  1.00 29.67 ? 201 VAL A CG2   1 
ATOM   1277 N  N     . GLY A 1 171 ? 13.818  35.044  17.554  1.00 29.98 ? 202 GLY A N     1 
ATOM   1278 C  CA    . GLY A 1 171 ? 14.252  33.644  17.214  1.00 30.28 ? 202 GLY A CA    1 
ATOM   1279 C  C     . GLY A 1 171 ? 15.750  33.776  17.229  1.00 30.42 ? 202 GLY A C     1 
ATOM   1280 O  O     . GLY A 1 171 ? 16.224  34.820  16.859  1.00 30.92 ? 202 GLY A O     1 
ATOM   1281 N  N     . GLY A 1 172 ? 16.576  32.840  17.664  1.00 30.61 ? 203 GLY A N     1 
ATOM   1282 C  CA    . GLY A 1 172 ? 16.559  31.456  17.677  1.00 30.64 ? 203 GLY A CA    1 
ATOM   1283 C  C     . GLY A 1 172 ? 17.763  31.038  16.839  1.00 30.16 ? 203 GLY A C     1 
ATOM   1284 O  O     . GLY A 1 172 ? 18.933  31.240  17.148  1.00 30.24 ? 203 GLY A O     1 
ATOM   1285 N  N     . GLN A 1 173 ? 17.376  30.497  15.718  1.00 29.73 ? 204 GLN A N     1 
ATOM   1286 C  CA    . GLN A 1 173 ? 18.208  29.750  14.840  1.00 29.24 ? 204 GLN A CA    1 
ATOM   1287 C  C     . GLN A 1 173 ? 19.048  30.717  14.013  1.00 29.17 ? 204 GLN A C     1 
ATOM   1288 O  O     . GLN A 1 173 ? 18.705  31.905  13.891  1.00 28.69 ? 204 GLN A O     1 
ATOM   1289 C  CB    . GLN A 1 173 ? 17.316  28.874  13.937  1.00 28.64 ? 204 GLN A CB    1 
ATOM   1290 C  CG    . GLN A 1 173 ? 16.585  27.708  14.615  1.00 28.22 ? 204 GLN A CG    1 
ATOM   1291 C  CD    . GLN A 1 173 ? 15.557  28.080  15.715  1.00 28.98 ? 204 GLN A CD    1 
ATOM   1292 O  OE1   . GLN A 1 173 ? 14.946  29.159  15.727  1.00 28.18 ? 204 GLN A OE1   1 
ATOM   1293 N  NE2   . GLN A 1 173 ? 15.386  27.167  16.655  1.00 28.53 ? 204 GLN A NE2   1 
ATOM   1294 N  N     . ARG A 1 174 ? 20.149  30.192  13.471  1.00 28.82 ? 205 ARG A N     1 
ATOM   1295 C  CA    . ARG A 1 174 ? 21.030  30.947  12.596  1.00 28.96 ? 205 ARG A CA    1 
ATOM   1296 C  C     . ARG A 1 174 ? 20.271  31.861  11.644  1.00 28.97 ? 205 ARG A C     1 
ATOM   1297 O  O     . ARG A 1 174 ? 20.609  33.026  11.522  1.00 29.50 ? 205 ARG A O     1 
ATOM   1298 C  CB    . ARG A 1 174 ? 21.923  30.007  11.782  1.00 29.06 ? 205 ARG A CB    1 
ATOM   1299 C  CG    . ARG A 1 174 ? 22.945  29.267  12.641  1.00 29.85 ? 205 ARG A CG    1 
ATOM   1300 C  CD    . ARG A 1 174 ? 23.887  28.441  11.820  1.00 29.18 ? 205 ARG A CD    1 
ATOM   1301 N  NE    . ARG A 1 174 ? 24.934  27.877  12.669  1.00 29.80 ? 205 ARG A NE    1 
ATOM   1302 C  CZ    . ARG A 1 174 ? 25.802  26.942  12.290  1.00 27.95 ? 205 ARG A CZ    1 
ATOM   1303 N  NH1   . ARG A 1 174 ? 25.764  26.416  11.066  1.00 27.12 ? 205 ARG A NH1   1 
ATOM   1304 N  NH2   . ARG A 1 174 ? 26.694  26.511  13.162  1.00 27.81 ? 205 ARG A NH2   1 
ATOM   1305 N  N     . SER A 1 175 ? 19.245  31.322  10.988  1.00 29.18 ? 206 SER A N     1 
ATOM   1306 C  CA    . SER A 1 175 ? 18.427  32.068  10.026  1.00 29.01 ? 206 SER A CA    1 
ATOM   1307 C  C     . SER A 1 175 ? 17.766  33.320  10.609  1.00 29.03 ? 206 SER A C     1 
ATOM   1308 O  O     . SER A 1 175 ? 17.542  34.280  9.899   1.00 29.20 ? 206 SER A O     1 
ATOM   1309 C  CB    . SER A 1 175 ? 17.352  31.161  9.398   1.00 29.41 ? 206 SER A CB    1 
ATOM   1310 O  OG    . SER A 1 175 ? 16.295  30.864  10.299  1.00 28.96 ? 206 SER A OG    1 
ATOM   1311 N  N     . GLU A 1 176 ? 17.450  33.316  11.895  1.00 29.54 ? 207 GLU A N     1 
ATOM   1312 C  CA    . GLU A 1 176 ? 16.787  34.463  12.524  1.00 29.78 ? 207 GLU A CA    1 
ATOM   1313 C  C     . GLU A 1 176 ? 17.761  35.543  12.967  1.00 29.94 ? 207 GLU A C     1 
ATOM   1314 O  O     . GLU A 1 176 ? 17.352  36.690  13.193  1.00 30.19 ? 207 GLU A O     1 
ATOM   1315 C  CB    . GLU A 1 176 ? 15.998  34.012  13.737  1.00 29.60 ? 207 GLU A CB    1 
ATOM   1316 C  CG    . GLU A 1 176 ? 14.971  32.928  13.415  1.00 30.83 ? 207 GLU A CG    1 
ATOM   1317 C  CD    . GLU A 1 176 ? 13.773  33.443  12.663  1.00 32.06 ? 207 GLU A CD    1 
ATOM   1318 O  OE1   . GLU A 1 176 ? 13.065  32.618  12.051  1.00 34.60 ? 207 GLU A OE1   1 
ATOM   1319 O  OE2   . GLU A 1 176 ? 13.534  34.670  12.671  1.00 33.29 ? 207 GLU A OE2   1 
ATOM   1320 N  N     . ARG A 1 177 ? 19.040  35.194  13.086  1.00 29.76 ? 208 ARG A N     1 
ATOM   1321 C  CA    . ARG A 1 177 ? 19.982  36.078  13.764  1.00 30.38 ? 208 ARG A CA    1 
ATOM   1322 C  C     . ARG A 1 177 ? 20.336  37.323  12.942  1.00 30.10 ? 208 ARG A C     1 
ATOM   1323 O  O     . ARG A 1 177 ? 20.525  38.377  13.509  1.00 29.89 ? 208 ARG A O     1 
ATOM   1324 C  CB    . ARG A 1 177 ? 21.224  35.305  14.207  1.00 30.61 ? 208 ARG A CB    1 
ATOM   1325 C  CG    . ARG A 1 177 ? 20.840  34.039  14.924  1.00 32.84 ? 208 ARG A CG    1 
ATOM   1326 C  CD    . ARG A 1 177 ? 21.625  33.771  16.175  1.00 35.23 ? 208 ARG A CD    1 
ATOM   1327 N  NE    . ARG A 1 177 ? 22.707  32.810  15.955  1.00 38.14 ? 208 ARG A NE    1 
ATOM   1328 C  CZ    . ARG A 1 177 ? 22.632  31.503  16.182  1.00 36.66 ? 208 ARG A CZ    1 
ATOM   1329 N  NH1   . ARG A 1 177 ? 23.686  30.763  15.972  1.00 36.82 ? 208 ARG A NH1   1 
ATOM   1330 N  NH2   . ARG A 1 177 ? 21.522  30.934  16.625  1.00 36.57 ? 208 ARG A NH2   1 
ATOM   1331 N  N     . LYS A 1 178 ? 20.368  37.201  11.618  1.00 30.22 ? 209 LYS A N     1 
ATOM   1332 C  CA    . LYS A 1 178 ? 20.523  38.359  10.722  1.00 30.75 ? 209 LYS A CA    1 
ATOM   1333 C  C     . LYS A 1 178 ? 19.534  39.489  11.012  1.00 30.57 ? 209 LYS A C     1 
ATOM   1334 O  O     . LYS A 1 178 ? 19.777  40.616  10.643  1.00 30.84 ? 209 LYS A O     1 
ATOM   1335 C  CB    . LYS A 1 178 ? 20.310  37.968  9.243   1.00 30.83 ? 209 LYS A CB    1 
ATOM   1336 C  CG    . LYS A 1 178 ? 20.208  36.476  8.922   1.00 31.91 ? 209 LYS A CG    1 
ATOM   1337 C  CD    . LYS A 1 178 ? 20.088  36.260  7.412   1.00 32.29 ? 209 LYS A CD    1 
ATOM   1338 C  CE    . LYS A 1 178 ? 20.168  34.776  7.064   1.00 34.88 ? 209 LYS A CE    1 
ATOM   1339 N  NZ    . LYS A 1 178 ? 21.518  34.311  6.535   1.00 37.41 ? 209 LYS A NZ    1 
ATOM   1340 N  N     . LYS A 1 179 ? 18.408  39.165  11.630  1.00 30.50 ? 210 LYS A N     1 
ATOM   1341 C  CA    . LYS A 1 179 ? 17.336  40.114  11.877  1.00 30.68 ? 210 LYS A CA    1 
ATOM   1342 C  C     . LYS A 1 179 ? 17.508  40.873  13.199  1.00 30.56 ? 210 LYS A C     1 
ATOM   1343 O  O     . LYS A 1 179 ? 16.750  41.800  13.485  1.00 30.29 ? 210 LYS A O     1 
ATOM   1344 C  CB    . LYS A 1 179 ? 16.020  39.335  11.983  1.00 30.99 ? 210 LYS A CB    1 
ATOM   1345 C  CG    . LYS A 1 179 ? 15.694  38.440  10.801  1.00 31.28 ? 210 LYS A CG    1 
ATOM   1346 C  CD    . LYS A 1 179 ? 14.612  37.452  11.218  1.00 31.23 ? 210 LYS A CD    1 
ATOM   1347 C  CE    . LYS A 1 179 ? 13.838  36.938  10.016  1.00 30.85 ? 210 LYS A CE    1 
ATOM   1348 N  NZ    . LYS A 1 179 ? 12.671  36.114  10.490  1.00 30.06 ? 210 LYS A NZ    1 
ATOM   1349 N  N     . TRP A 1 180 ? 18.468  40.439  14.011  1.00 30.34 ? 211 TRP A N     1 
ATOM   1350 C  CA    . TRP A 1 180 ? 18.668  40.968  15.350  1.00 30.56 ? 211 TRP A CA    1 
ATOM   1351 C  C     . TRP A 1 180 ? 19.120  42.424  15.343  1.00 30.61 ? 211 TRP A C     1 
ATOM   1352 O  O     . TRP A 1 180 ? 18.782  43.189  16.239  1.00 30.29 ? 211 TRP A O     1 
ATOM   1353 C  CB    . TRP A 1 180 ? 19.693  40.094  16.075  1.00 30.98 ? 211 TRP A CB    1 
ATOM   1354 C  CG    . TRP A 1 180 ? 19.148  38.753  16.520  1.00 31.48 ? 211 TRP A CG    1 
ATOM   1355 C  CD1   . TRP A 1 180 ? 17.974  38.176  16.119  1.00 32.01 ? 211 TRP A CD1   1 
ATOM   1356 C  CD2   . TRP A 1 180 ? 19.759  37.822  17.430  1.00 31.04 ? 211 TRP A CD2   1 
ATOM   1357 N  NE1   . TRP A 1 180 ? 17.820  36.965  16.725  1.00 32.54 ? 211 TRP A NE1   1 
ATOM   1358 C  CE2   . TRP A 1 180 ? 18.894  36.718  17.536  1.00 31.52 ? 211 TRP A CE2   1 
ATOM   1359 C  CE3   . TRP A 1 180 ? 20.952  37.815  18.165  1.00 31.50 ? 211 TRP A CE3   1 
ATOM   1360 C  CZ2   . TRP A 1 180 ? 19.171  35.622  18.354  1.00 31.46 ? 211 TRP A CZ2   1 
ATOM   1361 C  CZ3   . TRP A 1 180 ? 21.229  36.725  18.979  1.00 31.73 ? 211 TRP A CZ3   1 
ATOM   1362 C  CH2   . TRP A 1 180 ? 20.336  35.641  19.069  1.00 31.25 ? 211 TRP A CH2   1 
ATOM   1363 N  N     . ILE A 1 181 ? 19.868  42.802  14.310  1.00 30.77 ? 212 ILE A N     1 
ATOM   1364 C  CA    . ILE A 1 181 ? 20.409  44.158  14.184  1.00 30.88 ? 212 ILE A CA    1 
ATOM   1365 C  C     . ILE A 1 181 ? 19.312  45.226  14.324  1.00 31.02 ? 212 ILE A C     1 
ATOM   1366 O  O     . ILE A 1 181 ? 19.543  46.313  14.856  1.00 30.76 ? 212 ILE A O     1 
ATOM   1367 C  CB    . ILE A 1 181 ? 21.193  44.327  12.842  1.00 31.28 ? 212 ILE A CB    1 
ATOM   1368 C  CG1   . ILE A 1 181 ? 20.311  44.006  11.636  1.00 31.33 ? 212 ILE A CG1   1 
ATOM   1369 C  CG2   . ILE A 1 181 ? 22.440  43.419  12.800  1.00 30.83 ? 212 ILE A CG2   1 
ATOM   1370 C  CD1   . ILE A 1 181 ? 20.980  44.345  10.337  1.00 32.91 ? 212 ILE A CD1   1 
ATOM   1371 N  N     . HIS A 1 182 ? 18.103  44.886  13.891  1.00 31.45 ? 213 HIS A N     1 
ATOM   1372 C  CA    . HIS A 1 182 ? 16.978  45.817  13.940  1.00 31.74 ? 213 HIS A CA    1 
ATOM   1373 C  C     . HIS A 1 182 ? 16.447  46.090  15.360  1.00 31.68 ? 213 HIS A C     1 
ATOM   1374 O  O     . HIS A 1 182 ? 15.589  46.951  15.516  1.00 31.41 ? 213 HIS A O     1 
ATOM   1375 C  CB    . HIS A 1 182 ? 15.881  45.308  12.998  1.00 32.11 ? 213 HIS A CB    1 
ATOM   1376 C  CG    . HIS A 1 182 ? 16.301  45.288  11.565  1.00 32.86 ? 213 HIS A CG    1 
ATOM   1377 N  ND1   . HIS A 1 182 ? 16.093  44.205  10.738  1.00 35.99 ? 213 HIS A ND1   1 
ATOM   1378 C  CD2   . HIS A 1 182 ? 16.948  46.210  10.815  1.00 34.80 ? 213 HIS A CD2   1 
ATOM   1379 C  CE1   . HIS A 1 182 ? 16.575  44.469  9.535   1.00 35.49 ? 213 HIS A CE1   1 
ATOM   1380 N  NE2   . HIS A 1 182 ? 17.107  45.677  9.556   1.00 35.08 ? 213 HIS A NE2   1 
ATOM   1381 N  N     . CYS A 1 183 ? 16.949  45.345  16.361  1.00 31.74 ? 214 CYS A N     1 
ATOM   1382 C  CA    . CYS A 1 183 ? 16.685  45.589  17.788  1.00 32.55 ? 214 CYS A CA    1 
ATOM   1383 C  C     . CYS A 1 183 ? 17.795  46.273  18.532  1.00 31.94 ? 214 CYS A C     1 
ATOM   1384 O  O     . CYS A 1 183 ? 17.649  46.582  19.726  1.00 31.63 ? 214 CYS A O     1 
ATOM   1385 C  CB    . CYS A 1 183 ? 16.693  44.279  18.564  1.00 33.17 ? 214 CYS A CB    1 
ATOM   1386 S  SG    . CYS A 1 183 ? 15.459  43.246  18.278  1.00 39.09 ? 214 CYS A SG    1 
ATOM   1387 N  N     . PHE A 1 184 ? 18.940  46.384  17.879  1.00 31.44 ? 215 PHE A N     1 
ATOM   1388 C  CA    . PHE A 1 184 ? 20.201  46.558  18.587  1.00 31.40 ? 215 PHE A CA    1 
ATOM   1389 C  C     . PHE A 1 184 ? 20.485  47.989  19.061  1.00 31.84 ? 215 PHE A C     1 
ATOM   1390 O  O     . PHE A 1 184 ? 21.464  48.216  19.764  1.00 31.92 ? 215 PHE A O     1 
ATOM   1391 C  CB    . PHE A 1 184 ? 21.367  46.044  17.706  1.00 30.85 ? 215 PHE A CB    1 
ATOM   1392 C  CG    . PHE A 1 184 ? 21.649  44.547  17.814  1.00 29.32 ? 215 PHE A CG    1 
ATOM   1393 C  CD1   . PHE A 1 184 ? 22.809  44.029  17.245  1.00 28.79 ? 215 PHE A CD1   1 
ATOM   1394 C  CD2   . PHE A 1 184 ? 20.791  43.670  18.479  1.00 28.09 ? 215 PHE A CD2   1 
ATOM   1395 C  CE1   . PHE A 1 184 ? 23.117  42.661  17.330  1.00 29.21 ? 215 PHE A CE1   1 
ATOM   1396 C  CE2   . PHE A 1 184 ? 21.083  42.305  18.573  1.00 27.52 ? 215 PHE A CE2   1 
ATOM   1397 C  CZ    . PHE A 1 184 ? 22.242  41.790  17.999  1.00 28.57 ? 215 PHE A CZ    1 
ATOM   1398 N  N     . GLU A 1 185 ? 19.632  48.943  18.700  1.00 32.15 ? 216 GLU A N     1 
ATOM   1399 C  CA    . GLU A 1 185 ? 19.838  50.344  19.057  1.00 32.20 ? 216 GLU A CA    1 
ATOM   1400 C  C     . GLU A 1 185 ? 19.267  50.679  20.436  1.00 31.82 ? 216 GLU A C     1 
ATOM   1401 O  O     . GLU A 1 185 ? 18.135  50.290  20.776  1.00 32.11 ? 216 GLU A O     1 
ATOM   1402 C  CB    . GLU A 1 185 ? 19.195  51.233  18.001  1.00 32.43 ? 216 GLU A CB    1 
ATOM   1403 C  CG    . GLU A 1 185 ? 19.291  52.734  18.261  1.00 33.86 ? 216 GLU A CG    1 
ATOM   1404 C  CD    . GLU A 1 185 ? 18.650  53.529  17.144  1.00 34.92 ? 216 GLU A CD    1 
ATOM   1405 O  OE1   . GLU A 1 185 ? 17.788  52.945  16.440  1.00 36.55 ? 216 GLU A OE1   1 
ATOM   1406 O  OE2   . GLU A 1 185 ? 19.018  54.712  16.960  1.00 35.55 ? 216 GLU A OE2   1 
ATOM   1407 N  N     . GLY A 1 186 ? 20.068  51.394  21.225  1.00 30.91 ? 217 GLY A N     1 
ATOM   1408 C  CA    . GLY A 1 186 ? 19.632  51.931  22.505  1.00 30.33 ? 217 GLY A CA    1 
ATOM   1409 C  C     . GLY A 1 186 ? 19.227  50.907  23.535  1.00 29.86 ? 217 GLY A C     1 
ATOM   1410 O  O     . GLY A 1 186 ? 18.293  51.142  24.294  1.00 29.91 ? 217 GLY A O     1 
ATOM   1411 N  N     . VAL A 1 187 ? 19.952  49.793  23.594  1.00 29.49 ? 218 VAL A N     1 
ATOM   1412 C  CA    . VAL A 1 187 ? 19.577  48.659  24.460  1.00 29.33 ? 218 VAL A CA    1 
ATOM   1413 C  C     . VAL A 1 187 ? 20.083  48.858  25.885  1.00 29.16 ? 218 VAL A C     1 
ATOM   1414 O  O     . VAL A 1 187 ? 21.269  49.108  26.071  1.00 29.26 ? 218 VAL A O     1 
ATOM   1415 C  CB    . VAL A 1 187 ? 20.120  47.315  23.867  1.00 29.27 ? 218 VAL A CB    1 
ATOM   1416 C  CG1   . VAL A 1 187 ? 19.860  46.130  24.807  1.00 29.56 ? 218 VAL A CG1   1 
ATOM   1417 C  CG2   . VAL A 1 187 ? 19.507  47.060  22.490  1.00 28.38 ? 218 VAL A CG2   1 
ATOM   1418 N  N     . THR A 1 188 ? 19.193  48.758  26.878  1.00 28.70 ? 219 THR A N     1 
ATOM   1419 C  CA    . THR A 1 188 ? 19.605  48.923  28.281  1.00 28.44 ? 219 THR A CA    1 
ATOM   1420 C  C     . THR A 1 188 ? 20.110  47.629  28.871  1.00 28.44 ? 219 THR A C     1 
ATOM   1421 O  O     . THR A 1 188 ? 21.001  47.635  29.703  1.00 28.70 ? 219 THR A O     1 
ATOM   1422 C  CB    . THR A 1 188 ? 18.467  49.381  29.171  1.00 28.32 ? 219 THR A CB    1 
ATOM   1423 O  OG1   . THR A 1 188 ? 17.827  50.509  28.574  1.00 28.90 ? 219 THR A OG1   1 
ATOM   1424 C  CG2   . THR A 1 188 ? 19.001  49.786  30.526  1.00 27.69 ? 219 THR A CG2   1 
ATOM   1425 N  N     . ALA A 1 189 ? 19.492  46.523  28.480  1.00 28.73 ? 220 ALA A N     1 
ATOM   1426 C  CA    . ALA A 1 189 ? 19.810  45.228  29.059  1.00 28.81 ? 220 ALA A CA    1 
ATOM   1427 C  C     . ALA A 1 189 ? 19.553  44.096  28.068  1.00 29.13 ? 220 ALA A C     1 
ATOM   1428 O  O     . ALA A 1 189 ? 18.652  44.159  27.242  1.00 29.17 ? 220 ALA A O     1 
ATOM   1429 C  CB    . ALA A 1 189 ? 19.008  45.008  30.312  1.00 28.53 ? 220 ALA A CB    1 
ATOM   1430 N  N     . ILE A 1 190 ? 20.382  43.069  28.156  1.00 29.57 ? 221 ILE A N     1 
ATOM   1431 C  CA    . ILE A 1 190 ? 20.224  41.844  27.394  1.00 29.92 ? 221 ILE A CA    1 
ATOM   1432 C  C     . ILE A 1 190 ? 20.174  40.707  28.403  1.00 30.30 ? 221 ILE A C     1 
ATOM   1433 O  O     . ILE A 1 190 ? 21.038  40.620  29.272  1.00 30.72 ? 221 ILE A O     1 
ATOM   1434 C  CB    . ILE A 1 190 ? 21.449  41.582  26.457  1.00 30.16 ? 221 ILE A CB    1 
ATOM   1435 C  CG1   . ILE A 1 190 ? 21.450  42.521  25.240  1.00 30.90 ? 221 ILE A CG1   1 
ATOM   1436 C  CG2   . ILE A 1 190 ? 21.477  40.149  25.946  1.00 30.85 ? 221 ILE A CG2   1 
ATOM   1437 C  CD1   . ILE A 1 190 ? 22.777  42.532  24.465  1.00 29.49 ? 221 ILE A CD1   1 
ATOM   1438 N  N     . ILE A 1 191 ? 19.139  39.875  28.328  1.00 30.55 ? 222 ILE A N     1 
ATOM   1439 C  CA    . ILE A 1 191 ? 19.135  38.593  28.998  1.00 30.61 ? 222 ILE A CA    1 
ATOM   1440 C  C     . ILE A 1 191 ? 19.516  37.617  27.902  1.00 30.90 ? 222 ILE A C     1 
ATOM   1441 O  O     . ILE A 1 191 ? 18.764  37.425  26.957  1.00 31.29 ? 222 ILE A O     1 
ATOM   1442 C  CB    . ILE A 1 191 ? 17.748  38.254  29.625  1.00 30.80 ? 222 ILE A CB    1 
ATOM   1443 C  CG1   . ILE A 1 191 ? 17.335  39.364  30.611  1.00 31.25 ? 222 ILE A CG1   1 
ATOM   1444 C  CG2   . ILE A 1 191 ? 17.783  36.919  30.358  1.00 30.60 ? 222 ILE A CG2   1 
ATOM   1445 C  CD1   . ILE A 1 191 ? 16.160  39.007  31.525  1.00 30.79 ? 222 ILE A CD1   1 
ATOM   1446 N  N     . PHE A 1 192 ? 20.717  37.049  27.996  1.00 31.18 ? 223 PHE A N     1 
ATOM   1447 C  CA    . PHE A 1 192 ? 21.181  36.069  27.044  1.00 30.87 ? 223 PHE A CA    1 
ATOM   1448 C  C     . PHE A 1 192 ? 20.927  34.705  27.637  1.00 31.70 ? 223 PHE A C     1 
ATOM   1449 O  O     . PHE A 1 192 ? 21.490  34.378  28.676  1.00 32.22 ? 223 PHE A O     1 
ATOM   1450 C  CB    . PHE A 1 192 ? 22.671  36.228  26.779  1.00 30.81 ? 223 PHE A CB    1 
ATOM   1451 C  CG    . PHE A 1 192 ? 23.169  35.377  25.641  1.00 31.17 ? 223 PHE A CG    1 
ATOM   1452 C  CD1   . PHE A 1 192 ? 23.324  35.913  24.369  1.00 30.83 ? 223 PHE A CD1   1 
ATOM   1453 C  CD2   . PHE A 1 192 ? 23.451  34.037  25.825  1.00 28.80 ? 223 PHE A CD2   1 
ATOM   1454 C  CE1   . PHE A 1 192 ? 23.755  35.111  23.305  1.00 31.23 ? 223 PHE A CE1   1 
ATOM   1455 C  CE2   . PHE A 1 192 ? 23.894  33.252  24.760  1.00 30.14 ? 223 PHE A CE2   1 
ATOM   1456 C  CZ    . PHE A 1 192 ? 24.030  33.783  23.509  1.00 29.84 ? 223 PHE A CZ    1 
ATOM   1457 N  N     . CYS A 1 193 ? 20.088  33.906  26.988  1.00 32.04 ? 224 CYS A N     1 
ATOM   1458 C  CA    . CYS A 1 193 ? 19.761  32.590  27.483  1.00 32.67 ? 224 CYS A CA    1 
ATOM   1459 C  C     . CYS A 1 193 ? 20.607  31.491  26.858  1.00 32.82 ? 224 CYS A C     1 
ATOM   1460 O  O     . CYS A 1 193 ? 20.829  31.481  25.654  1.00 32.86 ? 224 CYS A O     1 
ATOM   1461 C  CB    . CYS A 1 193 ? 18.303  32.290  27.182  1.00 33.06 ? 224 CYS A CB    1 
ATOM   1462 S  SG    . CYS A 1 193 ? 17.178  33.419  27.980  1.00 34.49 ? 224 CYS A SG    1 
ATOM   1463 N  N     . VAL A 1 194 ? 21.020  30.548  27.703  1.00 33.03 ? 225 VAL A N     1 
ATOM   1464 C  CA    . VAL A 1 194 ? 21.732  29.361  27.323  1.00 32.80 ? 225 VAL A CA    1 
ATOM   1465 C  C     . VAL A 1 194 ? 21.027  28.167  27.935  1.00 33.33 ? 225 VAL A C     1 
ATOM   1466 O  O     . VAL A 1 194 ? 20.618  28.187  29.119  1.00 33.42 ? 225 VAL A O     1 
ATOM   1467 C  CB    . VAL A 1 194 ? 23.133  29.348  27.879  1.00 32.94 ? 225 VAL A CB    1 
ATOM   1468 C  CG1   . VAL A 1 194 ? 23.810  28.022  27.525  1.00 32.78 ? 225 VAL A CG1   1 
ATOM   1469 C  CG2   . VAL A 1 194 ? 23.911  30.518  27.347  1.00 33.18 ? 225 VAL A CG2   1 
ATOM   1470 N  N     . ALA A 1 195 ? 20.874  27.128  27.123  1.00 33.11 ? 226 ALA A N     1 
ATOM   1471 C  CA    . ALA A 1 195 ? 20.313  25.885  27.571  1.00 32.53 ? 226 ALA A CA    1 
ATOM   1472 C  C     . ALA A 1 195 ? 21.473  25.029  28.101  1.00 32.18 ? 226 ALA A C     1 
ATOM   1473 O  O     . ALA A 1 195 ? 22.297  24.521  27.347  1.00 32.27 ? 226 ALA A O     1 
ATOM   1474 C  CB    . ALA A 1 195 ? 19.597  25.203  26.422  1.00 32.22 ? 226 ALA A CB    1 
ATOM   1475 N  N     . LEU A 1 196 ? 21.528  24.875  29.414  1.00 32.17 ? 227 LEU A N     1 
ATOM   1476 C  CA    . LEU A 1 196 ? 22.584  24.097  30.073  1.00 31.70 ? 227 LEU A CA    1 
ATOM   1477 C  C     . LEU A 1 196 ? 22.602  22.666  29.558  1.00 31.94 ? 227 LEU A C     1 
ATOM   1478 O  O     . LEU A 1 196 ? 23.653  22.077  29.361  1.00 31.42 ? 227 LEU A O     1 
ATOM   1479 C  CB    . LEU A 1 196 ? 22.388  24.105  31.595  1.00 30.83 ? 227 LEU A CB    1 
ATOM   1480 C  CG    . LEU A 1 196 ? 22.878  25.380  32.292  1.00 30.93 ? 227 LEU A CG    1 
ATOM   1481 C  CD1   . LEU A 1 196 ? 22.462  25.448  33.761  1.00 26.53 ? 227 LEU A CD1   1 
ATOM   1482 C  CD2   . LEU A 1 196 ? 24.401  25.508  32.159  1.00 29.52 ? 227 LEU A CD2   1 
ATOM   1483 N  N     . SER A 1 197 ? 21.416  22.124  29.331  1.00 32.61 ? 228 SER A N     1 
ATOM   1484 C  CA    . SER A 1 197 ? 21.251  20.732  28.970  1.00 33.33 ? 228 SER A CA    1 
ATOM   1485 C  C     . SER A 1 197 ? 21.587  20.469  27.501  1.00 33.49 ? 228 SER A C     1 
ATOM   1486 O  O     . SER A 1 197 ? 21.565  19.337  27.071  1.00 33.90 ? 228 SER A O     1 
ATOM   1487 C  CB    . SER A 1 197 ? 19.816  20.291  29.260  1.00 33.49 ? 228 SER A CB    1 
ATOM   1488 O  OG    . SER A 1 197 ? 18.914  21.308  28.866  1.00 35.05 ? 228 SER A OG    1 
ATOM   1489 N  N     . ASP A 1 198 ? 21.926  21.510  26.747  1.00 33.90 ? 229 ASP A N     1 
ATOM   1490 C  CA    . ASP A 1 198 ? 22.257  21.375  25.334  1.00 33.97 ? 229 ASP A CA    1 
ATOM   1491 C  C     . ASP A 1 198 ? 23.706  20.912  25.111  1.00 33.43 ? 229 ASP A C     1 
ATOM   1492 O  O     . ASP A 1 198 ? 24.155  20.794  23.970  1.00 33.19 ? 229 ASP A O     1 
ATOM   1493 C  CB    . ASP A 1 198 ? 21.986  22.702  24.596  1.00 34.48 ? 229 ASP A CB    1 
ATOM   1494 C  CG    . ASP A 1 198 ? 20.513  22.867  24.180  1.00 36.69 ? 229 ASP A CG    1 
ATOM   1495 O  OD1   . ASP A 1 198 ? 19.656  22.048  24.619  1.00 38.44 ? 229 ASP A OD1   1 
ATOM   1496 O  OD2   . ASP A 1 198 ? 20.219  23.819  23.399  1.00 39.79 ? 229 ASP A OD2   1 
ATOM   1497 N  N     . TYR A 1 199 ? 24.426  20.627  26.196  1.00 32.75 ? 230 TYR A N     1 
ATOM   1498 C  CA    . TYR A 1 199 ? 25.862  20.382  26.097  1.00 31.95 ? 230 TYR A CA    1 
ATOM   1499 C  C     . TYR A 1 199 ? 26.192  19.124  25.288  1.00 31.37 ? 230 TYR A C     1 
ATOM   1500 O  O     . TYR A 1 199 ? 27.289  19.000  24.774  1.00 31.14 ? 230 TYR A O     1 
ATOM   1501 C  CB    . TYR A 1 199 ? 26.516  20.357  27.492  1.00 31.67 ? 230 TYR A CB    1 
ATOM   1502 C  CG    . TYR A 1 199 ? 26.184  19.146  28.328  1.00 31.45 ? 230 TYR A CG    1 
ATOM   1503 C  CD1   . TYR A 1 199 ? 25.079  19.143  29.163  1.00 32.40 ? 230 TYR A CD1   1 
ATOM   1504 C  CD2   . TYR A 1 199 ? 26.977  18.008  28.299  1.00 30.87 ? 230 TYR A CD2   1 
ATOM   1505 C  CE1   . TYR A 1 199 ? 24.758  18.035  29.936  1.00 31.25 ? 230 TYR A CE1   1 
ATOM   1506 C  CE2   . TYR A 1 199 ? 26.671  16.900  29.083  1.00 30.54 ? 230 TYR A CE2   1 
ATOM   1507 C  CZ    . TYR A 1 199 ? 25.555  16.930  29.893  1.00 30.64 ? 230 TYR A CZ    1 
ATOM   1508 O  OH    . TYR A 1 199 ? 25.205  15.868  30.668  1.00 31.17 ? 230 TYR A OH    1 
ATOM   1509 N  N     . ASP A 1 200 ? 25.248  18.201  25.164  1.00 30.89 ? 231 ASP A N     1 
ATOM   1510 C  CA    . ASP A 1 200 ? 25.503  16.967  24.404  1.00 30.67 ? 231 ASP A CA    1 
ATOM   1511 C  C     . ASP A 1 200 ? 24.581  16.847  23.192  1.00 30.53 ? 231 ASP A C     1 
ATOM   1512 O  O     . ASP A 1 200 ? 24.406  15.790  22.636  1.00 30.35 ? 231 ASP A O     1 
ATOM   1513 C  CB    . ASP A 1 200 ? 25.423  15.739  25.333  1.00 30.56 ? 231 ASP A CB    1 
ATOM   1514 C  CG    . ASP A 1 200 ? 24.002  15.422  25.811  1.00 30.80 ? 231 ASP A CG    1 
ATOM   1515 O  OD1   . ASP A 1 200 ? 23.040  16.173  25.500  1.00 28.37 ? 231 ASP A OD1   1 
ATOM   1516 O  OD2   . ASP A 1 200 ? 23.849  14.390  26.509  1.00 32.11 ? 231 ASP A OD2   1 
ATOM   1517 N  N     . LEU A 1 201 ? 23.980  17.958  22.800  1.00 30.85 ? 232 LEU A N     1 
ATOM   1518 C  CA    . LEU A 1 201 ? 23.089  17.984  21.677  1.00 30.73 ? 232 LEU A CA    1 
ATOM   1519 C  C     . LEU A 1 201 ? 23.753  18.710  20.493  1.00 31.03 ? 232 LEU A C     1 
ATOM   1520 O  O     . LEU A 1 201 ? 24.812  19.351  20.622  1.00 31.08 ? 232 LEU A O     1 
ATOM   1521 C  CB    . LEU A 1 201 ? 21.773  18.661  22.074  1.00 30.83 ? 232 LEU A CB    1 
ATOM   1522 C  CG    . LEU A 1 201 ? 20.920  17.964  23.151  1.00 31.38 ? 232 LEU A CG    1 
ATOM   1523 C  CD1   . LEU A 1 201 ? 19.561  18.637  23.359  1.00 30.44 ? 232 LEU A CD1   1 
ATOM   1524 C  CD2   . LEU A 1 201 ? 20.718  16.522  22.806  1.00 30.32 ? 232 LEU A CD2   1 
ATOM   1525 N  N     . VAL A 1 202 ? 23.091  18.614  19.347  1.00 30.87 ? 233 VAL A N     1 
ATOM   1526 C  CA    . VAL A 1 202 ? 23.547  19.212  18.115  1.00 31.07 ? 233 VAL A CA    1 
ATOM   1527 C  C     . VAL A 1 202 ? 22.496  20.207  17.590  1.00 30.84 ? 233 VAL A C     1 
ATOM   1528 O  O     . VAL A 1 202 ? 21.296  20.047  17.837  1.00 30.49 ? 233 VAL A O     1 
ATOM   1529 C  CB    . VAL A 1 202 ? 23.772  18.093  17.098  1.00 31.32 ? 233 VAL A CB    1 
ATOM   1530 C  CG1   . VAL A 1 202 ? 24.042  18.675  15.775  1.00 31.90 ? 233 VAL A CG1   1 
ATOM   1531 C  CG2   . VAL A 1 202 ? 24.933  17.206  17.559  1.00 31.95 ? 233 VAL A CG2   1 
ATOM   1532 N  N     . LEU A 1 203 ? 22.934  21.226  16.860  1.00 30.74 ? 234 LEU A N     1 
ATOM   1533 C  CA    . LEU A 1 203 ? 21.996  22.188  16.263  1.00 30.97 ? 234 LEU A CA    1 
ATOM   1534 C  C     . LEU A 1 203 ? 20.987  21.503  15.326  1.00 31.12 ? 234 LEU A C     1 
ATOM   1535 O  O     . LEU A 1 203 ? 21.375  20.705  14.470  1.00 31.27 ? 234 LEU A O     1 
ATOM   1536 C  CB    . LEU A 1 203 ? 22.772  23.248  15.465  1.00 30.73 ? 234 LEU A CB    1 
ATOM   1537 C  CG    . LEU A 1 203 ? 23.697  24.190  16.245  1.00 31.42 ? 234 LEU A CG    1 
ATOM   1538 C  CD1   . LEU A 1 203 ? 24.614  25.000  15.267  1.00 31.44 ? 234 LEU A CD1   1 
ATOM   1539 C  CD2   . LEU A 1 203 ? 22.919  25.137  17.198  1.00 28.43 ? 234 LEU A CD2   1 
ATOM   1540 N  N     . ALA A 1 204 ? 19.709  21.847  15.458  1.00 31.50 ? 235 ALA A N     1 
ATOM   1541 C  CA    . ALA A 1 204 ? 18.678  21.392  14.512  1.00 31.81 ? 235 ALA A CA    1 
ATOM   1542 C  C     . ALA A 1 204 ? 18.996  21.861  13.100  1.00 32.31 ? 235 ALA A C     1 
ATOM   1543 O  O     . ALA A 1 204 ? 18.723  21.155  12.144  1.00 32.52 ? 235 ALA A O     1 
ATOM   1544 C  CB    . ALA A 1 204 ? 17.284  21.901  14.945  1.00 31.75 ? 235 ALA A CB    1 
ATOM   1545 N  N     . GLU A 1 205 ? 19.584  23.050  12.976  1.00 33.38 ? 236 GLU A N     1 
ATOM   1546 C  CA    . GLU A 1 205 ? 19.960  23.628  11.663  1.00 33.94 ? 236 GLU A CA    1 
ATOM   1547 C  C     . GLU A 1 205 ? 21.342  23.209  11.167  1.00 34.19 ? 236 GLU A C     1 
ATOM   1548 O  O     . GLU A 1 205 ? 21.727  23.603  10.079  1.00 34.51 ? 236 GLU A O     1 
ATOM   1549 C  CB    . GLU A 1 205 ? 19.870  25.160  11.687  1.00 34.07 ? 236 GLU A CB    1 
ATOM   1550 C  CG    . GLU A 1 205 ? 20.901  25.859  12.575  1.00 34.42 ? 236 GLU A CG    1 
ATOM   1551 C  CD    . GLU A 1 205 ? 20.369  26.247  13.940  1.00 34.40 ? 236 GLU A CD    1 
ATOM   1552 O  OE1   . GLU A 1 205 ? 20.611  27.407  14.331  1.00 34.00 ? 236 GLU A OE1   1 
ATOM   1553 O  OE2   . GLU A 1 205 ? 19.714  25.410  14.605  1.00 34.94 ? 236 GLU A OE2   1 
ATOM   1554 N  N     . ASP A 1 206 ? 22.087  22.431  11.947  1.00 34.83 ? 237 ASP A N     1 
ATOM   1555 C  CA    . ASP A 1 206 ? 23.436  21.974  11.537  1.00 35.58 ? 237 ASP A CA    1 
ATOM   1556 C  C     . ASP A 1 206 ? 23.885  20.792  12.405  1.00 36.08 ? 237 ASP A C     1 
ATOM   1557 O  O     . ASP A 1 206 ? 24.386  20.974  13.530  1.00 36.13 ? 237 ASP A O     1 
ATOM   1558 C  CB    . ASP A 1 206 ? 24.467  23.119  11.644  1.00 35.33 ? 237 ASP A CB    1 
ATOM   1559 C  CG    . ASP A 1 206 ? 25.896  22.685  11.248  1.00 36.32 ? 237 ASP A CG    1 
ATOM   1560 O  OD1   . ASP A 1 206 ? 26.140  21.475  11.035  1.00 38.42 ? 237 ASP A OD1   1 
ATOM   1561 O  OD2   . ASP A 1 206 ? 26.784  23.558  11.141  1.00 36.17 ? 237 ASP A OD2   1 
ATOM   1562 N  N     . GLU A 1 207 ? 23.705  19.586  11.880  1.00 36.69 ? 238 GLU A N     1 
ATOM   1563 C  CA    . GLU A 1 207 ? 23.950  18.368  12.660  1.00 37.21 ? 238 GLU A CA    1 
ATOM   1564 C  C     . GLU A 1 207 ? 25.424  18.222  13.088  1.00 37.38 ? 238 GLU A C     1 
ATOM   1565 O  O     . GLU A 1 207 ? 25.717  17.410  13.955  1.00 37.43 ? 238 GLU A O     1 
ATOM   1566 C  CB    . GLU A 1 207 ? 23.442  17.111  11.921  1.00 37.69 ? 238 GLU A CB    1 
ATOM   1567 N  N     . GLU A 1 208 ? 26.329  19.025  12.515  1.00 37.66 ? 239 GLU A N     1 
ATOM   1568 C  CA    . GLU A 1 208 ? 27.768  18.940  12.811  1.00 37.99 ? 239 GLU A CA    1 
ATOM   1569 C  C     . GLU A 1 208 ? 28.274  19.849  13.948  1.00 37.58 ? 239 GLU A C     1 
ATOM   1570 O  O     . GLU A 1 208 ? 29.455  19.770  14.327  1.00 37.42 ? 239 GLU A O     1 
ATOM   1571 C  CB    . GLU A 1 208 ? 28.581  19.266  11.549  1.00 38.45 ? 239 GLU A CB    1 
ATOM   1572 C  CG    . GLU A 1 208 ? 28.442  18.240  10.418  1.00 40.66 ? 239 GLU A CG    1 
ATOM   1573 C  CD    . GLU A 1 208 ? 29.068  16.897  10.767  1.00 43.86 ? 239 GLU A CD    1 
ATOM   1574 O  OE1   . GLU A 1 208 ? 30.307  16.780  10.694  1.00 47.33 ? 239 GLU A OE1   1 
ATOM   1575 O  OE2   . GLU A 1 208 ? 28.327  15.956  11.115  1.00 45.45 ? 239 GLU A OE2   1 
ATOM   1576 N  N     . MET A 1 209 ? 27.408  20.718  14.470  1.00 36.93 ? 240 MET A N     1 
ATOM   1577 C  CA    . MET A 1 209 ? 27.815  21.706  15.459  1.00 36.35 ? 240 MET A CA    1 
ATOM   1578 C  C     . MET A 1 209 ? 27.130  21.422  16.776  1.00 35.67 ? 240 MET A C     1 
ATOM   1579 O  O     . MET A 1 209 ? 25.895  21.384  16.846  1.00 35.92 ? 240 MET A O     1 
ATOM   1580 C  CB    . MET A 1 209 ? 27.445  23.108  14.991  1.00 36.94 ? 240 MET A CB    1 
ATOM   1581 C  CG    . MET A 1 209 ? 27.809  24.238  15.954  1.00 37.78 ? 240 MET A CG    1 
ATOM   1582 S  SD    . MET A 1 209 ? 29.584  24.511  16.079  1.00 40.26 ? 240 MET A SD    1 
ATOM   1583 C  CE    . MET A 1 209 ? 29.721  26.250  16.460  1.00 40.01 ? 240 MET A CE    1 
ATOM   1584 N  N     . ASN A 1 210 ? 27.947  21.225  17.812  1.00 34.70 ? 241 ASN A N     1 
ATOM   1585 C  CA    . ASN A 1 210 ? 27.475  21.091  19.183  1.00 33.89 ? 241 ASN A CA    1 
ATOM   1586 C  C     . ASN A 1 210 ? 26.742  22.367  19.626  1.00 33.23 ? 241 ASN A C     1 
ATOM   1587 O  O     . ASN A 1 210 ? 27.267  23.466  19.513  1.00 32.65 ? 241 ASN A O     1 
ATOM   1588 C  CB    . ASN A 1 210 ? 28.652  20.784  20.147  1.00 33.73 ? 241 ASN A CB    1 
ATOM   1589 C  CG    . ASN A 1 210 ? 28.261  20.912  21.634  1.00 33.99 ? 241 ASN A CG    1 
ATOM   1590 O  OD1   . ASN A 1 210 ? 28.171  22.015  22.182  1.00 33.12 ? 241 ASN A OD1   1 
ATOM   1591 N  ND2   . ASN A 1 210 ? 28.019  19.780  22.278  1.00 34.09 ? 241 ASN A ND2   1 
ATOM   1592 N  N     . ARG A 1 211 ? 25.550  22.194  20.172  1.00 32.68 ? 242 ARG A N     1 
ATOM   1593 C  CA    . ARG A 1 211 ? 24.705  23.313  20.564  1.00 32.44 ? 242 ARG A CA    1 
ATOM   1594 C  C     . ARG A 1 211 ? 25.340  24.270  21.551  1.00 32.25 ? 242 ARG A C     1 
ATOM   1595 O  O     . ARG A 1 211 ? 25.092  25.451  21.481  1.00 32.01 ? 242 ARG A O     1 
ATOM   1596 C  CB    . ARG A 1 211 ? 23.431  22.789  21.204  1.00 32.41 ? 242 ARG A CB    1 
ATOM   1597 C  CG    . ARG A 1 211 ? 22.503  22.124  20.251  1.00 32.46 ? 242 ARG A CG    1 
ATOM   1598 C  CD    . ARG A 1 211 ? 21.097  22.352  20.676  1.00 34.00 ? 242 ARG A CD    1 
ATOM   1599 N  NE    . ARG A 1 211 ? 20.147  21.888  19.690  1.00 34.60 ? 242 ARG A NE    1 
ATOM   1600 C  CZ    . ARG A 1 211 ? 18.843  21.982  19.854  1.00 36.30 ? 242 ARG A CZ    1 
ATOM   1601 N  NH1   . ARG A 1 211 ? 18.350  22.539  20.957  1.00 37.85 ? 242 ARG A NH1   1 
ATOM   1602 N  NH2   . ARG A 1 211 ? 18.035  21.528  18.915  1.00 35.22 ? 242 ARG A NH2   1 
ATOM   1603 N  N     . MET A 1 212 ? 26.112  23.756  22.500  1.00 32.35 ? 243 MET A N     1 
ATOM   1604 C  CA    . MET A 1 212 ? 26.720  24.608  23.536  1.00 32.35 ? 243 MET A CA    1 
ATOM   1605 C  C     . MET A 1 212 ? 27.894  25.392  22.952  1.00 32.11 ? 243 MET A C     1 
ATOM   1606 O  O     . MET A 1 212 ? 28.118  26.539  23.316  1.00 31.42 ? 243 MET A O     1 
ATOM   1607 C  CB    . MET A 1 212 ? 27.156  23.771  24.739  1.00 32.10 ? 243 MET A CB    1 
ATOM   1608 C  CG    . MET A 1 212 ? 27.882  24.511  25.845  1.00 32.46 ? 243 MET A CG    1 
ATOM   1609 S  SD    . MET A 1 212 ? 26.768  25.377  26.953  1.00 35.63 ? 243 MET A SD    1 
ATOM   1610 C  CE    . MET A 1 212 ? 26.247  24.030  28.031  1.00 31.75 ? 243 MET A CE    1 
ATOM   1611 N  N     . HIS A 1 213 ? 28.637  24.766  22.049  1.00 32.32 ? 244 HIS A N     1 
ATOM   1612 C  CA    . HIS A 1 213 ? 29.686  25.461  21.294  1.00 32.49 ? 244 HIS A CA    1 
ATOM   1613 C  C     . HIS A 1 213 ? 29.098  26.618  20.488  1.00 32.29 ? 244 HIS A C     1 
ATOM   1614 O  O     . HIS A 1 213 ? 29.714  27.663  20.361  1.00 32.06 ? 244 HIS A O     1 
ATOM   1615 C  CB    . HIS A 1 213 ? 30.413  24.488  20.367  1.00 32.49 ? 244 HIS A CB    1 
ATOM   1616 C  CG    . HIS A 1 213 ? 31.226  23.461  21.090  1.00 33.52 ? 244 HIS A CG    1 
ATOM   1617 N  ND1   . HIS A 1 213 ? 32.046  22.566  20.436  1.00 35.01 ? 244 HIS A ND1   1 
ATOM   1618 C  CD2   . HIS A 1 213 ? 31.373  23.208  22.413  1.00 33.94 ? 244 HIS A CD2   1 
ATOM   1619 C  CE1   . HIS A 1 213 ? 32.649  21.796  21.325  1.00 34.46 ? 244 HIS A CE1   1 
ATOM   1620 N  NE2   . HIS A 1 213 ? 32.257  22.164  22.532  1.00 32.89 ? 244 HIS A NE2   1 
ATOM   1621 N  N     . GLU A 1 214 ? 27.902  26.424  19.938  1.00 32.69 ? 245 GLU A N     1 
ATOM   1622 C  CA    . GLU A 1 214 ? 27.202  27.495  19.212  1.00 32.88 ? 245 GLU A CA    1 
ATOM   1623 C  C     . GLU A 1 214 ? 26.858  28.627  20.164  1.00 32.35 ? 245 GLU A C     1 
ATOM   1624 O  O     . GLU A 1 214 ? 27.136  29.807  19.910  1.00 32.17 ? 245 GLU A O     1 
ATOM   1625 C  CB    . GLU A 1 214 ? 25.910  26.982  18.564  1.00 33.50 ? 245 GLU A CB    1 
ATOM   1626 C  CG    . GLU A 1 214 ? 25.194  28.033  17.663  1.00 34.44 ? 245 GLU A CG    1 
ATOM   1627 C  CD    . GLU A 1 214 ? 25.836  28.177  16.311  1.00 35.70 ? 245 GLU A CD    1 
ATOM   1628 O  OE1   . GLU A 1 214 ? 26.788  27.436  15.995  1.00 39.38 ? 245 GLU A OE1   1 
ATOM   1629 O  OE2   . GLU A 1 214 ? 25.392  29.021  15.530  1.00 38.29 ? 245 GLU A OE2   1 
ATOM   1630 N  N     . SER A 1 215 ? 26.250  28.252  21.266  1.00 32.42 ? 246 SER A N     1 
ATOM   1631 C  CA    . SER A 1 215 ? 25.819  29.215  22.260  1.00 33.12 ? 246 SER A CA    1 
ATOM   1632 C  C     . SER A 1 215 ? 27.003  30.055  22.739  1.00 33.11 ? 246 SER A C     1 
ATOM   1633 O  O     . SER A 1 215 ? 26.890  31.265  22.858  1.00 33.65 ? 246 SER A O     1 
ATOM   1634 C  CB    . SER A 1 215 ? 25.122  28.487  23.412  1.00 32.91 ? 246 SER A CB    1 
ATOM   1635 O  OG    . SER A 1 215 ? 25.017  29.305  24.575  1.00 36.43 ? 246 SER A OG    1 
ATOM   1636 N  N     . MET A 1 216 ? 28.142  29.419  22.966  1.00 33.40 ? 247 MET A N     1 
ATOM   1637 C  CA    . MET A 1 216 ? 29.364  30.122  23.369  1.00 34.01 ? 247 MET A CA    1 
ATOM   1638 C  C     . MET A 1 216 ? 29.829  31.139  22.331  1.00 33.88 ? 247 MET A C     1 
ATOM   1639 O  O     . MET A 1 216 ? 30.084  32.302  22.670  1.00 34.38 ? 247 MET A O     1 
ATOM   1640 C  CB    . MET A 1 216 ? 30.502  29.127  23.657  1.00 33.82 ? 247 MET A CB    1 
ATOM   1641 C  CG    . MET A 1 216 ? 30.379  28.453  25.023  1.00 34.34 ? 247 MET A CG    1 
ATOM   1642 S  SD    . MET A 1 216 ? 31.645  27.177  25.311  1.00 36.27 ? 247 MET A SD    1 
ATOM   1643 C  CE    . MET A 1 216 ? 33.089  28.179  25.655  1.00 32.98 ? 247 MET A CE    1 
ATOM   1644 N  N     . LYS A 1 217 ? 29.947  30.700  21.075  1.00 33.58 ? 248 LYS A N     1 
ATOM   1645 C  CA    . LYS A 1 217 ? 30.327  31.583  19.984  1.00 33.00 ? 248 LYS A CA    1 
ATOM   1646 C  C     . LYS A 1 217 ? 29.335  32.748  19.850  1.00 32.39 ? 248 LYS A C     1 
ATOM   1647 O  O     . LYS A 1 217 ? 29.720  33.856  19.523  1.00 32.46 ? 248 LYS A O     1 
ATOM   1648 C  CB    . LYS A 1 217 ? 30.441  30.796  18.670  1.00 32.40 ? 248 LYS A CB    1 
ATOM   1649 N  N     . LEU A 1 218 ? 28.057  32.496  20.092  1.00 31.83 ? 249 LEU A N     1 
ATOM   1650 C  CA    . LEU A 1 218 ? 27.047  33.550  19.963  1.00 31.63 ? 249 LEU A CA    1 
ATOM   1651 C  C     . LEU A 1 218 ? 27.176  34.524  21.127  1.00 31.57 ? 249 LEU A C     1 
ATOM   1652 O  O     . LEU A 1 218 ? 27.131  35.744  20.941  1.00 31.60 ? 249 LEU A O     1 
ATOM   1653 C  CB    . LEU A 1 218 ? 25.654  32.944  19.930  1.00 31.38 ? 249 LEU A CB    1 
ATOM   1654 C  CG    . LEU A 1 218 ? 24.471  33.876  19.711  1.00 31.71 ? 249 LEU A CG    1 
ATOM   1655 C  CD1   . LEU A 1 218 ? 24.642  34.742  18.456  1.00 30.46 ? 249 LEU A CD1   1 
ATOM   1656 C  CD2   . LEU A 1 218 ? 23.203  33.023  19.638  1.00 29.92 ? 249 LEU A CD2   1 
ATOM   1657 N  N     . PHE A 1 219 ? 27.383  33.997  22.326  1.00 30.95 ? 250 PHE A N     1 
ATOM   1658 C  CA    . PHE A 1 219 ? 27.590  34.867  23.462  1.00 31.01 ? 250 PHE A CA    1 
ATOM   1659 C  C     . PHE A 1 219 ? 28.871  35.699  23.317  1.00 31.05 ? 250 PHE A C     1 
ATOM   1660 O  O     . PHE A 1 219 ? 28.907  36.856  23.718  1.00 30.73 ? 250 PHE A O     1 
ATOM   1661 C  CB    . PHE A 1 219 ? 27.644  34.067  24.751  1.00 31.05 ? 250 PHE A CB    1 
ATOM   1662 C  CG    . PHE A 1 219 ? 27.753  34.918  25.963  1.00 30.85 ? 250 PHE A CG    1 
ATOM   1663 C  CD1   . PHE A 1 219 ? 26.733  35.777  26.303  1.00 31.32 ? 250 PHE A CD1   1 
ATOM   1664 C  CD2   . PHE A 1 219 ? 28.881  34.882  26.755  1.00 31.15 ? 250 PHE A CD2   1 
ATOM   1665 C  CE1   . PHE A 1 219 ? 26.832  36.569  27.426  1.00 32.01 ? 250 PHE A CE1   1 
ATOM   1666 C  CE2   . PHE A 1 219 ? 28.978  35.678  27.896  1.00 31.27 ? 250 PHE A CE2   1 
ATOM   1667 C  CZ    . PHE A 1 219 ? 27.963  36.514  28.226  1.00 30.95 ? 250 PHE A CZ    1 
ATOM   1668 N  N     . ASP A 1 220 ? 29.915  35.113  22.759  1.00 31.23 ? 251 ASP A N     1 
ATOM   1669 C  CA    . ASP A 1 220 ? 31.172  35.836  22.586  1.00 32.20 ? 251 ASP A CA    1 
ATOM   1670 C  C     . ASP A 1 220 ? 30.869  37.053  21.723  1.00 32.45 ? 251 ASP A C     1 
ATOM   1671 O  O     . ASP A 1 220 ? 31.290  38.171  22.051  1.00 32.57 ? 251 ASP A O     1 
ATOM   1672 C  CB    . ASP A 1 220 ? 32.246  34.924  21.953  1.00 32.84 ? 251 ASP A CB    1 
ATOM   1673 C  CG    . ASP A 1 220 ? 33.627  35.571  21.856  1.00 33.40 ? 251 ASP A CG    1 
ATOM   1674 O  OD1   . ASP A 1 220 ? 33.799  36.730  22.240  1.00 34.33 ? 251 ASP A OD1   1 
ATOM   1675 O  OD2   . ASP A 1 220 ? 34.565  34.892  21.379  1.00 35.96 ? 251 ASP A OD2   1 
ATOM   1676 N  N     . SER A 1 221 ? 30.099  36.837  20.654  1.00 32.54 ? 252 SER A N     1 
ATOM   1677 C  CA    . SER A 1 221 ? 29.744  37.914  19.728  1.00 32.67 ? 252 SER A CA    1 
ATOM   1678 C  C     . SER A 1 221 ? 28.900  39.026  20.374  1.00 32.62 ? 252 SER A C     1 
ATOM   1679 O  O     . SER A 1 221 ? 29.186  40.204  20.191  1.00 32.67 ? 252 SER A O     1 
ATOM   1680 C  CB    . SER A 1 221 ? 28.998  37.352  18.517  1.00 32.38 ? 252 SER A CB    1 
ATOM   1681 O  OG    . SER A 1 221 ? 28.702  38.427  17.646  1.00 33.39 ? 252 SER A OG    1 
ATOM   1682 N  N     . ILE A 1 222 ? 27.861  38.640  21.113  1.00 32.67 ? 253 ILE A N     1 
ATOM   1683 C  CA    . ILE A 1 222 ? 26.949  39.602  21.747  1.00 32.70 ? 253 ILE A CA    1 
ATOM   1684 C  C     . ILE A 1 222 ? 27.613  40.373  22.900  1.00 33.33 ? 253 ILE A C     1 
ATOM   1685 O  O     . ILE A 1 222 ? 27.521  41.603  22.987  1.00 33.51 ? 253 ILE A O     1 
ATOM   1686 C  CB    . ILE A 1 222 ? 25.715  38.893  22.335  1.00 32.29 ? 253 ILE A CB    1 
ATOM   1687 C  CG1   . ILE A 1 222 ? 24.886  38.223  21.230  1.00 32.39 ? 253 ILE A CG1   1 
ATOM   1688 C  CG2   . ILE A 1 222 ? 24.883  39.871  23.123  1.00 32.03 ? 253 ILE A CG2   1 
ATOM   1689 C  CD1   . ILE A 1 222 ? 24.590  39.105  19.990  1.00 31.32 ? 253 ILE A CD1   1 
ATOM   1690 N  N     . CYS A 1 223 ? 28.260  39.635  23.795  1.00 33.73 ? 254 CYS A N     1 
ATOM   1691 C  CA    . CYS A 1 223 ? 28.871  40.202  24.994  1.00 33.58 ? 254 CYS A CA    1 
ATOM   1692 C  C     . CYS A 1 223 ? 29.869  41.299  24.673  1.00 33.37 ? 254 CYS A C     1 
ATOM   1693 O  O     . CYS A 1 223 ? 29.995  42.267  25.412  1.00 33.00 ? 254 CYS A O     1 
ATOM   1694 C  CB    . CYS A 1 223 ? 29.619  39.115  25.776  1.00 33.63 ? 254 CYS A CB    1 
ATOM   1695 S  SG    . CYS A 1 223 ? 30.241  39.709  27.342  1.00 36.23 ? 254 CYS A SG    1 
ATOM   1696 N  N     . ASN A 1 224 ? 30.590  41.119  23.573  1.00 33.07 ? 255 ASN A N     1 
ATOM   1697 C  CA    . ASN A 1 224 ? 31.704  41.976  23.250  1.00 33.08 ? 255 ASN A CA    1 
ATOM   1698 C  C     . ASN A 1 224 ? 31.364  42.983  22.164  1.00 33.01 ? 255 ASN A C     1 
ATOM   1699 O  O     . ASN A 1 224 ? 32.216  43.771  21.772  1.00 32.47 ? 255 ASN A O     1 
ATOM   1700 C  CB    . ASN A 1 224 ? 32.918  41.112  22.889  1.00 33.12 ? 255 ASN A CB    1 
ATOM   1701 C  CG    . ASN A 1 224 ? 33.475  40.387  24.098  1.00 33.46 ? 255 ASN A CG    1 
ATOM   1702 O  OD1   . ASN A 1 224 ? 33.606  40.985  25.177  1.00 35.29 ? 255 ASN A OD1   1 
ATOM   1703 N  ND2   . ASN A 1 224 ? 33.797  39.104  23.940  1.00 32.57 ? 255 ASN A ND2   1 
ATOM   1704 N  N     . ASN A 1 225 ? 30.108  42.964  21.708  1.00 33.01 ? 256 ASN A N     1 
ATOM   1705 C  CA    . ASN A 1 225 ? 29.647  43.894  20.687  1.00 32.86 ? 256 ASN A CA    1 
ATOM   1706 C  C     . ASN A 1 225 ? 29.674  45.336  21.169  1.00 32.45 ? 256 ASN A C     1 
ATOM   1707 O  O     . ASN A 1 225 ? 29.178  45.659  22.248  1.00 31.56 ? 256 ASN A O     1 
ATOM   1708 C  CB    . ASN A 1 225 ? 28.234  43.533  20.216  1.00 33.12 ? 256 ASN A CB    1 
ATOM   1709 C  CG    . ASN A 1 225 ? 27.929  44.088  18.844  1.00 33.54 ? 256 ASN A CG    1 
ATOM   1710 O  OD1   . ASN A 1 225 ? 27.966  45.297  18.631  1.00 34.24 ? 256 ASN A OD1   1 
ATOM   1711 N  ND2   . ASN A 1 225 ? 27.643  43.205  17.903  1.00 34.00 ? 256 ASN A ND2   1 
ATOM   1712 N  N     . LYS A 1 226 ? 30.227  46.212  20.338  1.00 32.61 ? 257 LYS A N     1 
ATOM   1713 C  CA    . LYS A 1 226 ? 30.341  47.640  20.698  1.00 32.49 ? 257 LYS A CA    1 
ATOM   1714 C  C     . LYS A 1 226 ? 28.979  48.349  20.890  1.00 32.06 ? 257 LYS A C     1 
ATOM   1715 O  O     . LYS A 1 226 ? 28.925  49.387  21.562  1.00 31.81 ? 257 LYS A O     1 
ATOM   1716 C  CB    . LYS A 1 226 ? 31.203  48.400  19.689  1.00 32.55 ? 257 LYS A CB    1 
ATOM   1717 C  CG    . LYS A 1 226 ? 30.606  48.445  18.297  1.00 33.24 ? 257 LYS A CG    1 
ATOM   1718 C  CD    . LYS A 1 226 ? 31.569  48.995  17.282  1.00 34.43 ? 257 LYS A CD    1 
ATOM   1719 C  CE    . LYS A 1 226 ? 31.140  48.567  15.874  1.00 35.18 ? 257 LYS A CE    1 
ATOM   1720 N  NZ    . LYS A 1 226 ? 31.884  49.318  14.786  1.00 38.48 ? 257 LYS A NZ    1 
ATOM   1721 N  N     . TRP A 1 227 ? 27.892  47.802  20.334  1.00 31.16 ? 258 TRP A N     1 
ATOM   1722 C  CA    . TRP A 1 227 ? 26.572  48.375  20.602  1.00 30.49 ? 258 TRP A CA    1 
ATOM   1723 C  C     . TRP A 1 227 ? 26.154  48.199  22.059  1.00 29.44 ? 258 TRP A C     1 
ATOM   1724 O  O     . TRP A 1 227 ? 25.234  48.867  22.519  1.00 28.60 ? 258 TRP A O     1 
ATOM   1725 C  CB    . TRP A 1 227 ? 25.488  47.759  19.733  1.00 30.47 ? 258 TRP A CB    1 
ATOM   1726 C  CG    . TRP A 1 227 ? 25.792  47.588  18.292  1.00 30.33 ? 258 TRP A CG    1 
ATOM   1727 C  CD1   . TRP A 1 227 ? 25.461  46.516  17.540  1.00 30.00 ? 258 TRP A CD1   1 
ATOM   1728 C  CD2   . TRP A 1 227 ? 26.469  48.497  17.424  1.00 29.16 ? 258 TRP A CD2   1 
ATOM   1729 N  NE1   . TRP A 1 227 ? 25.875  46.694  16.258  1.00 31.09 ? 258 TRP A NE1   1 
ATOM   1730 C  CE2   . TRP A 1 227 ? 26.508  47.899  16.156  1.00 29.56 ? 258 TRP A CE2   1 
ATOM   1731 C  CE3   . TRP A 1 227 ? 27.044  49.753  17.593  1.00 30.46 ? 258 TRP A CE3   1 
ATOM   1732 C  CZ2   . TRP A 1 227 ? 27.075  48.514  15.049  1.00 30.56 ? 258 TRP A CZ2   1 
ATOM   1733 C  CZ3   . TRP A 1 227 ? 27.630  50.377  16.489  1.00 30.67 ? 258 TRP A CZ3   1 
ATOM   1734 C  CH2   . TRP A 1 227 ? 27.640  49.752  15.233  1.00 30.63 ? 258 TRP A CH2   1 
ATOM   1735 N  N     . PHE A 1 228 ? 26.796  47.273  22.761  1.00 28.73 ? 259 PHE A N     1 
ATOM   1736 C  CA    . PHE A 1 228 ? 26.350  46.898  24.095  1.00 28.82 ? 259 PHE A CA    1 
ATOM   1737 C  C     . PHE A 1 228 ? 27.358  47.258  25.203  1.00 28.83 ? 259 PHE A C     1 
ATOM   1738 O  O     . PHE A 1 228 ? 27.258  46.811  26.342  1.00 28.06 ? 259 PHE A O     1 
ATOM   1739 C  CB    . PHE A 1 228 ? 25.969  45.431  24.101  1.00 28.35 ? 259 PHE A CB    1 
ATOM   1740 C  CG    . PHE A 1 228 ? 25.010  45.062  23.003  1.00 28.40 ? 259 PHE A CG    1 
ATOM   1741 C  CD1   . PHE A 1 228 ? 23.920  45.862  22.709  1.00 28.86 ? 259 PHE A CD1   1 
ATOM   1742 C  CD2   . PHE A 1 228 ? 25.191  43.904  22.273  1.00 28.45 ? 259 PHE A CD2   1 
ATOM   1743 C  CE1   . PHE A 1 228 ? 23.044  45.502  21.708  1.00 30.08 ? 259 PHE A CE1   1 
ATOM   1744 C  CE2   . PHE A 1 228 ? 24.315  43.536  21.263  1.00 28.70 ? 259 PHE A CE2   1 
ATOM   1745 C  CZ    . PHE A 1 228 ? 23.251  44.318  20.979  1.00 29.14 ? 259 PHE A CZ    1 
ATOM   1746 N  N     . THR A 1 229 ? 28.260  48.165  24.868  1.00 28.87 ? 260 THR A N     1 
ATOM   1747 C  CA    . THR A 1 229 ? 29.218  48.680  25.809  1.00 29.33 ? 260 THR A CA    1 
ATOM   1748 C  C     . THR A 1 229 ? 28.581  49.288  27.041  1.00 29.62 ? 260 THR A C     1 
ATOM   1749 O  O     . THR A 1 229 ? 29.138  49.200  28.123  1.00 29.90 ? 260 THR A O     1 
ATOM   1750 C  CB    . THR A 1 229 ? 30.022  49.785  25.156  1.00 29.58 ? 260 THR A CB    1 
ATOM   1751 O  OG1   . THR A 1 229 ? 30.562  49.290  23.928  1.00 28.84 ? 260 THR A OG1   1 
ATOM   1752 C  CG2   . THR A 1 229 ? 31.140  50.230  26.070  1.00 30.02 ? 260 THR A CG2   1 
ATOM   1753 N  N     . ASP A 1 230 ? 27.433  49.936  26.862  1.00 29.83 ? 261 ASP A N     1 
ATOM   1754 C  CA    . ASP A 1 230 ? 26.684  50.554  27.960  1.00 29.93 ? 261 ASP A CA    1 
ATOM   1755 C  C     . ASP A 1 230 ? 25.435  49.728  28.345  1.00 29.78 ? 261 ASP A C     1 
ATOM   1756 O  O     . ASP A 1 230 ? 24.507  50.232  28.969  1.00 30.09 ? 261 ASP A O     1 
ATOM   1757 C  CB    . ASP A 1 230 ? 26.250  51.962  27.520  1.00 30.06 ? 261 ASP A CB    1 
ATOM   1758 C  CG    . ASP A 1 230 ? 25.945  52.895  28.704  1.00 31.83 ? 261 ASP A CG    1 
ATOM   1759 O  OD1   . ASP A 1 230 ? 26.142  52.506  29.875  1.00 32.99 ? 261 ASP A OD1   1 
ATOM   1760 O  OD2   . ASP A 1 230 ? 25.503  54.033  28.457  1.00 34.89 ? 261 ASP A OD2   1 
ATOM   1761 N  N     . THR A 1 231 ? 25.390  48.474  27.918  1.00 29.47 ? 262 THR A N     1 
ATOM   1762 C  CA    . THR A 1 231 ? 24.259  47.606  28.158  1.00 28.84 ? 262 THR A CA    1 
ATOM   1763 C  C     . THR A 1 231 ? 24.601  46.614  29.259  1.00 28.74 ? 262 THR A C     1 
ATOM   1764 O  O     . THR A 1 231 ? 25.694  46.049  29.257  1.00 28.54 ? 262 THR A O     1 
ATOM   1765 C  CB    . THR A 1 231 ? 23.991  46.793  26.894  1.00 28.66 ? 262 THR A CB    1 
ATOM   1766 O  OG1   . THR A 1 231 ? 23.780  47.677  25.792  1.00 28.16 ? 262 THR A OG1   1 
ATOM   1767 C  CG2   . THR A 1 231 ? 22.806  45.894  27.060  1.00 29.18 ? 262 THR A CG2   1 
ATOM   1768 N  N     . SER A 1 232 ? 23.672  46.390  30.181  1.00 28.53 ? 263 SER A N     1 
ATOM   1769 C  CA    . SER A 1 232 ? 23.841  45.362  31.196  1.00 28.95 ? 263 SER A CA    1 
ATOM   1770 C  C     . SER A 1 232 ? 23.636  43.994  30.560  1.00 29.05 ? 263 SER A C     1 
ATOM   1771 O  O     . SER A 1 232 ? 22.561  43.699  30.061  1.00 29.12 ? 263 SER A O     1 
ATOM   1772 C  CB    . SER A 1 232 ? 22.861  45.565  32.357  1.00 29.28 ? 263 SER A CB    1 
ATOM   1773 O  OG    . SER A 1 232 ? 23.089  46.816  32.993  1.00 30.33 ? 263 SER A OG    1 
ATOM   1774 N  N     . ILE A 1 233 ? 24.684  43.180  30.558  1.00 29.20 ? 264 ILE A N     1 
ATOM   1775 C  CA    . ILE A 1 233 ? 24.627  41.860  29.994  1.00 29.24 ? 264 ILE A CA    1 
ATOM   1776 C  C     . ILE A 1 233 ? 24.361  40.865  31.109  1.00 29.60 ? 264 ILE A C     1 
ATOM   1777 O  O     . ILE A 1 233 ? 25.190  40.682  31.998  1.00 29.57 ? 264 ILE A O     1 
ATOM   1778 C  CB    . ILE A 1 233 ? 25.936  41.485  29.330  1.00 29.34 ? 264 ILE A CB    1 
ATOM   1779 C  CG1   . ILE A 1 233 ? 26.341  42.553  28.305  1.00 31.77 ? 264 ILE A CG1   1 
ATOM   1780 C  CG2   . ILE A 1 233 ? 25.811  40.144  28.654  1.00 28.35 ? 264 ILE A CG2   1 
ATOM   1781 C  CD1   . ILE A 1 233 ? 25.539  42.548  26.981  1.00 31.86 ? 264 ILE A CD1   1 
ATOM   1782 N  N     . ILE A 1 234 ? 23.189  40.234  31.034  1.00 29.79 ? 265 ILE A N     1 
ATOM   1783 C  CA    . ILE A 1 234 ? 22.730  39.242  31.968  1.00 29.64 ? 265 ILE A CA    1 
ATOM   1784 C  C     . ILE A 1 234 ? 22.736  37.899  31.252  1.00 30.12 ? 265 ILE A C     1 
ATOM   1785 O  O     . ILE A 1 234 ? 22.280  37.780  30.117  1.00 29.54 ? 265 ILE A O     1 
ATOM   1786 C  CB    . ILE A 1 234 ? 21.306  39.565  32.427  1.00 29.54 ? 265 ILE A CB    1 
ATOM   1787 C  CG1   . ILE A 1 234 ? 21.318  40.790  33.335  1.00 30.33 ? 265 ILE A CG1   1 
ATOM   1788 C  CG2   . ILE A 1 234 ? 20.685  38.427  33.178  1.00 28.68 ? 265 ILE A CG2   1 
ATOM   1789 C  CD1   . ILE A 1 234 ? 21.769  42.019  32.661  1.00 30.82 ? 265 ILE A CD1   1 
ATOM   1790 N  N     . LEU A 1 235 ? 23.244  36.881  31.941  1.00 30.39 ? 266 LEU A N     1 
ATOM   1791 C  CA    . LEU A 1 235 ? 23.360  35.565  31.386  1.00 30.26 ? 266 LEU A CA    1 
ATOM   1792 C  C     . LEU A 1 235 ? 22.489  34.627  32.219  1.00 30.77 ? 266 LEU A C     1 
ATOM   1793 O  O     . LEU A 1 235 ? 22.723  34.465  33.420  1.00 31.27 ? 266 LEU A O     1 
ATOM   1794 C  CB    . LEU A 1 235 ? 24.828  35.131  31.438  1.00 30.13 ? 266 LEU A CB    1 
ATOM   1795 C  CG    . LEU A 1 235 ? 25.211  33.743  30.890  1.00 30.58 ? 266 LEU A CG    1 
ATOM   1796 C  CD1   . LEU A 1 235 ? 24.881  33.621  29.393  1.00 28.40 ? 266 LEU A CD1   1 
ATOM   1797 C  CD2   . LEU A 1 235 ? 26.687  33.428  31.178  1.00 29.44 ? 266 LEU A CD2   1 
ATOM   1798 N  N     . PHE A 1 236 ? 21.493  34.023  31.573  1.00 31.00 ? 267 PHE A N     1 
ATOM   1799 C  CA    . PHE A 1 236 ? 20.646  32.999  32.171  1.00 30.84 ? 267 PHE A CA    1 
ATOM   1800 C  C     . PHE A 1 236 ? 21.146  31.640  31.719  1.00 31.22 ? 267 PHE A C     1 
ATOM   1801 O  O     . PHE A 1 236 ? 20.925  31.245  30.574  1.00 31.48 ? 267 PHE A O     1 
ATOM   1802 C  CB    . PHE A 1 236 ? 19.193  33.157  31.718  1.00 30.64 ? 267 PHE A CB    1 
ATOM   1803 C  CG    . PHE A 1 236 ? 18.404  34.216  32.472  1.00 31.05 ? 267 PHE A CG    1 
ATOM   1804 C  CD1   . PHE A 1 236 ? 19.019  35.127  33.331  1.00 31.60 ? 267 PHE A CD1   1 
ATOM   1805 C  CD2   . PHE A 1 236 ? 17.036  34.325  32.275  1.00 30.48 ? 267 PHE A CD2   1 
ATOM   1806 C  CE1   . PHE A 1 236 ? 18.266  36.099  34.004  1.00 31.34 ? 267 PHE A CE1   1 
ATOM   1807 C  CE2   . PHE A 1 236 ? 16.297  35.286  32.932  1.00 30.53 ? 267 PHE A CE2   1 
ATOM   1808 C  CZ    . PHE A 1 236 ? 16.918  36.177  33.800  1.00 31.06 ? 267 PHE A CZ    1 
ATOM   1809 N  N     . LEU A 1 237 ? 21.836  30.934  32.609  1.00 31.51 ? 268 LEU A N     1 
ATOM   1810 C  CA    . LEU A 1 237 ? 22.206  29.566  32.373  1.00 31.68 ? 268 LEU A CA    1 
ATOM   1811 C  C     . LEU A 1 237 ? 20.994  28.739  32.781  1.00 31.97 ? 268 LEU A C     1 
ATOM   1812 O  O     . LEU A 1 237 ? 20.804  28.392  33.929  1.00 31.79 ? 268 LEU A O     1 
ATOM   1813 C  CB    . LEU A 1 237 ? 23.476  29.221  33.145  1.00 31.62 ? 268 LEU A CB    1 
ATOM   1814 C  CG    . LEU A 1 237 ? 24.663  30.088  32.674  1.00 31.95 ? 268 LEU A CG    1 
ATOM   1815 C  CD1   . LEU A 1 237 ? 25.896  29.922  33.562  1.00 31.21 ? 268 LEU A CD1   1 
ATOM   1816 C  CD2   . LEU A 1 237 ? 25.023  29.796  31.232  1.00 29.62 ? 268 LEU A CD2   1 
ATOM   1817 N  N     . ASN A 1 238 ? 20.169  28.460  31.785  1.00 32.89 ? 269 ASN A N     1 
ATOM   1818 C  CA    . ASN A 1 238 ? 18.781  28.010  31.957  1.00 33.41 ? 269 ASN A CA    1 
ATOM   1819 C  C     . ASN A 1 238 ? 18.697  26.511  31.801  1.00 33.23 ? 269 ASN A C     1 
ATOM   1820 O  O     . ASN A 1 238 ? 19.674  25.867  31.415  1.00 33.33 ? 269 ASN A O     1 
ATOM   1821 C  CB    . ASN A 1 238 ? 17.878  28.696  30.902  1.00 33.22 ? 269 ASN A CB    1 
ATOM   1822 C  CG    . ASN A 1 238 ? 16.410  28.412  31.108  1.00 34.59 ? 269 ASN A CG    1 
ATOM   1823 O  OD1   . ASN A 1 238 ? 15.908  28.497  32.240  1.00 37.41 ? 269 ASN A OD1   1 
ATOM   1824 N  ND2   . ASN A 1 238 ? 15.700  28.074  30.021  1.00 33.25 ? 269 ASN A ND2   1 
ATOM   1825 N  N     . LYS A 1 239 ? 17.526  25.958  32.101  1.00 33.34 ? 270 LYS A N     1 
ATOM   1826 C  CA    . LYS A 1 239 ? 17.298  24.514  32.033  1.00 33.28 ? 270 LYS A CA    1 
ATOM   1827 C  C     . LYS A 1 239 ? 18.228  23.758  33.001  1.00 33.03 ? 270 LYS A C     1 
ATOM   1828 O  O     . LYS A 1 239 ? 18.676  22.646  32.721  1.00 32.99 ? 270 LYS A O     1 
ATOM   1829 C  CB    . LYS A 1 239 ? 17.440  24.023  30.575  1.00 33.92 ? 270 LYS A CB    1 
ATOM   1830 C  CG    . LYS A 1 239 ? 16.262  24.426  29.655  1.00 33.50 ? 270 LYS A CG    1 
ATOM   1831 C  CD    . LYS A 1 239 ? 16.545  24.160  28.181  1.00 33.63 ? 270 LYS A CD    1 
ATOM   1832 C  CE    . LYS A 1 239 ? 15.293  24.375  27.324  1.00 34.34 ? 270 LYS A CE    1 
ATOM   1833 N  NZ    . LYS A 1 239 ? 15.446  23.936  25.896  1.00 34.59 ? 270 LYS A NZ    1 
ATOM   1834 N  N     . LYS A 1 240 ? 18.495  24.379  34.145  1.00 32.78 ? 271 LYS A N     1 
ATOM   1835 C  CA    . LYS A 1 240 ? 19.347  23.790  35.162  1.00 32.65 ? 271 LYS A CA    1 
ATOM   1836 C  C     . LYS A 1 240 ? 18.696  22.515  35.741  1.00 32.72 ? 271 LYS A C     1 
ATOM   1837 O  O     . LYS A 1 240 ? 19.397  21.572  36.116  1.00 32.75 ? 271 LYS A O     1 
ATOM   1838 C  CB    . LYS A 1 240 ? 19.661  24.828  36.268  1.00 32.79 ? 271 LYS A CB    1 
ATOM   1839 C  CG    . LYS A 1 240 ? 18.537  25.032  37.321  1.00 31.83 ? 271 LYS A CG    1 
ATOM   1840 C  CD    . LYS A 1 240 ? 18.710  26.305  38.111  1.00 32.01 ? 271 LYS A CD    1 
ATOM   1841 C  CE    . LYS A 1 240 ? 17.872  26.313  39.395  1.00 32.12 ? 271 LYS A CE    1 
ATOM   1842 N  NZ    . LYS A 1 240 ? 17.443  27.708  39.693  1.00 32.61 ? 271 LYS A NZ    1 
ATOM   1843 N  N     . ASP A 1 241 ? 17.365  22.479  35.817  1.00 32.61 ? 272 ASP A N     1 
ATOM   1844 C  CA    . ASP A 1 241 ? 16.683  21.233  36.218  1.00 32.76 ? 272 ASP A CA    1 
ATOM   1845 C  C     . ASP A 1 241 ? 16.965  20.099  35.238  1.00 32.58 ? 272 ASP A C     1 
ATOM   1846 O  O     . ASP A 1 241 ? 17.284  18.998  35.664  1.00 33.36 ? 272 ASP A O     1 
ATOM   1847 C  CB    . ASP A 1 241 ? 15.179  21.413  36.406  1.00 32.55 ? 272 ASP A CB    1 
ATOM   1848 C  CG    . ASP A 1 241 ? 14.462  21.785  35.124  1.00 33.86 ? 272 ASP A CG    1 
ATOM   1849 O  OD1   . ASP A 1 241 ? 15.033  22.536  34.306  1.00 30.95 ? 272 ASP A OD1   1 
ATOM   1850 O  OD2   . ASP A 1 241 ? 13.311  21.321  34.940  1.00 37.05 ? 272 ASP A OD2   1 
ATOM   1851 N  N     . LEU A 1 242 ? 16.891  20.364  33.935  1.00 32.36 ? 273 LEU A N     1 
ATOM   1852 C  CA    . LEU A 1 242 ? 17.177  19.326  32.939  1.00 32.02 ? 273 LEU A CA    1 
ATOM   1853 C  C     . LEU A 1 242 ? 18.661  18.935  32.989  1.00 32.27 ? 273 LEU A C     1 
ATOM   1854 O  O     . LEU A 1 242 ? 19.013  17.777  32.820  1.00 31.53 ? 273 LEU A O     1 
ATOM   1855 C  CB    . LEU A 1 242 ? 16.793  19.798  31.533  1.00 31.49 ? 273 LEU A CB    1 
ATOM   1856 C  CG    . LEU A 1 242 ? 15.294  20.022  31.332  1.00 30.49 ? 273 LEU A CG    1 
ATOM   1857 C  CD1   . LEU A 1 242 ? 15.026  20.611  29.958  1.00 26.53 ? 273 LEU A CD1   1 
ATOM   1858 C  CD2   . LEU A 1 242 ? 14.519  18.722  31.540  1.00 26.94 ? 273 LEU A CD2   1 
ATOM   1859 N  N     . PHE A 1 243 ? 19.512  19.925  33.240  1.00 32.88 ? 274 PHE A N     1 
ATOM   1860 C  CA    . PHE A 1 243 ? 20.937  19.718  33.357  1.00 33.51 ? 274 PHE A CA    1 
ATOM   1861 C  C     . PHE A 1 243 ? 21.268  18.831  34.548  1.00 34.47 ? 274 PHE A C     1 
ATOM   1862 O  O     . PHE A 1 243 ? 22.072  17.896  34.434  1.00 34.37 ? 274 PHE A O     1 
ATOM   1863 C  CB    . PHE A 1 243 ? 21.649  21.052  33.515  1.00 33.64 ? 274 PHE A CB    1 
ATOM   1864 C  CG    . PHE A 1 243 ? 23.127  20.927  33.591  1.00 33.84 ? 274 PHE A CG    1 
ATOM   1865 C  CD1   . PHE A 1 243 ? 23.871  20.693  32.455  1.00 33.83 ? 274 PHE A CD1   1 
ATOM   1866 C  CD2   . PHE A 1 243 ? 23.779  21.030  34.805  1.00 35.00 ? 274 PHE A CD2   1 
ATOM   1867 C  CE1   . PHE A 1 243 ? 25.250  20.574  32.524  1.00 35.12 ? 274 PHE A CE1   1 
ATOM   1868 C  CE2   . PHE A 1 243 ? 25.166  20.914  34.888  1.00 34.68 ? 274 PHE A CE2   1 
ATOM   1869 C  CZ    . PHE A 1 243 ? 25.904  20.685  33.754  1.00 34.22 ? 274 PHE A CZ    1 
ATOM   1870 N  N     . GLU A 1 244 ? 20.632  19.105  35.683  1.00 35.24 ? 275 GLU A N     1 
ATOM   1871 C  CA    . GLU A 1 244 ? 20.877  18.322  36.879  1.00 36.13 ? 275 GLU A CA    1 
ATOM   1872 C  C     . GLU A 1 244 ? 20.594  16.854  36.635  1.00 36.00 ? 275 GLU A C     1 
ATOM   1873 O  O     . GLU A 1 244 ? 21.301  16.001  37.158  1.00 35.80 ? 275 GLU A O     1 
ATOM   1874 C  CB    . GLU A 1 244 ? 20.016  18.827  38.045  1.00 36.51 ? 275 GLU A CB    1 
ATOM   1875 C  CG    . GLU A 1 244 ? 20.035  17.937  39.281  1.00 37.15 ? 275 GLU A CG    1 
ATOM   1876 C  CD    . GLU A 1 244 ? 19.185  18.501  40.392  1.00 37.92 ? 275 GLU A CD    1 
ATOM   1877 O  OE1   . GLU A 1 244 ? 18.062  17.997  40.602  1.00 40.61 ? 275 GLU A OE1   1 
ATOM   1878 O  OE2   . GLU A 1 244 ? 19.629  19.461  41.048  1.00 38.89 ? 275 GLU A OE2   1 
ATOM   1879 N  N     . GLU A 1 245 ? 19.546  16.559  35.863  1.00 36.60 ? 276 GLU A N     1 
ATOM   1880 C  CA    . GLU A 1 245 ? 19.179  15.163  35.596  1.00 37.16 ? 276 GLU A CA    1 
ATOM   1881 C  C     . GLU A 1 245 ? 20.112  14.520  34.603  1.00 36.56 ? 276 GLU A C     1 
ATOM   1882 O  O     . GLU A 1 245 ? 20.316  13.324  34.647  1.00 36.79 ? 276 GLU A O     1 
ATOM   1883 C  CB    . GLU A 1 245 ? 17.738  15.032  35.069  1.00 37.59 ? 276 GLU A CB    1 
ATOM   1884 C  CG    . GLU A 1 245 ? 16.612  15.254  36.105  1.00 40.48 ? 276 GLU A CG    1 
ATOM   1885 C  CD    . GLU A 1 245 ? 16.386  14.056  37.059  1.00 44.37 ? 276 GLU A CD    1 
ATOM   1886 O  OE1   . GLU A 1 245 ? 17.273  13.756  37.907  1.00 46.12 ? 276 GLU A OE1   1 
ATOM   1887 O  OE2   . GLU A 1 245 ? 15.301  13.428  36.975  1.00 46.35 ? 276 GLU A OE2   1 
ATOM   1888 N  N     . LYS A 1 246 ? 20.674  15.321  33.718  1.00 36.28 ? 277 LYS A N     1 
ATOM   1889 C  CA    . LYS A 1 246 ? 21.382  14.815  32.565  1.00 36.33 ? 277 LYS A CA    1 
ATOM   1890 C  C     . LYS A 1 246 ? 22.847  14.547  32.839  1.00 36.21 ? 277 LYS A C     1 
ATOM   1891 O  O     . LYS A 1 246 ? 23.431  13.619  32.272  1.00 36.00 ? 277 LYS A O     1 
ATOM   1892 C  CB    . LYS A 1 246 ? 21.266  15.823  31.443  1.00 36.17 ? 277 LYS A CB    1 
ATOM   1893 C  CG    . LYS A 1 246 ? 21.695  15.297  30.108  1.00 36.79 ? 277 LYS A CG    1 
ATOM   1894 C  CD    . LYS A 1 246 ? 20.837  15.931  29.036  1.00 37.22 ? 277 LYS A CD    1 
ATOM   1895 C  CE    . LYS A 1 246 ? 21.480  15.867  27.736  1.00 37.13 ? 277 LYS A CE    1 
ATOM   1896 N  NZ    . LYS A 1 246 ? 20.740  16.667  26.750  1.00 38.31 ? 277 LYS A NZ    1 
ATOM   1897 N  N     . ILE A 1 247 ? 23.447  15.381  33.684  1.00 35.94 ? 278 ILE A N     1 
ATOM   1898 C  CA    . ILE A 1 247 ? 24.879  15.315  33.959  1.00 35.62 ? 278 ILE A CA    1 
ATOM   1899 C  C     . ILE A 1 247 ? 25.266  14.006  34.666  1.00 36.05 ? 278 ILE A C     1 
ATOM   1900 O  O     . ILE A 1 247 ? 26.407  13.560  34.570  1.00 36.22 ? 278 ILE A O     1 
ATOM   1901 C  CB    . ILE A 1 247 ? 25.340  16.575  34.735  1.00 35.37 ? 278 ILE A CB    1 
ATOM   1902 C  CG1   . ILE A 1 247 ? 26.862  16.776  34.646  1.00 35.94 ? 278 ILE A CG1   1 
ATOM   1903 C  CG2   . ILE A 1 247 ? 24.856  16.553  36.168  1.00 33.81 ? 278 ILE A CG2   1 
ATOM   1904 C  CD1   . ILE A 1 247 ? 27.397  17.018  33.218  1.00 35.17 ? 278 ILE A CD1   1 
ATOM   1905 N  N     . LYS A 1 248 ? 24.299  13.394  35.352  1.00 36.59 ? 279 LYS A N     1 
ATOM   1906 C  CA    . LYS A 1 248 ? 24.447  12.051  35.935  1.00 36.93 ? 279 LYS A CA    1 
ATOM   1907 C  C     . LYS A 1 248 ? 24.674  11.012  34.837  1.00 36.87 ? 279 LYS A C     1 
ATOM   1908 O  O     . LYS A 1 248 ? 25.514  10.119  34.979  1.00 36.54 ? 279 LYS A O     1 
ATOM   1909 C  CB    . LYS A 1 248 ? 23.168  11.659  36.724  1.00 37.14 ? 279 LYS A CB    1 
ATOM   1910 C  CG    . LYS A 1 248 ? 22.766  12.615  37.875  1.00 37.62 ? 279 LYS A CG    1 
ATOM   1911 N  N     . LYS A 1 249 ? 23.912  11.151  33.746  1.00 36.75 ? 280 LYS A N     1 
ATOM   1912 C  CA    . LYS A 1 249 ? 23.841  10.138  32.683  1.00 36.64 ? 280 LYS A CA    1 
ATOM   1913 C  C     . LYS A 1 249 ? 24.889  10.349  31.587  1.00 35.71 ? 280 LYS A C     1 
ATOM   1914 O  O     . LYS A 1 249 ? 25.350  9.387   30.998  1.00 36.03 ? 280 LYS A O     1 
ATOM   1915 C  CB    . LYS A 1 249 ? 22.440  10.135  32.034  1.00 36.80 ? 280 LYS A CB    1 
ATOM   1916 C  CG    . LYS A 1 249 ? 21.248  10.060  33.022  1.00 38.31 ? 280 LYS A CG    1 
ATOM   1917 C  CD    . LYS A 1 249 ? 19.941  9.630   32.317  1.00 37.91 ? 280 LYS A CD    1 
ATOM   1918 N  N     . SER A 1 250 ? 25.258  11.596  31.306  1.00 34.76 ? 281 SER A N     1 
ATOM   1919 C  CA    . SER A 1 250 ? 25.940  11.929  30.045  1.00 34.08 ? 281 SER A CA    1 
ATOM   1920 C  C     . SER A 1 250 ? 27.113  12.907  30.260  1.00 33.45 ? 281 SER A C     1 
ATOM   1921 O  O     . SER A 1 250 ? 26.904  14.049  30.625  1.00 32.69 ? 281 SER A O     1 
ATOM   1922 C  CB    . SER A 1 250 ? 24.925  12.505  29.057  1.00 33.99 ? 281 SER A CB    1 
ATOM   1923 O  OG    . SER A 1 250 ? 25.564  13.076  27.940  1.00 33.76 ? 281 SER A OG    1 
ATOM   1924 N  N     . PRO A 1 251 ? 28.356  12.456  30.002  1.00 33.22 ? 282 PRO A N     1 
ATOM   1925 C  CA    . PRO A 1 251 ? 29.481  13.217  30.543  1.00 33.01 ? 282 PRO A CA    1 
ATOM   1926 C  C     . PRO A 1 251 ? 29.706  14.547  29.841  1.00 32.68 ? 282 PRO A C     1 
ATOM   1927 O  O     . PRO A 1 251 ? 29.533  14.656  28.629  1.00 32.94 ? 282 PRO A O     1 
ATOM   1928 C  CB    . PRO A 1 251 ? 30.695  12.285  30.335  1.00 33.21 ? 282 PRO A CB    1 
ATOM   1929 C  CG    . PRO A 1 251 ? 30.135  10.952  29.812  1.00 33.12 ? 282 PRO A CG    1 
ATOM   1930 C  CD    . PRO A 1 251 ? 28.808  11.287  29.216  1.00 33.42 ? 282 PRO A CD    1 
ATOM   1931 N  N     . LEU A 1 252 ? 30.115  15.544  30.608  1.00 32.19 ? 283 LEU A N     1 
ATOM   1932 C  CA    . LEU A 1 252 ? 30.338  16.882  30.065  1.00 32.09 ? 283 LEU A CA    1 
ATOM   1933 C  C     . LEU A 1 252 ? 31.485  16.934  29.032  1.00 32.10 ? 283 LEU A C     1 
ATOM   1934 O  O     . LEU A 1 252 ? 31.541  17.841  28.193  1.00 31.65 ? 283 LEU A O     1 
ATOM   1935 C  CB    . LEU A 1 252 ? 30.615  17.867  31.203  1.00 32.14 ? 283 LEU A CB    1 
ATOM   1936 C  CG    . LEU A 1 252 ? 30.589  19.350  30.825  1.00 32.32 ? 283 LEU A CG    1 
ATOM   1937 C  CD1   . LEU A 1 252 ? 29.330  19.684  29.995  1.00 31.28 ? 283 LEU A CD1   1 
ATOM   1938 C  CD2   . LEU A 1 252 ? 30.678  20.223  32.066  1.00 31.14 ? 283 LEU A CD2   1 
ATOM   1939 N  N     . THR A 1 253 ? 32.372  15.945  29.092  1.00 32.00 ? 284 THR A N     1 
ATOM   1940 C  CA    . THR A 1 253 ? 33.468  15.826  28.155  1.00 32.21 ? 284 THR A CA    1 
ATOM   1941 C  C     . THR A 1 253 ? 33.016  15.652  26.705  1.00 32.54 ? 284 THR A C     1 
ATOM   1942 O  O     . THR A 1 253 ? 33.807  15.896  25.814  1.00 33.04 ? 284 THR A O     1 
ATOM   1943 C  CB    . THR A 1 253 ? 34.395  14.645  28.556  1.00 32.55 ? 284 THR A CB    1 
ATOM   1944 O  OG1   . THR A 1 253 ? 33.582  13.513  28.894  1.00 32.67 ? 284 THR A OG1   1 
ATOM   1945 C  CG2   . THR A 1 253 ? 35.286  15.016  29.768  1.00 31.00 ? 284 THR A CG2   1 
ATOM   1946 N  N     . ILE A 1 254 ? 31.767  15.240  26.462  1.00 32.92 ? 285 ILE A N     1 
ATOM   1947 C  CA    . ILE A 1 254 ? 31.219  15.223  25.094  1.00 33.11 ? 285 ILE A CA    1 
ATOM   1948 C  C     . ILE A 1 254 ? 31.276  16.632  24.514  1.00 33.40 ? 285 ILE A C     1 
ATOM   1949 O  O     . ILE A 1 254 ? 31.467  16.791  23.322  1.00 33.82 ? 285 ILE A O     1 
ATOM   1950 C  CB    . ILE A 1 254 ? 29.751  14.725  25.015  1.00 33.36 ? 285 ILE A CB    1 
ATOM   1951 C  CG1   . ILE A 1 254 ? 29.613  13.285  25.529  1.00 33.09 ? 285 ILE A CG1   1 
ATOM   1952 C  CG2   . ILE A 1 254 ? 29.241  14.791  23.564  1.00 33.05 ? 285 ILE A CG2   1 
ATOM   1953 C  CD1   . ILE A 1 254 ? 28.188  12.899  25.896  1.00 32.76 ? 285 ILE A CD1   1 
ATOM   1954 N  N     . CYS A 1 255 ? 31.115  17.639  25.375  1.00 33.83 ? 286 CYS A N     1 
ATOM   1955 C  CA    . CYS A 1 255 ? 31.148  19.044  24.983  1.00 33.59 ? 286 CYS A CA    1 
ATOM   1956 C  C     . CYS A 1 255 ? 32.502  19.685  25.207  1.00 33.57 ? 286 CYS A C     1 
ATOM   1957 O  O     . CYS A 1 255 ? 32.963  20.485  24.387  1.00 33.70 ? 286 CYS A O     1 
ATOM   1958 C  CB    . CYS A 1 255 ? 30.140  19.817  25.815  1.00 33.68 ? 286 CYS A CB    1 
ATOM   1959 S  SG    . CYS A 1 255 ? 29.900  21.540  25.293  1.00 36.01 ? 286 CYS A SG    1 
ATOM   1960 N  N     . TYR A 1 256 ? 33.107  19.367  26.352  1.00 33.45 ? 287 TYR A N     1 
ATOM   1961 C  CA    . TYR A 1 256 ? 34.422  19.884  26.747  1.00 33.04 ? 287 TYR A CA    1 
ATOM   1962 C  C     . TYR A 1 256 ? 35.399  18.738  26.983  1.00 32.87 ? 287 TYR A C     1 
ATOM   1963 O  O     . TYR A 1 256 ? 35.548  18.284  28.112  1.00 32.45 ? 287 TYR A O     1 
ATOM   1964 C  CB    . TYR A 1 256 ? 34.329  20.687  28.053  1.00 33.49 ? 287 TYR A CB    1 
ATOM   1965 C  CG    . TYR A 1 256 ? 33.485  21.936  27.970  1.00 33.71 ? 287 TYR A CG    1 
ATOM   1966 C  CD1   . TYR A 1 256 ? 33.911  23.049  27.258  1.00 33.80 ? 287 TYR A CD1   1 
ATOM   1967 C  CD2   . TYR A 1 256 ? 32.260  22.001  28.608  1.00 33.80 ? 287 TYR A CD2   1 
ATOM   1968 C  CE1   . TYR A 1 256 ? 33.116  24.190  27.169  1.00 33.71 ? 287 TYR A CE1   1 
ATOM   1969 C  CE2   . TYR A 1 256 ? 31.472  23.118  28.535  1.00 33.83 ? 287 TYR A CE2   1 
ATOM   1970 C  CZ    . TYR A 1 256 ? 31.895  24.210  27.811  1.00 34.04 ? 287 TYR A CZ    1 
ATOM   1971 O  OH    . TYR A 1 256 ? 31.077  25.322  27.761  1.00 34.83 ? 287 TYR A OH    1 
ATOM   1972 N  N     . PRO A 1 257 ? 36.092  18.277  25.928  1.00 32.72 ? 288 PRO A N     1 
ATOM   1973 C  CA    . PRO A 1 257 ? 37.009  17.128  26.055  1.00 32.57 ? 288 PRO A CA    1 
ATOM   1974 C  C     . PRO A 1 257 ? 38.102  17.324  27.108  1.00 32.49 ? 288 PRO A C     1 
ATOM   1975 O  O     . PRO A 1 257 ? 38.632  16.344  27.637  1.00 32.80 ? 288 PRO A O     1 
ATOM   1976 C  CB    . PRO A 1 257 ? 37.664  17.044  24.683  1.00 32.39 ? 288 PRO A CB    1 
ATOM   1977 C  CG    . PRO A 1 257 ? 36.757  17.770  23.765  1.00 32.81 ? 288 PRO A CG    1 
ATOM   1978 C  CD    . PRO A 1 257 ? 36.081  18.827  24.564  1.00 32.60 ? 288 PRO A CD    1 
ATOM   1979 N  N     . GLU A 1 258 ? 38.470  18.577  27.369  1.00 32.26 ? 289 GLU A N     1 
ATOM   1980 C  CA    . GLU A 1 258 ? 39.507  18.882  28.355  1.00 32.03 ? 289 GLU A CA    1 
ATOM   1981 C  C     . GLU A 1 258 ? 38.978  18.862  29.803  1.00 32.11 ? 289 GLU A C     1 
ATOM   1982 O  O     . GLU A 1 258 ? 39.762  18.829  30.752  1.00 32.62 ? 289 GLU A O     1 
ATOM   1983 C  CB    . GLU A 1 258 ? 40.159  20.235  28.065  1.00 31.68 ? 289 GLU A CB    1 
ATOM   1984 N  N     . TYR A 1 259 ? 37.659  18.862  29.987  1.00 31.77 ? 290 TYR A N     1 
ATOM   1985 C  CA    . TYR A 1 259 ? 37.083  18.858  31.337  1.00 31.24 ? 290 TYR A CA    1 
ATOM   1986 C  C     . TYR A 1 259 ? 37.569  17.700  32.195  1.00 31.14 ? 290 TYR A C     1 
ATOM   1987 O  O     . TYR A 1 259 ? 37.289  16.529  31.913  1.00 31.01 ? 290 TYR A O     1 
ATOM   1988 C  CB    . TYR A 1 259 ? 35.557  18.828  31.307  1.00 31.10 ? 290 TYR A CB    1 
ATOM   1989 C  CG    . TYR A 1 259 ? 34.926  18.931  32.679  1.00 31.37 ? 290 TYR A CG    1 
ATOM   1990 C  CD1   . TYR A 1 259 ? 35.183  20.022  33.507  1.00 31.75 ? 290 TYR A CD1   1 
ATOM   1991 C  CD2   . TYR A 1 259 ? 34.063  17.949  33.153  1.00 31.65 ? 290 TYR A CD2   1 
ATOM   1992 C  CE1   . TYR A 1 259 ? 34.597  20.128  34.774  1.00 32.06 ? 290 TYR A CE1   1 
ATOM   1993 C  CE2   . TYR A 1 259 ? 33.480  18.047  34.422  1.00 31.36 ? 290 TYR A CE2   1 
ATOM   1994 C  CZ    . TYR A 1 259 ? 33.749  19.134  35.227  1.00 31.58 ? 290 TYR A CZ    1 
ATOM   1995 O  OH    . TYR A 1 259 ? 33.167  19.240  36.485  1.00 31.23 ? 290 TYR A OH    1 
ATOM   1996 N  N     . ALA A 1 260 ? 38.257  18.061  33.271  1.00 31.03 ? 291 ALA A N     1 
ATOM   1997 C  CA    . ALA A 1 260 ? 38.962  17.122  34.144  1.00 31.08 ? 291 ALA A CA    1 
ATOM   1998 C  C     . ALA A 1 260 ? 38.195  16.810  35.430  1.00 31.08 ? 291 ALA A C     1 
ATOM   1999 O  O     . ALA A 1 260 ? 38.597  15.939  36.203  1.00 30.67 ? 291 ALA A O     1 
ATOM   2000 C  CB    . ALA A 1 260 ? 40.335  17.712  34.513  1.00 31.00 ? 291 ALA A CB    1 
ATOM   2001 N  N     . GLY A 1 261 ? 37.097  17.528  35.652  1.00 31.47 ? 292 GLY A N     1 
ATOM   2002 C  CA    . GLY A 1 261 ? 36.316  17.416  36.886  1.00 31.30 ? 292 GLY A CA    1 
ATOM   2003 C  C     . GLY A 1 261 ? 35.234  16.346  36.817  1.00 31.58 ? 292 GLY A C     1 
ATOM   2004 O  O     . GLY A 1 261 ? 35.080  15.637  35.798  1.00 31.51 ? 292 GLY A O     1 
ATOM   2005 N  N     . SER A 1 262 ? 34.486  16.234  37.910  1.00 31.59 ? 293 SER A N     1 
ATOM   2006 C  CA    . SER A 1 262 ? 33.479  15.192  38.088  1.00 31.71 ? 293 SER A CA    1 
ATOM   2007 C  C     . SER A 1 262 ? 32.205  15.546  37.396  1.00 32.03 ? 293 SER A C     1 
ATOM   2008 O  O     . SER A 1 262 ? 31.912  16.720  37.244  1.00 31.84 ? 293 SER A O     1 
ATOM   2009 C  CB    . SER A 1 262 ? 33.164  15.048  39.583  1.00 31.90 ? 293 SER A CB    1 
ATOM   2010 O  OG    . SER A 1 262 ? 32.698  16.279  40.132  1.00 30.94 ? 293 SER A OG    1 
ATOM   2011 N  N     . ASN A 1 263 ? 31.434  14.531  37.004  1.00 32.86 ? 294 ASN A N     1 
ATOM   2012 C  CA    . ASN A 1 263 ? 30.106  14.746  36.439  1.00 33.50 ? 294 ASN A CA    1 
ATOM   2013 C  C     . ASN A 1 263 ? 29.124  14.861  37.582  1.00 33.92 ? 294 ASN A C     1 
ATOM   2014 O  O     . ASN A 1 263 ? 28.394  13.908  37.891  1.00 34.84 ? 294 ASN A O     1 
ATOM   2015 C  CB    . ASN A 1 263 ? 29.715  13.590  35.527  1.00 33.82 ? 294 ASN A CB    1 
ATOM   2016 C  CG    . ASN A 1 263 ? 30.434  13.632  34.187  1.00 34.96 ? 294 ASN A CG    1 
ATOM   2017 O  OD1   . ASN A 1 263 ? 30.671  14.710  33.583  1.00 34.20 ? 294 ASN A OD1   1 
ATOM   2018 N  ND2   . ASN A 1 263 ? 30.770  12.450  33.700  1.00 35.45 ? 294 ASN A ND2   1 
ATOM   2019 N  N     . THR A 1 264 ? 29.181  16.005  38.254  1.00 33.88 ? 295 THR A N     1 
ATOM   2020 C  CA    . THR A 1 264 ? 28.275  16.377  39.334  1.00 33.83 ? 295 THR A CA    1 
ATOM   2021 C  C     . THR A 1 264 ? 27.631  17.717  38.970  1.00 33.74 ? 295 THR A C     1 
ATOM   2022 O  O     . THR A 1 264 ? 28.227  18.552  38.281  1.00 33.92 ? 295 THR A O     1 
ATOM   2023 C  CB    . THR A 1 264 ? 29.018  16.490  40.696  1.00 33.84 ? 295 THR A CB    1 
ATOM   2024 O  OG1   . THR A 1 264 ? 30.218  17.258  40.542  1.00 34.74 ? 295 THR A OG1   1 
ATOM   2025 C  CG2   . THR A 1 264 ? 29.405  15.121  41.204  1.00 34.04 ? 295 THR A CG2   1 
ATOM   2026 N  N     . TYR A 1 265 ? 26.406  17.922  39.418  1.00 33.77 ? 296 TYR A N     1 
ATOM   2027 C  CA    . TYR A 1 265 ? 25.644  19.121  39.050  1.00 33.95 ? 296 TYR A CA    1 
ATOM   2028 C  C     . TYR A 1 265 ? 26.425  20.404  39.360  1.00 33.56 ? 296 TYR A C     1 
ATOM   2029 O  O     . TYR A 1 265 ? 26.600  21.247  38.482  1.00 33.72 ? 296 TYR A O     1 
ATOM   2030 C  CB    . TYR A 1 265 ? 24.283  19.079  39.758  1.00 34.07 ? 296 TYR A CB    1 
ATOM   2031 C  CG    . TYR A 1 265 ? 23.344  20.257  39.570  1.00 35.45 ? 296 TYR A CG    1 
ATOM   2032 C  CD1   . TYR A 1 265 ? 23.278  20.975  38.371  1.00 35.73 ? 296 TYR A CD1   1 
ATOM   2033 C  CD2   . TYR A 1 265 ? 22.481  20.630  40.601  1.00 36.03 ? 296 TYR A CD2   1 
ATOM   2034 C  CE1   . TYR A 1 265 ? 22.386  22.030  38.217  1.00 35.32 ? 296 TYR A CE1   1 
ATOM   2035 C  CE2   . TYR A 1 265 ? 21.598  21.685  40.461  1.00 35.88 ? 296 TYR A CE2   1 
ATOM   2036 C  CZ    . TYR A 1 265 ? 21.545  22.384  39.274  1.00 36.37 ? 296 TYR A CZ    1 
ATOM   2037 O  OH    . TYR A 1 265 ? 20.640  23.435  39.180  1.00 35.90 ? 296 TYR A OH    1 
ATOM   2038 N  N     . GLU A 1 266 ? 26.961  20.509  40.564  1.00 32.90 ? 297 GLU A N     1 
ATOM   2039 C  CA    . GLU A 1 266 ? 27.539  21.760  40.980  1.00 32.88 ? 297 GLU A CA    1 
ATOM   2040 C  C     . GLU A 1 266 ? 28.912  22.066  40.362  1.00 32.41 ? 297 GLU A C     1 
ATOM   2041 O  O     . GLU A 1 266 ? 29.119  23.221  39.996  1.00 32.72 ? 297 GLU A O     1 
ATOM   2042 C  CB    . GLU A 1 266 ? 27.415  22.033  42.508  1.00 33.27 ? 297 GLU A CB    1 
ATOM   2043 C  CG    . GLU A 1 266 ? 27.074  20.872  43.439  1.00 33.62 ? 297 GLU A CG    1 
ATOM   2044 C  CD    . GLU A 1 266 ? 25.647  20.325  43.310  1.00 32.45 ? 297 GLU A CD    1 
ATOM   2045 O  OE1   . GLU A 1 266 ? 25.566  19.129  42.946  1.00 31.67 ? 297 GLU A OE1   1 
ATOM   2046 O  OE2   . GLU A 1 266 ? 24.648  21.044  43.599  1.00 29.07 ? 297 GLU A OE2   1 
ATOM   2047 N  N     . GLU A 1 267 ? 29.793  21.077  40.168  1.00 31.63 ? 298 GLU A N     1 
ATOM   2048 C  CA    . GLU A 1 267 ? 31.087  21.346  39.527  1.00 31.26 ? 298 GLU A CA    1 
ATOM   2049 C  C     . GLU A 1 267 ? 30.951  21.674  38.041  1.00 30.93 ? 298 GLU A C     1 
ATOM   2050 O  O     . GLU A 1 267 ? 31.525  22.664  37.588  1.00 31.03 ? 298 GLU A O     1 
ATOM   2051 C  CB    . GLU A 1 267 ? 32.048  20.188  39.748  1.00 31.33 ? 298 GLU A CB    1 
ATOM   2052 C  CG    . GLU A 1 267 ? 33.430  20.545  39.322  1.00 31.27 ? 298 GLU A CG    1 
ATOM   2053 C  CD    . GLU A 1 267 ? 34.467  19.566  39.777  1.00 31.50 ? 298 GLU A CD    1 
ATOM   2054 O  OE1   . GLU A 1 267 ? 35.629  19.963  39.689  1.00 31.39 ? 298 GLU A OE1   1 
ATOM   2055 O  OE2   . GLU A 1 267 ? 34.150  18.424  40.196  1.00 32.14 ? 298 GLU A OE2   1 
ATOM   2056 N  N     . ALA A 1 268 ? 30.215  20.833  37.308  1.00 30.63 ? 299 ALA A N     1 
ATOM   2057 C  CA    . ALA A 1 268 ? 30.001  20.985  35.872  1.00 30.49 ? 299 ALA A CA    1 
ATOM   2058 C  C     . ALA A 1 268 ? 29.220  22.278  35.567  1.00 30.48 ? 299 ALA A C     1 
ATOM   2059 O  O     . ALA A 1 268 ? 29.470  22.950  34.573  1.00 31.10 ? 299 ALA A O     1 
ATOM   2060 C  CB    . ALA A 1 268 ? 29.250  19.771  35.334  1.00 30.33 ? 299 ALA A CB    1 
ATOM   2061 N  N     . ALA A 1 269 ? 28.268  22.629  36.421  1.00 30.21 ? 300 ALA A N     1 
ATOM   2062 C  CA    . ALA A 1 269 ? 27.591  23.929  36.294  1.00 30.22 ? 300 ALA A CA    1 
ATOM   2063 C  C     . ALA A 1 269 ? 28.569  25.091  36.450  1.00 30.17 ? 300 ALA A C     1 
ATOM   2064 O  O     . ALA A 1 269 ? 28.501  26.092  35.711  1.00 30.95 ? 300 ALA A O     1 
ATOM   2065 C  CB    . ALA A 1 269 ? 26.488  24.077  37.324  1.00 29.77 ? 300 ALA A CB    1 
ATOM   2066 N  N     . ALA A 1 270 ? 29.483  24.955  37.391  1.00 29.53 ? 301 ALA A N     1 
ATOM   2067 C  CA    . ALA A 1 270 ? 30.446  26.006  37.622  1.00 29.96 ? 301 ALA A CA    1 
ATOM   2068 C  C     . ALA A 1 270 ? 31.371  26.163  36.423  1.00 29.74 ? 301 ALA A C     1 
ATOM   2069 O  O     . ALA A 1 270 ? 31.726  27.288  36.090  1.00 29.45 ? 301 ALA A O     1 
ATOM   2070 C  CB    . ALA A 1 270 ? 31.248  25.775  38.984  1.00 29.64 ? 301 ALA A CB    1 
ATOM   2071 N  N     . TYR A 1 271 ? 31.739  25.036  35.794  1.00 29.83 ? 302 TYR A N     1 
ATOM   2072 C  CA    . TYR A 1 271 ? 32.668  25.022  34.665  1.00 29.78 ? 302 TYR A CA    1 
ATOM   2073 C  C     . TYR A 1 271 ? 32.014  25.709  33.481  1.00 29.44 ? 302 TYR A C     1 
ATOM   2074 O  O     . TYR A 1 271 ? 32.584  26.591  32.859  1.00 29.47 ? 302 TYR A O     1 
ATOM   2075 C  CB    . TYR A 1 271 ? 33.029  23.590  34.364  1.00 30.10 ? 302 TYR A CB    1 
ATOM   2076 C  CG    . TYR A 1 271 ? 34.220  23.457  33.508  1.00 30.98 ? 302 TYR A CG    1 
ATOM   2077 C  CD1   . TYR A 1 271 ? 35.507  23.594  34.039  1.00 31.58 ? 302 TYR A CD1   1 
ATOM   2078 C  CD2   . TYR A 1 271 ? 34.080  23.188  32.156  1.00 31.72 ? 302 TYR A CD2   1 
ATOM   2079 C  CE1   . TYR A 1 271 ? 36.628  23.461  33.221  1.00 31.11 ? 302 TYR A CE1   1 
ATOM   2080 C  CE2   . TYR A 1 271 ? 35.185  23.049  31.341  1.00 32.29 ? 302 TYR A CE2   1 
ATOM   2081 C  CZ    . TYR A 1 271 ? 36.448  23.187  31.874  1.00 31.28 ? 302 TYR A CZ    1 
ATOM   2082 O  OH    . TYR A 1 271 ? 37.504  23.042  31.023  1.00 31.91 ? 302 TYR A OH    1 
ATOM   2083 N  N     . ILE A 1 272 ? 30.777  25.345  33.200  1.00 29.50 ? 303 ILE A N     1 
ATOM   2084 C  CA    . ILE A 1 272 ? 30.064  26.003  32.112  1.00 29.38 ? 303 ILE A CA    1 
ATOM   2085 C  C     . ILE A 1 272 ? 30.064  27.524  32.384  1.00 29.79 ? 303 ILE A C     1 
ATOM   2086 O  O     . ILE A 1 272 ? 30.532  28.312  31.576  1.00 29.74 ? 303 ILE A O     1 
ATOM   2087 C  CB    . ILE A 1 272 ? 28.640  25.433  31.920  1.00 29.19 ? 303 ILE A CB    1 
ATOM   2088 C  CG1   . ILE A 1 272 ? 28.723  23.962  31.503  1.00 28.67 ? 303 ILE A CG1   1 
ATOM   2089 C  CG2   . ILE A 1 272 ? 27.880  26.248  30.884  1.00 26.90 ? 303 ILE A CG2   1 
ATOM   2090 C  CD1   . ILE A 1 272 ? 27.365  23.238  31.371  1.00 27.69 ? 303 ILE A CD1   1 
ATOM   2091 N  N     . GLN A 1 273 ? 29.630  27.926  33.572  1.00 30.14 ? 304 GLN A N     1 
ATOM   2092 C  CA    . GLN A 1 273 ? 29.629  29.362  33.906  1.00 30.02 ? 304 GLN A CA    1 
ATOM   2093 C  C     . GLN A 1 273 ? 30.945  30.037  33.539  1.00 30.17 ? 304 GLN A C     1 
ATOM   2094 O  O     . GLN A 1 273 ? 30.949  31.049  32.856  1.00 30.52 ? 304 GLN A O     1 
ATOM   2095 C  CB    . GLN A 1 273 ? 29.342  29.603  35.381  1.00 29.61 ? 304 GLN A CB    1 
ATOM   2096 C  CG    . GLN A 1 273 ? 29.301  31.064  35.771  1.00 29.59 ? 304 GLN A CG    1 
ATOM   2097 C  CD    . GLN A 1 273 ? 29.023  31.286  37.241  1.00 30.49 ? 304 GLN A CD    1 
ATOM   2098 O  OE1   . GLN A 1 273 ? 28.448  30.432  37.912  1.00 33.00 ? 304 GLN A OE1   1 
ATOM   2099 N  NE2   . GLN A 1 273 ? 29.432  32.439  37.753  1.00 28.83 ? 304 GLN A NE2   1 
ATOM   2100 N  N     . CYS A 1 274 ? 32.054  29.470  33.987  1.00 30.44 ? 305 CYS A N     1 
ATOM   2101 C  CA    . CYS A 1 274 ? 33.360  30.048  33.744  1.00 30.85 ? 305 CYS A CA    1 
ATOM   2102 C  C     . CYS A 1 274 ? 33.767  30.065  32.263  1.00 31.09 ? 305 CYS A C     1 
ATOM   2103 O  O     . CYS A 1 274 ? 34.503  30.963  31.843  1.00 30.85 ? 305 CYS A O     1 
ATOM   2104 C  CB    . CYS A 1 274 ? 34.399  29.327  34.606  1.00 31.20 ? 305 CYS A CB    1 
ATOM   2105 S  SG    . CYS A 1 274 ? 34.312  29.721  36.408  1.00 30.52 ? 305 CYS A SG    1 
ATOM   2106 N  N     . GLN A 1 275 ? 33.284  29.093  31.479  1.00 31.23 ? 306 GLN A N     1 
ATOM   2107 C  CA    . GLN A 1 275 ? 33.557  29.061  30.049  1.00 31.32 ? 306 GLN A CA    1 
ATOM   2108 C  C     . GLN A 1 275 ? 32.905  30.245  29.362  1.00 31.73 ? 306 GLN A C     1 
ATOM   2109 O  O     . GLN A 1 275 ? 33.544  30.911  28.539  1.00 32.08 ? 306 GLN A O     1 
ATOM   2110 C  CB    . GLN A 1 275 ? 33.078  27.742  29.450  1.00 31.73 ? 306 GLN A CB    1 
ATOM   2111 C  CG    . GLN A 1 275 ? 33.950  26.579  29.841  1.00 31.56 ? 306 GLN A CG    1 
ATOM   2112 C  CD    . GLN A 1 275 ? 35.354  26.757  29.317  1.00 32.66 ? 306 GLN A CD    1 
ATOM   2113 O  OE1   . GLN A 1 275 ? 35.562  26.827  28.101  1.00 32.87 ? 306 GLN A OE1   1 
ATOM   2114 N  NE2   . GLN A 1 275 ? 36.324  26.869  30.224  1.00 31.13 ? 306 GLN A NE2   1 
ATOM   2115 N  N     . PHE A 1 276 ? 31.658  30.531  29.717  1.00 31.67 ? 307 PHE A N     1 
ATOM   2116 C  CA    . PHE A 1 276 ? 30.980  31.726  29.210  1.00 32.46 ? 307 PHE A CA    1 
ATOM   2117 C  C     . PHE A 1 276 ? 31.558  33.023  29.763  1.00 32.58 ? 307 PHE A C     1 
ATOM   2118 O  O     . PHE A 1 276 ? 31.828  33.966  29.030  1.00 32.70 ? 307 PHE A O     1 
ATOM   2119 C  CB    . PHE A 1 276 ? 29.482  31.668  29.491  1.00 32.80 ? 307 PHE A CB    1 
ATOM   2120 C  CG    . PHE A 1 276 ? 28.755  30.712  28.595  1.00 33.25 ? 307 PHE A CG    1 
ATOM   2121 C  CD1   . PHE A 1 276 ? 28.733  29.352  28.884  1.00 32.36 ? 307 PHE A CD1   1 
ATOM   2122 C  CD2   . PHE A 1 276 ? 28.129  31.167  27.437  1.00 33.92 ? 307 PHE A CD2   1 
ATOM   2123 C  CE1   . PHE A 1 276 ? 28.080  28.465  28.045  1.00 33.04 ? 307 PHE A CE1   1 
ATOM   2124 C  CE2   . PHE A 1 276 ? 27.459  30.289  26.593  1.00 33.45 ? 307 PHE A CE2   1 
ATOM   2125 C  CZ    . PHE A 1 276 ? 27.437  28.939  26.893  1.00 33.78 ? 307 PHE A CZ    1 
ATOM   2126 N  N     . GLU A 1 277 ? 31.790  33.072  31.054  1.00 32.97 ? 308 GLU A N     1 
ATOM   2127 C  CA    . GLU A 1 277 ? 32.302  34.296  31.631  1.00 33.43 ? 308 GLU A CA    1 
ATOM   2128 C  C     . GLU A 1 277 ? 33.709  34.665  31.114  1.00 33.68 ? 308 GLU A C     1 
ATOM   2129 O  O     . GLU A 1 277 ? 34.020  35.844  31.034  1.00 33.95 ? 308 GLU A O     1 
ATOM   2130 C  CB    . GLU A 1 277 ? 32.233  34.247  33.154  1.00 33.65 ? 308 GLU A CB    1 
ATOM   2131 C  CG    . GLU A 1 277 ? 30.820  34.427  33.666  1.00 34.21 ? 308 GLU A CG    1 
ATOM   2132 C  CD    . GLU A 1 277 ? 30.712  34.470  35.163  1.00 36.42 ? 308 GLU A CD    1 
ATOM   2133 O  OE1   . GLU A 1 277 ? 31.745  34.697  35.838  1.00 37.90 ? 308 GLU A OE1   1 
ATOM   2134 O  OE2   . GLU A 1 277 ? 29.576  34.278  35.672  1.00 38.44 ? 308 GLU A OE2   1 
ATOM   2135 N  N     . ASP A 1 278 ? 34.526  33.682  30.725  1.00 33.62 ? 309 ASP A N     1 
ATOM   2136 C  CA    . ASP A 1 278 ? 35.837  33.973  30.126  1.00 33.61 ? 309 ASP A CA    1 
ATOM   2137 C  C     . ASP A 1 278 ? 35.759  34.611  28.739  1.00 33.08 ? 309 ASP A C     1 
ATOM   2138 O  O     . ASP A 1 278 ? 36.728  35.182  28.291  1.00 32.63 ? 309 ASP A O     1 
ATOM   2139 C  CB    . ASP A 1 278 ? 36.713  32.718  30.053  1.00 34.01 ? 309 ASP A CB    1 
ATOM   2140 C  CG    . ASP A 1 278 ? 37.298  32.322  31.398  1.00 35.87 ? 309 ASP A CG    1 
ATOM   2141 O  OD1   . ASP A 1 278 ? 36.900  32.897  32.445  1.00 38.90 ? 309 ASP A OD1   1 
ATOM   2142 O  OD2   . ASP A 1 278 ? 38.164  31.421  31.416  1.00 38.61 ? 309 ASP A OD2   1 
ATOM   2143 N  N     . LEU A 1 279 ? 34.621  34.506  28.053  1.00 33.16 ? 310 LEU A N     1 
ATOM   2144 C  CA    . LEU A 1 279 ? 34.488  35.080  26.699  1.00 32.77 ? 310 LEU A CA    1 
ATOM   2145 C  C     . LEU A 1 279 ? 34.492  36.620  26.743  1.00 32.69 ? 310 LEU A C     1 
ATOM   2146 O  O     . LEU A 1 279 ? 34.869  37.295  25.776  1.00 32.44 ? 310 LEU A O     1 
ATOM   2147 C  CB    . LEU A 1 279 ? 33.230  34.551  26.021  1.00 32.25 ? 310 LEU A CB    1 
ATOM   2148 C  CG    . LEU A 1 279 ? 33.279  33.032  25.788  1.00 33.35 ? 310 LEU A CG    1 
ATOM   2149 C  CD1   . LEU A 1 279 ? 31.914  32.439  25.384  1.00 32.31 ? 310 LEU A CD1   1 
ATOM   2150 C  CD2   . LEU A 1 279 ? 34.350  32.671  24.754  1.00 29.12 ? 310 LEU A CD2   1 
ATOM   2151 N  N     . ASN A 1 280 ? 34.080  37.167  27.878  1.00 32.61 ? 311 ASN A N     1 
ATOM   2152 C  CA    . ASN A 1 280 ? 34.145  38.604  28.101  1.00 32.91 ? 311 ASN A CA    1 
ATOM   2153 C  C     . ASN A 1 280 ? 35.565  39.138  27.883  1.00 32.78 ? 311 ASN A C     1 
ATOM   2154 O  O     . ASN A 1 280 ? 36.489  38.765  28.602  1.00 32.63 ? 311 ASN A O     1 
ATOM   2155 C  CB    . ASN A 1 280 ? 33.659  38.941  29.535  1.00 32.66 ? 311 ASN A CB    1 
ATOM   2156 C  CG    . ASN A 1 280 ? 33.516  40.430  29.764  1.00 32.98 ? 311 ASN A CG    1 
ATOM   2157 O  OD1   . ASN A 1 280 ? 33.816  41.231  28.863  1.00 35.57 ? 311 ASN A OD1   1 
ATOM   2158 N  ND2   . ASN A 1 280 ? 33.067  40.822  30.959  1.00 31.65 ? 311 ASN A ND2   1 
ATOM   2159 N  N     . LYS A 1 281 ? 35.722  40.008  26.895  1.00 32.88 ? 312 LYS A N     1 
ATOM   2160 C  CA    . LYS A 1 281 ? 37.034  40.549  26.535  1.00 33.44 ? 312 LYS A CA    1 
ATOM   2161 C  C     . LYS A 1 281 ? 37.220  41.975  27.092  1.00 33.67 ? 312 LYS A C     1 
ATOM   2162 O  O     . LYS A 1 281 ? 38.198  42.644  26.785  1.00 33.30 ? 312 LYS A O     1 
ATOM   2163 C  CB    . LYS A 1 281 ? 37.234  40.462  25.012  1.00 33.42 ? 312 LYS A CB    1 
ATOM   2164 C  CG    . LYS A 1 281 ? 37.874  39.114  24.600  1.00 34.69 ? 312 LYS A CG    1 
ATOM   2165 C  CD    . LYS A 1 281 ? 37.476  38.647  23.201  1.00 36.94 ? 312 LYS A CD    1 
ATOM   2166 C  CE    . LYS A 1 281 ? 37.795  37.145  22.961  1.00 37.05 ? 312 LYS A CE    1 
ATOM   2167 N  NZ    . LYS A 1 281 ? 36.619  36.212  23.240  1.00 38.66 ? 312 LYS A NZ    1 
ATOM   2168 N  N     . ARG A 1 282 ? 36.267  42.414  27.917  1.00 33.98 ? 313 ARG A N     1 
ATOM   2169 C  CA    . ARG A 1 282 ? 36.357  43.667  28.656  1.00 34.31 ? 313 ARG A CA    1 
ATOM   2170 C  C     . ARG A 1 282 ? 36.108  43.454  30.153  1.00 34.44 ? 313 ARG A C     1 
ATOM   2171 O  O     . ARG A 1 282 ? 35.302  44.158  30.746  1.00 33.83 ? 313 ARG A O     1 
ATOM   2172 C  CB    . ARG A 1 282 ? 35.289  44.665  28.196  1.00 34.22 ? 313 ARG A CB    1 
ATOM   2173 C  CG    . ARG A 1 282 ? 35.070  44.848  26.716  1.00 34.53 ? 313 ARG A CG    1 
ATOM   2174 C  CD    . ARG A 1 282 ? 33.538  44.803  26.460  1.00 35.22 ? 313 ARG A CD    1 
ATOM   2175 N  NE    . ARG A 1 282 ? 33.101  45.784  25.485  1.00 34.67 ? 313 ARG A NE    1 
ATOM   2176 C  CZ    . ARG A 1 282 ? 31.885  45.841  24.947  1.00 33.64 ? 313 ARG A CZ    1 
ATOM   2177 N  NH1   . ARG A 1 282 ? 30.936  44.980  25.275  1.00 31.94 ? 313 ARG A NH1   1 
ATOM   2178 N  NH2   . ARG A 1 282 ? 31.624  46.792  24.058  1.00 34.89 ? 313 ARG A NH2   1 
ATOM   2179 N  N     . LYS A 1 283 ? 36.798  42.499  30.760  1.00 35.26 ? 314 LYS A N     1 
ATOM   2180 C  CA    . LYS A 1 283 ? 36.628  42.216  32.187  1.00 36.16 ? 314 LYS A CA    1 
ATOM   2181 C  C     . LYS A 1 283 ? 36.891  43.418  33.111  1.00 36.38 ? 314 LYS A C     1 
ATOM   2182 O  O     . LYS A 1 283 ? 36.365  43.464  34.227  1.00 36.01 ? 314 LYS A O     1 
ATOM   2183 C  CB    . LYS A 1 283 ? 37.513  41.044  32.599  1.00 36.53 ? 314 LYS A CB    1 
ATOM   2184 C  CG    . LYS A 1 283 ? 36.925  39.685  32.213  1.00 37.75 ? 314 LYS A CG    1 
ATOM   2185 C  CD    . LYS A 1 283 ? 38.013  38.636  31.927  1.00 37.86 ? 314 LYS A CD    1 
ATOM   2186 C  CE    . LYS A 1 283 ? 37.404  37.363  31.306  1.00 38.10 ? 314 LYS A CE    1 
ATOM   2187 N  NZ    . LYS A 1 283 ? 38.327  36.708  30.331  1.00 38.45 ? 314 LYS A NZ    1 
ATOM   2188 N  N     . ASP A 1 284 ? 37.693  44.372  32.636  1.00 36.88 ? 315 ASP A N     1 
ATOM   2189 C  CA    . ASP A 1 284 ? 37.986  45.618  33.356  1.00 37.50 ? 315 ASP A CA    1 
ATOM   2190 C  C     . ASP A 1 284 ? 36.804  46.564  33.491  1.00 37.57 ? 315 ASP A C     1 
ATOM   2191 O  O     . ASP A 1 284 ? 36.645  47.207  34.519  1.00 37.58 ? 315 ASP A O     1 
ATOM   2192 C  CB    . ASP A 1 284 ? 39.043  46.453  32.597  1.00 37.83 ? 315 ASP A CB    1 
ATOM   2193 C  CG    . ASP A 1 284 ? 40.476  45.980  32.793  1.00 38.90 ? 315 ASP A CG    1 
ATOM   2194 O  OD1   . ASP A 1 284 ? 41.379  46.662  32.245  1.00 40.07 ? 315 ASP A OD1   1 
ATOM   2195 O  OD2   . ASP A 1 284 ? 40.718  44.960  33.470  1.00 41.27 ? 315 ASP A OD2   1 
ATOM   2196 N  N     . THR A 1 285 ? 36.037  46.723  32.418  1.00 37.87 ? 316 THR A N     1 
ATOM   2197 C  CA    . THR A 1 285 ? 34.966  47.724  32.388  1.00 37.91 ? 316 THR A CA    1 
ATOM   2198 C  C     . THR A 1 285 ? 33.595  47.109  32.555  1.00 38.01 ? 316 THR A C     1 
ATOM   2199 O  O     . THR A 1 285 ? 32.643  47.800  32.894  1.00 37.82 ? 316 THR A O     1 
ATOM   2200 C  CB    . THR A 1 285 ? 34.968  48.550  31.098  1.00 38.04 ? 316 THR A CB    1 
ATOM   2201 O  OG1   . THR A 1 285 ? 34.783  47.695  29.964  1.00 37.59 ? 316 THR A OG1   1 
ATOM   2202 C  CG2   . THR A 1 285 ? 36.286  49.333  30.975  1.00 38.21 ? 316 THR A CG2   1 
ATOM   2203 N  N     . LYS A 1 286 ? 33.487  45.808  32.313  1.00 38.07 ? 317 LYS A N     1 
ATOM   2204 C  CA    . LYS A 1 286 ? 32.183  45.200  32.146  1.00 38.14 ? 317 LYS A CA    1 
ATOM   2205 C  C     . LYS A 1 286 ? 32.010  43.902  32.958  1.00 37.87 ? 317 LYS A C     1 
ATOM   2206 O  O     . LYS A 1 286 ? 32.914  43.068  33.046  1.00 37.67 ? 317 LYS A O     1 
ATOM   2207 C  CB    . LYS A 1 286 ? 31.934  44.975  30.666  1.00 37.92 ? 317 LYS A CB    1 
ATOM   2208 C  CG    . LYS A 1 286 ? 30.487  44.787  30.347  1.00 39.12 ? 317 LYS A CG    1 
ATOM   2209 C  CD    . LYS A 1 286 ? 30.224  44.750  28.820  1.00 38.79 ? 317 LYS A CD    1 
ATOM   2210 C  CE    . LYS A 1 286 ? 28.823  45.226  28.535  1.00 37.73 ? 317 LYS A CE    1 
ATOM   2211 N  NZ    . LYS A 1 286 ? 28.705  46.686  28.857  1.00 36.51 ? 317 LYS A NZ    1 
ATOM   2212 N  N     . GLU A 1 287 ? 30.835  43.774  33.557  1.00 37.48 ? 318 GLU A N     1 
ATOM   2213 C  CA    . GLU A 1 287 ? 30.494  42.651  34.403  1.00 37.79 ? 318 GLU A CA    1 
ATOM   2214 C  C     . GLU A 1 287 ? 29.354  41.873  33.745  1.00 36.89 ? 318 GLU A C     1 
ATOM   2215 O  O     . GLU A 1 287 ? 28.379  42.475  33.255  1.00 36.29 ? 318 GLU A O     1 
ATOM   2216 C  CB    . GLU A 1 287 ? 30.054  43.171  35.779  1.00 38.25 ? 318 GLU A CB    1 
ATOM   2217 C  CG    . GLU A 1 287 ? 30.130  42.137  36.852  1.00 40.30 ? 318 GLU A CG    1 
ATOM   2218 C  CD    . GLU A 1 287 ? 29.954  42.697  38.260  1.00 43.45 ? 318 GLU A CD    1 
ATOM   2219 O  OE1   . GLU A 1 287 ? 30.532  43.763  38.585  1.00 45.70 ? 318 GLU A OE1   1 
ATOM   2220 O  OE2   . GLU A 1 287 ? 29.242  42.041  39.051  1.00 44.58 ? 318 GLU A OE2   1 
ATOM   2221 N  N     . ILE A 1 288 ? 29.488  40.548  33.689  1.00 36.11 ? 319 ILE A N     1 
ATOM   2222 C  CA    . ILE A 1 288 ? 28.370  39.693  33.276  1.00 35.23 ? 319 ILE A CA    1 
ATOM   2223 C  C     . ILE A 1 288 ? 27.604  39.331  34.553  1.00 34.24 ? 319 ILE A C     1 
ATOM   2224 O  O     . ILE A 1 288 ? 28.216  38.919  35.552  1.00 34.10 ? 319 ILE A O     1 
ATOM   2225 C  CB    . ILE A 1 288 ? 28.815  38.351  32.601  1.00 35.60 ? 319 ILE A CB    1 
ATOM   2226 C  CG1   . ILE A 1 288 ? 29.977  38.529  31.612  1.00 35.79 ? 319 ILE A CG1   1 
ATOM   2227 C  CG2   . ILE A 1 288 ? 27.600  37.646  31.947  1.00 34.77 ? 319 ILE A CG2   1 
ATOM   2228 C  CD1   . ILE A 1 288 ? 29.773  39.605  30.583  1.00 38.57 ? 319 ILE A CD1   1 
ATOM   2229 N  N     . TYR A 1 289 ? 26.285  39.468  34.526  1.00 32.92 ? 320 TYR A N     1 
ATOM   2230 C  CA    . TYR A 1 289 ? 25.466  39.092  35.686  1.00 32.75 ? 320 TYR A CA    1 
ATOM   2231 C  C     . TYR A 1 289 ? 24.818  37.745  35.411  1.00 32.71 ? 320 TYR A C     1 
ATOM   2232 O  O     . TYR A 1 289 ? 23.852  37.638  34.617  1.00 32.76 ? 320 TYR A O     1 
ATOM   2233 C  CB    . TYR A 1 289 ? 24.420  40.163  36.003  1.00 32.46 ? 320 TYR A CB    1 
ATOM   2234 C  CG    . TYR A 1 289 ? 25.038  41.540  36.085  1.00 32.25 ? 320 TYR A CG    1 
ATOM   2235 C  CD1   . TYR A 1 289 ? 25.554  42.036  37.285  1.00 32.23 ? 320 TYR A CD1   1 
ATOM   2236 C  CD2   . TYR A 1 289 ? 25.142  42.335  34.949  1.00 31.93 ? 320 TYR A CD2   1 
ATOM   2237 C  CE1   . TYR A 1 289 ? 26.136  43.316  37.345  1.00 32.16 ? 320 TYR A CE1   1 
ATOM   2238 C  CE2   . TYR A 1 289 ? 25.741  43.592  34.994  1.00 31.09 ? 320 TYR A CE2   1 
ATOM   2239 C  CZ    . TYR A 1 289 ? 26.226  44.077  36.181  1.00 31.33 ? 320 TYR A CZ    1 
ATOM   2240 O  OH    . TYR A 1 289 ? 26.780  45.329  36.185  1.00 31.55 ? 320 TYR A OH    1 
ATOM   2241 N  N     . THR A 1 290 ? 25.379  36.715  36.046  1.00 32.08 ? 321 THR A N     1 
ATOM   2242 C  CA    . THR A 1 290 ? 25.006  35.348  35.765  1.00 31.56 ? 321 THR A CA    1 
ATOM   2243 C  C     . THR A 1 290 ? 24.015  34.785  36.781  1.00 31.59 ? 321 THR A C     1 
ATOM   2244 O  O     . THR A 1 290 ? 24.204  34.938  37.981  1.00 31.07 ? 321 THR A O     1 
ATOM   2245 C  CB    . THR A 1 290 ? 26.264  34.486  35.712  1.00 31.71 ? 321 THR A CB    1 
ATOM   2246 O  OG1   . THR A 1 290 ? 27.088  34.960  34.641  1.00 30.32 ? 321 THR A OG1   1 
ATOM   2247 C  CG2   . THR A 1 290 ? 25.918  33.004  35.489  1.00 30.90 ? 321 THR A CG2   1 
ATOM   2248 N  N     . HIS A 1 291 ? 22.956  34.145  36.270  1.00 31.51 ? 322 HIS A N     1 
ATOM   2249 C  CA    . HIS A 1 291 ? 21.993  33.423  37.109  1.00 31.63 ? 322 HIS A CA    1 
ATOM   2250 C  C     . HIS A 1 291 ? 21.649  32.074  36.501  1.00 31.62 ? 322 HIS A C     1 
ATOM   2251 O  O     . HIS A 1 291 ? 21.408  31.961  35.286  1.00 31.26 ? 322 HIS A O     1 
ATOM   2252 C  CB    . HIS A 1 291 ? 20.684  34.201  37.258  1.00 31.60 ? 322 HIS A CB    1 
ATOM   2253 C  CG    . HIS A 1 291 ? 20.863  35.561  37.846  1.00 32.40 ? 322 HIS A CG    1 
ATOM   2254 N  ND1   . HIS A 1 291 ? 20.720  35.813  39.195  1.00 32.24 ? 322 HIS A ND1   1 
ATOM   2255 C  CD2   . HIS A 1 291 ? 21.186  36.741  37.272  1.00 31.58 ? 322 HIS A CD2   1 
ATOM   2256 C  CE1   . HIS A 1 291 ? 20.936  37.093  39.425  1.00 32.10 ? 322 HIS A CE1   1 
ATOM   2257 N  NE2   . HIS A 1 291 ? 21.225  37.676  38.276  1.00 33.54 ? 322 HIS A NE2   1 
ATOM   2258 N  N     . PHE A 1 292 ? 21.586  31.066  37.360  1.00 31.40 ? 323 PHE A N     1 
ATOM   2259 C  CA    . PHE A 1 292 ? 21.160  29.755  36.948  1.00 31.45 ? 323 PHE A CA    1 
ATOM   2260 C  C     . PHE A 1 292 ? 19.685  29.755  37.106  1.00 31.19 ? 323 PHE A C     1 
ATOM   2261 O  O     . PHE A 1 292 ? 19.202  30.017  38.193  1.00 31.81 ? 323 PHE A O     1 
ATOM   2262 C  CB    . PHE A 1 292 ? 21.814  28.684  37.795  1.00 31.16 ? 323 PHE A CB    1 
ATOM   2263 C  CG    . PHE A 1 292 ? 23.246  28.549  37.503  1.00 30.16 ? 323 PHE A CG    1 
ATOM   2264 C  CD1   . PHE A 1 292 ? 24.146  29.460  38.027  1.00 30.65 ? 323 PHE A CD1   1 
ATOM   2265 C  CD2   . PHE A 1 292 ? 23.695  27.561  36.652  1.00 29.32 ? 323 PHE A CD2   1 
ATOM   2266 C  CE1   . PHE A 1 292 ? 25.494  29.364  37.743  1.00 31.81 ? 323 PHE A CE1   1 
ATOM   2267 C  CE2   . PHE A 1 292 ? 25.034  27.454  36.339  1.00 29.93 ? 323 PHE A CE2   1 
ATOM   2268 C  CZ    . PHE A 1 292 ? 25.948  28.360  36.881  1.00 31.46 ? 323 PHE A CZ    1 
ATOM   2269 N  N     . THR A 1 293 ? 18.975  29.485  36.020  1.00 30.53 ? 324 THR A N     1 
ATOM   2270 C  CA    . THR A 1 293 ? 17.543  29.615  36.018  1.00 30.25 ? 324 THR A CA    1 
ATOM   2271 C  C     . THR A 1 293 ? 16.856  28.358  35.586  1.00 29.96 ? 324 THR A C     1 
ATOM   2272 O  O     . THR A 1 293 ? 17.444  27.497  34.925  1.00 29.75 ? 324 THR A O     1 
ATOM   2273 C  CB    . THR A 1 293 ? 17.086  30.695  35.017  1.00 31.04 ? 324 THR A CB    1 
ATOM   2274 O  OG1   . THR A 1 293 ? 17.408  30.292  33.664  1.00 29.57 ? 324 THR A OG1   1 
ATOM   2275 C  CG2   . THR A 1 293 ? 17.717  32.031  35.359  1.00 29.75 ? 324 THR A CG2   1 
ATOM   2276 N  N     . CYS A 1 294 ? 15.590  28.270  35.961  1.00 29.79 ? 325 CYS A N     1 
ATOM   2277 C  CA    . CYS A 1 294 ? 14.663  27.282  35.410  1.00 29.72 ? 325 CYS A CA    1 
ATOM   2278 C  C     . CYS A 1 294 ? 13.452  28.084  34.918  1.00 29.80 ? 325 CYS A C     1 
ATOM   2279 O  O     . CYS A 1 294 ? 12.602  28.523  35.736  1.00 29.57 ? 325 CYS A O     1 
ATOM   2280 C  CB    . CYS A 1 294 ? 14.271  26.273  36.480  1.00 29.79 ? 325 CYS A CB    1 
ATOM   2281 S  SG    . CYS A 1 294 ? 13.042  25.058  35.957  1.00 30.22 ? 325 CYS A SG    1 
ATOM   2282 N  N     . ALA A 1 295 ? 13.391  28.307  33.600  1.00 29.41 ? 326 ALA A N     1 
ATOM   2283 C  CA    . ALA A 1 295 ? 12.461  29.292  33.038  1.00 29.34 ? 326 ALA A CA    1 
ATOM   2284 C  C     . ALA A 1 295 ? 11.019  28.894  33.275  1.00 29.50 ? 326 ALA A C     1 
ATOM   2285 O  O     . ALA A 1 295 ? 10.130  29.741  33.318  1.00 29.95 ? 326 ALA A O     1 
ATOM   2286 C  CB    . ALA A 1 295 ? 12.718  29.515  31.533  1.00 29.19 ? 326 ALA A CB    1 
ATOM   2287 N  N     . THR A 1 296 ? 10.778  27.600  33.427  1.00 29.31 ? 327 THR A N     1 
ATOM   2288 C  CA    . THR A 1 296 ? 9.425   27.130  33.632  1.00 29.14 ? 327 THR A CA    1 
ATOM   2289 C  C     . THR A 1 296 ? 9.040   27.191  35.105  1.00 29.42 ? 327 THR A C     1 
ATOM   2290 O  O     . THR A 1 296 ? 7.883   26.944  35.443  1.00 29.21 ? 327 THR A O     1 
ATOM   2291 C  CB    . THR A 1 296 ? 9.268   25.703  33.107  1.00 28.87 ? 327 THR A CB    1 
ATOM   2292 O  OG1   . THR A 1 296 ? 10.304  24.900  33.660  1.00 29.15 ? 327 THR A OG1   1 
ATOM   2293 C  CG2   . THR A 1 296 ? 9.384   25.684  31.604  1.00 27.58 ? 327 THR A CG2   1 
ATOM   2294 N  N     . ASP A 1 297 ? 10.006  27.505  35.971  1.00 29.80 ? 328 ASP A N     1 
ATOM   2295 C  CA    . ASP A 1 297 ? 9.738   27.718  37.419  1.00 30.34 ? 328 ASP A CA    1 
ATOM   2296 C  C     . ASP A 1 297 ? 9.456   29.206  37.703  1.00 29.91 ? 328 ASP A C     1 
ATOM   2297 O  O     . ASP A 1 297 ? 10.383  30.033  37.759  1.00 29.99 ? 328 ASP A O     1 
ATOM   2298 C  CB    . ASP A 1 297 ? 10.918  27.216  38.274  1.00 30.90 ? 328 ASP A CB    1 
ATOM   2299 C  CG    . ASP A 1 297 ? 10.663  27.324  39.786  1.00 32.04 ? 328 ASP A CG    1 
ATOM   2300 O  OD1   . ASP A 1 297 ? 9.675   27.979  40.185  1.00 33.03 ? 328 ASP A OD1   1 
ATOM   2301 O  OD2   . ASP A 1 297 ? 11.473  26.753  40.573  1.00 33.99 ? 328 ASP A OD2   1 
ATOM   2302 N  N     . THR A 1 298 ? 8.177   29.532  37.864  1.00 29.53 ? 329 THR A N     1 
ATOM   2303 C  CA    . THR A 1 298 ? 7.737   30.907  38.065  1.00 29.43 ? 329 THR A CA    1 
ATOM   2304 C  C     . THR A 1 298 ? 8.435   31.541  39.259  1.00 29.67 ? 329 THR A C     1 
ATOM   2305 O  O     . THR A 1 298 ? 8.972   32.635  39.140  1.00 29.50 ? 329 THR A O     1 
ATOM   2306 C  CB    . THR A 1 298 ? 6.199   30.991  38.228  1.00 29.28 ? 329 THR A CB    1 
ATOM   2307 O  OG1   . THR A 1 298 ? 5.576   30.732  36.966  1.00 29.28 ? 329 THR A OG1   1 
ATOM   2308 C  CG2   . THR A 1 298 ? 5.763   32.369  38.722  1.00 28.36 ? 329 THR A CG2   1 
ATOM   2309 N  N     . LYS A 1 299 ? 8.447   30.834  40.392  1.00 29.88 ? 330 LYS A N     1 
ATOM   2310 C  CA    . LYS A 1 299 ? 9.147   31.304  41.587  1.00 30.02 ? 330 LYS A CA    1 
ATOM   2311 C  C     . LYS A 1 299 ? 10.601  31.672  41.316  1.00 29.92 ? 330 LYS A C     1 
ATOM   2312 O  O     . LYS A 1 299 ? 11.062  32.699  41.789  1.00 30.16 ? 330 LYS A O     1 
ATOM   2313 C  CB    . LYS A 1 299 ? 9.128   30.246  42.686  1.00 30.30 ? 330 LYS A CB    1 
ATOM   2314 C  CG    . LYS A 1 299 ? 9.556   30.763  44.072  1.00 31.10 ? 330 LYS A CG    1 
ATOM   2315 N  N     . ASN A 1 300 ? 11.327  30.831  40.582  1.00 29.90 ? 331 ASN A N     1 
ATOM   2316 C  CA    . ASN A 1 300 ? 12.737  31.078  40.330  1.00 29.68 ? 331 ASN A CA    1 
ATOM   2317 C  C     . ASN A 1 300 ? 12.919  32.250  39.357  1.00 29.83 ? 331 ASN A C     1 
ATOM   2318 O  O     . ASN A 1 300 ? 13.794  33.085  39.540  1.00 30.22 ? 331 ASN A O     1 
ATOM   2319 C  CB    . ASN A 1 300 ? 13.455  29.841  39.814  1.00 29.56 ? 331 ASN A CB    1 
ATOM   2320 C  CG    . ASN A 1 300 ? 14.869  30.148  39.356  1.00 29.15 ? 331 ASN A CG    1 
ATOM   2321 O  OD1   . ASN A 1 300 ? 15.178  30.016  38.192  1.00 31.39 ? 331 ASN A OD1   1 
ATOM   2322 N  ND2   . ASN A 1 300 ? 15.709  30.617  40.256  1.00 28.12 ? 331 ASN A ND2   1 
ATOM   2323 N  N     . VAL A 1 301 ? 12.085  32.343  38.338  1.00 29.70 ? 332 VAL A N     1 
ATOM   2324 C  CA    . VAL A 1 301 ? 12.188  33.489  37.434  1.00 29.71 ? 332 VAL A CA    1 
ATOM   2325 C  C     . VAL A 1 301 ? 11.781  34.799  38.149  1.00 30.04 ? 332 VAL A C     1 
ATOM   2326 O  O     . VAL A 1 301 ? 12.333  35.867  37.871  1.00 30.43 ? 332 VAL A O     1 
ATOM   2327 C  CB    . VAL A 1 301 ? 11.395  33.268  36.091  1.00 29.39 ? 332 VAL A CB    1 
ATOM   2328 C  CG1   . VAL A 1 301 ? 11.321  34.566  35.250  1.00 28.51 ? 332 VAL A CG1   1 
ATOM   2329 C  CG2   . VAL A 1 301 ? 12.036  32.191  35.301  1.00 27.87 ? 332 VAL A CG2   1 
ATOM   2330 N  N     . GLN A 1 302 ? 10.850  34.736  39.084  1.00 30.46 ? 333 GLN A N     1 
ATOM   2331 C  CA    . GLN A 1 302 ? 10.469  35.952  39.804  1.00 30.89 ? 333 GLN A CA    1 
ATOM   2332 C  C     . GLN A 1 302 ? 11.611  36.482  40.665  1.00 30.81 ? 333 GLN A C     1 
ATOM   2333 O  O     . GLN A 1 302 ? 11.842  37.680  40.732  1.00 30.29 ? 333 GLN A O     1 
ATOM   2334 C  CB    . GLN A 1 302 ? 9.223   35.727  40.649  1.00 31.04 ? 333 GLN A CB    1 
ATOM   2335 C  CG    . GLN A 1 302 ? 8.442   37.001  40.851  1.00 31.87 ? 333 GLN A CG    1 
ATOM   2336 C  CD    . GLN A 1 302 ? 7.422   36.878  41.941  1.00 33.63 ? 333 GLN A CD    1 
ATOM   2337 O  OE1   . GLN A 1 302 ? 7.384   37.707  42.826  1.00 35.47 ? 333 GLN A OE1   1 
ATOM   2338 N  NE2   . GLN A 1 302 ? 6.594   35.829  41.896  1.00 34.10 ? 333 GLN A NE2   1 
ATOM   2339 N  N     . PHE A 1 303 ? 12.325  35.577  41.316  1.00 31.50 ? 334 PHE A N     1 
ATOM   2340 C  CA    . PHE A 1 303 ? 13.451  35.973  42.163  1.00 32.11 ? 334 PHE A CA    1 
ATOM   2341 C  C     . PHE A 1 303 ? 14.599  36.500  41.304  1.00 31.78 ? 334 PHE A C     1 
ATOM   2342 O  O     . PHE A 1 303 ? 15.183  37.530  41.614  1.00 31.78 ? 334 PHE A O     1 
ATOM   2343 C  CB    . PHE A 1 303 ? 13.885  34.801  43.053  1.00 32.73 ? 334 PHE A CB    1 
ATOM   2344 C  CG    . PHE A 1 303 ? 15.179  35.028  43.801  1.00 33.38 ? 334 PHE A CG    1 
ATOM   2345 C  CD1   . PHE A 1 303 ? 15.175  35.609  45.064  1.00 33.39 ? 334 PHE A CD1   1 
ATOM   2346 C  CD2   . PHE A 1 303 ? 16.402  34.613  43.249  1.00 34.79 ? 334 PHE A CD2   1 
ATOM   2347 C  CE1   . PHE A 1 303 ? 16.367  35.802  45.776  1.00 33.53 ? 334 PHE A CE1   1 
ATOM   2348 C  CE2   . PHE A 1 303 ? 17.606  34.811  43.949  1.00 35.35 ? 334 PHE A CE2   1 
ATOM   2349 C  CZ    . PHE A 1 303 ? 17.584  35.410  45.222  1.00 33.76 ? 334 PHE A CZ    1 
ATOM   2350 N  N     . VAL A 1 304 ? 14.901  35.805  40.219  1.00 31.42 ? 335 VAL A N     1 
ATOM   2351 C  CA    . VAL A 1 304 ? 16.007  36.202  39.364  1.00 31.12 ? 335 VAL A CA    1 
ATOM   2352 C  C     . VAL A 1 304 ? 15.703  37.513  38.657  1.00 31.50 ? 335 VAL A C     1 
ATOM   2353 O  O     . VAL A 1 304 ? 16.554  38.385  38.571  1.00 31.72 ? 335 VAL A O     1 
ATOM   2354 C  CB    . VAL A 1 304 ? 16.357  35.121  38.323  1.00 31.15 ? 335 VAL A CB    1 
ATOM   2355 C  CG1   . VAL A 1 304 ? 17.101  35.754  37.127  1.00 29.22 ? 335 VAL A CG1   1 
ATOM   2356 C  CG2   . VAL A 1 304 ? 17.177  34.024  38.982  1.00 28.83 ? 335 VAL A CG2   1 
ATOM   2357 N  N     . PHE A 1 305 ? 14.485  37.675  38.160  1.00 31.65 ? 336 PHE A N     1 
ATOM   2358 C  CA    . PHE A 1 305 ? 14.139  38.946  37.503  1.00 31.47 ? 336 PHE A CA    1 
ATOM   2359 C  C     . PHE A 1 305 ? 14.180  40.142  38.439  1.00 31.21 ? 336 PHE A C     1 
ATOM   2360 O  O     . PHE A 1 305 ? 14.546  41.228  38.014  1.00 31.56 ? 336 PHE A O     1 
ATOM   2361 C  CB    . PHE A 1 305 ? 12.773  38.886  36.840  1.00 31.57 ? 336 PHE A CB    1 
ATOM   2362 C  CG    . PHE A 1 305 ? 12.572  39.941  35.817  1.00 31.10 ? 336 PHE A CG    1 
ATOM   2363 C  CD1   . PHE A 1 305 ? 13.312  39.921  34.654  1.00 30.34 ? 336 PHE A CD1   1 
ATOM   2364 C  CD2   . PHE A 1 305 ? 11.645  40.956  36.013  1.00 31.56 ? 336 PHE A CD2   1 
ATOM   2365 C  CE1   . PHE A 1 305 ? 13.144  40.903  33.685  1.00 31.59 ? 336 PHE A CE1   1 
ATOM   2366 C  CE2   . PHE A 1 305 ? 11.459  41.948  35.048  1.00 32.28 ? 336 PHE A CE2   1 
ATOM   2367 C  CZ    . PHE A 1 305 ? 12.214  41.923  33.883  1.00 31.39 ? 336 PHE A CZ    1 
ATOM   2368 N  N     . ASP A 1 306 ? 13.812  39.949  39.699  1.00 31.15 ? 337 ASP A N     1 
ATOM   2369 C  CA    . ASP A 1 306 ? 13.934  41.013  40.698  1.00 31.20 ? 337 ASP A CA    1 
ATOM   2370 C  C     . ASP A 1 306 ? 15.397  41.449  40.865  1.00 31.21 ? 337 ASP A C     1 
ATOM   2371 O  O     . ASP A 1 306 ? 15.688  42.642  40.901  1.00 31.53 ? 337 ASP A O     1 
ATOM   2372 C  CB    . ASP A 1 306 ? 13.332  40.566  42.023  1.00 31.70 ? 337 ASP A CB    1 
ATOM   2373 C  CG    . ASP A 1 306 ? 13.286  41.670  43.043  1.00 33.22 ? 337 ASP A CG    1 
ATOM   2374 O  OD1   . ASP A 1 306 ? 14.351  41.909  43.659  1.00 36.62 ? 337 ASP A OD1   1 
ATOM   2375 O  OD2   . ASP A 1 306 ? 12.201  42.281  43.243  1.00 33.11 ? 337 ASP A OD2   1 
ATOM   2376 N  N     . ALA A 1 307 ? 16.324  40.493  40.925  1.00 30.90 ? 338 ALA A N     1 
ATOM   2377 C  CA    . ALA A 1 307 ? 17.753  40.811  41.016  1.00 30.67 ? 338 ALA A CA    1 
ATOM   2378 C  C     . ALA A 1 307 ? 18.267  41.547  39.775  1.00 30.58 ? 338 ALA A C     1 
ATOM   2379 O  O     . ALA A 1 307 ? 18.994  42.541  39.880  1.00 30.22 ? 338 ALA A O     1 
ATOM   2380 C  CB    . ALA A 1 307 ? 18.559  39.545  41.222  1.00 30.60 ? 338 ALA A CB    1 
ATOM   2381 N  N     . VAL A 1 308 ? 17.907  41.016  38.609  1.00 30.60 ? 339 VAL A N     1 
ATOM   2382 C  CA    . VAL A 1 308 ? 18.238  41.621  37.309  1.00 30.49 ? 339 VAL A CA    1 
ATOM   2383 C  C     . VAL A 1 308 ? 17.757  43.070  37.239  1.00 30.34 ? 339 VAL A C     1 
ATOM   2384 O  O     . VAL A 1 308 ? 18.518  43.957  36.857  1.00 30.35 ? 339 VAL A O     1 
ATOM   2385 C  CB    . VAL A 1 308 ? 17.613  40.810  36.177  1.00 30.65 ? 339 VAL A CB    1 
ATOM   2386 C  CG1   . VAL A 1 308 ? 17.655  41.572  34.872  1.00 31.13 ? 339 VAL A CG1   1 
ATOM   2387 C  CG2   . VAL A 1 308 ? 18.301  39.479  36.077  1.00 30.79 ? 339 VAL A CG2   1 
ATOM   2388 N  N     . THR A 1 309 ? 16.513  43.320  37.664  1.00 30.41 ? 340 THR A N     1 
ATOM   2389 C  CA    . THR A 1 309 ? 15.968  44.694  37.661  1.00 30.11 ? 340 THR A CA    1 
ATOM   2390 C  C     . THR A 1 309 ? 16.739  45.617  38.597  1.00 29.64 ? 340 THR A C     1 
ATOM   2391 O  O     . THR A 1 309 ? 16.975  46.771  38.252  1.00 29.54 ? 340 THR A O     1 
ATOM   2392 C  CB    . THR A 1 309 ? 14.441  44.730  37.949  1.00 30.13 ? 340 THR A CB    1 
ATOM   2393 O  OG1   . THR A 1 309 ? 13.759  44.073  36.868  1.00 29.96 ? 340 THR A OG1   1 
ATOM   2394 C  CG2   . THR A 1 309 ? 13.920  46.169  38.060  1.00 29.05 ? 340 THR A CG2   1 
ATOM   2395 N  N     . ASP A 1 310 ? 17.167  45.108  39.746  1.00 29.61 ? 341 ASP A N     1 
ATOM   2396 C  CA    . ASP A 1 310 ? 18.028  45.898  40.643  1.00 29.78 ? 341 ASP A CA    1 
ATOM   2397 C  C     . ASP A 1 310 ? 19.390  46.194  40.013  1.00 29.60 ? 341 ASP A C     1 
ATOM   2398 O  O     . ASP A 1 310 ? 19.957  47.255  40.248  1.00 29.81 ? 341 ASP A O     1 
ATOM   2399 C  CB    . ASP A 1 310 ? 18.219  45.219  42.000  1.00 29.63 ? 341 ASP A CB    1 
ATOM   2400 C  CG    . ASP A 1 310 ? 16.996  45.327  42.879  1.00 31.08 ? 341 ASP A CG    1 
ATOM   2401 O  OD1   . ASP A 1 310 ? 16.226  46.319  42.728  1.00 32.39 ? 341 ASP A OD1   1 
ATOM   2402 O  OD2   . ASP A 1 310 ? 16.803  44.420  43.728  1.00 32.66 ? 341 ASP A OD2   1 
ATOM   2403 N  N     . VAL A 1 311 ? 19.906  45.268  39.207  1.00 29.45 ? 342 VAL A N     1 
ATOM   2404 C  CA    . VAL A 1 311 ? 21.165  45.506  38.514  1.00 29.22 ? 342 VAL A CA    1 
ATOM   2405 C  C     . VAL A 1 311 ? 20.976  46.590  37.484  1.00 29.15 ? 342 VAL A C     1 
ATOM   2406 O  O     . VAL A 1 311 ? 21.853  47.421  37.294  1.00 29.73 ? 342 VAL A O     1 
ATOM   2407 C  CB    . VAL A 1 311 ? 21.754  44.231  37.860  1.00 29.51 ? 342 VAL A CB    1 
ATOM   2408 C  CG1   . VAL A 1 311 ? 22.832  44.598  36.806  1.00 28.36 ? 342 VAL A CG1   1 
ATOM   2409 C  CG2   . VAL A 1 311 ? 22.334  43.315  38.938  1.00 27.94 ? 342 VAL A CG2   1 
ATOM   2410 N  N     . ILE A 1 312 ? 19.818  46.614  36.849  1.00 29.14 ? 343 ILE A N     1 
ATOM   2411 C  CA    . ILE A 1 312 ? 19.531  47.649  35.879  1.00 29.07 ? 343 ILE A CA    1 
ATOM   2412 C  C     . ILE A 1 312 ? 19.329  49.010  36.565  1.00 29.67 ? 343 ILE A C     1 
ATOM   2413 O  O     . ILE A 1 312 ? 19.815  50.025  36.072  1.00 29.61 ? 343 ILE A O     1 
ATOM   2414 C  CB    . ILE A 1 312 ? 18.327  47.274  35.031  1.00 29.24 ? 343 ILE A CB    1 
ATOM   2415 C  CG1   . ILE A 1 312 ? 18.609  45.970  34.275  1.00 28.57 ? 343 ILE A CG1   1 
ATOM   2416 C  CG2   . ILE A 1 312 ? 17.986  48.401  34.082  1.00 28.95 ? 343 ILE A CG2   1 
ATOM   2417 C  CD1   . ILE A 1 312 ? 17.472  45.512  33.381  1.00 28.61 ? 343 ILE A CD1   1 
ATOM   2418 N  N     . ILE A 1 313 ? 18.630  49.050  37.697  1.00 30.19 ? 344 ILE A N     1 
ATOM   2419 C  CA    . ILE A 1 313 ? 18.517  50.315  38.432  1.00 30.79 ? 344 ILE A CA    1 
ATOM   2420 C  C     . ILE A 1 313 ? 19.913  50.867  38.749  1.00 31.28 ? 344 ILE A C     1 
ATOM   2421 O  O     . ILE A 1 313 ? 20.184  52.031  38.461  1.00 31.57 ? 344 ILE A O     1 
ATOM   2422 C  CB    . ILE A 1 313 ? 17.721  50.178  39.774  1.00 31.23 ? 344 ILE A CB    1 
ATOM   2423 C  CG1   . ILE A 1 313 ? 16.242  49.832  39.520  1.00 31.49 ? 344 ILE A CG1   1 
ATOM   2424 C  CG2   . ILE A 1 313 ? 17.867  51.454  40.616  1.00 29.09 ? 344 ILE A CG2   1 
ATOM   2425 C  CD1   . ILE A 1 313 ? 15.507  50.869  38.721  1.00 33.07 ? 344 ILE A CD1   1 
ATOM   2426 N  N     . LYS A 1 314 ? 20.774  50.033  39.348  1.00 31.55 ? 345 LYS A N     1 
ATOM   2427 C  CA    . LYS A 1 314 ? 22.121  50.455  39.773  1.00 32.01 ? 345 LYS A CA    1 
ATOM   2428 C  C     . LYS A 1 314 ? 22.986  50.895  38.584  1.00 32.32 ? 345 LYS A C     1 
ATOM   2429 O  O     . LYS A 1 314 ? 23.811  51.796  38.711  1.00 31.83 ? 345 LYS A O     1 
ATOM   2430 C  CB    . LYS A 1 314 ? 22.837  49.350  40.573  1.00 31.85 ? 345 LYS A CB    1 
ATOM   2431 N  N     . ASN A 1 315 ? 22.780  50.280  37.424  1.00 32.85 ? 346 ASN A N     1 
ATOM   2432 C  CA    . ASN A 1 315 ? 23.571  50.632  36.241  1.00 33.53 ? 346 ASN A CA    1 
ATOM   2433 C  C     . ASN A 1 315 ? 23.054  51.826  35.404  1.00 34.20 ? 346 ASN A C     1 
ATOM   2434 O  O     . ASN A 1 315 ? 23.775  52.292  34.517  1.00 34.15 ? 346 ASN A O     1 
ATOM   2435 C  CB    . ASN A 1 315 ? 23.803  49.401  35.354  1.00 33.35 ? 346 ASN A CB    1 
ATOM   2436 C  CG    . ASN A 1 315 ? 24.856  48.466  35.932  1.00 34.24 ? 346 ASN A CG    1 
ATOM   2437 O  OD1   . ASN A 1 315 ? 25.528  48.807  36.906  1.00 37.02 ? 346 ASN A OD1   1 
ATOM   2438 N  ND2   . ASN A 1 315 ? 25.010  47.292  35.341  1.00 33.98 ? 346 ASN A ND2   1 
ATOM   2439 N  N     . ASN A 1 316 ? 21.847  52.334  35.696  1.00 34.85 ? 347 ASN A N     1 
ATOM   2440 C  CA    . ASN A 1 316 ? 21.259  53.469  34.934  1.00 35.24 ? 347 ASN A CA    1 
ATOM   2441 C  C     . ASN A 1 316 ? 20.613  54.483  35.858  1.00 36.19 ? 347 ASN A C     1 
ATOM   2442 O  O     . ASN A 1 316 ? 19.441  54.831  35.697  1.00 36.57 ? 347 ASN A O     1 
ATOM   2443 C  CB    . ASN A 1 316 ? 20.188  53.027  33.940  1.00 34.93 ? 347 ASN A CB    1 
ATOM   2444 C  CG    . ASN A 1 316 ? 20.717  52.113  32.892  1.00 34.03 ? 347 ASN A CG    1 
ATOM   2445 O  OD1   . ASN A 1 316 ? 21.120  52.550  31.806  1.00 30.39 ? 347 ASN A OD1   1 
ATOM   2446 N  ND2   . ASN A 1 316 ? 20.715  50.823  33.199  1.00 32.77 ? 347 ASN A ND2   1 
ATOM   2447 N  N     . LEU A 1 317 ? 21.401  54.981  36.801  1.00 36.96 ? 348 LEU A N     1 
ATOM   2448 C  CA    . LEU A 1 317 ? 20.897  55.543  38.029  1.00 37.61 ? 348 LEU A CA    1 
ATOM   2449 C  C     . LEU A 1 317 ? 21.155  57.001  38.218  1.00 37.82 ? 348 LEU A C     1 
ATOM   2450 O  O     . LEU A 1 317 ? 22.324  57.369  38.339  1.00 38.70 ? 348 LEU A O     1 
ATOM   2451 C  CB    . LEU A 1 317 ? 21.642  54.773  39.164  1.00 37.94 ? 348 LEU A CB    1 
ATOM   2452 C  CG    . LEU A 1 317 ? 21.458  55.052  40.655  1.00 39.36 ? 348 LEU A CG    1 
ATOM   2453 C  CD1   . LEU A 1 317 ? 20.298  54.222  41.211  1.00 41.05 ? 348 LEU A CD1   1 
ATOM   2454 C  CD2   . LEU A 1 317 ? 22.761  54.757  41.419  1.00 39.93 ? 348 LEU A CD2   1 
ATOM   2455 N  N     . ARG B 1 1   ? -11.668 9.313   67.845  1.00 36.04 ? 32  ARG B N     1 
ATOM   2456 C  CA    . ARG B 1 1   ? -12.910 8.688   68.401  1.00 36.17 ? 32  ARG B CA    1 
ATOM   2457 C  C     . ARG B 1 1   ? -14.133 9.071   67.553  1.00 35.89 ? 32  ARG B C     1 
ATOM   2458 O  O     . ARG B 1 1   ? -15.026 9.772   68.012  1.00 35.89 ? 32  ARG B O     1 
ATOM   2459 C  CB    . ARG B 1 1   ? -13.083 9.101   69.872  1.00 35.98 ? 32  ARG B CB    1 
ATOM   2460 N  N     . GLU B 1 2   ? -14.168 8.597   66.312  1.00 35.96 ? 33  GLU B N     1 
ATOM   2461 C  CA    . GLU B 1 2   ? -15.265 8.928   65.392  1.00 35.99 ? 33  GLU B CA    1 
ATOM   2462 C  C     . GLU B 1 2   ? -16.402 7.892   65.498  1.00 35.70 ? 33  GLU B C     1 
ATOM   2463 O  O     . GLU B 1 2   ? -16.190 6.765   65.968  1.00 35.99 ? 33  GLU B O     1 
ATOM   2464 C  CB    . GLU B 1 2   ? -14.736 9.095   63.971  1.00 35.86 ? 33  GLU B CB    1 
ATOM   2465 C  CG    . GLU B 1 2   ? -13.448 9.974   63.894  1.00 36.69 ? 33  GLU B CG    1 
ATOM   2466 C  CD    . GLU B 1 2   ? -13.135 10.503  62.479  1.00 37.16 ? 33  GLU B CD    1 
ATOM   2467 O  OE1   . GLU B 1 2   ? -13.957 10.286  61.553  1.00 39.31 ? 33  GLU B OE1   1 
ATOM   2468 O  OE2   . GLU B 1 2   ? -12.066 11.141  62.295  1.00 37.82 ? 33  GLU B OE2   1 
ATOM   2469 N  N     . VAL B 1 3   ? -17.614 8.312   65.141  1.00 34.90 ? 34  VAL B N     1 
ATOM   2470 C  CA    . VAL B 1 3   ? -18.777 7.457   65.168  1.00 34.42 ? 34  VAL B CA    1 
ATOM   2471 C  C     . VAL B 1 3   ? -19.536 7.646   63.867  1.00 34.35 ? 34  VAL B C     1 
ATOM   2472 O  O     . VAL B 1 3   ? -20.092 8.716   63.635  1.00 34.44 ? 34  VAL B O     1 
ATOM   2473 C  CB    . VAL B 1 3   ? -19.682 7.842   66.352  1.00 34.65 ? 34  VAL B CB    1 
ATOM   2474 C  CG1   . VAL B 1 3   ? -21.002 7.087   66.302  1.00 33.49 ? 34  VAL B CG1   1 
ATOM   2475 C  CG2   . VAL B 1 3   ? -18.953 7.608   67.675  1.00 34.20 ? 34  VAL B CG2   1 
ATOM   2476 N  N     . LYS B 1 4   ? -19.550 6.618   63.022  1.00 34.26 ? 35  LYS B N     1 
ATOM   2477 C  CA    . LYS B 1 4   ? -20.309 6.658   61.800  1.00 34.22 ? 35  LYS B CA    1 
ATOM   2478 C  C     . LYS B 1 4   ? -21.719 6.185   62.107  1.00 34.78 ? 35  LYS B C     1 
ATOM   2479 O  O     . LYS B 1 4   ? -21.932 5.034   62.513  1.00 34.52 ? 35  LYS B O     1 
ATOM   2480 C  CB    . LYS B 1 4   ? -19.673 5.789   60.730  1.00 34.25 ? 35  LYS B CB    1 
ATOM   2481 C  CG    . LYS B 1 4   ? -20.243 6.060   59.365  1.00 32.80 ? 35  LYS B CG    1 
ATOM   2482 C  CD    . LYS B 1 4   ? -19.429 5.437   58.282  1.00 30.81 ? 35  LYS B CD    1 
ATOM   2483 C  CE    . LYS B 1 4   ? -20.133 5.626   56.948  1.00 30.10 ? 35  LYS B CE    1 
ATOM   2484 N  NZ    . LYS B 1 4   ? -19.353 5.079   55.847  1.00 27.56 ? 35  LYS B NZ    1 
ATOM   2485 N  N     . LEU B 1 5   ? -22.674 7.092   61.891  1.00 35.64 ? 36  LEU B N     1 
ATOM   2486 C  CA    . LEU B 1 5   ? -24.095 6.872   62.176  1.00 35.85 ? 36  LEU B CA    1 
ATOM   2487 C  C     . LEU B 1 5   ? -24.914 6.980   60.893  1.00 35.66 ? 36  LEU B C     1 
ATOM   2488 O  O     . LEU B 1 5   ? -24.791 7.956   60.169  1.00 35.42 ? 36  LEU B O     1 
ATOM   2489 C  CB    . LEU B 1 5   ? -24.582 7.913   63.190  1.00 35.80 ? 36  LEU B CB    1 
ATOM   2490 C  CG    . LEU B 1 5   ? -26.072 7.938   63.581  1.00 37.03 ? 36  LEU B CG    1 
ATOM   2491 C  CD1   . LEU B 1 5   ? -26.486 6.659   64.303  1.00 36.60 ? 36  LEU B CD1   1 
ATOM   2492 C  CD2   . LEU B 1 5   ? -26.368 9.142   64.473  1.00 36.38 ? 36  LEU B CD2   1 
ATOM   2493 N  N     . LEU B 1 6   ? -25.745 5.977   60.629  1.00 35.71 ? 37  LEU B N     1 
ATOM   2494 C  CA    . LEU B 1 6   ? -26.690 6.012   59.517  1.00 35.60 ? 37  LEU B CA    1 
ATOM   2495 C  C     . LEU B 1 6   ? -28.115 6.183   60.019  1.00 36.16 ? 37  LEU B C     1 
ATOM   2496 O  O     . LEU B 1 6   ? -28.572 5.454   60.905  1.00 35.89 ? 37  LEU B O     1 
ATOM   2497 C  CB    . LEU B 1 6   ? -26.629 4.735   58.678  1.00 35.43 ? 37  LEU B CB    1 
ATOM   2498 C  CG    . LEU B 1 6   ? -25.621 4.576   57.551  1.00 34.60 ? 37  LEU B CG    1 
ATOM   2499 C  CD1   . LEU B 1 6   ? -24.340 5.347   57.780  1.00 33.68 ? 37  LEU B CD1   1 
ATOM   2500 C  CD2   . LEU B 1 6   ? -25.350 3.080   57.354  1.00 33.00 ? 37  LEU B CD2   1 
ATOM   2501 N  N     . LEU B 1 7   ? -28.823 7.149   59.438  1.00 36.42 ? 38  LEU B N     1 
ATOM   2502 C  CA    . LEU B 1 7   ? -30.245 7.236   59.635  1.00 36.90 ? 38  LEU B CA    1 
ATOM   2503 C  C     . LEU B 1 7   ? -30.884 6.558   58.448  1.00 36.51 ? 38  LEU B C     1 
ATOM   2504 O  O     . LEU B 1 7   ? -30.767 7.029   57.316  1.00 36.95 ? 38  LEU B O     1 
ATOM   2505 C  CB    . LEU B 1 7   ? -30.718 8.677   59.756  1.00 37.57 ? 38  LEU B CB    1 
ATOM   2506 C  CG    . LEU B 1 7   ? -30.651 9.277   61.159  1.00 38.25 ? 38  LEU B CG    1 
ATOM   2507 C  CD1   . LEU B 1 7   ? -29.290 9.033   61.775  1.00 38.93 ? 38  LEU B CD1   1 
ATOM   2508 C  CD2   . LEU B 1 7   ? -30.932 10.762  61.056  1.00 40.14 ? 38  LEU B CD2   1 
ATOM   2509 N  N     . LEU B 1 8   ? -31.530 5.431   58.717  1.00 35.91 ? 39  LEU B N     1 
ATOM   2510 C  CA    . LEU B 1 8   ? -32.178 4.621   57.707  1.00 35.43 ? 39  LEU B CA    1 
ATOM   2511 C  C     . LEU B 1 8   ? -33.638 4.388   58.056  1.00 35.37 ? 39  LEU B C     1 
ATOM   2512 O  O     . LEU B 1 8   ? -34.079 4.571   59.204  1.00 35.63 ? 39  LEU B O     1 
ATOM   2513 C  CB    . LEU B 1 8   ? -31.482 3.254   57.601  1.00 35.17 ? 39  LEU B CB    1 
ATOM   2514 C  CG    . LEU B 1 8   ? -30.005 3.195   57.163  1.00 35.22 ? 39  LEU B CG    1 
ATOM   2515 C  CD1   . LEU B 1 8   ? -29.549 1.738   57.090  1.00 32.74 ? 39  LEU B CD1   1 
ATOM   2516 C  CD2   . LEU B 1 8   ? -29.716 3.939   55.810  1.00 33.40 ? 39  LEU B CD2   1 
ATOM   2517 N  N     . GLY B 1 9   ? -34.388 3.961   57.048  1.00 35.03 ? 40  GLY B N     1 
ATOM   2518 C  CA    . GLY B 1 9   ? -35.812 3.699   57.202  1.00 34.62 ? 40  GLY B CA    1 
ATOM   2519 C  C     . GLY B 1 9   ? -36.498 4.008   55.905  1.00 33.74 ? 40  GLY B C     1 
ATOM   2520 O  O     . GLY B 1 9   ? -35.887 4.600   55.025  1.00 33.77 ? 40  GLY B O     1 
ATOM   2521 N  N     . ALA B 1 10  ? -37.751 3.579   55.761  1.00 33.56 ? 41  ALA B N     1 
ATOM   2522 C  CA    . ALA B 1 10  ? -38.523 3.852   54.528  1.00 33.42 ? 41  ALA B CA    1 
ATOM   2523 C  C     . ALA B 1 10  ? -38.868 5.325   54.427  1.00 33.45 ? 41  ALA B C     1 
ATOM   2524 O  O     . ALA B 1 10  ? -38.628 6.100   55.359  1.00 33.13 ? 41  ALA B O     1 
ATOM   2525 C  CB    . ALA B 1 10  ? -39.783 3.025   54.482  1.00 33.12 ? 41  ALA B CB    1 
ATOM   2526 N  N     . GLY B 1 11  ? -39.428 5.700   53.283  1.00 33.93 ? 42  GLY B N     1 
ATOM   2527 C  CA    . GLY B 1 11  ? -39.917 7.056   53.049  1.00 34.14 ? 42  GLY B CA    1 
ATOM   2528 C  C     . GLY B 1 11  ? -40.819 7.579   54.147  1.00 34.48 ? 42  GLY B C     1 
ATOM   2529 O  O     . GLY B 1 11  ? -41.651 6.860   54.651  1.00 34.74 ? 42  GLY B O     1 
ATOM   2530 N  N     . GLU B 1 12  ? -40.625 8.830   54.543  1.00 35.02 ? 43  GLU B N     1 
ATOM   2531 C  CA    . GLU B 1 12  ? -41.504 9.508   55.526  1.00 36.01 ? 43  GLU B CA    1 
ATOM   2532 C  C     . GLU B 1 12  ? -41.510 8.853   56.914  1.00 35.54 ? 43  GLU B C     1 
ATOM   2533 O  O     . GLU B 1 12  ? -42.511 8.939   57.624  1.00 36.02 ? 43  GLU B O     1 
ATOM   2534 C  CB    . GLU B 1 12  ? -42.973 9.610   55.054  1.00 35.49 ? 43  GLU B CB    1 
ATOM   2535 C  CG    . GLU B 1 12  ? -43.191 9.982   53.576  1.00 38.36 ? 43  GLU B CG    1 
ATOM   2536 C  CD    . GLU B 1 12  ? -44.574 10.630  53.299  1.00 38.39 ? 43  GLU B CD    1 
ATOM   2537 O  OE1   . GLU B 1 12  ? -45.619 10.089  53.736  1.00 39.61 ? 43  GLU B OE1   1 
ATOM   2538 O  OE2   . GLU B 1 12  ? -44.603 11.711  52.667  1.00 41.05 ? 43  GLU B OE2   1 
ATOM   2539 N  N     . SER B 1 13  ? -40.424 8.203   57.305  1.00 34.69 ? 44  SER B N     1 
ATOM   2540 C  CA    . SER B 1 13  ? -40.390 7.580   58.606  1.00 34.59 ? 44  SER B CA    1 
ATOM   2541 C  C     . SER B 1 13  ? -39.792 8.485   59.687  1.00 34.42 ? 44  SER B C     1 
ATOM   2542 O  O     . SER B 1 13  ? -39.888 8.163   60.866  1.00 34.73 ? 44  SER B O     1 
ATOM   2543 C  CB    . SER B 1 13  ? -39.623 6.253   58.542  1.00 34.80 ? 44  SER B CB    1 
ATOM   2544 O  OG    . SER B 1 13  ? -38.359 6.424   57.939  1.00 36.97 ? 44  SER B OG    1 
ATOM   2545 N  N     . GLY B 1 14  ? -39.167 9.594   59.297  1.00 34.13 ? 45  GLY B N     1 
ATOM   2546 C  CA    . GLY B 1 14  ? -38.716 10.605  60.252  1.00 34.15 ? 45  GLY B CA    1 
ATOM   2547 C  C     . GLY B 1 14  ? -37.217 10.846  60.355  1.00 34.17 ? 45  GLY B C     1 
ATOM   2548 O  O     . GLY B 1 14  ? -36.745 11.507  61.270  1.00 34.09 ? 45  GLY B O     1 
ATOM   2549 N  N     . LYS B 1 15  ? -36.473 10.340  59.385  1.00 34.42 ? 46  LYS B N     1 
ATOM   2550 C  CA    . LYS B 1 15  ? -35.027 10.399  59.397  1.00 34.17 ? 46  LYS B CA    1 
ATOM   2551 C  C     . LYS B 1 15  ? -34.543 11.847  59.432  1.00 33.72 ? 46  LYS B C     1 
ATOM   2552 O  O     . LYS B 1 15  ? -33.687 12.209  60.251  1.00 33.63 ? 46  LYS B O     1 
ATOM   2553 C  CB    . LYS B 1 15  ? -34.454 9.713   58.140  1.00 34.26 ? 46  LYS B CB    1 
ATOM   2554 C  CG    . LYS B 1 15  ? -34.725 8.214   58.039  1.00 34.75 ? 46  LYS B CG    1 
ATOM   2555 C  CD    . LYS B 1 15  ? -34.235 7.628   56.703  1.00 34.97 ? 46  LYS B CD    1 
ATOM   2556 C  CE    . LYS B 1 15  ? -35.089 8.037   55.508  1.00 35.18 ? 46  LYS B CE    1 
ATOM   2557 N  NZ    . LYS B 1 15  ? -36.492 7.687   55.740  1.00 36.78 ? 46  LYS B NZ    1 
ATOM   2558 N  N     . SER B 1 16  ? -35.074 12.669  58.535  1.00 33.04 ? 47  SER B N     1 
ATOM   2559 C  CA    . SER B 1 16  ? -34.623 14.056  58.458  1.00 32.73 ? 47  SER B CA    1 
ATOM   2560 C  C     . SER B 1 16  ? -35.067 14.871  59.676  1.00 32.54 ? 47  SER B C     1 
ATOM   2561 O  O     . SER B 1 16  ? -34.405 15.847  60.064  1.00 32.70 ? 47  SER B O     1 
ATOM   2562 C  CB    . SER B 1 16  ? -35.050 14.704  57.145  1.00 32.61 ? 47  SER B CB    1 
ATOM   2563 O  OG    . SER B 1 16  ? -34.227 14.219  56.091  1.00 30.95 ? 47  SER B OG    1 
ATOM   2564 N  N     . THR B 1 17  ? -36.162 14.461  60.298  1.00 32.00 ? 48  THR B N     1 
ATOM   2565 C  CA    . THR B 1 17  ? -36.628 15.140  61.491  1.00 31.61 ? 48  THR B CA    1 
ATOM   2566 C  C     . THR B 1 17  ? -35.634 14.904  62.633  1.00 31.70 ? 48  THR B C     1 
ATOM   2567 O  O     . THR B 1 17  ? -35.310 15.825  63.388  1.00 31.90 ? 48  THR B O     1 
ATOM   2568 C  CB    . THR B 1 17  ? -38.038 14.668  61.825  1.00 31.60 ? 48  THR B CB    1 
ATOM   2569 O  OG1   . THR B 1 17  ? -38.840 14.794  60.645  1.00 31.96 ? 48  THR B OG1   1 
ATOM   2570 C  CG2   . THR B 1 17  ? -38.655 15.473  62.969  1.00 29.68 ? 48  THR B CG2   1 
ATOM   2571 N  N     . ILE B 1 18  ? -35.127 13.681  62.750  1.00 31.30 ? 49  ILE B N     1 
ATOM   2572 C  CA    . ILE B 1 18  ? -34.096 13.390  63.745  1.00 30.74 ? 49  ILE B CA    1 
ATOM   2573 C  C     . ILE B 1 18  ? -32.860 14.213  63.423  1.00 30.74 ? 49  ILE B C     1 
ATOM   2574 O  O     . ILE B 1 18  ? -32.200 14.734  64.344  1.00 30.73 ? 49  ILE B O     1 
ATOM   2575 C  CB    . ILE B 1 18  ? -33.766 11.886  63.805  1.00 30.85 ? 49  ILE B CB    1 
ATOM   2576 C  CG1   . ILE B 1 18  ? -34.950 11.103  64.404  1.00 31.18 ? 49  ILE B CG1   1 
ATOM   2577 C  CG2   . ILE B 1 18  ? -32.511 11.609  64.603  1.00 29.74 ? 49  ILE B CG2   1 
ATOM   2578 C  CD1   . ILE B 1 18  ? -35.186 11.346  65.882  1.00 30.03 ? 49  ILE B CD1   1 
ATOM   2579 N  N     . VAL B 1 19  ? -32.547 14.360  62.128  1.00 30.09 ? 50  VAL B N     1 
ATOM   2580 C  CA    . VAL B 1 19  ? -31.376 15.157  61.740  1.00 29.34 ? 50  VAL B CA    1 
ATOM   2581 C  C     . VAL B 1 19  ? -31.546 16.573  62.242  1.00 29.08 ? 50  VAL B C     1 
ATOM   2582 O  O     . VAL B 1 19  ? -30.624 17.136  62.809  1.00 28.51 ? 50  VAL B O     1 
ATOM   2583 C  CB    . VAL B 1 19  ? -31.104 15.144  60.209  1.00 29.58 ? 50  VAL B CB    1 
ATOM   2584 C  CG1   . VAL B 1 19  ? -30.064 16.225  59.815  1.00 27.29 ? 50  VAL B CG1   1 
ATOM   2585 C  CG2   . VAL B 1 19  ? -30.626 13.745  59.769  1.00 28.83 ? 50  VAL B CG2   1 
ATOM   2586 N  N     . LYS B 1 20  ? -32.748 17.120  62.057  1.00 29.27 ? 51  LYS B N     1 
ATOM   2587 C  CA    . LYS B 1 20  ? -33.091 18.458  62.559  1.00 29.27 ? 51  LYS B CA    1 
ATOM   2588 C  C     . LYS B 1 20  ? -32.925 18.549  64.078  1.00 28.93 ? 51  LYS B C     1 
ATOM   2589 O  O     . LYS B 1 20  ? -32.335 19.495  64.573  1.00 28.11 ? 51  LYS B O     1 
ATOM   2590 C  CB    . LYS B 1 20  ? -34.494 18.895  62.102  1.00 29.06 ? 51  LYS B CB    1 
ATOM   2591 C  CG    . LYS B 1 20  ? -34.535 19.361  60.653  1.00 29.58 ? 51  LYS B CG    1 
ATOM   2592 C  CD    . LYS B 1 20  ? -35.954 19.736  60.094  1.00 30.45 ? 51  LYS B CD    1 
ATOM   2593 C  CE    . LYS B 1 20  ? -36.082 19.252  58.592  1.00 31.92 ? 51  LYS B CE    1 
ATOM   2594 N  NZ    . LYS B 1 20  ? -37.259 19.754  57.770  1.00 31.95 ? 51  LYS B NZ    1 
ATOM   2595 N  N     . GLN B 1 21  ? -33.366 17.524  64.800  1.00 29.35 ? 52  GLN B N     1 
ATOM   2596 C  CA    . GLN B 1 21  ? -33.170 17.474  66.254  1.00 29.61 ? 52  GLN B CA    1 
ATOM   2597 C  C     . GLN B 1 21  ? -31.693 17.454  66.675  1.00 29.95 ? 52  GLN B C     1 
ATOM   2598 O  O     . GLN B 1 21  ? -31.339 18.075  67.687  1.00 30.03 ? 52  GLN B O     1 
ATOM   2599 C  CB    . GLN B 1 21  ? -33.917 16.296  66.869  1.00 29.36 ? 52  GLN B CB    1 
ATOM   2600 C  CG    . GLN B 1 21  ? -35.461 16.369  66.690  1.00 29.91 ? 52  GLN B CG    1 
ATOM   2601 C  CD    . GLN B 1 21  ? -36.173 17.364  67.617  1.00 29.51 ? 52  GLN B CD    1 
ATOM   2602 O  OE1   . GLN B 1 21  ? -35.572 18.279  68.177  1.00 28.39 ? 52  GLN B OE1   1 
ATOM   2603 N  NE2   . GLN B 1 21  ? -37.471 17.165  67.785  1.00 29.86 ? 52  GLN B NE2   1 
ATOM   2604 N  N     . MET B 1 22  ? -30.837 16.780  65.913  1.00 30.08 ? 53  MET B N     1 
ATOM   2605 C  CA    . MET B 1 22  ? -29.402 16.814  66.191  1.00 30.66 ? 53  MET B CA    1 
ATOM   2606 C  C     . MET B 1 22  ? -28.837 18.248  66.062  1.00 30.95 ? 53  MET B C     1 
ATOM   2607 O  O     . MET B 1 22  ? -27.989 18.638  66.863  1.00 30.76 ? 53  MET B O     1 
ATOM   2608 C  CB    . MET B 1 22  ? -28.603 15.832  65.311  1.00 30.66 ? 53  MET B CB    1 
ATOM   2609 C  CG    . MET B 1 22  ? -28.970 14.357  65.502  1.00 30.87 ? 53  MET B CG    1 
ATOM   2610 S  SD    . MET B 1 22  ? -28.922 13.756  67.207  1.00 33.74 ? 53  MET B SD    1 
ATOM   2611 C  CE    . MET B 1 22  ? -30.591 13.081  67.334  1.00 31.14 ? 53  MET B CE    1 
ATOM   2612 N  N     . LYS B 1 23  ? -29.291 19.027  65.080  1.00 31.26 ? 54  LYS B N     1 
ATOM   2613 C  CA    . LYS B 1 23  ? -28.854 20.434  64.999  1.00 31.93 ? 54  LYS B CA    1 
ATOM   2614 C  C     . LYS B 1 23  ? -29.296 21.195  66.245  1.00 32.09 ? 54  LYS B C     1 
ATOM   2615 O  O     . LYS B 1 23  ? -28.503 21.938  66.831  1.00 32.36 ? 54  LYS B O     1 
ATOM   2616 C  CB    . LYS B 1 23  ? -29.360 21.180  63.748  1.00 31.87 ? 54  LYS B CB    1 
ATOM   2617 N  N     . ILE B 1 24  ? -30.543 20.997  66.657  1.00 32.18 ? 55  ILE B N     1 
ATOM   2618 C  CA    . ILE B 1 24  ? -31.084 21.718  67.808  1.00 32.43 ? 55  ILE B CA    1 
ATOM   2619 C  C     . ILE B 1 24  ? -30.344 21.370  69.106  1.00 32.65 ? 55  ILE B C     1 
ATOM   2620 O  O     . ILE B 1 24  ? -29.900 22.256  69.817  1.00 32.80 ? 55  ILE B O     1 
ATOM   2621 C  CB    . ILE B 1 24  ? -32.607 21.461  67.999  1.00 32.89 ? 55  ILE B CB    1 
ATOM   2622 C  CG1   . ILE B 1 24  ? -33.406 21.953  66.780  1.00 32.68 ? 55  ILE B CG1   1 
ATOM   2623 C  CG2   . ILE B 1 24  ? -33.125 22.128  69.302  1.00 31.57 ? 55  ILE B CG2   1 
ATOM   2624 C  CD1   . ILE B 1 24  ? -34.872 21.506  66.778  1.00 32.01 ? 55  ILE B CD1   1 
ATOM   2625 N  N     . ILE B 1 25  ? -30.205 20.080  69.400  1.00 33.18 ? 56  ILE B N     1 
ATOM   2626 C  CA    . ILE B 1 25  ? -29.711 19.627  70.704  1.00 32.88 ? 56  ILE B CA    1 
ATOM   2627 C  C     . ILE B 1 25  ? -28.209 19.828  70.794  1.00 33.95 ? 56  ILE B C     1 
ATOM   2628 O  O     . ILE B 1 25  ? -27.708 20.284  71.817  1.00 33.62 ? 56  ILE B O     1 
ATOM   2629 C  CB    . ILE B 1 25  ? -30.073 18.131  70.993  1.00 33.02 ? 56  ILE B CB    1 
ATOM   2630 C  CG1   . ILE B 1 25  ? -31.589 17.885  70.852  1.00 32.36 ? 56  ILE B CG1   1 
ATOM   2631 C  CG2   . ILE B 1 25  ? -29.634 17.715  72.408  1.00 31.75 ? 56  ILE B CG2   1 
ATOM   2632 C  CD1   . ILE B 1 25  ? -31.978 16.441  70.743  1.00 31.08 ? 56  ILE B CD1   1 
ATOM   2633 N  N     . HIS B 1 26  ? -27.494 19.511  69.719  1.00 35.20 ? 57  HIS B N     1 
ATOM   2634 C  CA    . HIS B 1 26  ? -26.027 19.497  69.751  1.00 36.14 ? 57  HIS B CA    1 
ATOM   2635 C  C     . HIS B 1 26  ? -25.338 20.721  69.156  1.00 37.01 ? 57  HIS B C     1 
ATOM   2636 O  O     . HIS B 1 26  ? -24.250 21.081  69.587  1.00 36.73 ? 57  HIS B O     1 
ATOM   2637 C  CB    . HIS B 1 26  ? -25.540 18.205  69.111  1.00 36.13 ? 57  HIS B CB    1 
ATOM   2638 C  CG    . HIS B 1 26  ? -26.075 16.988  69.796  1.00 36.34 ? 57  HIS B CG    1 
ATOM   2639 N  ND1   . HIS B 1 26  ? -26.757 15.990  69.130  1.00 36.89 ? 57  HIS B ND1   1 
ATOM   2640 C  CD2   . HIS B 1 26  ? -26.074 16.638  71.107  1.00 35.77 ? 57  HIS B CD2   1 
ATOM   2641 C  CE1   . HIS B 1 26  ? -27.133 15.065  70.001  1.00 36.81 ? 57  HIS B CE1   1 
ATOM   2642 N  NE2   . HIS B 1 26  ? -26.734 15.437  71.206  1.00 36.54 ? 57  HIS B NE2   1 
ATOM   2643 N  N     . GLU B 1 27  ? -25.964 21.362  68.179  1.00 38.51 ? 58  GLU B N     1 
ATOM   2644 C  CA    . GLU B 1 27  ? -25.376 22.555  67.561  1.00 39.69 ? 58  GLU B CA    1 
ATOM   2645 C  C     . GLU B 1 27  ? -26.241 23.784  67.802  1.00 40.47 ? 58  GLU B C     1 
ATOM   2646 O  O     . GLU B 1 27  ? -26.275 24.686  66.976  1.00 41.16 ? 58  GLU B O     1 
ATOM   2647 C  CB    . GLU B 1 27  ? -25.118 22.320  66.060  1.00 40.07 ? 58  GLU B CB    1 
ATOM   2648 C  CG    . GLU B 1 27  ? -24.138 21.136  65.750  1.00 40.84 ? 58  GLU B CG    1 
ATOM   2649 C  CD    . GLU B 1 27  ? -22.729 21.339  66.331  1.00 42.25 ? 58  GLU B CD    1 
ATOM   2650 O  OE1   . GLU B 1 27  ? -22.339 22.509  66.586  1.00 42.96 ? 58  GLU B OE1   1 
ATOM   2651 O  OE2   . GLU B 1 27  ? -22.009 20.328  66.531  1.00 42.77 ? 58  GLU B OE2   1 
ATOM   2652 N  N     . ALA B 1 28  ? -26.960 23.801  68.923  1.00 41.18 ? 59  ALA B N     1 
ATOM   2653 C  CA    . ALA B 1 28  ? -27.592 25.020  69.426  1.00 41.83 ? 59  ALA B CA    1 
ATOM   2654 C  C     . ALA B 1 28  ? -28.686 25.671  68.548  1.00 42.29 ? 59  ALA B C     1 
ATOM   2655 O  O     . ALA B 1 28  ? -28.521 26.808  68.097  1.00 42.45 ? 59  ALA B O     1 
ATOM   2656 C  CB    . ALA B 1 28  ? -26.492 26.076  69.744  1.00 42.22 ? 59  ALA B CB    1 
ATOM   2657 N  N     . GLY B 1 29  ? -29.797 24.969  68.327  1.00 42.56 ? 60  GLY B N     1 
ATOM   2658 C  CA    . GLY B 1 29  ? -31.066 25.624  67.963  1.00 42.79 ? 60  GLY B CA    1 
ATOM   2659 C  C     . GLY B 1 29  ? -31.172 26.240  66.572  1.00 43.06 ? 60  GLY B C     1 
ATOM   2660 O  O     . GLY B 1 29  ? -30.221 26.200  65.781  1.00 43.72 ? 60  GLY B O     1 
ATOM   2661 N  N     . TYR B 1 30  ? -32.362 26.776  66.282  1.00 42.67 ? 61  TYR B N     1 
ATOM   2662 C  CA    . TYR B 1 30  ? -32.667 27.484  65.044  1.00 42.23 ? 61  TYR B CA    1 
ATOM   2663 C  C     . TYR B 1 30  ? -32.894 28.935  65.399  1.00 42.03 ? 61  TYR B C     1 
ATOM   2664 O  O     . TYR B 1 30  ? -33.700 29.239  66.276  1.00 42.19 ? 61  TYR B O     1 
ATOM   2665 C  CB    . TYR B 1 30  ? -33.945 26.937  64.398  1.00 42.48 ? 61  TYR B CB    1 
ATOM   2666 C  CG    . TYR B 1 30  ? -33.734 25.729  63.510  1.00 42.51 ? 61  TYR B CG    1 
ATOM   2667 C  CD1   . TYR B 1 30  ? -34.070 24.463  63.936  1.00 41.88 ? 61  TYR B CD1   1 
ATOM   2668 C  CD2   . TYR B 1 30  ? -33.198 25.867  62.236  1.00 42.82 ? 61  TYR B CD2   1 
ATOM   2669 C  CE1   . TYR B 1 30  ? -33.864 23.365  63.124  1.00 42.93 ? 61  TYR B CE1   1 
ATOM   2670 C  CE2   . TYR B 1 30  ? -32.993 24.772  61.419  1.00 42.40 ? 61  TYR B CE2   1 
ATOM   2671 C  CZ    . TYR B 1 30  ? -33.324 23.528  61.865  1.00 42.44 ? 61  TYR B CZ    1 
ATOM   2672 O  OH    . TYR B 1 30  ? -33.124 22.443  61.054  1.00 42.56 ? 61  TYR B OH    1 
ATOM   2673 N  N     . SER B 1 31  ? -32.193 29.831  64.718  1.00 41.84 ? 62  SER B N     1 
ATOM   2674 C  CA    . SER B 1 31  ? -32.314 31.258  64.988  1.00 41.68 ? 62  SER B CA    1 
ATOM   2675 C  C     . SER B 1 31  ? -33.588 31.811  64.362  1.00 41.55 ? 62  SER B C     1 
ATOM   2676 O  O     . SER B 1 31  ? -34.271 31.111  63.611  1.00 41.20 ? 62  SER B O     1 
ATOM   2677 C  CB    . SER B 1 31  ? -31.122 32.013  64.406  1.00 41.69 ? 62  SER B CB    1 
ATOM   2678 O  OG    . SER B 1 31  ? -31.310 32.217  63.015  1.00 41.67 ? 62  SER B OG    1 
ATOM   2679 N  N     . GLU B 1 32  ? -33.887 33.078  64.661  1.00 41.39 ? 63  GLU B N     1 
ATOM   2680 C  CA    . GLU B 1 32  ? -35.040 33.745  64.054  1.00 41.40 ? 63  GLU B CA    1 
ATOM   2681 C  C     . GLU B 1 32  ? -34.867 33.795  62.532  1.00 41.22 ? 63  GLU B C     1 
ATOM   2682 O  O     . GLU B 1 32  ? -35.809 33.513  61.787  1.00 41.30 ? 63  GLU B O     1 
ATOM   2683 C  CB    . GLU B 1 32  ? -35.239 35.171  64.598  1.00 41.49 ? 63  GLU B CB    1 
ATOM   2684 C  CG    . GLU B 1 32  ? -36.613 35.787  64.256  1.00 41.55 ? 63  GLU B CG    1 
ATOM   2685 C  CD    . GLU B 1 32  ? -36.617 37.311  64.275  1.00 41.87 ? 63  GLU B CD    1 
ATOM   2686 O  OE1   . GLU B 1 32  ? -37.251 37.888  65.181  1.00 42.60 ? 63  GLU B OE1   1 
ATOM   2687 O  OE2   . GLU B 1 32  ? -35.994 37.940  63.387  1.00 42.33 ? 63  GLU B OE2   1 
ATOM   2688 N  N     . GLU B 1 33  ? -33.667 34.147  62.071  1.00 40.90 ? 64  GLU B N     1 
ATOM   2689 C  CA    . GLU B 1 33  ? -33.431 34.291  60.629  1.00 40.84 ? 64  GLU B CA    1 
ATOM   2690 C  C     . GLU B 1 33  ? -33.507 32.956  59.921  1.00 40.07 ? 64  GLU B C     1 
ATOM   2691 O  O     . GLU B 1 33  ? -33.980 32.897  58.799  1.00 40.42 ? 64  GLU B O     1 
ATOM   2692 C  CB    . GLU B 1 33  ? -32.086 34.980  60.314  1.00 41.09 ? 64  GLU B CB    1 
ATOM   2693 C  CG    . GLU B 1 33  ? -31.996 35.488  58.857  1.00 41.72 ? 64  GLU B CG    1 
ATOM   2694 C  CD    . GLU B 1 33  ? -30.743 36.319  58.573  1.00 42.22 ? 64  GLU B CD    1 
ATOM   2695 O  OE1   . GLU B 1 33  ? -30.024 35.998  57.599  1.00 44.02 ? 64  GLU B OE1   1 
ATOM   2696 O  OE2   . GLU B 1 33  ? -30.470 37.296  59.314  1.00 44.04 ? 64  GLU B OE2   1 
ATOM   2697 N  N     . GLU B 1 34  ? -33.056 31.886  60.574  1.00 39.54 ? 65  GLU B N     1 
ATOM   2698 C  CA    . GLU B 1 34  ? -33.123 30.546  59.981  1.00 38.96 ? 65  GLU B CA    1 
ATOM   2699 C  C     . GLU B 1 34  ? -34.564 30.050  59.915  1.00 38.60 ? 65  GLU B C     1 
ATOM   2700 O  O     . GLU B 1 34  ? -34.959 29.438  58.933  1.00 38.93 ? 65  GLU B O     1 
ATOM   2701 C  CB    . GLU B 1 34  ? -32.241 29.559  60.751  1.00 39.03 ? 65  GLU B CB    1 
ATOM   2702 N  N     . CYS B 1 35  ? -35.343 30.325  60.955  1.00 38.17 ? 66  CYS B N     1 
ATOM   2703 C  CA    . CYS B 1 35  ? -36.769 29.990  60.982  1.00 37.77 ? 66  CYS B CA    1 
ATOM   2704 C  C     . CYS B 1 35  ? -37.584 30.687  59.911  1.00 37.58 ? 66  CYS B C     1 
ATOM   2705 O  O     . CYS B 1 35  ? -38.522 30.112  59.381  1.00 37.91 ? 66  CYS B O     1 
ATOM   2706 C  CB    . CYS B 1 35  ? -37.365 30.361  62.325  1.00 37.82 ? 66  CYS B CB    1 
ATOM   2707 S  SG    . CYS B 1 35  ? -36.804 29.303  63.596  1.00 37.23 ? 66  CYS B SG    1 
ATOM   2708 N  N     . LYS B 1 36  ? -37.248 31.937  59.617  1.00 37.25 ? 67  LYS B N     1 
ATOM   2709 C  CA    . LYS B 1 36  ? -37.983 32.694  58.615  1.00 36.95 ? 67  LYS B CA    1 
ATOM   2710 C  C     . LYS B 1 36  ? -37.838 32.027  57.241  1.00 36.72 ? 67  LYS B C     1 
ATOM   2711 O  O     . LYS B 1 36  ? -38.733 32.110  56.402  1.00 36.60 ? 67  LYS B O     1 
ATOM   2712 C  CB    . LYS B 1 36  ? -37.477 34.132  58.558  1.00 36.96 ? 67  LYS B CB    1 
ATOM   2713 C  CG    . LYS B 1 36  ? -37.709 34.927  59.831  1.00 37.48 ? 67  LYS B CG    1 
ATOM   2714 N  N     . GLN B 1 37  ? -36.710 31.355  57.019  1.00 36.34 ? 68  GLN B N     1 
ATOM   2715 C  CA    . GLN B 1 37  ? -36.452 30.691  55.735  1.00 36.12 ? 68  GLN B CA    1 
ATOM   2716 C  C     . GLN B 1 37  ? -37.333 29.467  55.522  1.00 35.71 ? 68  GLN B C     1 
ATOM   2717 O  O     . GLN B 1 37  ? -37.445 28.971  54.412  1.00 35.89 ? 68  GLN B O     1 
ATOM   2718 C  CB    . GLN B 1 37  ? -34.972 30.303  55.589  1.00 36.23 ? 68  GLN B CB    1 
ATOM   2719 C  CG    . GLN B 1 37  ? -34.018 31.515  55.475  1.00 36.03 ? 68  GLN B CG    1 
ATOM   2720 N  N     . TYR B 1 38  ? -37.972 28.976  56.576  1.00 35.10 ? 69  TYR B N     1 
ATOM   2721 C  CA    . TYR B 1 38  ? -38.910 27.857  56.423  1.00 34.52 ? 69  TYR B CA    1 
ATOM   2722 C  C     . TYR B 1 38  ? -40.365 28.314  56.221  1.00 33.52 ? 69  TYR B C     1 
ATOM   2723 O  O     . TYR B 1 38  ? -41.235 27.495  55.959  1.00 33.32 ? 69  TYR B O     1 
ATOM   2724 C  CB    . TYR B 1 38  ? -38.816 26.882  57.609  1.00 34.90 ? 69  TYR B CB    1 
ATOM   2725 C  CG    . TYR B 1 38  ? -37.636 25.944  57.554  1.00 35.27 ? 69  TYR B CG    1 
ATOM   2726 C  CD1   . TYR B 1 38  ? -36.415 26.297  58.117  1.00 35.34 ? 69  TYR B CD1   1 
ATOM   2727 C  CD2   . TYR B 1 38  ? -37.743 24.685  56.955  1.00 35.75 ? 69  TYR B CD2   1 
ATOM   2728 C  CE1   . TYR B 1 38  ? -35.326 25.427  58.065  1.00 35.13 ? 69  TYR B CE1   1 
ATOM   2729 C  CE2   . TYR B 1 38  ? -36.661 23.812  56.909  1.00 34.38 ? 69  TYR B CE2   1 
ATOM   2730 C  CZ    . TYR B 1 38  ? -35.458 24.193  57.454  1.00 34.98 ? 69  TYR B CZ    1 
ATOM   2731 O  OH    . TYR B 1 38  ? -34.376 23.333  57.409  1.00 36.51 ? 69  TYR B OH    1 
ATOM   2732 N  N     . LYS B 1 39  ? -40.628 29.607  56.354  1.00 32.59 ? 70  LYS B N     1 
ATOM   2733 C  CA    . LYS B 1 39  ? -41.950 30.159  56.074  1.00 32.22 ? 70  LYS B CA    1 
ATOM   2734 C  C     . LYS B 1 39  ? -42.522 29.531  54.784  1.00 31.63 ? 70  LYS B C     1 
ATOM   2735 O  O     . LYS B 1 39  ? -43.551 28.834  54.805  1.00 31.90 ? 70  LYS B O     1 
ATOM   2736 C  CB    . LYS B 1 39  ? -41.803 31.673  55.950  1.00 32.52 ? 70  LYS B CB    1 
ATOM   2737 C  CG    . LYS B 1 39  ? -43.060 32.480  55.698  1.00 33.72 ? 70  LYS B CG    1 
ATOM   2738 C  CD    . LYS B 1 39  ? -43.014 33.787  56.507  1.00 34.65 ? 70  LYS B CD    1 
ATOM   2739 C  CE    . LYS B 1 39  ? -43.485 35.014  55.726  1.00 36.43 ? 70  LYS B CE    1 
ATOM   2740 N  NZ    . LYS B 1 39  ? -42.341 35.763  55.134  1.00 35.64 ? 70  LYS B NZ    1 
ATOM   2741 N  N     . ALA B 1 40  ? -41.819 29.738  53.678  1.00 30.66 ? 71  ALA B N     1 
ATOM   2742 C  CA    . ALA B 1 40  ? -42.224 29.215  52.360  1.00 30.12 ? 71  ALA B CA    1 
ATOM   2743 C  C     . ALA B 1 40  ? -42.541 27.720  52.356  1.00 29.91 ? 71  ALA B C     1 
ATOM   2744 O  O     . ALA B 1 40  ? -43.443 27.269  51.655  1.00 29.63 ? 71  ALA B O     1 
ATOM   2745 C  CB    . ALA B 1 40  ? -41.148 29.498  51.314  1.00 29.48 ? 71  ALA B CB    1 
ATOM   2746 N  N     . VAL B 1 41  ? -41.803 26.947  53.140  1.00 29.66 ? 72  VAL B N     1 
ATOM   2747 C  CA    . VAL B 1 41  ? -42.057 25.520  53.202  1.00 29.35 ? 72  VAL B CA    1 
ATOM   2748 C  C     . VAL B 1 41  ? -43.339 25.192  53.971  1.00 29.44 ? 72  VAL B C     1 
ATOM   2749 O  O     . VAL B 1 41  ? -44.093 24.311  53.565  1.00 29.88 ? 72  VAL B O     1 
ATOM   2750 C  CB    . VAL B 1 41  ? -40.884 24.729  53.798  1.00 29.41 ? 72  VAL B CB    1 
ATOM   2751 C  CG1   . VAL B 1 41  ? -41.241 23.231  53.835  1.00 28.83 ? 72  VAL B CG1   1 
ATOM   2752 C  CG2   . VAL B 1 41  ? -39.623 24.957  52.983  1.00 28.93 ? 72  VAL B CG2   1 
ATOM   2753 N  N     . VAL B 1 42  ? -43.586 25.880  55.077  1.00 29.52 ? 73  VAL B N     1 
ATOM   2754 C  CA    . VAL B 1 42  ? -44.837 25.689  55.798  1.00 29.57 ? 73  VAL B CA    1 
ATOM   2755 C  C     . VAL B 1 42  ? -46.024 26.026  54.888  1.00 29.60 ? 73  VAL B C     1 
ATOM   2756 O  O     . VAL B 1 42  ? -46.993 25.266  54.831  1.00 29.18 ? 73  VAL B O     1 
ATOM   2757 C  CB    . VAL B 1 42  ? -44.898 26.497  57.102  1.00 29.66 ? 73  VAL B CB    1 
ATOM   2758 C  CG1   . VAL B 1 42  ? -46.353 26.589  57.625  1.00 29.96 ? 73  VAL B CG1   1 
ATOM   2759 C  CG2   . VAL B 1 42  ? -43.983 25.857  58.139  1.00 29.27 ? 73  VAL B CG2   1 
ATOM   2760 N  N     . TYR B 1 43  ? -45.956 27.156  54.186  1.00 29.74 ? 74  TYR B N     1 
ATOM   2761 C  CA    . TYR B 1 43  ? -47.054 27.519  53.288  1.00 30.21 ? 74  TYR B CA    1 
ATOM   2762 C  C     . TYR B 1 43  ? -47.225 26.460  52.202  1.00 30.19 ? 74  TYR B C     1 
ATOM   2763 O  O     . TYR B 1 43  ? -48.345 26.009  51.905  1.00 30.12 ? 74  TYR B O     1 
ATOM   2764 C  CB    . TYR B 1 43  ? -46.865 28.895  52.627  1.00 30.57 ? 74  TYR B CB    1 
ATOM   2765 C  CG    . TYR B 1 43  ? -46.962 30.092  53.563  1.00 30.93 ? 74  TYR B CG    1 
ATOM   2766 C  CD1   . TYR B 1 43  ? -47.598 30.005  54.805  1.00 32.28 ? 74  TYR B CD1   1 
ATOM   2767 C  CD2   . TYR B 1 43  ? -46.427 31.309  53.200  1.00 30.47 ? 74  TYR B CD2   1 
ATOM   2768 C  CE1   . TYR B 1 43  ? -47.673 31.096  55.652  1.00 31.45 ? 74  TYR B CE1   1 
ATOM   2769 C  CE2   . TYR B 1 43  ? -46.502 32.401  54.044  1.00 31.51 ? 74  TYR B CE2   1 
ATOM   2770 C  CZ    . TYR B 1 43  ? -47.125 32.284  55.259  1.00 31.12 ? 74  TYR B CZ    1 
ATOM   2771 O  OH    . TYR B 1 43  ? -47.197 33.366  56.085  1.00 31.78 ? 74  TYR B OH    1 
ATOM   2772 N  N     . SER B 1 44  ? -46.110 26.076  51.598  1.00 30.24 ? 75  SER B N     1 
ATOM   2773 C  CA    . SER B 1 44  ? -46.124 25.048  50.565  1.00 29.96 ? 75  SER B CA    1 
ATOM   2774 C  C     . SER B 1 44  ? -46.723 23.722  51.088  1.00 30.05 ? 75  SER B C     1 
ATOM   2775 O  O     . SER B 1 44  ? -47.507 23.070  50.389  1.00 29.97 ? 75  SER B O     1 
ATOM   2776 C  CB    . SER B 1 44  ? -44.703 24.843  50.068  1.00 29.68 ? 75  SER B CB    1 
ATOM   2777 O  OG    . SER B 1 44  ? -44.629 23.804  49.136  1.00 29.86 ? 75  SER B OG    1 
ATOM   2778 N  N     . ASN B 1 45  ? -46.343 23.335  52.307  1.00 29.92 ? 76  ASN B N     1 
ATOM   2779 C  CA    . ASN B 1 45  ? -46.897 22.152  52.971  1.00 30.17 ? 76  ASN B CA    1 
ATOM   2780 C  C     . ASN B 1 45  ? -48.413 22.273  53.196  1.00 30.65 ? 76  ASN B C     1 
ATOM   2781 O  O     . ASN B 1 45  ? -49.172 21.347  52.875  1.00 31.15 ? 76  ASN B O     1 
ATOM   2782 C  CB    . ASN B 1 45  ? -46.206 21.894  54.335  1.00 30.18 ? 76  ASN B CB    1 
ATOM   2783 C  CG    . ASN B 1 45  ? -44.836 21.133  54.227  1.00 29.71 ? 76  ASN B CG    1 
ATOM   2784 O  OD1   . ASN B 1 45  ? -44.200 20.871  55.246  1.00 27.34 ? 76  ASN B OD1   1 
ATOM   2785 N  ND2   . ASN B 1 45  ? -44.404 20.799  53.021  1.00 26.72 ? 76  ASN B ND2   1 
ATOM   2786 N  N     . THR B 1 46  ? -48.846 23.397  53.772  1.00 30.70 ? 77  THR B N     1 
ATOM   2787 C  CA    . THR B 1 46  ? -50.248 23.641  54.047  1.00 30.51 ? 77  THR B CA    1 
ATOM   2788 C  C     . THR B 1 46  ? -51.053 23.592  52.747  1.00 31.13 ? 77  THR B C     1 
ATOM   2789 O  O     . THR B 1 46  ? -52.048 22.884  52.641  1.00 31.08 ? 77  THR B O     1 
ATOM   2790 C  CB    . THR B 1 46  ? -50.415 25.013  54.651  1.00 30.90 ? 77  THR B CB    1 
ATOM   2791 O  OG1   . THR B 1 46  ? -49.639 25.108  55.864  1.00 30.52 ? 77  THR B OG1   1 
ATOM   2792 C  CG2   . THR B 1 46  ? -51.892 25.303  54.903  1.00 29.43 ? 77  THR B CG2   1 
ATOM   2793 N  N     . ILE B 1 47  ? -50.604 24.348  51.754  1.00 31.38 ? 78  ILE B N     1 
ATOM   2794 C  CA    . ILE B 1 47  ? -51.298 24.442  50.487  1.00 31.56 ? 78  ILE B CA    1 
ATOM   2795 C  C     . ILE B 1 47  ? -51.401 23.093  49.780  1.00 31.92 ? 78  ILE B C     1 
ATOM   2796 O  O     . ILE B 1 47  ? -52.484 22.691  49.348  1.00 32.16 ? 78  ILE B O     1 
ATOM   2797 C  CB    . ILE B 1 47  ? -50.591 25.399  49.523  1.00 31.76 ? 78  ILE B CB    1 
ATOM   2798 C  CG1   . ILE B 1 47  ? -50.819 26.844  49.947  1.00 31.19 ? 78  ILE B CG1   1 
ATOM   2799 C  CG2   . ILE B 1 47  ? -51.102 25.213  48.074  1.00 31.61 ? 78  ILE B CG2   1 
ATOM   2800 C  CD1   . ILE B 1 47  ? -49.936 27.808  49.207  1.00 29.85 ? 78  ILE B CD1   1 
ATOM   2801 N  N     . GLN B 1 48  ? -50.278 22.390  49.657  1.00 32.00 ? 79  GLN B N     1 
ATOM   2802 C  CA    . GLN B 1 48  ? -50.285 21.050  49.039  1.00 31.39 ? 79  GLN B CA    1 
ATOM   2803 C  C     . GLN B 1 48  ? -51.142 20.043  49.832  1.00 31.44 ? 79  GLN B C     1 
ATOM   2804 O  O     . GLN B 1 48  ? -51.702 19.105  49.261  1.00 31.49 ? 79  GLN B O     1 
ATOM   2805 C  CB    . GLN B 1 48  ? -48.869 20.511  48.890  1.00 30.76 ? 79  GLN B CB    1 
ATOM   2806 N  N     . SER B 1 49  ? -51.254 20.236  51.145  1.00 31.44 ? 80  SER B N     1 
ATOM   2807 C  CA    . SER B 1 49  ? -52.094 19.362  51.964  1.00 31.47 ? 80  SER B CA    1 
ATOM   2808 C  C     . SER B 1 49  ? -53.604 19.529  51.730  1.00 31.11 ? 80  SER B C     1 
ATOM   2809 O  O     . SER B 1 49  ? -54.300 18.540  51.539  1.00 31.09 ? 80  SER B O     1 
ATOM   2810 C  CB    . SER B 1 49  ? -51.788 19.527  53.446  1.00 31.28 ? 80  SER B CB    1 
ATOM   2811 O  OG    . SER B 1 49  ? -50.705 18.704  53.793  1.00 32.97 ? 80  SER B OG    1 
ATOM   2812 N  N     . ILE B 1 50  ? -54.119 20.751  51.777  1.00 30.52 ? 81  ILE B N     1 
ATOM   2813 C  CA    . ILE B 1 50  ? -55.541 20.936  51.515  1.00 30.33 ? 81  ILE B CA    1 
ATOM   2814 C  C     . ILE B 1 50  ? -55.878 20.539  50.073  1.00 30.47 ? 81  ILE B C     1 
ATOM   2815 O  O     . ILE B 1 50  ? -56.934 19.967  49.826  1.00 30.13 ? 81  ILE B O     1 
ATOM   2816 C  CB    . ILE B 1 50  ? -56.041 22.352  51.831  1.00 29.89 ? 81  ILE B CB    1 
ATOM   2817 C  CG1   . ILE B 1 50  ? -57.576 22.368  51.796  1.00 29.75 ? 81  ILE B CG1   1 
ATOM   2818 C  CG2   . ILE B 1 50  ? -55.420 23.369  50.903  1.00 28.58 ? 81  ILE B CG2   1 
ATOM   2819 C  CD1   . ILE B 1 50  ? -58.236 21.473  52.828  1.00 26.33 ? 81  ILE B CD1   1 
ATOM   2820 N  N     . ILE B 1 51  ? -54.975 20.819  49.137  1.00 30.65 ? 82  ILE B N     1 
ATOM   2821 C  CA    . ILE B 1 51  ? -55.171 20.392  47.752  1.00 30.99 ? 82  ILE B CA    1 
ATOM   2822 C  C     . ILE B 1 51  ? -55.354 18.885  47.661  1.00 31.34 ? 82  ILE B C     1 
ATOM   2823 O  O     . ILE B 1 51  ? -56.263 18.395  46.997  1.00 32.10 ? 82  ILE B O     1 
ATOM   2824 C  CB    . ILE B 1 51  ? -54.012 20.802  46.819  1.00 30.86 ? 82  ILE B CB    1 
ATOM   2825 C  CG1   . ILE B 1 51  ? -54.190 22.260  46.374  1.00 30.13 ? 82  ILE B CG1   1 
ATOM   2826 C  CG2   . ILE B 1 51  ? -53.952 19.894  45.586  1.00 30.37 ? 82  ILE B CG2   1 
ATOM   2827 C  CD1   . ILE B 1 51  ? -53.152 22.715  45.374  1.00 29.51 ? 82  ILE B CD1   1 
ATOM   2828 N  N     . ALA B 1 52  ? -54.493 18.138  48.327  1.00 31.53 ? 83  ALA B N     1 
ATOM   2829 C  CA    . ALA B 1 52  ? -54.607 16.664  48.315  1.00 31.47 ? 83  ALA B CA    1 
ATOM   2830 C  C     . ALA B 1 52  ? -55.944 16.163  48.891  1.00 31.73 ? 83  ALA B C     1 
ATOM   2831 O  O     . ALA B 1 52  ? -56.527 15.219  48.377  1.00 32.10 ? 83  ALA B O     1 
ATOM   2832 C  CB    . ALA B 1 52  ? -53.476 16.029  49.051  1.00 31.25 ? 83  ALA B CB    1 
ATOM   2833 N  N     . ILE B 1 53  ? -56.433 16.801  49.947  1.00 31.81 ? 84  ILE B N     1 
ATOM   2834 C  CA    . ILE B 1 53  ? -57.733 16.442  50.514  1.00 32.04 ? 84  ILE B CA    1 
ATOM   2835 C  C     . ILE B 1 53  ? -58.874 16.745  49.534  1.00 31.85 ? 84  ILE B C     1 
ATOM   2836 O  O     . ILE B 1 53  ? -59.795 15.942  49.394  1.00 31.85 ? 84  ILE B O     1 
ATOM   2837 C  CB    . ILE B 1 53  ? -58.029 17.208  51.855  1.00 32.32 ? 84  ILE B CB    1 
ATOM   2838 C  CG1   . ILE B 1 53  ? -56.957 16.927  52.911  1.00 32.41 ? 84  ILE B CG1   1 
ATOM   2839 C  CG2   . ILE B 1 53  ? -59.409 16.815  52.440  1.00 32.16 ? 84  ILE B CG2   1 
ATOM   2840 C  CD1   . ILE B 1 53  ? -57.084 17.821  54.149  1.00 32.29 ? 84  ILE B CD1   1 
ATOM   2841 N  N     . ILE B 1 54  ? -58.816 17.892  48.866  1.00 31.34 ? 85  ILE B N     1 
ATOM   2842 C  CA    . ILE B 1 54  ? -59.842 18.237  47.889  1.00 31.52 ? 85  ILE B CA    1 
ATOM   2843 C  C     . ILE B 1 54  ? -59.826 17.353  46.634  1.00 31.38 ? 85  ILE B C     1 
ATOM   2844 O  O     . ILE B 1 54  ? -60.890 16.986  46.116  1.00 30.81 ? 85  ILE B O     1 
ATOM   2845 C  CB    . ILE B 1 54  ? -59.733 19.699  47.480  1.00 31.75 ? 85  ILE B CB    1 
ATOM   2846 C  CG1   . ILE B 1 54  ? -60.196 20.555  48.657  1.00 32.32 ? 85  ILE B CG1   1 
ATOM   2847 C  CG2   . ILE B 1 54  ? -60.570 19.971  46.227  1.00 30.11 ? 85  ILE B CG2   1 
ATOM   2848 C  CD1   . ILE B 1 54  ? -59.756 21.933  48.539  1.00 35.01 ? 85  ILE B CD1   1 
ATOM   2849 N  N     . ARG B 1 55  ? -58.633 17.035  46.133  1.00 31.17 ? 86  ARG B N     1 
ATOM   2850 C  CA    . ARG B 1 55  ? -58.536 16.136  44.980  1.00 31.14 ? 86  ARG B CA    1 
ATOM   2851 C  C     . ARG B 1 55  ? -59.124 14.788  45.323  1.00 30.73 ? 86  ARG B C     1 
ATOM   2852 O  O     . ARG B 1 55  ? -59.854 14.205  44.525  1.00 30.43 ? 86  ARG B O     1 
ATOM   2853 C  CB    . ARG B 1 55  ? -57.099 15.925  44.534  1.00 31.27 ? 86  ARG B CB    1 
ATOM   2854 C  CG    . ARG B 1 55  ? -56.590 17.013  43.665  1.00 32.05 ? 86  ARG B CG    1 
ATOM   2855 C  CD    . ARG B 1 55  ? -55.172 16.759  43.333  1.00 33.84 ? 86  ARG B CD    1 
ATOM   2856 N  NE    . ARG B 1 55  ? -54.668 17.789  42.442  1.00 35.32 ? 86  ARG B NE    1 
ATOM   2857 C  CZ    . ARG B 1 55  ? -53.385 18.137  42.370  1.00 38.17 ? 86  ARG B CZ    1 
ATOM   2858 N  NH1   . ARG B 1 55  ? -52.470 17.570  43.166  1.00 38.43 ? 86  ARG B NH1   1 
ATOM   2859 N  NH2   . ARG B 1 55  ? -53.009 19.084  41.518  1.00 37.86 ? 86  ARG B NH2   1 
ATOM   2860 N  N     . ALA B 1 56  ? -58.806 14.298  46.521  1.00 30.45 ? 87  ALA B N     1 
ATOM   2861 C  CA    . ALA B 1 56  ? -59.353 13.024  46.992  1.00 30.35 ? 87  ALA B CA    1 
ATOM   2862 C  C     . ALA B 1 56  ? -60.888 13.007  46.984  1.00 30.63 ? 87  ALA B C     1 
ATOM   2863 O  O     . ALA B 1 56  ? -61.493 12.000  46.605  1.00 30.20 ? 87  ALA B O     1 
ATOM   2864 C  CB    . ALA B 1 56  ? -58.838 12.668  48.361  1.00 29.98 ? 87  ALA B CB    1 
ATOM   2865 N  N     . MET B 1 57  ? -61.512 14.120  47.369  1.00 31.02 ? 88  MET B N     1 
ATOM   2866 C  CA    . MET B 1 57  ? -62.970 14.213  47.345  1.00 31.66 ? 88  MET B CA    1 
ATOM   2867 C  C     . MET B 1 57  ? -63.551 13.909  45.968  1.00 32.56 ? 88  MET B C     1 
ATOM   2868 O  O     . MET B 1 57  ? -64.552 13.191  45.865  1.00 32.19 ? 88  MET B O     1 
ATOM   2869 C  CB    . MET B 1 57  ? -63.476 15.582  47.841  1.00 31.78 ? 88  MET B CB    1 
ATOM   2870 C  CG    . MET B 1 57  ? -63.214 15.812  49.322  1.00 31.72 ? 88  MET B CG    1 
ATOM   2871 S  SD    . MET B 1 57  ? -63.825 17.388  49.933  1.00 31.40 ? 88  MET B SD    1 
ATOM   2872 C  CE    . MET B 1 57  ? -65.579 17.054  50.028  1.00 28.95 ? 88  MET B CE    1 
ATOM   2873 N  N     . GLY B 1 58  ? -62.944 14.458  44.913  1.00 33.67 ? 89  GLY B N     1 
ATOM   2874 C  CA    . GLY B 1 58  ? -63.406 14.189  43.549  1.00 33.97 ? 89  GLY B CA    1 
ATOM   2875 C  C     . GLY B 1 58  ? -63.253 12.709  43.223  1.00 34.65 ? 89  GLY B C     1 
ATOM   2876 O  O     . GLY B 1 58  ? -64.178 12.086  42.695  1.00 35.18 ? 89  GLY B O     1 
ATOM   2877 N  N     . ARG B 1 59  ? -62.091 12.145  43.554  1.00 35.26 ? 90  ARG B N     1 
ATOM   2878 C  CA    . ARG B 1 59  ? -61.799 10.725  43.298  1.00 35.85 ? 90  ARG B CA    1 
ATOM   2879 C  C     . ARG B 1 59  ? -62.699 9.776   44.081  1.00 35.43 ? 90  ARG B C     1 
ATOM   2880 O  O     . ARG B 1 59  ? -63.185 8.800   43.535  1.00 35.36 ? 90  ARG B O     1 
ATOM   2881 C  CB    . ARG B 1 59  ? -60.355 10.393  43.719  1.00 36.50 ? 90  ARG B CB    1 
ATOM   2882 C  CG    . ARG B 1 59  ? -59.356 10.308  42.589  1.00 38.80 ? 90  ARG B CG    1 
ATOM   2883 C  CD    . ARG B 1 59  ? -58.134 9.451   42.969  1.00 41.26 ? 90  ARG B CD    1 
ATOM   2884 N  NE    . ARG B 1 59  ? -58.470 8.180   43.642  1.00 42.48 ? 90  ARG B NE    1 
ATOM   2885 C  CZ    . ARG B 1 59  ? -58.180 7.866   44.914  1.00 43.51 ? 90  ARG B CZ    1 
ATOM   2886 N  NH1   . ARG B 1 59  ? -57.546 8.718   45.727  1.00 44.58 ? 90  ARG B NH1   1 
ATOM   2887 N  NH2   . ARG B 1 59  ? -58.531 6.677   45.391  1.00 42.78 ? 90  ARG B NH2   1 
ATOM   2888 N  N     . LEU B 1 60  ? -62.859 10.044  45.380  1.00 35.21 ? 91  LEU B N     1 
ATOM   2889 C  CA    . LEU B 1 60  ? -63.677 9.199   46.276  1.00 34.97 ? 91  LEU B CA    1 
ATOM   2890 C  C     . LEU B 1 60  ? -65.161 9.608   46.262  1.00 35.18 ? 91  LEU B C     1 
ATOM   2891 O  O     . LEU B 1 60  ? -65.956 9.055   47.031  1.00 34.96 ? 91  LEU B O     1 
ATOM   2892 C  CB    . LEU B 1 60  ? -63.208 9.255   47.752  1.00 34.97 ? 91  LEU B CB    1 
ATOM   2893 C  CG    . LEU B 1 60  ? -61.775 8.958   48.249  1.00 34.81 ? 91  LEU B CG    1 
ATOM   2894 C  CD1   . LEU B 1 60  ? -61.642 9.335   49.710  1.00 31.66 ? 91  LEU B CD1   1 
ATOM   2895 C  CD2   . LEU B 1 60  ? -61.333 7.493   48.035  1.00 33.38 ? 91  LEU B CD2   1 
ATOM   2896 N  N     . LYS B 1 61  ? -65.525 10.589  45.425  1.00 35.50 ? 92  LYS B N     1 
ATOM   2897 C  CA    . LYS B 1 61  ? -66.904 11.100  45.338  1.00 35.47 ? 92  LYS B CA    1 
ATOM   2898 C  C     . LYS B 1 61  ? -67.520 11.478  46.724  1.00 35.27 ? 92  LYS B C     1 
ATOM   2899 O  O     . LYS B 1 61  ? -68.600 11.003  47.085  1.00 35.12 ? 92  LYS B O     1 
ATOM   2900 C  CB    . LYS B 1 61  ? -67.804 10.085  44.607  1.00 35.80 ? 92  LYS B CB    1 
ATOM   2901 C  CG    . LYS B 1 61  ? -67.192 9.442   43.342  1.00 36.91 ? 92  LYS B CG    1 
ATOM   2902 N  N     . ILE B 1 62  ? -66.835 12.335  47.489  1.00 35.15 ? 93  ILE B N     1 
ATOM   2903 C  CA    . ILE B 1 62  ? -67.390 12.845  48.758  1.00 34.77 ? 93  ILE B CA    1 
ATOM   2904 C  C     . ILE B 1 62  ? -67.915 14.243  48.559  1.00 34.91 ? 93  ILE B C     1 
ATOM   2905 O  O     . ILE B 1 62  ? -67.213 15.107  48.054  1.00 35.17 ? 93  ILE B O     1 
ATOM   2906 C  CB    . ILE B 1 62  ? -66.378 12.940  49.929  1.00 34.89 ? 93  ILE B CB    1 
ATOM   2907 C  CG1   . ILE B 1 62  ? -65.689 11.603  50.197  1.00 34.85 ? 93  ILE B CG1   1 
ATOM   2908 C  CG2   . ILE B 1 62  ? -67.099 13.395  51.224  1.00 33.99 ? 93  ILE B CG2   1 
ATOM   2909 C  CD1   . ILE B 1 62  ? -64.836 11.580  51.492  1.00 34.28 ? 93  ILE B CD1   1 
ATOM   2910 N  N     . ASP B 1 63  ? -69.152 14.467  48.969  1.00 35.04 ? 94  ASP B N     1 
ATOM   2911 C  CA    . ASP B 1 63  ? -69.771 15.777  48.847  1.00 35.10 ? 94  ASP B CA    1 
ATOM   2912 C  C     . ASP B 1 63  ? -69.221 16.766  49.860  1.00 34.70 ? 94  ASP B C     1 
ATOM   2913 O  O     . ASP B 1 63  ? -68.770 16.393  50.958  1.00 34.88 ? 94  ASP B O     1 
ATOM   2914 C  CB    . ASP B 1 63  ? -71.279 15.675  49.081  1.00 35.25 ? 94  ASP B CB    1 
ATOM   2915 C  CG    . ASP B 1 63  ? -71.991 14.927  47.989  1.00 36.02 ? 94  ASP B CG    1 
ATOM   2916 O  OD1   . ASP B 1 63  ? -71.304 14.464  47.041  1.00 37.38 ? 94  ASP B OD1   1 
ATOM   2917 O  OD2   . ASP B 1 63  ? -73.236 14.813  48.091  1.00 35.86 ? 94  ASP B OD2   1 
ATOM   2918 N  N     . PHE B 1 64  ? -69.277 18.038  49.491  1.00 34.12 ? 95  PHE B N     1 
ATOM   2919 C  CA    . PHE B 1 64  ? -69.057 19.086  50.454  1.00 33.70 ? 95  PHE B CA    1 
ATOM   2920 C  C     . PHE B 1 64  ? -70.240 19.121  51.405  1.00 33.34 ? 95  PHE B C     1 
ATOM   2921 O  O     . PHE B 1 64  ? -71.353 18.745  51.035  1.00 32.80 ? 95  PHE B O     1 
ATOM   2922 C  CB    . PHE B 1 64  ? -68.901 20.432  49.765  1.00 33.68 ? 95  PHE B CB    1 
ATOM   2923 C  CG    . PHE B 1 64  ? -67.566 20.624  49.165  1.00 33.13 ? 95  PHE B CG    1 
ATOM   2924 C  CD1   . PHE B 1 64  ? -66.446 20.675  49.967  1.00 34.05 ? 95  PHE B CD1   1 
ATOM   2925 C  CD2   . PHE B 1 64  ? -67.419 20.754  47.807  1.00 33.04 ? 95  PHE B CD2   1 
ATOM   2926 C  CE1   . PHE B 1 64  ? -65.191 20.849  49.420  1.00 34.40 ? 95  PHE B CE1   1 
ATOM   2927 C  CE2   . PHE B 1 64  ? -66.183 20.932  47.259  1.00 33.91 ? 95  PHE B CE2   1 
ATOM   2928 C  CZ    . PHE B 1 64  ? -65.059 20.968  48.065  1.00 34.25 ? 95  PHE B CZ    1 
ATOM   2929 N  N     . GLY B 1 65  ? -69.985 19.566  52.631  1.00 32.88 ? 96  GLY B N     1 
ATOM   2930 C  CA    . GLY B 1 65  ? -71.043 19.822  53.596  1.00 32.78 ? 96  GLY B CA    1 
ATOM   2931 C  C     . GLY B 1 65  ? -71.969 20.930  53.135  1.00 32.61 ? 96  GLY B C     1 
ATOM   2932 O  O     . GLY B 1 65  ? -73.183 20.813  53.256  1.00 32.67 ? 96  GLY B O     1 
ATOM   2933 N  N     . ASP B 1 66  ? -71.373 21.997  52.600  1.00 32.47 ? 97  ASP B N     1 
ATOM   2934 C  CA    . ASP B 1 66  ? -72.091 23.140  52.031  1.00 32.12 ? 97  ASP B CA    1 
ATOM   2935 C  C     . ASP B 1 66  ? -71.542 23.421  50.639  1.00 31.68 ? 97  ASP B C     1 
ATOM   2936 O  O     . ASP B 1 66  ? -70.345 23.645  50.502  1.00 31.68 ? 97  ASP B O     1 
ATOM   2937 C  CB    . ASP B 1 66  ? -71.922 24.383  52.931  1.00 32.01 ? 97  ASP B CB    1 
ATOM   2938 C  CG    . ASP B 1 66  ? -72.826 25.547  52.507  1.00 32.28 ? 97  ASP B CG    1 
ATOM   2939 O  OD1   . ASP B 1 66  ? -72.969 25.800  51.285  1.00 32.84 ? 97  ASP B OD1   1 
ATOM   2940 O  OD2   . ASP B 1 66  ? -73.400 26.213  53.393  1.00 32.61 ? 97  ASP B OD2   1 
ATOM   2941 N  N     . SER B 1 67  ? -72.423 23.446  49.635  1.00 31.17 ? 98  SER B N     1 
ATOM   2942 C  CA    . SER B 1 67  ? -72.035 23.541  48.216  1.00 30.94 ? 98  SER B CA    1 
ATOM   2943 C  C     . SER B 1 67  ? -71.378 24.865  47.808  1.00 30.74 ? 98  SER B C     1 
ATOM   2944 O  O     . SER B 1 67  ? -70.817 24.966  46.715  1.00 31.01 ? 98  SER B O     1 
ATOM   2945 C  CB    . SER B 1 67  ? -73.259 23.275  47.336  1.00 30.81 ? 98  SER B CB    1 
ATOM   2946 O  OG    . SER B 1 67  ? -74.353 24.074  47.741  1.00 30.71 ? 98  SER B OG    1 
ATOM   2947 N  N     . ALA B 1 68  ? -71.463 25.880  48.669  1.00 30.55 ? 99  ALA B N     1 
ATOM   2948 C  CA    . ALA B 1 68  ? -70.722 27.150  48.484  1.00 30.16 ? 99  ALA B CA    1 
ATOM   2949 C  C     . ALA B 1 68  ? -69.212 26.935  48.484  1.00 29.77 ? 99  ALA B C     1 
ATOM   2950 O  O     . ALA B 1 68  ? -68.460 27.761  47.967  1.00 29.87 ? 99  ALA B O     1 
ATOM   2951 C  CB    . ALA B 1 68  ? -71.094 28.152  49.589  1.00 29.58 ? 99  ALA B CB    1 
ATOM   2952 N  N     . ARG B 1 69  ? -68.778 25.832  49.079  1.00 29.43 ? 100 ARG B N     1 
ATOM   2953 C  CA    . ARG B 1 69  ? -67.374 25.483  49.101  1.00 29.41 ? 100 ARG B CA    1 
ATOM   2954 C  C     . ARG B 1 69  ? -66.837 25.120  47.722  1.00 29.45 ? 100 ARG B C     1 
ATOM   2955 O  O     . ARG B 1 69  ? -65.623 25.113  47.526  1.00 29.92 ? 100 ARG B O     1 
ATOM   2956 C  CB    . ARG B 1 69  ? -67.132 24.315  50.055  1.00 29.07 ? 100 ARG B CB    1 
ATOM   2957 C  CG    . ARG B 1 69  ? -67.517 24.575  51.510  1.00 29.07 ? 100 ARG B CG    1 
ATOM   2958 C  CD    . ARG B 1 69  ? -66.591 25.566  52.227  1.00 28.21 ? 100 ARG B CD    1 
ATOM   2959 N  NE    . ARG B 1 69  ? -66.983 26.955  51.992  1.00 28.09 ? 100 ARG B NE    1 
ATOM   2960 C  CZ    . ARG B 1 69  ? -68.038 27.551  52.542  1.00 27.40 ? 100 ARG B CZ    1 
ATOM   2961 N  NH1   . ARG B 1 69  ? -68.851 26.885  53.351  1.00 27.39 ? 100 ARG B NH1   1 
ATOM   2962 N  NH2   . ARG B 1 69  ? -68.302 28.820  52.253  1.00 28.03 ? 100 ARG B NH2   1 
ATOM   2963 N  N     . ALA B 1 70  ? -67.705 24.782  46.773  1.00 29.59 ? 101 ALA B N     1 
ATOM   2964 C  CA    . ALA B 1 70  ? -67.222 24.426  45.431  1.00 29.81 ? 101 ALA B CA    1 
ATOM   2965 C  C     . ALA B 1 70  ? -66.464 25.620  44.843  1.00 29.75 ? 101 ALA B C     1 
ATOM   2966 O  O     . ALA B 1 70  ? -65.379 25.471  44.320  1.00 29.49 ? 101 ALA B O     1 
ATOM   2967 C  CB    . ALA B 1 70  ? -68.353 23.960  44.521  1.00 29.25 ? 101 ALA B CB    1 
ATOM   2968 N  N     . ASP B 1 71  ? -67.011 26.813  45.008  1.00 30.03 ? 102 ASP B N     1 
ATOM   2969 C  CA    . ASP B 1 71  ? -66.323 28.018  44.570  1.00 30.38 ? 102 ASP B CA    1 
ATOM   2970 C  C     . ASP B 1 71  ? -64.978 28.229  45.270  1.00 30.18 ? 102 ASP B C     1 
ATOM   2971 O  O     . ASP B 1 71  ? -63.997 28.614  44.641  1.00 29.73 ? 102 ASP B O     1 
ATOM   2972 C  CB    . ASP B 1 71  ? -67.219 29.231  44.820  1.00 30.78 ? 102 ASP B CB    1 
ATOM   2973 C  CG    . ASP B 1 71  ? -66.739 30.469  44.085  1.00 32.33 ? 102 ASP B CG    1 
ATOM   2974 O  OD1   . ASP B 1 71  ? -66.680 31.562  44.711  1.00 31.07 ? 102 ASP B OD1   1 
ATOM   2975 O  OD2   . ASP B 1 71  ? -66.404 30.322  42.877  1.00 34.70 ? 102 ASP B OD2   1 
ATOM   2976 N  N     . ASP B 1 72  ? -64.949 27.988  46.578  1.00 30.24 ? 103 ASP B N     1 
ATOM   2977 C  CA    . ASP B 1 72  ? -63.714 28.052  47.349  1.00 29.98 ? 103 ASP B CA    1 
ATOM   2978 C  C     . ASP B 1 72  ? -62.673 27.076  46.795  1.00 30.04 ? 103 ASP B C     1 
ATOM   2979 O  O     . ASP B 1 72  ? -61.489 27.416  46.674  1.00 30.13 ? 103 ASP B O     1 
ATOM   2980 C  CB    . ASP B 1 72  ? -63.988 27.724  48.822  1.00 30.43 ? 103 ASP B CB    1 
ATOM   2981 C  CG    . ASP B 1 72  ? -64.684 28.850  49.569  1.00 30.42 ? 103 ASP B CG    1 
ATOM   2982 O  OD1   . ASP B 1 72  ? -64.937 29.903  48.964  1.00 33.25 ? 103 ASP B OD1   1 
ATOM   2983 O  OD2   . ASP B 1 72  ? -64.971 28.691  50.775  1.00 29.60 ? 103 ASP B OD2   1 
ATOM   2984 N  N     . ALA B 1 73  ? -63.114 25.876  46.427  1.00 30.02 ? 104 ALA B N     1 
ATOM   2985 C  CA    . ALA B 1 73  ? -62.192 24.854  45.904  1.00 29.90 ? 104 ALA B CA    1 
ATOM   2986 C  C     . ALA B 1 73  ? -61.605 25.248  44.553  1.00 29.74 ? 104 ALA B C     1 
ATOM   2987 O  O     . ALA B 1 73  ? -60.430 25.003  44.300  1.00 29.26 ? 104 ALA B O     1 
ATOM   2988 C  CB    . ALA B 1 73  ? -62.885 23.491  45.799  1.00 30.03 ? 104 ALA B CB    1 
ATOM   2989 N  N     . ARG B 1 74  ? -62.401 25.860  43.677  1.00 29.77 ? 105 ARG B N     1 
ATOM   2990 C  CA    . ARG B 1 74  ? -61.808 26.295  42.401  1.00 30.42 ? 105 ARG B CA    1 
ATOM   2991 C  C     . ARG B 1 74  ? -60.858 27.466  42.640  1.00 30.15 ? 105 ARG B C     1 
ATOM   2992 O  O     . ARG B 1 74  ? -59.754 27.504  42.116  1.00 29.79 ? 105 ARG B O     1 
ATOM   2993 C  CB    . ARG B 1 74  ? -62.794 26.560  41.264  1.00 30.38 ? 105 ARG B CB    1 
ATOM   2994 C  CG    . ARG B 1 74  ? -64.137 26.929  41.654  1.00 32.09 ? 105 ARG B CG    1 
ATOM   2995 C  CD    . ARG B 1 74  ? -64.854 27.576  40.507  1.00 33.19 ? 105 ARG B CD    1 
ATOM   2996 N  NE    . ARG B 1 74  ? -66.115 28.154  40.967  1.00 32.90 ? 105 ARG B NE    1 
ATOM   2997 C  CZ    . ARG B 1 74  ? -67.233 27.457  41.154  1.00 32.48 ? 105 ARG B CZ    1 
ATOM   2998 N  NH1   . ARG B 1 74  ? -67.257 26.155  40.936  1.00 31.41 ? 105 ARG B NH1   1 
ATOM   2999 N  NH2   . ARG B 1 74  ? -68.339 28.074  41.564  1.00 33.84 ? 105 ARG B NH2   1 
ATOM   3000 N  N     . GLN B 1 75  ? -61.266 28.377  43.501  1.00 30.29 ? 106 GLN B N     1 
ATOM   3001 C  CA    . GLN B 1 75  ? -60.399 29.460  43.925  1.00 30.49 ? 106 GLN B CA    1 
ATOM   3002 C  C     . GLN B 1 75  ? -59.071 28.921  44.494  1.00 30.08 ? 106 GLN B C     1 
ATOM   3003 O  O     . GLN B 1 75  ? -57.988 29.407  44.151  1.00 29.42 ? 106 GLN B O     1 
ATOM   3004 C  CB    . GLN B 1 75  ? -61.149 30.320  44.936  1.00 30.65 ? 106 GLN B CB    1 
ATOM   3005 C  CG    . GLN B 1 75  ? -60.856 31.803  44.852  1.00 32.47 ? 106 GLN B CG    1 
ATOM   3006 C  CD    . GLN B 1 75  ? -61.096 32.424  43.467  1.00 33.42 ? 106 GLN B CD    1 
ATOM   3007 O  OE1   . GLN B 1 75  ? -61.697 31.820  42.570  1.00 32.84 ? 106 GLN B OE1   1 
ATOM   3008 N  NE2   . GLN B 1 75  ? -60.610 33.648  43.303  1.00 33.85 ? 106 GLN B NE2   1 
ATOM   3009 N  N     . LEU B 1 76  ? -59.148 27.885  45.327  1.00 30.08 ? 107 LEU B N     1 
ATOM   3010 C  CA    . LEU B 1 76  ? -57.926 27.249  45.845  1.00 29.75 ? 107 LEU B CA    1 
ATOM   3011 C  C     . LEU B 1 76  ? -56.964 26.908  44.728  1.00 29.93 ? 107 LEU B C     1 
ATOM   3012 O  O     . LEU B 1 76  ? -55.787 27.251  44.817  1.00 30.21 ? 107 LEU B O     1 
ATOM   3013 C  CB    . LEU B 1 76  ? -58.234 25.986  46.632  1.00 29.46 ? 107 LEU B CB    1 
ATOM   3014 C  CG    . LEU B 1 76  ? -56.983 25.287  47.187  1.00 29.50 ? 107 LEU B CG    1 
ATOM   3015 C  CD1   . LEU B 1 76  ? -56.337 26.096  48.275  1.00 29.46 ? 107 LEU B CD1   1 
ATOM   3016 C  CD2   . LEU B 1 76  ? -57.326 23.926  47.718  1.00 28.54 ? 107 LEU B CD2   1 
ATOM   3017 N  N     . PHE B 1 77  ? -57.460 26.247  43.675  1.00 29.92 ? 108 PHE B N     1 
ATOM   3018 C  CA    . PHE B 1 77  ? -56.589 25.827  42.568  1.00 29.89 ? 108 PHE B CA    1 
ATOM   3019 C  C     . PHE B 1 77  ? -56.069 27.018  41.779  1.00 29.93 ? 108 PHE B C     1 
ATOM   3020 O  O     . PHE B 1 77  ? -54.925 27.027  41.375  1.00 30.68 ? 108 PHE B O     1 
ATOM   3021 C  CB    . PHE B 1 77  ? -57.262 24.791  41.647  1.00 30.05 ? 108 PHE B CB    1 
ATOM   3022 C  CG    . PHE B 1 77  ? -57.370 23.419  42.278  1.00 30.57 ? 108 PHE B CG    1 
ATOM   3023 C  CD1   . PHE B 1 77  ? -56.277 22.572  42.318  1.00 30.55 ? 108 PHE B CD1   1 
ATOM   3024 C  CD2   . PHE B 1 77  ? -58.552 23.010  42.891  1.00 31.00 ? 108 PHE B CD2   1 
ATOM   3025 C  CE1   . PHE B 1 77  ? -56.365 21.338  42.943  1.00 31.35 ? 108 PHE B CE1   1 
ATOM   3026 C  CE2   . PHE B 1 77  ? -58.646 21.774  43.524  1.00 30.63 ? 108 PHE B CE2   1 
ATOM   3027 C  CZ    . PHE B 1 77  ? -57.558 20.935  43.550  1.00 30.24 ? 108 PHE B CZ    1 
ATOM   3028 N  N     . VAL B 1 78  ? -56.898 28.033  41.577  1.00 30.01 ? 109 VAL B N     1 
ATOM   3029 C  CA    . VAL B 1 78  ? -56.505 29.211  40.817  1.00 29.85 ? 109 VAL B CA    1 
ATOM   3030 C  C     . VAL B 1 78  ? -55.463 30.030  41.555  1.00 30.26 ? 109 VAL B C     1 
ATOM   3031 O  O     . VAL B 1 78  ? -54.479 30.484  40.975  1.00 30.08 ? 109 VAL B O     1 
ATOM   3032 C  CB    . VAL B 1 78  ? -57.725 30.165  40.608  1.00 30.11 ? 109 VAL B CB    1 
ATOM   3033 C  CG1   . VAL B 1 78  ? -57.325 31.432  39.813  1.00 29.17 ? 109 VAL B CG1   1 
ATOM   3034 C  CG2   . VAL B 1 78  ? -58.902 29.457  39.926  1.00 30.56 ? 109 VAL B CG2   1 
ATOM   3035 N  N     . LEU B 1 79  ? -55.704 30.223  42.846  1.00 30.71 ? 110 LEU B N     1 
ATOM   3036 C  CA    . LEU B 1 79  ? -54.797 30.965  43.692  1.00 31.01 ? 110 LEU B CA    1 
ATOM   3037 C  C     . LEU B 1 79  ? -53.492 30.187  43.911  1.00 31.70 ? 110 LEU B C     1 
ATOM   3038 O  O     . LEU B 1 79  ? -52.429 30.773  43.818  1.00 31.89 ? 110 LEU B O     1 
ATOM   3039 C  CB    . LEU B 1 79  ? -55.474 31.315  45.018  1.00 30.67 ? 110 LEU B CB    1 
ATOM   3040 C  CG    . LEU B 1 79  ? -56.674 32.259  44.943  1.00 29.93 ? 110 LEU B CG    1 
ATOM   3041 C  CD1   . LEU B 1 79  ? -57.427 32.243  46.265  1.00 28.60 ? 110 LEU B CD1   1 
ATOM   3042 C  CD2   . LEU B 1 79  ? -56.268 33.673  44.567  1.00 28.28 ? 110 LEU B CD2   1 
ATOM   3043 N  N     . ALA B 1 80  ? -53.561 28.880  44.167  1.00 32.47 ? 111 ALA B N     1 
ATOM   3044 C  CA    . ALA B 1 80  ? -52.331 28.075  44.328  1.00 33.32 ? 111 ALA B CA    1 
ATOM   3045 C  C     . ALA B 1 80  ? -51.515 28.165  43.047  1.00 34.29 ? 111 ALA B C     1 
ATOM   3046 O  O     . ALA B 1 80  ? -50.314 28.188  43.085  1.00 35.07 ? 111 ALA B O     1 
ATOM   3047 C  CB    . ALA B 1 80  ? -52.653 26.644  44.635  1.00 32.79 ? 111 ALA B CB    1 
ATOM   3048 N  N     . GLY B 1 81  ? -52.179 28.314  41.899  1.00 35.81 ? 112 GLY B N     1 
ATOM   3049 C  CA    . GLY B 1 81  ? -51.473 28.522  40.620  1.00 36.67 ? 112 GLY B CA    1 
ATOM   3050 C  C     . GLY B 1 81  ? -50.576 29.754  40.577  1.00 37.63 ? 112 GLY B C     1 
ATOM   3051 O  O     . GLY B 1 81  ? -49.622 29.809  39.795  1.00 37.63 ? 112 GLY B O     1 
ATOM   3052 N  N     . ALA B 1 82  ? -50.911 30.748  41.401  1.00 38.87 ? 113 ALA B N     1 
ATOM   3053 C  CA    . ALA B 1 82  ? -50.112 31.959  41.578  1.00 39.85 ? 113 ALA B CA    1 
ATOM   3054 C  C     . ALA B 1 82  ? -49.425 31.983  42.960  1.00 40.90 ? 113 ALA B C     1 
ATOM   3055 O  O     . ALA B 1 82  ? -50.082 32.142  43.995  1.00 40.85 ? 113 ALA B O     1 
ATOM   3056 C  CB    . ALA B 1 82  ? -50.992 33.196  41.410  1.00 39.63 ? 113 ALA B CB    1 
ATOM   3057 N  N     . ALA B 1 83  ? -48.100 31.817  42.968  1.00 41.97 ? 114 ALA B N     1 
ATOM   3058 C  CA    . ALA B 1 83  ? -47.272 32.140  44.136  1.00 42.40 ? 114 ALA B CA    1 
ATOM   3059 C  C     . ALA B 1 83  ? -47.487 33.660  44.503  1.00 42.80 ? 114 ALA B C     1 
ATOM   3060 O  O     . ALA B 1 83  ? -48.572 34.178  44.219  1.00 43.02 ? 114 ALA B O     1 
ATOM   3061 C  CB    . ALA B 1 83  ? -45.818 31.780  43.829  1.00 42.51 ? 114 ALA B CB    1 
ATOM   3062 N  N     . GLU B 1 84  ? -46.542 34.410  45.092  1.00 43.05 ? 115 GLU B N     1 
ATOM   3063 C  CA    . GLU B 1 84  ? -45.128 34.083  45.243  1.00 43.24 ? 115 GLU B CA    1 
ATOM   3064 C  C     . GLU B 1 84  ? -44.911 33.216  46.467  1.00 43.37 ? 115 GLU B C     1 
ATOM   3065 O  O     . GLU B 1 84  ? -45.792 33.096  47.330  1.00 43.30 ? 115 GLU B O     1 
ATOM   3066 C  CB    . GLU B 1 84  ? -44.290 35.362  45.385  1.00 43.32 ? 115 GLU B CB    1 
ATOM   3067 C  CG    . GLU B 1 84  ? -44.419 36.345  44.210  1.00 43.67 ? 115 GLU B CG    1 
ATOM   3068 C  CD    . GLU B 1 84  ? -45.602 37.315  44.340  1.00 44.08 ? 115 GLU B CD    1 
ATOM   3069 O  OE1   . GLU B 1 84  ? -46.516 37.059  45.151  1.00 44.20 ? 115 GLU B OE1   1 
ATOM   3070 O  OE2   . GLU B 1 84  ? -45.616 38.339  43.626  1.00 44.01 ? 115 GLU B OE2   1 
ATOM   3071 N  N     . GLU B 1 85  ? -43.733 32.599  46.524  1.00 43.50 ? 116 GLU B N     1 
ATOM   3072 C  CA    . GLU B 1 85  ? -43.330 31.841  47.704  1.00 43.51 ? 116 GLU B CA    1 
ATOM   3073 C  C     . GLU B 1 85  ? -42.981 32.832  48.820  1.00 43.10 ? 116 GLU B C     1 
ATOM   3074 O  O     . GLU B 1 85  ? -42.570 33.977  48.552  1.00 42.99 ? 116 GLU B O     1 
ATOM   3075 C  CB    . GLU B 1 85  ? -42.173 30.855  47.412  1.00 43.63 ? 116 GLU B CB    1 
ATOM   3076 C  CG    . GLU B 1 85  ? -40.843 31.474  46.945  1.00 44.60 ? 116 GLU B CG    1 
ATOM   3077 C  CD    . GLU B 1 85  ? -40.801 31.741  45.443  1.00 45.86 ? 116 GLU B CD    1 
ATOM   3078 O  OE1   . GLU B 1 85  ? -39.885 32.464  44.977  1.00 45.53 ? 116 GLU B OE1   1 
ATOM   3079 O  OE2   . GLU B 1 85  ? -41.698 31.229  44.733  1.00 47.16 ? 116 GLU B OE2   1 
ATOM   3080 N  N     . GLY B 1 86  ? -43.190 32.393  50.061  1.00 42.55 ? 117 GLY B N     1 
ATOM   3081 C  CA    . GLY B 1 86  ? -42.967 33.231  51.238  1.00 42.23 ? 117 GLY B CA    1 
ATOM   3082 C  C     . GLY B 1 86  ? -44.150 34.117  51.600  1.00 41.63 ? 117 GLY B C     1 
ATOM   3083 O  O     . GLY B 1 86  ? -44.061 34.912  52.542  1.00 41.94 ? 117 GLY B O     1 
ATOM   3084 N  N     . PHE B 1 87  ? -45.243 33.999  50.846  1.00 40.66 ? 118 PHE B N     1 
ATOM   3085 C  CA    . PHE B 1 87  ? -46.472 34.717  51.139  1.00 40.13 ? 118 PHE B CA    1 
ATOM   3086 C  C     . PHE B 1 87  ? -47.719 33.844  50.852  1.00 39.44 ? 118 PHE B C     1 
ATOM   3087 O  O     . PHE B 1 87  ? -47.785 33.065  49.890  1.00 39.32 ? 118 PHE B O     1 
ATOM   3088 C  CB    . PHE B 1 87  ? -46.533 36.052  50.375  1.00 40.39 ? 118 PHE B CB    1 
ATOM   3089 C  CG    . PHE B 1 87  ? -45.395 37.008  50.709  1.00 41.12 ? 118 PHE B CG    1 
ATOM   3090 C  CD1   . PHE B 1 87  ? -44.382 37.271  49.779  1.00 41.60 ? 118 PHE B CD1   1 
ATOM   3091 C  CD2   . PHE B 1 87  ? -45.328 37.635  51.956  1.00 41.34 ? 118 PHE B CD2   1 
ATOM   3092 C  CE1   . PHE B 1 87  ? -43.329 38.145  50.083  1.00 41.10 ? 118 PHE B CE1   1 
ATOM   3093 C  CE2   . PHE B 1 87  ? -44.275 38.509  52.266  1.00 41.39 ? 118 PHE B CE2   1 
ATOM   3094 C  CZ    . PHE B 1 87  ? -43.277 38.763  51.327  1.00 41.15 ? 118 PHE B CZ    1 
ATOM   3095 N  N     . MET B 1 88  ? -48.672 33.966  51.763  1.00 38.24 ? 119 MET B N     1 
ATOM   3096 C  CA    . MET B 1 88  ? -50.012 33.446  51.644  1.00 37.56 ? 119 MET B CA    1 
ATOM   3097 C  C     . MET B 1 88  ? -50.919 34.657  51.820  1.00 36.37 ? 119 MET B C     1 
ATOM   3098 O  O     . MET B 1 88  ? -50.788 35.377  52.794  1.00 36.51 ? 119 MET B O     1 
ATOM   3099 C  CB    . MET B 1 88  ? -50.277 32.417  52.737  1.00 37.58 ? 119 MET B CB    1 
ATOM   3100 C  CG    . MET B 1 88  ? -51.746 32.003  52.816  1.00 38.08 ? 119 MET B CG    1 
ATOM   3101 S  SD    . MET B 1 88  ? -52.063 30.420  53.602  1.00 38.41 ? 119 MET B SD    1 
ATOM   3102 C  CE    . MET B 1 88  ? -50.905 29.353  52.742  1.00 38.40 ? 119 MET B CE    1 
ATOM   3103 N  N     . THR B 1 89  ? -51.835 34.886  50.886  1.00 35.29 ? 120 THR B N     1 
ATOM   3104 C  CA    . THR B 1 89  ? -52.727 36.052  50.955  1.00 34.07 ? 120 THR B CA    1 
ATOM   3105 C  C     . THR B 1 89  ? -53.844 35.826  51.986  1.00 33.28 ? 120 THR B C     1 
ATOM   3106 O  O     . THR B 1 89  ? -54.104 34.696  52.400  1.00 33.23 ? 120 THR B O     1 
ATOM   3107 C  CB    . THR B 1 89  ? -53.313 36.400  49.540  1.00 33.99 ? 120 THR B CB    1 
ATOM   3108 O  OG1   . THR B 1 89  ? -54.153 35.342  49.069  1.00 32.42 ? 120 THR B OG1   1 
ATOM   3109 C  CG2   . THR B 1 89  ? -52.195 36.635  48.515  1.00 33.27 ? 120 THR B CG2   1 
ATOM   3110 N  N     . ALA B 1 90  ? -54.480 36.906  52.423  1.00 32.41 ? 121 ALA B N     1 
ATOM   3111 C  CA    . ALA B 1 90  ? -55.652 36.811  53.300  1.00 31.60 ? 121 ALA B CA    1 
ATOM   3112 C  C     . ALA B 1 90  ? -56.769 36.059  52.561  1.00 30.82 ? 121 ALA B C     1 
ATOM   3113 O  O     . ALA B 1 90  ? -57.477 35.240  53.142  1.00 30.64 ? 121 ALA B O     1 
ATOM   3114 C  CB    . ALA B 1 90  ? -56.121 38.194  53.726  1.00 31.15 ? 121 ALA B CB    1 
ATOM   3115 N  N     . GLU B 1 91  ? -56.915 36.349  51.277  1.00 29.79 ? 122 GLU B N     1 
ATOM   3116 C  CA    . GLU B 1 91  ? -57.910 35.681  50.464  1.00 29.55 ? 122 GLU B CA    1 
ATOM   3117 C  C     . GLU B 1 91  ? -57.637 34.172  50.435  1.00 29.09 ? 122 GLU B C     1 
ATOM   3118 O  O     . GLU B 1 91  ? -58.542 33.361  50.635  1.00 29.15 ? 122 GLU B O     1 
ATOM   3119 C  CB    . GLU B 1 91  ? -57.925 36.270  49.043  1.00 29.52 ? 122 GLU B CB    1 
ATOM   3120 C  CG    . GLU B 1 91  ? -58.676 35.431  48.018  1.00 29.83 ? 122 GLU B CG    1 
ATOM   3121 C  CD    . GLU B 1 91  ? -58.855 36.135  46.688  1.00 30.21 ? 122 GLU B CD    1 
ATOM   3122 O  OE1   . GLU B 1 91  ? -57.867 36.669  46.134  1.00 31.62 ? 122 GLU B OE1   1 
ATOM   3123 O  OE2   . GLU B 1 91  ? -59.996 36.147  46.189  1.00 31.42 ? 122 GLU B OE2   1 
ATOM   3124 N  N     . LEU B 1 92  ? -56.387 33.795  50.197  1.00 28.31 ? 123 LEU B N     1 
ATOM   3125 C  CA    . LEU B 1 92  ? -56.042 32.386  50.098  1.00 28.05 ? 123 LEU B CA    1 
ATOM   3126 C  C     . LEU B 1 92  ? -56.162 31.685  51.447  1.00 27.87 ? 123 LEU B C     1 
ATOM   3127 O  O     . LEU B 1 92  ? -56.620 30.558  51.516  1.00 27.64 ? 123 LEU B O     1 
ATOM   3128 C  CB    . LEU B 1 92  ? -54.642 32.221  49.486  1.00 27.74 ? 123 LEU B CB    1 
ATOM   3129 C  CG    . LEU B 1 92  ? -54.057 30.813  49.391  1.00 27.39 ? 123 LEU B CG    1 
ATOM   3130 C  CD1   . LEU B 1 92  ? -55.076 29.775  48.902  1.00 25.75 ? 123 LEU B CD1   1 
ATOM   3131 C  CD2   . LEU B 1 92  ? -52.810 30.849  48.501  1.00 28.12 ? 123 LEU B CD2   1 
ATOM   3132 N  N     . ALA B 1 93  ? -55.788 32.373  52.515  1.00 28.12 ? 124 ALA B N     1 
ATOM   3133 C  CA    . ALA B 1 93  ? -55.989 31.854  53.869  1.00 28.15 ? 124 ALA B CA    1 
ATOM   3134 C  C     . ALA B 1 93  ? -57.467 31.602  54.143  1.00 28.13 ? 124 ALA B C     1 
ATOM   3135 O  O     . ALA B 1 93  ? -57.805 30.546  54.649  1.00 28.09 ? 124 ALA B O     1 
ATOM   3136 C  CB    . ALA B 1 93  ? -55.407 32.794  54.895  1.00 28.31 ? 124 ALA B CB    1 
ATOM   3137 N  N     . GLY B 1 94  ? -58.340 32.550  53.786  1.00 28.24 ? 125 GLY B N     1 
ATOM   3138 C  CA    . GLY B 1 94  ? -59.785 32.406  54.037  1.00 28.59 ? 125 GLY B CA    1 
ATOM   3139 C  C     . GLY B 1 94  ? -60.388 31.254  53.260  1.00 28.74 ? 125 GLY B C     1 
ATOM   3140 O  O     . GLY B 1 94  ? -61.230 30.509  53.761  1.00 28.99 ? 125 GLY B O     1 
ATOM   3141 N  N     . VAL B 1 95  ? -59.952 31.114  52.021  1.00 28.89 ? 126 VAL B N     1 
ATOM   3142 C  CA    . VAL B 1 95  ? -60.344 29.986  51.208  1.00 28.91 ? 126 VAL B CA    1 
ATOM   3143 C  C     . VAL B 1 95  ? -59.906 28.690  51.891  1.00 29.67 ? 126 VAL B C     1 
ATOM   3144 O  O     . VAL B 1 95  ? -60.675 27.725  51.953  1.00 30.25 ? 126 VAL B O     1 
ATOM   3145 C  CB    . VAL B 1 95  ? -59.753 30.092  49.798  1.00 28.87 ? 126 VAL B CB    1 
ATOM   3146 C  CG1   . VAL B 1 95  ? -59.869 28.774  49.062  1.00 28.10 ? 126 VAL B CG1   1 
ATOM   3147 C  CG2   . VAL B 1 95  ? -60.454 31.223  49.017  1.00 27.85 ? 126 VAL B CG2   1 
ATOM   3148 N  N     . ILE B 1 96  ? -58.704 28.658  52.457  1.00 30.01 ? 127 ILE B N     1 
ATOM   3149 C  CA    . ILE B 1 96  ? -58.261 27.417  53.071  1.00 30.37 ? 127 ILE B CA    1 
ATOM   3150 C  C     . ILE B 1 96  ? -59.016 27.120  54.392  1.00 31.06 ? 127 ILE B C     1 
ATOM   3151 O  O     . ILE B 1 96  ? -59.458 25.987  54.596  1.00 31.63 ? 127 ILE B O     1 
ATOM   3152 C  CB    . ILE B 1 96  ? -56.731 27.343  53.209  1.00 30.18 ? 127 ILE B CB    1 
ATOM   3153 C  CG1   . ILE B 1 96  ? -56.079 27.314  51.811  1.00 29.19 ? 127 ILE B CG1   1 
ATOM   3154 C  CG2   . ILE B 1 96  ? -56.337 26.075  53.979  1.00 30.21 ? 127 ILE B CG2   1 
ATOM   3155 C  CD1   . ILE B 1 96  ? -54.578 27.515  51.803  1.00 26.84 ? 127 ILE B CD1   1 
ATOM   3156 N  N     . LYS B 1 97  ? -59.213 28.132  55.239  1.00 31.35 ? 128 LYS B N     1 
ATOM   3157 C  CA    . LYS B 1 97  ? -59.953 27.969  56.488  1.00 31.57 ? 128 LYS B CA    1 
ATOM   3158 C  C     . LYS B 1 97  ? -61.347 27.424  56.220  1.00 31.30 ? 128 LYS B C     1 
ATOM   3159 O  O     . LYS B 1 97  ? -61.778 26.499  56.899  1.00 31.62 ? 128 LYS B O     1 
ATOM   3160 C  CB    . LYS B 1 97  ? -60.060 29.296  57.257  1.00 31.59 ? 128 LYS B CB    1 
ATOM   3161 C  CG    . LYS B 1 97  ? -58.747 29.837  57.813  1.00 32.40 ? 128 LYS B CG    1 
ATOM   3162 C  CD    . LYS B 1 97  ? -58.860 31.318  58.248  1.00 32.47 ? 128 LYS B CD    1 
ATOM   3163 C  CE    . LYS B 1 97  ? -57.495 31.974  58.455  1.00 33.01 ? 128 LYS B CE    1 
ATOM   3164 N  NZ    . LYS B 1 97  ? -57.593 33.404  58.885  1.00 33.82 ? 128 LYS B NZ    1 
ATOM   3165 N  N     . ARG B 1 98  ? -62.042 27.985  55.231  1.00 31.01 ? 129 ARG B N     1 
ATOM   3166 C  CA    . ARG B 1 98  ? -63.441 27.627  54.987  1.00 30.89 ? 129 ARG B CA    1 
ATOM   3167 C  C     . ARG B 1 98  ? -63.528 26.187  54.495  1.00 30.76 ? 129 ARG B C     1 
ATOM   3168 O  O     . ARG B 1 98  ? -64.389 25.439  54.931  1.00 30.69 ? 129 ARG B O     1 
ATOM   3169 C  CB    . ARG B 1 98  ? -64.100 28.607  54.014  1.00 30.82 ? 129 ARG B CB    1 
ATOM   3170 C  CG    . ARG B 1 98  ? -64.370 29.993  54.626  1.00 30.61 ? 129 ARG B CG    1 
ATOM   3171 C  CD    . ARG B 1 98  ? -65.189 30.890  53.707  1.00 30.95 ? 129 ARG B CD    1 
ATOM   3172 N  NE    . ARG B 1 98  ? -64.598 31.003  52.374  1.00 31.75 ? 129 ARG B NE    1 
ATOM   3173 C  CZ    . ARG B 1 98  ? -63.734 31.944  51.976  1.00 32.16 ? 129 ARG B CZ    1 
ATOM   3174 N  NH1   . ARG B 1 98  ? -63.354 32.935  52.774  1.00 30.71 ? 129 ARG B NH1   1 
ATOM   3175 N  NH2   . ARG B 1 98  ? -63.265 31.906  50.729  1.00 32.73 ? 129 ARG B NH2   1 
ATOM   3176 N  N     . LEU B 1 99  ? -62.622 25.787  53.606  1.00 30.81 ? 130 LEU B N     1 
ATOM   3177 C  CA    . LEU B 1 99  ? -62.601 24.395  53.167  1.00 30.84 ? 130 LEU B CA    1 
ATOM   3178 C  C     . LEU B 1 99  ? -62.293 23.486  54.358  1.00 31.19 ? 130 LEU B C     1 
ATOM   3179 O  O     . LEU B 1 99  ? -62.976 22.495  54.614  1.00 31.30 ? 130 LEU B O     1 
ATOM   3180 C  CB    . LEU B 1 99  ? -61.592 24.164  52.058  1.00 30.65 ? 130 LEU B CB    1 
ATOM   3181 C  CG    . LEU B 1 99  ? -61.967 24.745  50.706  1.00 29.83 ? 130 LEU B CG    1 
ATOM   3182 C  CD1   . LEU B 1 99  ? -60.723 24.849  49.867  1.00 28.09 ? 130 LEU B CD1   1 
ATOM   3183 C  CD2   . LEU B 1 99  ? -63.056 23.891  50.013  1.00 29.97 ? 130 LEU B CD2   1 
ATOM   3184 N  N     . TRP B 1 100 ? -61.291 23.854  55.123  1.00 31.62 ? 131 TRP B N     1 
ATOM   3185 C  CA    . TRP B 1 100 ? -60.834 22.990  56.204  1.00 32.09 ? 131 TRP B CA    1 
ATOM   3186 C  C     . TRP B 1 100 ? -61.894 22.755  57.290  1.00 32.23 ? 131 TRP B C     1 
ATOM   3187 O  O     . TRP B 1 100 ? -61.922 21.675  57.871  1.00 32.60 ? 131 TRP B O     1 
ATOM   3188 C  CB    . TRP B 1 100 ? -59.525 23.541  56.780  1.00 32.41 ? 131 TRP B CB    1 
ATOM   3189 C  CG    . TRP B 1 100 ? -59.013 22.848  58.012  1.00 32.58 ? 131 TRP B CG    1 
ATOM   3190 C  CD1   . TRP B 1 100 ? -58.886 23.401  59.239  1.00 32.17 ? 131 TRP B CD1   1 
ATOM   3191 C  CD2   . TRP B 1 100 ? -58.549 21.495  58.126  1.00 32.14 ? 131 TRP B CD2   1 
ATOM   3192 N  NE1   . TRP B 1 100 ? -58.380 22.486  60.117  1.00 33.07 ? 131 TRP B NE1   1 
ATOM   3193 C  CE2   . TRP B 1 100 ? -58.170 21.301  59.464  1.00 33.39 ? 131 TRP B CE2   1 
ATOM   3194 C  CE3   . TRP B 1 100 ? -58.429 20.426  57.230  1.00 32.91 ? 131 TRP B CE3   1 
ATOM   3195 C  CZ2   . TRP B 1 100 ? -57.670 20.069  59.943  1.00 33.18 ? 131 TRP B CZ2   1 
ATOM   3196 C  CZ3   . TRP B 1 100 ? -57.925 19.205  57.697  1.00 32.67 ? 131 TRP B CZ3   1 
ATOM   3197 C  CH2   . TRP B 1 100 ? -57.551 19.041  59.041  1.00 32.58 ? 131 TRP B CH2   1 
ATOM   3198 N  N     . LYS B 1 101 ? -62.789 23.719  57.544  1.00 32.35 ? 132 LYS B N     1 
ATOM   3199 C  CA    . LYS B 1 101 ? -63.820 23.506  58.574  1.00 32.38 ? 132 LYS B CA    1 
ATOM   3200 C  C     . LYS B 1 101 ? -65.152 22.943  58.044  1.00 32.11 ? 132 LYS B C     1 
ATOM   3201 O  O     . LYS B 1 101 ? -66.029 22.611  58.829  1.00 32.13 ? 132 LYS B O     1 
ATOM   3202 C  CB    . LYS B 1 101 ? -63.962 24.705  59.521  1.00 32.41 ? 132 LYS B CB    1 
ATOM   3203 C  CG    . LYS B 1 101 ? -64.290 26.076  58.934  1.00 33.86 ? 132 LYS B CG    1 
ATOM   3204 C  CD    . LYS B 1 101 ? -63.907 27.172  59.975  1.00 34.08 ? 132 LYS B CD    1 
ATOM   3205 C  CE    . LYS B 1 101 ? -64.619 28.500  59.741  1.00 35.30 ? 132 LYS B CE    1 
ATOM   3206 N  NZ    . LYS B 1 101 ? -65.985 28.472  60.301  1.00 35.68 ? 132 LYS B NZ    1 
ATOM   3207 N  N     . ASP B 1 102 ? -65.249 22.728  56.730  1.00 32.20 ? 133 ASP B N     1 
ATOM   3208 C  CA    . ASP B 1 102 ? -66.395 22.075  56.141  1.00 31.87 ? 133 ASP B CA    1 
ATOM   3209 C  C     . ASP B 1 102 ? -66.464 20.586  56.500  1.00 31.90 ? 133 ASP B C     1 
ATOM   3210 O  O     . ASP B 1 102 ? -65.470 19.847  56.421  1.00 31.57 ? 133 ASP B O     1 
ATOM   3211 C  CB    . ASP B 1 102 ? -66.365 22.207  54.630  1.00 32.23 ? 133 ASP B CB    1 
ATOM   3212 C  CG    . ASP B 1 102 ? -67.542 21.527  53.991  1.00 32.02 ? 133 ASP B CG    1 
ATOM   3213 O  OD1   . ASP B 1 102 ? -68.670 22.074  54.065  1.00 31.56 ? 133 ASP B OD1   1 
ATOM   3214 O  OD2   . ASP B 1 102 ? -67.329 20.423  53.459  1.00 31.62 ? 133 ASP B OD2   1 
ATOM   3215 N  N     . SER B 1 103 ? -67.675 20.145  56.821  1.00 31.82 ? 134 SER B N     1 
ATOM   3216 C  CA    . SER B 1 103 ? -67.926 18.762  57.231  1.00 31.69 ? 134 SER B CA    1 
ATOM   3217 C  C     . SER B 1 103 ? -67.483 17.676  56.218  1.00 31.35 ? 134 SER B C     1 
ATOM   3218 O  O     . SER B 1 103 ? -67.064 16.615  56.653  1.00 31.82 ? 134 SER B O     1 
ATOM   3219 C  CB    . SER B 1 103 ? -69.400 18.586  57.620  1.00 31.40 ? 134 SER B CB    1 
ATOM   3220 O  OG    . SER B 1 103 ? -70.225 18.798  56.494  1.00 31.48 ? 134 SER B OG    1 
ATOM   3221 N  N     . GLY B 1 104 ? -67.570 17.930  54.906  1.00 30.87 ? 135 GLY B N     1 
ATOM   3222 C  CA    . GLY B 1 104 ? -67.147 16.958  53.886  1.00 30.39 ? 135 GLY B CA    1 
ATOM   3223 C  C     . GLY B 1 104 ? -65.631 16.884  53.705  1.00 30.15 ? 135 GLY B C     1 
ATOM   3224 O  O     . GLY B 1 104 ? -65.076 15.804  53.552  1.00 30.25 ? 135 GLY B O     1 
ATOM   3225 N  N     . VAL B 1 105 ? -64.958 18.035  53.699  1.00 29.65 ? 136 VAL B N     1 
ATOM   3226 C  CA    . VAL B 1 105 ? -63.494 18.073  53.625  1.00 28.97 ? 136 VAL B CA    1 
ATOM   3227 C  C     . VAL B 1 105 ? -62.928 17.291  54.802  1.00 29.08 ? 136 VAL B C     1 
ATOM   3228 O  O     . VAL B 1 105 ? -62.045 16.449  54.659  1.00 29.24 ? 136 VAL B O     1 
ATOM   3229 C  CB    . VAL B 1 105 ? -62.933 19.514  53.673  1.00 28.38 ? 136 VAL B CB    1 
ATOM   3230 C  CG1   . VAL B 1 105 ? -61.418 19.484  53.702  1.00 27.30 ? 136 VAL B CG1   1 
ATOM   3231 C  CG2   . VAL B 1 105 ? -63.428 20.348  52.493  1.00 26.50 ? 136 VAL B CG2   1 
ATOM   3232 N  N     . GLN B 1 106 ? -63.487 17.565  55.967  1.00 28.93 ? 137 GLN B N     1 
ATOM   3233 C  CA    . GLN B 1 106 ? -63.175 16.847  57.205  1.00 28.78 ? 137 GLN B CA    1 
ATOM   3234 C  C     . GLN B 1 106 ? -63.513 15.345  57.064  1.00 28.78 ? 137 GLN B C     1 
ATOM   3235 O  O     . GLN B 1 106 ? -62.707 14.504  57.461  1.00 28.81 ? 137 GLN B O     1 
ATOM   3236 C  CB    . GLN B 1 106 ? -63.952 17.513  58.376  1.00 29.04 ? 137 GLN B CB    1 
ATOM   3237 C  CG    . GLN B 1 106 ? -63.276 17.746  59.752  1.00 29.24 ? 137 GLN B CG    1 
ATOM   3238 C  CD    . GLN B 1 106 ? -61.818 18.230  59.745  1.00 29.27 ? 137 GLN B CD    1 
ATOM   3239 O  OE1   . GLN B 1 106 ? -61.013 17.714  60.510  1.00 31.88 ? 137 GLN B OE1   1 
ATOM   3240 N  NE2   . GLN B 1 106 ? -61.485 19.217  58.924  1.00 27.37 ? 137 GLN B NE2   1 
ATOM   3241 N  N     . ALA B 1 107 ? -64.660 14.991  56.471  1.00 28.62 ? 138 ALA B N     1 
ATOM   3242 C  CA    . ALA B 1 107 ? -64.940 13.575  56.202  1.00 29.09 ? 138 ALA B CA    1 
ATOM   3243 C  C     . ALA B 1 107 ? -63.778 12.969  55.387  1.00 29.50 ? 138 ALA B C     1 
ATOM   3244 O  O     . ALA B 1 107 ? -63.204 11.940  55.765  1.00 29.39 ? 138 ALA B O     1 
ATOM   3245 C  CB    . ALA B 1 107 ? -66.273 13.395  55.489  1.00 28.74 ? 138 ALA B CB    1 
ATOM   3246 N  N     . CYS B 1 108 ? -63.402 13.639  54.302  1.00 29.89 ? 139 CYS B N     1 
ATOM   3247 C  CA    . CYS B 1 108 ? -62.326 13.158  53.474  1.00 30.49 ? 139 CYS B CA    1 
ATOM   3248 C  C     . CYS B 1 108 ? -61.000 13.071  54.207  1.00 30.89 ? 139 CYS B C     1 
ATOM   3249 O  O     . CYS B 1 108 ? -60.212 12.162  53.971  1.00 31.13 ? 139 CYS B O     1 
ATOM   3250 C  CB    . CYS B 1 108 ? -62.149 14.055  52.296  1.00 30.80 ? 139 CYS B CB    1 
ATOM   3251 S  SG    . CYS B 1 108 ? -61.199 13.198  51.127  1.00 32.82 ? 139 CYS B SG    1 
ATOM   3252 N  N     . PHE B 1 109 ? -60.753 14.039  55.079  1.00 31.08 ? 140 PHE B N     1 
ATOM   3253 C  CA    . PHE B 1 109 ? -59.549 14.054  55.873  1.00 31.06 ? 140 PHE B CA    1 
ATOM   3254 C  C     . PHE B 1 109 ? -59.434 12.815  56.756  1.00 31.25 ? 140 PHE B C     1 
ATOM   3255 O  O     . PHE B 1 109 ? -58.355 12.232  56.877  1.00 31.42 ? 140 PHE B O     1 
ATOM   3256 C  CB    . PHE B 1 109 ? -59.496 15.310  56.745  1.00 31.39 ? 140 PHE B CB    1 
ATOM   3257 C  CG    . PHE B 1 109 ? -58.490 15.227  57.849  1.00 31.69 ? 140 PHE B CG    1 
ATOM   3258 C  CD1   . PHE B 1 109 ? -57.136 15.129  57.562  1.00 32.18 ? 140 PHE B CD1   1 
ATOM   3259 C  CD2   . PHE B 1 109 ? -58.891 15.219  59.182  1.00 32.72 ? 140 PHE B CD2   1 
ATOM   3260 C  CE1   . PHE B 1 109 ? -56.195 15.045  58.594  1.00 32.21 ? 140 PHE B CE1   1 
ATOM   3261 C  CE2   . PHE B 1 109 ? -57.945 15.119  60.223  1.00 31.22 ? 140 PHE B CE2   1 
ATOM   3262 C  CZ    . PHE B 1 109 ? -56.607 15.038  59.921  1.00 31.21 ? 140 PHE B CZ    1 
ATOM   3263 N  N     . ASN B 1 110 ? -60.543 12.401  57.361  1.00 31.32 ? 141 ASN B N     1 
ATOM   3264 C  CA    . ASN B 1 110 ? -60.532 11.216  58.216  1.00 31.20 ? 141 ASN B CA    1 
ATOM   3265 C  C     . ASN B 1 110 ? -60.341 9.915   57.439  1.00 31.46 ? 141 ASN B C     1 
ATOM   3266 O  O     . ASN B 1 110 ? -60.056 8.882   58.045  1.00 31.93 ? 141 ASN B O     1 
ATOM   3267 C  CB    . ASN B 1 110 ? -61.780 11.163  59.104  1.00 30.85 ? 141 ASN B CB    1 
ATOM   3268 C  CG    . ASN B 1 110 ? -61.768 12.243  60.198  1.00 30.73 ? 141 ASN B CG    1 
ATOM   3269 O  OD1   . ASN B 1 110 ? -60.785 12.405  60.916  1.00 30.00 ? 141 ASN B OD1   1 
ATOM   3270 N  ND2   . ASN B 1 110 ? -62.855 12.994  60.305  1.00 29.04 ? 141 ASN B ND2   1 
ATOM   3271 N  N     . ARG B 1 111 ? -60.470 9.964   56.116  1.00 31.30 ? 142 ARG B N     1 
ATOM   3272 C  CA    . ARG B 1 111 ? -60.211 8.805   55.286  1.00 31.53 ? 142 ARG B CA    1 
ATOM   3273 C  C     . ARG B 1 111 ? -58.867 8.929   54.542  1.00 31.50 ? 142 ARG B C     1 
ATOM   3274 O  O     . ARG B 1 111 ? -58.655 8.273   53.528  1.00 31.00 ? 142 ARG B O     1 
ATOM   3275 C  CB    . ARG B 1 111 ? -61.395 8.602   54.346  1.00 31.90 ? 142 ARG B CB    1 
ATOM   3276 C  CG    . ARG B 1 111 ? -62.686 8.210   55.089  1.00 31.78 ? 142 ARG B CG    1 
ATOM   3277 C  CD    . ARG B 1 111 ? -63.914 8.223   54.188  1.00 31.88 ? 142 ARG B CD    1 
ATOM   3278 N  NE    . ARG B 1 111 ? -63.683 7.532   52.918  1.00 32.84 ? 142 ARG B NE    1 
ATOM   3279 C  CZ    . ARG B 1 111 ? -64.580 7.417   51.945  1.00 32.08 ? 142 ARG B CZ    1 
ATOM   3280 N  NH1   . ARG B 1 111 ? -65.786 7.949   52.065  1.00 32.46 ? 142 ARG B NH1   1 
ATOM   3281 N  NH2   . ARG B 1 111 ? -64.248 6.775   50.837  1.00 31.92 ? 142 ARG B NH2   1 
ATOM   3282 N  N     . SER B 1 112 ? -57.951 9.739   55.095  1.00 31.74 ? 143 SER B N     1 
ATOM   3283 C  CA    . SER B 1 112 ? -56.633 10.022  54.481  1.00 31.96 ? 143 SER B CA    1 
ATOM   3284 C  C     . SER B 1 112 ? -55.795 8.786   54.145  1.00 32.49 ? 143 SER B C     1 
ATOM   3285 O  O     . SER B 1 112 ? -54.925 8.844   53.269  1.00 33.46 ? 143 SER B O     1 
ATOM   3286 C  CB    . SER B 1 112 ? -55.812 10.992  55.348  1.00 31.88 ? 143 SER B CB    1 
ATOM   3287 O  OG    . SER B 1 112 ? -55.099 10.332  56.383  1.00 30.70 ? 143 SER B OG    1 
ATOM   3288 N  N     . ARG B 1 113 ? -56.074 7.670   54.806  1.00 32.24 ? 144 ARG B N     1 
ATOM   3289 C  CA    . ARG B 1 113 ? -55.469 6.397   54.439  1.00 32.42 ? 144 ARG B CA    1 
ATOM   3290 C  C     . ARG B 1 113 ? -55.788 5.914   53.002  1.00 31.95 ? 144 ARG B C     1 
ATOM   3291 O  O     . ARG B 1 113 ? -55.132 4.994   52.520  1.00 32.27 ? 144 ARG B O     1 
ATOM   3292 C  CB    . ARG B 1 113 ? -55.851 5.320   55.475  1.00 32.27 ? 144 ARG B CB    1 
ATOM   3293 C  CG    . ARG B 1 113 ? -57.352 4.981   55.569  1.00 32.85 ? 144 ARG B CG    1 
ATOM   3294 C  CD    . ARG B 1 113 ? -57.589 3.765   56.450  1.00 33.32 ? 144 ARG B CD    1 
ATOM   3295 N  NE    . ARG B 1 113 ? -56.880 2.610   55.901  1.00 34.02 ? 144 ARG B NE    1 
ATOM   3296 C  CZ    . ARG B 1 113 ? -57.435 1.614   55.211  1.00 35.15 ? 144 ARG B CZ    1 
ATOM   3297 N  NH1   . ARG B 1 113 ? -58.748 1.565   54.990  1.00 35.16 ? 144 ARG B NH1   1 
ATOM   3298 N  NH2   . ARG B 1 113 ? -56.657 0.638   54.750  1.00 35.54 ? 144 ARG B NH2   1 
ATOM   3299 N  N     . GLU B 1 114 ? -56.770 6.510   52.333  1.00 31.36 ? 145 GLU B N     1 
ATOM   3300 C  CA    . GLU B 1 114 ? -57.171 6.094   50.979  1.00 31.66 ? 145 GLU B CA    1 
ATOM   3301 C  C     . GLU B 1 114 ? -56.468 6.902   49.882  1.00 31.42 ? 145 GLU B C     1 
ATOM   3302 O  O     . GLU B 1 114 ? -56.682 6.672   48.696  1.00 31.65 ? 145 GLU B O     1 
ATOM   3303 C  CB    . GLU B 1 114 ? -58.699 6.201   50.852  1.00 31.50 ? 145 GLU B CB    1 
ATOM   3304 C  CG    . GLU B 1 114 ? -59.484 5.295   51.839  1.00 31.86 ? 145 GLU B CG    1 
ATOM   3305 C  CD    . GLU B 1 114 ? -61.009 5.318   51.627  1.00 32.69 ? 145 GLU B CD    1 
ATOM   3306 O  OE1   . GLU B 1 114 ? -61.480 5.138   50.458  1.00 33.47 ? 145 GLU B OE1   1 
ATOM   3307 O  OE2   . GLU B 1 114 ? -61.737 5.499   52.639  1.00 32.51 ? 145 GLU B OE2   1 
ATOM   3308 N  N     . TYR B 1 115 ? -55.640 7.856   50.291  1.00 31.22 ? 146 TYR B N     1 
ATOM   3309 C  CA    . TYR B 1 115 ? -54.794 8.639   49.381  1.00 31.02 ? 146 TYR B CA    1 
ATOM   3310 C  C     . TYR B 1 115 ? -53.511 8.982   50.138  1.00 31.22 ? 146 TYR B C     1 
ATOM   3311 O  O     . TYR B 1 115 ? -53.195 8.321   51.121  1.00 31.48 ? 146 TYR B O     1 
ATOM   3312 C  CB    . TYR B 1 115 ? -55.530 9.881   48.895  1.00 30.36 ? 146 TYR B CB    1 
ATOM   3313 C  CG    . TYR B 1 115 ? -56.198 10.706  49.994  1.00 31.12 ? 146 TYR B CG    1 
ATOM   3314 C  CD1   . TYR B 1 115 ? -57.443 10.340  50.523  1.00 30.98 ? 146 TYR B CD1   1 
ATOM   3315 C  CD2   . TYR B 1 115 ? -55.595 11.868  50.486  1.00 30.78 ? 146 TYR B CD2   1 
ATOM   3316 C  CE1   . TYR B 1 115 ? -58.057 11.108  51.511  1.00 30.79 ? 146 TYR B CE1   1 
ATOM   3317 C  CE2   . TYR B 1 115 ? -56.186 12.630  51.466  1.00 30.17 ? 146 TYR B CE2   1 
ATOM   3318 C  CZ    . TYR B 1 115 ? -57.414 12.257  51.978  1.00 30.64 ? 146 TYR B CZ    1 
ATOM   3319 O  OH    . TYR B 1 115 ? -57.972 13.032  52.959  1.00 29.68 ? 146 TYR B OH    1 
ATOM   3320 N  N     . GLN B 1 116 ? -52.764 9.984   49.684  1.00 31.38 ? 147 GLN B N     1 
ATOM   3321 C  CA    . GLN B 1 116 ? -51.477 10.344  50.297  1.00 30.63 ? 147 GLN B CA    1 
ATOM   3322 C  C     . GLN B 1 116 ? -51.564 11.745  50.871  1.00 30.98 ? 147 GLN B C     1 
ATOM   3323 O  O     . GLN B 1 116 ? -51.720 12.733  50.136  1.00 31.96 ? 147 GLN B O     1 
ATOM   3324 C  CB    . GLN B 1 116 ? -50.357 10.254  49.258  1.00 30.35 ? 147 GLN B CB    1 
ATOM   3325 C  CG    . GLN B 1 116 ? -50.132 8.823   48.693  1.00 29.65 ? 147 GLN B CG    1 
ATOM   3326 C  CD    . GLN B 1 116 ? -49.595 7.834   49.760  1.00 27.50 ? 147 GLN B CD    1 
ATOM   3327 O  OE1   . GLN B 1 116 ? -48.845 8.212   50.640  1.00 24.64 ? 147 GLN B OE1   1 
ATOM   3328 N  NE2   . GLN B 1 116 ? -49.995 6.587   49.667  1.00 26.20 ? 147 GLN B NE2   1 
ATOM   3329 N  N     . LEU B 1 117 ? -51.449 11.837  52.188  1.00 31.05 ? 148 LEU B N     1 
ATOM   3330 C  CA    . LEU B 1 117 ? -51.553 13.101  52.894  1.00 30.97 ? 148 LEU B CA    1 
ATOM   3331 C  C     . LEU B 1 117 ? -50.427 13.239  53.871  1.00 31.08 ? 148 LEU B C     1 
ATOM   3332 O  O     . LEU B 1 117 ? -50.133 12.324  54.645  1.00 31.74 ? 148 LEU B O     1 
ATOM   3333 C  CB    . LEU B 1 117 ? -52.873 13.169  53.655  1.00 31.44 ? 148 LEU B CB    1 
ATOM   3334 C  CG    . LEU B 1 117 ? -53.227 14.501  54.314  1.00 31.25 ? 148 LEU B CG    1 
ATOM   3335 C  CD1   . LEU B 1 117 ? -53.455 15.570  53.276  1.00 28.64 ? 148 LEU B CD1   1 
ATOM   3336 C  CD2   . LEU B 1 117 ? -54.457 14.297  55.190  1.00 30.87 ? 148 LEU B CD2   1 
ATOM   3337 N  N     . ASN B 1 118 ? -49.806 14.401  53.845  1.00 31.32 ? 149 ASN B N     1 
ATOM   3338 C  CA    . ASN B 1 118 ? -48.786 14.764  54.817  1.00 31.58 ? 149 ASN B CA    1 
ATOM   3339 C  C     . ASN B 1 118 ? -49.301 14.723  56.243  1.00 31.19 ? 149 ASN B C     1 
ATOM   3340 O  O     . ASN B 1 118 ? -50.335 15.267  56.540  1.00 31.01 ? 149 ASN B O     1 
ATOM   3341 C  CB    . ASN B 1 118 ? -48.276 16.143  54.455  1.00 31.88 ? 149 ASN B CB    1 
ATOM   3342 C  CG    . ASN B 1 118 ? -47.925 16.215  52.997  1.00 33.89 ? 149 ASN B CG    1 
ATOM   3343 O  OD1   . ASN B 1 118 ? -48.836 16.321  52.110  1.00 37.67 ? 149 ASN B OD1   1 
ATOM   3344 N  ND2   . ASN B 1 118 ? -46.643 16.045  52.705  1.00 30.51 ? 149 ASN B ND2   1 
ATOM   3345 N  N     . ASP B 1 119 ? -48.558 14.047  57.107  1.00 31.40 ? 150 ASP B N     1 
ATOM   3346 C  CA    . ASP B 1 119 ? -48.873 13.922  58.523  1.00 31.55 ? 150 ASP B CA    1 
ATOM   3347 C  C     . ASP B 1 119 ? -48.960 15.256  59.316  1.00 31.44 ? 150 ASP B C     1 
ATOM   3348 O  O     . ASP B 1 119 ? -49.587 15.304  60.373  1.00 31.85 ? 150 ASP B O     1 
ATOM   3349 C  CB    . ASP B 1 119 ? -47.832 13.001  59.180  1.00 31.51 ? 150 ASP B CB    1 
ATOM   3350 C  CG    . ASP B 1 119 ? -48.086 11.508  58.899  1.00 31.70 ? 150 ASP B CG    1 
ATOM   3351 O  OD1   . ASP B 1 119 ? -49.255 11.090  58.806  1.00 31.01 ? 150 ASP B OD1   1 
ATOM   3352 O  OD2   . ASP B 1 119 ? -47.105 10.746  58.794  1.00 32.17 ? 150 ASP B OD2   1 
ATOM   3353 N  N     . SER B 1 120 ? -48.331 16.319  58.827  1.00 30.97 ? 151 SER B N     1 
ATOM   3354 C  CA    . SER B 1 120 ? -48.411 17.609  59.489  1.00 30.78 ? 151 SER B CA    1 
ATOM   3355 C  C     . SER B 1 120 ? -49.581 18.480  58.979  1.00 30.99 ? 151 SER B C     1 
ATOM   3356 O  O     . SER B 1 120 ? -49.720 19.641  59.382  1.00 31.34 ? 151 SER B O     1 
ATOM   3357 C  CB    . SER B 1 120 ? -47.072 18.364  59.387  1.00 30.69 ? 151 SER B CB    1 
ATOM   3358 O  OG    . SER B 1 120 ? -46.031 17.705  60.085  1.00 29.07 ? 151 SER B OG    1 
ATOM   3359 N  N     . ALA B 1 121 ? -50.440 17.906  58.146  1.00 30.91 ? 152 ALA B N     1 
ATOM   3360 C  CA    . ALA B 1 121 ? -51.562 18.628  57.548  1.00 31.01 ? 152 ALA B CA    1 
ATOM   3361 C  C     . ALA B 1 121 ? -52.439 19.262  58.618  1.00 30.92 ? 152 ALA B C     1 
ATOM   3362 O  O     . ALA B 1 121 ? -52.698 20.467  58.569  1.00 31.97 ? 152 ALA B O     1 
ATOM   3363 C  CB    . ALA B 1 121 ? -52.397 17.685  56.652  1.00 30.47 ? 152 ALA B CB    1 
ATOM   3364 N  N     . ALA B 1 122 ? -52.894 18.465  59.579  1.00 30.52 ? 153 ALA B N     1 
ATOM   3365 C  CA    . ALA B 1 122 ? -53.740 18.989  60.664  1.00 30.52 ? 153 ALA B CA    1 
ATOM   3366 C  C     . ALA B 1 122 ? -52.983 20.016  61.536  1.00 29.94 ? 153 ALA B C     1 
ATOM   3367 O  O     . ALA B 1 122 ? -53.494 21.084  61.847  1.00 29.99 ? 153 ALA B O     1 
ATOM   3368 C  CB    . ALA B 1 122 ? -54.304 17.841  61.533  1.00 30.18 ? 153 ALA B CB    1 
ATOM   3369 N  N     . TYR B 1 123 ? -51.770 19.691  61.939  1.00 29.76 ? 154 TYR B N     1 
ATOM   3370 C  CA    . TYR B 1 123 ? -50.994 20.628  62.741  1.00 30.17 ? 154 TYR B CA    1 
ATOM   3371 C  C     . TYR B 1 123 ? -51.054 22.039  62.128  1.00 30.29 ? 154 TYR B C     1 
ATOM   3372 O  O     . TYR B 1 123 ? -51.363 23.036  62.830  1.00 30.42 ? 154 TYR B O     1 
ATOM   3373 C  CB    . TYR B 1 123 ? -49.544 20.155  62.914  1.00 30.20 ? 154 TYR B CB    1 
ATOM   3374 C  CG    . TYR B 1 123 ? -48.583 21.178  63.521  1.00 30.40 ? 154 TYR B CG    1 
ATOM   3375 C  CD1   . TYR B 1 123 ? -48.378 21.263  64.905  1.00 30.36 ? 154 TYR B CD1   1 
ATOM   3376 C  CD2   . TYR B 1 123 ? -47.868 22.037  62.710  1.00 29.47 ? 154 TYR B CD2   1 
ATOM   3377 C  CE1   . TYR B 1 123 ? -47.493 22.200  65.442  1.00 29.83 ? 154 TYR B CE1   1 
ATOM   3378 C  CE2   . TYR B 1 123 ? -46.995 22.955  63.227  1.00 29.58 ? 154 TYR B CE2   1 
ATOM   3379 C  CZ    . TYR B 1 123 ? -46.803 23.048  64.583  1.00 30.35 ? 154 TYR B CZ    1 
ATOM   3380 O  OH    . TYR B 1 123 ? -45.909 23.997  65.049  1.00 29.62 ? 154 TYR B OH    1 
ATOM   3381 N  N     . TYR B 1 124 ? -50.819 22.115  60.818  1.00 29.88 ? 155 TYR B N     1 
ATOM   3382 C  CA    . TYR B 1 124 ? -50.748 23.406  60.132  1.00 29.67 ? 155 TYR B CA    1 
ATOM   3383 C  C     . TYR B 1 124 ? -52.121 23.978  59.875  1.00 29.75 ? 155 TYR B C     1 
ATOM   3384 O  O     . TYR B 1 124 ? -52.360 25.166  60.120  1.00 30.19 ? 155 TYR B O     1 
ATOM   3385 C  CB    . TYR B 1 124 ? -49.996 23.307  58.803  1.00 29.73 ? 155 TYR B CB    1 
ATOM   3386 C  CG    . TYR B 1 124 ? -48.500 23.109  58.908  1.00 28.90 ? 155 TYR B CG    1 
ATOM   3387 C  CD1   . TYR B 1 124 ? -47.730 24.002  59.619  1.00 27.62 ? 155 TYR B CD1   1 
ATOM   3388 C  CD2   . TYR B 1 124 ? -47.856 22.046  58.255  1.00 28.40 ? 155 TYR B CD2   1 
ATOM   3389 C  CE1   . TYR B 1 124 ? -46.359 23.860  59.716  1.00 29.00 ? 155 TYR B CE1   1 
ATOM   3390 C  CE2   . TYR B 1 124 ? -46.464 21.879  58.346  1.00 28.12 ? 155 TYR B CE2   1 
ATOM   3391 C  CZ    . TYR B 1 124 ? -45.715 22.814  59.084  1.00 29.33 ? 155 TYR B CZ    1 
ATOM   3392 O  OH    . TYR B 1 124 ? -44.332 22.734  59.225  1.00 28.26 ? 155 TYR B OH    1 
ATOM   3393 N  N     . LEU B 1 125 ? -53.027 23.144  59.390  1.00 29.85 ? 156 LEU B N     1 
ATOM   3394 C  CA    . LEU B 1 125 ? -54.357 23.612  59.031  1.00 30.00 ? 156 LEU B CA    1 
ATOM   3395 C  C     . LEU B 1 125 ? -55.170 24.055  60.274  1.00 30.50 ? 156 LEU B C     1 
ATOM   3396 O  O     . LEU B 1 125 ? -55.916 25.039  60.207  1.00 30.90 ? 156 LEU B O     1 
ATOM   3397 C  CB    . LEU B 1 125 ? -55.078 22.560  58.170  1.00 29.96 ? 156 LEU B CB    1 
ATOM   3398 C  CG    . LEU B 1 125 ? -54.514 22.307  56.744  1.00 29.42 ? 156 LEU B CG    1 
ATOM   3399 C  CD1   . LEU B 1 125 ? -55.145 21.047  56.086  1.00 27.90 ? 156 LEU B CD1   1 
ATOM   3400 C  CD2   . LEU B 1 125 ? -54.723 23.491  55.828  1.00 27.16 ? 156 LEU B CD2   1 
ATOM   3401 N  N     . ASN B 1 126 ? -55.002 23.388  61.414  1.00 30.78 ? 157 ASN B N     1 
ATOM   3402 C  CA    . ASN B 1 126 ? -55.648 23.859  62.654  1.00 31.34 ? 157 ASN B CA    1 
ATOM   3403 C  C     . ASN B 1 126 ? -55.066 25.168  63.218  1.00 31.91 ? 157 ASN B C     1 
ATOM   3404 O  O     . ASN B 1 126 ? -55.740 25.868  63.985  1.00 32.57 ? 157 ASN B O     1 
ATOM   3405 C  CB    . ASN B 1 126 ? -55.634 22.769  63.734  1.00 31.10 ? 157 ASN B CB    1 
ATOM   3406 C  CG    . ASN B 1 126 ? -56.509 21.573  63.368  1.00 31.12 ? 157 ASN B CG    1 
ATOM   3407 O  OD1   . ASN B 1 126 ? -57.587 21.722  62.758  1.00 28.67 ? 157 ASN B OD1   1 
ATOM   3408 N  ND2   . ASN B 1 126 ? -56.040 20.373  63.720  1.00 29.58 ? 157 ASN B ND2   1 
ATOM   3409 N  N     . ASP B 1 127 ? -53.839 25.510  62.837  1.00 32.67 ? 158 ASP B N     1 
ATOM   3410 C  CA    . ASP B 1 127 ? -53.183 26.750  63.297  1.00 33.54 ? 158 ASP B CA    1 
ATOM   3411 C  C     . ASP B 1 127 ? -53.091 27.797  62.186  1.00 33.61 ? 158 ASP B C     1 
ATOM   3412 O  O     . ASP B 1 127 ? -52.177 28.626  62.159  1.00 32.79 ? 158 ASP B O     1 
ATOM   3413 C  CB    . ASP B 1 127 ? -51.756 26.456  63.806  1.00 33.83 ? 158 ASP B CB    1 
ATOM   3414 C  CG    . ASP B 1 127 ? -51.575 26.727  65.292  1.00 36.65 ? 158 ASP B CG    1 
ATOM   3415 O  OD1   . ASP B 1 127 ? -52.222 27.665  65.849  1.00 40.59 ? 158 ASP B OD1   1 
ATOM   3416 O  OD2   . ASP B 1 127 ? -50.734 26.010  65.906  1.00 40.04 ? 158 ASP B OD2   1 
ATOM   3417 N  N     . LEU B 1 128 ? -54.033 27.782  61.264  1.00 34.15 ? 159 LEU B N     1 
ATOM   3418 C  CA    . LEU B 1 128 ? -53.893 28.671  60.126  1.00 34.93 ? 159 LEU B CA    1 
ATOM   3419 C  C     . LEU B 1 128 ? -54.010 30.152  60.494  1.00 35.25 ? 159 LEU B C     1 
ATOM   3420 O  O     . LEU B 1 128 ? -53.389 30.980  59.827  1.00 35.33 ? 159 LEU B O     1 
ATOM   3421 C  CB    . LEU B 1 128 ? -54.829 28.299  58.973  1.00 35.09 ? 159 LEU B CB    1 
ATOM   3422 C  CG    . LEU B 1 128 ? -54.181 28.738  57.660  1.00 35.34 ? 159 LEU B CG    1 
ATOM   3423 C  CD1   . LEU B 1 128 ? -54.268 27.662  56.606  1.00 35.62 ? 159 LEU B CD1   1 
ATOM   3424 C  CD2   . LEU B 1 128 ? -54.822 30.040  57.210  1.00 36.71 ? 159 LEU B CD2   1 
ATOM   3425 N  N     . ASP B 1 129 ? -54.776 30.477  61.542  1.00 35.51 ? 160 ASP B N     1 
ATOM   3426 C  CA    . ASP B 1 129 ? -54.856 31.853  62.036  1.00 35.87 ? 160 ASP B CA    1 
ATOM   3427 C  C     . ASP B 1 129 ? -53.461 32.357  62.369  1.00 35.40 ? 160 ASP B C     1 
ATOM   3428 O  O     . ASP B 1 129 ? -53.093 33.463  61.982  1.00 35.91 ? 160 ASP B O     1 
ATOM   3429 C  CB    . ASP B 1 129 ? -55.774 31.962  63.275  1.00 36.20 ? 160 ASP B CB    1 
ATOM   3430 C  CG    . ASP B 1 129 ? -57.277 31.866  62.931  1.00 37.34 ? 160 ASP B CG    1 
ATOM   3431 O  OD1   . ASP B 1 129 ? -57.636 31.620  61.753  1.00 38.37 ? 160 ASP B OD1   1 
ATOM   3432 O  OD2   . ASP B 1 129 ? -58.105 32.028  63.860  1.00 39.03 ? 160 ASP B OD2   1 
ATOM   3433 N  N     . ARG B 1 130 ? -52.696 31.548  63.096  1.00 34.72 ? 161 ARG B N     1 
ATOM   3434 C  CA    . ARG B 1 130 ? -51.329 31.911  63.479  1.00 34.28 ? 161 ARG B CA    1 
ATOM   3435 C  C     . ARG B 1 130 ? -50.409 32.002  62.264  1.00 34.10 ? 161 ARG B C     1 
ATOM   3436 O  O     . ARG B 1 130 ? -49.664 32.970  62.115  1.00 33.89 ? 161 ARG B O     1 
ATOM   3437 C  CB    . ARG B 1 130 ? -50.767 30.887  64.471  1.00 34.14 ? 161 ARG B CB    1 
ATOM   3438 C  CG    . ARG B 1 130 ? -49.424 31.239  65.075  1.00 33.47 ? 161 ARG B CG    1 
ATOM   3439 C  CD    . ARG B 1 130 ? -49.073 30.261  66.188  1.00 33.40 ? 161 ARG B CD    1 
ATOM   3440 N  NE    . ARG B 1 130 ? -48.926 28.885  65.694  1.00 32.88 ? 161 ARG B NE    1 
ATOM   3441 C  CZ    . ARG B 1 130 ? -47.846 28.412  65.071  1.00 31.89 ? 161 ARG B CZ    1 
ATOM   3442 N  NH1   . ARG B 1 130 ? -46.786 29.177  64.865  1.00 31.90 ? 161 ARG B NH1   1 
ATOM   3443 N  NH2   . ARG B 1 130 ? -47.827 27.163  64.650  1.00 31.40 ? 161 ARG B NH2   1 
ATOM   3444 N  N     . ILE B 1 131 ? -50.471 30.980  61.414  1.00 33.96 ? 162 ILE B N     1 
ATOM   3445 C  CA    . ILE B 1 131 ? -49.571 30.829  60.273  1.00 34.20 ? 162 ILE B CA    1 
ATOM   3446 C  C     . ILE B 1 131 ? -49.818 31.909  59.207  1.00 34.05 ? 162 ILE B C     1 
ATOM   3447 O  O     . ILE B 1 131 ? -48.878 32.427  58.603  1.00 33.93 ? 162 ILE B O     1 
ATOM   3448 C  CB    . ILE B 1 131 ? -49.716 29.383  59.648  1.00 34.75 ? 162 ILE B CB    1 
ATOM   3449 C  CG1   . ILE B 1 131 ? -49.320 28.289  60.644  1.00 35.27 ? 162 ILE B CG1   1 
ATOM   3450 C  CG2   . ILE B 1 131 ? -48.887 29.193  58.405  1.00 35.27 ? 162 ILE B CG2   1 
ATOM   3451 C  CD1   . ILE B 1 131 ? -47.993 28.472  61.280  1.00 35.33 ? 162 ILE B CD1   1 
ATOM   3452 N  N     . ALA B 1 132 ? -51.079 32.268  58.988  1.00 34.03 ? 163 ALA B N     1 
ATOM   3453 C  CA    . ALA B 1 132 ? -51.434 33.255  57.948  1.00 34.03 ? 163 ALA B CA    1 
ATOM   3454 C  C     . ALA B 1 132 ? -51.180 34.716  58.301  1.00 34.14 ? 163 ALA B C     1 
ATOM   3455 O  O     . ALA B 1 132 ? -51.402 35.582  57.456  1.00 34.27 ? 163 ALA B O     1 
ATOM   3456 C  CB    . ALA B 1 132 ? -52.895 33.097  57.526  1.00 33.93 ? 163 ALA B CB    1 
ATOM   3457 N  N     . GLN B 1 133 ? -50.744 35.019  59.524  1.00 34.35 ? 164 GLN B N     1 
ATOM   3458 C  CA    . GLN B 1 133 ? -50.498 36.420  59.896  1.00 34.43 ? 164 GLN B CA    1 
ATOM   3459 C  C     . GLN B 1 133 ? -49.341 36.993  59.060  1.00 34.22 ? 164 GLN B C     1 
ATOM   3460 O  O     . GLN B 1 133 ? -48.358 36.306  58.811  1.00 34.19 ? 164 GLN B O     1 
ATOM   3461 C  CB    . GLN B 1 133 ? -50.196 36.558  61.395  1.00 34.56 ? 164 GLN B CB    1 
ATOM   3462 C  CG    . GLN B 1 133 ? -51.418 36.366  62.294  1.00 35.44 ? 164 GLN B CG    1 
ATOM   3463 C  CD    . GLN B 1 133 ? -52.496 37.418  62.057  1.00 36.65 ? 164 GLN B CD    1 
ATOM   3464 O  OE1   . GLN B 1 133 ? -52.203 38.534  61.637  1.00 37.73 ? 164 GLN B OE1   1 
ATOM   3465 N  NE2   . GLN B 1 133 ? -53.750 37.061  62.322  1.00 37.78 ? 164 GLN B NE2   1 
ATOM   3466 N  N     . PRO B 1 134 ? -49.456 38.253  58.617  1.00 34.16 ? 165 PRO B N     1 
ATOM   3467 C  CA    . PRO B 1 134 ? -48.380 38.842  57.821  1.00 34.08 ? 165 PRO B CA    1 
ATOM   3468 C  C     . PRO B 1 134 ? -46.992 38.702  58.450  1.00 33.74 ? 165 PRO B C     1 
ATOM   3469 O  O     . PRO B 1 134 ? -46.047 38.361  57.748  1.00 33.64 ? 165 PRO B O     1 
ATOM   3470 C  CB    . PRO B 1 134 ? -48.777 40.320  57.715  1.00 34.37 ? 165 PRO B CB    1 
ATOM   3471 C  CG    . PRO B 1 134 ? -50.249 40.326  57.894  1.00 34.60 ? 165 PRO B CG    1 
ATOM   3472 C  CD    . PRO B 1 134 ? -50.563 39.201  58.832  1.00 34.31 ? 165 PRO B CD    1 
ATOM   3473 N  N     . ASN B 1 135 ? -46.865 38.937  59.752  1.00 33.58 ? 166 ASN B N     1 
ATOM   3474 C  CA    . ASN B 1 135 ? -45.542 38.883  60.380  1.00 33.75 ? 166 ASN B CA    1 
ATOM   3475 C  C     . ASN B 1 135 ? -45.224 37.535  61.037  1.00 33.44 ? 166 ASN B C     1 
ATOM   3476 O  O     . ASN B 1 135 ? -44.491 37.444  62.029  1.00 33.84 ? 166 ASN B O     1 
ATOM   3477 C  CB    . ASN B 1 135 ? -45.330 40.102  61.276  1.00 33.88 ? 166 ASN B CB    1 
ATOM   3478 C  CG    . ASN B 1 135 ? -44.880 41.332  60.459  1.00 35.14 ? 166 ASN B CG    1 
ATOM   3479 O  OD1   . ASN B 1 135 ? -45.587 42.341  60.379  1.00 36.42 ? 166 ASN B OD1   1 
ATOM   3480 N  ND2   . ASN B 1 135 ? -43.711 41.223  59.818  1.00 35.38 ? 166 ASN B ND2   1 
ATOM   3481 N  N     . TYR B 1 136 ? -45.748 36.484  60.423  1.00 32.67 ? 167 TYR B N     1 
ATOM   3482 C  CA    . TYR B 1 136 ? -45.549 35.133  60.893  1.00 32.26 ? 167 TYR B CA    1 
ATOM   3483 C  C     . TYR B 1 136 ? -44.094 34.708  60.809  1.00 32.44 ? 167 TYR B C     1 
ATOM   3484 O  O     . TYR B 1 136 ? -43.477 34.757  59.735  1.00 32.36 ? 167 TYR B O     1 
ATOM   3485 C  CB    . TYR B 1 136 ? -46.359 34.156  60.048  1.00 31.67 ? 167 TYR B CB    1 
ATOM   3486 C  CG    . TYR B 1 136 ? -45.939 32.709  60.195  1.00 30.78 ? 167 TYR B CG    1 
ATOM   3487 C  CD1   . TYR B 1 136 ? -45.913 32.095  61.447  1.00 29.83 ? 167 TYR B CD1   1 
ATOM   3488 C  CD2   . TYR B 1 136 ? -45.621 31.938  59.072  1.00 30.00 ? 167 TYR B CD2   1 
ATOM   3489 C  CE1   . TYR B 1 136 ? -45.558 30.757  61.585  1.00 30.54 ? 167 TYR B CE1   1 
ATOM   3490 C  CE2   . TYR B 1 136 ? -45.273 30.604  59.192  1.00 30.52 ? 167 TYR B CE2   1 
ATOM   3491 C  CZ    . TYR B 1 136 ? -45.233 30.015  60.453  1.00 31.04 ? 167 TYR B CZ    1 
ATOM   3492 O  OH    . TYR B 1 136 ? -44.892 28.691  60.576  1.00 30.33 ? 167 TYR B OH    1 
ATOM   3493 N  N     . ILE B 1 137 ? -43.583 34.255  61.955  1.00 32.29 ? 168 ILE B N     1 
ATOM   3494 C  CA    . ILE B 1 137 ? -42.264 33.654  62.078  1.00 31.62 ? 168 ILE B CA    1 
ATOM   3495 C  C     . ILE B 1 137 ? -42.482 32.230  62.565  1.00 30.99 ? 168 ILE B C     1 
ATOM   3496 O  O     . ILE B 1 137 ? -43.045 32.028  63.638  1.00 30.90 ? 168 ILE B O     1 
ATOM   3497 C  CB    . ILE B 1 137 ? -41.399 34.460  63.094  1.00 31.96 ? 168 ILE B CB    1 
ATOM   3498 C  CG1   . ILE B 1 137 ? -41.231 35.897  62.596  1.00 31.19 ? 168 ILE B CG1   1 
ATOM   3499 C  CG2   . ILE B 1 137 ? -40.032 33.781  63.329  1.00 31.84 ? 168 ILE B CG2   1 
ATOM   3500 C  CD1   . ILE B 1 137 ? -40.185 36.688  63.352  1.00 31.98 ? 168 ILE B CD1   1 
ATOM   3501 N  N     . PRO B 1 138 ? -42.122 31.232  61.746  1.00 30.47 ? 169 PRO B N     1 
ATOM   3502 C  CA    . PRO B 1 138 ? -42.188 29.839  62.177  1.00 30.05 ? 169 PRO B CA    1 
ATOM   3503 C  C     . PRO B 1 138 ? -41.480 29.573  63.496  1.00 29.40 ? 169 PRO B C     1 
ATOM   3504 O  O     . PRO B 1 138 ? -40.360 30.004  63.679  1.00 29.63 ? 169 PRO B O     1 
ATOM   3505 C  CB    . PRO B 1 138 ? -41.487 29.102  61.035  1.00 30.01 ? 169 PRO B CB    1 
ATOM   3506 C  CG    . PRO B 1 138 ? -41.779 29.942  59.854  1.00 29.81 ? 169 PRO B CG    1 
ATOM   3507 C  CD    . PRO B 1 138 ? -41.712 31.336  60.335  1.00 30.51 ? 169 PRO B CD    1 
ATOM   3508 N  N     . THR B 1 139 ? -42.155 28.882  64.402  1.00 28.95 ? 170 THR B N     1 
ATOM   3509 C  CA    . THR B 1 139 ? -41.565 28.427  65.644  1.00 28.49 ? 170 THR B CA    1 
ATOM   3510 C  C     . THR B 1 139 ? -40.639 27.280  65.313  1.00 28.61 ? 170 THR B C     1 
ATOM   3511 O  O     . THR B 1 139 ? -40.694 26.718  64.211  1.00 28.87 ? 170 THR B O     1 
ATOM   3512 C  CB    . THR B 1 139 ? -42.651 27.911  66.607  1.00 28.81 ? 170 THR B CB    1 
ATOM   3513 O  OG1   . THR B 1 139 ? -43.387 26.840  65.965  1.00 29.71 ? 170 THR B OG1   1 
ATOM   3514 C  CG2   . THR B 1 139 ? -43.602 29.039  67.013  1.00 26.17 ? 170 THR B CG2   1 
ATOM   3515 N  N     . GLN B 1 140 ? -39.796 26.892  66.265  1.00 29.02 ? 171 GLN B N     1 
ATOM   3516 C  CA    . GLN B 1 140 ? -38.999 25.662  66.087  1.00 29.03 ? 171 GLN B CA    1 
ATOM   3517 C  C     . GLN B 1 140 ? -39.861 24.455  65.761  1.00 28.42 ? 171 GLN B C     1 
ATOM   3518 O  O     . GLN B 1 140 ? -39.484 23.670  64.918  1.00 28.93 ? 171 GLN B O     1 
ATOM   3519 C  CB    . GLN B 1 140 ? -38.127 25.339  67.299  1.00 29.39 ? 171 GLN B CB    1 
ATOM   3520 C  CG    . GLN B 1 140 ? -36.745 25.993  67.244  1.00 31.48 ? 171 GLN B CG    1 
ATOM   3521 C  CD    . GLN B 1 140 ? -35.673 25.227  68.019  1.00 33.35 ? 171 GLN B CD    1 
ATOM   3522 O  OE1   . GLN B 1 140 ? -35.946 24.230  68.709  1.00 33.03 ? 171 GLN B OE1   1 
ATOM   3523 N  NE2   . GLN B 1 140 ? -34.439 25.699  67.904  1.00 33.30 ? 171 GLN B NE2   1 
ATOM   3524 N  N     . GLN B 1 141 ? -41.010 24.305  66.412  1.00 28.11 ? 172 GLN B N     1 
ATOM   3525 C  CA    . GLN B 1 141 ? -41.868 23.143  66.176  1.00 27.97 ? 172 GLN B CA    1 
ATOM   3526 C  C     . GLN B 1 141 ? -42.405 23.159  64.752  1.00 27.88 ? 172 GLN B C     1 
ATOM   3527 O  O     . GLN B 1 141 ? -42.521 22.118  64.116  1.00 27.36 ? 172 GLN B O     1 
ATOM   3528 C  CB    . GLN B 1 141 ? -43.025 23.099  67.183  1.00 27.98 ? 172 GLN B CB    1 
ATOM   3529 C  CG    . GLN B 1 141 ? -44.114 22.014  66.913  1.00 28.43 ? 172 GLN B CG    1 
ATOM   3530 C  CD    . GLN B 1 141 ? -43.642 20.558  67.143  1.00 29.16 ? 172 GLN B CD    1 
ATOM   3531 O  OE1   . GLN B 1 141 ? -44.362 19.599  66.807  1.00 28.33 ? 172 GLN B OE1   1 
ATOM   3532 N  NE2   . GLN B 1 141 ? -42.459 20.394  67.747  1.00 26.12 ? 172 GLN B NE2   1 
ATOM   3533 N  N     . ASP B 1 142 ? -42.755 24.355  64.268  1.00 28.18 ? 173 ASP B N     1 
ATOM   3534 C  CA    . ASP B 1 142 ? -43.173 24.551  62.874  1.00 27.75 ? 173 ASP B CA    1 
ATOM   3535 C  C     . ASP B 1 142 ? -42.166 24.029  61.915  1.00 27.28 ? 173 ASP B C     1 
ATOM   3536 O  O     . ASP B 1 142 ? -42.528 23.432  60.912  1.00 27.18 ? 173 ASP B O     1 
ATOM   3537 C  CB    . ASP B 1 142 ? -43.340 26.034  62.554  1.00 28.06 ? 173 ASP B CB    1 
ATOM   3538 C  CG    . ASP B 1 142 ? -44.625 26.597  63.082  1.00 29.24 ? 173 ASP B CG    1 
ATOM   3539 O  OD1   . ASP B 1 142 ? -45.521 25.794  63.447  1.00 31.09 ? 173 ASP B OD1   1 
ATOM   3540 O  OD2   . ASP B 1 142 ? -44.741 27.830  63.112  1.00 27.40 ? 173 ASP B OD2   1 
ATOM   3541 N  N     . VAL B 1 143 ? -40.896 24.293  62.199  1.00 27.03 ? 174 VAL B N     1 
ATOM   3542 C  CA    . VAL B 1 143 ? -39.817 23.816  61.319  1.00 26.66 ? 174 VAL B CA    1 
ATOM   3543 C  C     . VAL B 1 143 ? -39.721 22.306  61.406  1.00 26.60 ? 174 VAL B C     1 
ATOM   3544 O  O     . VAL B 1 143 ? -39.630 21.633  60.375  1.00 26.96 ? 174 VAL B O     1 
ATOM   3545 C  CB    . VAL B 1 143 ? -38.432 24.427  61.642  1.00 26.76 ? 174 VAL B CB    1 
ATOM   3546 C  CG1   . VAL B 1 143 ? -37.337 23.713  60.886  1.00 24.73 ? 174 VAL B CG1   1 
ATOM   3547 C  CG2   . VAL B 1 143 ? -38.405 25.940  61.342  1.00 27.02 ? 174 VAL B CG2   1 
ATOM   3548 N  N     . LEU B 1 144 ? -39.762 21.767  62.626  1.00 26.54 ? 175 LEU B N     1 
ATOM   3549 C  CA    . LEU B 1 144 ? -39.673 20.307  62.829  1.00 26.46 ? 175 LEU B CA    1 
ATOM   3550 C  C     . LEU B 1 144 ? -40.802 19.559  62.120  1.00 26.70 ? 175 LEU B C     1 
ATOM   3551 O  O     . LEU B 1 144 ? -40.584 18.449  61.638  1.00 25.94 ? 175 LEU B O     1 
ATOM   3552 C  CB    . LEU B 1 144 ? -39.672 19.947  64.318  1.00 26.09 ? 175 LEU B CB    1 
ATOM   3553 C  CG    . LEU B 1 144 ? -38.363 20.248  65.045  1.00 25.20 ? 175 LEU B CG    1 
ATOM   3554 C  CD1   . LEU B 1 144 ? -38.594 20.376  66.555  1.00 20.03 ? 175 LEU B CD1   1 
ATOM   3555 C  CD2   . LEU B 1 144 ? -37.290 19.163  64.674  1.00 21.98 ? 175 LEU B CD2   1 
ATOM   3556 N  N     . ARG B 1 145 ? -41.980 20.193  62.040  1.00 26.98 ? 176 ARG B N     1 
ATOM   3557 C  CA    . ARG B 1 145 ? -43.154 19.616  61.376  1.00 27.45 ? 176 ARG B CA    1 
ATOM   3558 C  C     . ARG B 1 145 ? -43.101 19.669  59.849  1.00 27.52 ? 176 ARG B C     1 
ATOM   3559 O  O     . ARG B 1 145 ? -43.950 19.038  59.179  1.00 27.58 ? 176 ARG B O     1 
ATOM   3560 C  CB    . ARG B 1 145 ? -44.435 20.328  61.825  1.00 27.84 ? 176 ARG B CB    1 
ATOM   3561 C  CG    . ARG B 1 145 ? -44.834 20.060  63.299  1.00 28.99 ? 176 ARG B CG    1 
ATOM   3562 C  CD    . ARG B 1 145 ? -45.508 18.736  63.478  1.00 28.05 ? 176 ARG B CD    1 
ATOM   3563 N  NE    . ARG B 1 145 ? -45.806 18.497  64.884  1.00 28.34 ? 176 ARG B NE    1 
ATOM   3564 C  CZ    . ARG B 1 145 ? -46.850 17.794  65.346  1.00 28.11 ? 176 ARG B CZ    1 
ATOM   3565 N  NH1   . ARG B 1 145 ? -47.716 17.207  64.533  1.00 27.11 ? 176 ARG B NH1   1 
ATOM   3566 N  NH2   . ARG B 1 145 ? -47.037 17.679  66.655  1.00 29.09 ? 176 ARG B NH2   1 
ATOM   3567 N  N     . THR B 1 146 ? -42.152 20.424  59.278  1.00 27.43 ? 177 THR B N     1 
ATOM   3568 C  CA    . THR B 1 146 ? -42.136 20.596  57.815  1.00 27.23 ? 177 THR B CA    1 
ATOM   3569 C  C     . THR B 1 146 ? -41.710 19.320  57.101  1.00 27.35 ? 177 THR B C     1 
ATOM   3570 O  O     . THR B 1 146 ? -40.988 18.479  57.646  1.00 26.75 ? 177 THR B O     1 
ATOM   3571 C  CB    . THR B 1 146 ? -41.166 21.712  57.302  1.00 27.77 ? 177 THR B CB    1 
ATOM   3572 O  OG1   . THR B 1 146 ? -39.811 21.344  57.594  1.00 27.70 ? 177 THR B OG1   1 
ATOM   3573 C  CG2   . THR B 1 146 ? -41.513 23.090  57.859  1.00 26.41 ? 177 THR B CG2   1 
ATOM   3574 N  N     . ARG B 1 147 ? -42.127 19.228  55.845  1.00 27.96 ? 178 ARG B N     1 
ATOM   3575 C  CA    . ARG B 1 147 ? -41.904 18.059  55.014  1.00 28.25 ? 178 ARG B CA    1 
ATOM   3576 C  C     . ARG B 1 147 ? -41.130 18.481  53.792  1.00 28.47 ? 178 ARG B C     1 
ATOM   3577 O  O     . ARG B 1 147 ? -41.593 19.337  53.035  1.00 28.87 ? 178 ARG B O     1 
ATOM   3578 C  CB    . ARG B 1 147 ? -43.250 17.441  54.595  1.00 28.64 ? 178 ARG B CB    1 
ATOM   3579 C  CG    . ARG B 1 147 ? -43.191 16.314  53.561  1.00 29.33 ? 178 ARG B CG    1 
ATOM   3580 C  CD    . ARG B 1 147 ? -42.198 15.221  54.033  1.00 30.76 ? 178 ARG B CD    1 
ATOM   3581 N  NE    . ARG B 1 147 ? -41.979 14.198  53.012  1.00 31.61 ? 178 ARG B NE    1 
ATOM   3582 C  CZ    . ARG B 1 147 ? -40.974 13.328  53.007  1.00 29.98 ? 178 ARG B CZ    1 
ATOM   3583 N  NH1   . ARG B 1 147 ? -40.073 13.349  53.966  1.00 28.75 ? 178 ARG B NH1   1 
ATOM   3584 N  NH2   . ARG B 1 147 ? -40.899 12.412  52.042  1.00 30.94 ? 178 ARG B NH2   1 
ATOM   3585 N  N     . VAL B 1 148 ? -39.958 17.876  53.616  1.00 28.68 ? 179 VAL B N     1 
ATOM   3586 C  CA    . VAL B 1 148 ? -39.170 18.005  52.401  1.00 28.90 ? 179 VAL B CA    1 
ATOM   3587 C  C     . VAL B 1 148 ? -38.591 16.639  52.066  1.00 29.15 ? 179 VAL B C     1 
ATOM   3588 O  O     . VAL B 1 148 ? -37.902 16.008  52.883  1.00 29.06 ? 179 VAL B O     1 
ATOM   3589 C  CB    . VAL B 1 148 ? -38.046 19.086  52.525  1.00 30.25 ? 179 VAL B CB    1 
ATOM   3590 C  CG1   . VAL B 1 148 ? -37.117 19.095  51.245  1.00 29.48 ? 179 VAL B CG1   1 
ATOM   3591 C  CG2   . VAL B 1 148 ? -38.667 20.526  52.771  1.00 27.52 ? 179 VAL B CG2   1 
ATOM   3592 N  N     . LYS B 1 149 ? -38.920 16.147  50.871  1.00 29.43 ? 180 LYS B N     1 
ATOM   3593 C  CA    . LYS B 1 149 ? -38.476 14.813  50.444  1.00 29.00 ? 180 LYS B CA    1 
ATOM   3594 C  C     . LYS B 1 149 ? -36.962 14.875  50.253  1.00 28.72 ? 180 LYS B C     1 
ATOM   3595 O  O     . LYS B 1 149 ? -36.453 15.764  49.582  1.00 27.97 ? 180 LYS B O     1 
ATOM   3596 C  CB    . LYS B 1 149 ? -39.193 14.375  49.163  1.00 29.41 ? 180 LYS B CB    1 
ATOM   3597 C  CG    . LYS B 1 149 ? -39.021 12.894  48.734  1.00 30.41 ? 180 LYS B CG    1 
ATOM   3598 C  CD    . LYS B 1 149 ? -39.848 12.523  47.445  1.00 28.85 ? 180 LYS B CD    1 
ATOM   3599 N  N     . THR B 1 150 ? -36.253 13.969  50.921  1.00 28.69 ? 181 THR B N     1 
ATOM   3600 C  CA    . THR B 1 150 ? -34.817 13.836  50.769  1.00 28.46 ? 181 THR B CA    1 
ATOM   3601 C  C     . THR B 1 150 ? -34.501 12.892  49.636  1.00 28.75 ? 181 THR B C     1 
ATOM   3602 O  O     . THR B 1 150 ? -35.064 11.781  49.561  1.00 27.93 ? 181 THR B O     1 
ATOM   3603 C  CB    . THR B 1 150 ? -34.143 13.252  52.002  1.00 28.70 ? 181 THR B CB    1 
ATOM   3604 O  OG1   . THR B 1 150 ? -34.812 13.693  53.193  1.00 29.39 ? 181 THR B OG1   1 
ATOM   3605 C  CG2   . THR B 1 150 ? -32.684 13.666  52.036  1.00 28.86 ? 181 THR B CG2   1 
ATOM   3606 N  N     . THR B 1 151 ? -33.628 13.345  48.730  1.00 29.26 ? 182 THR B N     1 
ATOM   3607 C  CA    . THR B 1 151 ? -33.007 12.468  47.755  1.00 29.11 ? 182 THR B CA    1 
ATOM   3608 C  C     . THR B 1 151 ? -31.508 12.447  47.978  1.00 29.37 ? 182 THR B C     1 
ATOM   3609 O  O     . THR B 1 151 ? -30.895 13.480  48.233  1.00 29.47 ? 182 THR B O     1 
ATOM   3610 C  CB    . THR B 1 151 ? -33.252 12.889  46.304  1.00 29.41 ? 182 THR B CB    1 
ATOM   3611 O  OG1   . THR B 1 151 ? -32.536 11.994  45.418  1.00 30.40 ? 182 THR B OG1   1 
ATOM   3612 C  CG2   . THR B 1 151 ? -32.768 14.284  46.054  1.00 29.12 ? 182 THR B CG2   1 
ATOM   3613 N  N     . GLY B 1 152 ? -30.918 11.266  47.830  1.00 29.95 ? 183 GLY B N     1 
ATOM   3614 C  CA    . GLY B 1 152 ? -29.462 11.093  47.889  1.00 30.12 ? 183 GLY B CA    1 
ATOM   3615 C  C     . GLY B 1 152 ? -28.958 10.751  49.291  1.00 30.46 ? 183 GLY B C     1 
ATOM   3616 O  O     . GLY B 1 152 ? -29.653 10.156  50.106  1.00 30.82 ? 183 GLY B O     1 
ATOM   3617 N  N     . ILE B 1 153 ? -27.726 11.124  49.575  1.00 30.69 ? 184 ILE B N     1 
ATOM   3618 C  CA    . ILE B 1 153 ? -27.138 10.884  50.882  1.00 30.62 ? 184 ILE B CA    1 
ATOM   3619 C  C     . ILE B 1 153 ? -26.450 12.154  51.296  1.00 30.41 ? 184 ILE B C     1 
ATOM   3620 O  O     . ILE B 1 153 ? -25.669 12.710  50.527  1.00 30.67 ? 184 ILE B O     1 
ATOM   3621 C  CB    . ILE B 1 153 ? -26.110 9.722   50.874  1.00 30.65 ? 184 ILE B CB    1 
ATOM   3622 C  CG1   . ILE B 1 153 ? -26.736 8.457   50.258  1.00 30.13 ? 184 ILE B CG1   1 
ATOM   3623 C  CG2   . ILE B 1 153 ? -25.628 9.452   52.300  1.00 30.11 ? 184 ILE B CG2   1 
ATOM   3624 C  CD1   . ILE B 1 153 ? -25.750 7.408   49.865  1.00 29.77 ? 184 ILE B CD1   1 
ATOM   3625 N  N     . VAL B 1 154 ? -26.762 12.598  52.506  1.00 30.48 ? 185 VAL B N     1 
ATOM   3626 C  CA    . VAL B 1 154 ? -26.302 13.860  53.040  1.00 30.61 ? 185 VAL B CA    1 
ATOM   3627 C  C     . VAL B 1 154 ? -25.588 13.595  54.361  1.00 31.26 ? 185 VAL B C     1 
ATOM   3628 O  O     . VAL B 1 154 ? -26.154 12.952  55.241  1.00 30.61 ? 185 VAL B O     1 
ATOM   3629 C  CB    . VAL B 1 154 ? -27.510 14.776  53.303  1.00 30.86 ? 185 VAL B CB    1 
ATOM   3630 C  CG1   . VAL B 1 154 ? -27.055 16.203  53.663  1.00 29.77 ? 185 VAL B CG1   1 
ATOM   3631 C  CG2   . VAL B 1 154 ? -28.455 14.764  52.086  1.00 29.74 ? 185 VAL B CG2   1 
ATOM   3632 N  N     . GLU B 1 155 ? -24.362 14.111  54.480  1.00 32.25 ? 186 GLU B N     1 
ATOM   3633 C  CA    . GLU B 1 155 ? -23.483 13.901  55.634  1.00 33.09 ? 186 GLU B CA    1 
ATOM   3634 C  C     . GLU B 1 155 ? -23.473 15.133  56.538  1.00 33.22 ? 186 GLU B C     1 
ATOM   3635 O  O     . GLU B 1 155 ? -23.367 16.243  56.051  1.00 33.54 ? 186 GLU B O     1 
ATOM   3636 C  CB    . GLU B 1 155 ? -22.062 13.620  55.136  1.00 32.94 ? 186 GLU B CB    1 
ATOM   3637 C  CG    . GLU B 1 155 ? -21.047 13.372  56.231  1.00 33.92 ? 186 GLU B CG    1 
ATOM   3638 C  CD    . GLU B 1 155 ? -19.658 13.058  55.706  1.00 34.07 ? 186 GLU B CD    1 
ATOM   3639 O  OE1   . GLU B 1 155 ? -19.466 12.966  54.479  1.00 35.86 ? 186 GLU B OE1   1 
ATOM   3640 O  OE2   . GLU B 1 155 ? -18.745 12.905  56.537  1.00 36.77 ? 186 GLU B OE2   1 
ATOM   3641 N  N     . THR B 1 156 ? -23.560 14.923  57.850  1.00 33.68 ? 187 THR B N     1 
ATOM   3642 C  CA    . THR B 1 156 ? -23.582 15.997  58.849  1.00 33.81 ? 187 THR B CA    1 
ATOM   3643 C  C     . THR B 1 156 ? -22.583 15.626  59.916  1.00 33.38 ? 187 THR B C     1 
ATOM   3644 O  O     . THR B 1 156 ? -22.463 14.452  60.238  1.00 33.36 ? 187 THR B O     1 
ATOM   3645 C  CB    . THR B 1 156 ? -24.958 16.088  59.570  1.00 34.24 ? 187 THR B CB    1 
ATOM   3646 O  OG1   . THR B 1 156 ? -25.982 16.434  58.635  1.00 36.89 ? 187 THR B OG1   1 
ATOM   3647 C  CG2   . THR B 1 156 ? -24.949 17.144  60.689  1.00 34.32 ? 187 THR B CG2   1 
ATOM   3648 N  N     . HIS B 1 157 ? -21.907 16.624  60.489  1.00 32.96 ? 188 HIS B N     1 
ATOM   3649 C  CA    . HIS B 1 157 ? -20.973 16.418  61.588  1.00 32.84 ? 188 HIS B CA    1 
ATOM   3650 C  C     . HIS B 1 157 ? -21.410 17.121  62.883  1.00 32.54 ? 188 HIS B C     1 
ATOM   3651 O  O     . HIS B 1 157 ? -21.946 18.221  62.858  1.00 32.32 ? 188 HIS B O     1 
ATOM   3652 C  CB    . HIS B 1 157 ? -19.587 16.905  61.188  1.00 32.93 ? 188 HIS B CB    1 
ATOM   3653 C  CG    . HIS B 1 157 ? -18.997 16.144  60.044  1.00 33.26 ? 188 HIS B CG    1 
ATOM   3654 N  ND1   . HIS B 1 157 ? -17.882 16.576  59.364  1.00 32.50 ? 188 HIS B ND1   1 
ATOM   3655 C  CD2   . HIS B 1 157 ? -19.373 14.982  59.455  1.00 33.23 ? 188 HIS B CD2   1 
ATOM   3656 C  CE1   . HIS B 1 157 ? -17.586 15.704  58.416  1.00 33.55 ? 188 HIS B CE1   1 
ATOM   3657 N  NE2   . HIS B 1 157 ? -18.477 14.730  58.447  1.00 33.23 ? 188 HIS B NE2   1 
ATOM   3658 N  N     . PHE B 1 158 ? -21.194 16.456  64.012  1.00 32.09 ? 189 PHE B N     1 
ATOM   3659 C  CA    . PHE B 1 158 ? -21.434 17.048  65.320  1.00 31.76 ? 189 PHE B CA    1 
ATOM   3660 C  C     . PHE B 1 158 ? -20.744 16.239  66.401  1.00 31.54 ? 189 PHE B C     1 
ATOM   3661 O  O     . PHE B 1 158 ? -20.428 15.072  66.215  1.00 31.57 ? 189 PHE B O     1 
ATOM   3662 C  CB    . PHE B 1 158 ? -22.929 17.205  65.644  1.00 31.69 ? 189 PHE B CB    1 
ATOM   3663 C  CG    . PHE B 1 158 ? -23.704 15.907  65.701  1.00 31.97 ? 189 PHE B CG    1 
ATOM   3664 C  CD1   . PHE B 1 158 ? -23.763 15.167  66.868  1.00 32.19 ? 189 PHE B CD1   1 
ATOM   3665 C  CD2   . PHE B 1 158 ? -24.402 15.449  64.592  1.00 32.33 ? 189 PHE B CD2   1 
ATOM   3666 C  CE1   . PHE B 1 158 ? -24.471 13.993  66.928  1.00 31.68 ? 189 PHE B CE1   1 
ATOM   3667 C  CE2   . PHE B 1 158 ? -25.130 14.278  64.647  1.00 31.69 ? 189 PHE B CE2   1 
ATOM   3668 C  CZ    . PHE B 1 158 ? -25.176 13.551  65.813  1.00 31.63 ? 189 PHE B CZ    1 
ATOM   3669 N  N     . THR B 1 159 ? -20.512 16.885  67.528  1.00 31.32 ? 190 THR B N     1 
ATOM   3670 C  CA    . THR B 1 159 ? -19.782 16.294  68.628  1.00 31.29 ? 190 THR B CA    1 
ATOM   3671 C  C     . THR B 1 159 ? -20.699 16.103  69.808  1.00 31.09 ? 190 THR B C     1 
ATOM   3672 O  O     . THR B 1 159 ? -21.507 16.956  70.088  1.00 30.80 ? 190 THR B O     1 
ATOM   3673 C  CB    . THR B 1 159 ? -18.630 17.211  69.024  1.00 30.86 ? 190 THR B CB    1 
ATOM   3674 O  OG1   . THR B 1 159 ? -17.714 17.265  67.930  1.00 30.44 ? 190 THR B OG1   1 
ATOM   3675 C  CG2   . THR B 1 159 ? -17.913 16.700  70.268  1.00 30.73 ? 190 THR B CG2   1 
ATOM   3676 N  N     . PHE B 1 160 ? -20.587 14.967  70.483  1.00 31.50 ? 191 PHE B N     1 
ATOM   3677 C  CA    . PHE B 1 160 ? -21.415 14.693  71.651  1.00 31.61 ? 191 PHE B CA    1 
ATOM   3678 C  C     . PHE B 1 160 ? -20.735 13.687  72.559  1.00 31.62 ? 191 PHE B C     1 
ATOM   3679 O  O     . PHE B 1 160 ? -20.299 12.642  72.100  1.00 31.56 ? 191 PHE B O     1 
ATOM   3680 C  CB    . PHE B 1 160 ? -22.792 14.200  71.206  1.00 31.60 ? 191 PHE B CB    1 
ATOM   3681 C  CG    . PHE B 1 160 ? -23.771 13.980  72.339  1.00 31.99 ? 191 PHE B CG    1 
ATOM   3682 C  CD1   . PHE B 1 160 ? -23.944 14.937  73.338  1.00 32.42 ? 191 PHE B CD1   1 
ATOM   3683 C  CD2   . PHE B 1 160 ? -24.547 12.827  72.386  1.00 31.91 ? 191 PHE B CD2   1 
ATOM   3684 C  CE1   . PHE B 1 160 ? -24.853 14.727  74.374  1.00 32.23 ? 191 PHE B CE1   1 
ATOM   3685 C  CE2   . PHE B 1 160 ? -25.459 12.618  73.416  1.00 32.04 ? 191 PHE B CE2   1 
ATOM   3686 C  CZ    . PHE B 1 160 ? -25.607 13.560  74.409  1.00 31.73 ? 191 PHE B CZ    1 
ATOM   3687 N  N     . LYS B 1 161 ? -20.652 14.021  73.847  1.00 31.88 ? 192 LYS B N     1 
ATOM   3688 C  CA    . LYS B 1 161 ? -19.910 13.229  74.843  1.00 32.08 ? 192 LYS B CA    1 
ATOM   3689 C  C     . LYS B 1 161 ? -18.518 12.877  74.327  1.00 31.88 ? 192 LYS B C     1 
ATOM   3690 O  O     . LYS B 1 161 ? -18.054 11.737  74.475  1.00 31.66 ? 192 LYS B O     1 
ATOM   3691 C  CB    . LYS B 1 161 ? -20.693 11.981  75.263  1.00 32.41 ? 192 LYS B CB    1 
ATOM   3692 C  CG    . LYS B 1 161 ? -22.127 12.279  75.697  1.00 33.51 ? 192 LYS B CG    1 
ATOM   3693 C  CD    . LYS B 1 161 ? -22.658 11.210  76.651  1.00 35.62 ? 192 LYS B CD    1 
ATOM   3694 C  CE    . LYS B 1 161 ? -24.197 11.243  76.756  1.00 36.78 ? 192 LYS B CE    1 
ATOM   3695 N  NZ    . LYS B 1 161 ? -24.724 10.083  77.553  1.00 37.12 ? 192 LYS B NZ    1 
ATOM   3696 N  N     . ASP B 1 162 ? -17.880 13.886  73.717  1.00 31.77 ? 193 ASP B N     1 
ATOM   3697 C  CA    . ASP B 1 162 ? -16.515 13.805  73.180  1.00 31.49 ? 193 ASP B CA    1 
ATOM   3698 C  C     . ASP B 1 162 ? -16.355 12.792  72.045  1.00 31.06 ? 193 ASP B C     1 
ATOM   3699 O  O     . ASP B 1 162 ? -15.249 12.311  71.791  1.00 31.50 ? 193 ASP B O     1 
ATOM   3700 C  CB    . ASP B 1 162 ? -15.513 13.561  74.321  1.00 31.48 ? 193 ASP B CB    1 
ATOM   3701 C  CG    . ASP B 1 162 ? -15.611 14.625  75.441  1.00 32.41 ? 193 ASP B CG    1 
ATOM   3702 O  OD1   . ASP B 1 162 ? -15.941 15.810  75.170  1.00 31.05 ? 193 ASP B OD1   1 
ATOM   3703 O  OD2   . ASP B 1 162 ? -15.338 14.270  76.609  1.00 35.11 ? 193 ASP B OD2   1 
ATOM   3704 N  N     . LEU B 1 163 ? -17.454 12.488  71.358  1.00 30.58 ? 194 LEU B N     1 
ATOM   3705 C  CA    . LEU B 1 163 ? -17.437 11.600  70.197  1.00 30.50 ? 194 LEU B CA    1 
ATOM   3706 C  C     . LEU B 1 163 ? -17.760 12.427  68.959  1.00 30.52 ? 194 LEU B C     1 
ATOM   3707 O  O     . LEU B 1 163 ? -18.634 13.289  68.989  1.00 30.33 ? 194 LEU B O     1 
ATOM   3708 C  CB    . LEU B 1 163 ? -18.443 10.471  70.377  1.00 30.23 ? 194 LEU B CB    1 
ATOM   3709 C  CG    . LEU B 1 163 ? -18.156 9.595   71.607  1.00 31.10 ? 194 LEU B CG    1 
ATOM   3710 C  CD1   . LEU B 1 163 ? -19.352 8.730   71.955  1.00 29.07 ? 194 LEU B CD1   1 
ATOM   3711 C  CD2   . LEU B 1 163 ? -16.881 8.734   71.402  1.00 30.56 ? 194 LEU B CD2   1 
ATOM   3712 N  N     . HIS B 1 164 ? -17.045 12.183  67.871  1.00 30.47 ? 195 HIS B N     1 
ATOM   3713 C  CA    . HIS B 1 164 ? -17.254 12.968  66.680  1.00 30.90 ? 195 HIS B CA    1 
ATOM   3714 C  C     . HIS B 1 164 ? -18.108 12.144  65.745  1.00 30.67 ? 195 HIS B C     1 
ATOM   3715 O  O     . HIS B 1 164 ? -17.639 11.149  65.192  1.00 31.01 ? 195 HIS B O     1 
ATOM   3716 C  CB    . HIS B 1 164 ? -15.909 13.384  66.081  1.00 31.43 ? 195 HIS B CB    1 
ATOM   3717 C  CG    . HIS B 1 164 ? -15.024 14.080  67.070  1.00 33.26 ? 195 HIS B CG    1 
ATOM   3718 N  ND1   . HIS B 1 164 ? -15.053 15.446  67.263  1.00 34.93 ? 195 HIS B ND1   1 
ATOM   3719 C  CD2   . HIS B 1 164 ? -14.134 13.593  67.969  1.00 35.31 ? 195 HIS B CD2   1 
ATOM   3720 C  CE1   . HIS B 1 164 ? -14.199 15.774  68.218  1.00 35.91 ? 195 HIS B CE1   1 
ATOM   3721 N  NE2   . HIS B 1 164 ? -13.632 14.667  68.668  1.00 36.18 ? 195 HIS B NE2   1 
ATOM   3722 N  N     . PHE B 1 165 ? -19.371 12.548  65.612  1.00 30.02 ? 196 PHE B N     1 
ATOM   3723 C  CA    . PHE B 1 165 ? -20.340 11.844  64.803  1.00 29.81 ? 196 PHE B CA    1 
ATOM   3724 C  C     . PHE B 1 165 ? -20.253 12.270  63.364  1.00 29.57 ? 196 PHE B C     1 
ATOM   3725 O  O     . PHE B 1 165 ? -20.345 13.450  63.067  1.00 29.46 ? 196 PHE B O     1 
ATOM   3726 C  CB    . PHE B 1 165 ? -21.762 12.137  65.298  1.00 29.70 ? 196 PHE B CB    1 
ATOM   3727 C  CG    . PHE B 1 165 ? -22.155 11.376  66.526  1.00 29.76 ? 196 PHE B CG    1 
ATOM   3728 C  CD1   . PHE B 1 165 ? -21.776 11.820  67.790  1.00 29.59 ? 196 PHE B CD1   1 
ATOM   3729 C  CD2   . PHE B 1 165 ? -22.915 10.225  66.426  1.00 29.09 ? 196 PHE B CD2   1 
ATOM   3730 C  CE1   . PHE B 1 165 ? -22.152 11.126  68.935  1.00 29.24 ? 196 PHE B CE1   1 
ATOM   3731 C  CE2   . PHE B 1 165 ? -23.299 9.535   67.576  1.00 29.97 ? 196 PHE B CE2   1 
ATOM   3732 C  CZ    . PHE B 1 165 ? -22.913 9.996   68.835  1.00 28.53 ? 196 PHE B CZ    1 
ATOM   3733 N  N     . LYS B 1 166 ? -20.096 11.303  62.472  1.00 29.84 ? 197 LYS B N     1 
ATOM   3734 C  CA    . LYS B 1 166 ? -20.307 11.532  61.052  1.00 30.20 ? 197 LYS B CA    1 
ATOM   3735 C  C     . LYS B 1 166 ? -21.649 10.881  60.734  1.00 30.23 ? 197 LYS B C     1 
ATOM   3736 O  O     . LYS B 1 166 ? -21.765 9.662   60.629  1.00 30.37 ? 197 LYS B O     1 
ATOM   3737 C  CB    . LYS B 1 166 ? -19.174 10.953  60.206  1.00 30.32 ? 197 LYS B CB    1 
ATOM   3738 C  CG    . LYS B 1 166 ? -17.763 11.233  60.733  1.00 31.19 ? 197 LYS B CG    1 
ATOM   3739 C  CD    . LYS B 1 166 ? -17.430 12.731  60.948  1.00 32.10 ? 197 LYS B CD    1 
ATOM   3740 C  CE    . LYS B 1 166 ? -16.141 12.873  61.810  1.00 33.03 ? 197 LYS B CE    1 
ATOM   3741 N  NZ    . LYS B 1 166 ? -15.672 14.269  62.073  1.00 32.65 ? 197 LYS B NZ    1 
ATOM   3742 N  N     . MET B 1 167 ? -22.660 11.723  60.592  1.00 30.28 ? 198 MET B N     1 
ATOM   3743 C  CA    . MET B 1 167 ? -24.029 11.286  60.434  1.00 30.57 ? 198 MET B CA    1 
ATOM   3744 C  C     . MET B 1 167 ? -24.504 11.366  58.980  1.00 30.89 ? 198 MET B C     1 
ATOM   3745 O  O     . MET B 1 167 ? -24.391 12.408  58.299  1.00 31.20 ? 198 MET B O     1 
ATOM   3746 C  CB    . MET B 1 167 ? -24.918 12.172  61.306  1.00 30.44 ? 198 MET B CB    1 
ATOM   3747 C  CG    . MET B 1 167 ? -26.365 11.738  61.348  1.00 30.47 ? 198 MET B CG    1 
ATOM   3748 S  SD    . MET B 1 167 ? -27.385 12.895  62.284  1.00 31.46 ? 198 MET B SD    1 
ATOM   3749 C  CE    . MET B 1 167 ? -28.058 11.752  63.491  1.00 28.53 ? 198 MET B CE    1 
ATOM   3750 N  N     . PHE B 1 168 ? -25.058 10.263  58.503  1.00 31.17 ? 199 PHE B N     1 
ATOM   3751 C  CA    . PHE B 1 168 ? -25.516 10.171  57.126  1.00 30.81 ? 199 PHE B CA    1 
ATOM   3752 C  C     . PHE B 1 168 ? -27.002 9.969   57.130  1.00 30.68 ? 199 PHE B C     1 
ATOM   3753 O  O     . PHE B 1 168 ? -27.494 9.043   57.751  1.00 30.95 ? 199 PHE B O     1 
ATOM   3754 C  CB    . PHE B 1 168 ? -24.817 9.015   56.446  1.00 30.44 ? 199 PHE B CB    1 
ATOM   3755 C  CG    . PHE B 1 168 ? -23.353 9.228   56.277  1.00 30.27 ? 199 PHE B CG    1 
ATOM   3756 C  CD1   . PHE B 1 168 ? -22.839 9.689   55.065  1.00 29.77 ? 199 PHE B CD1   1 
ATOM   3757 C  CD2   . PHE B 1 168 ? -22.475 8.971   57.328  1.00 30.33 ? 199 PHE B CD2   1 
ATOM   3758 C  CE1   . PHE B 1 168 ? -21.475 9.891   54.894  1.00 29.09 ? 199 PHE B CE1   1 
ATOM   3759 C  CE2   . PHE B 1 168 ? -21.106 9.164   57.166  1.00 30.78 ? 199 PHE B CE2   1 
ATOM   3760 C  CZ    . PHE B 1 168 ? -20.605 9.620   55.934  1.00 30.16 ? 199 PHE B CZ    1 
ATOM   3761 N  N     . ASP B 1 169 ? -27.699 10.869  56.460  1.00 30.95 ? 200 ASP B N     1 
ATOM   3762 C  CA    . ASP B 1 169 ? -29.150 10.856  56.315  1.00 31.29 ? 200 ASP B CA    1 
ATOM   3763 C  C     . ASP B 1 169 ? -29.430 10.475  54.843  1.00 30.91 ? 200 ASP B C     1 
ATOM   3764 O  O     . ASP B 1 169 ? -28.800 11.020  53.937  1.00 30.87 ? 200 ASP B O     1 
ATOM   3765 C  CB    . ASP B 1 169 ? -29.678 12.263  56.649  1.00 31.34 ? 200 ASP B CB    1 
ATOM   3766 C  CG    . ASP B 1 169 ? -31.189 12.404  56.478  1.00 32.96 ? 200 ASP B CG    1 
ATOM   3767 O  OD1   . ASP B 1 169 ? -31.899 11.388  56.567  1.00 36.00 ? 200 ASP B OD1   1 
ATOM   3768 O  OD2   . ASP B 1 169 ? -31.679 13.544  56.269  1.00 34.74 ? 200 ASP B OD2   1 
ATOM   3769 N  N     . VAL B 1 170 ? -30.358 9.551   54.610  1.00 30.40 ? 201 VAL B N     1 
ATOM   3770 C  CA    . VAL B 1 170 ? -30.656 9.074   53.251  1.00 30.13 ? 201 VAL B CA    1 
ATOM   3771 C  C     . VAL B 1 170 ? -32.140 9.185   52.896  1.00 30.15 ? 201 VAL B C     1 
ATOM   3772 O  O     . VAL B 1 170 ? -32.977 9.446   53.741  1.00 30.07 ? 201 VAL B O     1 
ATOM   3773 C  CB    . VAL B 1 170 ? -30.214 7.608   53.040  1.00 29.81 ? 201 VAL B CB    1 
ATOM   3774 C  CG1   . VAL B 1 170 ? -28.719 7.473   53.199  1.00 29.05 ? 201 VAL B CG1   1 
ATOM   3775 C  CG2   . VAL B 1 170 ? -30.964 6.669   53.997  1.00 30.34 ? 201 VAL B CG2   1 
ATOM   3776 N  N     . GLY B 1 171 ? -32.438 9.030   51.614  1.00 30.31 ? 202 GLY B N     1 
ATOM   3777 C  CA    . GLY B 1 171 ? -33.805 8.864   51.153  1.00 30.69 ? 202 GLY B CA    1 
ATOM   3778 C  C     . GLY B 1 171 ? -34.210 7.414   51.272  1.00 30.57 ? 202 GLY B C     1 
ATOM   3779 O  O     . GLY B 1 171 ? -33.409 6.511   51.111  1.00 30.98 ? 202 GLY B O     1 
ATOM   3780 N  N     . GLY B 1 172 ? -35.467 7.236   51.614  1.00 30.67 ? 203 GLY B N     1 
ATOM   3781 C  CA    . GLY B 1 172 ? -36.115 6.031   51.902  1.00 30.73 ? 203 GLY B CA    1 
ATOM   3782 C  C     . GLY B 1 172 ? -37.054 5.442   50.902  1.00 30.23 ? 203 GLY B C     1 
ATOM   3783 O  O     . GLY B 1 172 ? -37.482 4.356   51.133  1.00 30.61 ? 203 GLY B O     1 
ATOM   3784 N  N     . GLN B 1 173 ? -37.389 6.102   49.807  1.00 30.12 ? 204 GLN B N     1 
ATOM   3785 C  CA    . GLN B 1 173 ? -38.215 5.460   48.798  1.00 29.56 ? 204 GLN B CA    1 
ATOM   3786 C  C     . GLN B 1 173 ? -37.398 4.370   48.142  1.00 29.31 ? 204 GLN B C     1 
ATOM   3787 O  O     . GLN B 1 173 ? -36.172 4.454   48.064  1.00 28.56 ? 204 GLN B O     1 
ATOM   3788 C  CB    . GLN B 1 173 ? -38.688 6.470   47.744  1.00 29.22 ? 204 GLN B CB    1 
ATOM   3789 C  CG    . GLN B 1 173 ? -39.766 7.424   48.237  1.00 29.62 ? 204 GLN B CG    1 
ATOM   3790 C  CD    . GLN B 1 173 ? -39.267 8.455   49.239  1.00 30.23 ? 204 GLN B CD    1 
ATOM   3791 O  OE1   . GLN B 1 173 ? -38.119 8.909   49.181  1.00 29.38 ? 204 GLN B OE1   1 
ATOM   3792 N  NE2   . GLN B 1 173 ? -40.134 8.826   50.168  1.00 30.43 ? 204 GLN B NE2   1 
ATOM   3793 N  N     . ARG B 1 174 ? -38.096 3.344   47.672  1.00 29.42 ? 205 ARG B N     1 
ATOM   3794 C  CA    . ARG B 1 174 ? -37.491 2.261   46.921  1.00 29.22 ? 205 ARG B CA    1 
ATOM   3795 C  C     . ARG B 1 174 ? -36.393 2.772   46.005  1.00 29.16 ? 205 ARG B C     1 
ATOM   3796 O  O     . ARG B 1 174 ? -35.285 2.267   46.037  1.00 29.54 ? 205 ARG B O     1 
ATOM   3797 C  CB    . ARG B 1 174 ? -38.571 1.548   46.123  1.00 29.20 ? 205 ARG B CB    1 
ATOM   3798 C  CG    . ARG B 1 174 ? -39.499 0.731   47.006  1.00 29.43 ? 205 ARG B CG    1 
ATOM   3799 C  CD    . ARG B 1 174 ? -40.507 -0.102  46.204  1.00 28.87 ? 205 ARG B CD    1 
ATOM   3800 N  NE    . ARG B 1 174 ? -41.210 -1.004  47.106  1.00 29.37 ? 205 ARG B NE    1 
ATOM   3801 C  CZ    . ARG B 1 174 ? -42.296 -1.707  46.804  1.00 28.25 ? 205 ARG B CZ    1 
ATOM   3802 N  NH1   . ARG B 1 174 ? -42.835 -1.654  45.604  1.00 27.20 ? 205 ARG B NH1   1 
ATOM   3803 N  NH2   . ARG B 1 174 ? -42.843 -2.483  47.732  1.00 27.96 ? 205 ARG B NH2   1 
ATOM   3804 N  N     . SER B 1 175 ? -36.719 3.789   45.215  1.00 29.26 ? 206 SER B N     1 
ATOM   3805 C  CA    . SER B 1 175 ? -35.792 4.465   44.303  1.00 29.44 ? 206 SER B CA    1 
ATOM   3806 C  C     . SER B 1 175 ? -34.443 4.847   44.901  1.00 29.36 ? 206 SER B C     1 
ATOM   3807 O  O     . SER B 1 175 ? -33.435 4.779   44.235  1.00 29.56 ? 206 SER B O     1 
ATOM   3808 C  CB    . SER B 1 175 ? -36.480 5.754   43.790  1.00 29.46 ? 206 SER B CB    1 
ATOM   3809 O  OG    . SER B 1 175 ? -35.636 6.911   43.866  1.00 31.04 ? 206 SER B OG    1 
ATOM   3810 N  N     . GLU B 1 176 ? -34.446 5.294   46.147  1.00 29.88 ? 207 GLU B N     1 
ATOM   3811 C  CA    . GLU B 1 176 ? -33.242 5.787   46.807  1.00 30.27 ? 207 GLU B CA    1 
ATOM   3812 C  C     . GLU B 1 176 ? -32.355 4.667   47.379  1.00 30.30 ? 207 GLU B C     1 
ATOM   3813 O  O     . GLU B 1 176 ? -31.155 4.870   47.594  1.00 30.38 ? 207 GLU B O     1 
ATOM   3814 C  CB    . GLU B 1 176 ? -33.627 6.741   47.943  1.00 30.10 ? 207 GLU B CB    1 
ATOM   3815 C  CG    . GLU B 1 176 ? -34.442 7.940   47.497  1.00 29.85 ? 207 GLU B CG    1 
ATOM   3816 C  CD    . GLU B 1 176 ? -33.613 9.010   46.793  1.00 31.04 ? 207 GLU B CD    1 
ATOM   3817 O  OE1   . GLU B 1 176 ? -34.242 9.896   46.146  1.00 32.79 ? 207 GLU B OE1   1 
ATOM   3818 O  OE2   . GLU B 1 176 ? -32.357 8.984   46.884  1.00 29.19 ? 207 GLU B OE2   1 
ATOM   3819 N  N     . ARG B 1 177 ? -32.935 3.495   47.589  1.00 30.00 ? 208 ARG B N     1 
ATOM   3820 C  CA    . ARG B 1 177 ? -32.309 2.482   48.420  1.00 30.74 ? 208 ARG B CA    1 
ATOM   3821 C  C     . ARG B 1 177 ? -31.083 1.825   47.771  1.00 30.61 ? 208 ARG B C     1 
ATOM   3822 O  O     . ARG B 1 177 ? -30.125 1.498   48.469  1.00 30.33 ? 208 ARG B O     1 
ATOM   3823 C  CB    . ARG B 1 177 ? -33.351 1.449   48.870  1.00 30.86 ? 208 ARG B CB    1 
ATOM   3824 C  CG    . ARG B 1 177 ? -34.625 2.136   49.330  1.00 32.46 ? 208 ARG B CG    1 
ATOM   3825 C  CD    . ARG B 1 177 ? -35.168 1.669   50.611  1.00 33.81 ? 208 ARG B CD    1 
ATOM   3826 N  NE    . ARG B 1 177 ? -36.128 0.618   50.366  1.00 36.26 ? 208 ARG B NE    1 
ATOM   3827 C  CZ    . ARG B 1 177 ? -37.447 0.707   50.537  1.00 36.02 ? 208 ARG B CZ    1 
ATOM   3828 N  NH1   . ARG B 1 177 ? -38.182 -0.350  50.274  1.00 36.99 ? 208 ARG B NH1   1 
ATOM   3829 N  NH2   . ARG B 1 177 ? -38.045 1.806   50.953  1.00 33.70 ? 208 ARG B NH2   1 
ATOM   3830 N  N     . LYS B 1 178 ? -31.084 1.683   46.447  1.00 30.67 ? 209 LYS B N     1 
ATOM   3831 C  CA    . LYS B 1 178 ? -29.879 1.192   45.746  1.00 31.06 ? 209 LYS B CA    1 
ATOM   3832 C  C     . LYS B 1 178 ? -28.629 2.061   45.998  1.00 31.08 ? 209 LYS B C     1 
ATOM   3833 O  O     . LYS B 1 178 ? -27.528 1.643   45.686  1.00 31.31 ? 209 LYS B O     1 
ATOM   3834 C  CB    . LYS B 1 178 ? -30.089 1.060   44.233  1.00 30.83 ? 209 LYS B CB    1 
ATOM   3835 C  CG    . LYS B 1 178 ? -29.806 2.342   43.408  1.00 30.74 ? 209 LYS B CG    1 
ATOM   3836 C  CD    . LYS B 1 178 ? -30.332 2.198   41.997  1.00 31.32 ? 209 LYS B CD    1 
ATOM   3837 C  CE    . LYS B 1 178 ? -31.872 2.264   41.956  1.00 33.69 ? 209 LYS B CE    1 
ATOM   3838 N  NZ    . LYS B 1 178 ? -32.435 1.552   40.774  1.00 36.41 ? 209 LYS B NZ    1 
ATOM   3839 N  N     . LYS B 1 179 ? -28.802 3.270   46.520  1.00 31.04 ? 210 LYS B N     1 
ATOM   3840 C  CA    . LYS B 1 179 ? -27.680 4.169   46.751  1.00 31.00 ? 210 LYS B CA    1 
ATOM   3841 C  C     . LYS B 1 179 ? -27.078 3.968   48.134  1.00 30.86 ? 210 LYS B C     1 
ATOM   3842 O  O     . LYS B 1 179 ? -26.004 4.474   48.426  1.00 30.32 ? 210 LYS B O     1 
ATOM   3843 C  CB    . LYS B 1 179 ? -28.137 5.622   46.621  1.00 31.41 ? 210 LYS B CB    1 
ATOM   3844 C  CG    . LYS B 1 179 ? -28.668 6.047   45.231  1.00 31.50 ? 210 LYS B CG    1 
ATOM   3845 C  CD    . LYS B 1 179 ? -29.632 7.225   45.439  1.00 32.33 ? 210 LYS B CD    1 
ATOM   3846 C  CE    . LYS B 1 179 ? -29.979 7.957   44.144  1.00 32.15 ? 210 LYS B CE    1 
ATOM   3847 N  NZ    . LYS B 1 179 ? -30.727 9.218   44.439  1.00 32.24 ? 210 LYS B NZ    1 
ATOM   3848 N  N     . TRP B 1 180 ? -27.773 3.233   48.993  1.00 30.86 ? 211 TRP B N     1 
ATOM   3849 C  CA    . TRP B 1 180 ? -27.360 3.103   50.393  1.00 30.96 ? 211 TRP B CA    1 
ATOM   3850 C  C     . TRP B 1 180 ? -26.009 2.408   50.543  1.00 31.21 ? 211 TRP B C     1 
ATOM   3851 O  O     . TRP B 1 180 ? -25.256 2.689   51.502  1.00 30.62 ? 211 TRP B O     1 
ATOM   3852 C  CB    . TRP B 1 180 ? -28.403 2.321   51.198  1.00 31.55 ? 211 TRP B CB    1 
ATOM   3853 C  CG    . TRP B 1 180 ? -29.684 3.049   51.406  1.00 31.95 ? 211 TRP B CG    1 
ATOM   3854 C  CD1   . TRP B 1 180 ? -30.091 4.189   50.782  1.00 32.53 ? 211 TRP B CD1   1 
ATOM   3855 C  CD2   . TRP B 1 180 ? -30.742 2.672   52.273  1.00 30.96 ? 211 TRP B CD2   1 
ATOM   3856 N  NE1   . TRP B 1 180 ? -31.324 4.551   51.219  1.00 32.36 ? 211 TRP B NE1   1 
ATOM   3857 C  CE2   . TRP B 1 180 ? -31.758 3.629   52.128  1.00 32.51 ? 211 TRP B CE2   1 
ATOM   3858 C  CE3   . TRP B 1 180 ? -30.936 1.616   53.152  1.00 32.07 ? 211 TRP B CE3   1 
ATOM   3859 C  CZ2   . TRP B 1 180 ? -32.944 3.575   52.844  1.00 32.51 ? 211 TRP B CZ2   1 
ATOM   3860 C  CZ3   . TRP B 1 180 ? -32.112 1.558   53.856  1.00 32.59 ? 211 TRP B CZ3   1 
ATOM   3861 C  CH2   . TRP B 1 180 ? -33.102 2.536   53.702  1.00 32.23 ? 211 TRP B CH2   1 
ATOM   3862 N  N     . ILE B 1 181 ? -25.697 1.506   49.607  1.00 31.13 ? 212 ILE B N     1 
ATOM   3863 C  CA    . ILE B 1 181 ? -24.445 0.764   49.667  1.00 31.27 ? 212 ILE B CA    1 
ATOM   3864 C  C     . ILE B 1 181 ? -23.261 1.728   49.824  1.00 31.64 ? 212 ILE B C     1 
ATOM   3865 O  O     . ILE B 1 181 ? -22.291 1.434   50.522  1.00 31.32 ? 212 ILE B O     1 
ATOM   3866 C  CB    . ILE B 1 181 ? -24.248 -0.169  48.438  1.00 31.31 ? 212 ILE B CB    1 
ATOM   3867 C  CG1   . ILE B 1 181 ? -23.071 -1.109  48.661  1.00 30.92 ? 212 ILE B CG1   1 
ATOM   3868 C  CG2   . ILE B 1 181 ? -24.077 0.629   47.102  1.00 30.35 ? 212 ILE B CG2   1 
ATOM   3869 C  CD1   . ILE B 1 181 ? -22.977 -2.194  47.588  1.00 32.15 ? 212 ILE B CD1   1 
ATOM   3870 N  N     . HIS B 1 182 ? -23.359 2.901   49.210  1.00 31.85 ? 213 HIS B N     1 
ATOM   3871 C  CA    . HIS B 1 182 ? -22.260 3.855   49.267  1.00 32.41 ? 213 HIS B CA    1 
ATOM   3872 C  C     . HIS B 1 182 ? -21.944 4.371   50.677  1.00 32.51 ? 213 HIS B C     1 
ATOM   3873 O  O     . HIS B 1 182 ? -20.889 4.968   50.884  1.00 32.14 ? 213 HIS B O     1 
ATOM   3874 C  CB    . HIS B 1 182 ? -22.535 5.076   48.379  1.00 32.56 ? 213 HIS B CB    1 
ATOM   3875 C  CG    . HIS B 1 182 ? -22.596 4.766   46.922  1.00 32.26 ? 213 HIS B CG    1 
ATOM   3876 N  ND1   . HIS B 1 182 ? -23.769 4.816   46.201  1.00 33.76 ? 213 HIS B ND1   1 
ATOM   3877 C  CD2   . HIS B 1 182 ? -21.633 4.396   46.050  1.00 33.86 ? 213 HIS B CD2   1 
ATOM   3878 C  CE1   . HIS B 1 182 ? -23.526 4.490   44.943  1.00 35.20 ? 213 HIS B CE1   1 
ATOM   3879 N  NE2   . HIS B 1 182 ? -22.235 4.238   44.823  1.00 35.00 ? 213 HIS B NE2   1 
ATOM   3880 N  N     . CYS B 1 183 ? -22.842 4.178   51.641  1.00 32.39 ? 214 CYS B N     1 
ATOM   3881 C  CA    . CYS B 1 183 ? -22.538 4.642   52.986  1.00 32.52 ? 214 CYS B CA    1 
ATOM   3882 C  C     . CYS B 1 183 ? -22.367 3.501   53.980  1.00 31.94 ? 214 CYS B C     1 
ATOM   3883 O  O     . CYS B 1 183 ? -22.173 3.740   55.163  1.00 31.65 ? 214 CYS B O     1 
ATOM   3884 C  CB    . CYS B 1 183 ? -23.514 5.740   53.442  1.00 32.70 ? 214 CYS B CB    1 
ATOM   3885 S  SG    . CYS B 1 183 ? -25.142 5.240   53.896  1.00 34.03 ? 214 CYS B SG    1 
ATOM   3886 N  N     . PHE B 1 184 ? -22.353 2.273   53.461  1.00 31.67 ? 215 PHE B N     1 
ATOM   3887 C  CA    . PHE B 1 184 ? -22.432 1.060   54.269  1.00 31.36 ? 215 PHE B CA    1 
ATOM   3888 C  C     . PHE B 1 184 ? -21.119 0.625   54.901  1.00 31.74 ? 215 PHE B C     1 
ATOM   3889 O  O     . PHE B 1 184 ? -21.122 -0.268  55.754  1.00 31.74 ? 215 PHE B O     1 
ATOM   3890 C  CB    . PHE B 1 184 ? -22.986 -0.068  53.402  1.00 31.10 ? 215 PHE B CB    1 
ATOM   3891 C  CG    . PHE B 1 184 ? -24.478 -0.141  53.396  1.00 30.63 ? 215 PHE B CG    1 
ATOM   3892 C  CD1   . PHE B 1 184 ? -25.111 -1.302  53.022  1.00 30.04 ? 215 PHE B CD1   1 
ATOM   3893 C  CD2   . PHE B 1 184 ? -25.248 0.933   53.803  1.00 31.07 ? 215 PHE B CD2   1 
ATOM   3894 C  CE1   . PHE B 1 184 ? -26.482 -1.391  53.025  1.00 30.69 ? 215 PHE B CE1   1 
ATOM   3895 C  CE2   . PHE B 1 184 ? -26.616 0.854   53.813  1.00 31.26 ? 215 PHE B CE2   1 
ATOM   3896 C  CZ    . PHE B 1 184 ? -27.238 -0.317  53.425  1.00 31.40 ? 215 PHE B CZ    1 
ATOM   3897 N  N     . GLU B 1 185 ? -20.006 1.237   54.499  1.00 31.78 ? 216 GLU B N     1 
ATOM   3898 C  CA    . GLU B 1 185 ? -18.688 0.796   54.998  1.00 32.58 ? 216 GLU B CA    1 
ATOM   3899 C  C     . GLU B 1 185 ? -18.351 1.363   56.383  1.00 31.79 ? 216 GLU B C     1 
ATOM   3900 O  O     . GLU B 1 185 ? -18.515 2.558   56.623  1.00 31.94 ? 216 GLU B O     1 
ATOM   3901 C  CB    . GLU B 1 185 ? -17.591 1.177   54.000  1.00 32.78 ? 216 GLU B CB    1 
ATOM   3902 C  CG    . GLU B 1 185 ? -16.145 1.001   54.484  1.00 34.07 ? 216 GLU B CG    1 
ATOM   3903 C  CD    . GLU B 1 185 ? -15.123 1.439   53.407  1.00 35.43 ? 216 GLU B CD    1 
ATOM   3904 O  OE1   . GLU B 1 185 ? -15.483 2.298   52.542  1.00 37.89 ? 216 GLU B OE1   1 
ATOM   3905 O  OE2   . GLU B 1 185 ? -13.968 0.926   53.426  1.00 38.10 ? 216 GLU B OE2   1 
ATOM   3906 N  N     . GLY B 1 186 ? -17.884 0.494   57.282  1.00 31.00 ? 217 GLY B N     1 
ATOM   3907 C  CA    . GLY B 1 186 ? -17.358 0.908   58.591  1.00 30.30 ? 217 GLY B CA    1 
ATOM   3908 C  C     . GLY B 1 186 ? -18.359 1.578   59.516  1.00 30.01 ? 217 GLY B C     1 
ATOM   3909 O  O     . GLY B 1 186 ? -18.017 2.507   60.238  1.00 29.88 ? 217 GLY B O     1 
ATOM   3910 N  N     . VAL B 1 187 ? -19.598 1.098   59.519  1.00 29.82 ? 218 VAL B N     1 
ATOM   3911 C  CA    . VAL B 1 187 ? -20.647 1.755   60.279  1.00 29.19 ? 218 VAL B CA    1 
ATOM   3912 C  C     . VAL B 1 187 ? -20.635 1.316   61.745  1.00 29.40 ? 218 VAL B C     1 
ATOM   3913 O  O     . VAL B 1 187 ? -20.569 0.131   62.065  1.00 29.39 ? 218 VAL B O     1 
ATOM   3914 C  CB    . VAL B 1 187 ? -22.007 1.532   59.651  1.00 28.99 ? 218 VAL B CB    1 
ATOM   3915 C  CG1   . VAL B 1 187 ? -23.135 2.025   60.610  1.00 26.35 ? 218 VAL B CG1   1 
ATOM   3916 C  CG2   . VAL B 1 187 ? -22.026 2.237   58.267  1.00 28.49 ? 218 VAL B CG2   1 
ATOM   3917 N  N     . THR B 1 188 ? -20.691 2.299   62.634  1.00 29.22 ? 219 THR B N     1 
ATOM   3918 C  CA    . THR B 1 188 ? -20.715 2.035   64.058  1.00 28.57 ? 219 THR B CA    1 
ATOM   3919 C  C     . THR B 1 188 ? -22.128 1.851   64.573  1.00 28.73 ? 219 THR B C     1 
ATOM   3920 O  O     . THR B 1 188 ? -22.345 1.049   65.476  1.00 28.67 ? 219 THR B O     1 
ATOM   3921 C  CB    . THR B 1 188 ? -20.088 3.179   64.853  1.00 28.40 ? 219 THR B CB    1 
ATOM   3922 O  OG1   . THR B 1 188 ? -18.888 3.623   64.213  1.00 26.94 ? 219 THR B OG1   1 
ATOM   3923 C  CG2   . THR B 1 188 ? -19.772 2.721   66.267  1.00 27.71 ? 219 THR B CG2   1 
ATOM   3924 N  N     . ALA B 1 189 ? -23.080 2.602   64.018  1.00 28.89 ? 220 ALA B N     1 
ATOM   3925 C  CA    . ALA B 1 189 ? -24.447 2.556   64.503  1.00 29.07 ? 220 ALA B CA    1 
ATOM   3926 C  C     . ALA B 1 189 ? -25.435 2.885   63.419  1.00 29.43 ? 220 ALA B C     1 
ATOM   3927 O  O     . ALA B 1 189 ? -25.160 3.716   62.562  1.00 29.52 ? 220 ALA B O     1 
ATOM   3928 C  CB    . ALA B 1 189 ? -24.611 3.532   65.648  1.00 28.82 ? 220 ALA B CB    1 
ATOM   3929 N  N     . ILE B 1 190 ? -26.592 2.239   63.462  1.00 30.00 ? 221 ILE B N     1 
ATOM   3930 C  CA    . ILE B 1 190 ? -27.690 2.592   62.580  1.00 30.34 ? 221 ILE B CA    1 
ATOM   3931 C  C     . ILE B 1 190 ? -28.866 2.912   63.453  1.00 30.46 ? 221 ILE B C     1 
ATOM   3932 O  O     . ILE B 1 190 ? -29.194 2.117   64.321  1.00 30.85 ? 221 ILE B O     1 
ATOM   3933 C  CB    . ILE B 1 190 ? -28.103 1.432   61.707  1.00 30.74 ? 221 ILE B CB    1 
ATOM   3934 C  CG1   . ILE B 1 190 ? -26.982 1.042   60.741  1.00 30.28 ? 221 ILE B CG1   1 
ATOM   3935 C  CG2   . ILE B 1 190 ? -29.368 1.805   60.923  1.00 31.67 ? 221 ILE B CG2   1 
ATOM   3936 C  CD1   . ILE B 1 190 ? -27.272 -0.273  60.012  1.00 28.96 ? 221 ILE B CD1   1 
ATOM   3937 N  N     . ILE B 1 191 ? -29.478 4.074   63.245  1.00 30.41 ? 222 ILE B N     1 
ATOM   3938 C  CA    . ILE B 1 191 ? -30.808 4.334   63.755  1.00 30.63 ? 222 ILE B CA    1 
ATOM   3939 C  C     . ILE B 1 191 ? -31.773 4.049   62.616  1.00 30.93 ? 222 ILE B C     1 
ATOM   3940 O  O     . ILE B 1 191 ? -31.792 4.771   61.620  1.00 31.09 ? 222 ILE B O     1 
ATOM   3941 C  CB    . ILE B 1 191 ? -30.965 5.767   64.233  1.00 30.40 ? 222 ILE B CB    1 
ATOM   3942 C  CG1   . ILE B 1 191 ? -30.212 5.958   65.539  1.00 31.04 ? 222 ILE B CG1   1 
ATOM   3943 C  CG2   . ILE B 1 191 ? -32.416 6.109   64.459  1.00 30.51 ? 222 ILE B CG2   1 
ATOM   3944 C  CD1   . ILE B 1 191 ? -29.894 7.389   65.833  1.00 30.03 ? 222 ILE B CD1   1 
ATOM   3945 N  N     . PHE B 1 192 ? -32.542 2.973   62.748  1.00 31.19 ? 223 PHE B N     1 
ATOM   3946 C  CA    . PHE B 1 192 ? -33.553 2.613   61.753  1.00 31.24 ? 223 PHE B CA    1 
ATOM   3947 C  C     . PHE B 1 192 ? -34.907 3.137   62.208  1.00 31.72 ? 223 PHE B C     1 
ATOM   3948 O  O     . PHE B 1 192 ? -35.414 2.724   63.241  1.00 31.67 ? 223 PHE B O     1 
ATOM   3949 C  CB    . PHE B 1 192 ? -33.617 1.118   61.604  1.00 30.91 ? 223 PHE B CB    1 
ATOM   3950 C  CG    . PHE B 1 192 ? -34.444 0.668   60.462  1.00 31.83 ? 223 PHE B CG    1 
ATOM   3951 C  CD1   . PHE B 1 192 ? -33.840 0.254   59.271  1.00 31.47 ? 223 PHE B CD1   1 
ATOM   3952 C  CD2   . PHE B 1 192 ? -35.831 0.630   60.562  1.00 30.09 ? 223 PHE B CD2   1 
ATOM   3953 C  CE1   . PHE B 1 192 ? -34.613 -0.186  58.204  1.00 31.74 ? 223 PHE B CE1   1 
ATOM   3954 C  CE2   . PHE B 1 192 ? -36.596 0.192   59.492  1.00 30.99 ? 223 PHE B CE2   1 
ATOM   3955 C  CZ    . PHE B 1 192 ? -35.996 -0.201  58.308  1.00 30.24 ? 223 PHE B CZ    1 
ATOM   3956 N  N     . CYS B 1 193 ? -35.489 4.042   61.426  1.00 32.27 ? 224 CYS B N     1 
ATOM   3957 C  CA    . CYS B 1 193 ? -36.778 4.612   61.758  1.00 32.61 ? 224 CYS B CA    1 
ATOM   3958 C  C     . CYS B 1 193 ? -37.917 3.879   61.118  1.00 32.66 ? 224 CYS B C     1 
ATOM   3959 O  O     . CYS B 1 193 ? -37.845 3.518   59.962  1.00 33.00 ? 224 CYS B O     1 
ATOM   3960 C  CB    . CYS B 1 193 ? -36.831 6.031   61.276  1.00 33.03 ? 224 CYS B CB    1 
ATOM   3961 S  SG    . CYS B 1 193 ? -35.564 6.966   62.005  1.00 35.31 ? 224 CYS B SG    1 
ATOM   3962 N  N     . VAL B 1 194 ? -38.988 3.729   61.881  1.00 32.90 ? 225 VAL B N     1 
ATOM   3963 C  CA    . VAL B 1 194 ? -40.242 3.173   61.431  1.00 32.82 ? 225 VAL B CA    1 
ATOM   3964 C  C     . VAL B 1 194 ? -41.345 4.126   61.869  1.00 33.18 ? 225 VAL B C     1 
ATOM   3965 O  O     . VAL B 1 194 ? -41.386 4.557   63.028  1.00 33.54 ? 225 VAL B O     1 
ATOM   3966 C  CB    . VAL B 1 194 ? -40.496 1.850   62.129  1.00 33.39 ? 225 VAL B CB    1 
ATOM   3967 C  CG1   . VAL B 1 194 ? -41.964 1.392   61.929  1.00 33.09 ? 225 VAL B CG1   1 
ATOM   3968 C  CG2   . VAL B 1 194 ? -39.489 0.808   61.656  1.00 33.50 ? 225 VAL B CG2   1 
ATOM   3969 N  N     . ALA B 1 195 ? -42.239 4.444   60.948  1.00 32.81 ? 226 ALA B N     1 
ATOM   3970 C  CA    . ALA B 1 195 ? -43.392 5.256   61.235  1.00 32.42 ? 226 ALA B CA    1 
ATOM   3971 C  C     . ALA B 1 195 ? -44.427 4.294   61.770  1.00 32.18 ? 226 ALA B C     1 
ATOM   3972 O  O     . ALA B 1 195 ? -44.891 3.441   61.034  1.00 32.14 ? 226 ALA B O     1 
ATOM   3973 C  CB    . ALA B 1 195 ? -43.887 5.960   59.953  1.00 31.26 ? 226 ALA B CB    1 
ATOM   3974 N  N     . LEU B 1 196 ? -44.748 4.409   63.060  1.00 32.07 ? 227 LEU B N     1 
ATOM   3975 C  CA    . LEU B 1 196 ? -45.754 3.550   63.689  1.00 31.73 ? 227 LEU B CA    1 
ATOM   3976 C  C     . LEU B 1 196 ? -47.133 3.739   63.062  1.00 32.14 ? 227 LEU B C     1 
ATOM   3977 O  O     . LEU B 1 196 ? -47.925 2.799   62.949  1.00 31.39 ? 227 LEU B O     1 
ATOM   3978 C  CB    . LEU B 1 196 ? -45.847 3.856   65.179  1.00 31.56 ? 227 LEU B CB    1 
ATOM   3979 C  CG    . LEU B 1 196 ? -44.767 3.239   66.060  1.00 30.71 ? 227 LEU B CG    1 
ATOM   3980 C  CD1   . LEU B 1 196 ? -44.876 3.784   67.485  1.00 27.31 ? 227 LEU B CD1   1 
ATOM   3981 C  CD2   . LEU B 1 196 ? -44.929 1.731   66.009  1.00 29.61 ? 227 LEU B CD2   1 
ATOM   3982 N  N     . SER B 1 197 ? -47.403 4.978   62.666  1.00 32.84 ? 228 SER B N     1 
ATOM   3983 C  CA    . SER B 1 197 ? -48.712 5.390   62.172  1.00 33.26 ? 228 SER B CA    1 
ATOM   3984 C  C     . SER B 1 197 ? -48.933 4.973   60.747  1.00 33.37 ? 228 SER B C     1 
ATOM   3985 O  O     . SER B 1 197 ? -49.982 5.245   60.192  1.00 33.94 ? 228 SER B O     1 
ATOM   3986 C  CB    . SER B 1 197 ? -48.857 6.910   62.299  1.00 33.26 ? 228 SER B CB    1 
ATOM   3987 O  OG    . SER B 1 197 ? -47.598 7.563   62.181  1.00 33.81 ? 228 SER B OG    1 
ATOM   3988 N  N     . ASP B 1 198 ? -47.946 4.302   60.168  1.00 33.67 ? 229 ASP B N     1 
ATOM   3989 C  CA    . ASP B 1 198 ? -48.001 3.845   58.797  1.00 33.88 ? 229 ASP B CA    1 
ATOM   3990 C  C     . ASP B 1 198 ? -48.737 2.524   58.643  1.00 33.48 ? 229 ASP B C     1 
ATOM   3991 O  O     . ASP B 1 198 ? -48.848 1.999   57.529  1.00 33.54 ? 229 ASP B O     1 
ATOM   3992 C  CB    . ASP B 1 198 ? -46.568 3.655   58.275  1.00 34.08 ? 229 ASP B CB    1 
ATOM   3993 C  CG    . ASP B 1 198 ? -45.956 4.927   57.745  1.00 36.21 ? 229 ASP B CG    1 
ATOM   3994 O  OD1   . ASP B 1 198 ? -46.527 6.026   58.011  1.00 38.04 ? 229 ASP B OD1   1 
ATOM   3995 O  OD2   . ASP B 1 198 ? -44.894 4.820   57.050  1.00 39.05 ? 229 ASP B OD2   1 
ATOM   3996 N  N     . TYR B 1 199 ? -49.232 1.966   59.742  1.00 32.90 ? 230 TYR B N     1 
ATOM   3997 C  CA    . TYR B 1 199 ? -49.749 0.600   59.723  1.00 31.86 ? 230 TYR B CA    1 
ATOM   3998 C  C     . TYR B 1 199 ? -50.987 0.438   58.828  1.00 31.59 ? 230 TYR B C     1 
ATOM   3999 O  O     . TYR B 1 199 ? -51.253 -0.660  58.336  1.00 31.56 ? 230 TYR B O     1 
ATOM   4000 C  CB    . TYR B 1 199 ? -49.989 0.084   61.135  1.00 31.29 ? 230 TYR B CB    1 
ATOM   4001 C  CG    . TYR B 1 199 ? -51.184 0.666   61.846  1.00 31.53 ? 230 TYR B CG    1 
ATOM   4002 C  CD1   . TYR B 1 199 ? -51.047 1.756   62.678  1.00 31.05 ? 230 TYR B CD1   1 
ATOM   4003 C  CD2   . TYR B 1 199 ? -52.454 0.123   61.691  1.00 31.53 ? 230 TYR B CD2   1 
ATOM   4004 C  CE1   . TYR B 1 199 ? -52.133 2.305   63.337  1.00 30.92 ? 230 TYR B CE1   1 
ATOM   4005 C  CE2   . TYR B 1 199 ? -53.548 0.669   62.362  1.00 31.67 ? 230 TYR B CE2   1 
ATOM   4006 C  CZ    . TYR B 1 199 ? -53.371 1.764   63.188  1.00 30.43 ? 230 TYR B CZ    1 
ATOM   4007 O  OH    . TYR B 1 199 ? -54.422 2.329   63.865  1.00 29.94 ? 230 TYR B OH    1 
ATOM   4008 N  N     . ASP B 1 200 ? -51.708 1.522   58.559  1.00 31.10 ? 231 ASP B N     1 
ATOM   4009 C  CA    . ASP B 1 200 ? -52.885 1.421   57.691  1.00 30.88 ? 231 ASP B CA    1 
ATOM   4010 C  C     . ASP B 1 200 ? -52.728 2.203   56.386  1.00 30.63 ? 231 ASP B C     1 
ATOM   4011 O  O     . ASP B 1 200 ? -53.702 2.472   55.683  1.00 30.34 ? 231 ASP B O     1 
ATOM   4012 C  CB    . ASP B 1 200 ? -54.152 1.839   58.457  1.00 30.93 ? 231 ASP B CB    1 
ATOM   4013 C  CG    . ASP B 1 200 ? -54.139 3.294   58.898  1.00 30.81 ? 231 ASP B CG    1 
ATOM   4014 O  OD1   . ASP B 1 200 ? -53.170 4.035   58.642  1.00 30.64 ? 231 ASP B OD1   1 
ATOM   4015 O  OD2   . ASP B 1 200 ? -55.127 3.707   59.516  1.00 32.85 ? 231 ASP B OD2   1 
ATOM   4016 N  N     . LEU B 1 201 ? -51.488 2.546   56.062  1.00 31.03 ? 232 LEU B N     1 
ATOM   4017 C  CA    . LEU B 1 201 ? -51.170 3.335   54.873  1.00 30.82 ? 232 LEU B CA    1 
ATOM   4018 C  C     . LEU B 1 201 ? -50.531 2.457   53.798  1.00 31.22 ? 232 LEU B C     1 
ATOM   4019 O  O     . LEU B 1 201 ? -50.147 1.307   54.045  1.00 31.76 ? 232 LEU B O     1 
ATOM   4020 C  CB    . LEU B 1 201 ? -50.238 4.490   55.228  1.00 30.28 ? 232 LEU B CB    1 
ATOM   4021 C  CG    . LEU B 1 201 ? -50.759 5.571   56.192  1.00 30.63 ? 232 LEU B CG    1 
ATOM   4022 C  CD1   . LEU B 1 201 ? -49.785 6.787   56.326  1.00 29.13 ? 232 LEU B CD1   1 
ATOM   4023 C  CD2   . LEU B 1 201 ? -52.120 6.045   55.765  1.00 28.65 ? 232 LEU B CD2   1 
ATOM   4024 N  N     . VAL B 1 202 ? -50.436 3.020   52.606  1.00 31.10 ? 233 VAL B N     1 
ATOM   4025 C  CA    . VAL B 1 202 ? -49.895 2.353   51.445  1.00 31.26 ? 233 VAL B CA    1 
ATOM   4026 C  C     . VAL B 1 202 ? -48.667 3.149   50.960  1.00 31.11 ? 233 VAL B C     1 
ATOM   4027 O  O     . VAL B 1 202 ? -48.620 4.355   51.159  1.00 30.53 ? 233 VAL B O     1 
ATOM   4028 C  CB    . VAL B 1 202 ? -51.012 2.316   50.362  1.00 31.51 ? 233 VAL B CB    1 
ATOM   4029 C  CG1   . VAL B 1 202 ? -50.451 2.513   49.027  1.00 31.41 ? 233 VAL B CG1   1 
ATOM   4030 C  CG2   . VAL B 1 202 ? -51.831 1.037   50.463  1.00 30.98 ? 233 VAL B CG2   1 
ATOM   4031 N  N     . LEU B 1 203 ? -47.666 2.497   50.349  1.00 31.16 ? 234 LEU B N     1 
ATOM   4032 C  CA    . LEU B 1 203 ? -46.493 3.258   49.812  1.00 31.11 ? 234 LEU B CA    1 
ATOM   4033 C  C     . LEU B 1 203 ? -46.951 4.293   48.780  1.00 31.20 ? 234 LEU B C     1 
ATOM   4034 O  O     . LEU B 1 203 ? -47.860 4.056   48.025  1.00 31.49 ? 234 LEU B O     1 
ATOM   4035 C  CB    . LEU B 1 203 ? -45.420 2.358   49.165  1.00 31.05 ? 234 LEU B CB    1 
ATOM   4036 C  CG    . LEU B 1 203 ? -44.539 1.458   50.052  1.00 31.03 ? 234 LEU B CG    1 
ATOM   4037 C  CD1   . LEU B 1 203 ? -43.667 0.552   49.216  1.00 29.54 ? 234 LEU B CD1   1 
ATOM   4038 C  CD2   . LEU B 1 203 ? -43.668 2.284   50.994  1.00 30.58 ? 234 LEU B CD2   1 
ATOM   4039 N  N     . ALA B 1 204 ? -46.323 5.452   48.775  1.00 31.79 ? 235 ALA B N     1 
ATOM   4040 C  CA    . ALA B 1 204 ? -46.499 6.433   47.703  1.00 32.15 ? 235 ALA B CA    1 
ATOM   4041 C  C     . ALA B 1 204 ? -45.977 5.899   46.346  1.00 32.75 ? 235 ALA B C     1 
ATOM   4042 O  O     . ALA B 1 204 ? -46.538 6.225   45.293  1.00 32.45 ? 235 ALA B O     1 
ATOM   4043 C  CB    . ALA B 1 204 ? -45.811 7.756   48.069  1.00 31.19 ? 235 ALA B CB    1 
ATOM   4044 N  N     . GLU B 1 205 ? -44.920 5.071   46.395  1.00 33.76 ? 236 GLU B N     1 
ATOM   4045 C  CA    . GLU B 1 205 ? -44.324 4.410   45.199  1.00 34.36 ? 236 GLU B CA    1 
ATOM   4046 C  C     . GLU B 1 205 ? -45.111 3.215   44.687  1.00 34.45 ? 236 GLU B C     1 
ATOM   4047 O  O     . GLU B 1 205 ? -44.854 2.750   43.596  1.00 34.54 ? 236 GLU B O     1 
ATOM   4048 C  CB    . GLU B 1 205 ? -42.938 3.792   45.495  1.00 34.53 ? 236 GLU B CB    1 
ATOM   4049 C  CG    . GLU B 1 205 ? -41.939 4.586   46.325  1.00 36.05 ? 236 GLU B CG    1 
ATOM   4050 C  CD    . GLU B 1 205 ? -41.967 4.300   47.817  1.00 33.87 ? 236 GLU B CD    1 
ATOM   4051 O  OE1   . GLU B 1 205 ? -41.117 3.523   48.295  1.00 34.28 ? 236 GLU B OE1   1 
ATOM   4052 O  OE2   . GLU B 1 205 ? -42.804 4.888   48.520  1.00 34.07 ? 236 GLU B OE2   1 
ATOM   4053 N  N     . ASP B 1 206 ? -45.996 2.664   45.499  1.00 35.06 ? 237 ASP B N     1 
ATOM   4054 C  CA    . ASP B 1 206 ? -46.657 1.412   45.155  1.00 36.05 ? 237 ASP B CA    1 
ATOM   4055 C  C     . ASP B 1 206 ? -47.923 1.220   45.977  1.00 36.36 ? 237 ASP B C     1 
ATOM   4056 O  O     . ASP B 1 206 ? -47.880 0.737   47.103  1.00 36.49 ? 237 ASP B O     1 
ATOM   4057 C  CB    . ASP B 1 206 ? -45.722 0.206   45.332  1.00 36.23 ? 237 ASP B CB    1 
ATOM   4058 C  CG    . ASP B 1 206 ? -46.334 -1.087  44.803  1.00 36.44 ? 237 ASP B CG    1 
ATOM   4059 O  OD1   . ASP B 1 206 ? -47.416 -1.031  44.174  1.00 37.15 ? 237 ASP B OD1   1 
ATOM   4060 O  OD2   . ASP B 1 206 ? -45.724 -2.157  45.011  1.00 36.81 ? 237 ASP B OD2   1 
ATOM   4061 N  N     . GLU B 1 207 ? -49.040 1.583   45.364  1.00 36.96 ? 238 GLU B N     1 
ATOM   4062 C  CA    . GLU B 1 207 ? -50.350 1.577   45.987  1.00 37.37 ? 238 GLU B CA    1 
ATOM   4063 C  C     . GLU B 1 207 ? -50.740 0.223   46.583  1.00 37.60 ? 238 GLU B C     1 
ATOM   4064 O  O     . GLU B 1 207 ? -51.618 0.167   47.439  1.00 37.61 ? 238 GLU B O     1 
ATOM   4065 C  CB    . GLU B 1 207 ? -51.410 1.979   44.938  1.00 37.77 ? 238 GLU B CB    1 
ATOM   4066 N  N     . GLU B 1 208 ? -50.104 -0.859  46.130  1.00 37.88 ? 239 GLU B N     1 
ATOM   4067 C  CA    . GLU B 1 208 ? -50.508 -2.215  46.530  1.00 38.20 ? 239 GLU B CA    1 
ATOM   4068 C  C     . GLU B 1 208 ? -49.756 -2.772  47.739  1.00 37.55 ? 239 GLU B C     1 
ATOM   4069 O  O     . GLU B 1 208 ? -50.066 -3.854  48.211  1.00 37.40 ? 239 GLU B O     1 
ATOM   4070 C  CB    . GLU B 1 208 ? -50.370 -3.161  45.343  1.00 38.63 ? 239 GLU B CB    1 
ATOM   4071 C  CG    . GLU B 1 208 ? -51.470 -2.977  44.328  1.00 40.82 ? 239 GLU B CG    1 
ATOM   4072 C  CD    . GLU B 1 208 ? -50.947 -3.065  42.915  1.00 45.24 ? 239 GLU B CD    1 
ATOM   4073 O  OE1   . GLU B 1 208 ? -49.996 -2.295  42.596  1.00 47.74 ? 239 GLU B OE1   1 
ATOM   4074 O  OE2   . GLU B 1 208 ? -51.475 -3.903  42.130  1.00 47.21 ? 239 GLU B OE2   1 
ATOM   4075 N  N     . MET B 1 209 ? -48.788 -2.015  48.247  1.00 37.06 ? 240 MET B N     1 
ATOM   4076 C  CA    . MET B 1 209 ? -47.950 -2.456  49.340  1.00 36.40 ? 240 MET B CA    1 
ATOM   4077 C  C     . MET B 1 209 ? -48.250 -1.628  50.572  1.00 35.55 ? 240 MET B C     1 
ATOM   4078 O  O     . MET B 1 209 ? -48.146 -0.411  50.550  1.00 35.74 ? 240 MET B O     1 
ATOM   4079 C  CB    . MET B 1 209 ? -46.493 -2.282  48.955  1.00 36.68 ? 240 MET B CB    1 
ATOM   4080 C  CG    . MET B 1 209 ? -45.540 -2.692  50.051  1.00 38.15 ? 240 MET B CG    1 
ATOM   4081 S  SD    . MET B 1 209 ? -45.383 -4.458  50.130  1.00 41.60 ? 240 MET B SD    1 
ATOM   4082 C  CE    . MET B 1 209 ? -44.560 -4.709  51.706  1.00 38.96 ? 240 MET B CE    1 
ATOM   4083 N  N     . ASN B 1 210 ? -48.622 -2.311  51.643  1.00 34.61 ? 241 ASN B N     1 
ATOM   4084 C  CA    . ASN B 1 210 ? -48.742 -1.710  52.947  1.00 33.85 ? 241 ASN B CA    1 
ATOM   4085 C  C     . ASN B 1 210 ? -47.408 -1.144  53.474  1.00 33.03 ? 241 ASN B C     1 
ATOM   4086 O  O     . ASN B 1 210 ? -46.368 -1.786  53.417  1.00 32.35 ? 241 ASN B O     1 
ATOM   4087 C  CB    . ASN B 1 210 ? -49.274 -2.760  53.903  1.00 34.08 ? 241 ASN B CB    1 
ATOM   4088 C  CG    . ASN B 1 210 ? -49.403 -2.249  55.288  1.00 33.71 ? 241 ASN B CG    1 
ATOM   4089 O  OD1   . ASN B 1 210 ? -48.413 -2.075  55.989  1.00 31.72 ? 241 ASN B OD1   1 
ATOM   4090 N  ND2   . ASN B 1 210 ? -50.636 -2.019  55.710  1.00 35.00 ? 241 ASN B ND2   1 
ATOM   4091 N  N     . ARG B 1 211 ? -47.447 0.070   53.991  1.00 32.32 ? 242 ARG B N     1 
ATOM   4092 C  CA    . ARG B 1 211 ? -46.215 0.739   54.384  1.00 32.09 ? 242 ARG B CA    1 
ATOM   4093 C  C     . ARG B 1 211 ? -45.453 0.044   55.508  1.00 31.96 ? 242 ARG B C     1 
ATOM   4094 O  O     . ARG B 1 211 ? -44.228 0.073   55.526  1.00 31.95 ? 242 ARG B O     1 
ATOM   4095 C  CB    . ARG B 1 211 ? -46.496 2.167   54.801  1.00 31.84 ? 242 ARG B CB    1 
ATOM   4096 C  CG    . ARG B 1 211 ? -46.726 3.078   53.665  1.00 32.46 ? 242 ARG B CG    1 
ATOM   4097 C  CD    . ARG B 1 211 ? -46.603 4.488   54.137  1.00 34.41 ? 242 ARG B CD    1 
ATOM   4098 N  NE    . ARG B 1 211 ? -46.730 5.450   53.056  1.00 36.44 ? 242 ARG B NE    1 
ATOM   4099 C  CZ    . ARG B 1 211 ? -46.557 6.760   53.216  1.00 37.65 ? 242 ARG B CZ    1 
ATOM   4100 N  NH1   . ARG B 1 211 ? -46.237 7.246   54.414  1.00 39.59 ? 242 ARG B NH1   1 
ATOM   4101 N  NH2   . ARG B 1 211 ? -46.689 7.575   52.180  1.00 34.85 ? 242 ARG B NH2   1 
ATOM   4102 N  N     . MET B 1 212 ? -46.166 -0.549  56.456  1.00 31.77 ? 243 MET B N     1 
ATOM   4103 C  CA    . MET B 1 212 ? -45.513 -1.204  57.566  1.00 31.97 ? 243 MET B CA    1 
ATOM   4104 C  C     . MET B 1 212 ? -44.882 -2.518  57.123  1.00 31.78 ? 243 MET B C     1 
ATOM   4105 O  O     . MET B 1 212 ? -43.775 -2.849  57.527  1.00 31.07 ? 243 MET B O     1 
ATOM   4106 C  CB    . MET B 1 212 ? -46.474 -1.461  58.709  1.00 32.25 ? 243 MET B CB    1 
ATOM   4107 C  CG    . MET B 1 212 ? -45.743 -1.989  59.916  1.00 33.84 ? 243 MET B CG    1 
ATOM   4108 S  SD    . MET B 1 212 ? -45.481 -0.772  61.192  1.00 39.82 ? 243 MET B SD    1 
ATOM   4109 C  CE    . MET B 1 212 ? -46.919 -1.297  62.153  1.00 36.05 ? 243 MET B CE    1 
ATOM   4110 N  N     . HIS B 1 213 ? -45.609 -3.262  56.306  1.00 32.23 ? 244 HIS B N     1 
ATOM   4111 C  CA    . HIS B 1 213 ? -45.083 -4.459  55.684  1.00 32.46 ? 244 HIS B CA    1 
ATOM   4112 C  C     . HIS B 1 213 ? -43.775 -4.148  54.965  1.00 32.15 ? 244 HIS B C     1 
ATOM   4113 O  O     . HIS B 1 213 ? -42.804 -4.895  55.094  1.00 32.20 ? 244 HIS B O     1 
ATOM   4114 C  CB    . HIS B 1 213 ? -46.105 -5.019  54.703  1.00 32.90 ? 244 HIS B CB    1 
ATOM   4115 C  CG    . HIS B 1 213 ? -47.278 -5.675  55.354  1.00 34.31 ? 244 HIS B CG    1 
ATOM   4116 N  ND1   . HIS B 1 213 ? -48.242 -6.362  54.634  1.00 35.77 ? 244 HIS B ND1   1 
ATOM   4117 C  CD2   . HIS B 1 213 ? -47.635 -5.776  56.658  1.00 35.45 ? 244 HIS B CD2   1 
ATOM   4118 C  CE1   . HIS B 1 213 ? -49.148 -6.839  55.471  1.00 36.05 ? 244 HIS B CE1   1 
ATOM   4119 N  NE2   . HIS B 1 213 ? -48.800 -6.505  56.706  1.00 35.26 ? 244 HIS B NE2   1 
ATOM   4120 N  N     . GLU B 1 214 ? -43.741 -3.035  54.242  1.00 32.41 ? 245 GLU B N     1 
ATOM   4121 C  CA    . GLU B 1 214 ? -42.512 -2.560  53.580  1.00 32.76 ? 245 GLU B CA    1 
ATOM   4122 C  C     . GLU B 1 214 ? -41.397 -2.300  54.554  1.00 32.33 ? 245 GLU B C     1 
ATOM   4123 O  O     . GLU B 1 214 ? -40.301 -2.745  54.369  1.00 32.11 ? 245 GLU B O     1 
ATOM   4124 C  CB    . GLU B 1 214 ? -42.776 -1.250  52.844  1.00 32.94 ? 245 GLU B CB    1 
ATOM   4125 C  CG    . GLU B 1 214 ? -41.602 -0.703  52.017  1.00 33.47 ? 245 GLU B CG    1 
ATOM   4126 C  CD    . GLU B 1 214 ? -41.330 -1.509  50.746  1.00 33.72 ? 245 GLU B CD    1 
ATOM   4127 O  OE1   . GLU B 1 214 ? -40.561 -1.047  49.914  1.00 33.60 ? 245 GLU B OE1   1 
ATOM   4128 O  OE2   . GLU B 1 214 ? -41.905 -2.591  50.544  1.00 37.53 ? 245 GLU B OE2   1 
ATOM   4129 N  N     . SER B 1 215 ? -41.706 -1.562  55.596  1.00 32.71 ? 246 SER B N     1 
ATOM   4130 C  CA    . SER B 1 215 ? -40.736 -1.220  56.624  1.00 33.55 ? 246 SER B CA    1 
ATOM   4131 C  C     . SER B 1 215 ? -40.171 -2.465  57.330  1.00 33.62 ? 246 SER B C     1 
ATOM   4132 O  O     . SER B 1 215 ? -38.978 -2.549  57.568  1.00 33.91 ? 246 SER B O     1 
ATOM   4133 C  CB    . SER B 1 215 ? -41.375 -0.228  57.596  1.00 33.38 ? 246 SER B CB    1 
ATOM   4134 O  OG    . SER B 1 215 ? -40.711 -0.223  58.840  1.00 36.35 ? 246 SER B OG    1 
ATOM   4135 N  N     . MET B 1 216 ? -41.021 -3.447  57.601  1.00 33.99 ? 247 MET B N     1 
ATOM   4136 C  CA    . MET B 1 216 ? -40.600 -4.756  58.122  1.00 34.20 ? 247 MET B CA    1 
ATOM   4137 C  C     . MET B 1 216 ? -39.621 -5.484  57.202  1.00 33.96 ? 247 MET B C     1 
ATOM   4138 O  O     . MET B 1 216 ? -38.550 -5.897  57.628  1.00 34.24 ? 247 MET B O     1 
ATOM   4139 C  CB    . MET B 1 216 ? -41.825 -5.663  58.331  1.00 33.79 ? 247 MET B CB    1 
ATOM   4140 C  CG    . MET B 1 216 ? -42.736 -5.233  59.450  1.00 33.69 ? 247 MET B CG    1 
ATOM   4141 S  SD    . MET B 1 216 ? -44.182 -6.292  59.580  1.00 35.41 ? 247 MET B SD    1 
ATOM   4142 C  CE    . MET B 1 216 ? -43.442 -7.906  59.923  1.00 31.63 ? 247 MET B CE    1 
ATOM   4143 N  N     . LYS B 1 217 ? -39.990 -5.665  55.938  1.00 33.79 ? 248 LYS B N     1 
ATOM   4144 C  CA    . LYS B 1 217 ? -39.077 -6.318  54.978  1.00 33.37 ? 248 LYS B CA    1 
ATOM   4145 C  C     . LYS B 1 217 ? -37.731 -5.548  54.871  1.00 32.89 ? 248 LYS B C     1 
ATOM   4146 O  O     . LYS B 1 217 ? -36.663 -6.153  54.737  1.00 32.76 ? 248 LYS B O     1 
ATOM   4147 C  CB    . LYS B 1 217 ? -39.745 -6.452  53.605  1.00 33.48 ? 248 LYS B CB    1 
ATOM   4148 C  CG    . LYS B 1 217 ? -38.789 -6.785  52.424  1.00 34.34 ? 248 LYS B CG    1 
ATOM   4149 N  N     . LEU B 1 218 ? -37.780 -4.222  54.952  1.00 32.02 ? 249 LEU B N     1 
ATOM   4150 C  CA    . LEU B 1 218 ? -36.568 -3.432  54.877  1.00 32.02 ? 249 LEU B CA    1 
ATOM   4151 C  C     . LEU B 1 218 ? -35.723 -3.608  56.157  1.00 31.73 ? 249 LEU B C     1 
ATOM   4152 O  O     . LEU B 1 218 ? -34.503 -3.760  56.082  1.00 31.48 ? 249 LEU B O     1 
ATOM   4153 C  CB    . LEU B 1 218 ? -36.904 -1.972  54.618  1.00 31.77 ? 249 LEU B CB    1 
ATOM   4154 C  CG    . LEU B 1 218 ? -35.720 -1.033  54.424  1.00 32.44 ? 249 LEU B CG    1 
ATOM   4155 C  CD1   . LEU B 1 218 ? -34.900 -1.432  53.222  1.00 32.76 ? 249 LEU B CD1   1 
ATOM   4156 C  CD2   . LEU B 1 218 ? -36.200 0.433   54.296  1.00 32.27 ? 249 LEU B CD2   1 
ATOM   4157 N  N     . PHE B 1 219 ? -36.364 -3.623  57.318  1.00 31.01 ? 250 PHE B N     1 
ATOM   4158 C  CA    . PHE B 1 219 ? -35.621 -3.874  58.549  1.00 31.23 ? 250 PHE B CA    1 
ATOM   4159 C  C     . PHE B 1 219 ? -34.996 -5.279  58.579  1.00 31.23 ? 250 PHE B C     1 
ATOM   4160 O  O     . PHE B 1 219 ? -33.901 -5.483  59.085  1.00 30.71 ? 250 PHE B O     1 
ATOM   4161 C  CB    . PHE B 1 219 ? -36.498 -3.683  59.780  1.00 31.13 ? 250 PHE B CB    1 
ATOM   4162 C  CG    . PHE B 1 219 ? -35.768 -3.906  61.069  1.00 30.49 ? 250 PHE B CG    1 
ATOM   4163 C  CD1   . PHE B 1 219 ? -34.642 -3.153  61.372  1.00 31.75 ? 250 PHE B CD1   1 
ATOM   4164 C  CD2   . PHE B 1 219 ? -36.177 -4.879  61.959  1.00 30.58 ? 250 PHE B CD2   1 
ATOM   4165 C  CE1   . PHE B 1 219 ? -33.940 -3.338  62.561  1.00 31.73 ? 250 PHE B CE1   1 
ATOM   4166 C  CE2   . PHE B 1 219 ? -35.487 -5.086  63.141  1.00 31.99 ? 250 PHE B CE2   1 
ATOM   4167 C  CZ    . PHE B 1 219 ? -34.360 -4.308  63.448  1.00 32.06 ? 250 PHE B CZ    1 
ATOM   4168 N  N     . ASP B 1 220 ? -35.725 -6.238  58.046  1.00 31.70 ? 251 ASP B N     1 
ATOM   4169 C  CA    . ASP B 1 220 ? -35.264 -7.606  57.940  1.00 32.49 ? 251 ASP B CA    1 
ATOM   4170 C  C     . ASP B 1 220 ? -33.918 -7.607  57.208  1.00 32.72 ? 251 ASP B C     1 
ATOM   4171 O  O     . ASP B 1 220 ? -32.902 -8.153  57.692  1.00 32.86 ? 251 ASP B O     1 
ATOM   4172 C  CB    . ASP B 1 220 ? -36.315 -8.401  57.148  1.00 32.32 ? 251 ASP B CB    1 
ATOM   4173 C  CG    . ASP B 1 220 ? -36.158 -9.892  57.273  1.00 32.43 ? 251 ASP B CG    1 
ATOM   4174 O  OD1   . ASP B 1 220 ? -35.079 -10.351 57.696  1.00 30.91 ? 251 ASP B OD1   1 
ATOM   4175 O  OD2   . ASP B 1 220 ? -37.141 -10.602 56.930  1.00 32.57 ? 251 ASP B OD2   1 
ATOM   4176 N  N     . SER B 1 221 ? -33.912 -6.933  56.067  1.00 32.80 ? 252 SER B N     1 
ATOM   4177 C  CA    . SER B 1 221 ? -32.726 -6.830  55.226  1.00 32.93 ? 252 SER B CA    1 
ATOM   4178 C  C     . SER B 1 221 ? -31.556 -6.083  55.906  1.00 32.89 ? 252 SER B C     1 
ATOM   4179 O  O     . SER B 1 221 ? -30.419 -6.520  55.828  1.00 32.80 ? 252 SER B O     1 
ATOM   4180 C  CB    . SER B 1 221 ? -33.102 -6.152  53.912  1.00 32.94 ? 252 SER B CB    1 
ATOM   4181 O  OG    . SER B 1 221 ? -31.969 -5.942  53.098  1.00 33.68 ? 252 SER B OG    1 
ATOM   4182 N  N     . ILE B 1 222 ? -31.841 -4.974  56.582  1.00 32.85 ? 253 ILE B N     1 
ATOM   4183 C  CA    . ILE B 1 222 ? -30.798 -4.173  57.200  1.00 33.06 ? 253 ILE B CA    1 
ATOM   4184 C  C     . ILE B 1 222 ? -30.217 -4.824  58.456  1.00 33.61 ? 253 ILE B C     1 
ATOM   4185 O  O     . ILE B 1 222 ? -28.991 -4.909  58.612  1.00 33.47 ? 253 ILE B O     1 
ATOM   4186 C  CB    . ILE B 1 222 ? -31.339 -2.781  57.560  1.00 33.13 ? 253 ILE B CB    1 
ATOM   4187 C  CG1   . ILE B 1 222 ? -31.668 -1.980  56.293  1.00 32.90 ? 253 ILE B CG1   1 
ATOM   4188 C  CG2   . ILE B 1 222 ? -30.354 -2.020  58.442  1.00 33.23 ? 253 ILE B CG2   1 
ATOM   4189 C  CD1   . ILE B 1 222 ? -30.529 -1.737  55.352  1.00 31.47 ? 253 ILE B CD1   1 
ATOM   4190 N  N     . CYS B 1 223 ? -31.112 -5.281  59.336  1.00 33.80 ? 254 CYS B N     1 
ATOM   4191 C  CA    . CYS B 1 223 ? -30.750 -5.867  60.620  1.00 33.59 ? 254 CYS B CA    1 
ATOM   4192 C  C     . CYS B 1 223 ? -29.837 -7.075  60.495  1.00 33.51 ? 254 CYS B C     1 
ATOM   4193 O  O     . CYS B 1 223 ? -28.963 -7.286  61.346  1.00 33.69 ? 254 CYS B O     1 
ATOM   4194 C  CB    . CYS B 1 223 ? -32.016 -6.316  61.344  1.00 34.01 ? 254 CYS B CB    1 
ATOM   4195 S  SG    . CYS B 1 223 ? -31.728 -6.735  63.047  1.00 34.53 ? 254 CYS B SG    1 
ATOM   4196 N  N     . ASN B 1 224 ? -30.060 -7.872  59.449  1.00 33.13 ? 255 ASN B N     1 
ATOM   4197 C  CA    . ASN B 1 224 ? -29.393 -9.164  59.275  1.00 32.86 ? 255 ASN B CA    1 
ATOM   4198 C  C     . ASN B 1 224 ? -28.265 -9.079  58.247  1.00 32.78 ? 255 ASN B C     1 
ATOM   4199 O  O     . ASN B 1 224 ? -27.640 -10.074 57.918  1.00 32.47 ? 255 ASN B O     1 
ATOM   4200 C  CB    . ASN B 1 224 ? -30.409 -10.240 58.845  1.00 32.73 ? 255 ASN B CB    1 
ATOM   4201 C  CG    . ASN B 1 224 ? -31.541 -10.424 59.851  1.00 32.72 ? 255 ASN B CG    1 
ATOM   4202 O  OD1   . ASN B 1 224 ? -31.310 -10.512 61.045  1.00 34.13 ? 255 ASN B OD1   1 
ATOM   4203 N  ND2   . ASN B 1 224 ? -32.770 -10.474 59.363  1.00 31.94 ? 255 ASN B ND2   1 
ATOM   4204 N  N     . ASN B 1 225 ? -28.020 -7.879  57.735  1.00 32.72 ? 256 ASN B N     1 
ATOM   4205 C  CA    . ASN B 1 225 ? -26.949 -7.639  56.789  1.00 32.49 ? 256 ASN B CA    1 
ATOM   4206 C  C     . ASN B 1 225 ? -25.558 -7.873  57.401  1.00 32.06 ? 256 ASN B C     1 
ATOM   4207 O  O     . ASN B 1 225 ? -25.241 -7.390  58.483  1.00 31.11 ? 256 ASN B O     1 
ATOM   4208 C  CB    . ASN B 1 225 ? -27.039 -6.196  56.307  1.00 32.72 ? 256 ASN B CB    1 
ATOM   4209 C  CG    . ASN B 1 225 ? -26.659 -6.035  54.871  1.00 34.49 ? 256 ASN B CG    1 
ATOM   4210 O  OD1   . ASN B 1 225 ? -25.666 -6.610  54.398  1.00 38.39 ? 256 ASN B OD1   1 
ATOM   4211 N  ND2   . ASN B 1 225 ? -27.440 -5.234  54.152  1.00 34.79 ? 256 ASN B ND2   1 
ATOM   4212 N  N     . LYS B 1 226 ? -24.730 -8.602  56.665  1.00 32.00 ? 257 LYS B N     1 
ATOM   4213 C  CA    . LYS B 1 226 ? -23.354 -8.917  57.066  1.00 31.87 ? 257 LYS B CA    1 
ATOM   4214 C  C     . LYS B 1 226 ? -22.470 -7.681  57.283  1.00 31.27 ? 257 LYS B C     1 
ATOM   4215 O  O     . LYS B 1 226 ? -21.493 -7.718  58.022  1.00 31.19 ? 257 LYS B O     1 
ATOM   4216 C  CB    . LYS B 1 226 ? -22.689 -9.759  55.964  1.00 32.21 ? 257 LYS B CB    1 
ATOM   4217 C  CG    . LYS B 1 226 ? -23.471 -10.982 55.515  1.00 32.90 ? 257 LYS B CG    1 
ATOM   4218 C  CD    . LYS B 1 226 ? -23.828 -11.890 56.692  1.00 33.62 ? 257 LYS B CD    1 
ATOM   4219 C  CE    . LYS B 1 226 ? -24.466 -13.156 56.183  1.00 34.66 ? 257 LYS B CE    1 
ATOM   4220 N  NZ    . LYS B 1 226 ? -24.980 -13.963 57.299  1.00 34.80 ? 257 LYS B NZ    1 
ATOM   4221 N  N     . TRP B 1 227 ? -22.796 -6.588  56.606  1.00 30.67 ? 258 TRP B N     1 
ATOM   4222 C  CA    . TRP B 1 227 ? -22.104 -5.320  56.852  1.00 30.04 ? 258 TRP B CA    1 
ATOM   4223 C  C     . TRP B 1 227 ? -22.261 -4.815  58.279  1.00 29.06 ? 258 TRP B C     1 
ATOM   4224 O  O     . TRP B 1 227 ? -21.441 -4.027  58.748  1.00 28.36 ? 258 TRP B O     1 
ATOM   4225 C  CB    . TRP B 1 227 ? -22.676 -4.206  55.971  1.00 30.52 ? 258 TRP B CB    1 
ATOM   4226 C  CG    . TRP B 1 227 ? -21.869 -3.869  54.786  1.00 30.84 ? 258 TRP B CG    1 
ATOM   4227 C  CD1   . TRP B 1 227 ? -20.596 -3.350  54.760  1.00 31.46 ? 258 TRP B CD1   1 
ATOM   4228 C  CD2   . TRP B 1 227 ? -22.291 -3.972  53.439  1.00 30.26 ? 258 TRP B CD2   1 
ATOM   4229 N  NE1   . TRP B 1 227 ? -20.197 -3.153  53.458  1.00 31.81 ? 258 TRP B NE1   1 
ATOM   4230 C  CE2   . TRP B 1 227 ? -21.222 -3.537  52.629  1.00 30.94 ? 258 TRP B CE2   1 
ATOM   4231 C  CE3   . TRP B 1 227 ? -23.462 -4.428  52.832  1.00 31.38 ? 258 TRP B CE3   1 
ATOM   4232 C  CZ2   . TRP B 1 227 ? -21.297 -3.533  51.248  1.00 31.32 ? 258 TRP B CZ2   1 
ATOM   4233 C  CZ3   . TRP B 1 227 ? -23.534 -4.434  51.454  1.00 31.66 ? 258 TRP B CZ3   1 
ATOM   4234 C  CH2   . TRP B 1 227 ? -22.459 -3.989  50.676  1.00 31.44 ? 258 TRP B CH2   1 
ATOM   4235 N  N     . PHE B 1 228 ? -23.346 -5.220  58.931  1.00 28.39 ? 259 PHE B N     1 
ATOM   4236 C  CA    . PHE B 1 228 ? -23.742 -4.619  60.191  1.00 28.42 ? 259 PHE B CA    1 
ATOM   4237 C  C     . PHE B 1 228 ? -23.695 -5.586  61.350  1.00 28.35 ? 259 PHE B C     1 
ATOM   4238 O  O     . PHE B 1 228 ? -24.331 -5.343  62.349  1.00 27.48 ? 259 PHE B O     1 
ATOM   4239 C  CB    . PHE B 1 228 ? -25.141 -4.008  60.085  1.00 28.36 ? 259 PHE B CB    1 
ATOM   4240 C  CG    . PHE B 1 228 ? -25.269 -2.985  59.006  1.00 28.13 ? 259 PHE B CG    1 
ATOM   4241 C  CD1   . PHE B 1 228 ? -24.317 -1.990  58.848  1.00 29.72 ? 259 PHE B CD1   1 
ATOM   4242 C  CD2   . PHE B 1 228 ? -26.342 -3.005  58.143  1.00 28.74 ? 259 PHE B CD2   1 
ATOM   4243 C  CE1   . PHE B 1 228 ? -24.445 -1.032  57.823  1.00 29.40 ? 259 PHE B CE1   1 
ATOM   4244 C  CE2   . PHE B 1 228 ? -26.481 -2.064  57.136  1.00 28.43 ? 259 PHE B CE2   1 
ATOM   4245 C  CZ    . PHE B 1 228 ? -25.520 -1.087  56.966  1.00 28.81 ? 259 PHE B CZ    1 
ATOM   4246 N  N     . THR B 1 229 ? -22.909 -6.655  61.201  1.00 28.68 ? 260 THR B N     1 
ATOM   4247 C  CA    . THR B 1 229 ? -22.660 -7.620  62.249  1.00 29.11 ? 260 THR B CA    1 
ATOM   4248 C  C     . THR B 1 229 ? -22.074 -6.947  63.496  1.00 29.43 ? 260 THR B C     1 
ATOM   4249 O  O     . THR B 1 229 ? -22.451 -7.279  64.602  1.00 29.57 ? 260 THR B O     1 
ATOM   4250 C  CB    . THR B 1 229 ? -21.660 -8.706  61.755  1.00 29.47 ? 260 THR B CB    1 
ATOM   4251 O  OG1   . THR B 1 229 ? -22.016 -9.135  60.432  1.00 29.31 ? 260 THR B OG1   1 
ATOM   4252 C  CG2   . THR B 1 229 ? -21.632 -9.907  62.715  1.00 29.30 ? 260 THR B CG2   1 
ATOM   4253 N  N     . ASP B 1 230 ? -21.138 -6.019  63.306  1.00 29.87 ? 261 ASP B N     1 
ATOM   4254 C  CA    . ASP B 1 230 ? -20.471 -5.330  64.419  1.00 30.07 ? 261 ASP B CA    1 
ATOM   4255 C  C     . ASP B 1 230 ? -21.045 -3.938  64.664  1.00 29.94 ? 261 ASP B C     1 
ATOM   4256 O  O     . ASP B 1 230 ? -20.477 -3.170  65.418  1.00 30.37 ? 261 ASP B O     1 
ATOM   4257 C  CB    . ASP B 1 230 ? -18.962 -5.254  64.160  1.00 30.33 ? 261 ASP B CB    1 
ATOM   4258 C  CG    . ASP B 1 230 ? -18.240 -6.547  64.538  1.00 32.18 ? 261 ASP B CG    1 
ATOM   4259 O  OD1   . ASP B 1 230 ? -17.119 -6.788  64.026  1.00 33.39 ? 261 ASP B OD1   1 
ATOM   4260 O  OD2   . ASP B 1 230 ? -18.794 -7.319  65.358  1.00 34.16 ? 261 ASP B OD2   1 
ATOM   4261 N  N     . THR B 1 231 ? -22.180 -3.635  64.043  1.00 29.42 ? 262 THR B N     1 
ATOM   4262 C  CA    . THR B 1 231 ? -22.812 -2.346  64.169  1.00 28.95 ? 262 THR B CA    1 
ATOM   4263 C  C     . THR B 1 231 ? -23.969 -2.423  65.190  1.00 28.82 ? 262 THR B C     1 
ATOM   4264 O  O     . THR B 1 231 ? -24.724 -3.395  65.221  1.00 28.43 ? 262 THR B O     1 
ATOM   4265 C  CB    . THR B 1 231 ? -23.353 -1.872  62.794  1.00 29.07 ? 262 THR B CB    1 
ATOM   4266 O  OG1   . THR B 1 231 ? -22.309 -1.940  61.812  1.00 27.71 ? 262 THR B OG1   1 
ATOM   4267 C  CG2   . THR B 1 231 ? -23.907 -0.456  62.890  1.00 27.70 ? 262 THR B CG2   1 
ATOM   4268 N  N     . SER B 1 232 ? -24.111 -1.387  66.003  1.00 28.56 ? 263 SER B N     1 
ATOM   4269 C  CA    . SER B 1 232 ? -25.246 -1.268  66.905  1.00 28.94 ? 263 SER B CA    1 
ATOM   4270 C  C     . SER B 1 232 ? -26.508 -0.895  66.124  1.00 28.96 ? 263 SER B C     1 
ATOM   4271 O  O     . SER B 1 232 ? -26.584 0.178   65.522  1.00 28.77 ? 263 SER B O     1 
ATOM   4272 C  CB    . SER B 1 232 ? -24.962 -0.217  67.994  1.00 29.10 ? 263 SER B CB    1 
ATOM   4273 O  OG    . SER B 1 232 ? -23.806 -0.544  68.772  1.00 28.89 ? 263 SER B OG    1 
ATOM   4274 N  N     . ILE B 1 233 ? -27.490 -1.791  66.122  1.00 29.26 ? 264 ILE B N     1 
ATOM   4275 C  CA    . ILE B 1 233 ? -28.756 -1.537  65.453  1.00 29.39 ? 264 ILE B CA    1 
ATOM   4276 C  C     . ILE B 1 233 ? -29.756 -0.978  66.450  1.00 29.55 ? 264 ILE B C     1 
ATOM   4277 O  O     . ILE B 1 233 ? -30.132 -1.660  67.410  1.00 29.83 ? 264 ILE B O     1 
ATOM   4278 C  CB    . ILE B 1 233 ? -29.346 -2.800  64.839  1.00 29.85 ? 264 ILE B CB    1 
ATOM   4279 C  CG1   . ILE B 1 233 ? -28.340 -3.463  63.895  1.00 30.85 ? 264 ILE B CG1   1 
ATOM   4280 C  CG2   . ILE B 1 233 ? -30.630 -2.459  64.075  1.00 28.35 ? 264 ILE B CG2   1 
ATOM   4281 C  CD1   . ILE B 1 233 ? -28.271 -2.808  62.539  1.00 32.06 ? 264 ILE B CD1   1 
ATOM   4282 N  N     . ILE B 1 234 ? -30.159 0.267   66.226  1.00 29.52 ? 265 ILE B N     1 
ATOM   4283 C  CA    . ILE B 1 234 ? -31.115 0.955   67.076  1.00 29.69 ? 265 ILE B CA    1 
ATOM   4284 C  C     . ILE B 1 234 ? -32.352 1.165   66.238  1.00 30.05 ? 265 ILE B C     1 
ATOM   4285 O  O     . ILE B 1 234 ? -32.265 1.561   65.067  1.00 29.86 ? 265 ILE B O     1 
ATOM   4286 C  CB    . ILE B 1 234 ? -30.599 2.332   67.586  1.00 29.97 ? 265 ILE B CB    1 
ATOM   4287 C  CG1   . ILE B 1 234 ? -29.417 2.162   68.555  1.00 30.68 ? 265 ILE B CG1   1 
ATOM   4288 C  CG2   . ILE B 1 234 ? -31.675 3.041   68.375  1.00 28.86 ? 265 ILE B CG2   1 
ATOM   4289 C  CD1   . ILE B 1 234 ? -28.075 1.878   67.919  1.00 31.05 ? 265 ILE B CD1   1 
ATOM   4290 N  N     . LEU B 1 235 ? -33.503 0.874   66.823  1.00 30.25 ? 266 LEU B N     1 
ATOM   4291 C  CA    . LEU B 1 235 ? -34.763 0.924   66.090  1.00 30.22 ? 266 LEU B CA    1 
ATOM   4292 C  C     . LEU B 1 235 ? -35.647 1.947   66.769  1.00 30.60 ? 266 LEU B C     1 
ATOM   4293 O  O     . LEU B 1 235 ? -36.001 1.793   67.952  1.00 30.82 ? 266 LEU B O     1 
ATOM   4294 C  CB    . LEU B 1 235 ? -35.407 -0.462  66.085  1.00 30.62 ? 266 LEU B CB    1 
ATOM   4295 C  CG    . LEU B 1 235 ? -36.860 -0.573  65.630  1.00 30.30 ? 266 LEU B CG    1 
ATOM   4296 C  CD1   . LEU B 1 235 ? -36.968 -0.106  64.199  1.00 29.32 ? 266 LEU B CD1   1 
ATOM   4297 C  CD2   . LEU B 1 235 ? -37.357 -2.010  65.818  1.00 29.10 ? 266 LEU B CD2   1 
ATOM   4298 N  N     . PHE B 1 236 ? -35.973 3.006   66.024  1.00 31.01 ? 267 PHE B N     1 
ATOM   4299 C  CA    . PHE B 1 236 ? -36.854 4.079   66.496  1.00 30.74 ? 267 PHE B CA    1 
ATOM   4300 C  C     . PHE B 1 236 ? -38.227 3.755   65.978  1.00 30.74 ? 267 PHE B C     1 
ATOM   4301 O  O     . PHE B 1 236 ? -38.437 3.788   64.800  1.00 31.03 ? 267 PHE B O     1 
ATOM   4302 C  CB    . PHE B 1 236 ? -36.381 5.453   65.981  1.00 30.79 ? 267 PHE B CB    1 
ATOM   4303 C  CG    . PHE B 1 236 ? -35.260 6.087   66.806  1.00 30.75 ? 267 PHE B CG    1 
ATOM   4304 C  CD1   . PHE B 1 236 ? -34.511 5.354   67.723  1.00 31.54 ? 267 PHE B CD1   1 
ATOM   4305 C  CD2   . PHE B 1 236 ? -34.927 7.429   66.624  1.00 30.86 ? 267 PHE B CD2   1 
ATOM   4306 C  CE1   . PHE B 1 236 ? -33.462 5.968   68.478  1.00 30.50 ? 267 PHE B CE1   1 
ATOM   4307 C  CE2   . PHE B 1 236 ? -33.890 8.032   67.363  1.00 30.19 ? 267 PHE B CE2   1 
ATOM   4308 C  CZ    . PHE B 1 236 ? -33.163 7.292   68.287  1.00 29.80 ? 267 PHE B CZ    1 
ATOM   4309 N  N     . LEU B 1 237 ? -39.135 3.352   66.867  1.00 31.42 ? 268 LEU B N     1 
ATOM   4310 C  CA    . LEU B 1 237 ? -40.548 3.204   66.524  1.00 31.62 ? 268 LEU B CA    1 
ATOM   4311 C  C     . LEU B 1 237 ? -41.165 4.572   66.730  1.00 31.90 ? 268 LEU B C     1 
ATOM   4312 O  O     . LEU B 1 237 ? -41.574 4.943   67.811  1.00 32.18 ? 268 LEU B O     1 
ATOM   4313 C  CB    . LEU B 1 237 ? -41.212 2.122   67.358  1.00 31.55 ? 268 LEU B CB    1 
ATOM   4314 C  CG    . LEU B 1 237 ? -40.590 0.736   67.142  1.00 31.39 ? 268 LEU B CG    1 
ATOM   4315 C  CD1   . LEU B 1 237 ? -41.317 -0.291  67.994  1.00 31.00 ? 268 LEU B CD1   1 
ATOM   4316 C  CD2   . LEU B 1 237 ? -40.642 0.314   65.705  1.00 29.36 ? 268 LEU B CD2   1 
ATOM   4317 N  N     . ASN B 1 238 ? -41.190 5.329   65.653  1.00 32.53 ? 269 ASN B N     1 
ATOM   4318 C  CA    . ASN B 1 238 ? -41.401 6.749   65.701  1.00 33.10 ? 269 ASN B CA    1 
ATOM   4319 C  C     . ASN B 1 238 ? -42.851 7.066   65.426  1.00 32.94 ? 269 ASN B C     1 
ATOM   4320 O  O     . ASN B 1 238 ? -43.616 6.173   65.098  1.00 33.39 ? 269 ASN B O     1 
ATOM   4321 C  CB    . ASN B 1 238 ? -40.484 7.360   64.646  1.00 33.52 ? 269 ASN B CB    1 
ATOM   4322 C  CG    . ASN B 1 238 ? -40.390 8.839   64.735  1.00 35.28 ? 269 ASN B CG    1 
ATOM   4323 O  OD1   . ASN B 1 238 ? -40.287 9.407   65.832  1.00 37.87 ? 269 ASN B OD1   1 
ATOM   4324 N  ND2   . ASN B 1 238 ? -40.385 9.497   63.567  1.00 36.60 ? 269 ASN B ND2   1 
ATOM   4325 N  N     . LYS B 1 239 ? -43.223 8.338   65.545  1.00 33.08 ? 270 LYS B N     1 
ATOM   4326 C  CA    . LYS B 1 239 ? -44.595 8.795   65.343  1.00 32.80 ? 270 LYS B CA    1 
ATOM   4327 C  C     . LYS B 1 239 ? -45.537 8.112   66.317  1.00 32.72 ? 270 LYS B C     1 
ATOM   4328 O  O     . LYS B 1 239 ? -46.674 7.799   66.001  1.00 33.02 ? 270 LYS B O     1 
ATOM   4329 C  CB    . LYS B 1 239 ? -45.030 8.598   63.884  1.00 32.96 ? 270 LYS B CB    1 
ATOM   4330 C  CG    . LYS B 1 239 ? -44.294 9.507   62.920  1.00 33.29 ? 270 LYS B CG    1 
ATOM   4331 C  CD    . LYS B 1 239 ? -44.719 9.289   61.483  1.00 34.30 ? 270 LYS B CD    1 
ATOM   4332 C  CE    . LYS B 1 239 ? -43.911 10.159  60.513  1.00 34.41 ? 270 LYS B CE    1 
ATOM   4333 N  NZ    . LYS B 1 239 ? -44.668 10.460  59.258  1.00 33.61 ? 270 LYS B NZ    1 
ATOM   4334 N  N     . LYS B 1 240 ? -45.062 7.897   67.534  1.00 32.83 ? 271 LYS B N     1 
ATOM   4335 C  CA    . LYS B 1 240 ? -45.884 7.270   68.554  1.00 32.56 ? 271 LYS B CA    1 
ATOM   4336 C  C     . LYS B 1 240 ? -47.076 8.151   68.945  1.00 32.66 ? 271 LYS B C     1 
ATOM   4337 O  O     . LYS B 1 240 ? -48.156 7.645   69.327  1.00 32.37 ? 271 LYS B O     1 
ATOM   4338 C  CB    . LYS B 1 240 ? -45.029 6.956   69.770  1.00 32.89 ? 271 LYS B CB    1 
ATOM   4339 C  CG    . LYS B 1 240 ? -44.529 8.166   70.520  1.00 32.76 ? 271 LYS B CG    1 
ATOM   4340 C  CD    . LYS B 1 240 ? -43.472 7.785   71.560  1.00 31.64 ? 271 LYS B CD    1 
ATOM   4341 C  CE    . LYS B 1 240 ? -43.347 8.861   72.639  1.00 31.54 ? 271 LYS B CE    1 
ATOM   4342 N  NZ    . LYS B 1 240 ? -41.996 8.899   73.210  1.00 31.80 ? 271 LYS B NZ    1 
ATOM   4343 N  N     . ASP B 1 241 ? -46.874 9.467   68.879  1.00 32.52 ? 272 ASP B N     1 
ATOM   4344 C  CA    . ASP B 1 241 ? -47.981 10.402  69.105  1.00 32.64 ? 272 ASP B CA    1 
ATOM   4345 C  C     . ASP B 1 241 ? -49.084 10.230  68.060  1.00 32.62 ? 272 ASP B C     1 
ATOM   4346 O  O     . ASP B 1 241 ? -50.253 10.182  68.420  1.00 33.53 ? 272 ASP B O     1 
ATOM   4347 C  CB    . ASP B 1 241 ? -47.517 11.870  69.192  1.00 32.37 ? 272 ASP B CB    1 
ATOM   4348 C  CG    . ASP B 1 241 ? -46.771 12.355  67.938  1.00 32.87 ? 272 ASP B CG    1 
ATOM   4349 O  OD1   . ASP B 1 241 ? -46.126 11.545  67.259  1.00 30.36 ? 272 ASP B OD1   1 
ATOM   4350 O  OD2   . ASP B 1 241 ? -46.820 13.574  67.650  1.00 35.81 ? 272 ASP B OD2   1 
ATOM   4351 N  N     . LEU B 1 242 ? -48.717 10.106  66.786  1.00 32.49 ? 273 LEU B N     1 
ATOM   4352 C  CA    . LEU B 1 242 ? -49.703 9.929   65.711  1.00 32.22 ? 273 LEU B CA    1 
ATOM   4353 C  C     . LEU B 1 242 ? -50.364 8.569   65.879  1.00 32.26 ? 273 LEU B C     1 
ATOM   4354 O  O     . LEU B 1 242 ? -51.577 8.421   65.744  1.00 31.41 ? 273 LEU B O     1 
ATOM   4355 C  CB    . LEU B 1 242 ? -49.038 10.086  64.319  1.00 31.70 ? 273 LEU B CB    1 
ATOM   4356 C  CG    . LEU B 1 242 ? -48.516 11.513  64.059  1.00 31.31 ? 273 LEU B CG    1 
ATOM   4357 C  CD1   . LEU B 1 242 ? -47.644 11.681  62.763  1.00 26.68 ? 273 LEU B CD1   1 
ATOM   4358 C  CD2   . LEU B 1 242 ? -49.712 12.542  64.094  1.00 27.16 ? 273 LEU B CD2   1 
ATOM   4359 N  N     . PHE B 1 243 ? -49.542 7.591   66.229  1.00 33.07 ? 274 PHE B N     1 
ATOM   4360 C  CA    . PHE B 1 243 ? -50.004 6.238   66.473  1.00 33.64 ? 274 PHE B CA    1 
ATOM   4361 C  C     . PHE B 1 243 ? -51.033 6.194   67.579  1.00 34.31 ? 274 PHE B C     1 
ATOM   4362 O  O     . PHE B 1 243 ? -52.050 5.528   67.460  1.00 34.32 ? 274 PHE B O     1 
ATOM   4363 C  CB    . PHE B 1 243 ? -48.831 5.351   66.863  1.00 33.67 ? 274 PHE B CB    1 
ATOM   4364 C  CG    . PHE B 1 243 ? -49.215 3.930   67.090  1.00 33.62 ? 274 PHE B CG    1 
ATOM   4365 C  CD1   . PHE B 1 243 ? -49.482 3.105   66.018  1.00 33.74 ? 274 PHE B CD1   1 
ATOM   4366 C  CD2   . PHE B 1 243 ? -49.349 3.431   68.369  1.00 34.29 ? 274 PHE B CD2   1 
ATOM   4367 C  CE1   . PHE B 1 243 ? -49.854 1.806   66.207  1.00 34.60 ? 274 PHE B CE1   1 
ATOM   4368 C  CE2   . PHE B 1 243 ? -49.723 2.125   68.575  1.00 34.55 ? 274 PHE B CE2   1 
ATOM   4369 C  CZ    . PHE B 1 243 ? -49.961 1.302   67.491  1.00 34.70 ? 274 PHE B CZ    1 
ATOM   4370 N  N     . GLU B 1 244 ? -50.758 6.888   68.674  1.00 35.30 ? 275 GLU B N     1 
ATOM   4371 C  CA    . GLU B 1 244 ? -51.653 6.839   69.822  1.00 36.04 ? 275 GLU B CA    1 
ATOM   4372 C  C     . GLU B 1 244 ? -53.016 7.384   69.481  1.00 35.95 ? 275 GLU B C     1 
ATOM   4373 O  O     . GLU B 1 244 ? -54.007 6.893   69.984  1.00 36.13 ? 275 GLU B O     1 
ATOM   4374 C  CB    . GLU B 1 244 ? -51.063 7.610   70.985  1.00 36.69 ? 275 GLU B CB    1 
ATOM   4375 C  CG    . GLU B 1 244 ? -51.777 7.418   72.285  1.00 37.23 ? 275 GLU B CG    1 
ATOM   4376 C  CD    . GLU B 1 244 ? -51.165 8.237   73.401  1.00 38.35 ? 275 GLU B CD    1 
ATOM   4377 O  OE1   . GLU B 1 244 ? -50.197 8.988   73.128  1.00 39.12 ? 275 GLU B OE1   1 
ATOM   4378 O  OE2   . GLU B 1 244 ? -51.666 8.127   74.546  1.00 37.92 ? 275 GLU B OE2   1 
ATOM   4379 N  N     . GLU B 1 245 ? -53.084 8.382   68.610  1.00 36.43 ? 276 GLU B N     1 
ATOM   4380 C  CA    . GLU B 1 245 ? -54.391 8.887   68.209  1.00 36.83 ? 276 GLU B CA    1 
ATOM   4381 C  C     . GLU B 1 245 ? -55.067 8.030   67.136  1.00 36.24 ? 276 GLU B C     1 
ATOM   4382 O  O     . GLU B 1 245 ? -56.283 7.969   67.085  1.00 36.63 ? 276 GLU B O     1 
ATOM   4383 C  CB    . GLU B 1 245 ? -54.345 10.378  67.870  1.00 37.47 ? 276 GLU B CB    1 
ATOM   4384 C  CG    . GLU B 1 245 ? -54.647 11.299  69.153  1.00 40.30 ? 276 GLU B CG    1 
ATOM   4385 C  CD    . GLU B 1 245 ? -56.044 11.039  69.822  1.00 43.23 ? 276 GLU B CD    1 
ATOM   4386 O  OE1   . GLU B 1 245 ? -56.925 10.358  69.227  1.00 44.02 ? 276 GLU B OE1   1 
ATOM   4387 O  OE2   . GLU B 1 245 ? -56.259 11.522  70.957  1.00 46.00 ? 276 GLU B OE2   1 
ATOM   4388 N  N     . LYS B 1 246 ? -54.286 7.306   66.347  1.00 35.91 ? 277 LYS B N     1 
ATOM   4389 C  CA    . LYS B 1 246 ? -54.812 6.564   65.204  1.00 36.10 ? 277 LYS B CA    1 
ATOM   4390 C  C     . LYS B 1 246 ? -55.373 5.194   65.558  1.00 35.66 ? 277 LYS B C     1 
ATOM   4391 O  O     . LYS B 1 246 ? -56.345 4.743   64.942  1.00 35.48 ? 277 LYS B O     1 
ATOM   4392 C  CB    . LYS B 1 246 ? -53.715 6.377   64.167  1.00 36.11 ? 277 LYS B CB    1 
ATOM   4393 C  CG    . LYS B 1 246 ? -54.184 5.743   62.872  1.00 37.09 ? 277 LYS B CG    1 
ATOM   4394 C  CD    . LYS B 1 246 ? -53.063 5.700   61.824  1.00 37.59 ? 277 LYS B CD    1 
ATOM   4395 C  CE    . LYS B 1 246 ? -53.105 6.858   60.859  1.00 39.05 ? 277 LYS B CE    1 
ATOM   4396 N  NZ    . LYS B 1 246 ? -52.086 6.684   59.758  1.00 40.37 ? 277 LYS B NZ    1 
ATOM   4397 N  N     . ILE B 1 247 ? -54.749 4.543   66.537  1.00 35.38 ? 278 ILE B N     1 
ATOM   4398 C  CA    . ILE B 1 247 ? -55.133 3.205   66.957  1.00 35.28 ? 278 ILE B CA    1 
ATOM   4399 C  C     . ILE B 1 247 ? -56.536 3.171   67.537  1.00 35.52 ? 278 ILE B C     1 
ATOM   4400 O  O     . ILE B 1 247 ? -57.203 2.172   67.418  1.00 36.12 ? 278 ILE B O     1 
ATOM   4401 C  CB    . ILE B 1 247 ? -54.115 2.602   67.957  1.00 35.34 ? 278 ILE B CB    1 
ATOM   4402 C  CG1   . ILE B 1 247 ? -54.243 1.084   67.993  1.00 35.19 ? 278 ILE B CG1   1 
ATOM   4403 C  CG2   . ILE B 1 247 ? -54.277 3.205   69.358  1.00 34.30 ? 278 ILE B CG2   1 
ATOM   4404 C  CD1   . ILE B 1 247 ? -53.958 0.410   66.684  1.00 34.00 ? 278 ILE B CD1   1 
ATOM   4405 N  N     . LYS B 1 248 ? -56.997 4.264   68.134  1.00 36.17 ? 279 LYS B N     1 
ATOM   4406 C  CA    . LYS B 1 248 ? -58.403 4.378   68.583  1.00 36.55 ? 279 LYS B CA    1 
ATOM   4407 C  C     . LYS B 1 248 ? -59.398 4.328   67.414  1.00 36.58 ? 279 LYS B C     1 
ATOM   4408 O  O     . LYS B 1 248 ? -60.502 3.789   67.542  1.00 36.58 ? 279 LYS B O     1 
ATOM   4409 C  CB    . LYS B 1 248 ? -58.633 5.704   69.314  1.00 36.83 ? 279 LYS B CB    1 
ATOM   4410 C  CG    . LYS B 1 248 ? -57.717 5.990   70.496  1.00 37.15 ? 279 LYS B CG    1 
ATOM   4411 C  CD    . LYS B 1 248 ? -58.029 7.355   71.135  1.00 37.33 ? 279 LYS B CD    1 
ATOM   4412 C  CE    . LYS B 1 248 ? -56.769 7.960   71.806  1.00 38.71 ? 279 LYS B CE    1 
ATOM   4413 N  NZ    . LYS B 1 248 ? -57.082 8.948   72.884  1.00 38.68 ? 279 LYS B NZ    1 
ATOM   4414 N  N     . LYS B 1 249 ? -59.001 4.907   66.280  1.00 36.53 ? 280 LYS B N     1 
ATOM   4415 C  CA    . LYS B 1 249 ? -59.877 5.069   65.113  1.00 36.50 ? 280 LYS B CA    1 
ATOM   4416 C  C     . LYS B 1 249 ? -59.738 3.974   64.033  1.00 35.68 ? 280 LYS B C     1 
ATOM   4417 O  O     . LYS B 1 249 ? -60.664 3.779   63.246  1.00 35.86 ? 280 LYS B O     1 
ATOM   4418 C  CB    . LYS B 1 249 ? -59.603 6.431   64.426  1.00 36.92 ? 280 LYS B CB    1 
ATOM   4419 C  CG    . LYS B 1 249 ? -59.702 7.683   65.313  1.00 36.96 ? 280 LYS B CG    1 
ATOM   4420 N  N     . SER B 1 250 ? -58.599 3.286   63.979  1.00 34.58 ? 281 SER B N     1 
ATOM   4421 C  CA    . SER B 1 250 ? -58.267 2.433   62.825  1.00 34.08 ? 281 SER B CA    1 
ATOM   4422 C  C     . SER B 1 250 ? -57.602 1.123   63.259  1.00 33.57 ? 281 SER B C     1 
ATOM   4423 O  O     . SER B 1 250 ? -56.510 1.143   63.811  1.00 33.03 ? 281 SER B O     1 
ATOM   4424 C  CB    . SER B 1 250 ? -57.331 3.209   61.871  1.00 34.21 ? 281 SER B CB    1 
ATOM   4425 O  OG    . SER B 1 250 ? -57.076 2.501   60.657  1.00 34.79 ? 281 SER B OG    1 
ATOM   4426 N  N     . PRO B 1 251 ? -58.237 -0.029  62.983  1.00 33.39 ? 282 PRO B N     1 
ATOM   4427 C  CA    . PRO B 1 251 ? -57.780 -1.226  63.685  1.00 33.23 ? 282 PRO B CA    1 
ATOM   4428 C  C     . PRO B 1 251 ? -56.444 -1.723  63.136  1.00 32.86 ? 282 PRO B C     1 
ATOM   4429 O  O     . PRO B 1 251 ? -56.186 -1.620  61.941  1.00 33.03 ? 282 PRO B O     1 
ATOM   4430 C  CB    . PRO B 1 251 ? -58.899 -2.256  63.406  1.00 33.27 ? 282 PRO B CB    1 
ATOM   4431 C  CG    . PRO B 1 251 ? -59.939 -1.551  62.597  1.00 32.87 ? 282 PRO B CG    1 
ATOM   4432 C  CD    . PRO B 1 251 ? -59.306 -0.340  62.018  1.00 33.03 ? 282 PRO B CD    1 
ATOM   4433 N  N     . LEU B 1 252 ? -55.621 -2.275  64.011  1.00 32.51 ? 283 LEU B N     1 
ATOM   4434 C  CA    . LEU B 1 252 ? -54.327 -2.818  63.628  1.00 32.33 ? 283 LEU B CA    1 
ATOM   4435 C  C     . LEU B 1 252 ? -54.443 -3.955  62.610  1.00 32.27 ? 283 LEU B C     1 
ATOM   4436 O  O     . LEU B 1 252 ? -53.543 -4.165  61.818  1.00 31.90 ? 283 LEU B O     1 
ATOM   4437 C  CB    . LEU B 1 252 ? -53.590 -3.319  64.881  1.00 32.01 ? 283 LEU B CB    1 
ATOM   4438 C  CG    . LEU B 1 252 ? -52.156 -3.773  64.649  1.00 31.93 ? 283 LEU B CG    1 
ATOM   4439 C  CD1   . LEU B 1 252 ? -51.324 -2.612  64.066  1.00 29.62 ? 283 LEU B CD1   1 
ATOM   4440 C  CD2   . LEU B 1 252 ? -51.552 -4.335  65.940  1.00 31.64 ? 283 LEU B CD2   1 
ATOM   4441 N  N     . THR B 1 253 ? -55.549 -4.695  62.652  1.00 32.46 ? 284 THR B N     1 
ATOM   4442 C  CA    . THR B 1 253 ? -55.732 -5.844  61.781  1.00 32.42 ? 284 THR B CA    1 
ATOM   4443 C  C     . THR B 1 253 ? -55.712 -5.480  60.309  1.00 32.96 ? 284 THR B C     1 
ATOM   4444 O  O     . THR B 1 253 ? -55.543 -6.352  59.444  1.00 33.30 ? 284 THR B O     1 
ATOM   4445 C  CB    . THR B 1 253 ? -57.046 -6.547  62.028  1.00 32.19 ? 284 THR B CB    1 
ATOM   4446 O  OG1   . THR B 1 253 ? -58.112 -5.615  61.854  1.00 32.01 ? 284 THR B OG1   1 
ATOM   4447 C  CG2   . THR B 1 253 ? -57.079 -7.145  63.416  1.00 31.96 ? 284 THR B CG2   1 
ATOM   4448 N  N     . ILE B 1 254 ? -55.908 -4.201  60.000  1.00 33.38 ? 285 ILE B N     1 
ATOM   4449 C  CA    . ILE B 1 254 ? -55.696 -3.733  58.631  1.00 33.52 ? 285 ILE B CA    1 
ATOM   4450 C  C     . ILE B 1 254 ? -54.283 -4.102  58.163  1.00 33.73 ? 285 ILE B C     1 
ATOM   4451 O  O     . ILE B 1 254 ? -54.104 -4.499  57.019  1.00 34.22 ? 285 ILE B O     1 
ATOM   4452 C  CB    . ILE B 1 254 ? -55.940 -2.202  58.482  1.00 33.68 ? 285 ILE B CB    1 
ATOM   4453 C  CG1   . ILE B 1 254 ? -57.430 -1.886  58.619  1.00 34.05 ? 285 ILE B CG1   1 
ATOM   4454 C  CG2   . ILE B 1 254 ? -55.483 -1.709  57.122  1.00 33.60 ? 285 ILE B CG2   1 
ATOM   4455 C  CD1   . ILE B 1 254 ? -57.765 -0.403  58.487  1.00 33.14 ? 285 ILE B CD1   1 
ATOM   4456 N  N     . CYS B 1 255 ? -53.304 -4.013  59.060  1.00 33.97 ? 286 CYS B N     1 
ATOM   4457 C  CA    . CYS B 1 255 ? -51.926 -4.388  58.763  1.00 33.90 ? 286 CYS B CA    1 
ATOM   4458 C  C     . CYS B 1 255 ? -51.614 -5.827  59.137  1.00 33.75 ? 286 CYS B C     1 
ATOM   4459 O  O     . CYS B 1 255 ? -50.901 -6.529  58.413  1.00 33.96 ? 286 CYS B O     1 
ATOM   4460 C  CB    . CYS B 1 255 ? -50.957 -3.487  59.529  1.00 34.39 ? 286 CYS B CB    1 
ATOM   4461 S  SG    . CYS B 1 255 ? -49.230 -3.966  59.307  1.00 34.98 ? 286 CYS B SG    1 
ATOM   4462 N  N     . TYR B 1 256 ? -52.135 -6.247  60.281  1.00 33.52 ? 287 TYR B N     1 
ATOM   4463 C  CA    . TYR B 1 256 ? -51.900 -7.569  60.827  1.00 33.41 ? 287 TYR B CA    1 
ATOM   4464 C  C     . TYR B 1 256 ? -53.228 -8.295  61.052  1.00 33.15 ? 287 TYR B C     1 
ATOM   4465 O  O     . TYR B 1 256 ? -53.786 -8.264  62.150  1.00 32.89 ? 287 TYR B O     1 
ATOM   4466 C  CB    . TYR B 1 256 ? -51.179 -7.402  62.147  1.00 33.57 ? 287 TYR B CB    1 
ATOM   4467 C  CG    . TYR B 1 256 ? -49.805 -6.804  62.012  1.00 33.13 ? 287 TYR B CG    1 
ATOM   4468 C  CD1   . TYR B 1 256 ? -48.801 -7.475  61.325  1.00 32.49 ? 287 TYR B CD1   1 
ATOM   4469 C  CD2   . TYR B 1 256 ? -49.501 -5.591  62.603  1.00 33.77 ? 287 TYR B CD2   1 
ATOM   4470 C  CE1   . TYR B 1 256 ? -47.548 -6.946  61.221  1.00 33.63 ? 287 TYR B CE1   1 
ATOM   4471 C  CE2   . TYR B 1 256 ? -48.234 -5.062  62.529  1.00 34.16 ? 287 TYR B CE2   1 
ATOM   4472 C  CZ    . TYR B 1 256 ? -47.266 -5.733  61.828  1.00 33.68 ? 287 TYR B CZ    1 
ATOM   4473 O  OH    . TYR B 1 256 ? -46.012 -5.199  61.756  1.00 33.96 ? 287 TYR B OH    1 
ATOM   4474 N  N     . PRO B 1 257 ? -53.760 -8.923  60.000  1.00 32.85 ? 288 PRO B N     1 
ATOM   4475 C  CA    . PRO B 1 257 ? -55.019 -9.694  60.142  1.00 32.83 ? 288 PRO B CA    1 
ATOM   4476 C  C     . PRO B 1 257 ? -55.073 -10.776 61.244  1.00 32.65 ? 288 PRO B C     1 
ATOM   4477 O  O     . PRO B 1 257 ? -56.165 -11.114 61.699  1.00 32.83 ? 288 PRO B O     1 
ATOM   4478 C  CB    . PRO B 1 257 ? -55.230 -10.328 58.746  1.00 32.89 ? 288 PRO B CB    1 
ATOM   4479 C  CG    . PRO B 1 257 ? -54.199 -9.699  57.808  1.00 32.67 ? 288 PRO B CG    1 
ATOM   4480 C  CD    . PRO B 1 257 ? -53.248 -8.862  58.614  1.00 32.42 ? 288 PRO B CD    1 
ATOM   4481 N  N     . GLU B 1 258 ? -53.927 -11.313 61.656  1.00 32.53 ? 289 GLU B N     1 
ATOM   4482 C  CA    . GLU B 1 258 ? -53.863 -12.306 62.743  1.00 32.39 ? 289 GLU B CA    1 
ATOM   4483 C  C     . GLU B 1 258 ? -53.953 -11.662 64.138  1.00 32.38 ? 289 GLU B C     1 
ATOM   4484 O  O     . GLU B 1 258 ? -54.208 -12.359 65.125  1.00 32.81 ? 289 GLU B O     1 
ATOM   4485 C  CB    . GLU B 1 258 ? -52.561 -13.120 62.623  1.00 32.21 ? 289 GLU B CB    1 
ATOM   4486 N  N     . TYR B 1 259 ? -53.738 -10.349 64.221  1.00 31.92 ? 290 TYR B N     1 
ATOM   4487 C  CA    . TYR B 1 259 ? -53.751 -9.649  65.499  1.00 31.74 ? 290 TYR B CA    1 
ATOM   4488 C  C     . TYR B 1 259 ? -55.049 -9.911  66.242  1.00 31.43 ? 290 TYR B C     1 
ATOM   4489 O  O     . TYR B 1 259 ? -56.137 -9.608  65.733  1.00 30.85 ? 290 TYR B O     1 
ATOM   4490 C  CB    . TYR B 1 259 ? -53.546 -8.143  65.294  1.00 31.71 ? 290 TYR B CB    1 
ATOM   4491 C  CG    . TYR B 1 259 ? -53.564 -7.375  66.575  1.00 31.41 ? 290 TYR B CG    1 
ATOM   4492 C  CD1   . TYR B 1 259 ? -52.647 -7.643  67.570  1.00 32.11 ? 290 TYR B CD1   1 
ATOM   4493 C  CD2   . TYR B 1 259 ? -54.512 -6.388  66.801  1.00 31.91 ? 290 TYR B CD2   1 
ATOM   4494 C  CE1   . TYR B 1 259 ? -52.668 -6.936  68.772  1.00 32.35 ? 290 TYR B CE1   1 
ATOM   4495 C  CE2   . TYR B 1 259 ? -54.541 -5.677  67.991  1.00 31.25 ? 290 TYR B CE2   1 
ATOM   4496 C  CZ    . TYR B 1 259 ? -53.625 -5.959  68.966  1.00 31.05 ? 290 TYR B CZ    1 
ATOM   4497 O  OH    . TYR B 1 259 ? -53.666 -5.264  70.132  1.00 31.29 ? 290 TYR B OH    1 
ATOM   4498 N  N     . ALA B 1 260 ? -54.906 -10.483 67.439  1.00 31.32 ? 291 ALA B N     1 
ATOM   4499 C  CA    . ALA B 1 260 ? -56.046 -10.925 68.254  1.00 31.32 ? 291 ALA B CA    1 
ATOM   4500 C  C     . ALA B 1 260 ? -56.316 -9.989  69.448  1.00 31.36 ? 291 ALA B C     1 
ATOM   4501 O  O     . ALA B 1 260 ? -57.322 -10.133 70.147  1.00 30.95 ? 291 ALA B O     1 
ATOM   4502 C  CB    . ALA B 1 260 ? -55.817 -12.363 68.716  1.00 30.72 ? 291 ALA B CB    1 
ATOM   4503 N  N     . GLY B 1 261 ? -55.424 -9.021  69.662  1.00 31.72 ? 292 GLY B N     1 
ATOM   4504 C  CA    . GLY B 1 261 ? -55.528 -8.126  70.805  1.00 31.79 ? 292 GLY B CA    1 
ATOM   4505 C  C     . GLY B 1 261 ? -56.488 -6.978  70.603  1.00 31.77 ? 292 GLY B C     1 
ATOM   4506 O  O     . GLY B 1 261 ? -57.201 -6.910  69.604  1.00 31.26 ? 292 GLY B O     1 
ATOM   4507 N  N     . SER B 1 262 ? -56.488 -6.062  71.567  1.00 32.14 ? 293 SER B N     1 
ATOM   4508 C  CA    . SER B 1 262 ? -57.322 -4.870  71.487  1.00 31.96 ? 293 SER B CA    1 
ATOM   4509 C  C     . SER B 1 262 ? -56.580 -3.705  70.829  1.00 32.52 ? 293 SER B C     1 
ATOM   4510 O  O     . SER B 1 262 ? -55.348 -3.646  70.790  1.00 32.03 ? 293 SER B O     1 
ATOM   4511 C  CB    . SER B 1 262 ? -57.845 -4.461  72.852  1.00 31.84 ? 293 SER B CB    1 
ATOM   4512 O  OG    . SER B 1 262 ? -58.843 -5.353  73.267  1.00 30.00 ? 293 SER B OG    1 
ATOM   4513 N  N     . ASN B 1 263 ? -57.364 -2.771  70.314  1.00 33.24 ? 294 ASN B N     1 
ATOM   4514 C  CA    . ASN B 1 263 ? -56.820 -1.585  69.670  1.00 33.74 ? 294 ASN B CA    1 
ATOM   4515 C  C     . ASN B 1 263 ? -56.557 -0.497  70.700  1.00 34.07 ? 294 ASN B C     1 
ATOM   4516 O  O     . ASN B 1 263 ? -57.215 0.540   70.696  1.00 34.78 ? 294 ASN B O     1 
ATOM   4517 C  CB    . ASN B 1 263 ? -57.779 -1.099  68.577  1.00 33.52 ? 294 ASN B CB    1 
ATOM   4518 C  CG    . ASN B 1 263 ? -58.007 -2.152  67.483  1.00 34.11 ? 294 ASN B CG    1 
ATOM   4519 O  OD1   . ASN B 1 263 ? -57.065 -2.812  67.016  1.00 33.28 ? 294 ASN B OD1   1 
ATOM   4520 N  ND2   . ASN B 1 263 ? -59.268 -2.307  67.067  1.00 34.17 ? 294 ASN B ND2   1 
ATOM   4521 N  N     . THR B 1 264 ? -55.592 -0.768  71.584  1.00 34.17 ? 295 THR B N     1 
ATOM   4522 C  CA    . THR B 1 264 ? -55.123 0.159   72.618  1.00 33.74 ? 295 THR B CA    1 
ATOM   4523 C  C     . THR B 1 264 ? -53.697 0.513   72.276  1.00 33.76 ? 295 THR B C     1 
ATOM   4524 O  O     . THR B 1 264 ? -53.011 -0.287  71.621  1.00 33.76 ? 295 THR B O     1 
ATOM   4525 C  CB    . THR B 1 264 ? -55.025 -0.516  73.954  1.00 33.53 ? 295 THR B CB    1 
ATOM   4526 O  OG1   . THR B 1 264 ? -54.033 -1.556  73.874  1.00 32.80 ? 295 THR B OG1   1 
ATOM   4527 C  CG2   . THR B 1 264 ? -56.366 -1.076  74.382  1.00 33.54 ? 295 THR B CG2   1 
ATOM   4528 N  N     . TYR B 1 265 ? -53.231 1.680   72.713  1.00 33.64 ? 296 TYR B N     1 
ATOM   4529 C  CA    . TYR B 1 265 ? -51.845 2.060   72.437  1.00 33.72 ? 296 TYR B CA    1 
ATOM   4530 C  C     . TYR B 1 265 ? -50.869 0.981   72.921  1.00 33.31 ? 296 TYR B C     1 
ATOM   4531 O  O     . TYR B 1 265 ? -49.992 0.536   72.193  1.00 33.37 ? 296 TYR B O     1 
ATOM   4532 C  CB    . TYR B 1 265 ? -51.476 3.338   73.145  1.00 34.72 ? 296 TYR B CB    1 
ATOM   4533 C  CG    . TYR B 1 265 ? -50.028 3.690   72.988  1.00 35.58 ? 296 TYR B CG    1 
ATOM   4534 C  CD1   . TYR B 1 265 ? -49.591 4.363   71.860  1.00 37.32 ? 296 TYR B CD1   1 
ATOM   4535 C  CD2   . TYR B 1 265 ? -49.093 3.345   73.947  1.00 37.28 ? 296 TYR B CD2   1 
ATOM   4536 C  CE1   . TYR B 1 265 ? -48.269 4.713   71.694  1.00 37.55 ? 296 TYR B CE1   1 
ATOM   4537 C  CE2   . TYR B 1 265 ? -47.744 3.686   73.791  1.00 38.03 ? 296 TYR B CE2   1 
ATOM   4538 C  CZ    . TYR B 1 265 ? -47.352 4.380   72.655  1.00 37.95 ? 296 TYR B CZ    1 
ATOM   4539 O  OH    . TYR B 1 265 ? -46.040 4.757   72.450  1.00 39.56 ? 296 TYR B OH    1 
ATOM   4540 N  N     . GLU B 1 266 ? -51.027 0.585   74.174  1.00 32.77 ? 297 GLU B N     1 
ATOM   4541 C  CA    . GLU B 1 266 ? -50.073 -0.312  74.848  1.00 32.74 ? 297 GLU B CA    1 
ATOM   4542 C  C     . GLU B 1 266 ? -49.849 -1.643  74.130  1.00 32.41 ? 297 GLU B C     1 
ATOM   4543 O  O     . GLU B 1 266 ? -48.710 -2.080  73.883  1.00 32.76 ? 297 GLU B O     1 
ATOM   4544 C  CB    . GLU B 1 266 ? -50.577 -0.753  76.246  1.00 32.14 ? 297 GLU B CB    1 
ATOM   4545 C  CG    . GLU B 1 266 ? -51.393 0.233   77.055  1.00 33.13 ? 297 GLU B CG    1 
ATOM   4546 C  CD    . GLU B 1 266 ? -52.902 0.238   76.759  1.00 31.97 ? 297 GLU B CD    1 
ATOM   4547 O  OE1   . GLU B 1 266 ? -53.661 -0.625  77.255  1.00 26.68 ? 297 GLU B OE1   1 
ATOM   4548 O  OE2   . GLU B 1 266 ? -53.321 1.193   76.065  1.00 32.94 ? 297 GLU B OE2   1 
ATOM   4549 N  N     . GLU B 1 267 ? -50.957 -2.321  73.876  1.00 31.49 ? 298 GLU B N     1 
ATOM   4550 C  CA    . GLU B 1 267 ? -50.901 -3.671  73.353  1.00 31.17 ? 298 GLU B CA    1 
ATOM   4551 C  C     . GLU B 1 267 ? -50.498 -3.718  71.874  1.00 31.12 ? 298 GLU B C     1 
ATOM   4552 O  O     . GLU B 1 267 ? -49.698 -4.568  71.443  1.00 30.93 ? 298 GLU B O     1 
ATOM   4553 C  CB    . GLU B 1 267 ? -52.250 -4.406  73.514  1.00 31.14 ? 298 GLU B CB    1 
ATOM   4554 C  CG    . GLU B 1 267 ? -52.270 -5.817  72.877  1.00 30.23 ? 298 GLU B CG    1 
ATOM   4555 C  CD    . GLU B 1 267 ? -53.469 -6.687  73.290  1.00 31.34 ? 298 GLU B CD    1 
ATOM   4556 O  OE1   . GLU B 1 267 ? -53.355 -7.934  73.153  1.00 32.09 ? 298 GLU B OE1   1 
ATOM   4557 O  OE2   . GLU B 1 267 ? -54.520 -6.159  73.743  1.00 30.05 ? 298 GLU B OE2   1 
ATOM   4558 N  N     . ALA B 1 268 ? -51.072 -2.819  71.088  1.00 30.84 ? 299 ALA B N     1 
ATOM   4559 C  CA    . ALA B 1 268 ? -50.736 -2.734  69.682  1.00 30.52 ? 299 ALA B CA    1 
ATOM   4560 C  C     . ALA B 1 268 ? -49.301 -2.238  69.454  1.00 30.36 ? 299 ALA B C     1 
ATOM   4561 O  O     . ALA B 1 268 ? -48.631 -2.692  68.534  1.00 31.13 ? 299 ALA B O     1 
ATOM   4562 C  CB    . ALA B 1 268 ? -51.740 -1.871  68.956  1.00 30.23 ? 299 ALA B CB    1 
ATOM   4563 N  N     . ALA B 1 269 ? -48.826 -1.311  70.268  1.00 30.20 ? 300 ALA B N     1 
ATOM   4564 C  CA    . ALA B 1 269 ? -47.425 -0.902  70.191  1.00 30.31 ? 300 ALA B CA    1 
ATOM   4565 C  C     . ALA B 1 269 ? -46.521 -2.100  70.476  1.00 30.30 ? 300 ALA B C     1 
ATOM   4566 O  O     . ALA B 1 269 ? -45.511 -2.300  69.808  1.00 30.98 ? 300 ALA B O     1 
ATOM   4567 C  CB    . ALA B 1 269 ? -47.149 0.226   71.163  1.00 29.68 ? 300 ALA B CB    1 
ATOM   4568 N  N     . ALA B 1 270 ? -46.877 -2.879  71.492  1.00 29.73 ? 301 ALA B N     1 
ATOM   4569 C  CA    . ALA B 1 270 ? -46.081 -4.024  71.873  1.00 29.79 ? 301 ALA B CA    1 
ATOM   4570 C  C     . ALA B 1 270 ? -45.998 -5.030  70.724  1.00 29.90 ? 301 ALA B C     1 
ATOM   4571 O  O     . ALA B 1 270 ? -44.951 -5.618  70.447  1.00 30.15 ? 301 ALA B O     1 
ATOM   4572 C  CB    . ALA B 1 270 ? -46.680 -4.698  73.089  1.00 29.30 ? 301 ALA B CB    1 
ATOM   4573 N  N     . TYR B 1 271 ? -47.124 -5.248  70.065  1.00 29.67 ? 302 TYR B N     1 
ATOM   4574 C  CA    . TYR B 1 271 ? -47.198 -6.236  68.988  1.00 29.55 ? 302 TYR B CA    1 
ATOM   4575 C  C     . TYR B 1 271 ? -46.318 -5.785  67.818  1.00 29.73 ? 302 TYR B C     1 
ATOM   4576 O  O     . TYR B 1 271 ? -45.586 -6.596  67.235  1.00 30.15 ? 302 TYR B O     1 
ATOM   4577 C  CB    . TYR B 1 271 ? -48.647 -6.400  68.487  1.00 29.81 ? 302 TYR B CB    1 
ATOM   4578 C  CG    . TYR B 1 271 ? -48.950 -7.557  67.543  1.00 29.36 ? 302 TYR B CG    1 
ATOM   4579 C  CD1   . TYR B 1 271 ? -49.431 -8.775  68.038  1.00 30.35 ? 302 TYR B CD1   1 
ATOM   4580 C  CD2   . TYR B 1 271 ? -48.830 -7.421  66.159  1.00 30.11 ? 302 TYR B CD2   1 
ATOM   4581 C  CE1   . TYR B 1 271 ? -49.745 -9.855  67.188  1.00 29.03 ? 302 TYR B CE1   1 
ATOM   4582 C  CE2   . TYR B 1 271 ? -49.143 -8.498  65.282  1.00 30.49 ? 302 TYR B CE2   1 
ATOM   4583 C  CZ    . TYR B 1 271 ? -49.605 -9.717  65.817  1.00 30.87 ? 302 TYR B CZ    1 
ATOM   4584 O  OH    . TYR B 1 271 ? -49.914 -10.791 64.994  1.00 29.91 ? 302 TYR B OH    1 
ATOM   4585 N  N     . ILE B 1 272 ? -46.372 -4.503  67.478  1.00 29.05 ? 303 ILE B N     1 
ATOM   4586 C  CA    . ILE B 1 272 ? -45.537 -4.023  66.415  1.00 29.03 ? 303 ILE B CA    1 
ATOM   4587 C  C     . ILE B 1 272 ? -44.069 -4.243  66.826  1.00 29.73 ? 303 ILE B C     1 
ATOM   4588 O  O     . ILE B 1 272 ? -43.309 -4.863  66.064  1.00 29.88 ? 303 ILE B O     1 
ATOM   4589 C  CB    . ILE B 1 272 ? -45.850 -2.576  66.038  1.00 28.62 ? 303 ILE B CB    1 
ATOM   4590 C  CG1   . ILE B 1 272 ? -47.291 -2.476  65.550  1.00 28.92 ? 303 ILE B CG1   1 
ATOM   4591 C  CG2   . ILE B 1 272 ? -44.921 -2.107  64.934  1.00 28.17 ? 303 ILE B CG2   1 
ATOM   4592 C  CD1   . ILE B 1 272 ? -47.803 -1.058  65.387  1.00 29.57 ? 303 ILE B CD1   1 
ATOM   4593 N  N     . GLN B 1 273 ? -43.692 -3.810  68.037  1.00 29.93 ? 304 GLN B N     1 
ATOM   4594 C  CA    . GLN B 1 273 ? -42.321 -3.974  68.508  1.00 30.03 ? 304 GLN B CA    1 
ATOM   4595 C  C     . GLN B 1 273 ? -41.871 -5.384  68.234  1.00 30.05 ? 304 GLN B C     1 
ATOM   4596 O  O     . GLN B 1 273 ? -40.870 -5.580  67.565  1.00 30.34 ? 304 GLN B O     1 
ATOM   4597 C  CB    . GLN B 1 273 ? -42.184 -3.661  70.001  1.00 30.11 ? 304 GLN B CB    1 
ATOM   4598 C  CG    . GLN B 1 273 ? -40.729 -3.539  70.420  1.00 30.91 ? 304 GLN B CG    1 
ATOM   4599 C  CD    . GLN B 1 273 ? -40.547 -3.169  71.867  1.00 30.86 ? 304 GLN B CD    1 
ATOM   4600 O  OE1   . GLN B 1 273 ? -41.434 -2.595  72.476  1.00 33.99 ? 304 GLN B OE1   1 
ATOM   4601 N  NE2   . GLN B 1 273 ? -39.391 -3.493  72.421  1.00 27.26 ? 304 GLN B NE2   1 
ATOM   4602 N  N     . CYS B 1 274 ? -42.645 -6.354  68.709  1.00 30.28 ? 305 CYS B N     1 
ATOM   4603 C  CA    . CYS B 1 274 ? -42.280 -7.775  68.587  1.00 30.78 ? 305 CYS B CA    1 
ATOM   4604 C  C     . CYS B 1 274 ? -42.158 -8.261  67.156  1.00 30.86 ? 305 CYS B C     1 
ATOM   4605 O  O     . CYS B 1 274 ? -41.319 -9.111  66.860  1.00 30.80 ? 305 CYS B O     1 
ATOM   4606 C  CB    . CYS B 1 274 ? -43.273 -8.687  69.312  1.00 30.74 ? 305 CYS B CB    1 
ATOM   4607 S  SG    . CYS B 1 274 ? -43.167 -8.469  71.071  1.00 31.74 ? 305 CYS B SG    1 
ATOM   4608 N  N     . GLN B 1 275 ? -43.001 -7.744  66.275  1.00 31.10 ? 306 GLN B N     1 
ATOM   4609 C  CA    . GLN B 1 275 ? -42.929 -8.123  64.861  1.00 31.12 ? 306 GLN B CA    1 
ATOM   4610 C  C     . GLN B 1 275 ? -41.569 -7.715  64.279  1.00 31.58 ? 306 GLN B C     1 
ATOM   4611 O  O     . GLN B 1 275 ? -40.925 -8.494  63.563  1.00 31.47 ? 306 GLN B O     1 
ATOM   4612 C  CB    . GLN B 1 275 ? -44.026 -7.443  64.036  1.00 31.12 ? 306 GLN B CB    1 
ATOM   4613 C  CG    . GLN B 1 275 ? -45.410 -8.001  64.235  1.00 31.48 ? 306 GLN B CG    1 
ATOM   4614 C  CD    . GLN B 1 275 ? -45.569 -9.413  63.675  1.00 32.12 ? 306 GLN B CD    1 
ATOM   4615 O  OE1   . GLN B 1 275 ? -45.301 -9.665  62.486  1.00 31.13 ? 306 GLN B OE1   1 
ATOM   4616 N  NE2   . GLN B 1 275 ? -46.007 -10.342 64.534  1.00 29.02 ? 306 GLN B NE2   1 
ATOM   4617 N  N     . PHE B 1 276 ? -41.125 -6.495  64.592  1.00 31.87 ? 307 PHE B N     1 
ATOM   4618 C  CA    . PHE B 1 276 ? -39.792 -6.050  64.177  1.00 32.36 ? 307 PHE B CA    1 
ATOM   4619 C  C     . PHE B 1 276 ? -38.664 -6.802  64.879  1.00 32.54 ? 307 PHE B C     1 
ATOM   4620 O  O     . PHE B 1 276 ? -37.734 -7.232  64.225  1.00 32.55 ? 307 PHE B O     1 
ATOM   4621 C  CB    . PHE B 1 276 ? -39.636 -4.548  64.366  1.00 32.85 ? 307 PHE B CB    1 
ATOM   4622 C  CG    . PHE B 1 276 ? -40.280 -3.749  63.271  1.00 33.49 ? 307 PHE B CG    1 
ATOM   4623 C  CD1   . PHE B 1 276 ? -41.616 -3.397  63.349  1.00 32.68 ? 307 PHE B CD1   1 
ATOM   4624 C  CD2   . PHE B 1 276 ? -39.562 -3.384  62.149  1.00 33.88 ? 307 PHE B CD2   1 
ATOM   4625 C  CE1   . PHE B 1 276 ? -42.224 -2.695  62.335  1.00 33.78 ? 307 PHE B CE1   1 
ATOM   4626 C  CE2   . PHE B 1 276 ? -40.175 -2.662  61.127  1.00 35.27 ? 307 PHE B CE2   1 
ATOM   4627 C  CZ    . PHE B 1 276 ? -41.508 -2.316  61.226  1.00 33.86 ? 307 PHE B CZ    1 
ATOM   4628 N  N     . GLU B 1 277 ? -38.764 -6.995  66.190  1.00 32.72 ? 308 GLU B N     1 
ATOM   4629 C  CA    . GLU B 1 277 ? -37.698 -7.649  66.931  1.00 33.28 ? 308 GLU B CA    1 
ATOM   4630 C  C     . GLU B 1 277 ? -37.499 -9.106  66.503  1.00 33.46 ? 308 GLU B C     1 
ATOM   4631 O  O     . GLU B 1 277 ? -36.368 -9.600  66.488  1.00 33.69 ? 308 GLU B O     1 
ATOM   4632 C  CB    . GLU B 1 277 ? -37.932 -7.501  68.437  1.00 33.23 ? 308 GLU B CB    1 
ATOM   4633 C  CG    . GLU B 1 277 ? -37.777 -6.038  68.869  1.00 34.34 ? 308 GLU B CG    1 
ATOM   4634 C  CD    . GLU B 1 277 ? -37.906 -5.769  70.359  1.00 34.19 ? 308 GLU B CD    1 
ATOM   4635 O  OE1   . GLU B 1 277 ? -38.442 -6.627  71.112  1.00 35.94 ? 308 GLU B OE1   1 
ATOM   4636 O  OE2   . GLU B 1 277 ? -37.479 -4.652  70.756  1.00 34.85 ? 308 GLU B OE2   1 
ATOM   4637 N  N     . ASP B 1 278 ? -38.587 -9.771  66.118  1.00 33.51 ? 309 ASP B N     1 
ATOM   4638 C  CA    . ASP B 1 278 ? -38.537 -11.150 65.641  1.00 33.51 ? 309 ASP B CA    1 
ATOM   4639 C  C     . ASP B 1 278 ? -37.785 -11.324 64.324  1.00 32.89 ? 309 ASP B C     1 
ATOM   4640 O  O     . ASP B 1 278 ? -37.345 -12.416 64.006  1.00 32.45 ? 309 ASP B O     1 
ATOM   4641 C  CB    . ASP B 1 278 ? -39.955 -11.708 65.452  1.00 34.17 ? 309 ASP B CB    1 
ATOM   4642 C  CG    . ASP B 1 278 ? -40.581 -12.200 66.741  1.00 36.20 ? 309 ASP B CG    1 
ATOM   4643 O  OD1   . ASP B 1 278 ? -40.157 -11.789 67.850  1.00 39.24 ? 309 ASP B OD1   1 
ATOM   4644 O  OD2   . ASP B 1 278 ? -41.527 -13.000 66.636  1.00 39.61 ? 309 ASP B OD2   1 
ATOM   4645 N  N     . LEU B 1 279 ? -37.649 -10.255 63.554  1.00 32.93 ? 310 LEU B N     1 
ATOM   4646 C  CA    . LEU B 1 279 ? -36.957 -10.322 62.263  1.00 32.63 ? 310 LEU B CA    1 
ATOM   4647 C  C     . LEU B 1 279 ? -35.438 -10.521 62.404  1.00 32.59 ? 310 LEU B C     1 
ATOM   4648 O  O     . LEU B 1 279 ? -34.782 -11.000 61.471  1.00 32.49 ? 310 LEU B O     1 
ATOM   4649 C  CB    . LEU B 1 279 ? -37.302 -9.101  61.401  1.00 32.37 ? 310 LEU B CB    1 
ATOM   4650 C  CG    . LEU B 1 279 ? -38.765 -9.061  60.906  1.00 32.72 ? 310 LEU B CG    1 
ATOM   4651 C  CD1   . LEU B 1 279 ? -39.156 -7.708  60.325  1.00 31.63 ? 310 LEU B CD1   1 
ATOM   4652 C  CD2   . LEU B 1 279 ? -39.065 -10.175 59.893  1.00 30.42 ? 310 LEU B CD2   1 
ATOM   4653 N  N     . ASN B 1 280 ? -34.891 -10.182 63.571  1.00 32.63 ? 311 ASN B N     1 
ATOM   4654 C  CA    . ASN B 1 280 ? -33.506 -10.527 63.903  1.00 32.80 ? 311 ASN B CA    1 
ATOM   4655 C  C     . ASN B 1 280 ? -33.248 -12.036 63.883  1.00 32.66 ? 311 ASN B C     1 
ATOM   4656 O  O     . ASN B 1 280 ? -33.816 -12.776 64.673  1.00 32.55 ? 311 ASN B O     1 
ATOM   4657 C  CB    . ASN B 1 280 ? -33.116 -10.006 65.285  1.00 32.94 ? 311 ASN B CB    1 
ATOM   4658 C  CG    . ASN B 1 280 ? -31.638 -10.176 65.576  1.00 31.81 ? 311 ASN B CG    1 
ATOM   4659 O  OD1   . ASN B 1 280 ? -30.847 -10.591 64.720  1.00 30.97 ? 311 ASN B OD1   1 
ATOM   4660 N  ND2   . ASN B 1 280 ? -31.258 -9.844  66.790  1.00 31.72 ? 311 ASN B ND2   1 
ATOM   4661 N  N     . LYS B 1 281 ? -32.354 -12.459 62.999  1.00 32.65 ? 312 LYS B N     1 
ATOM   4662 C  CA    . LYS B 1 281 ? -32.041 -13.867 62.819  1.00 33.03 ? 312 LYS B CA    1 
ATOM   4663 C  C     . LYS B 1 281 ? -30.745 -14.264 63.543  1.00 33.31 ? 312 LYS B C     1 
ATOM   4664 O  O     . LYS B 1 281 ? -30.282 -15.391 63.403  1.00 32.89 ? 312 LYS B O     1 
ATOM   4665 C  CB    . LYS B 1 281 ? -31.965 -14.209 61.318  1.00 32.76 ? 312 LYS B CB    1 
ATOM   4666 N  N     . ARG B 1 282 ? -30.173 -13.342 64.323  1.00 33.72 ? 313 ARG B N     1 
ATOM   4667 C  CA    . ARG B 1 282 ? -29.016 -13.647 65.175  1.00 33.79 ? 313 ARG B CA    1 
ATOM   4668 C  C     . ARG B 1 282 ? -29.261 -13.095 66.599  1.00 33.92 ? 313 ARG B C     1 
ATOM   4669 O  O     . ARG B 1 282 ? -28.470 -12.334 67.158  1.00 33.49 ? 313 ARG B O     1 
ATOM   4670 C  CB    . ARG B 1 282 ? -27.709 -13.166 64.525  1.00 33.87 ? 313 ARG B CB    1 
ATOM   4671 C  CG    . ARG B 1 282 ? -27.897 -12.100 63.447  1.00 34.50 ? 313 ARG B CG    1 
ATOM   4672 C  CD    . ARG B 1 282 ? -26.586 -11.659 62.814  1.00 34.06 ? 313 ARG B CD    1 
ATOM   4673 N  NE    . ARG B 1 282 ? -26.688 -10.331 62.204  1.00 34.05 ? 313 ARG B NE    1 
ATOM   4674 C  CZ    . ARG B 1 282 ? -25.782 -9.778  61.383  1.00 33.83 ? 313 ARG B CZ    1 
ATOM   4675 N  NH1   . ARG B 1 282 ? -24.682 -10.439 61.016  1.00 31.19 ? 313 ARG B NH1   1 
ATOM   4676 N  NH2   . ARG B 1 282 ? -25.989 -8.540  60.911  1.00 33.80 ? 313 ARG B NH2   1 
ATOM   4677 N  N     . LYS B 1 283 ? -30.378 -13.522 67.179  1.00 34.40 ? 314 LYS B N     1 
ATOM   4678 C  CA    . LYS B 1 283 ? -30.750 -13.155 68.548  1.00 35.10 ? 314 LYS B CA    1 
ATOM   4679 C  C     . LYS B 1 283 ? -29.682 -13.494 69.584  1.00 35.40 ? 314 LYS B C     1 
ATOM   4680 O  O     . LYS B 1 283 ? -29.621 -12.855 70.633  1.00 35.42 ? 314 LYS B O     1 
ATOM   4681 C  CB    . LYS B 1 283 ? -32.054 -13.861 68.936  1.00 35.33 ? 314 LYS B CB    1 
ATOM   4682 C  CG    . LYS B 1 283 ? -33.294 -13.330 68.224  1.00 36.02 ? 314 LYS B CG    1 
ATOM   4683 C  CD    . LYS B 1 283 ? -34.373 -14.402 68.112  1.00 37.48 ? 314 LYS B CD    1 
ATOM   4684 C  CE    . LYS B 1 283 ? -35.614 -13.894 67.380  1.00 38.00 ? 314 LYS B CE    1 
ATOM   4685 N  NZ    . LYS B 1 283 ? -36.313 -12.873 68.189  1.00 38.76 ? 314 LYS B NZ    1 
ATOM   4686 N  N     . ASP B 1 284 ? -28.859 -14.503 69.308  1.00 35.73 ? 315 ASP B N     1 
ATOM   4687 C  CA    . ASP B 1 284 ? -27.799 -14.893 70.245  1.00 36.31 ? 315 ASP B CA    1 
ATOM   4688 C  C     . ASP B 1 284 ? -26.591 -13.951 70.251  1.00 36.44 ? 315 ASP B C     1 
ATOM   4689 O  O     . ASP B 1 284 ? -25.972 -13.743 71.296  1.00 36.53 ? 315 ASP B O     1 
ATOM   4690 C  CB    . ASP B 1 284 ? -27.390 -16.332 69.994  1.00 36.59 ? 315 ASP B CB    1 
ATOM   4691 C  CG    . ASP B 1 284 ? -28.509 -17.282 70.317  1.00 37.61 ? 315 ASP B CG    1 
ATOM   4692 O  OD1   . ASP B 1 284 ? -29.570 -17.201 69.657  1.00 39.20 ? 315 ASP B OD1   1 
ATOM   4693 O  OD2   . ASP B 1 284 ? -28.352 -18.068 71.262  1.00 39.88 ? 315 ASP B OD2   1 
ATOM   4694 N  N     . THR B 1 285 ? -26.289 -13.371 69.093  1.00 36.70 ? 316 THR B N     1 
ATOM   4695 C  CA    . THR B 1 285 ? -25.126 -12.508 68.885  1.00 37.05 ? 316 THR B CA    1 
ATOM   4696 C  C     . THR B 1 285 ? -25.444 -11.035 69.025  1.00 37.14 ? 316 THR B C     1 
ATOM   4697 O  O     . THR B 1 285 ? -24.577 -10.230 69.356  1.00 37.22 ? 316 THR B O     1 
ATOM   4698 C  CB    . THR B 1 285 ? -24.663 -12.624 67.392  1.00 37.41 ? 316 THR B CB    1 
ATOM   4699 O  OG1   . THR B 1 285 ? -24.802 -13.978 66.932  1.00 38.22 ? 316 THR B OG1   1 
ATOM   4700 C  CG2   . THR B 1 285 ? -23.221 -12.110 67.177  1.00 38.04 ? 316 THR B CG2   1 
ATOM   4701 N  N     . LYS B 1 286 ? -26.689 -10.681 68.731  1.00 37.37 ? 317 LYS B N     1 
ATOM   4702 C  CA    . LYS B 1 286 ? -27.034 -9.309  68.413  1.00 37.40 ? 317 LYS B CA    1 
ATOM   4703 C  C     . LYS B 1 286 ? -28.326 -8.868  69.070  1.00 37.29 ? 317 LYS B C     1 
ATOM   4704 O  O     . LYS B 1 286 ? -29.326 -9.582  69.054  1.00 37.10 ? 317 LYS B O     1 
ATOM   4705 C  CB    . LYS B 1 286 ? -27.174 -9.159  66.892  1.00 37.76 ? 317 LYS B CB    1 
ATOM   4706 C  CG    . LYS B 1 286 ? -27.173 -7.713  66.393  1.00 38.07 ? 317 LYS B CG    1 
ATOM   4707 C  CD    . LYS B 1 286 ? -26.905 -7.657  64.897  1.00 38.09 ? 317 LYS B CD    1 
ATOM   4708 C  CE    . LYS B 1 286 ? -26.346 -6.310  64.478  1.00 37.28 ? 317 LYS B CE    1 
ATOM   4709 N  NZ    . LYS B 1 286 ? -24.938 -6.084  64.940  1.00 36.49 ? 317 LYS B NZ    1 
ATOM   4710 N  N     . GLU B 1 287 ? -28.284 -7.653  69.601  1.00 37.30 ? 318 GLU B N     1 
ATOM   4711 C  CA    . GLU B 1 287 ? -29.371 -7.046  70.349  1.00 37.67 ? 318 GLU B CA    1 
ATOM   4712 C  C     . GLU B 1 287 ? -29.884 -5.845  69.542  1.00 36.65 ? 318 GLU B C     1 
ATOM   4713 O  O     . GLU B 1 287 ? -29.086 -5.028  69.067  1.00 36.39 ? 318 GLU B O     1 
ATOM   4714 C  CB    . GLU B 1 287 ? -28.784 -6.605  71.696  1.00 37.72 ? 318 GLU B CB    1 
ATOM   4715 C  CG    . GLU B 1 287 ? -29.748 -6.213  72.813  1.00 39.30 ? 318 GLU B CG    1 
ATOM   4716 C  CD    . GLU B 1 287 ? -29.054 -6.234  74.191  1.00 40.43 ? 318 GLU B CD    1 
ATOM   4717 O  OE1   . GLU B 1 287 ? -27.821 -6.503  74.252  1.00 43.54 ? 318 GLU B OE1   1 
ATOM   4718 O  OE2   . GLU B 1 287 ? -29.737 -6.003  75.219  1.00 44.05 ? 318 GLU B OE2   1 
ATOM   4719 N  N     . ILE B 1 288 ? -31.197 -5.752  69.357  1.00 35.83 ? 319 ILE B N     1 
ATOM   4720 C  CA    . ILE B 1 288 ? -31.789 -4.544  68.784  1.00 35.19 ? 319 ILE B CA    1 
ATOM   4721 C  C     . ILE B 1 288 ? -32.128 -3.639  69.947  1.00 34.37 ? 319 ILE B C     1 
ATOM   4722 O  O     . ILE B 1 288 ? -32.682 -4.106  70.936  1.00 34.46 ? 319 ILE B O     1 
ATOM   4723 C  CB    . ILE B 1 288 ? -33.084 -4.795  67.978  1.00 35.39 ? 319 ILE B CB    1 
ATOM   4724 C  CG1   . ILE B 1 288 ? -32.966 -6.012  67.058  1.00 35.05 ? 319 ILE B CG1   1 
ATOM   4725 C  CG2   . ILE B 1 288 ? -33.399 -3.558  67.139  1.00 35.09 ? 319 ILE B CG2   1 
ATOM   4726 C  CD1   . ILE B 1 288 ? -31.825 -5.907  66.111  1.00 36.07 ? 319 ILE B CD1   1 
ATOM   4727 N  N     . TYR B 1 289 ? -31.782 -2.363  69.848  1.00 33.14 ? 320 TYR B N     1 
ATOM   4728 C  CA    . TYR B 1 289 ? -32.087 -1.414  70.906  1.00 32.57 ? 320 TYR B CA    1 
ATOM   4729 C  C     . TYR B 1 289 ? -33.283 -0.566  70.464  1.00 32.66 ? 320 TYR B C     1 
ATOM   4730 O  O     . TYR B 1 289 ? -33.176 0.346   69.605  1.00 33.11 ? 320 TYR B O     1 
ATOM   4731 C  CB    . TYR B 1 289 ? -30.866 -0.560  71.213  1.00 32.15 ? 320 TYR B CB    1 
ATOM   4732 C  CG    . TYR B 1 289 ? -29.611 -1.374  71.507  1.00 31.97 ? 320 TYR B CG    1 
ATOM   4733 C  CD1   . TYR B 1 289 ? -29.311 -1.801  72.805  1.00 31.86 ? 320 TYR B CD1   1 
ATOM   4734 C  CD2   . TYR B 1 289 ? -28.719 -1.698  70.497  1.00 31.58 ? 320 TYR B CD2   1 
ATOM   4735 C  CE1   . TYR B 1 289 ? -28.165 -2.540  73.079  1.00 31.05 ? 320 TYR B CE1   1 
ATOM   4736 C  CE2   . TYR B 1 289 ? -27.569 -2.420  70.760  1.00 31.86 ? 320 TYR B CE2   1 
ATOM   4737 C  CZ    . TYR B 1 289 ? -27.295 -2.850  72.053  1.00 31.80 ? 320 TYR B CZ    1 
ATOM   4738 O  OH    . TYR B 1 289 ? -26.151 -3.588  72.305  1.00 31.53 ? 320 TYR B OH    1 
ATOM   4739 N  N     . THR B 1 290 ? -34.445 -0.873  71.023  1.00 32.17 ? 321 THR B N     1 
ATOM   4740 C  CA    . THR B 1 290 ? -35.677 -0.218  70.566  1.00 31.51 ? 321 THR B CA    1 
ATOM   4741 C  C     . THR B 1 290 ? -36.111 0.919   71.472  1.00 31.57 ? 321 THR B C     1 
ATOM   4742 O  O     . THR B 1 290 ? -36.121 0.790   72.708  1.00 31.39 ? 321 THR B O     1 
ATOM   4743 C  CB    . THR B 1 290 ? -36.837 -1.203  70.434  1.00 31.28 ? 321 THR B CB    1 
ATOM   4744 O  OG1   . THR B 1 290 ? -36.453 -2.248  69.533  1.00 30.65 ? 321 THR B OG1   1 
ATOM   4745 C  CG2   . THR B 1 290 ? -38.080 -0.493  69.917  1.00 28.10 ? 321 THR B CG2   1 
ATOM   4746 N  N     . HIS B 1 291 ? -36.489 2.027   70.844  1.00 31.47 ? 322 HIS B N     1 
ATOM   4747 C  CA    . HIS B 1 291 ? -37.090 3.142   71.552  1.00 31.51 ? 322 HIS B CA    1 
ATOM   4748 C  C     . HIS B 1 291 ? -38.305 3.606   70.801  1.00 31.41 ? 322 HIS B C     1 
ATOM   4749 O  O     . HIS B 1 291 ? -38.292 3.686   69.569  1.00 31.37 ? 322 HIS B O     1 
ATOM   4750 C  CB    . HIS B 1 291 ? -36.096 4.295   71.691  1.00 31.79 ? 322 HIS B CB    1 
ATOM   4751 C  CG    . HIS B 1 291 ? -34.827 3.909   72.376  1.00 31.87 ? 322 HIS B CG    1 
ATOM   4752 N  ND1   . HIS B 1 291 ? -34.645 4.049   73.736  1.00 33.16 ? 322 HIS B ND1   1 
ATOM   4753 C  CD2   . HIS B 1 291 ? -33.696 3.342   71.898  1.00 31.19 ? 322 HIS B CD2   1 
ATOM   4754 C  CE1   . HIS B 1 291 ? -33.444 3.603   74.062  1.00 33.94 ? 322 HIS B CE1   1 
ATOM   4755 N  NE2   . HIS B 1 291 ? -32.847 3.171   72.961  1.00 33.98 ? 322 HIS B NE2   1 
ATOM   4756 N  N     . PHE B 1 292 ? -39.355 3.910   71.550  1.00 31.51 ? 323 PHE B N     1 
ATOM   4757 C  CA    . PHE B 1 292 ? -40.547 4.560   71.002  1.00 31.57 ? 323 PHE B CA    1 
ATOM   4758 C  C     . PHE B 1 292 ? -40.270 6.016   71.047  1.00 31.16 ? 323 PHE B C     1 
ATOM   4759 O  O     . PHE B 1 292 ? -39.960 6.529   72.105  1.00 31.69 ? 323 PHE B O     1 
ATOM   4760 C  CB    . PHE B 1 292 ? -41.793 4.236   71.816  1.00 31.61 ? 323 PHE B CB    1 
ATOM   4761 C  CG    . PHE B 1 292 ? -42.280 2.849   71.595  1.00 32.28 ? 323 PHE B CG    1 
ATOM   4762 C  CD1   . PHE B 1 292 ? -41.781 1.808   72.337  1.00 33.37 ? 323 PHE B CD1   1 
ATOM   4763 C  CD2   . PHE B 1 292 ? -43.202 2.576   70.602  1.00 32.16 ? 323 PHE B CD2   1 
ATOM   4764 C  CE1   . PHE B 1 292 ? -42.221 0.503   72.102  1.00 33.52 ? 323 PHE B CE1   1 
ATOM   4765 C  CE2   . PHE B 1 292 ? -43.637 1.306   70.372  1.00 31.98 ? 323 PHE B CE2   1 
ATOM   4766 C  CZ    . PHE B 1 292 ? -43.145 0.261   71.120  1.00 32.80 ? 323 PHE B CZ    1 
ATOM   4767 N  N     . THR B 1 293 ? -40.345 6.662   69.891  1.00 30.89 ? 324 THR B N     1 
ATOM   4768 C  CA    . THR B 1 293 ? -39.960 8.050   69.766  1.00 30.65 ? 324 THR B CA    1 
ATOM   4769 C  C     . THR B 1 293 ? -41.049 8.919   69.141  1.00 30.20 ? 324 THR B C     1 
ATOM   4770 O  O     . THR B 1 293 ? -41.965 8.433   68.464  1.00 29.53 ? 324 THR B O     1 
ATOM   4771 C  CB    . THR B 1 293 ? -38.720 8.154   68.870  1.00 31.26 ? 324 THR B CB    1 
ATOM   4772 O  OG1   . THR B 1 293 ? -38.994 7.507   67.610  1.00 31.31 ? 324 THR B OG1   1 
ATOM   4773 C  CG2   . THR B 1 293 ? -37.505 7.508   69.562  1.00 30.72 ? 324 THR B CG2   1 
ATOM   4774 N  N     . CYS B 1 294 ? -40.925 10.215  69.409  1.00 29.90 ? 325 CYS B N     1 
ATOM   4775 C  CA    . CYS B 1 294 ? -41.631 11.254  68.696  1.00 29.64 ? 325 CYS B CA    1 
ATOM   4776 C  C     . CYS B 1 294 ? -40.588 12.227  68.186  1.00 29.74 ? 325 CYS B C     1 
ATOM   4777 O  O     . CYS B 1 294 ? -40.098 13.080  68.927  1.00 29.42 ? 325 CYS B O     1 
ATOM   4778 C  CB    . CYS B 1 294 ? -42.600 11.987  69.601  1.00 29.62 ? 325 CYS B CB    1 
ATOM   4779 S  SG    . CYS B 1 294 ? -43.505 13.264  68.691  1.00 29.09 ? 325 CYS B SG    1 
ATOM   4780 N  N     . ALA B 1 295 ? -40.258 12.106  66.905  1.00 29.83 ? 326 ALA B N     1 
ATOM   4781 C  CA    . ALA B 1 295 ? -39.109 12.810  66.342  1.00 29.81 ? 326 ALA B CA    1 
ATOM   4782 C  C     . ALA B 1 295 ? -39.273 14.321  66.370  1.00 29.65 ? 326 ALA B C     1 
ATOM   4783 O  O     . ALA B 1 295 ? -38.281 15.042  66.353  1.00 30.29 ? 326 ALA B O     1 
ATOM   4784 C  CB    . ALA B 1 295 ? -38.829 12.309  64.915  1.00 29.63 ? 326 ALA B CB    1 
ATOM   4785 N  N     . THR B 1 296 ? -40.511 14.805  66.414  1.00 29.44 ? 327 THR B N     1 
ATOM   4786 C  CA    . THR B 1 296 ? -40.770 16.252  66.496  1.00 29.28 ? 327 THR B CA    1 
ATOM   4787 C  C     . THR B 1 296 ? -40.708 16.781  67.926  1.00 29.55 ? 327 THR B C     1 
ATOM   4788 O  O     . THR B 1 296 ? -40.763 18.000  68.142  1.00 29.44 ? 327 THR B O     1 
ATOM   4789 C  CB    . THR B 1 296 ? -42.151 16.590  65.936  1.00 28.83 ? 327 THR B CB    1 
ATOM   4790 O  OG1   . THR B 1 296 ? -43.072 15.610  66.407  1.00 29.98 ? 327 THR B OG1   1 
ATOM   4791 C  CG2   . THR B 1 296 ? -42.147 16.574  64.432  1.00 26.92 ? 327 THR B CG2   1 
ATOM   4792 N  N     . ASP B 1 297 ? -40.600 15.869  68.890  1.00 29.84 ? 328 ASP B N     1 
ATOM   4793 C  CA    . ASP B 1 297 ? -40.495 16.204  70.309  1.00 30.33 ? 328 ASP B CA    1 
ATOM   4794 C  C     . ASP B 1 297 ? -39.017 16.254  70.739  1.00 30.09 ? 328 ASP B C     1 
ATOM   4795 O  O     . ASP B 1 297 ? -38.395 15.221  70.979  1.00 30.02 ? 328 ASP B O     1 
ATOM   4796 C  CB    . ASP B 1 297 ? -41.271 15.148  71.088  1.00 30.61 ? 328 ASP B CB    1 
ATOM   4797 C  CG    . ASP B 1 297 ? -41.407 15.454  72.548  1.00 31.83 ? 328 ASP B CG    1 
ATOM   4798 O  OD1   . ASP B 1 297 ? -40.664 16.298  73.087  1.00 32.27 ? 328 ASP B OD1   1 
ATOM   4799 O  OD2   . ASP B 1 297 ? -42.276 14.787  73.167  1.00 35.42 ? 328 ASP B OD2   1 
ATOM   4800 N  N     . THR B 1 298 ? -38.476 17.470  70.853  1.00 29.72 ? 329 THR B N     1 
ATOM   4801 C  CA    . THR B 1 298 ? -37.072 17.667  71.149  1.00 29.50 ? 329 THR B CA    1 
ATOM   4802 C  C     . THR B 1 298 ? -36.685 16.972  72.441  1.00 29.65 ? 329 THR B C     1 
ATOM   4803 O  O     . THR B 1 298 ? -35.701 16.240  72.470  1.00 29.97 ? 329 THR B O     1 
ATOM   4804 C  CB    . THR B 1 298 ? -36.744 19.170  71.181  1.00 29.84 ? 329 THR B CB    1 
ATOM   4805 O  OG1   . THR B 1 298 ? -36.924 19.687  69.856  1.00 30.74 ? 329 THR B OG1   1 
ATOM   4806 C  CG2   . THR B 1 298 ? -35.309 19.451  71.653  1.00 27.68 ? 329 THR B CG2   1 
ATOM   4807 N  N     . LYS B 1 299 ? -37.470 17.166  73.495  1.00 29.61 ? 330 LYS B N     1 
ATOM   4808 C  CA    . LYS B 1 299 ? -37.180 16.544  74.785  1.00 29.72 ? 330 LYS B CA    1 
ATOM   4809 C  C     . LYS B 1 299 ? -37.126 15.027  74.689  1.00 29.75 ? 330 LYS B C     1 
ATOM   4810 O  O     . LYS B 1 299 ? -36.291 14.408  75.328  1.00 29.82 ? 330 LYS B O     1 
ATOM   4811 C  CB    . LYS B 1 299 ? -38.184 16.987  75.870  1.00 29.88 ? 330 LYS B CB    1 
ATOM   4812 N  N     . ASN B 1 300 ? -38.002 14.423  73.879  1.00 30.04 ? 331 ASN B N     1 
ATOM   4813 C  CA    . ASN B 1 300 ? -38.007 12.980  73.719  1.00 29.58 ? 331 ASN B CA    1 
ATOM   4814 C  C     . ASN B 1 300 ? -36.779 12.524  72.974  1.00 29.63 ? 331 ASN B C     1 
ATOM   4815 O  O     . ASN B 1 300 ? -36.160 11.544  73.346  1.00 30.24 ? 331 ASN B O     1 
ATOM   4816 C  CB    . ASN B 1 300 ? -39.254 12.515  72.978  1.00 29.75 ? 331 ASN B CB    1 
ATOM   4817 C  CG    . ASN B 1 300 ? -39.320 10.981  72.840  1.00 29.87 ? 331 ASN B CG    1 
ATOM   4818 O  OD1   . ASN B 1 300 ? -39.035 10.425  71.795  1.00 28.75 ? 331 ASN B OD1   1 
ATOM   4819 N  ND2   . ASN B 1 300 ? -39.668 10.312  73.915  1.00 30.27 ? 331 ASN B ND2   1 
ATOM   4820 N  N     . VAL B 1 301 ? -36.433 13.222  71.907  1.00 29.60 ? 332 VAL B N     1 
ATOM   4821 C  CA    . VAL B 1 301 ? -35.264 12.840  71.124  1.00 29.75 ? 332 VAL B CA    1 
ATOM   4822 C  C     . VAL B 1 301 ? -33.951 13.058  71.890  1.00 30.09 ? 332 VAL B C     1 
ATOM   4823 O  O     . VAL B 1 301 ? -32.998 12.297  71.723  1.00 30.02 ? 332 VAL B O     1 
ATOM   4824 C  CB    . VAL B 1 301 ? -35.245 13.533  69.754  1.00 29.59 ? 332 VAL B CB    1 
ATOM   4825 C  CG1   . VAL B 1 301 ? -33.926 13.293  69.076  1.00 28.67 ? 332 VAL B CG1   1 
ATOM   4826 C  CG2   . VAL B 1 301 ? -36.406 12.998  68.905  1.00 27.99 ? 332 VAL B CG2   1 
ATOM   4827 N  N     . GLN B 1 302 ? -33.917 14.059  72.763  1.00 30.50 ? 333 GLN B N     1 
ATOM   4828 C  CA    . GLN B 1 302 ? -32.735 14.282  73.597  1.00 30.81 ? 333 GLN B CA    1 
ATOM   4829 C  C     . GLN B 1 302 ? -32.488 13.115  74.564  1.00 30.93 ? 333 GLN B C     1 
ATOM   4830 O  O     . GLN B 1 302 ? -31.374 12.615  74.705  1.00 30.55 ? 333 GLN B O     1 
ATOM   4831 C  CB    . GLN B 1 302 ? -32.864 15.591  74.373  1.00 30.77 ? 333 GLN B CB    1 
ATOM   4832 C  CG    . GLN B 1 302 ? -31.701 15.839  75.329  1.00 31.64 ? 333 GLN B CG    1 
ATOM   4833 C  CD    . GLN B 1 302 ? -31.684 17.241  75.875  1.00 33.83 ? 333 GLN B CD    1 
ATOM   4834 O  OE1   . GLN B 1 302 ? -32.618 18.024  75.664  1.00 35.76 ? 333 GLN B OE1   1 
ATOM   4835 N  NE2   . GLN B 1 302 ? -30.611 17.578  76.580  1.00 34.66 ? 333 GLN B NE2   1 
ATOM   4836 N  N     . PHE B 1 303 ? -33.550 12.672  75.211  1.00 31.60 ? 334 PHE B N     1 
ATOM   4837 C  CA    . PHE B 1 303 ? -33.479 11.546  76.137  1.00 32.11 ? 334 PHE B CA    1 
ATOM   4838 C  C     . PHE B 1 303 ? -33.101 10.234  75.430  1.00 32.00 ? 334 PHE B C     1 
ATOM   4839 O  O     . PHE B 1 303 ? -32.268 9.467   75.930  1.00 31.98 ? 334 PHE B O     1 
ATOM   4840 C  CB    . PHE B 1 303 ? -34.827 11.397  76.835  1.00 32.46 ? 334 PHE B CB    1 
ATOM   4841 C  CG    . PHE B 1 303 ? -34.968 10.150  77.645  1.00 33.28 ? 334 PHE B CG    1 
ATOM   4842 C  CD1   . PHE B 1 303 ? -34.416 10.064  78.913  1.00 32.83 ? 334 PHE B CD1   1 
ATOM   4843 C  CD2   . PHE B 1 303 ? -35.699 9.057   77.143  1.00 35.56 ? 334 PHE B CD2   1 
ATOM   4844 C  CE1   . PHE B 1 303 ? -34.568 8.922   79.679  1.00 32.87 ? 334 PHE B CE1   1 
ATOM   4845 C  CE2   . PHE B 1 303 ? -35.854 7.902   77.896  1.00 35.04 ? 334 PHE B CE2   1 
ATOM   4846 C  CZ    . PHE B 1 303 ? -35.276 7.836   79.179  1.00 34.39 ? 334 PHE B CZ    1 
ATOM   4847 N  N     . VAL B 1 304 ? -33.717 9.981   74.278  1.00 31.52 ? 335 VAL B N     1 
ATOM   4848 C  CA    . VAL B 1 304 ? -33.468 8.748   73.560  1.00 31.27 ? 335 VAL B CA    1 
ATOM   4849 C  C     . VAL B 1 304 ? -32.058 8.771   72.978  1.00 31.73 ? 335 VAL B C     1 
ATOM   4850 O  O     . VAL B 1 304 ? -31.333 7.786   73.106  1.00 31.93 ? 335 VAL B O     1 
ATOM   4851 C  CB    . VAL B 1 304 ? -34.541 8.473   72.481  1.00 31.24 ? 335 VAL B CB    1 
ATOM   4852 C  CG1   . VAL B 1 304 ? -34.043 7.479   71.454  1.00 31.03 ? 335 VAL B CG1   1 
ATOM   4853 C  CG2   . VAL B 1 304 ? -35.804 7.965   73.129  1.00 29.14 ? 335 VAL B CG2   1 
ATOM   4854 N  N     . PHE B 1 305 ? -31.637 9.892   72.388  1.00 31.71 ? 336 PHE B N     1 
ATOM   4855 C  CA    . PHE B 1 305 ? -30.302 9.939   71.813  1.00 31.45 ? 336 PHE B CA    1 
ATOM   4856 C  C     . PHE B 1 305 ? -29.195 9.808   72.855  1.00 31.40 ? 336 PHE B C     1 
ATOM   4857 O  O     . PHE B 1 305 ? -28.137 9.266   72.576  1.00 31.62 ? 336 PHE B O     1 
ATOM   4858 C  CB    . PHE B 1 305 ? -30.078 11.180  70.967  1.00 31.35 ? 336 PHE B CB    1 
ATOM   4859 C  CG    . PHE B 1 305 ? -28.911 11.050  70.067  1.00 30.73 ? 336 PHE B CG    1 
ATOM   4860 C  CD1   . PHE B 1 305 ? -29.003 10.272  68.911  1.00 30.41 ? 336 PHE B CD1   1 
ATOM   4861 C  CD2   . PHE B 1 305 ? -27.708 11.622  70.397  1.00 30.18 ? 336 PHE B CD2   1 
ATOM   4862 C  CE1   . PHE B 1 305 ? -27.927 10.126  68.064  1.00 30.17 ? 336 PHE B CE1   1 
ATOM   4863 C  CE2   . PHE B 1 305 ? -26.616 11.478  69.557  1.00 31.79 ? 336 PHE B CE2   1 
ATOM   4864 C  CZ    . PHE B 1 305 ? -26.728 10.732  68.377  1.00 31.27 ? 336 PHE B CZ    1 
ATOM   4865 N  N     . ASP B 1 306 ? -29.444 10.301  74.057  1.00 31.61 ? 337 ASP B N     1 
ATOM   4866 C  CA    . ASP B 1 306 ? -28.535 10.089  75.183  1.00 31.55 ? 337 ASP B CA    1 
ATOM   4867 C  C     . ASP B 1 306 ? -28.367 8.585   75.471  1.00 31.18 ? 337 ASP B C     1 
ATOM   4868 O  O     . ASP B 1 306 ? -27.260 8.097   75.670  1.00 31.25 ? 337 ASP B O     1 
ATOM   4869 C  CB    . ASP B 1 306 ? -29.100 10.817  76.406  1.00 31.85 ? 337 ASP B CB    1 
ATOM   4870 C  CG    . ASP B 1 306 ? -28.158 10.815  77.580  1.00 33.57 ? 337 ASP B CG    1 
ATOM   4871 O  OD1   . ASP B 1 306 ? -28.266 9.899   78.427  1.00 36.06 ? 337 ASP B OD1   1 
ATOM   4872 O  OD2   . ASP B 1 306 ? -27.312 11.733  77.651  1.00 35.75 ? 337 ASP B OD2   1 
ATOM   4873 N  N     . ALA B 1 307 ? -29.470 7.851   75.481  1.00 30.73 ? 338 ALA B N     1 
ATOM   4874 C  CA    . ALA B 1 307 ? -29.414 6.414   75.724  1.00 30.83 ? 338 ALA B CA    1 
ATOM   4875 C  C     . ALA B 1 307 ? -28.720 5.680   74.560  1.00 30.80 ? 338 ALA B C     1 
ATOM   4876 O  O     . ALA B 1 307 ? -27.882 4.794   74.773  1.00 30.85 ? 338 ALA B O     1 
ATOM   4877 C  CB    . ALA B 1 307 ? -30.821 5.854   75.971  1.00 30.40 ? 338 ALA B CB    1 
ATOM   4878 N  N     . VAL B 1 308 ? -29.069 6.060   73.333  1.00 30.62 ? 339 VAL B N     1 
ATOM   4879 C  CA    . VAL B 1 308 ? -28.411 5.546   72.136  1.00 30.54 ? 339 VAL B CA    1 
ATOM   4880 C  C     . VAL B 1 308 ? -26.899 5.700   72.229  1.00 30.42 ? 339 VAL B C     1 
ATOM   4881 O  O     . VAL B 1 308 ? -26.165 4.748   71.961  1.00 30.54 ? 339 VAL B O     1 
ATOM   4882 C  CB    . VAL B 1 308 ? -28.913 6.282   70.863  1.00 30.68 ? 339 VAL B CB    1 
ATOM   4883 C  CG1   . VAL B 1 308 ? -28.004 6.018   69.673  1.00 30.15 ? 339 VAL B CG1   1 
ATOM   4884 C  CG2   . VAL B 1 308 ? -30.334 5.876   70.550  1.00 30.79 ? 339 VAL B CG2   1 
ATOM   4885 N  N     . THR B 1 309 ? -26.436 6.892   72.613  1.00 30.21 ? 340 THR B N     1 
ATOM   4886 C  CA    . THR B 1 309 ? -24.995 7.171   72.685  1.00 29.96 ? 340 THR B CA    1 
ATOM   4887 C  C     . THR B 1 309 ? -24.311 6.323   73.756  1.00 29.69 ? 340 THR B C     1 
ATOM   4888 O  O     . THR B 1 309 ? -23.186 5.876   73.583  1.00 29.51 ? 340 THR B O     1 
ATOM   4889 C  CB    . THR B 1 309 ? -24.714 8.665   72.939  1.00 30.11 ? 340 THR B CB    1 
ATOM   4890 O  OG1   . THR B 1 309 ? -25.174 9.446   71.822  1.00 30.26 ? 340 THR B OG1   1 
ATOM   4891 C  CG2   . THR B 1 309 ? -23.220 8.908   73.134  1.00 29.53 ? 340 THR B CG2   1 
ATOM   4892 N  N     . ASP B 1 310 ? -25.001 6.091   74.863  1.00 29.80 ? 341 ASP B N     1 
ATOM   4893 C  CA    . ASP B 1 310 ? -24.481 5.214   75.901  1.00 29.90 ? 341 ASP B CA    1 
ATOM   4894 C  C     . ASP B 1 310 ? -24.313 3.790   75.395  1.00 29.84 ? 341 ASP B C     1 
ATOM   4895 O  O     . ASP B 1 310 ? -23.342 3.118   75.770  1.00 30.22 ? 341 ASP B O     1 
ATOM   4896 C  CB    . ASP B 1 310 ? -25.394 5.224   77.128  1.00 30.09 ? 341 ASP B CB    1 
ATOM   4897 C  CG    . ASP B 1 310 ? -25.158 6.433   78.042  1.00 31.37 ? 341 ASP B CG    1 
ATOM   4898 O  OD1   . ASP B 1 310 ? -24.232 7.253   77.769  1.00 31.89 ? 341 ASP B OD1   1 
ATOM   4899 O  OD2   . ASP B 1 310 ? -25.918 6.555   79.040  1.00 31.41 ? 341 ASP B OD2   1 
ATOM   4900 N  N     . VAL B 1 311 ? -25.238 3.338   74.544  1.00 29.55 ? 342 VAL B N     1 
ATOM   4901 C  CA    . VAL B 1 311 ? -25.153 2.008   73.968  1.00 29.38 ? 342 VAL B CA    1 
ATOM   4902 C  C     . VAL B 1 311 ? -23.960 1.953   73.044  1.00 29.34 ? 342 VAL B C     1 
ATOM   4903 O  O     . VAL B 1 311 ? -23.254 0.956   72.977  1.00 29.84 ? 342 VAL B O     1 
ATOM   4904 C  CB    . VAL B 1 311 ? -26.433 1.613   73.209  1.00 29.47 ? 342 VAL B CB    1 
ATOM   4905 C  CG1   . VAL B 1 311 ? -26.174 0.412   72.302  1.00 29.19 ? 342 VAL B CG1   1 
ATOM   4906 C  CG2   . VAL B 1 311 ? -27.566 1.318   74.202  1.00 29.64 ? 342 VAL B CG2   1 
ATOM   4907 N  N     . ILE B 1 312 ? -23.712 3.037   72.337  1.00 29.41 ? 343 ILE B N     1 
ATOM   4908 C  CA    . ILE B 1 312 ? -22.577 3.066   71.444  1.00 29.43 ? 343 ILE B CA    1 
ATOM   4909 C  C     . ILE B 1 312 ? -21.285 2.999   72.254  1.00 29.91 ? 343 ILE B C     1 
ATOM   4910 O  O     . ILE B 1 312 ? -20.402 2.214   71.926  1.00 29.74 ? 343 ILE B O     1 
ATOM   4911 C  CB    . ILE B 1 312 ? -22.599 4.308   70.559  1.00 29.15 ? 343 ILE B CB    1 
ATOM   4912 C  CG1   . ILE B 1 312 ? -23.802 4.245   69.619  1.00 28.67 ? 343 ILE B CG1   1 
ATOM   4913 C  CG2   . ILE B 1 312 ? -21.302 4.418   69.766  1.00 28.69 ? 343 ILE B CG2   1 
ATOM   4914 C  CD1   . ILE B 1 312 ? -24.006 5.496   68.830  1.00 27.49 ? 343 ILE B CD1   1 
ATOM   4915 N  N     . ILE B 1 313 ? -21.186 3.803   73.316  1.00 30.57 ? 344 ILE B N     1 
ATOM   4916 C  CA    . ILE B 1 313 ? -20.007 3.775   74.183  1.00 31.23 ? 344 ILE B CA    1 
ATOM   4917 C  C     . ILE B 1 313 ? -19.759 2.352   74.711  1.00 31.68 ? 344 ILE B C     1 
ATOM   4918 O  O     . ILE B 1 313 ? -18.648 1.839   74.621  1.00 31.84 ? 344 ILE B O     1 
ATOM   4919 C  CB    . ILE B 1 313 ? -20.130 4.754   75.415  1.00 31.76 ? 344 ILE B CB    1 
ATOM   4920 C  CG1   . ILE B 1 313 ? -20.163 6.221   74.969  1.00 31.96 ? 344 ILE B CG1   1 
ATOM   4921 C  CG2   . ILE B 1 313 ? -18.995 4.524   76.436  1.00 29.52 ? 344 ILE B CG2   1 
ATOM   4922 C  CD1   . ILE B 1 313 ? -19.336 6.484   73.738  1.00 33.47 ? 344 ILE B CD1   1 
ATOM   4923 N  N     . LYS B 1 314 ? -20.798 1.721   75.245  1.00 31.85 ? 345 LYS B N     1 
ATOM   4924 C  CA    . LYS B 1 314 ? -20.674 0.370   75.793  1.00 32.42 ? 345 LYS B CA    1 
ATOM   4925 C  C     . LYS B 1 314 ? -20.304 -0.695  74.741  1.00 32.57 ? 345 LYS B C     1 
ATOM   4926 O  O     . LYS B 1 314 ? -19.594 -1.646  75.056  1.00 32.07 ? 345 LYS B O     1 
ATOM   4927 C  CB    . LYS B 1 314 ? -21.967 -0.021  76.542  1.00 32.62 ? 345 LYS B CB    1 
ATOM   4928 N  N     . ASN B 1 315 ? -20.756 -0.524  73.499  1.00 33.09 ? 346 ASN B N     1 
ATOM   4929 C  CA    . ASN B 1 315 ? -20.448 -1.494  72.438  1.00 33.63 ? 346 ASN B CA    1 
ATOM   4930 C  C     . ASN B 1 315 ? -19.105 -1.301  71.730  1.00 34.17 ? 346 ASN B C     1 
ATOM   4931 O  O     . ASN B 1 315 ? -18.666 -2.185  70.993  1.00 34.16 ? 346 ASN B O     1 
ATOM   4932 C  CB    . ASN B 1 315 ? -21.582 -1.528  71.413  1.00 33.54 ? 346 ASN B CB    1 
ATOM   4933 C  CG    . ASN B 1 315 ? -22.849 -2.139  71.973  1.00 33.54 ? 346 ASN B CG    1 
ATOM   4934 O  OD1   . ASN B 1 315 ? -22.804 -2.916  72.913  1.00 33.22 ? 346 ASN B OD1   1 
ATOM   4935 N  ND2   . ASN B 1 315 ? -23.991 -1.788  71.388  1.00 35.48 ? 346 ASN B ND2   1 
ATOM   4936 N  N     . ASN B 1 316 ? -18.448 -0.168  71.958  1.00 34.85 ? 347 ASN B N     1 
ATOM   4937 C  CA    . ASN B 1 316 ? -17.286 0.192   71.171  1.00 35.56 ? 347 ASN B CA    1 
ATOM   4938 C  C     . ASN B 1 316 ? -16.201 0.767   72.058  1.00 36.22 ? 347 ASN B C     1 
ATOM   4939 O  O     . ASN B 1 316 ? -15.579 1.769   71.709  1.00 36.67 ? 347 ASN B O     1 
ATOM   4940 C  CB    . ASN B 1 316 ? -17.720 1.193   70.069  1.00 35.69 ? 347 ASN B CB    1 
ATOM   4941 N  N     . LEU B 1 317 ? -15.929 0.116   73.185  1.00 37.11 ? 348 LEU B N     1 
ATOM   4942 C  CA    . LEU B 1 317 ? -15.155 0.810   74.242  1.00 37.70 ? 348 LEU B CA    1 
ATOM   4943 C  C     . LEU B 1 317 ? -14.503 -0.095  75.298  1.00 38.06 ? 348 LEU B C     1 
ATOM   4944 O  O     . LEU B 1 317 ? -14.205 -1.269  75.034  1.00 38.76 ? 348 LEU B O     1 
ATOM   4945 C  CB    . LEU B 1 317 ? -16.010 1.936   74.947  1.00 37.83 ? 348 LEU B CB    1 
ATOM   4946 N  N     . VAL C 2 13  ? -15.980 32.967  29.837  1.00 39.68 ? 60  VAL C N     1 
ATOM   4947 C  CA    . VAL C 2 13  ? -17.126 33.844  30.194  1.00 39.61 ? 60  VAL C CA    1 
ATOM   4948 C  C     . VAL C 2 13  ? -17.860 33.287  31.410  1.00 39.65 ? 60  VAL C C     1 
ATOM   4949 O  O     . VAL C 2 13  ? -18.817 32.514  31.277  1.00 40.22 ? 60  VAL C O     1 
ATOM   4950 C  CB    . VAL C 2 13  ? -18.108 34.022  28.996  1.00 39.69 ? 60  VAL C CB    1 
ATOM   4951 C  CG1   . VAL C 2 13  ? -17.537 35.007  27.963  1.00 39.13 ? 60  VAL C CG1   1 
ATOM   4952 C  CG2   . VAL C 2 13  ? -18.429 32.672  28.345  1.00 39.71 ? 60  VAL C CG2   1 
ATOM   4953 N  N     . LEU C 2 14  ? -17.388 33.653  32.601  1.00 39.42 ? 61  LEU C N     1 
ATOM   4954 C  CA    . LEU C 2 14  ? -18.112 33.357  33.845  1.00 39.27 ? 61  LEU C CA    1 
ATOM   4955 C  C     . LEU C 2 14  ? -17.678 34.316  34.950  1.00 38.79 ? 61  LEU C C     1 
ATOM   4956 O  O     . LEU C 2 14  ? -16.495 34.430  35.256  1.00 38.78 ? 61  LEU C O     1 
ATOM   4957 C  CB    . LEU C 2 14  ? -17.922 31.905  34.298  1.00 39.24 ? 61  LEU C CB    1 
ATOM   4958 C  CG    . LEU C 2 14  ? -18.895 31.453  35.409  1.00 40.13 ? 61  LEU C CG    1 
ATOM   4959 C  CD1   . LEU C 2 14  ? -20.329 31.421  34.890  1.00 40.62 ? 61  LEU C CD1   1 
ATOM   4960 C  CD2   . LEU C 2 14  ? -18.543 30.082  36.007  1.00 39.59 ? 61  LEU C CD2   1 
ATOM   4961 N  N     . SER C 2 15  ? -18.659 34.982  35.556  1.00 38.28 ? 62  SER C N     1 
ATOM   4962 C  CA    . SER C 2 15  ? -18.425 36.094  36.469  1.00 37.62 ? 62  SER C CA    1 
ATOM   4963 C  C     . SER C 2 15  ? -19.003 35.814  37.848  1.00 37.20 ? 62  SER C C     1 
ATOM   4964 O  O     . SER C 2 15  ? -19.801 34.888  38.025  1.00 37.06 ? 62  SER C O     1 
ATOM   4965 C  CB    . SER C 2 15  ? -19.117 37.329  35.908  1.00 37.57 ? 62  SER C CB    1 
ATOM   4966 O  OG    . SER C 2 15  ? -20.504 37.059  35.730  1.00 37.13 ? 62  SER C OG    1 
ATOM   4967 N  N     . ALA C 2 16  ? -18.610 36.642  38.813  1.00 36.70 ? 63  ALA C N     1 
ATOM   4968 C  CA    . ALA C 2 16  ? -19.249 36.679  40.129  1.00 36.43 ? 63  ALA C CA    1 
ATOM   4969 C  C     . ALA C 2 16  ? -20.743 36.989  40.014  1.00 36.20 ? 63  ALA C C     1 
ATOM   4970 O  O     . ALA C 2 16  ? -21.569 36.337  40.652  1.00 36.03 ? 63  ALA C O     1 
ATOM   4971 C  CB    . ALA C 2 16  ? -18.565 37.713  41.020  1.00 36.30 ? 63  ALA C CB    1 
ATOM   4972 N  N     . ALA C 2 17  ? -21.079 37.985  39.198  1.00 36.05 ? 64  ALA C N     1 
ATOM   4973 C  CA    . ALA C 2 17  ? -22.470 38.370  38.971  1.00 36.06 ? 64  ALA C CA    1 
ATOM   4974 C  C     . ALA C 2 17  ? -23.330 37.186  38.525  1.00 36.18 ? 64  ALA C C     1 
ATOM   4975 O  O     . ALA C 2 17  ? -24.477 37.061  38.953  1.00 36.36 ? 64  ALA C O     1 
ATOM   4976 C  CB    . ALA C 2 17  ? -22.553 39.495  37.951  1.00 35.94 ? 64  ALA C CB    1 
ATOM   4977 N  N     . GLU C 2 18  ? -22.781 36.324  37.671  1.00 36.16 ? 65  GLU C N     1 
ATOM   4978 C  CA    . GLU C 2 18  ? -23.502 35.133  37.212  1.00 36.17 ? 65  GLU C CA    1 
ATOM   4979 C  C     . GLU C 2 18  ? -23.708 34.144  38.372  1.00 35.97 ? 65  GLU C C     1 
ATOM   4980 O  O     . GLU C 2 18  ? -24.832 33.703  38.637  1.00 35.93 ? 65  GLU C O     1 
ATOM   4981 C  CB    . GLU C 2 18  ? -22.758 34.477  36.033  1.00 36.36 ? 65  GLU C CB    1 
ATOM   4982 C  CG    . GLU C 2 18  ? -23.219 33.052  35.634  1.00 37.10 ? 65  GLU C CG    1 
ATOM   4983 C  CD    . GLU C 2 18  ? -24.565 33.000  34.918  1.00 38.27 ? 65  GLU C CD    1 
ATOM   4984 O  OE1   . GLU C 2 18  ? -24.779 33.833  34.013  1.00 37.60 ? 65  GLU C OE1   1 
ATOM   4985 O  OE2   . GLU C 2 18  ? -25.396 32.103  35.239  1.00 38.81 ? 65  GLU C OE2   1 
ATOM   4986 N  N     . VAL C 2 19  ? -22.622 33.823  39.070  1.00 35.58 ? 66  VAL C N     1 
ATOM   4987 C  CA    . VAL C 2 19  ? -22.651 32.838  40.147  1.00 35.17 ? 66  VAL C CA    1 
ATOM   4988 C  C     . VAL C 2 19  ? -23.447 33.311  41.369  1.00 34.98 ? 66  VAL C C     1 
ATOM   4989 O  O     . VAL C 2 19  ? -24.138 32.522  41.992  1.00 34.57 ? 66  VAL C O     1 
ATOM   4990 C  CB    . VAL C 2 19  ? -21.226 32.423  40.558  1.00 35.16 ? 66  VAL C CB    1 
ATOM   4991 C  CG1   . VAL C 2 19  ? -21.255 31.479  41.758  1.00 35.02 ? 66  VAL C CG1   1 
ATOM   4992 C  CG2   . VAL C 2 19  ? -20.525 31.761  39.383  1.00 35.08 ? 66  VAL C CG2   1 
ATOM   4993 N  N     . MET C 2 20  ? -23.373 34.592  41.708  1.00 35.06 ? 67  MET C N     1 
ATOM   4994 C  CA    . MET C 2 20  ? -24.261 35.131  42.745  1.00 35.30 ? 67  MET C CA    1 
ATOM   4995 C  C     . MET C 2 20  ? -25.724 34.948  42.338  1.00 34.89 ? 67  MET C C     1 
ATOM   4996 O  O     . MET C 2 20  ? -26.536 34.503  43.148  1.00 34.60 ? 67  MET C O     1 
ATOM   4997 C  CB    . MET C 2 20  ? -23.956 36.606  43.059  1.00 35.45 ? 67  MET C CB    1 
ATOM   4998 C  CG    . MET C 2 20  ? -22.911 36.797  44.168  1.00 35.83 ? 67  MET C CG    1 
ATOM   4999 S  SD    . MET C 2 20  ? -21.978 38.352  44.081  1.00 36.55 ? 67  MET C SD    1 
ATOM   5000 C  CE    . MET C 2 20  ? -20.666 38.059  45.272  1.00 36.44 ? 67  MET C CE    1 
ATOM   5001 N  N     . GLN C 2 21  ? -26.045 35.247  41.079  1.00 34.84 ? 68  GLN C N     1 
ATOM   5002 C  CA    . GLN C 2 21  ? -27.421 35.108  40.575  1.00 34.98 ? 68  GLN C CA    1 
ATOM   5003 C  C     . GLN C 2 21  ? -27.960 33.663  40.654  1.00 35.26 ? 68  GLN C C     1 
ATOM   5004 O  O     . GLN C 2 21  ? -29.176 33.448  40.643  1.00 35.00 ? 68  GLN C O     1 
ATOM   5005 C  CB    . GLN C 2 21  ? -27.549 35.651  39.142  1.00 35.08 ? 68  GLN C CB    1 
ATOM   5006 C  CG    . GLN C 2 21  ? -27.734 37.177  39.047  1.00 34.74 ? 68  GLN C CG    1 
ATOM   5007 N  N     . TRP C 2 22  ? -27.065 32.679  40.745  1.00 35.43 ? 69  TRP C N     1 
ATOM   5008 C  CA    . TRP C 2 22  ? -27.474 31.294  40.946  1.00 35.49 ? 69  TRP C CA    1 
ATOM   5009 C  C     . TRP C 2 22  ? -28.282 31.069  42.243  1.00 35.39 ? 69  TRP C C     1 
ATOM   5010 O  O     . TRP C 2 22  ? -29.056 30.121  42.331  1.00 35.16 ? 69  TRP C O     1 
ATOM   5011 C  CB    . TRP C 2 22  ? -26.251 30.367  40.924  1.00 35.43 ? 69  TRP C CB    1 
ATOM   5012 C  CG    . TRP C 2 22  ? -25.646 30.156  39.555  1.00 35.36 ? 69  TRP C CG    1 
ATOM   5013 C  CD1   . TRP C 2 22  ? -26.182 30.524  38.357  1.00 35.11 ? 69  TRP C CD1   1 
ATOM   5014 C  CD2   . TRP C 2 22  ? -24.414 29.473  39.249  1.00 34.86 ? 69  TRP C CD2   1 
ATOM   5015 N  NE1   . TRP C 2 22  ? -25.359 30.132  37.332  1.00 35.63 ? 69  TRP C NE1   1 
ATOM   5016 C  CE2   . TRP C 2 22  ? -24.273 29.478  37.850  1.00 35.01 ? 69  TRP C CE2   1 
ATOM   5017 C  CE3   . TRP C 2 22  ? -23.423 28.860  40.023  1.00 34.99 ? 69  TRP C CE3   1 
ATOM   5018 C  CZ2   . TRP C 2 22  ? -23.177 28.905  37.206  1.00 34.63 ? 69  TRP C CZ2   1 
ATOM   5019 C  CZ3   . TRP C 2 22  ? -22.342 28.281  39.382  1.00 35.03 ? 69  TRP C CZ3   1 
ATOM   5020 C  CH2   . TRP C 2 22  ? -22.228 28.311  37.986  1.00 34.86 ? 69  TRP C CH2   1 
ATOM   5021 N  N     . SER C 2 23  ? -28.107 31.942  43.230  1.00 35.40 ? 70  SER C N     1 
ATOM   5022 C  CA    . SER C 2 23  ? -28.894 31.893  44.465  1.00 35.21 ? 70  SER C CA    1 
ATOM   5023 C  C     . SER C 2 23  ? -30.296 32.488  44.317  1.00 35.54 ? 70  SER C C     1 
ATOM   5024 O  O     . SER C 2 23  ? -31.106 32.350  45.225  1.00 35.59 ? 70  SER C O     1 
ATOM   5025 C  CB    . SER C 2 23  ? -28.168 32.623  45.599  1.00 35.13 ? 70  SER C CB    1 
ATOM   5026 O  OG    . SER C 2 23  ? -28.211 34.029  45.417  1.00 33.88 ? 70  SER C OG    1 
ATOM   5027 N  N     . GLN C 2 24  ? -30.581 33.170  43.206  1.00 35.90 ? 71  GLN C N     1 
ATOM   5028 C  CA    . GLN C 2 24  ? -31.924 33.722  42.981  1.00 36.23 ? 71  GLN C CA    1 
ATOM   5029 C  C     . GLN C 2 24  ? -32.917 32.593  42.758  1.00 36.28 ? 71  GLN C C     1 
ATOM   5030 O  O     . GLN C 2 24  ? -33.987 32.594  43.346  1.00 36.39 ? 71  GLN C O     1 
ATOM   5031 C  CB    . GLN C 2 24  ? -31.993 34.694  41.780  1.00 36.44 ? 71  GLN C CB    1 
ATOM   5032 C  CG    . GLN C 2 24  ? -31.160 35.981  41.871  1.00 36.89 ? 71  GLN C CG    1 
ATOM   5033 C  CD    . GLN C 2 24  ? -31.606 36.926  42.973  1.00 37.88 ? 71  GLN C CD    1 
ATOM   5034 O  OE1   . GLN C 2 24  ? -31.326 36.694  44.148  1.00 38.47 ? 71  GLN C OE1   1 
ATOM   5035 N  NE2   . GLN C 2 24  ? -32.276 38.017  42.595  1.00 37.82 ? 71  GLN C NE2   1 
ATOM   5036 N  N     . SER C 2 25  ? -32.572 31.635  41.903  1.00 36.61 ? 72  SER C N     1 
ATOM   5037 C  CA    . SER C 2 25  ? -33.482 30.518  41.607  1.00 36.95 ? 72  SER C CA    1 
ATOM   5038 C  C     . SER C 2 25  ? -32.780 29.313  40.978  1.00 37.00 ? 72  SER C C     1 
ATOM   5039 O  O     . SER C 2 25  ? -31.680 29.434  40.447  1.00 36.95 ? 72  SER C O     1 
ATOM   5040 C  CB    . SER C 2 25  ? -34.621 30.988  40.694  1.00 36.94 ? 72  SER C CB    1 
ATOM   5041 O  OG    . SER C 2 25  ? -34.114 31.726  39.592  1.00 37.55 ? 72  SER C OG    1 
ATOM   5042 N  N     . LEU C 2 26  ? -33.430 28.153  41.050  1.00 37.21 ? 73  LEU C N     1 
ATOM   5043 C  CA    . LEU C 2 26  ? -32.937 26.944  40.384  1.00 37.30 ? 73  LEU C CA    1 
ATOM   5044 C  C     . LEU C 2 26  ? -32.954 27.103  38.863  1.00 37.67 ? 73  LEU C C     1 
ATOM   5045 O  O     . LEU C 2 26  ? -32.084 26.560  38.170  1.00 37.59 ? 73  LEU C O     1 
ATOM   5046 C  CB    . LEU C 2 26  ? -33.757 25.703  40.777  1.00 37.26 ? 73  LEU C CB    1 
ATOM   5047 C  CG    . LEU C 2 26  ? -33.226 24.366  40.220  1.00 36.99 ? 73  LEU C CG    1 
ATOM   5048 C  CD1   . LEU C 2 26  ? -31.781 24.087  40.660  1.00 35.06 ? 73  LEU C CD1   1 
ATOM   5049 C  CD2   . LEU C 2 26  ? -34.144 23.216  40.596  1.00 36.80 ? 73  LEU C CD2   1 
ATOM   5050 N  N     . GLU C 2 27  ? -33.954 27.831  38.356  1.00 37.92 ? 74  GLU C N     1 
ATOM   5051 C  CA    . GLU C 2 27  ? -34.082 28.100  36.925  1.00 38.23 ? 74  GLU C CA    1 
ATOM   5052 C  C     . GLU C 2 27  ? -32.859 28.853  36.396  1.00 38.44 ? 74  GLU C C     1 
ATOM   5053 O  O     . GLU C 2 27  ? -32.340 28.537  35.320  1.00 38.38 ? 74  GLU C O     1 
ATOM   5054 C  CB    . GLU C 2 27  ? -35.358 28.907  36.637  1.00 38.18 ? 74  GLU C CB    1 
ATOM   5055 C  CG    . GLU C 2 27  ? -35.476 29.421  35.201  1.00 38.18 ? 74  GLU C CG    1 
ATOM   5056 C  CD    . GLU C 2 27  ? -36.699 30.293  34.980  1.00 38.50 ? 74  GLU C CD    1 
ATOM   5057 O  OE1   . GLU C 2 27  ? -37.590 30.325  35.858  1.00 40.17 ? 74  GLU C OE1   1 
ATOM   5058 O  OE2   . GLU C 2 27  ? -36.770 30.945  33.918  1.00 38.30 ? 74  GLU C OE2   1 
ATOM   5059 N  N     . LYS C 2 28  ? -32.418 29.858  37.150  1.00 38.66 ? 75  LYS C N     1 
ATOM   5060 C  CA    . LYS C 2 28  ? -31.243 30.633  36.779  1.00 39.00 ? 75  LYS C CA    1 
ATOM   5061 C  C     . LYS C 2 28  ? -29.998 29.738  36.826  1.00 39.18 ? 75  LYS C C     1 
ATOM   5062 O  O     . LYS C 2 28  ? -29.128 29.823  35.970  1.00 39.27 ? 75  LYS C O     1 
ATOM   5063 C  CB    . LYS C 2 28  ? -31.072 31.866  37.689  1.00 39.04 ? 75  LYS C CB    1 
ATOM   5064 C  CG    . LYS C 2 28  ? -31.796 33.136  37.195  1.00 39.47 ? 75  LYS C CG    1 
ATOM   5065 N  N     . LEU C 2 29  ? -29.927 28.860  37.815  1.00 39.37 ? 76  LEU C N     1 
ATOM   5066 C  CA    . LEU C 2 29  ? -28.786 27.964  37.938  1.00 39.43 ? 76  LEU C CA    1 
ATOM   5067 C  C     . LEU C 2 29  ? -28.702 26.999  36.744  1.00 39.64 ? 76  LEU C C     1 
ATOM   5068 O  O     . LEU C 2 29  ? -27.619 26.740  36.219  1.00 39.81 ? 76  LEU C O     1 
ATOM   5069 C  CB    . LEU C 2 29  ? -28.859 27.198  39.264  1.00 39.18 ? 76  LEU C CB    1 
ATOM   5070 C  CG    . LEU C 2 29  ? -27.866 26.053  39.485  1.00 39.18 ? 76  LEU C CG    1 
ATOM   5071 C  CD1   . LEU C 2 29  ? -26.429 26.457  39.145  1.00 38.06 ? 76  LEU C CD1   1 
ATOM   5072 C  CD2   . LEU C 2 29  ? -27.956 25.562  40.922  1.00 38.98 ? 76  LEU C CD2   1 
ATOM   5073 N  N     . LEU C 2 30  ? -29.848 26.471  36.327  1.00 39.75 ? 77  LEU C N     1 
ATOM   5074 C  CA    . LEU C 2 30  ? -29.901 25.503  35.236  1.00 39.84 ? 77  LEU C CA    1 
ATOM   5075 C  C     . LEU C 2 30  ? -30.053 26.161  33.870  1.00 40.01 ? 77  LEU C C     1 
ATOM   5076 O  O     . LEU C 2 30  ? -30.091 25.473  32.858  1.00 40.07 ? 77  LEU C O     1 
ATOM   5077 C  CB    . LEU C 2 30  ? -31.045 24.511  35.466  1.00 39.61 ? 77  LEU C CB    1 
ATOM   5078 C  CG    . LEU C 2 30  ? -30.895 23.656  36.722  1.00 39.62 ? 77  LEU C CG    1 
ATOM   5079 C  CD1   . LEU C 2 30  ? -32.191 22.917  37.019  1.00 39.00 ? 77  LEU C CD1   1 
ATOM   5080 C  CD2   . LEU C 2 30  ? -29.718 22.674  36.588  1.00 39.07 ? 77  LEU C CD2   1 
ATOM   5081 N  N     . ALA C 2 31  ? -30.146 27.485  33.831  1.00 40.27 ? 78  ALA C N     1 
ATOM   5082 C  CA    . ALA C 2 31  ? -30.240 28.189  32.559  1.00 40.67 ? 78  ALA C CA    1 
ATOM   5083 C  C     . ALA C 2 31  ? -29.018 27.900  31.701  1.00 40.80 ? 78  ALA C C     1 
ATOM   5084 O  O     . ALA C 2 31  ? -29.119 27.731  30.486  1.00 40.70 ? 78  ALA C O     1 
ATOM   5085 C  CB    . ALA C 2 31  ? -30.368 29.699  32.796  1.00 40.63 ? 78  ALA C CB    1 
ATOM   5086 N  N     . ASN C 2 32  ? -27.871 27.822  32.359  1.00 40.94 ? 79  ASN C N     1 
ATOM   5087 C  CA    . ASN C 2 32  ? -26.595 27.769  31.689  1.00 41.38 ? 79  ASN C CA    1 
ATOM   5088 C  C     . ASN C 2 32  ? -25.877 26.428  31.852  1.00 41.02 ? 79  ASN C C     1 
ATOM   5089 O  O     . ASN C 2 32  ? -25.999 25.779  32.880  1.00 41.25 ? 79  ASN C O     1 
ATOM   5090 C  CB    . ASN C 2 32  ? -25.761 28.927  32.277  1.00 41.92 ? 79  ASN C CB    1 
ATOM   5091 C  CG    . ASN C 2 32  ? -24.293 28.802  31.976  1.00 42.53 ? 79  ASN C CG    1 
ATOM   5092 O  OD1   . ASN C 2 32  ? -23.515 28.359  32.836  1.00 42.93 ? 79  ASN C OD1   1 
ATOM   5093 N  ND2   . ASN C 2 32  ? -23.893 29.184  30.757  1.00 42.28 ? 79  ASN C ND2   1 
ATOM   5094 N  N     . GLN C 2 33  ? -25.116 26.043  30.829  1.00 40.74 ? 80  GLN C N     1 
ATOM   5095 C  CA    . GLN C 2 33  ? -24.355 24.799  30.806  1.00 40.50 ? 80  GLN C CA    1 
ATOM   5096 C  C     . GLN C 2 33  ? -23.278 24.723  31.905  1.00 40.19 ? 80  GLN C C     1 
ATOM   5097 O  O     . GLN C 2 33  ? -23.011 23.636  32.430  1.00 40.12 ? 80  GLN C O     1 
ATOM   5098 C  CB    . GLN C 2 33  ? -23.758 24.636  29.398  1.00 40.71 ? 80  GLN C CB    1 
ATOM   5099 C  CG    . GLN C 2 33  ? -22.460 23.849  29.253  1.00 41.48 ? 80  GLN C CG    1 
ATOM   5100 C  CD    . GLN C 2 33  ? -22.690 22.375  28.981  1.00 41.85 ? 80  GLN C CD    1 
ATOM   5101 O  OE1   . GLN C 2 33  ? -22.509 21.907  27.850  1.00 41.00 ? 80  GLN C OE1   1 
ATOM   5102 N  NE2   . GLN C 2 33  ? -23.089 21.633  30.017  1.00 40.55 ? 80  GLN C NE2   1 
ATOM   5103 N  N     . THR C 2 34  ? -22.655 25.851  32.260  1.00 39.59 ? 81  THR C N     1 
ATOM   5104 C  CA    . THR C 2 34  ? -21.680 25.836  33.365  1.00 39.14 ? 81  THR C CA    1 
ATOM   5105 C  C     . THR C 2 34  ? -22.357 25.511  34.685  1.00 38.76 ? 81  THR C C     1 
ATOM   5106 O  O     . THR C 2 34  ? -21.884 24.645  35.425  1.00 38.56 ? 81  THR C O     1 
ATOM   5107 C  CB    . THR C 2 34  ? -20.909 27.144  33.562  1.00 39.06 ? 81  THR C CB    1 
ATOM   5108 O  OG1   . THR C 2 34  ? -20.369 27.580  32.311  1.00 39.65 ? 81  THR C OG1   1 
ATOM   5109 C  CG2   . THR C 2 34  ? -19.766 26.930  34.562  1.00 38.69 ? 81  THR C CG2   1 
ATOM   5110 N  N     . GLY C 2 35  ? -23.446 26.226  34.974  1.00 38.40 ? 82  GLY C N     1 
ATOM   5111 C  CA    . GLY C 2 35  ? -24.221 26.034  36.200  1.00 38.03 ? 82  GLY C CA    1 
ATOM   5112 C  C     . GLY C 2 35  ? -24.773 24.629  36.350  1.00 37.85 ? 82  GLY C C     1 
ATOM   5113 O  O     . GLY C 2 35  ? -24.813 24.089  37.457  1.00 37.91 ? 82  GLY C O     1 
ATOM   5114 N  N     . GLN C 2 36  ? -25.194 24.040  35.230  1.00 37.57 ? 83  GLN C N     1 
ATOM   5115 C  CA    . GLN C 2 36  ? -25.559 22.613  35.167  1.00 37.15 ? 83  GLN C CA    1 
ATOM   5116 C  C     . GLN C 2 36  ? -24.428 21.715  35.652  1.00 36.65 ? 83  GLN C C     1 
ATOM   5117 O  O     . GLN C 2 36  ? -24.629 20.864  36.508  1.00 36.61 ? 83  GLN C O     1 
ATOM   5118 C  CB    . GLN C 2 36  ? -25.915 22.202  33.726  1.00 37.21 ? 83  GLN C CB    1 
ATOM   5119 C  CG    . GLN C 2 36  ? -27.264 22.716  33.244  1.00 37.36 ? 83  GLN C CG    1 
ATOM   5120 C  CD    . GLN C 2 36  ? -27.457 22.598  31.740  1.00 37.26 ? 83  GLN C CD    1 
ATOM   5121 O  OE1   . GLN C 2 36  ? -26.637 22.017  31.019  1.00 38.29 ? 83  GLN C OE1   1 
ATOM   5122 N  NE2   . GLN C 2 36  ? -28.556 23.148  31.260  1.00 36.54 ? 83  GLN C NE2   1 
ATOM   5123 N  N     . ASN C 2 37  ? -23.246 21.902  35.077  1.00 36.49 ? 84  ASN C N     1 
ATOM   5124 C  CA    . ASN C 2 37  ? -22.067 21.129  35.450  1.00 36.30 ? 84  ASN C CA    1 
ATOM   5125 C  C     . ASN C 2 37  ? -21.740 21.235  36.941  1.00 35.98 ? 84  ASN C C     1 
ATOM   5126 O  O     . ASN C 2 37  ? -21.483 20.230  37.592  1.00 36.28 ? 84  ASN C O     1 
ATOM   5127 C  CB    . ASN C 2 37  ? -20.861 21.573  34.622  1.00 36.33 ? 84  ASN C CB    1 
ATOM   5128 C  CG    . ASN C 2 37  ? -21.001 21.215  33.151  1.00 37.06 ? 84  ASN C CG    1 
ATOM   5129 O  OD1   . ASN C 2 37  ? -21.896 20.460  32.779  1.00 38.31 ? 84  ASN C OD1   1 
ATOM   5130 N  ND2   . ASN C 2 37  ? -20.113 21.748  32.311  1.00 36.19 ? 84  ASN C ND2   1 
ATOM   5131 N  N     . VAL C 2 38  ? -21.768 22.448  37.482  1.00 35.51 ? 85  VAL C N     1 
ATOM   5132 C  CA    . VAL C 2 38  ? -21.358 22.681  38.867  1.00 35.14 ? 85  VAL C CA    1 
ATOM   5133 C  C     . VAL C 2 38  ? -22.373 22.093  39.838  1.00 35.04 ? 85  VAL C C     1 
ATOM   5134 O  O     . VAL C 2 38  ? -22.015 21.468  40.847  1.00 35.33 ? 85  VAL C O     1 
ATOM   5135 C  CB    . VAL C 2 38  ? -21.200 24.184  39.150  1.00 35.14 ? 85  VAL C CB    1 
ATOM   5136 C  CG1   . VAL C 2 38  ? -20.932 24.440  40.637  1.00 33.89 ? 85  VAL C CG1   1 
ATOM   5137 C  CG2   . VAL C 2 38  ? -20.085 24.752  38.275  1.00 34.80 ? 85  VAL C CG2   1 
ATOM   5138 N  N     . PHE C 2 39  ? -23.643 22.310  39.525  1.00 34.59 ? 86  PHE C N     1 
ATOM   5139 C  CA    . PHE C 2 39  ? -24.732 21.739  40.289  1.00 34.11 ? 86  PHE C CA    1 
ATOM   5140 C  C     . PHE C 2 39  ? -24.698 20.245  40.179  1.00 33.69 ? 86  PHE C C     1 
ATOM   5141 O  O     . PHE C 2 39  ? -24.963 19.541  41.155  1.00 33.83 ? 86  PHE C O     1 
ATOM   5142 C  CB    . PHE C 2 39  ? -26.072 22.261  39.768  1.00 34.09 ? 86  PHE C CB    1 
ATOM   5143 C  CG    . PHE C 2 39  ? -27.245 21.842  40.596  1.00 33.76 ? 86  PHE C CG    1 
ATOM   5144 C  CD1   . PHE C 2 39  ? -27.223 21.985  41.973  1.00 34.36 ? 86  PHE C CD1   1 
ATOM   5145 C  CD2   . PHE C 2 39  ? -28.373 21.313  39.998  1.00 33.75 ? 86  PHE C CD2   1 
ATOM   5146 C  CE1   . PHE C 2 39  ? -28.300 21.604  42.739  1.00 34.24 ? 86  PHE C CE1   1 
ATOM   5147 C  CE2   . PHE C 2 39  ? -29.454 20.927  40.753  1.00 34.08 ? 86  PHE C CE2   1 
ATOM   5148 C  CZ    . PHE C 2 39  ? -29.421 21.071  42.127  1.00 34.30 ? 86  PHE C CZ    1 
ATOM   5149 N  N     . GLY C 2 40  ? -24.387 19.766  38.978  1.00 33.16 ? 87  GLY C N     1 
ATOM   5150 C  CA    . GLY C 2 40  ? -24.241 18.337  38.727  1.00 33.03 ? 87  GLY C CA    1 
ATOM   5151 C  C     . GLY C 2 40  ? -23.204 17.729  39.642  1.00 32.77 ? 87  GLY C C     1 
ATOM   5152 O  O     . GLY C 2 40  ? -23.448 16.715  40.293  1.00 32.78 ? 87  GLY C O     1 
ATOM   5153 N  N     . SER C 2 41  ? -22.047 18.375  39.701  1.00 32.63 ? 88  SER C N     1 
ATOM   5154 C  CA    . SER C 2 41  ? -20.993 17.990  40.628  1.00 32.64 ? 88  SER C CA    1 
ATOM   5155 C  C     . SER C 2 41  ? -21.473 17.836  42.048  1.00 32.20 ? 88  SER C C     1 
ATOM   5156 O  O     . SER C 2 41  ? -21.103 16.889  42.725  1.00 31.55 ? 88  SER C O     1 
ATOM   5157 C  CB    . SER C 2 41  ? -19.890 19.039  40.642  1.00 32.51 ? 88  SER C CB    1 
ATOM   5158 O  OG    . SER C 2 41  ? -18.889 18.672  39.734  1.00 34.13 ? 88  SER C OG    1 
ATOM   5159 N  N     . PHE C 2 42  ? -22.259 18.799  42.506  1.00 32.36 ? 89  PHE C N     1 
ATOM   5160 C  CA    . PHE C 2 42  ? -22.766 18.756  43.852  1.00 32.63 ? 89  PHE C CA    1 
ATOM   5161 C  C     . PHE C 2 42  ? -23.704 17.560  44.040  1.00 32.64 ? 89  PHE C C     1 
ATOM   5162 O  O     . PHE C 2 42  ? -23.568 16.799  45.002  1.00 32.29 ? 89  PHE C O     1 
ATOM   5163 C  CB    . PHE C 2 42  ? -23.473 20.045  44.207  1.00 32.91 ? 89  PHE C CB    1 
ATOM   5164 C  CG    . PHE C 2 42  ? -24.082 20.017  45.561  1.00 33.56 ? 89  PHE C CG    1 
ATOM   5165 C  CD1   . PHE C 2 42  ? -23.288 20.149  46.686  1.00 34.41 ? 89  PHE C CD1   1 
ATOM   5166 C  CD2   . PHE C 2 42  ? -25.437 19.798  45.722  1.00 33.40 ? 89  PHE C CD2   1 
ATOM   5167 C  CE1   . PHE C 2 42  ? -23.845 20.111  47.951  1.00 33.88 ? 89  PHE C CE1   1 
ATOM   5168 C  CE2   . PHE C 2 42  ? -25.994 19.747  46.978  1.00 33.68 ? 89  PHE C CE2   1 
ATOM   5169 C  CZ    . PHE C 2 42  ? -25.196 19.901  48.097  1.00 33.86 ? 89  PHE C CZ    1 
ATOM   5170 N  N     . LEU C 2 43  ? -24.620 17.373  43.097  1.00 32.36 ? 90  LEU C N     1 
ATOM   5171 C  CA    . LEU C 2 43  ? -25.533 16.252  43.165  1.00 32.42 ? 90  LEU C CA    1 
ATOM   5172 C  C     . LEU C 2 43  ? -24.769 14.935  43.212  1.00 32.19 ? 90  LEU C C     1 
ATOM   5173 O  O     . LEU C 2 43  ? -25.164 14.013  43.925  1.00 31.56 ? 90  LEU C O     1 
ATOM   5174 C  CB    . LEU C 2 43  ? -26.514 16.279  41.973  1.00 32.51 ? 90  LEU C CB    1 
ATOM   5175 C  CG    . LEU C 2 43  ? -27.509 17.442  41.888  1.00 31.15 ? 90  LEU C CG    1 
ATOM   5176 C  CD1   . LEU C 2 43  ? -28.476 17.232  40.736  1.00 29.43 ? 90  LEU C CD1   1 
ATOM   5177 C  CD2   . LEU C 2 43  ? -28.245 17.584  43.182  1.00 27.69 ? 90  LEU C CD2   1 
ATOM   5178 N  N     . LYS C 2 44  ? -23.681 14.844  42.454  1.00 32.47 ? 91  LYS C N     1 
ATOM   5179 C  CA    . LYS C 2 44  ? -22.875 13.621  42.459  1.00 33.02 ? 91  LYS C CA    1 
ATOM   5180 C  C     . LYS C 2 44  ? -22.381 13.349  43.863  1.00 32.42 ? 91  LYS C C     1 
ATOM   5181 O  O     . LYS C 2 44  ? -22.497 12.230  44.351  1.00 32.41 ? 91  LYS C O     1 
ATOM   5182 C  CB    . LYS C 2 44  ? -21.692 13.671  41.475  1.00 33.19 ? 91  LYS C CB    1 
ATOM   5183 C  CG    . LYS C 2 44  ? -21.934 12.777  40.244  1.00 34.43 ? 91  LYS C CG    1 
ATOM   5184 C  CD    . LYS C 2 44  ? -20.673 12.709  39.346  1.00 35.12 ? 91  LYS C CD    1 
ATOM   5185 C  CE    . LYS C 2 44  ? -20.848 11.660  38.196  1.00 36.69 ? 91  LYS C CE    1 
ATOM   5186 N  NZ    . LYS C 2 44  ? -21.040 12.258  36.822  1.00 37.14 ? 91  LYS C NZ    1 
ATOM   5187 N  N     . SER C 2 45  ? -21.885 14.379  44.539  1.00 32.17 ? 92  SER C N     1 
ATOM   5188 C  CA    . SER C 2 45  ? -21.332 14.171  45.886  1.00 32.20 ? 92  SER C CA    1 
ATOM   5189 C  C     . SER C 2 45  ? -22.437 13.819  46.904  1.00 31.99 ? 92  SER C C     1 
ATOM   5190 O  O     . SER C 2 45  ? -22.148 13.227  47.946  1.00 32.26 ? 92  SER C O     1 
ATOM   5191 C  CB    . SER C 2 45  ? -20.447 15.338  46.352  1.00 31.78 ? 92  SER C CB    1 
ATOM   5192 O  OG    . SER C 2 45  ? -21.184 16.525  46.538  1.00 32.44 ? 92  SER C OG    1 
ATOM   5193 N  N     . GLU C 2 46  ? -23.687 14.128  46.575  1.00 31.63 ? 93  GLU C N     1 
ATOM   5194 C  CA    . GLU C 2 46  ? -24.824 13.689  47.372  1.00 32.12 ? 93  GLU C CA    1 
ATOM   5195 C  C     . GLU C 2 46  ? -25.559 12.467  46.782  1.00 31.94 ? 93  GLU C C     1 
ATOM   5196 O  O     . GLU C 2 46  ? -26.589 12.054  47.297  1.00 31.37 ? 93  GLU C O     1 
ATOM   5197 C  CB    . GLU C 2 46  ? -25.789 14.850  47.589  1.00 32.35 ? 93  GLU C CB    1 
ATOM   5198 C  CG    . GLU C 2 46  ? -25.378 15.814  48.688  1.00 31.84 ? 93  GLU C CG    1 
ATOM   5199 C  CD    . GLU C 2 46  ? -26.515 16.763  49.088  1.00 32.90 ? 93  GLU C CD    1 
ATOM   5200 O  OE1   . GLU C 2 46  ? -27.420 17.036  48.267  1.00 31.28 ? 93  GLU C OE1   1 
ATOM   5201 O  OE2   . GLU C 2 46  ? -26.497 17.242  50.241  1.00 36.85 ? 93  GLU C OE2   1 
ATOM   5202 N  N     . PHE C 2 47  ? -25.000 11.875  45.725  1.00 32.01 ? 94  PHE C N     1 
ATOM   5203 C  CA    . PHE C 2 47  ? -25.584 10.680  45.100  1.00 31.77 ? 94  PHE C CA    1 
ATOM   5204 C  C     . PHE C 2 47  ? -27.048 10.903  44.674  1.00 31.71 ? 94  PHE C C     1 
ATOM   5205 O  O     . PHE C 2 47  ? -27.928 10.105  44.969  1.00 31.48 ? 94  PHE C O     1 
ATOM   5206 C  CB    . PHE C 2 47  ? -25.434 9.487   46.040  1.00 31.63 ? 94  PHE C CB    1 
ATOM   5207 C  CG    . PHE C 2 47  ? -23.997 9.191   46.420  1.00 31.90 ? 94  PHE C CG    1 
ATOM   5208 C  CD1   . PHE C 2 47  ? -23.495 9.562   47.678  1.00 31.95 ? 94  PHE C CD1   1 
ATOM   5209 C  CD2   . PHE C 2 47  ? -23.143 8.547   45.517  1.00 31.30 ? 94  PHE C CD2   1 
ATOM   5210 C  CE1   . PHE C 2 47  ? -22.172 9.281   48.040  1.00 30.91 ? 94  PHE C CE1   1 
ATOM   5211 C  CE2   . PHE C 2 47  ? -21.821 8.260   45.858  1.00 31.77 ? 94  PHE C CE2   1 
ATOM   5212 C  CZ    . PHE C 2 47  ? -21.328 8.631   47.125  1.00 31.60 ? 94  PHE C CZ    1 
ATOM   5213 N  N     . SER C 2 48  ? -27.294 12.009  43.984  1.00 31.80 ? 95  SER C N     1 
ATOM   5214 C  CA    . SER C 2 48  ? -28.630 12.313  43.495  1.00 32.43 ? 95  SER C CA    1 
ATOM   5215 C  C     . SER C 2 48  ? -28.594 12.884  42.081  1.00 32.99 ? 95  SER C C     1 
ATOM   5216 O  O     . SER C 2 48  ? -29.533 13.566  41.644  1.00 32.93 ? 95  SER C O     1 
ATOM   5217 C  CB    . SER C 2 48  ? -29.367 13.271  44.466  1.00 32.55 ? 95  SER C CB    1 
ATOM   5218 O  OG    . SER C 2 48  ? -28.762 14.555  44.569  1.00 32.02 ? 95  SER C OG    1 
ATOM   5219 N  N     . GLU C 2 49  ? -27.536 12.550  41.348  1.00 33.22 ? 96  GLU C N     1 
ATOM   5220 C  CA    . GLU C 2 49  ? -27.291 13.156  40.065  1.00 33.73 ? 96  GLU C CA    1 
ATOM   5221 C  C     . GLU C 2 49  ? -28.279 12.672  39.007  1.00 33.61 ? 96  GLU C C     1 
ATOM   5222 O  O     . GLU C 2 49  ? -28.413 13.289  37.929  1.00 33.50 ? 96  GLU C O     1 
ATOM   5223 C  CB    . GLU C 2 49  ? -25.839 12.913  39.623  1.00 34.44 ? 96  GLU C CB    1 
ATOM   5224 C  CG    . GLU C 2 49  ? -25.497 11.456  39.206  1.00 36.32 ? 96  GLU C CG    1 
ATOM   5225 C  CD    . GLU C 2 49  ? -25.138 10.528  40.370  1.00 37.84 ? 96  GLU C CD    1 
ATOM   5226 O  OE1   . GLU C 2 49  ? -25.407 10.863  41.536  1.00 37.09 ? 96  GLU C OE1   1 
ATOM   5227 O  OE2   . GLU C 2 49  ? -24.579 9.446   40.100  1.00 40.31 ? 96  GLU C OE2   1 
ATOM   5228 N  N     . GLU C 2 50  ? -28.975 11.584  39.304  1.00 33.20 ? 97  GLU C N     1 
ATOM   5229 C  CA    . GLU C 2 50  ? -29.967 11.068  38.385  1.00 33.45 ? 97  GLU C CA    1 
ATOM   5230 C  C     . GLU C 2 50  ? -31.066 12.078  38.133  1.00 33.73 ? 97  GLU C C     1 
ATOM   5231 O  O     . GLU C 2 50  ? -31.672 12.065  37.072  1.00 34.35 ? 97  GLU C O     1 
ATOM   5232 C  CB    . GLU C 2 50  ? -30.577 9.755   38.888  1.00 33.48 ? 97  GLU C CB    1 
ATOM   5233 C  CG    . GLU C 2 50  ? -31.676 9.891   39.964  1.00 33.71 ? 97  GLU C CG    1 
ATOM   5234 C  CD    . GLU C 2 50  ? -31.148 9.893   41.386  1.00 33.93 ? 97  GLU C CD    1 
ATOM   5235 O  OE1   . GLU C 2 50  ? -29.910 9.771   41.595  1.00 34.35 ? 97  GLU C OE1   1 
ATOM   5236 O  OE2   . GLU C 2 50  ? -31.982 10.002  42.297  1.00 32.17 ? 97  GLU C OE2   1 
ATOM   5237 N  N     . ASN C 2 51  ? -31.318 12.955  39.095  1.00 33.63 ? 98  ASN C N     1 
ATOM   5238 C  CA    . ASN C 2 51  ? -32.365 13.938  38.952  1.00 33.72 ? 98  ASN C CA    1 
ATOM   5239 C  C     . ASN C 2 51  ? -32.049 14.953  37.858  1.00 34.50 ? 98  ASN C C     1 
ATOM   5240 O  O     . ASN C 2 51  ? -32.891 15.210  36.983  1.00 35.28 ? 98  ASN C O     1 
ATOM   5241 C  CB    . ASN C 2 51  ? -32.625 14.628  40.290  1.00 33.77 ? 98  ASN C CB    1 
ATOM   5242 C  CG    . ASN C 2 51  ? -33.398 13.758  41.254  1.00 33.59 ? 98  ASN C CG    1 
ATOM   5243 O  OD1   . ASN C 2 51  ? -34.250 12.968  40.835  1.00 34.43 ? 98  ASN C OD1   1 
ATOM   5244 N  ND2   . ASN C 2 51  ? -33.121 13.903  42.557  1.00 33.68 ? 98  ASN C ND2   1 
ATOM   5245 N  N     . ILE C 2 52  ? -30.842 15.519  37.877  1.00 34.71 ? 99  ILE C N     1 
ATOM   5246 C  CA    . ILE C 2 52  ? -30.433 16.464  36.841  1.00 34.75 ? 99  ILE C CA    1 
ATOM   5247 C  C     . ILE C 2 52  ? -30.219 15.756  35.490  1.00 35.33 ? 99  ILE C C     1 
ATOM   5248 O  O     . ILE C 2 52  ? -30.483 16.341  34.410  1.00 35.70 ? 99  ILE C O     1 
ATOM   5249 C  CB    . ILE C 2 52  ? -29.156 17.261  37.245  1.00 34.85 ? 99  ILE C CB    1 
ATOM   5250 C  CG1   . ILE C 2 52  ? -28.999 18.505  36.379  1.00 35.05 ? 99  ILE C CG1   1 
ATOM   5251 C  CG2   . ILE C 2 52  ? -27.867 16.408  37.135  1.00 34.79 ? 99  ILE C CG2   1 
ATOM   5252 C  CD1   . ILE C 2 52  ? -27.824 19.382  36.784  1.00 34.90 ? 99  ILE C CD1   1 
ATOM   5253 N  N     . GLU C 2 53  ? -29.745 14.507  35.525  1.00 35.54 ? 100 GLU C N     1 
ATOM   5254 C  CA    . GLU C 2 53  ? -29.535 13.771  34.275  1.00 35.54 ? 100 GLU C CA    1 
ATOM   5255 C  C     . GLU C 2 53  ? -30.886 13.531  33.633  1.00 35.07 ? 100 GLU C C     1 
ATOM   5256 O  O     . GLU C 2 53  ? -31.021 13.639  32.430  1.00 35.13 ? 100 GLU C O     1 
ATOM   5257 C  CB    . GLU C 2 53  ? -28.809 12.457  34.500  1.00 35.43 ? 100 GLU C CB    1 
ATOM   5258 C  CG    . GLU C 2 53  ? -27.345 12.631  34.847  1.00 37.03 ? 100 GLU C CG    1 
ATOM   5259 C  CD    . GLU C 2 53  ? -26.686 11.317  35.274  1.00 39.08 ? 100 GLU C CD    1 
ATOM   5260 O  OE1   . GLU C 2 53  ? -26.836 10.900  36.442  1.00 39.86 ? 100 GLU C OE1   1 
ATOM   5261 O  OE2   . GLU C 2 53  ? -26.012 10.698  34.427  1.00 41.83 ? 100 GLU C OE2   1 
ATOM   5262 N  N     . PHE C 2 54  ? -31.889 13.244  34.456  1.00 34.75 ? 101 PHE C N     1 
ATOM   5263 C  CA    . PHE C 2 54  ? -33.235 13.073  33.965  1.00 34.73 ? 101 PHE C CA    1 
ATOM   5264 C  C     . PHE C 2 54  ? -33.793 14.370  33.390  1.00 34.87 ? 101 PHE C C     1 
ATOM   5265 O  O     . PHE C 2 54  ? -34.348 14.378  32.296  1.00 34.62 ? 101 PHE C O     1 
ATOM   5266 C  CB    . PHE C 2 54  ? -34.162 12.598  35.065  1.00 34.37 ? 101 PHE C CB    1 
ATOM   5267 C  CG    . PHE C 2 54  ? -35.581 12.476  34.621  1.00 34.59 ? 101 PHE C CG    1 
ATOM   5268 C  CD1   . PHE C 2 54  ? -35.922 11.599  33.599  1.00 34.26 ? 101 PHE C CD1   1 
ATOM   5269 C  CD2   . PHE C 2 54  ? -36.577 13.250  35.199  1.00 34.95 ? 101 PHE C CD2   1 
ATOM   5270 C  CE1   . PHE C 2 54  ? -37.229 11.488  33.176  1.00 34.28 ? 101 PHE C CE1   1 
ATOM   5271 C  CE2   . PHE C 2 54  ? -37.894 13.129  34.781  1.00 34.17 ? 101 PHE C CE2   1 
ATOM   5272 C  CZ    . PHE C 2 54  ? -38.217 12.251  33.769  1.00 33.91 ? 101 PHE C CZ    1 
ATOM   5273 N  N     . TRP C 2 55  ? -33.655 15.456  34.145  1.00 34.91 ? 102 TRP C N     1 
ATOM   5274 C  CA    . TRP C 2 55  ? -34.078 16.772  33.674  1.00 34.93 ? 102 TRP C CA    1 
ATOM   5275 C  C     . TRP C 2 55  ? -33.475 17.079  32.310  1.00 34.67 ? 102 TRP C C     1 
ATOM   5276 O  O     . TRP C 2 55  ? -34.179 17.523  31.407  1.00 34.70 ? 102 TRP C O     1 
ATOM   5277 C  CB    . TRP C 2 55  ? -33.658 17.856  34.670  1.00 35.03 ? 102 TRP C CB    1 
ATOM   5278 C  CG    . TRP C 2 55  ? -34.256 19.201  34.417  1.00 34.71 ? 102 TRP C CG    1 
ATOM   5279 C  CD1   . TRP C 2 55  ? -35.481 19.635  34.811  1.00 34.68 ? 102 TRP C CD1   1 
ATOM   5280 C  CD2   . TRP C 2 55  ? -33.639 20.306  33.738  1.00 34.99 ? 102 TRP C CD2   1 
ATOM   5281 N  NE1   . TRP C 2 55  ? -35.677 20.937  34.405  1.00 34.78 ? 102 TRP C NE1   1 
ATOM   5282 C  CE2   . TRP C 2 55  ? -34.558 21.372  33.753  1.00 34.25 ? 102 TRP C CE2   1 
ATOM   5283 C  CE3   . TRP C 2 55  ? -32.400 20.491  33.115  1.00 35.12 ? 102 TRP C CE3   1 
ATOM   5284 C  CZ2   . TRP C 2 55  ? -34.284 22.601  33.171  1.00 35.44 ? 102 TRP C CZ2   1 
ATOM   5285 C  CZ3   . TRP C 2 55  ? -32.125 21.707  32.540  1.00 35.10 ? 102 TRP C CZ3   1 
ATOM   5286 C  CH2   . TRP C 2 55  ? -33.065 22.753  32.566  1.00 35.46 ? 102 TRP C CH2   1 
ATOM   5287 N  N     . LEU C 2 56  ? -32.178 16.820  32.162  1.00 34.57 ? 103 LEU C N     1 
ATOM   5288 C  CA    . LEU C 2 56  ? -31.476 17.100  30.904  1.00 34.36 ? 103 LEU C CA    1 
ATOM   5289 C  C     . LEU C 2 56  ? -31.953 16.183  29.791  1.00 34.27 ? 103 LEU C C     1 
ATOM   5290 O  O     . LEU C 2 56  ? -32.048 16.602  28.632  1.00 34.61 ? 103 LEU C O     1 
ATOM   5291 C  CB    . LEU C 2 56  ? -29.954 16.984  31.067  1.00 34.28 ? 103 LEU C CB    1 
ATOM   5292 C  CG    . LEU C 2 56  ? -29.272 18.042  31.952  1.00 33.89 ? 103 LEU C CG    1 
ATOM   5293 C  CD1   . LEU C 2 56  ? -27.809 17.668  32.299  1.00 31.47 ? 103 LEU C CD1   1 
ATOM   5294 C  CD2   . LEU C 2 56  ? -29.358 19.404  31.278  1.00 32.82 ? 103 LEU C CD2   1 
ATOM   5295 N  N     . ALA C 2 57  ? -32.267 14.943  30.137  1.00 34.03 ? 104 ALA C N     1 
ATOM   5296 C  CA    . ALA C 2 57  ? -32.808 13.998  29.167  1.00 34.06 ? 104 ALA C CA    1 
ATOM   5297 C  C     . ALA C 2 57  ? -34.169 14.454  28.637  1.00 33.94 ? 104 ALA C C     1 
ATOM   5298 O  O     . ALA C 2 57  ? -34.451 14.299  27.448  1.00 34.07 ? 104 ALA C O     1 
ATOM   5299 C  CB    . ALA C 2 57  ? -32.917 12.619  29.785  1.00 33.96 ? 104 ALA C CB    1 
ATOM   5300 N  N     . CYS C 2 58  ? -35.001 15.015  29.511  1.00 33.67 ? 105 CYS C N     1 
ATOM   5301 C  CA    . CYS C 2 58  ? -36.298 15.549  29.097  1.00 33.95 ? 105 CYS C CA    1 
ATOM   5302 C  C     . CYS C 2 58  ? -36.126 16.762  28.168  1.00 33.97 ? 105 CYS C C     1 
ATOM   5303 O  O     . CYS C 2 58  ? -36.789 16.880  27.126  1.00 33.90 ? 105 CYS C O     1 
ATOM   5304 C  CB    . CYS C 2 58  ? -37.136 15.925  30.314  1.00 33.85 ? 105 CYS C CB    1 
ATOM   5305 S  SG    . CYS C 2 58  ? -37.508 14.500  31.390  1.00 34.87 ? 105 CYS C SG    1 
ATOM   5306 N  N     . GLU C 2 59  ? -35.215 17.653  28.535  1.00 33.73 ? 106 GLU C N     1 
ATOM   5307 C  CA    . GLU C 2 59  ? -34.940 18.820  27.710  1.00 33.57 ? 106 GLU C CA    1 
ATOM   5308 C  C     . GLU C 2 59  ? -34.577 18.424  26.277  1.00 33.37 ? 106 GLU C C     1 
ATOM   5309 O  O     . GLU C 2 59  ? -35.129 18.952  25.321  1.00 33.55 ? 106 GLU C O     1 
ATOM   5310 C  CB    . GLU C 2 59  ? -33.811 19.647  28.335  1.00 33.53 ? 106 GLU C CB    1 
ATOM   5311 C  CG    . GLU C 2 59  ? -34.213 20.353  29.608  1.00 33.30 ? 106 GLU C CG    1 
ATOM   5312 C  CD    . GLU C 2 59  ? -35.239 21.420  29.352  1.00 33.20 ? 106 GLU C CD    1 
ATOM   5313 O  OE1   . GLU C 2 59  ? -36.390 21.250  29.794  1.00 33.24 ? 106 GLU C OE1   1 
ATOM   5314 O  OE2   . GLU C 2 59  ? -34.896 22.413  28.684  1.00 32.60 ? 106 GLU C OE2   1 
ATOM   5315 N  N     . ASP C 2 60  ? -33.646 17.494  26.147  1.00 33.31 ? 107 ASP C N     1 
ATOM   5316 C  CA    . ASP C 2 60  ? -33.208 16.999  24.859  1.00 33.44 ? 107 ASP C CA    1 
ATOM   5317 C  C     . ASP C 2 60  ? -34.379 16.327  24.139  1.00 33.35 ? 107 ASP C C     1 
ATOM   5318 O  O     . ASP C 2 60  ? -34.607 16.546  22.952  1.00 32.90 ? 107 ASP C O     1 
ATOM   5319 C  CB    . ASP C 2 60  ? -32.035 16.028  25.082  1.00 33.69 ? 107 ASP C CB    1 
ATOM   5320 C  CG    . ASP C 2 60  ? -31.729 15.174  23.873  1.00 34.59 ? 107 ASP C CG    1 
ATOM   5321 O  OD1   . ASP C 2 60  ? -31.159 15.690  22.890  1.00 35.72 ? 107 ASP C OD1   1 
ATOM   5322 O  OD2   . ASP C 2 60  ? -32.042 13.968  23.920  1.00 36.60 ? 107 ASP C OD2   1 
ATOM   5323 N  N     . TYR C 2 61  ? -35.148 15.539  24.876  1.00 33.36 ? 108 TYR C N     1 
ATOM   5324 C  CA    . TYR C 2 61  ? -36.306 14.874  24.307  1.00 33.28 ? 108 TYR C CA    1 
ATOM   5325 C  C     . TYR C 2 61  ? -37.292 15.868  23.698  1.00 33.48 ? 108 TYR C C     1 
ATOM   5326 O  O     . TYR C 2 61  ? -37.876 15.592  22.652  1.00 33.53 ? 108 TYR C O     1 
ATOM   5327 C  CB    . TYR C 2 61  ? -36.979 14.000  25.368  1.00 33.42 ? 108 TYR C CB    1 
ATOM   5328 C  CG    . TYR C 2 61  ? -38.256 13.355  24.905  1.00 32.92 ? 108 TYR C CG    1 
ATOM   5329 C  CD1   . TYR C 2 61  ? -38.237 12.130  24.248  1.00 32.71 ? 108 TYR C CD1   1 
ATOM   5330 C  CD2   . TYR C 2 61  ? -39.481 13.982  25.110  1.00 32.21 ? 108 TYR C CD2   1 
ATOM   5331 C  CE1   . TYR C 2 61  ? -39.409 11.541  23.803  1.00 33.59 ? 108 TYR C CE1   1 
ATOM   5332 C  CE2   . TYR C 2 61  ? -40.655 13.407  24.685  1.00 33.01 ? 108 TYR C CE2   1 
ATOM   5333 C  CZ    . TYR C 2 61  ? -40.620 12.186  24.031  1.00 33.66 ? 108 TYR C CZ    1 
ATOM   5334 O  OH    . TYR C 2 61  ? -41.795 11.622  23.598  1.00 33.34 ? 108 TYR C OH    1 
ATOM   5335 N  N     . LYS C 2 62  ? -37.466 17.021  24.334  1.00 33.82 ? 109 LYS C N     1 
ATOM   5336 C  CA    . LYS C 2 62  ? -38.384 18.054  23.824  1.00 34.30 ? 109 LYS C CA    1 
ATOM   5337 C  C     . LYS C 2 62  ? -37.928 18.641  22.482  1.00 34.21 ? 109 LYS C C     1 
ATOM   5338 O  O     . LYS C 2 62  ? -38.750 18.885  21.590  1.00 34.20 ? 109 LYS C O     1 
ATOM   5339 C  CB    . LYS C 2 62  ? -38.574 19.176  24.859  1.00 34.35 ? 109 LYS C CB    1 
ATOM   5340 C  CG    . LYS C 2 62  ? -39.589 18.856  25.951  1.00 35.04 ? 109 LYS C CG    1 
ATOM   5341 C  CD    . LYS C 2 62  ? -39.724 20.001  26.965  1.00 35.44 ? 109 LYS C CD    1 
ATOM   5342 C  CE    . LYS C 2 62  ? -39.195 19.595  28.345  1.00 36.66 ? 109 LYS C CE    1 
ATOM   5343 N  NZ    . LYS C 2 62  ? -39.392 20.664  29.372  1.00 36.90 ? 109 LYS C NZ    1 
ATOM   5344 N  N     . LYS C 2 63  ? -36.623 18.870  22.345  1.00 34.27 ? 110 LYS C N     1 
ATOM   5345 C  CA    . LYS C 2 63  ? -36.049 19.361  21.077  1.00 34.29 ? 110 LYS C CA    1 
ATOM   5346 C  C     . LYS C 2 63  ? -35.959 18.261  20.010  1.00 34.10 ? 110 LYS C C     1 
ATOM   5347 O  O     . LYS C 2 63  ? -35.763 18.562  18.845  1.00 34.23 ? 110 LYS C O     1 
ATOM   5348 C  CB    . LYS C 2 63  ? -34.656 19.975  21.302  1.00 34.16 ? 110 LYS C CB    1 
ATOM   5349 C  CG    . LYS C 2 63  ? -34.629 21.189  22.234  1.00 34.02 ? 110 LYS C CG    1 
ATOM   5350 N  N     . THR C 2 64  ? -36.104 16.998  20.410  1.00 34.21 ? 111 THR C N     1 
ATOM   5351 C  CA    . THR C 2 64  ? -35.992 15.862  19.481  1.00 34.28 ? 111 THR C CA    1 
ATOM   5352 C  C     . THR C 2 64  ? -37.165 15.792  18.494  1.00 34.20 ? 111 THR C C     1 
ATOM   5353 O  O     . THR C 2 64  ? -38.274 16.254  18.783  1.00 34.02 ? 111 THR C O     1 
ATOM   5354 C  CB    . THR C 2 64  ? -35.834 14.513  20.229  1.00 34.37 ? 111 THR C CB    1 
ATOM   5355 O  OG1   . THR C 2 64  ? -34.606 14.527  20.963  1.00 34.78 ? 111 THR C OG1   1 
ATOM   5356 C  CG2   . THR C 2 64  ? -35.806 13.331  19.253  1.00 34.36 ? 111 THR C CG2   1 
ATOM   5357 N  N     . GLU C 2 65  ? -36.898 15.187  17.338  1.00 34.23 ? 112 GLU C N     1 
ATOM   5358 C  CA    . GLU C 2 65  ? -37.777 15.283  16.178  1.00 34.41 ? 112 GLU C CA    1 
ATOM   5359 C  C     . GLU C 2 65  ? -38.950 14.310  16.241  1.00 34.46 ? 112 GLU C C     1 
ATOM   5360 O  O     . GLU C 2 65  ? -38.779 13.135  16.579  1.00 34.46 ? 112 GLU C O     1 
ATOM   5361 C  CB    . GLU C 2 65  ? -36.981 15.012  14.895  1.00 34.21 ? 112 GLU C CB    1 
ATOM   5362 N  N     . SER C 2 66  ? -40.136 14.814  15.890  1.00 34.59 ? 113 SER C N     1 
ATOM   5363 C  CA    . SER C 2 66  ? -41.355 14.006  15.793  1.00 34.56 ? 113 SER C CA    1 
ATOM   5364 C  C     . SER C 2 66  ? -41.070 12.526  15.514  1.00 34.56 ? 113 SER C C     1 
ATOM   5365 O  O     . SER C 2 66  ? -41.594 11.647  16.197  1.00 34.29 ? 113 SER C O     1 
ATOM   5366 C  CB    . SER C 2 66  ? -42.249 14.579  14.686  1.00 34.55 ? 113 SER C CB    1 
ATOM   5367 O  OG    . SER C 2 66  ? -43.139 13.606  14.163  1.00 34.38 ? 113 SER C OG    1 
ATOM   5368 N  N     . ASP C 2 67  ? -40.223 12.276  14.515  1.00 34.74 ? 114 ASP C N     1 
ATOM   5369 C  CA    . ASP C 2 67  ? -39.981 10.921  14.000  1.00 34.78 ? 114 ASP C CA    1 
ATOM   5370 C  C     . ASP C 2 67  ? -39.397 9.965   15.050  1.00 34.49 ? 114 ASP C C     1 
ATOM   5371 O  O     . ASP C 2 67  ? -39.873 8.838   15.186  1.00 34.24 ? 114 ASP C O     1 
ATOM   5372 C  CB    . ASP C 2 67  ? -39.053 10.951  12.766  1.00 34.74 ? 114 ASP C CB    1 
ATOM   5373 C  CG    . ASP C 2 67  ? -39.528 11.930  11.684  1.00 35.50 ? 114 ASP C CG    1 
ATOM   5374 O  OD1   . ASP C 2 67  ? -39.626 11.525  10.492  1.00 37.22 ? 114 ASP C OD1   1 
ATOM   5375 O  OD2   . ASP C 2 67  ? -39.783 13.115  12.013  1.00 35.79 ? 114 ASP C OD2   1 
ATOM   5376 N  N     . LEU C 2 68  ? -38.380 10.425  15.783  1.00 34.41 ? 115 LEU C N     1 
ATOM   5377 C  CA    . LEU C 2 68  ? -37.586 9.563   16.686  1.00 34.30 ? 115 LEU C CA    1 
ATOM   5378 C  C     . LEU C 2 68  ? -38.073 9.551   18.131  1.00 34.37 ? 115 LEU C C     1 
ATOM   5379 O  O     . LEU C 2 68  ? -37.405 8.995   19.001  1.00 34.36 ? 115 LEU C O     1 
ATOM   5380 C  CB    . LEU C 2 68  ? -36.110 10.007  16.694  1.00 34.22 ? 115 LEU C CB    1 
ATOM   5381 C  CG    . LEU C 2 68  ? -35.288 9.865   15.382  1.00 33.64 ? 115 LEU C CG    1 
ATOM   5382 C  CD1   . LEU C 2 68  ? -33.902 10.456  15.606  1.00 32.96 ? 115 LEU C CD1   1 
ATOM   5383 C  CD2   . LEU C 2 68  ? -35.159 8.384   14.897  1.00 32.92 ? 115 LEU C CD2   1 
ATOM   5384 N  N     . LEU C 2 69  ? -39.224 10.160  18.391  1.00 34.44 ? 116 LEU C N     1 
ATOM   5385 C  CA    . LEU C 2 69  ? -39.727 10.273  19.749  1.00 34.73 ? 116 LEU C CA    1 
ATOM   5386 C  C     . LEU C 2 69  ? -40.037 8.924   20.412  1.00 34.86 ? 116 LEU C C     1 
ATOM   5387 O  O     . LEU C 2 69  ? -39.705 8.742   21.585  1.00 34.97 ? 116 LEU C O     1 
ATOM   5388 C  CB    . LEU C 2 69  ? -40.949 11.210  19.815  1.00 34.62 ? 116 LEU C CB    1 
ATOM   5389 C  CG    . LEU C 2 69  ? -40.671 12.702  19.558  1.00 34.87 ? 116 LEU C CG    1 
ATOM   5390 C  CD1   . LEU C 2 69  ? -41.945 13.549  19.731  1.00 34.37 ? 116 LEU C CD1   1 
ATOM   5391 C  CD2   . LEU C 2 69  ? -39.535 13.237  20.447  1.00 34.80 ? 116 LEU C CD2   1 
ATOM   5392 N  N     . PRO C 2 70  ? -40.670 7.986   19.680  1.00 34.88 ? 117 PRO C N     1 
ATOM   5393 C  CA    . PRO C 2 70  ? -40.986 6.679   20.263  1.00 35.09 ? 117 PRO C CA    1 
ATOM   5394 C  C     . PRO C 2 70  ? -39.795 5.962   20.917  1.00 35.50 ? 117 PRO C C     1 
ATOM   5395 O  O     . PRO C 2 70  ? -39.950 5.372   22.001  1.00 34.87 ? 117 PRO C O     1 
ATOM   5396 C  CB    . PRO C 2 70  ? -41.509 5.882   19.068  1.00 35.08 ? 117 PRO C CB    1 
ATOM   5397 C  CG    . PRO C 2 70  ? -42.090 6.922   18.154  1.00 35.12 ? 117 PRO C CG    1 
ATOM   5398 C  CD    . PRO C 2 70  ? -41.168 8.099   18.294  1.00 35.02 ? 117 PRO C CD    1 
ATOM   5399 N  N     . CYS C 2 71  ? -38.627 6.027   20.270  1.00 35.83 ? 118 CYS C N     1 
ATOM   5400 C  CA    . CYS C 2 71  ? -37.415 5.384   20.802  1.00 36.33 ? 118 CYS C CA    1 
ATOM   5401 C  C     . CYS C 2 71  ? -36.777 6.173   21.909  1.00 36.00 ? 118 CYS C C     1 
ATOM   5402 O  O     . CYS C 2 71  ? -36.323 5.594   22.885  1.00 35.66 ? 118 CYS C O     1 
ATOM   5403 C  CB    . CYS C 2 71  ? -36.376 5.157   19.717  1.00 36.32 ? 118 CYS C CB    1 
ATOM   5404 S  SG    . CYS C 2 71  ? -36.789 3.749   18.753  1.00 39.33 ? 118 CYS C SG    1 
ATOM   5405 N  N     . LYS C 2 72  ? -36.704 7.490   21.726  1.00 36.17 ? 119 LYS C N     1 
ATOM   5406 C  CA    . LYS C 2 72  ? -36.190 8.373   22.766  1.00 36.37 ? 119 LYS C CA    1 
ATOM   5407 C  C     . LYS C 2 72  ? -37.036 8.218   24.033  1.00 36.29 ? 119 LYS C C     1 
ATOM   5408 O  O     . LYS C 2 72  ? -36.486 8.126   25.119  1.00 36.26 ? 119 LYS C O     1 
ATOM   5409 C  CB    . LYS C 2 72  ? -36.159 9.833   22.292  1.00 36.38 ? 119 LYS C CB    1 
ATOM   5410 C  CG    . LYS C 2 72  ? -35.146 10.707  23.048  1.00 36.31 ? 119 LYS C CG    1 
ATOM   5411 C  CD    . LYS C 2 72  ? -33.746 10.646  22.420  1.00 36.18 ? 119 LYS C CD    1 
ATOM   5412 C  CE    . LYS C 2 72  ? -33.552 11.679  21.311  1.00 34.81 ? 119 LYS C CE    1 
ATOM   5413 N  N     . ALA C 2 73  ? -38.361 8.155   23.876  1.00 36.48 ? 120 ALA C N     1 
ATOM   5414 C  CA    . ALA C 2 73  ? -39.283 7.981   25.008  1.00 36.78 ? 120 ALA C CA    1 
ATOM   5415 C  C     . ALA C 2 73  ? -39.081 6.646   25.733  1.00 37.19 ? 120 ALA C C     1 
ATOM   5416 O  O     . ALA C 2 73  ? -39.038 6.609   26.977  1.00 37.09 ? 120 ALA C O     1 
ATOM   5417 C  CB    . ALA C 2 73  ? -40.723 8.113   24.557  1.00 36.50 ? 120 ALA C CB    1 
ATOM   5418 N  N     . GLU C 2 74  ? -38.950 5.557   24.976  1.00 37.42 ? 121 GLU C N     1 
ATOM   5419 C  CA    . GLU C 2 74  ? -38.727 4.256   25.602  1.00 37.84 ? 121 GLU C CA    1 
ATOM   5420 C  C     . GLU C 2 74  ? -37.359 4.191   26.271  1.00 37.86 ? 121 GLU C C     1 
ATOM   5421 O  O     . GLU C 2 74  ? -37.236 3.630   27.353  1.00 38.66 ? 121 GLU C O     1 
ATOM   5422 C  CB    . GLU C 2 74  ? -38.902 3.073   24.648  1.00 37.97 ? 121 GLU C CB    1 
ATOM   5423 C  CG    . GLU C 2 74  ? -39.241 1.787   25.430  1.00 38.79 ? 121 GLU C CG    1 
ATOM   5424 C  CD    . GLU C 2 74  ? -39.009 0.507   24.646  1.00 40.31 ? 121 GLU C CD    1 
ATOM   5425 O  OE1   . GLU C 2 74  ? -39.191 0.511   23.414  1.00 40.35 ? 121 GLU C OE1   1 
ATOM   5426 O  OE2   . GLU C 2 74  ? -38.644 -0.516  25.272  1.00 41.80 ? 121 GLU C OE2   1 
ATOM   5427 N  N     . GLU C 2 75  ? -36.347 4.782   25.643  1.00 37.74 ? 122 GLU C N     1 
ATOM   5428 C  CA    . GLU C 2 75  ? -34.979 4.806   26.179  1.00 37.88 ? 122 GLU C CA    1 
ATOM   5429 C  C     . GLU C 2 75  ? -34.917 5.529   27.534  1.00 37.07 ? 122 GLU C C     1 
ATOM   5430 O  O     . GLU C 2 75  ? -34.265 5.054   28.472  1.00 36.94 ? 122 GLU C O     1 
ATOM   5431 C  CB    . GLU C 2 75  ? -34.051 5.474   25.150  1.00 38.12 ? 122 GLU C CB    1 
ATOM   5432 C  CG    . GLU C 2 75  ? -32.545 5.319   25.389  1.00 39.44 ? 122 GLU C CG    1 
ATOM   5433 C  CD    . GLU C 2 75  ? -31.708 6.270   24.497  1.00 39.92 ? 122 GLU C CD    1 
ATOM   5434 O  OE1   . GLU C 2 75  ? -31.168 7.268   25.058  1.00 42.08 ? 122 GLU C OE1   1 
ATOM   5435 O  OE2   . GLU C 2 75  ? -31.613 6.031   23.254  1.00 39.05 ? 122 GLU C OE2   1 
ATOM   5436 N  N     . ILE C 2 76  ? -35.618 6.659   27.626  1.00 36.28 ? 123 ILE C N     1 
ATOM   5437 C  CA    . ILE C 2 76  ? -35.652 7.477   28.838  1.00 35.71 ? 123 ILE C CA    1 
ATOM   5438 C  C     . ILE C 2 76  ? -36.481 6.799   29.927  1.00 35.40 ? 123 ILE C C     1 
ATOM   5439 O  O     . ILE C 2 76  ? -36.096 6.800   31.104  1.00 34.74 ? 123 ILE C O     1 
ATOM   5440 C  CB    . ILE C 2 76  ? -36.193 8.891   28.518  1.00 35.88 ? 123 ILE C CB    1 
ATOM   5441 C  CG1   . ILE C 2 76  ? -35.187 9.641   27.622  1.00 35.72 ? 123 ILE C CG1   1 
ATOM   5442 C  CG2   . ILE C 2 76  ? -36.458 9.665   29.792  1.00 35.31 ? 123 ILE C CG2   1 
ATOM   5443 C  CD1   . ILE C 2 76  ? -35.618 11.034  27.207  1.00 35.33 ? 123 ILE C CD1   1 
ATOM   5444 N  N     . TYR C 2 77  ? -37.606 6.205   29.528  1.00 35.11 ? 124 TYR C N     1 
ATOM   5445 C  CA    . TYR C 2 77  ? -38.439 5.459   30.464  1.00 34.96 ? 124 TYR C CA    1 
ATOM   5446 C  C     . TYR C 2 77  ? -37.651 4.325   31.129  1.00 34.83 ? 124 TYR C C     1 
ATOM   5447 O  O     . TYR C 2 77  ? -37.717 4.156   32.349  1.00 34.42 ? 124 TYR C O     1 
ATOM   5448 C  CB    . TYR C 2 77  ? -39.699 4.896   29.792  1.00 35.06 ? 124 TYR C CB    1 
ATOM   5449 C  CG    . TYR C 2 77  ? -40.644 4.293   30.808  1.00 35.03 ? 124 TYR C CG    1 
ATOM   5450 C  CD1   . TYR C 2 77  ? -40.671 2.932   31.039  1.00 35.27 ? 124 TYR C CD1   1 
ATOM   5451 C  CD2   . TYR C 2 77  ? -41.475 5.100   31.577  1.00 35.52 ? 124 TYR C CD2   1 
ATOM   5452 C  CE1   . TYR C 2 77  ? -41.520 2.383   31.999  1.00 35.56 ? 124 TYR C CE1   1 
ATOM   5453 C  CE2   . TYR C 2 77  ? -42.326 4.567   32.527  1.00 35.03 ? 124 TYR C CE2   1 
ATOM   5454 C  CZ    . TYR C 2 77  ? -42.349 3.209   32.733  1.00 35.45 ? 124 TYR C CZ    1 
ATOM   5455 O  OH    . TYR C 2 77  ? -43.184 2.673   33.688  1.00 35.92 ? 124 TYR C OH    1 
ATOM   5456 N  N     . LYS C 2 78  ? -36.899 3.566   30.328  1.00 34.55 ? 125 LYS C N     1 
ATOM   5457 C  CA    . LYS C 2 78  ? -36.127 2.455   30.863  1.00 34.33 ? 125 LYS C CA    1 
ATOM   5458 C  C     . LYS C 2 78  ? -34.951 2.928   31.728  1.00 33.92 ? 125 LYS C C     1 
ATOM   5459 O  O     . LYS C 2 78  ? -34.647 2.311   32.768  1.00 33.98 ? 125 LYS C O     1 
ATOM   5460 C  CB    . LYS C 2 78  ? -35.638 1.539   29.745  1.00 34.69 ? 125 LYS C CB    1 
ATOM   5461 C  CG    . LYS C 2 78  ? -36.747 0.803   28.991  1.00 35.01 ? 125 LYS C CG    1 
ATOM   5462 C  CD    . LYS C 2 78  ? -37.398 -0.301  29.822  1.00 34.81 ? 125 LYS C CD    1 
ATOM   5463 C  CE    . LYS C 2 78  ? -38.440 -1.113  29.015  1.00 34.92 ? 125 LYS C CE    1 
ATOM   5464 N  NZ    . LYS C 2 78  ? -37.950 -1.657  27.697  1.00 32.08 ? 125 LYS C NZ    1 
ATOM   5465 N  N     . ALA C 2 79  ? -34.317 4.024   31.322  1.00 33.35 ? 126 ALA C N     1 
ATOM   5466 C  CA    . ALA C 2 79  ? -33.102 4.495   31.988  1.00 33.20 ? 126 ALA C CA    1 
ATOM   5467 C  C     . ALA C 2 79  ? -33.423 5.161   33.302  1.00 32.90 ? 126 ALA C C     1 
ATOM   5468 O  O     . ALA C 2 79  ? -32.645 5.054   34.235  1.00 33.22 ? 126 ALA C O     1 
ATOM   5469 C  CB    . ALA C 2 79  ? -32.300 5.474   31.077  1.00 33.07 ? 126 ALA C CB    1 
ATOM   5470 N  N     . PHE C 2 80  ? -34.566 5.844   33.375  1.00 32.76 ? 127 PHE C N     1 
ATOM   5471 C  CA    . PHE C 2 80  ? -34.903 6.679   34.536  1.00 32.51 ? 127 PHE C CA    1 
ATOM   5472 C  C     . PHE C 2 80  ? -36.230 6.391   35.241  1.00 32.60 ? 127 PHE C C     1 
ATOM   5473 O  O     . PHE C 2 80  ? -36.320 6.570   36.456  1.00 33.31 ? 127 PHE C O     1 
ATOM   5474 C  CB    . PHE C 2 80  ? -34.950 8.147   34.131  1.00 32.38 ? 127 PHE C CB    1 
ATOM   5475 C  CG    . PHE C 2 80  ? -33.668 8.686   33.573  1.00 32.01 ? 127 PHE C CG    1 
ATOM   5476 C  CD1   . PHE C 2 80  ? -32.611 9.002   34.417  1.00 32.38 ? 127 PHE C CD1   1 
ATOM   5477 C  CD2   . PHE C 2 80  ? -33.536 8.928   32.213  1.00 30.63 ? 127 PHE C CD2   1 
ATOM   5478 C  CE1   . PHE C 2 80  ? -31.434 9.530   33.912  1.00 32.86 ? 127 PHE C CE1   1 
ATOM   5479 C  CE2   . PHE C 2 80  ? -32.363 9.449   31.694  1.00 30.65 ? 127 PHE C CE2   1 
ATOM   5480 C  CZ    . PHE C 2 80  ? -31.308 9.754   32.536  1.00 31.94 ? 127 PHE C CZ    1 
ATOM   5481 N  N     . VAL C 2 81  ? -37.276 6.005   34.519  1.00 32.56 ? 128 VAL C N     1 
ATOM   5482 C  CA    . VAL C 2 81  ? -38.624 6.021   35.127  1.00 32.57 ? 128 VAL C CA    1 
ATOM   5483 C  C     . VAL C 2 81  ? -39.111 4.663   35.636  1.00 32.87 ? 128 VAL C C     1 
ATOM   5484 O  O     . VAL C 2 81  ? -39.765 4.583   36.671  1.00 33.00 ? 128 VAL C O     1 
ATOM   5485 C  CB    . VAL C 2 81  ? -39.667 6.607   34.179  1.00 32.74 ? 128 VAL C CB    1 
ATOM   5486 C  CG1   . VAL C 2 81  ? -40.949 6.947   34.941  1.00 32.55 ? 128 VAL C CG1   1 
ATOM   5487 C  CG2   . VAL C 2 81  ? -39.122 7.877   33.506  1.00 32.72 ? 128 VAL C CG2   1 
ATOM   5488 N  N     . HIS C 2 82  ? -38.791 3.600   34.908  1.00 33.14 ? 129 HIS C N     1 
ATOM   5489 C  CA    . HIS C 2 82  ? -39.197 2.240   35.265  1.00 33.19 ? 129 HIS C CA    1 
ATOM   5490 C  C     . HIS C 2 82  ? -38.693 1.874   36.670  1.00 33.32 ? 129 HIS C C     1 
ATOM   5491 O  O     . HIS C 2 82  ? -37.597 2.293   37.056  1.00 32.81 ? 129 HIS C O     1 
ATOM   5492 C  CB    . HIS C 2 82  ? -38.628 1.277   34.215  1.00 33.44 ? 129 HIS C CB    1 
ATOM   5493 C  CG    . HIS C 2 82  ? -39.128 -0.130  34.322  1.00 34.03 ? 129 HIS C CG    1 
ATOM   5494 N  ND1   . HIS C 2 82  ? -38.821 -0.952  35.386  1.00 33.97 ? 129 HIS C ND1   1 
ATOM   5495 C  CD2   . HIS C 2 82  ? -39.869 -0.879  33.468  1.00 33.66 ? 129 HIS C CD2   1 
ATOM   5496 C  CE1   . HIS C 2 82  ? -39.379 -2.136  35.198  1.00 34.05 ? 129 HIS C CE1   1 
ATOM   5497 N  NE2   . HIS C 2 82  ? -40.013 -2.121  34.038  1.00 33.50 ? 129 HIS C NE2   1 
ATOM   5498 N  N     . SER C 2 83  ? -39.498 1.100   37.410  1.00 33.22 ? 130 SER C N     1 
ATOM   5499 C  CA    . SER C 2 83  ? -39.136 0.588   38.751  1.00 33.63 ? 130 SER C CA    1 
ATOM   5500 C  C     . SER C 2 83  ? -37.718 0.027   38.909  1.00 33.61 ? 130 SER C C     1 
ATOM   5501 O  O     . SER C 2 83  ? -37.131 0.135   39.970  1.00 33.33 ? 130 SER C O     1 
ATOM   5502 C  CB    . SER C 2 83  ? -40.134 -0.499  39.185  1.00 33.78 ? 130 SER C CB    1 
ATOM   5503 O  OG    . SER C 2 83  ? -41.345 0.107   39.584  1.00 33.42 ? 130 SER C OG    1 
ATOM   5504 N  N     . ASP C 2 84  ? -37.187 -0.582  37.860  1.00 34.13 ? 131 ASP C N     1 
ATOM   5505 C  CA    . ASP C 2 84  ? -35.902 -1.262  37.910  1.00 34.29 ? 131 ASP C CA    1 
ATOM   5506 C  C     . ASP C 2 84  ? -34.839 -0.484  37.102  1.00 34.53 ? 131 ASP C C     1 
ATOM   5507 O  O     . ASP C 2 84  ? -33.767 -1.012  36.795  1.00 35.17 ? 131 ASP C O     1 
ATOM   5508 C  CB    . ASP C 2 84  ? -36.115 -2.685  37.386  1.00 34.51 ? 131 ASP C CB    1 
ATOM   5509 C  CG    . ASP C 2 84  ? -37.175 -3.467  38.204  1.00 35.19 ? 131 ASP C CG    1 
ATOM   5510 O  OD1   . ASP C 2 84  ? -37.165 -3.354  39.455  1.00 37.75 ? 131 ASP C OD1   1 
ATOM   5511 O  OD2   . ASP C 2 84  ? -38.003 -4.202  37.614  1.00 33.11 ? 131 ASP C OD2   1 
ATOM   5512 N  N     . ALA C 2 85  ? -35.120 0.770   36.747  1.00 34.07 ? 132 ALA C N     1 
ATOM   5513 C  CA    . ALA C 2 85  ? -34.095 1.598   36.106  1.00 33.77 ? 132 ALA C CA    1 
ATOM   5514 C  C     . ALA C 2 85  ? -32.871 1.745   36.997  1.00 33.77 ? 132 ALA C C     1 
ATOM   5515 O  O     . ALA C 2 85  ? -32.990 1.798   38.230  1.00 34.36 ? 132 ALA C O     1 
ATOM   5516 C  CB    . ALA C 2 85  ? -34.640 2.976   35.757  1.00 33.70 ? 132 ALA C CB    1 
ATOM   5517 N  N     . ALA C 2 86  ? -31.707 1.840   36.361  1.00 33.48 ? 133 ALA C N     1 
ATOM   5518 C  CA    . ALA C 2 86  ? -30.438 2.049   37.037  1.00 33.68 ? 133 ALA C CA    1 
ATOM   5519 C  C     . ALA C 2 86  ? -30.293 3.440   37.635  1.00 33.82 ? 133 ALA C C     1 
ATOM   5520 O  O     . ALA C 2 86  ? -29.573 3.610   38.610  1.00 33.94 ? 133 ALA C O     1 
ATOM   5521 C  CB    . ALA C 2 86  ? -29.284 1.794   36.077  1.00 33.29 ? 133 ALA C CB    1 
ATOM   5522 N  N     . LYS C 2 87  ? -30.943 4.427   37.026  1.00 34.00 ? 134 LYS C N     1 
ATOM   5523 C  CA    . LYS C 2 87  ? -30.975 5.786   37.557  1.00 34.17 ? 134 LYS C CA    1 
ATOM   5524 C  C     . LYS C 2 87  ? -32.434 6.179   37.825  1.00 34.37 ? 134 LYS C C     1 
ATOM   5525 O  O     . LYS C 2 87  ? -32.919 7.209   37.348  1.00 34.23 ? 134 LYS C O     1 
ATOM   5526 C  CB    . LYS C 2 87  ? -30.339 6.773   36.583  1.00 34.62 ? 134 LYS C CB    1 
ATOM   5527 C  CG    . LYS C 2 87  ? -28.927 6.422   36.074  1.00 35.08 ? 134 LYS C CG    1 
ATOM   5528 C  CD    . LYS C 2 87  ? -27.822 6.923   37.022  1.00 36.72 ? 134 LYS C CD    1 
ATOM   5529 C  CE    . LYS C 2 87  ? -26.414 6.661   36.455  1.00 36.16 ? 134 LYS C CE    1 
ATOM   5530 N  NZ    . LYS C 2 87  ? -26.366 7.096   35.036  1.00 35.75 ? 134 LYS C NZ    1 
ATOM   5531 N  N     . GLN C 2 88  ? -33.115 5.355   38.625  1.00 34.34 ? 135 GLN C N     1 
ATOM   5532 C  CA    . GLN C 2 88  ? -34.539 5.495   38.874  1.00 33.96 ? 135 GLN C CA    1 
ATOM   5533 C  C     . GLN C 2 88  ? -34.804 6.779   39.634  1.00 34.14 ? 135 GLN C C     1 
ATOM   5534 O  O     . GLN C 2 88  ? -34.268 6.982   40.724  1.00 34.61 ? 135 GLN C O     1 
ATOM   5535 C  CB    . GLN C 2 88  ? -35.056 4.300   39.699  1.00 34.20 ? 135 GLN C CB    1 
ATOM   5536 C  CG    . GLN C 2 88  ? -36.591 4.133   39.704  1.00 33.65 ? 135 GLN C CG    1 
ATOM   5537 C  CD    . GLN C 2 88  ? -37.133 3.339   40.885  1.00 32.96 ? 135 GLN C CD    1 
ATOM   5538 O  OE1   . GLN C 2 88  ? -36.412 2.561   41.528  1.00 33.42 ? 135 GLN C OE1   1 
ATOM   5539 N  NE2   . GLN C 2 88  ? -38.411 3.553   41.193  1.00 29.95 ? 135 GLN C NE2   1 
ATOM   5540 N  N     . ILE C 2 89  ? -35.624 7.647   39.057  1.00 33.69 ? 136 ILE C N     1 
ATOM   5541 C  CA    . ILE C 2 89  ? -35.976 8.889   39.714  1.00 33.34 ? 136 ILE C CA    1 
ATOM   5542 C  C     . ILE C 2 89  ? -36.991 8.640   40.823  1.00 33.44 ? 136 ILE C C     1 
ATOM   5543 O  O     . ILE C 2 89  ? -37.832 7.753   40.702  1.00 33.36 ? 136 ILE C O     1 
ATOM   5544 C  CB    . ILE C 2 89  ? -36.522 9.951   38.725  1.00 32.93 ? 136 ILE C CB    1 
ATOM   5545 C  CG1   . ILE C 2 89  ? -37.659 9.403   37.887  1.00 33.36 ? 136 ILE C CG1   1 
ATOM   5546 C  CG2   . ILE C 2 89  ? -35.409 10.468  37.830  1.00 32.75 ? 136 ILE C CG2   1 
ATOM   5547 C  CD1   . ILE C 2 89  ? -38.383 10.477  37.110  1.00 34.61 ? 136 ILE C CD1   1 
ATOM   5548 N  N     . ASN C 2 90  ? -36.906 9.434   41.892  1.00 33.35 ? 137 ASN C N     1 
ATOM   5549 C  CA    . ASN C 2 90  ? -37.853 9.349   43.006  1.00 33.41 ? 137 ASN C CA    1 
ATOM   5550 C  C     . ASN C 2 90  ? -39.202 10.019  42.700  1.00 33.84 ? 137 ASN C C     1 
ATOM   5551 O  O     . ASN C 2 90  ? -39.413 11.180  43.011  1.00 33.50 ? 137 ASN C O     1 
ATOM   5552 C  CB    . ASN C 2 90  ? -37.245 9.991   44.249  1.00 33.66 ? 137 ASN C CB    1 
ATOM   5553 C  CG    . ASN C 2 90  ? -37.952 9.582   45.541  1.00 33.59 ? 137 ASN C CG    1 
ATOM   5554 O  OD1   . ASN C 2 90  ? -39.026 8.968   45.524  1.00 31.12 ? 137 ASN C OD1   1 
ATOM   5555 N  ND2   . ASN C 2 90  ? -37.338 9.930   46.675  1.00 32.09 ? 137 ASN C ND2   1 
ATOM   5556 N  N     . ILE C 2 91  ? -40.104 9.265   42.069  1.00 34.33 ? 138 ILE C N     1 
ATOM   5557 C  CA    . ILE C 2 91  ? -41.473 9.717   41.821  1.00 33.85 ? 138 ILE C CA    1 
ATOM   5558 C  C     . ILE C 2 91  ? -42.518 8.715   42.320  1.00 33.62 ? 138 ILE C C     1 
ATOM   5559 O  O     . ILE C 2 91  ? -42.290 7.512   42.343  1.00 33.76 ? 138 ILE C O     1 
ATOM   5560 C  CB    . ILE C 2 91  ? -41.739 9.951   40.320  1.00 33.61 ? 138 ILE C CB    1 
ATOM   5561 C  CG1   . ILE C 2 91  ? -41.572 8.648   39.518  1.00 33.69 ? 138 ILE C CG1   1 
ATOM   5562 C  CG2   . ILE C 2 91  ? -40.855 11.073  39.799  1.00 34.07 ? 138 ILE C CG2   1 
ATOM   5563 C  CD1   . ILE C 2 91  ? -41.705 8.820   38.006  1.00 32.95 ? 138 ILE C CD1   1 
ATOM   5564 N  N     . ASP C 2 92  ? -43.697 9.211   42.642  1.00 33.09 ? 139 ASP C N     1 
ATOM   5565 C  CA    . ASP C 2 92  ? -44.743 8.321   43.099  1.00 32.91 ? 139 ASP C CA    1 
ATOM   5566 C  C     . ASP C 2 92  ? -45.398 7.473   41.980  1.00 32.66 ? 139 ASP C C     1 
ATOM   5567 O  O     . ASP C 2 92  ? -45.196 7.693   40.772  1.00 31.96 ? 139 ASP C O     1 
ATOM   5568 C  CB    . ASP C 2 92  ? -45.798 9.075   43.938  1.00 32.83 ? 139 ASP C CB    1 
ATOM   5569 C  CG    . ASP C 2 92  ? -46.605 10.092  43.151  1.00 33.60 ? 139 ASP C CG    1 
ATOM   5570 O  OD1   . ASP C 2 92  ? -46.569 10.115  41.896  1.00 34.17 ? 139 ASP C OD1   1 
ATOM   5571 O  OD2   . ASP C 2 92  ? -47.303 10.890  43.830  1.00 36.62 ? 139 ASP C OD2   1 
ATOM   5572 N  N     . PHE C 2 93  ? -46.188 6.507   42.433  1.00 32.16 ? 140 PHE C N     1 
ATOM   5573 C  CA    . PHE C 2 93  ? -46.897 5.581   41.581  1.00 32.32 ? 140 PHE C CA    1 
ATOM   5574 C  C     . PHE C 2 93  ? -47.750 6.271   40.512  1.00 32.13 ? 140 PHE C C     1 
ATOM   5575 O  O     . PHE C 2 93  ? -47.653 5.916   39.335  1.00 31.93 ? 140 PHE C O     1 
ATOM   5576 C  CB    . PHE C 2 93  ? -47.782 4.683   42.461  1.00 32.36 ? 140 PHE C CB    1 
ATOM   5577 C  CG    . PHE C 2 93  ? -48.617 3.699   41.699  1.00 32.63 ? 140 PHE C CG    1 
ATOM   5578 C  CD1   . PHE C 2 93  ? -48.066 2.512   41.235  1.00 32.57 ? 140 PHE C CD1   1 
ATOM   5579 C  CD2   . PHE C 2 93  ? -49.971 3.945   41.465  1.00 33.29 ? 140 PHE C CD2   1 
ATOM   5580 C  CE1   . PHE C 2 93  ? -48.841 1.588   40.550  1.00 32.67 ? 140 PHE C CE1   1 
ATOM   5581 C  CE2   . PHE C 2 93  ? -50.749 3.017   40.772  1.00 32.94 ? 140 PHE C CE2   1 
ATOM   5582 C  CZ    . PHE C 2 93  ? -50.184 1.838   40.322  1.00 32.08 ? 140 PHE C CZ    1 
ATOM   5583 N  N     . ARG C 2 94  ? -48.592 7.226   40.920  1.00 32.02 ? 141 ARG C N     1 
ATOM   5584 C  CA    . ARG C 2 94  ? -49.510 7.888   39.981  1.00 32.42 ? 141 ARG C CA    1 
ATOM   5585 C  C     . ARG C 2 94  ? -48.753 8.580   38.835  1.00 32.51 ? 141 ARG C C     1 
ATOM   5586 O  O     . ARG C 2 94  ? -49.196 8.537   37.672  1.00 32.65 ? 141 ARG C O     1 
ATOM   5587 C  CB    . ARG C 2 94  ? -50.457 8.875   40.688  1.00 32.66 ? 141 ARG C CB    1 
ATOM   5588 C  CG    . ARG C 2 94  ? -51.577 8.215   41.514  1.00 32.96 ? 141 ARG C CG    1 
ATOM   5589 N  N     . THR C 2 95  ? -47.607 9.175   39.160  1.00 32.33 ? 142 THR C N     1 
ATOM   5590 C  CA    . THR C 2 95  ? -46.779 9.857   38.167  1.00 32.48 ? 142 THR C CA    1 
ATOM   5591 C  C     . THR C 2 95  ? -46.076 8.863   37.205  1.00 32.89 ? 142 THR C C     1 
ATOM   5592 O  O     . THR C 2 95  ? -46.025 9.069   35.979  1.00 32.64 ? 142 THR C O     1 
ATOM   5593 C  CB    . THR C 2 95  ? -45.716 10.743  38.849  1.00 32.44 ? 142 THR C CB    1 
ATOM   5594 O  OG1   . THR C 2 95  ? -46.331 11.601  39.815  1.00 31.48 ? 142 THR C OG1   1 
ATOM   5595 C  CG2   . THR C 2 95  ? -45.011 11.596  37.835  1.00 32.88 ? 142 THR C CG2   1 
ATOM   5596 N  N     . ARG C 2 96  ? -45.571 7.780   37.778  1.00 33.17 ? 143 ARG C N     1 
ATOM   5597 C  CA    . ARG C 2 96  ? -44.917 6.726   37.033  1.00 33.48 ? 143 ARG C CA    1 
ATOM   5598 C  C     . ARG C 2 96  ? -45.895 5.966   36.111  1.00 33.94 ? 143 ARG C C     1 
ATOM   5599 O  O     . ARG C 2 96  ? -45.541 5.611   34.985  1.00 33.84 ? 143 ARG C O     1 
ATOM   5600 C  CB    . ARG C 2 96  ? -44.243 5.755   38.010  1.00 33.35 ? 143 ARG C CB    1 
ATOM   5601 C  CG    . ARG C 2 96  ? -43.153 4.919   37.350  1.00 34.28 ? 143 ARG C CG    1 
ATOM   5602 C  CD    . ARG C 2 96  ? -42.479 3.906   38.277  1.00 33.54 ? 143 ARG C CD    1 
ATOM   5603 N  NE    . ARG C 2 96  ? -43.431 2.921   38.777  1.00 33.59 ? 143 ARG C NE    1 
ATOM   5604 C  CZ    . ARG C 2 96  ? -43.752 2.754   40.059  1.00 34.18 ? 143 ARG C CZ    1 
ATOM   5605 N  NH1   . ARG C 2 96  ? -44.653 1.832   40.386  1.00 34.05 ? 143 ARG C NH1   1 
ATOM   5606 N  NH2   . ARG C 2 96  ? -43.175 3.487   41.016  1.00 33.68 ? 143 ARG C NH2   1 
ATOM   5607 N  N     . GLU C 2 97  ? -47.112 5.711   36.585  1.00 34.47 ? 144 GLU C N     1 
ATOM   5608 C  CA    . GLU C 2 97  ? -48.129 5.037   35.760  1.00 35.07 ? 144 GLU C CA    1 
ATOM   5609 C  C     . GLU C 2 97  ? -48.587 5.906   34.587  1.00 34.77 ? 144 GLU C C     1 
ATOM   5610 O  O     . GLU C 2 97  ? -48.769 5.423   33.455  1.00 34.83 ? 144 GLU C O     1 
ATOM   5611 C  CB    . GLU C 2 97  ? -49.350 4.648   36.598  1.00 35.27 ? 144 GLU C CB    1 
ATOM   5612 C  CG    . GLU C 2 97  ? -49.214 3.294   37.273  1.00 37.68 ? 144 GLU C CG    1 
ATOM   5613 C  CD    . GLU C 2 97  ? -49.692 2.129   36.394  1.00 40.67 ? 144 GLU C CD    1 
ATOM   5614 O  OE1   . GLU C 2 97  ? -50.815 1.627   36.672  1.00 41.50 ? 144 GLU C OE1   1 
ATOM   5615 O  OE2   . GLU C 2 97  ? -48.964 1.724   35.436  1.00 41.68 ? 144 GLU C OE2   1 
ATOM   5616 N  N     . SER C 2 98  ? -48.789 7.184   34.876  1.00 34.34 ? 145 SER C N     1 
ATOM   5617 C  CA    . SER C 2 98  ? -49.234 8.134   33.876  1.00 34.16 ? 145 SER C CA    1 
ATOM   5618 C  C     . SER C 2 98  ? -48.161 8.352   32.817  1.00 33.84 ? 145 SER C C     1 
ATOM   5619 O  O     . SER C 2 98  ? -48.473 8.564   31.646  1.00 34.39 ? 145 SER C O     1 
ATOM   5620 C  CB    . SER C 2 98  ? -49.619 9.454   34.558  1.00 33.97 ? 145 SER C CB    1 
ATOM   5621 O  OG    . SER C 2 98  ? -49.591 10.521  33.642  1.00 34.29 ? 145 SER C OG    1 
ATOM   5622 N  N     . THR C 2 99  ? -46.900 8.288   33.221  1.00 33.45 ? 146 THR C N     1 
ATOM   5623 C  CA    . THR C 2 99  ? -45.811 8.339   32.264  1.00 33.21 ? 146 THR C CA    1 
ATOM   5624 C  C     . THR C 2 99  ? -45.783 7.056   31.462  1.00 32.90 ? 146 THR C C     1 
ATOM   5625 O  O     . THR C 2 99  ? -45.691 7.088   30.242  1.00 33.02 ? 146 THR C O     1 
ATOM   5626 C  CB    . THR C 2 99  ? -44.465 8.550   32.953  1.00 33.75 ? 146 THR C CB    1 
ATOM   5627 O  OG1   . THR C 2 99  ? -44.536 9.717   33.788  1.00 33.54 ? 146 THR C OG1   1 
ATOM   5628 C  CG2   . THR C 2 99  ? -43.346 8.711   31.915  1.00 33.41 ? 146 THR C CG2   1 
ATOM   5629 N  N     . ALA C 2 100 ? -45.910 5.924   32.140  1.00 32.69 ? 147 ALA C N     1 
ATOM   5630 C  CA    . ALA C 2 100 ? -45.967 4.635   31.449  1.00 32.65 ? 147 ALA C CA    1 
ATOM   5631 C  C     . ALA C 2 100 ? -46.965 4.659   30.295  1.00 32.68 ? 147 ALA C C     1 
ATOM   5632 O  O     . ALA C 2 100 ? -46.623 4.285   29.181  1.00 32.72 ? 147 ALA C O     1 
ATOM   5633 C  CB    . ALA C 2 100 ? -46.313 3.523   32.407  1.00 32.31 ? 147 ALA C CB    1 
ATOM   5634 N  N     . LYS C 2 101 ? -48.189 5.106   30.565  1.00 33.07 ? 148 LYS C N     1 
ATOM   5635 C  CA    . LYS C 2 101 ? -49.263 5.134   29.556  1.00 33.53 ? 148 LYS C CA    1 
ATOM   5636 C  C     . LYS C 2 101 ? -48.909 5.991   28.324  1.00 33.99 ? 148 LYS C C     1 
ATOM   5637 O  O     . LYS C 2 101 ? -49.367 5.713   27.223  1.00 33.80 ? 148 LYS C O     1 
ATOM   5638 C  CB    . LYS C 2 101 ? -50.589 5.653   30.162  1.00 33.47 ? 148 LYS C CB    1 
ATOM   5639 C  CG    . LYS C 2 101 ? -51.387 4.641   30.971  1.00 33.05 ? 148 LYS C CG    1 
ATOM   5640 N  N     . LYS C 2 102 ? -48.093 7.022   28.521  1.00 34.50 ? 149 LYS C N     1 
ATOM   5641 C  CA    . LYS C 2 102 ? -47.740 7.958   27.444  1.00 34.71 ? 149 LYS C CA    1 
ATOM   5642 C  C     . LYS C 2 102 ? -46.617 7.459   26.525  1.00 34.96 ? 149 LYS C C     1 
ATOM   5643 O  O     . LYS C 2 102 ? -46.450 7.967   25.417  1.00 35.20 ? 149 LYS C O     1 
ATOM   5644 C  CB    . LYS C 2 102 ? -47.330 9.323   28.028  1.00 34.75 ? 149 LYS C CB    1 
ATOM   5645 C  CG    . LYS C 2 102 ? -48.489 10.161  28.611  1.00 34.80 ? 149 LYS C CG    1 
ATOM   5646 C  CD    . LYS C 2 102 ? -47.976 11.254  29.556  1.00 34.27 ? 149 LYS C CD    1 
ATOM   5647 C  CE    . LYS C 2 102 ? -49.117 11.975  30.300  1.00 34.14 ? 149 LYS C CE    1 
ATOM   5648 N  NZ    . LYS C 2 102 ? -48.605 12.975  31.301  1.00 32.46 ? 149 LYS C NZ    1 
ATOM   5649 N  N     . ILE C 2 103 ? -45.847 6.475   26.982  1.00 35.34 ? 150 ILE C N     1 
ATOM   5650 C  CA    . ILE C 2 103 ? -44.660 6.005   26.254  1.00 35.51 ? 150 ILE C CA    1 
ATOM   5651 C  C     . ILE C 2 103 ? -45.059 5.332   24.928  1.00 35.95 ? 150 ILE C C     1 
ATOM   5652 O  O     . ILE C 2 103 ? -44.312 5.372   23.942  1.00 35.82 ? 150 ILE C O     1 
ATOM   5653 C  CB    . ILE C 2 103 ? -43.841 5.030   27.145  1.00 35.39 ? 150 ILE C CB    1 
ATOM   5654 C  CG1   . ILE C 2 103 ? -43.327 5.754   28.387  1.00 35.41 ? 150 ILE C CG1   1 
ATOM   5655 C  CG2   . ILE C 2 103 ? -42.654 4.411   26.403  1.00 35.81 ? 150 ILE C CG2   1 
ATOM   5656 C  CD1   . ILE C 2 103 ? -42.523 7.003   28.101  1.00 35.00 ? 150 ILE C CD1   1 
ATOM   5657 N  N     . LYS C 2 104 ? -46.262 4.753   24.918  1.00 36.36 ? 151 LYS C N     1 
ATOM   5658 C  CA    . LYS C 2 104 ? -46.791 3.976   23.796  1.00 36.25 ? 151 LYS C CA    1 
ATOM   5659 C  C     . LYS C 2 104 ? -46.973 4.850   22.548  1.00 36.28 ? 151 LYS C C     1 
ATOM   5660 O  O     . LYS C 2 104 ? -46.531 4.485   21.443  1.00 36.36 ? 151 LYS C O     1 
ATOM   5661 C  CB    . LYS C 2 104 ? -48.125 3.330   24.220  1.00 36.30 ? 151 LYS C CB    1 
ATOM   5662 C  CG    . LYS C 2 104 ? -48.054 2.500   25.541  1.00 36.55 ? 151 LYS C CG    1 
ATOM   5663 C  CD    . LYS C 2 104 ? -49.425 1.965   25.974  1.00 36.38 ? 151 LYS C CD    1 
ATOM   5664 N  N     . ALA C 2 105 ? -47.615 6.002   22.727  1.00 36.01 ? 152 ALA C N     1 
ATOM   5665 C  CA    . ALA C 2 105 ? -47.808 6.959   21.636  1.00 35.81 ? 152 ALA C CA    1 
ATOM   5666 C  C     . ALA C 2 105 ? -47.336 8.307   22.151  1.00 35.54 ? 152 ALA C C     1 
ATOM   5667 O  O     . ALA C 2 105 ? -48.146 9.130   22.557  1.00 35.71 ? 152 ALA C O     1 
ATOM   5668 C  CB    . ALA C 2 105 ? -49.275 7.010   21.217  1.00 35.59 ? 152 ALA C CB    1 
ATOM   5669 N  N     . PRO C 2 106 ? -46.010 8.526   22.159  1.00 35.19 ? 153 PRO C N     1 
ATOM   5670 C  CA    . PRO C 2 106 ? -45.466 9.689   22.841  1.00 34.92 ? 153 PRO C CA    1 
ATOM   5671 C  C     . PRO C 2 106 ? -45.520 10.985  22.035  1.00 34.75 ? 153 PRO C C     1 
ATOM   5672 O  O     . PRO C 2 106 ? -45.246 10.982  20.833  1.00 34.64 ? 153 PRO C O     1 
ATOM   5673 C  CB    . PRO C 2 106 ? -44.015 9.284   23.098  1.00 34.87 ? 153 PRO C CB    1 
ATOM   5674 C  CG    . PRO C 2 106 ? -43.688 8.276   22.073  1.00 34.75 ? 153 PRO C CG    1 
ATOM   5675 C  CD    . PRO C 2 106 ? -44.955 7.706   21.538  1.00 35.09 ? 153 PRO C CD    1 
ATOM   5676 N  N     . THR C 2 107 ? -45.871 12.073  22.721  1.00 34.65 ? 154 THR C N     1 
ATOM   5677 C  CA    . THR C 2 107 ? -45.813 13.427  22.178  1.00 34.53 ? 154 THR C CA    1 
ATOM   5678 C  C     . THR C 2 107 ? -44.634 14.146  22.851  1.00 34.84 ? 154 THR C C     1 
ATOM   5679 O  O     . THR C 2 107 ? -44.034 13.605  23.778  1.00 34.73 ? 154 THR C O     1 
ATOM   5680 C  CB    . THR C 2 107 ? -47.130 14.226  22.433  1.00 34.32 ? 154 THR C CB    1 
ATOM   5681 O  OG1   . THR C 2 107 ? -47.077 14.875  23.719  1.00 33.82 ? 154 THR C OG1   1 
ATOM   5682 C  CG2   . THR C 2 107 ? -48.353 13.310  22.360  1.00 33.42 ? 154 THR C CG2   1 
ATOM   5683 N  N     . PRO C 2 108 ? -44.278 15.349  22.367  1.00 35.13 ? 155 PRO C N     1 
ATOM   5684 C  CA    . PRO C 2 108 ? -43.167 16.108  22.950  1.00 35.33 ? 155 PRO C CA    1 
ATOM   5685 C  C     . PRO C 2 108 ? -43.296 16.469  24.437  1.00 35.68 ? 155 PRO C C     1 
ATOM   5686 O  O     . PRO C 2 108 ? -42.272 16.658  25.093  1.00 35.68 ? 155 PRO C O     1 
ATOM   5687 C  CB    . PRO C 2 108 ? -43.117 17.373  22.083  1.00 35.46 ? 155 PRO C CB    1 
ATOM   5688 C  CG    . PRO C 2 108 ? -43.739 16.961  20.778  1.00 35.49 ? 155 PRO C CG    1 
ATOM   5689 C  CD    . PRO C 2 108 ? -44.841 16.032  21.186  1.00 35.13 ? 155 PRO C CD    1 
ATOM   5690 N  N     . THR C 2 109 ? -44.526 16.559  24.956  1.00 35.98 ? 156 THR C N     1 
ATOM   5691 C  CA    . THR C 2 109 ? -44.768 16.886  26.371  1.00 36.20 ? 156 THR C CA    1 
ATOM   5692 C  C     . THR C 2 109 ? -44.812 15.644  27.269  1.00 36.40 ? 156 THR C C     1 
ATOM   5693 O  O     . THR C 2 109 ? -45.168 15.741  28.439  1.00 36.47 ? 156 THR C O     1 
ATOM   5694 C  CB    . THR C 2 109 ? -46.111 17.639  26.556  1.00 36.29 ? 156 THR C CB    1 
ATOM   5695 O  OG1   . THR C 2 109 ? -47.201 16.792  26.156  1.00 36.72 ? 156 THR C OG1   1 
ATOM   5696 C  CG2   . THR C 2 109 ? -46.134 18.940  25.746  1.00 35.96 ? 156 THR C CG2   1 
ATOM   5697 N  N     . CYS C 2 110 ? -44.434 14.492  26.721  1.00 36.45 ? 157 CYS C N     1 
ATOM   5698 C  CA    . CYS C 2 110 ? -44.598 13.196  27.376  1.00 36.41 ? 157 CYS C CA    1 
ATOM   5699 C  C     . CYS C 2 110 ? -44.083 13.155  28.825  1.00 36.56 ? 157 CYS C C     1 
ATOM   5700 O  O     . CYS C 2 110 ? -44.753 12.621  29.708  1.00 36.43 ? 157 CYS C O     1 
ATOM   5701 C  CB    . CYS C 2 110 ? -43.898 12.120  26.529  1.00 36.46 ? 157 CYS C CB    1 
ATOM   5702 S  SG    . CYS C 2 110 ? -43.817 10.441  27.235  1.00 36.18 ? 157 CYS C SG    1 
ATOM   5703 N  N     . PHE C 2 111 ? -42.905 13.731  29.057  1.00 36.64 ? 158 PHE C N     1 
ATOM   5704 C  CA    . PHE C 2 111 ? -42.253 13.695  30.367  1.00 36.52 ? 158 PHE C CA    1 
ATOM   5705 C  C     . PHE C 2 111 ? -42.440 14.957  31.217  1.00 36.78 ? 158 PHE C C     1 
ATOM   5706 O  O     . PHE C 2 111 ? -41.836 15.070  32.286  1.00 37.19 ? 158 PHE C O     1 
ATOM   5707 C  CB    . PHE C 2 111 ? -40.743 13.457  30.203  1.00 36.45 ? 158 PHE C CB    1 
ATOM   5708 C  CG    . PHE C 2 111 ? -40.406 12.158  29.550  1.00 36.10 ? 158 PHE C CG    1 
ATOM   5709 C  CD1   . PHE C 2 111 ? -40.642 10.964  30.200  1.00 36.88 ? 158 PHE C CD1   1 
ATOM   5710 C  CD2   . PHE C 2 111 ? -39.851 12.123  28.289  1.00 36.47 ? 158 PHE C CD2   1 
ATOM   5711 C  CE1   . PHE C 2 111 ? -40.342 9.754   29.597  1.00 36.81 ? 158 PHE C CE1   1 
ATOM   5712 C  CE2   . PHE C 2 111 ? -39.547 10.921  27.682  1.00 36.73 ? 158 PHE C CE2   1 
ATOM   5713 C  CZ    . PHE C 2 111 ? -39.796 9.736   28.339  1.00 37.04 ? 158 PHE C CZ    1 
ATOM   5714 N  N     . ASP C 2 112 ? -43.269 15.895  30.773  1.00 37.09 ? 159 ASP C N     1 
ATOM   5715 C  CA    . ASP C 2 112 ? -43.445 17.149  31.515  1.00 37.46 ? 159 ASP C CA    1 
ATOM   5716 C  C     . ASP C 2 112 ? -43.860 16.914  32.979  1.00 37.45 ? 159 ASP C C     1 
ATOM   5717 O  O     . ASP C 2 112 ? -43.312 17.559  33.873  1.00 37.35 ? 159 ASP C O     1 
ATOM   5718 C  CB    . ASP C 2 112 ? -44.424 18.105  30.793  1.00 37.57 ? 159 ASP C CB    1 
ATOM   5719 C  CG    . ASP C 2 112 ? -43.787 18.825  29.579  1.00 38.44 ? 159 ASP C CG    1 
ATOM   5720 O  OD1   . ASP C 2 112 ? -42.756 18.331  29.046  1.00 38.06 ? 159 ASP C OD1   1 
ATOM   5721 O  OD2   . ASP C 2 112 ? -44.340 19.883  29.154  1.00 39.11 ? 159 ASP C OD2   1 
ATOM   5722 N  N     . GLU C 2 113 ? -44.794 15.985  33.212  1.00 37.50 ? 160 GLU C N     1 
ATOM   5723 C  CA    . GLU C 2 113 ? -45.296 15.691  34.554  1.00 37.73 ? 160 GLU C CA    1 
ATOM   5724 C  C     . GLU C 2 113 ? -44.164 15.211  35.471  1.00 37.54 ? 160 GLU C C     1 
ATOM   5725 O  O     . GLU C 2 113 ? -43.971 15.754  36.561  1.00 37.30 ? 160 GLU C O     1 
ATOM   5726 C  CB    . GLU C 2 113 ? -46.435 14.663  34.489  1.00 37.41 ? 160 GLU C CB    1 
ATOM   5727 C  CG    . GLU C 2 113 ? -47.225 14.522  35.793  1.00 38.40 ? 160 GLU C CG    1 
ATOM   5728 C  CD    . GLU C 2 113 ? -48.437 13.573  35.677  1.00 39.26 ? 160 GLU C CD    1 
ATOM   5729 O  OE1   . GLU C 2 113 ? -48.376 12.593  34.884  1.00 40.77 ? 160 GLU C OE1   1 
ATOM   5730 O  OE2   . GLU C 2 113 ? -49.456 13.811  36.379  1.00 39.76 ? 160 GLU C OE2   1 
ATOM   5731 N  N     . ALA C 2 114 ? -43.411 14.212  35.010  1.00 37.44 ? 161 ALA C N     1 
ATOM   5732 C  CA    . ALA C 2 114 ? -42.288 13.671  35.775  1.00 37.26 ? 161 ALA C CA    1 
ATOM   5733 C  C     . ALA C 2 114 ? -41.176 14.697  35.912  1.00 37.26 ? 161 ALA C C     1 
ATOM   5734 O  O     . ALA C 2 114 ? -40.564 14.785  36.970  1.00 37.57 ? 161 ALA C O     1 
ATOM   5735 C  CB    . ALA C 2 114 ? -41.750 12.374  35.127  1.00 37.09 ? 161 ALA C CB    1 
ATOM   5736 N  N     . GLN C 2 115 ? -40.913 15.469  34.857  1.00 37.17 ? 162 GLN C N     1 
ATOM   5737 C  CA    . GLN C 2 115 ? -39.867 16.496  34.911  1.00 37.05 ? 162 GLN C CA    1 
ATOM   5738 C  C     . GLN C 2 115 ? -40.191 17.542  35.963  1.00 37.45 ? 162 GLN C C     1 
ATOM   5739 O  O     . GLN C 2 115 ? -39.302 17.947  36.707  1.00 38.24 ? 162 GLN C O     1 
ATOM   5740 C  CB    . GLN C 2 115 ? -39.650 17.182  33.561  1.00 36.99 ? 162 GLN C CB    1 
ATOM   5741 C  CG    . GLN C 2 115 ? -38.479 18.170  33.556  1.00 36.43 ? 162 GLN C CG    1 
ATOM   5742 C  CD    . GLN C 2 115 ? -38.221 18.788  32.197  1.00 36.78 ? 162 GLN C CD    1 
ATOM   5743 O  OE1   . GLN C 2 115 ? -39.115 18.864  31.355  1.00 37.64 ? 162 GLN C OE1   1 
ATOM   5744 N  NE2   . GLN C 2 115 ? -36.992 19.235  31.974  1.00 35.40 ? 162 GLN C NE2   1 
ATOM   5745 N  N     . LYS C 2 116 ? -41.453 17.962  36.040  1.00 37.34 ? 163 LYS C N     1 
ATOM   5746 C  CA    . LYS C 2 116 ? -41.877 18.957  37.027  1.00 37.55 ? 163 LYS C CA    1 
ATOM   5747 C  C     . LYS C 2 116 ? -41.623 18.442  38.469  1.00 37.55 ? 163 LYS C C     1 
ATOM   5748 O  O     . LYS C 2 116 ? -41.070 19.169  39.307  1.00 37.88 ? 163 LYS C O     1 
ATOM   5749 C  CB    . LYS C 2 116 ? -43.356 19.324  36.805  1.00 37.34 ? 163 LYS C CB    1 
ATOM   5750 C  CG    . LYS C 2 116 ? -43.733 20.700  37.277  1.00 37.79 ? 163 LYS C CG    1 
ATOM   5751 N  N     . VAL C 2 117 ? -41.988 17.188  38.735  1.00 37.19 ? 164 VAL C N     1 
ATOM   5752 C  CA    . VAL C 2 117 ? -41.774 16.569  40.052  1.00 36.87 ? 164 VAL C CA    1 
ATOM   5753 C  C     . VAL C 2 117 ? -40.290 16.445  40.426  1.00 36.76 ? 164 VAL C C     1 
ATOM   5754 O  O     . VAL C 2 117 ? -39.931 16.599  41.580  1.00 36.71 ? 164 VAL C O     1 
ATOM   5755 C  CB    . VAL C 2 117 ? -42.446 15.166  40.138  1.00 36.68 ? 164 VAL C CB    1 
ATOM   5756 C  CG1   . VAL C 2 117 ? -42.036 14.444  41.409  1.00 35.96 ? 164 VAL C CG1   1 
ATOM   5757 C  CG2   . VAL C 2 117 ? -43.960 15.291  40.060  1.00 35.72 ? 164 VAL C CG2   1 
ATOM   5758 N  N     . ILE C 2 118 ? -39.430 16.179  39.451  1.00 36.79 ? 165 ILE C N     1 
ATOM   5759 C  CA    . ILE C 2 118 ? -37.991 16.119  39.717  1.00 36.61 ? 165 ILE C CA    1 
ATOM   5760 C  C     . ILE C 2 118 ? -37.365 17.514  39.825  1.00 36.82 ? 165 ILE C C     1 
ATOM   5761 O  O     . ILE C 2 118 ? -36.404 17.695  40.557  1.00 37.38 ? 165 ILE C O     1 
ATOM   5762 C  CB    . ILE C 2 118 ? -37.254 15.271  38.670  1.00 36.24 ? 165 ILE C CB    1 
ATOM   5763 C  CG1   . ILE C 2 118 ? -37.721 13.833  38.785  1.00 35.70 ? 165 ILE C CG1   1 
ATOM   5764 C  CG2   . ILE C 2 118 ? -35.744 15.352  38.852  1.00 35.11 ? 165 ILE C CG2   1 
ATOM   5765 C  CD1   . ILE C 2 118 ? -37.570 13.259  40.170  1.00 36.14 ? 165 ILE C CD1   1 
ATOM   5766 N  N     . TYR C 2 119 ? -37.897 18.500  39.119  1.00 36.63 ? 166 TYR C N     1 
ATOM   5767 C  CA    . TYR C 2 119 ? -37.460 19.873  39.354  1.00 36.78 ? 166 TYR C CA    1 
ATOM   5768 C  C     . TYR C 2 119 ? -37.805 20.280  40.797  1.00 36.63 ? 166 TYR C C     1 
ATOM   5769 O  O     . TYR C 2 119 ? -36.937 20.713  41.551  1.00 37.02 ? 166 TYR C O     1 
ATOM   5770 C  CB    . TYR C 2 119 ? -38.110 20.822  38.353  1.00 37.05 ? 166 TYR C CB    1 
ATOM   5771 C  CG    . TYR C 2 119 ? -37.638 22.269  38.383  1.00 37.53 ? 166 TYR C CG    1 
ATOM   5772 C  CD1   . TYR C 2 119 ? -36.610 22.711  37.547  1.00 38.30 ? 166 TYR C CD1   1 
ATOM   5773 C  CD2   . TYR C 2 119 ? -38.267 23.211  39.196  1.00 37.64 ? 166 TYR C CD2   1 
ATOM   5774 C  CE1   . TYR C 2 119 ? -36.203 24.054  37.542  1.00 38.04 ? 166 TYR C CE1   1 
ATOM   5775 C  CE2   . TYR C 2 119 ? -37.864 24.546  39.206  1.00 38.20 ? 166 TYR C CE2   1 
ATOM   5776 C  CZ    . TYR C 2 119 ? -36.833 24.966  38.377  1.00 38.27 ? 166 TYR C CZ    1 
ATOM   5777 O  OH    . TYR C 2 119 ? -36.442 26.303  38.386  1.00 38.26 ? 166 TYR C OH    1 
ATOM   5778 N  N     . THR C 2 120 ? -39.062 20.127  41.183  1.00 36.16 ? 167 THR C N     1 
ATOM   5779 C  CA    . THR C 2 120 ? -39.483 20.468  42.534  1.00 36.17 ? 167 THR C CA    1 
ATOM   5780 C  C     . THR C 2 120 ? -38.631 19.780  43.612  1.00 36.32 ? 167 THR C C     1 
ATOM   5781 O  O     . THR C 2 120 ? -38.321 20.381  44.648  1.00 36.39 ? 167 THR C O     1 
ATOM   5782 C  CB    . THR C 2 120 ? -40.943 20.048  42.783  1.00 36.21 ? 167 THR C CB    1 
ATOM   5783 O  OG1   . THR C 2 120 ? -41.778 20.639  41.788  1.00 36.41 ? 167 THR C OG1   1 
ATOM   5784 C  CG2   . THR C 2 120 ? -41.411 20.474  44.157  1.00 34.53 ? 167 THR C CG2   1 
ATOM   5785 N  N     . LEU C 2 121 ? -38.275 18.521  43.371  1.00 36.09 ? 168 LEU C N     1 
ATOM   5786 C  CA    . LEU C 2 121 ? -37.451 17.761  44.299  1.00 36.16 ? 168 LEU C CA    1 
ATOM   5787 C  C     . LEU C 2 121 ? -36.074 18.402  44.409  1.00 36.34 ? 168 LEU C C     1 
ATOM   5788 O  O     . LEU C 2 121 ? -35.562 18.619  45.518  1.00 36.45 ? 168 LEU C O     1 
ATOM   5789 C  CB    . LEU C 2 121 ? -37.338 16.289  43.874  1.00 35.96 ? 168 LEU C CB    1 
ATOM   5790 C  CG    . LEU C 2 121 ? -36.451 15.318  44.690  1.00 36.41 ? 168 LEU C CG    1 
ATOM   5791 C  CD1   . LEU C 2 121 ? -36.900 15.131  46.126  1.00 35.19 ? 168 LEU C CD1   1 
ATOM   5792 C  CD2   . LEU C 2 121 ? -36.340 13.932  43.998  1.00 36.24 ? 168 LEU C CD2   1 
ATOM   5793 N  N     . MET C 2 122 ? -35.476 18.712  43.263  1.00 36.54 ? 169 MET C N     1 
ATOM   5794 C  CA    . MET C 2 122 ? -34.164 19.357  43.249  1.00 36.56 ? 169 MET C CA    1 
ATOM   5795 C  C     . MET C 2 122 ? -34.266 20.725  43.896  1.00 36.20 ? 169 MET C C     1 
ATOM   5796 O  O     . MET C 2 122 ? -33.464 21.076  44.749  1.00 36.15 ? 169 MET C O     1 
ATOM   5797 C  CB    . MET C 2 122 ? -33.647 19.530  41.830  1.00 36.63 ? 169 MET C CB    1 
ATOM   5798 C  CG    . MET C 2 122 ? -33.060 18.281  41.203  1.00 36.76 ? 169 MET C CG    1 
ATOM   5799 S  SD    . MET C 2 122 ? -32.281 18.683  39.627  1.00 37.82 ? 169 MET C SD    1 
ATOM   5800 C  CE    . MET C 2 122 ? -33.700 19.147  38.624  1.00 35.00 ? 169 MET C CE    1 
ATOM   5801 N  N     . GLU C 2 123 ? -35.281 21.481  43.494  1.00 35.89 ? 170 GLU C N     1 
ATOM   5802 C  CA    . GLU C 2 123 ? -35.484 22.832  43.988  1.00 35.66 ? 170 GLU C CA    1 
ATOM   5803 C  C     . GLU C 2 123 ? -35.643 22.874  45.509  1.00 35.11 ? 170 GLU C C     1 
ATOM   5804 O  O     . GLU C 2 123 ? -35.011 23.677  46.177  1.00 34.67 ? 170 GLU C O     1 
ATOM   5805 C  CB    . GLU C 2 123 ? -36.732 23.454  43.336  1.00 35.74 ? 170 GLU C CB    1 
ATOM   5806 C  CG    . GLU C 2 123 ? -37.002 24.934  43.714  1.00 35.24 ? 170 GLU C CG    1 
ATOM   5807 C  CD    . GLU C 2 123 ? -38.150 25.550  42.906  1.00 36.75 ? 170 GLU C CD    1 
ATOM   5808 O  OE1   . GLU C 2 123 ? -39.145 24.814  42.642  1.00 37.58 ? 170 GLU C OE1   1 
ATOM   5809 O  OE2   . GLU C 2 123 ? -38.062 26.768  42.541  1.00 37.70 ? 170 GLU C OE2   1 
ATOM   5810 N  N     . LYS C 2 124 ? -36.510 22.014  46.041  1.00 34.78 ? 171 LYS C N     1 
ATOM   5811 C  CA    . LYS C 2 124 ? -36.853 22.052  47.460  1.00 34.48 ? 171 LYS C CA    1 
ATOM   5812 C  C     . LYS C 2 124 ? -35.784 21.447  48.385  1.00 34.24 ? 171 LYS C C     1 
ATOM   5813 O  O     . LYS C 2 124 ? -35.587 21.948  49.490  1.00 34.66 ? 171 LYS C O     1 
ATOM   5814 C  CB    . LYS C 2 124 ? -38.221 21.373  47.722  1.00 34.68 ? 171 LYS C CB    1 
ATOM   5815 C  CG    . LYS C 2 124 ? -39.457 22.287  47.531  1.00 33.89 ? 171 LYS C CG    1 
ATOM   5816 N  N     . ASP C 2 125 ? -35.106 20.384  47.951  1.00 33.90 ? 172 ASP C N     1 
ATOM   5817 C  CA    . ASP C 2 125 ? -34.178 19.640  48.821  1.00 33.77 ? 172 ASP C CA    1 
ATOM   5818 C  C     . ASP C 2 125 ? -32.684 19.871  48.524  1.00 34.08 ? 172 ASP C C     1 
ATOM   5819 O  O     . ASP C 2 125 ? -31.930 20.302  49.395  1.00 34.20 ? 172 ASP C O     1 
ATOM   5820 C  CB    . ASP C 2 125 ? -34.483 18.138  48.737  1.00 33.47 ? 172 ASP C CB    1 
ATOM   5821 C  CG    . ASP C 2 125 ? -33.692 17.311  49.749  1.00 32.43 ? 172 ASP C CG    1 
ATOM   5822 O  OD1   . ASP C 2 125 ? -33.611 17.737  50.929  1.00 30.88 ? 172 ASP C OD1   1 
ATOM   5823 O  OD2   . ASP C 2 125 ? -33.164 16.225  49.373  1.00 29.67 ? 172 ASP C OD2   1 
ATOM   5824 N  N     . SER C 2 126 ? -32.278 19.580  47.295  1.00 34.25 ? 173 SER C N     1 
ATOM   5825 C  CA    . SER C 2 126 ? -30.873 19.607  46.878  1.00 34.34 ? 173 SER C CA    1 
ATOM   5826 C  C     . SER C 2 126 ? -30.291 21.017  46.743  1.00 34.30 ? 173 SER C C     1 
ATOM   5827 O  O     . SER C 2 126 ? -29.155 21.279  47.150  1.00 34.58 ? 173 SER C O     1 
ATOM   5828 C  CB    . SER C 2 126 ? -30.740 18.895  45.522  1.00 34.42 ? 173 SER C CB    1 
ATOM   5829 O  OG    . SER C 2 126 ? -31.272 17.569  45.582  1.00 34.69 ? 173 SER C OG    1 
ATOM   5830 N  N     . TYR C 2 127 ? -31.084 21.915  46.175  1.00 33.80 ? 174 TYR C N     1 
ATOM   5831 C  CA    . TYR C 2 127 ? -30.630 23.233  45.817  1.00 33.44 ? 174 TYR C CA    1 
ATOM   5832 C  C     . TYR C 2 127 ? -30.370 24.168  46.996  1.00 33.56 ? 174 TYR C C     1 
ATOM   5833 O  O     . TYR C 2 127 ? -29.353 24.850  47.010  1.00 33.56 ? 174 TYR C O     1 
ATOM   5834 C  CB    . TYR C 2 127 ? -31.626 23.832  44.856  1.00 33.51 ? 174 TYR C CB    1 
ATOM   5835 C  CG    . TYR C 2 127 ? -31.475 25.296  44.617  1.00 33.58 ? 174 TYR C CG    1 
ATOM   5836 C  CD1   . TYR C 2 127 ? -30.415 25.792  43.869  1.00 33.15 ? 174 TYR C CD1   1 
ATOM   5837 C  CD2   . TYR C 2 127 ? -32.421 26.195  45.106  1.00 33.59 ? 174 TYR C CD2   1 
ATOM   5838 C  CE1   . TYR C 2 127 ? -30.296 27.166  43.622  1.00 33.48 ? 174 TYR C CE1   1 
ATOM   5839 C  CE2   . TYR C 2 127 ? -32.304 27.562  44.873  1.00 33.56 ? 174 TYR C CE2   1 
ATOM   5840 C  CZ    . TYR C 2 127 ? -31.244 28.037  44.128  1.00 33.32 ? 174 TYR C CZ    1 
ATOM   5841 O  OH    . TYR C 2 127 ? -31.139 29.382  43.895  1.00 33.50 ? 174 TYR C OH    1 
ATOM   5842 N  N     . PRO C 2 128 ? -31.277 24.216  47.997  1.00 33.71 ? 175 PRO C N     1 
ATOM   5843 C  CA    . PRO C 2 128 ? -30.942 25.024  49.184  1.00 33.35 ? 175 PRO C CA    1 
ATOM   5844 C  C     . PRO C 2 128 ? -29.604 24.633  49.805  1.00 33.26 ? 175 PRO C C     1 
ATOM   5845 O  O     . PRO C 2 128 ? -28.884 25.483  50.339  1.00 33.70 ? 175 PRO C O     1 
ATOM   5846 C  CB    . PRO C 2 128 ? -32.085 24.724  50.154  1.00 32.96 ? 175 PRO C CB    1 
ATOM   5847 C  CG    . PRO C 2 128 ? -33.242 24.364  49.265  1.00 33.23 ? 175 PRO C CG    1 
ATOM   5848 C  CD    . PRO C 2 128 ? -32.610 23.592  48.125  1.00 33.81 ? 175 PRO C CD    1 
ATOM   5849 N  N     . ARG C 2 129 ? -29.266 23.357  49.708  1.00 32.98 ? 176 ARG C N     1 
ATOM   5850 C  CA    . ARG C 2 129 ? -28.022 22.852  50.267  1.00 32.84 ? 176 ARG C CA    1 
ATOM   5851 C  C     . ARG C 2 129 ? -26.832 23.212  49.371  1.00 32.65 ? 176 ARG C C     1 
ATOM   5852 O  O     . ARG C 2 129 ? -25.772 23.630  49.849  1.00 32.84 ? 176 ARG C O     1 
ATOM   5853 C  CB    . ARG C 2 129 ? -28.137 21.343  50.429  1.00 32.86 ? 176 ARG C CB    1 
ATOM   5854 C  CG    . ARG C 2 129 ? -27.759 20.796  51.805  1.00 32.95 ? 176 ARG C CG    1 
ATOM   5855 C  CD    . ARG C 2 129 ? -28.529 19.510  52.132  1.00 32.05 ? 176 ARG C CD    1 
ATOM   5856 N  NE    . ARG C 2 129 ? -28.832 18.746  50.925  1.00 32.56 ? 176 ARG C NE    1 
ATOM   5857 C  CZ    . ARG C 2 129 ? -29.922 18.011  50.724  1.00 32.31 ? 176 ARG C CZ    1 
ATOM   5858 N  NH1   . ARG C 2 129 ? -30.866 17.905  51.645  1.00 32.05 ? 176 ARG C NH1   1 
ATOM   5859 N  NH2   . ARG C 2 129 ? -30.070 17.381  49.572  1.00 32.44 ? 176 ARG C NH2   1 
ATOM   5860 N  N     . PHE C 2 130 ? -27.003 23.045  48.068  1.00 32.36 ? 177 PHE C N     1 
ATOM   5861 C  CA    . PHE C 2 130 ? -25.981 23.452  47.110  1.00 32.41 ? 177 PHE C CA    1 
ATOM   5862 C  C     . PHE C 2 130 ? -25.450 24.871  47.383  1.00 32.42 ? 177 PHE C C     1 
ATOM   5863 O  O     . PHE C 2 130 ? -24.239 25.107  47.363  1.00 32.15 ? 177 PHE C O     1 
ATOM   5864 C  CB    . PHE C 2 130 ? -26.537 23.361  45.689  1.00 32.48 ? 177 PHE C CB    1 
ATOM   5865 C  CG    . PHE C 2 130 ? -25.622 23.912  44.648  1.00 32.24 ? 177 PHE C CG    1 
ATOM   5866 C  CD1   . PHE C 2 130 ? -24.353 23.388  44.478  1.00 31.91 ? 177 PHE C CD1   1 
ATOM   5867 C  CD2   . PHE C 2 130 ? -26.026 24.951  43.833  1.00 32.73 ? 177 PHE C CD2   1 
ATOM   5868 C  CE1   . PHE C 2 130 ? -23.502 23.889  43.504  1.00 32.06 ? 177 PHE C CE1   1 
ATOM   5869 C  CE2   . PHE C 2 130 ? -25.175 25.469  42.867  1.00 32.22 ? 177 PHE C CE2   1 
ATOM   5870 C  CZ    . PHE C 2 130 ? -23.914 24.932  42.701  1.00 31.89 ? 177 PHE C CZ    1 
ATOM   5871 N  N     . LEU C 2 131 ? -26.375 25.795  47.658  1.00 32.45 ? 178 LEU C N     1 
ATOM   5872 C  CA    . LEU C 2 131 ? -26.047 27.186  47.966  1.00 32.31 ? 178 LEU C CA    1 
ATOM   5873 C  C     . LEU C 2 131 ? -25.212 27.380  49.245  1.00 32.85 ? 178 LEU C C     1 
ATOM   5874 O  O     . LEU C 2 131 ? -24.607 28.443  49.419  1.00 33.05 ? 178 LEU C O     1 
ATOM   5875 C  CB    . LEU C 2 131 ? -27.327 28.009  48.097  1.00 31.93 ? 178 LEU C CB    1 
ATOM   5876 C  CG    . LEU C 2 131 ? -28.259 28.091  46.886  1.00 31.09 ? 178 LEU C CG    1 
ATOM   5877 C  CD1   . LEU C 2 131 ? -29.409 29.031  47.216  1.00 29.20 ? 178 LEU C CD1   1 
ATOM   5878 C  CD2   . LEU C 2 131 ? -27.524 28.520  45.613  1.00 28.64 ? 178 LEU C CD2   1 
ATOM   5879 N  N     . LYS C 2 132 ? -25.198 26.381  50.134  1.00 33.08 ? 179 LYS C N     1 
ATOM   5880 C  CA    . LYS C 2 132 ? -24.413 26.428  51.378  1.00 33.26 ? 179 LYS C CA    1 
ATOM   5881 C  C     . LYS C 2 132 ? -23.155 25.544  51.312  1.00 33.19 ? 179 LYS C C     1 
ATOM   5882 O  O     . LYS C 2 132 ? -22.468 25.371  52.320  1.00 32.85 ? 179 LYS C O     1 
ATOM   5883 C  CB    . LYS C 2 132 ? -25.281 26.010  52.596  1.00 33.16 ? 179 LYS C CB    1 
ATOM   5884 C  CG    . LYS C 2 132 ? -26.360 27.048  52.995  1.00 33.59 ? 179 LYS C CG    1 
ATOM   5885 C  CD    . LYS C 2 132 ? -27.125 26.658  54.261  1.00 33.28 ? 179 LYS C CD    1 
ATOM   5886 N  N     . SER C 2 133 ? -22.834 25.014  50.129  1.00 33.12 ? 180 SER C N     1 
ATOM   5887 C  CA    . SER C 2 133 ? -21.767 24.008  50.002  1.00 33.00 ? 180 SER C CA    1 
ATOM   5888 C  C     . SER C 2 133 ? -20.403 24.595  49.635  1.00 32.90 ? 180 SER C C     1 
ATOM   5889 O  O     . SER C 2 133 ? -20.315 25.672  49.069  1.00 32.93 ? 180 SER C O     1 
ATOM   5890 C  CB    . SER C 2 133 ? -22.157 22.958  48.960  1.00 32.68 ? 180 SER C CB    1 
ATOM   5891 O  OG    . SER C 2 133 ? -22.218 23.532  47.676  1.00 32.73 ? 180 SER C OG    1 
ATOM   5892 N  N     . ASP C 2 134 ? -19.348 23.856  49.953  1.00 32.98 ? 181 ASP C N     1 
ATOM   5893 C  CA    . ASP C 2 134 ? -17.995 24.226  49.581  1.00 33.12 ? 181 ASP C CA    1 
ATOM   5894 C  C     . ASP C 2 134 ? -17.870 24.463  48.064  1.00 33.31 ? 181 ASP C C     1 
ATOM   5895 O  O     . ASP C 2 134 ? -17.270 25.456  47.634  1.00 33.65 ? 181 ASP C O     1 
ATOM   5896 C  CB    . ASP C 2 134 ? -16.989 23.154  50.055  1.00 33.08 ? 181 ASP C CB    1 
ATOM   5897 C  CG    . ASP C 2 134 ? -16.732 23.178  51.594  1.00 32.93 ? 181 ASP C CG    1 
ATOM   5898 O  OD1   . ASP C 2 134 ? -17.058 24.168  52.293  1.00 30.66 ? 181 ASP C OD1   1 
ATOM   5899 O  OD2   . ASP C 2 134 ? -16.172 22.180  52.105  1.00 32.60 ? 181 ASP C OD2   1 
ATOM   5900 N  N     . ILE C 2 135 ? -18.443 23.573  47.259  1.00 33.35 ? 182 ILE C N     1 
ATOM   5901 C  CA    . ILE C 2 135 ? -18.396 23.682  45.791  1.00 33.68 ? 182 ILE C CA    1 
ATOM   5902 C  C     . ILE C 2 135 ? -18.824 25.092  45.343  1.00 33.85 ? 182 ILE C C     1 
ATOM   5903 O  O     . ILE C 2 135 ? -18.036 25.828  44.747  1.00 33.65 ? 182 ILE C O     1 
ATOM   5904 C  CB    . ILE C 2 135 ? -19.288 22.594  45.115  1.00 33.76 ? 182 ILE C CB    1 
ATOM   5905 C  CG1   . ILE C 2 135 ? -18.700 21.198  45.346  1.00 34.73 ? 182 ILE C CG1   1 
ATOM   5906 C  CG2   . ILE C 2 135 ? -19.416 22.822  43.627  1.00 34.24 ? 182 ILE C CG2   1 
ATOM   5907 C  CD1   . ILE C 2 135 ? -19.729 20.129  45.628  1.00 34.27 ? 182 ILE C CD1   1 
ATOM   5908 N  N     . TYR C 2 136 ? -20.058 25.467  45.673  1.00 33.91 ? 183 TYR C N     1 
ATOM   5909 C  CA    . TYR C 2 136 ? -20.580 26.795  45.355  1.00 33.95 ? 183 TYR C CA    1 
ATOM   5910 C  C     . TYR C 2 136 ? -19.783 27.934  46.003  1.00 34.07 ? 183 TYR C C     1 
ATOM   5911 O  O     . TYR C 2 136 ? -19.392 28.885  45.318  1.00 34.22 ? 183 TYR C O     1 
ATOM   5912 C  CB    . TYR C 2 136 ? -22.067 26.903  45.749  1.00 33.71 ? 183 TYR C CB    1 
ATOM   5913 C  CG    . TYR C 2 136 ? -22.710 28.242  45.403  1.00 33.35 ? 183 TYR C CG    1 
ATOM   5914 C  CD1   . TYR C 2 136 ? -22.873 28.634  44.080  1.00 33.88 ? 183 TYR C CD1   1 
ATOM   5915 C  CD2   . TYR C 2 136 ? -23.156 29.112  46.395  1.00 33.19 ? 183 TYR C CD2   1 
ATOM   5916 C  CE1   . TYR C 2 136 ? -23.454 29.859  43.747  1.00 32.88 ? 183 TYR C CE1   1 
ATOM   5917 C  CE2   . TYR C 2 136 ? -23.737 30.332  46.075  1.00 32.84 ? 183 TYR C CE2   1 
ATOM   5918 C  CZ    . TYR C 2 136 ? -23.880 30.701  44.747  1.00 33.02 ? 183 TYR C CZ    1 
ATOM   5919 O  OH    . TYR C 2 136 ? -24.451 31.910  44.410  1.00 32.53 ? 183 TYR C OH    1 
ATOM   5920 N  N     . LEU C 2 137 ? -19.546 27.856  47.308  1.00 34.29 ? 184 LEU C N     1 
ATOM   5921 C  CA    . LEU C 2 137 ? -18.871 28.969  48.021  1.00 34.60 ? 184 LEU C CA    1 
ATOM   5922 C  C     . LEU C 2 137 ? -17.421 29.163  47.580  1.00 34.63 ? 184 LEU C C     1 
ATOM   5923 O  O     . LEU C 2 137 ? -16.960 30.301  47.438  1.00 34.64 ? 184 LEU C O     1 
ATOM   5924 C  CB    . LEU C 2 137 ? -18.954 28.798  49.545  1.00 34.62 ? 184 LEU C CB    1 
ATOM   5925 C  CG    . LEU C 2 137 ? -20.395 28.792  50.090  1.00 34.86 ? 184 LEU C CG    1 
ATOM   5926 C  CD1   . LEU C 2 137 ? -20.408 28.593  51.617  1.00 34.23 ? 184 LEU C CD1   1 
ATOM   5927 C  CD2   . LEU C 2 137 ? -21.169 30.065  49.659  1.00 33.78 ? 184 LEU C CD2   1 
ATOM   5928 N  N     . ASN C 2 138 ? -16.711 28.061  47.355  1.00 34.74 ? 185 ASN C N     1 
ATOM   5929 C  CA    . ASN C 2 138 ? -15.352 28.132  46.825  1.00 34.88 ? 185 ASN C CA    1 
ATOM   5930 C  C     . ASN C 2 138 ? -15.301 28.733  45.427  1.00 35.00 ? 185 ASN C C     1 
ATOM   5931 O  O     . ASN C 2 138 ? -14.381 29.484  45.119  1.00 35.41 ? 185 ASN C O     1 
ATOM   5932 C  CB    . ASN C 2 138 ? -14.677 26.757  46.840  1.00 34.98 ? 185 ASN C CB    1 
ATOM   5933 C  CG    . ASN C 2 138 ? -14.256 26.338  48.231  1.00 34.78 ? 185 ASN C CG    1 
ATOM   5934 O  OD1   . ASN C 2 138 ? -13.859 27.176  49.043  1.00 34.65 ? 185 ASN C OD1   1 
ATOM   5935 N  ND2   . ASN C 2 138 ? -14.335 25.042  48.514  1.00 34.15 ? 185 ASN C ND2   1 
ATOM   5936 N  N     . LEU C 2 139 ? -16.280 28.413  44.585  1.00 35.10 ? 186 LEU C N     1 
ATOM   5937 C  CA    . LEU C 2 139 ? -16.356 29.024  43.262  1.00 35.37 ? 186 LEU C CA    1 
ATOM   5938 C  C     . LEU C 2 139 ? -16.580 30.525  43.405  1.00 35.70 ? 186 LEU C C     1 
ATOM   5939 O  O     . LEU C 2 139 ? -15.829 31.340  42.856  1.00 35.63 ? 186 LEU C O     1 
ATOM   5940 C  CB    . LEU C 2 139 ? -17.482 28.439  42.402  1.00 35.16 ? 186 LEU C CB    1 
ATOM   5941 C  CG    . LEU C 2 139 ? -17.525 29.067  40.990  1.00 35.34 ? 186 LEU C CG    1 
ATOM   5942 C  CD1   . LEU C 2 139 ? -16.528 28.392  40.059  1.00 35.44 ? 186 LEU C CD1   1 
ATOM   5943 C  CD2   . LEU C 2 139 ? -18.913 29.063  40.380  1.00 35.33 ? 186 LEU C CD2   1 
ATOM   5944 N  N     . LEU C 2 140 ? -17.627 30.876  44.144  1.00 36.01 ? 187 LEU C N     1 
ATOM   5945 C  CA    . LEU C 2 140 ? -18.017 32.269  44.305  1.00 36.18 ? 187 LEU C CA    1 
ATOM   5946 C  C     . LEU C 2 140 ? -16.882 33.099  44.902  1.00 36.43 ? 187 LEU C C     1 
ATOM   5947 O  O     . LEU C 2 140 ? -16.575 34.165  44.384  1.00 36.77 ? 187 LEU C O     1 
ATOM   5948 C  CB    . LEU C 2 140 ? -19.296 32.386  45.145  1.00 36.17 ? 187 LEU C CB    1 
ATOM   5949 C  CG    . LEU C 2 140 ? -19.819 33.785  45.479  1.00 36.15 ? 187 LEU C CG    1 
ATOM   5950 C  CD1   . LEU C 2 140 ? -19.800 34.705  44.262  1.00 36.53 ? 187 LEU C CD1   1 
ATOM   5951 C  CD2   . LEU C 2 140 ? -21.212 33.715  46.068  1.00 35.90 ? 187 LEU C CD2   1 
ATOM   5952 N  N     . ASN C 2 141 ? -16.243 32.601  45.959  1.00 36.82 ? 188 ASN C N     1 
ATOM   5953 C  CA    . ASN C 2 141 ? -15.217 33.372  46.672  1.00 37.12 ? 188 ASN C CA    1 
ATOM   5954 C  C     . ASN C 2 141 ? -13.898 33.494  45.924  1.00 37.37 ? 188 ASN C C     1 
ATOM   5955 O  O     . ASN C 2 141 ? -13.200 34.483  46.101  1.00 37.20 ? 188 ASN C O     1 
ATOM   5956 C  CB    . ASN C 2 141 ? -14.955 32.787  48.063  1.00 37.11 ? 188 ASN C CB    1 
ATOM   5957 N  N     . ASP C 2 142 ? -13.549 32.515  45.089  1.00 37.88 ? 189 ASP C N     1 
ATOM   5958 C  CA    . ASP C 2 142 ? -12.275 32.607  44.364  1.00 38.32 ? 189 ASP C CA    1 
ATOM   5959 C  C     . ASP C 2 142 ? -12.353 33.531  43.131  1.00 38.48 ? 189 ASP C C     1 
ATOM   5960 O  O     . ASP C 2 142 ? -11.305 33.910  42.584  1.00 38.74 ? 189 ASP C O     1 
ATOM   5961 C  CB    . ASP C 2 142 ? -11.630 31.235  44.073  1.00 38.60 ? 189 ASP C CB    1 
ATOM   5962 C  CG    . ASP C 2 142 ? -12.412 30.394  43.103  1.00 39.62 ? 189 ASP C CG    1 
ATOM   5963 O  OD1   . ASP C 2 142 ? -13.172 30.957  42.290  1.00 42.31 ? 189 ASP C OD1   1 
ATOM   5964 O  OD2   . ASP C 2 142 ? -12.250 29.155  43.156  1.00 39.81 ? 189 ASP C OD2   1 
ATOM   5965 N  N     . LEU C 2 143 ? -13.565 33.937  42.727  1.00 38.56 ? 190 LEU C N     1 
ATOM   5966 C  CA    . LEU C 2 143 ? -13.720 34.912  41.624  1.00 38.69 ? 190 LEU C CA    1 
ATOM   5967 C  C     . LEU C 2 143 ? -13.756 36.384  42.077  1.00 38.87 ? 190 LEU C C     1 
ATOM   5968 O  O     . LEU C 2 143 ? -13.863 37.288  41.237  1.00 39.14 ? 190 LEU C O     1 
ATOM   5969 C  CB    . LEU C 2 143 ? -14.959 34.603  40.774  1.00 38.65 ? 190 LEU C CB    1 
ATOM   5970 C  CG    . LEU C 2 143 ? -14.984 33.274  40.002  1.00 38.79 ? 190 LEU C CG    1 
ATOM   5971 C  CD1   . LEU C 2 143 ? -16.012 33.353  38.887  1.00 38.78 ? 190 LEU C CD1   1 
ATOM   5972 C  CD2   . LEU C 2 143 ? -13.620 32.868  39.433  1.00 37.99 ? 190 LEU C CD2   1 
ATOM   5973 N  N     . GLN C 2 144 ? -13.624 36.630  43.381  1.00 38.93 ? 191 GLN C N     1 
ATOM   5974 C  CA    . GLN C 2 144 ? -13.705 37.987  43.931  1.00 38.87 ? 191 GLN C CA    1 
ATOM   5975 C  C     . GLN C 2 144 ? -12.366 38.392  44.555  1.00 38.75 ? 191 GLN C C     1 
ATOM   5976 O  O     . GLN C 2 144 ? -11.633 39.260  43.940  1.00 38.69 ? 191 GLN C O     1 
ATOM   5977 C  CB    . GLN C 2 144 ? -14.837 38.065  44.973  1.00 38.96 ? 191 GLN C CB    1 
ATOM   5978 C  CG    . GLN C 2 144 ? -16.174 37.424  44.526  1.00 38.95 ? 191 GLN C CG    1 
ATOM   5979 C  CD    . GLN C 2 144 ? -17.233 37.365  45.644  1.00 39.02 ? 191 GLN C CD    1 
ATOM   5980 O  OE1   . GLN C 2 144 ? -17.753 38.391  46.071  1.00 39.73 ? 191 GLN C OE1   1 
ATOM   5981 N  NE2   . GLN C 2 144 ? -17.561 36.160  46.100  1.00 38.33 ? 191 GLN C NE2   1 
ATOM   5982 N  N     . VAL D 2 13  ? -15.721 44.052  -3.805  1.00 37.46 ? 60  VAL D N     1 
ATOM   5983 C  CA    . VAL D 2 13  ? -14.847 44.635  -2.738  1.00 37.43 ? 60  VAL D CA    1 
ATOM   5984 C  C     . VAL D 2 13  ? -14.770 43.714  -1.508  1.00 37.48 ? 60  VAL D C     1 
ATOM   5985 O  O     . VAL D 2 13  ? -15.466 42.696  -1.439  1.00 37.31 ? 60  VAL D O     1 
ATOM   5986 C  CB    . VAL D 2 13  ? -15.347 46.045  -2.334  1.00 37.41 ? 60  VAL D CB    1 
ATOM   5987 C  CG1   . VAL D 2 13  ? -15.189 46.986  -3.531  1.00 37.35 ? 60  VAL D CG1   1 
ATOM   5988 C  CG2   . VAL D 2 13  ? -16.828 45.987  -1.860  1.00 37.14 ? 60  VAL D CG2   1 
ATOM   5989 N  N     . LEU D 2 14  ? -13.920 44.075  -0.544  1.00 37.67 ? 61  LEU D N     1 
ATOM   5990 C  CA    . LEU D 2 14  ? -13.627 43.223  0.626   1.00 37.85 ? 61  LEU D CA    1 
ATOM   5991 C  C     . LEU D 2 14  ? -14.659 43.393  1.750   1.00 37.95 ? 61  LEU D C     1 
ATOM   5992 O  O     . LEU D 2 14  ? -15.030 44.522  2.092   1.00 38.29 ? 61  LEU D O     1 
ATOM   5993 C  CB    . LEU D 2 14  ? -12.236 43.546  1.176   1.00 37.80 ? 61  LEU D CB    1 
ATOM   5994 C  CG    . LEU D 2 14  ? -11.767 42.643  2.340   1.00 37.98 ? 61  LEU D CG    1 
ATOM   5995 C  CD1   . LEU D 2 14  ? -11.577 41.191  1.825   1.00 38.43 ? 61  LEU D CD1   1 
ATOM   5996 C  CD2   . LEU D 2 14  ? -10.468 43.191  2.927   1.00 37.75 ? 61  LEU D CD2   1 
ATOM   5997 N  N     . SER D 2 15  ? -15.085 42.275  2.343   1.00 37.80 ? 62  SER D N     1 
ATOM   5998 C  CA    . SER D 2 15  ? -16.212 42.268  3.293   1.00 37.49 ? 62  SER D CA    1 
ATOM   5999 C  C     . SER D 2 15  ? -15.754 42.326  4.753   1.00 37.47 ? 62  SER D C     1 
ATOM   6000 O  O     . SER D 2 15  ? -14.556 42.359  5.038   1.00 37.36 ? 62  SER D O     1 
ATOM   6001 C  CB    . SER D 2 15  ? -17.053 41.008  3.085   1.00 37.32 ? 62  SER D CB    1 
ATOM   6002 O  OG    . SER D 2 15  ? -16.904 40.518  1.762   1.00 37.30 ? 62  SER D OG    1 
ATOM   6003 N  N     . ALA D 2 16  ? -16.724 42.343  5.669   1.00 37.36 ? 63  ALA D N     1 
ATOM   6004 C  CA    . ALA D 2 16  ? -16.453 42.197  7.102   1.00 37.17 ? 63  ALA D CA    1 
ATOM   6005 C  C     . ALA D 2 16  ? -16.460 40.711  7.460   1.00 37.13 ? 63  ALA D C     1 
ATOM   6006 O  O     . ALA D 2 16  ? -15.459 40.185  7.954   1.00 37.04 ? 63  ALA D O     1 
ATOM   6007 C  CB    . ALA D 2 16  ? -17.483 42.955  7.933   1.00 37.13 ? 63  ALA D CB    1 
ATOM   6008 N  N     . ALA D 2 17  ? -17.581 40.034  7.200   1.00 37.03 ? 64  ALA D N     1 
ATOM   6009 C  CA    . ALA D 2 17  ? -17.674 38.578  7.388   1.00 37.03 ? 64  ALA D CA    1 
ATOM   6010 C  C     . ALA D 2 17  ? -16.376 37.892  6.940   1.00 37.05 ? 64  ALA D C     1 
ATOM   6011 O  O     . ALA D 2 17  ? -15.786 37.096  7.676   1.00 36.77 ? 64  ALA D O     1 
ATOM   6012 C  CB    . ALA D 2 17  ? -18.861 38.017  6.614   1.00 36.91 ? 64  ALA D CB    1 
ATOM   6013 N  N     . GLU D 2 18  ? -15.960 38.240  5.721   1.00 37.05 ? 65  GLU D N     1 
ATOM   6014 C  CA    . GLU D 2 18  ? -14.712 37.802  5.094   1.00 36.94 ? 65  GLU D CA    1 
ATOM   6015 C  C     . GLU D 2 18  ? -13.486 37.902  6.019   1.00 36.83 ? 65  GLU D C     1 
ATOM   6016 O  O     . GLU D 2 18  ? -12.677 36.969  6.108   1.00 36.76 ? 65  GLU D O     1 
ATOM   6017 C  CB    . GLU D 2 18  ? -14.500 38.641  3.819   1.00 36.98 ? 65  GLU D CB    1 
ATOM   6018 C  CG    . GLU D 2 18  ? -13.184 38.441  3.079   1.00 37.43 ? 65  GLU D CG    1 
ATOM   6019 C  CD    . GLU D 2 18  ? -12.947 37.007  2.662   1.00 37.99 ? 65  GLU D CD    1 
ATOM   6020 O  OE1   . GLU D 2 18  ? -13.691 36.527  1.777   1.00 37.47 ? 65  GLU D OE1   1 
ATOM   6021 O  OE2   . GLU D 2 18  ? -12.009 36.369  3.210   1.00 38.66 ? 65  GLU D OE2   1 
ATOM   6022 N  N     . VAL D 2 19  ? -13.346 39.035  6.695   1.00 36.58 ? 66  VAL D N     1 
ATOM   6023 C  CA    . VAL D 2 19  ? -12.220 39.247  7.594   1.00 36.32 ? 66  VAL D CA    1 
ATOM   6024 C  C     . VAL D 2 19  ? -12.348 38.384  8.844   1.00 36.14 ? 66  VAL D C     1 
ATOM   6025 O  O     . VAL D 2 19  ? -11.351 37.858  9.324   1.00 36.64 ? 66  VAL D O     1 
ATOM   6026 C  CB    . VAL D 2 19  ? -12.069 40.731  7.989   1.00 36.29 ? 66  VAL D CB    1 
ATOM   6027 C  CG1   . VAL D 2 19  ? -11.244 40.870  9.258   1.00 36.61 ? 66  VAL D CG1   1 
ATOM   6028 C  CG2   . VAL D 2 19  ? -11.431 41.516  6.855   1.00 36.10 ? 66  VAL D CG2   1 
ATOM   6029 N  N     . MET D 2 20  ? -13.564 38.241  9.366   1.00 35.81 ? 67  MET D N     1 
ATOM   6030 C  CA    . MET D 2 20  ? -13.817 37.388  10.531  1.00 35.53 ? 67  MET D CA    1 
ATOM   6031 C  C     . MET D 2 20  ? -13.479 35.931  10.230  1.00 35.39 ? 67  MET D C     1 
ATOM   6032 O  O     . MET D 2 20  ? -12.971 35.214  11.099  1.00 35.33 ? 67  MET D O     1 
ATOM   6033 C  CB    . MET D 2 20  ? -15.278 37.496  10.977  1.00 35.58 ? 67  MET D CB    1 
ATOM   6034 N  N     . GLN D 2 21  ? -13.746 35.503  8.995   1.00 35.25 ? 68  GLN D N     1 
ATOM   6035 C  CA    . GLN D 2 21  ? -13.413 34.144  8.549   1.00 35.15 ? 68  GLN D CA    1 
ATOM   6036 C  C     . GLN D 2 21  ? -11.908 33.900  8.491   1.00 34.99 ? 68  GLN D C     1 
ATOM   6037 O  O     . GLN D 2 21  ? -11.474 32.751  8.401   1.00 35.03 ? 68  GLN D O     1 
ATOM   6038 C  CB    . GLN D 2 21  ? -14.025 33.844  7.181   1.00 35.10 ? 68  GLN D CB    1 
ATOM   6039 C  CG    . GLN D 2 21  ? -15.520 33.642  7.211   1.00 35.44 ? 68  GLN D CG    1 
ATOM   6040 C  CD    . GLN D 2 21  ? -16.117 33.558  5.821   1.00 35.87 ? 68  GLN D CD    1 
ATOM   6041 O  OE1   . GLN D 2 21  ? -15.425 33.184  4.864   1.00 35.63 ? 68  GLN D OE1   1 
ATOM   6042 N  NE2   . GLN D 2 21  ? -17.409 33.911  5.698   1.00 35.16 ? 68  GLN D NE2   1 
ATOM   6043 N  N     . TRP D 2 22  ? -11.116 34.971  8.531   1.00 34.76 ? 69  TRP D N     1 
ATOM   6044 C  CA    . TRP D 2 22  ? -9.663  34.830  8.631   1.00 34.72 ? 69  TRP D CA    1 
ATOM   6045 C  C     . TRP D 2 22  ? -9.212  34.226  9.980   1.00 34.69 ? 69  TRP D C     1 
ATOM   6046 O  O     . TRP D 2 22  ? -8.134  33.638  10.060  1.00 34.44 ? 69  TRP D O     1 
ATOM   6047 C  CB    . TRP D 2 22  ? -8.949  36.163  8.350   1.00 34.74 ? 69  TRP D CB    1 
ATOM   6048 C  CG    . TRP D 2 22  ? -9.091  36.658  6.929   1.00 34.71 ? 69  TRP D CG    1 
ATOM   6049 C  CD1   . TRP D 2 22  ? -9.549  35.952  5.855   1.00 34.80 ? 69  TRP D CD1   1 
ATOM   6050 C  CD2   . TRP D 2 22  ? -8.725  37.951  6.427   1.00 34.70 ? 69  TRP D CD2   1 
ATOM   6051 N  NE1   . TRP D 2 22  ? -9.518  36.731  4.723   1.00 35.07 ? 69  TRP D NE1   1 
ATOM   6052 C  CE2   . TRP D 2 22  ? -9.011  37.961  5.044   1.00 35.03 ? 69  TRP D CE2   1 
ATOM   6053 C  CE3   . TRP D 2 22  ? -8.192  39.102  7.011   1.00 34.88 ? 69  TRP D CE3   1 
ATOM   6054 C  CZ2   . TRP D 2 22  ? -8.785  39.081  4.236   1.00 34.86 ? 69  TRP D CZ2   1 
ATOM   6055 C  CZ3   . TRP D 2 22  ? -7.970  40.219  6.205   1.00 34.92 ? 69  TRP D CZ3   1 
ATOM   6056 C  CH2   . TRP D 2 22  ? -8.266  40.197  4.835   1.00 34.75 ? 69  TRP D CH2   1 
ATOM   6057 N  N     . SER D 2 23  ? -10.038 34.355  11.021  1.00 34.70 ? 70  SER D N     1 
ATOM   6058 C  CA    . SER D 2 23  ? -9.748  33.739  12.315  1.00 34.64 ? 70  SER D CA    1 
ATOM   6059 C  C     . SER D 2 23  ? -10.053 32.241  12.333  1.00 34.99 ? 70  SER D C     1 
ATOM   6060 O  O     . SER D 2 23  ? -9.640  31.553  13.259  1.00 35.01 ? 70  SER D O     1 
ATOM   6061 C  CB    . SER D 2 23  ? -10.508 34.456  13.444  1.00 34.61 ? 70  SER D CB    1 
ATOM   6062 O  OG    . SER D 2 23  ? -11.862 34.064  13.507  1.00 33.77 ? 70  SER D OG    1 
ATOM   6063 N  N     . GLN D 2 24  ? -10.770 31.740  11.325  1.00 35.45 ? 71  GLN D N     1 
ATOM   6064 C  CA    . GLN D 2 24  ? -11.069 30.309  11.230  1.00 35.79 ? 71  GLN D CA    1 
ATOM   6065 C  C     . GLN D 2 24  ? -9.806  29.497  10.991  1.00 36.01 ? 71  GLN D C     1 
ATOM   6066 O  O     . GLN D 2 24  ? -9.593  28.482  11.650  1.00 36.09 ? 71  GLN D O     1 
ATOM   6067 C  CB    . GLN D 2 24  ? -12.054 30.018  10.091  1.00 35.96 ? 71  GLN D CB    1 
ATOM   6068 C  CG    . GLN D 2 24  ? -13.509 30.389  10.369  1.00 36.54 ? 71  GLN D CG    1 
ATOM   6069 C  CD    . GLN D 2 24  ? -14.336 29.225  10.917  1.00 36.80 ? 71  GLN D CD    1 
ATOM   6070 O  OE1   . GLN D 2 24  ? -14.121 28.751  12.038  1.00 36.77 ? 71  GLN D OE1   1 
ATOM   6071 N  NE2   . GLN D 2 24  ? -15.295 28.771  10.126  1.00 36.83 ? 71  GLN D NE2   1 
ATOM   6072 N  N     . SER D 2 25  ? -8.983  29.933  10.036  1.00 36.33 ? 72  SER D N     1 
ATOM   6073 C  CA    . SER D 2 25  ? -7.760  29.203  9.681   1.00 36.70 ? 72  SER D CA    1 
ATOM   6074 C  C     . SER D 2 25  ? -6.763  30.050  8.901   1.00 36.87 ? 72  SER D C     1 
ATOM   6075 O  O     . SER D 2 25  ? -7.140  31.049  8.283   1.00 36.81 ? 72  SER D O     1 
ATOM   6076 C  CB    . SER D 2 25  ? -8.103  27.963  8.844   1.00 37.00 ? 72  SER D CB    1 
ATOM   6077 O  OG    . SER D 2 25  ? -8.662  28.306  7.574   1.00 37.30 ? 72  SER D OG    1 
ATOM   6078 N  N     . LEU D 2 26  ? -5.494  29.636  8.930   1.00 37.05 ? 73  LEU D N     1 
ATOM   6079 C  CA    . LEU D 2 26  ? -4.452  30.282  8.136   1.00 37.16 ? 73  LEU D CA    1 
ATOM   6080 C  C     . LEU D 2 26  ? -4.718  30.082  6.652   1.00 37.56 ? 73  LEU D C     1 
ATOM   6081 O  O     . LEU D 2 26  ? -4.404  30.958  5.861   1.00 37.60 ? 73  LEU D O     1 
ATOM   6082 C  CB    . LEU D 2 26  ? -3.059  29.740  8.497   1.00 37.17 ? 73  LEU D CB    1 
ATOM   6083 C  CG    . LEU D 2 26  ? -1.843  30.323  7.752   1.00 37.01 ? 73  LEU D CG    1 
ATOM   6084 C  CD1   . LEU D 2 26  ? -1.738  31.830  7.919   1.00 36.54 ? 73  LEU D CD1   1 
ATOM   6085 C  CD2   . LEU D 2 26  ? -0.563  29.684  8.220   1.00 36.98 ? 73  LEU D CD2   1 
ATOM   6086 N  N     . GLU D 2 27  ? -5.285  28.930  6.286   1.00 37.85 ? 74  GLU D N     1 
ATOM   6087 C  CA    . GLU D 2 27  ? -5.619  28.621  4.897   1.00 38.19 ? 74  GLU D CA    1 
ATOM   6088 C  C     . GLU D 2 27  ? -6.644  29.610  4.335   1.00 38.46 ? 74  GLU D C     1 
ATOM   6089 O  O     . GLU D 2 27  ? -6.534  30.055  3.177   1.00 38.20 ? 74  GLU D O     1 
ATOM   6090 C  CB    . GLU D 2 27  ? -6.151  27.182  4.790   1.00 38.36 ? 74  GLU D CB    1 
ATOM   6091 C  CG    . GLU D 2 27  ? -6.715  26.793  3.409   1.00 38.51 ? 74  GLU D CG    1 
ATOM   6092 C  CD    . GLU D 2 27  ? -6.857  25.289  3.222   1.00 38.40 ? 74  GLU D CD    1 
ATOM   6093 O  OE1   . GLU D 2 27  ? -5.873  24.562  3.469   1.00 39.84 ? 74  GLU D OE1   1 
ATOM   6094 O  OE2   . GLU D 2 27  ? -7.944  24.835  2.815   1.00 38.19 ? 74  GLU D OE2   1 
ATOM   6095 N  N     . LYS D 2 28  ? -7.642  29.942  5.152   1.00 38.72 ? 75  LYS D N     1 
ATOM   6096 C  CA    . LYS D 2 28  ? -8.662  30.911  4.753   1.00 39.03 ? 75  LYS D CA    1 
ATOM   6097 C  C     . LYS D 2 28  ? -8.062  32.312  4.638   1.00 39.17 ? 75  LYS D C     1 
ATOM   6098 O  O     . LYS D 2 28  ? -8.431  33.071  3.745   1.00 39.23 ? 75  LYS D O     1 
ATOM   6099 C  CB    . LYS D 2 28  ? -9.855  30.890  5.719   1.00 39.09 ? 75  LYS D CB    1 
ATOM   6100 C  CG    . LYS D 2 28  ? -10.825 29.725  5.474   1.00 39.21 ? 75  LYS D CG    1 
ATOM   6101 N  N     . LEU D 2 29  ? -7.121  32.641  5.522   1.00 39.39 ? 76  LEU D N     1 
ATOM   6102 C  CA    . LEU D 2 29  ? -6.442  33.942  5.470   1.00 39.46 ? 76  LEU D CA    1 
ATOM   6103 C  C     . LEU D 2 29  ? -5.588  34.087  4.205   1.00 39.58 ? 76  LEU D C     1 
ATOM   6104 O  O     . LEU D 2 29  ? -5.617  35.138  3.550   1.00 39.75 ? 76  LEU D O     1 
ATOM   6105 C  CB    . LEU D 2 29  ? -5.592  34.165  6.731   1.00 39.51 ? 76  LEU D CB    1 
ATOM   6106 C  CG    . LEU D 2 29  ? -4.766  35.457  6.826   1.00 39.50 ? 76  LEU D CG    1 
ATOM   6107 C  CD1   . LEU D 2 29  ? -5.596  36.681  6.454   1.00 39.61 ? 76  LEU D CD1   1 
ATOM   6108 C  CD2   . LEU D 2 29  ? -4.181  35.612  8.226   1.00 39.31 ? 76  LEU D CD2   1 
ATOM   6109 N  N     . LEU D 2 30  ? -4.863  33.025  3.852   1.00 39.54 ? 77  LEU D N     1 
ATOM   6110 C  CA    . LEU D 2 30  ? -4.001  33.024  2.670   1.00 39.65 ? 77  LEU D CA    1 
ATOM   6111 C  C     . LEU D 2 30  ? -4.724  32.638  1.381   1.00 39.80 ? 77  LEU D C     1 
ATOM   6112 O  O     . LEU D 2 30  ? -4.114  32.660  0.317   1.00 39.80 ? 77  LEU D O     1 
ATOM   6113 C  CB    . LEU D 2 30  ? -2.807  32.087  2.873   1.00 39.55 ? 77  LEU D CB    1 
ATOM   6114 C  CG    . LEU D 2 30  ? -1.837  32.461  3.997   1.00 39.90 ? 77  LEU D CG    1 
ATOM   6115 C  CD1   . LEU D 2 30  ? -0.602  31.569  3.963   1.00 39.60 ? 77  LEU D CD1   1 
ATOM   6116 C  CD2   . LEU D 2 30  ? -1.435  33.911  3.902   1.00 39.79 ? 77  LEU D CD2   1 
ATOM   6117 N  N     . ALA D 2 31  ? -6.001  32.272  1.468   1.00 40.06 ? 78  ALA D N     1 
ATOM   6118 C  CA    . ALA D 2 31  ? -6.780  31.941  0.271   1.00 40.44 ? 78  ALA D CA    1 
ATOM   6119 C  C     . ALA D 2 31  ? -6.828  33.106  -0.711  1.00 40.64 ? 78  ALA D C     1 
ATOM   6120 O  O     . ALA D 2 31  ? -6.706  32.894  -1.916  1.00 40.68 ? 78  ALA D O     1 
ATOM   6121 C  CB    . ALA D 2 31  ? -8.207  31.505  0.634   1.00 40.41 ? 78  ALA D CB    1 
ATOM   6122 N  N     . ASN D 2 32  ? -6.996  34.331  -0.210  1.00 40.84 ? 79  ASN D N     1 
ATOM   6123 C  CA    . ASN D 2 32  ? -7.150  35.483  -1.122  1.00 41.10 ? 79  ASN D CA    1 
ATOM   6124 C  C     . ASN D 2 32  ? -6.017  36.488  -1.020  1.00 40.85 ? 79  ASN D C     1 
ATOM   6125 O  O     . ASN D 2 32  ? -5.334  36.567  -0.009  1.00 41.15 ? 79  ASN D O     1 
ATOM   6126 C  CB    . ASN D 2 32  ? -8.552  36.146  -1.110  1.00 41.25 ? 79  ASN D CB    1 
ATOM   6127 C  CG    . ASN D 2 32  ? -9.140  36.328  0.280   1.00 42.05 ? 79  ASN D CG    1 
ATOM   6128 O  OD1   . ASN D 2 32  ? -10.364 36.246  0.441   1.00 42.47 ? 79  ASN D OD1   1 
ATOM   6129 N  ND2   . ASN D 2 32  ? -8.296  36.602  1.278   1.00 41.32 ? 79  ASN D ND2   1 
ATOM   6130 N  N     . GLN D 2 33  ? -5.826  37.248  -2.093  1.00 40.69 ? 80  GLN D N     1 
ATOM   6131 C  CA    . GLN D 2 33  ? -4.674  38.155  -2.210  1.00 40.58 ? 80  GLN D CA    1 
ATOM   6132 C  C     . GLN D 2 33  ? -4.748  39.346  -1.241  1.00 40.20 ? 80  GLN D C     1 
ATOM   6133 O  O     . GLN D 2 33  ? -3.708  39.868  -0.833  1.00 40.06 ? 80  GLN D O     1 
ATOM   6134 C  CB    . GLN D 2 33  ? -4.443  38.617  -3.664  1.00 40.58 ? 80  GLN D CB    1 
ATOM   6135 C  CG    . GLN D 2 33  ? -4.869  40.049  -4.008  1.00 41.00 ? 80  GLN D CG    1 
ATOM   6136 C  CD    . GLN D 2 33  ? -4.726  40.351  -5.503  1.00 41.27 ? 80  GLN D CD    1 
ATOM   6137 O  OE1   . GLN D 2 33  ? -3.770  39.911  -6.143  1.00 42.75 ? 80  GLN D OE1   1 
ATOM   6138 N  NE2   . GLN D 2 33  ? -5.680  41.099  -6.061  1.00 40.38 ? 80  GLN D NE2   1 
ATOM   6139 N  N     . THR D 2 34  ? -5.958  39.768  -0.869  1.00 39.63 ? 81  THR D N     1 
ATOM   6140 C  CA    . THR D 2 34  ? -6.119  40.802  0.152   1.00 39.19 ? 81  THR D CA    1 
ATOM   6141 C  C     . THR D 2 34  ? -5.549  40.357  1.502   1.00 38.89 ? 81  THR D C     1 
ATOM   6142 O  O     . THR D 2 34  ? -4.737  41.058  2.111   1.00 38.65 ? 81  THR D O     1 
ATOM   6143 C  CB    . THR D 2 34  ? -7.595  41.155  0.351   1.00 39.04 ? 81  THR D CB    1 
ATOM   6144 O  OG1   . THR D 2 34  ? -8.111  41.734  -0.852  1.00 38.80 ? 81  THR D OG1   1 
ATOM   6145 C  CG2   . THR D 2 34  ? -7.758  42.143  1.504   1.00 38.74 ? 81  THR D CG2   1 
ATOM   6146 N  N     . GLY D 2 35  ? -5.996  39.192  1.963   1.00 38.59 ? 82  GLY D N     1 
ATOM   6147 C  CA    . GLY D 2 35  ? -5.546  38.630  3.237   1.00 38.31 ? 82  GLY D CA    1 
ATOM   6148 C  C     . GLY D 2 35  ? -4.048  38.406  3.268   1.00 37.96 ? 82  GLY D C     1 
ATOM   6149 O  O     . GLY D 2 35  ? -3.412  38.650  4.283   1.00 37.94 ? 82  GLY D O     1 
ATOM   6150 N  N     . GLN D 2 36  ? -3.500  37.940  2.147   1.00 37.59 ? 83  GLN D N     1 
ATOM   6151 C  CA    . GLN D 2 36  ? -2.060  37.798  1.964   1.00 37.19 ? 83  GLN D CA    1 
ATOM   6152 C  C     . GLN D 2 36  ? -1.343  39.110  2.247   1.00 36.77 ? 83  GLN D C     1 
ATOM   6153 O  O     . GLN D 2 36  ? -0.407  39.139  3.027   1.00 36.87 ? 83  GLN D O     1 
ATOM   6154 C  CB    . GLN D 2 36  ? -1.752  37.314  0.543   1.00 37.16 ? 83  GLN D CB    1 
ATOM   6155 C  CG    . GLN D 2 36  ? -2.164  35.865  0.297   1.00 36.91 ? 83  GLN D CG    1 
ATOM   6156 C  CD    . GLN D 2 36  ? -2.158  35.475  -1.166  1.00 36.61 ? 83  GLN D CD    1 
ATOM   6157 O  OE1   . GLN D 2 36  ? -1.345  35.963  -1.953  1.00 37.00 ? 83  GLN D OE1   1 
ATOM   6158 N  NE2   . GLN D 2 36  ? -3.066  34.582  -1.538  1.00 36.27 ? 83  GLN D NE2   1 
ATOM   6159 N  N     . ASN D 2 37  ? -1.793  40.186  1.612   1.00 36.59 ? 84  ASN D N     1 
ATOM   6160 C  CA    . ASN D 2 37  ? -1.230  41.522  1.827   1.00 36.41 ? 84  ASN D CA    1 
ATOM   6161 C  C     . ASN D 2 37  ? -1.267  41.961  3.290   1.00 36.07 ? 84  ASN D C     1 
ATOM   6162 O  O     . ASN D 2 37  ? -0.280  42.498  3.800   1.00 36.19 ? 84  ASN D O     1 
ATOM   6163 C  CB    . ASN D 2 37  ? -1.972  42.582  0.990   1.00 36.44 ? 84  ASN D CB    1 
ATOM   6164 C  CG    . ASN D 2 37  ? -1.642  42.513  -0.494  1.00 36.70 ? 84  ASN D CG    1 
ATOM   6165 O  OD1   . ASN D 2 37  ? -0.545  42.130  -0.885  1.00 37.67 ? 84  ASN D OD1   1 
ATOM   6166 N  ND2   . ASN D 2 37  ? -2.593  42.913  -1.326  1.00 35.96 ? 84  ASN D ND2   1 
ATOM   6167 N  N     . VAL D 2 38  ? -2.407  41.750  3.949   1.00 35.50 ? 85  VAL D N     1 
ATOM   6168 C  CA    . VAL D 2 38  ? -2.612  42.237  5.317   1.00 35.05 ? 85  VAL D CA    1 
ATOM   6169 C  C     . VAL D 2 38  ? -1.770  41.450  6.319   1.00 35.02 ? 85  VAL D C     1 
ATOM   6170 O  O     . VAL D 2 38  ? -1.154  42.013  7.234   1.00 35.28 ? 85  VAL D O     1 
ATOM   6171 C  CB    . VAL D 2 38  ? -4.097  42.170  5.711   1.00 35.03 ? 85  VAL D CB    1 
ATOM   6172 C  CG1   . VAL D 2 38  ? -4.274  42.497  7.176   1.00 34.30 ? 85  VAL D CG1   1 
ATOM   6173 C  CG2   . VAL D 2 38  ? -4.917  43.132  4.834   1.00 34.18 ? 85  VAL D CG2   1 
ATOM   6174 N  N     . PHE D 2 39  ? -1.752  40.138  6.139   1.00 34.51 ? 86  PHE D N     1 
ATOM   6175 C  CA    . PHE D 2 39  ? -0.932  39.266  6.953   1.00 34.00 ? 86  PHE D CA    1 
ATOM   6176 C  C     . PHE D 2 39  ? 0.537   39.551  6.653   1.00 33.60 ? 86  PHE D C     1 
ATOM   6177 O  O     . PHE D 2 39  ? 1.371   39.532  7.550   1.00 33.61 ? 86  PHE D O     1 
ATOM   6178 C  CB    . PHE D 2 39  ? -1.286  37.803  6.660   1.00 34.03 ? 86  PHE D CB    1 
ATOM   6179 C  CG    . PHE D 2 39  ? -0.498  36.799  7.466   1.00 33.28 ? 86  PHE D CG    1 
ATOM   6180 C  CD1   . PHE D 2 39  ? -0.522  36.830  8.848   1.00 33.77 ? 86  PHE D CD1   1 
ATOM   6181 C  CD2   . PHE D 2 39  ? 0.221   35.798  6.832   1.00 32.93 ? 86  PHE D CD2   1 
ATOM   6182 C  CE1   . PHE D 2 39  ? 0.190   35.901  9.595   1.00 34.22 ? 86  PHE D CE1   1 
ATOM   6183 C  CE2   . PHE D 2 39  ? 0.920   34.864  7.556   1.00 33.73 ? 86  PHE D CE2   1 
ATOM   6184 C  CZ    . PHE D 2 39  ? 0.913   34.913  8.945   1.00 34.49 ? 86  PHE D CZ    1 
ATOM   6185 N  N     . GLY D 2 40  ? 0.835   39.819  5.382   1.00 32.92 ? 87  GLY D N     1 
ATOM   6186 C  CA    . GLY D 2 40  ? 2.174   40.172  4.955   1.00 32.69 ? 87  GLY D CA    1 
ATOM   6187 C  C     . GLY D 2 40  ? 2.681   41.369  5.718   1.00 32.54 ? 87  GLY D C     1 
ATOM   6188 O  O     . GLY D 2 40  ? 3.785   41.334  6.267   1.00 32.65 ? 87  GLY D O     1 
ATOM   6189 N  N     . SER D 2 41  ? 1.853   42.411  5.773   1.00 32.36 ? 88  SER D N     1 
ATOM   6190 C  CA    . SER D 2 41  ? 2.143   43.613  6.558   1.00 32.21 ? 88  SER D CA    1 
ATOM   6191 C  C     . SER D 2 41  ? 2.454   43.280  7.998   1.00 31.86 ? 88  SER D C     1 
ATOM   6192 O  O     . SER D 2 41  ? 3.387   43.835  8.566   1.00 31.30 ? 88  SER D O     1 
ATOM   6193 C  CB    . SER D 2 41  ? 0.976   44.594  6.527   1.00 32.07 ? 88  SER D CB    1 
ATOM   6194 O  OG    . SER D 2 41  ? 0.664   44.926  5.194   1.00 33.49 ? 88  SER D OG    1 
ATOM   6195 N  N     . PHE D 2 42  ? 1.665   42.387  8.589   1.00 32.08 ? 89  PHE D N     1 
ATOM   6196 C  CA    . PHE D 2 42  ? 1.902   41.990  9.976   1.00 32.47 ? 89  PHE D CA    1 
ATOM   6197 C  C     . PHE D 2 42  ? 3.268   41.340  10.126  1.00 32.24 ? 89  PHE D C     1 
ATOM   6198 O  O     . PHE D 2 42  ? 4.019   41.680  11.041  1.00 32.02 ? 89  PHE D O     1 
ATOM   6199 C  CB    . PHE D 2 42  ? 0.828   41.026  10.503  1.00 32.89 ? 89  PHE D CB    1 
ATOM   6200 C  CG    . PHE D 2 42  ? 1.026   40.650  11.951  1.00 33.22 ? 89  PHE D CG    1 
ATOM   6201 C  CD1   . PHE D 2 42  ? 0.899   41.610  12.955  1.00 34.19 ? 89  PHE D CD1   1 
ATOM   6202 C  CD2   . PHE D 2 42  ? 1.367   39.358  12.309  1.00 33.30 ? 89  PHE D CD2   1 
ATOM   6203 C  CE1   . PHE D 2 42  ? 1.099   41.281  14.295  1.00 33.58 ? 89  PHE D CE1   1 
ATOM   6204 C  CE2   . PHE D 2 42  ? 1.561   39.026  13.637  1.00 33.98 ? 89  PHE D CE2   1 
ATOM   6205 C  CZ    . PHE D 2 42  ? 1.427   39.996  14.635  1.00 33.64 ? 89  PHE D CZ    1 
ATOM   6206 N  N     . LEU D 2 43  ? 3.583   40.409  9.228   1.00 32.06 ? 90  LEU D N     1 
ATOM   6207 C  CA    . LEU D 2 43  ? 4.880   39.742  9.281   1.00 32.15 ? 90  LEU D CA    1 
ATOM   6208 C  C     . LEU D 2 43  ? 6.010   40.741  9.120   1.00 31.94 ? 90  LEU D C     1 
ATOM   6209 O  O     . LEU D 2 43  ? 7.057   40.586  9.724   1.00 31.50 ? 90  LEU D O     1 
ATOM   6210 C  CB    . LEU D 2 43  ? 5.014   38.649  8.213   1.00 32.12 ? 90  LEU D CB    1 
ATOM   6211 C  CG    . LEU D 2 43  ? 3.997   37.520  8.335   1.00 31.79 ? 90  LEU D CG    1 
ATOM   6212 C  CD1   . LEU D 2 43  ? 4.360   36.351  7.433   1.00 29.58 ? 90  LEU D CD1   1 
ATOM   6213 C  CD2   . LEU D 2 43  ? 3.868   37.083  9.780   1.00 31.18 ? 90  LEU D CD2   1 
ATOM   6214 N  N     . LYS D 2 44  ? 5.810   41.759  8.298   1.00 32.13 ? 91  LYS D N     1 
ATOM   6215 C  CA    . LYS D 2 44  ? 6.854   42.754  8.113   1.00 32.56 ? 91  LYS D CA    1 
ATOM   6216 C  C     . LYS D 2 44  ? 7.136   43.479  9.445   1.00 32.36 ? 91  LYS D C     1 
ATOM   6217 O  O     . LYS D 2 44  ? 8.289   43.741  9.788   1.00 32.24 ? 91  LYS D O     1 
ATOM   6218 C  CB    . LYS D 2 44  ? 6.488   43.742  7.005   1.00 32.51 ? 91  LYS D CB    1 
ATOM   6219 C  CG    . LYS D 2 44  ? 7.624   44.684  6.627   1.00 33.34 ? 91  LYS D CG    1 
ATOM   6220 N  N     . SER D 2 45  ? 6.082   43.765  10.205  1.00 32.12 ? 92  SER D N     1 
ATOM   6221 C  CA    . SER D 2 45  ? 6.232   44.442  11.491  1.00 32.15 ? 92  SER D CA    1 
ATOM   6222 C  C     . SER D 2 45  ? 6.900   43.547  12.538  1.00 32.11 ? 92  SER D C     1 
ATOM   6223 O  O     . SER D 2 45  ? 7.456   44.051  13.522  1.00 32.20 ? 92  SER D O     1 
ATOM   6224 C  CB    . SER D 2 45  ? 4.873   44.947  12.010  1.00 32.07 ? 92  SER D CB    1 
ATOM   6225 O  OG    . SER D 2 45  ? 4.025   43.894  12.425  1.00 31.52 ? 92  SER D OG    1 
ATOM   6226 N  N     . GLU D 2 46  ? 6.836   42.234  12.321  1.00 31.68 ? 93  GLU D N     1 
ATOM   6227 C  CA    . GLU D 2 46  ? 7.542   41.271  13.164  1.00 32.01 ? 93  GLU D CA    1 
ATOM   6228 C  C     . GLU D 2 46  ? 8.833   40.727  12.538  1.00 31.72 ? 93  GLU D C     1 
ATOM   6229 O  O     . GLU D 2 46  ? 9.441   39.810  13.073  1.00 31.33 ? 93  GLU D O     1 
ATOM   6230 C  CB    . GLU D 2 46  ? 6.611   40.104  13.550  1.00 32.03 ? 93  GLU D CB    1 
ATOM   6231 C  CG    . GLU D 2 46  ? 5.526   40.516  14.525  1.00 32.74 ? 93  GLU D CG    1 
ATOM   6232 C  CD    . GLU D 2 46  ? 4.862   39.355  15.269  1.00 32.54 ? 93  GLU D CD    1 
ATOM   6233 O  OE1   . GLU D 2 46  ? 4.839   38.216  14.740  1.00 30.66 ? 93  GLU D OE1   1 
ATOM   6234 O  OE2   . GLU D 2 46  ? 4.343   39.622  16.381  1.00 32.18 ? 93  GLU D OE2   1 
ATOM   6235 N  N     . PHE D 2 47  ? 9.259   41.300  11.420  1.00 31.76 ? 94  PHE D N     1 
ATOM   6236 C  CA    . PHE D 2 47  ? 10.487  40.872  10.755  1.00 31.53 ? 94  PHE D CA    1 
ATOM   6237 C  C     . PHE D 2 47  ? 10.500  39.373  10.429  1.00 31.58 ? 94  PHE D C     1 
ATOM   6238 O  O     . PHE D 2 47  ? 11.492  38.683  10.659  1.00 31.43 ? 94  PHE D O     1 
ATOM   6239 C  CB    . PHE D 2 47  ? 11.702  41.233  11.612  1.00 31.13 ? 94  PHE D CB    1 
ATOM   6240 C  CG    . PHE D 2 47  ? 11.854  42.685  11.838  1.00 31.16 ? 94  PHE D CG    1 
ATOM   6241 C  CD1   . PHE D 2 47  ? 11.095  43.333  12.809  1.00 32.38 ? 94  PHE D CD1   1 
ATOM   6242 C  CD2   . PHE D 2 47  ? 12.747  43.428  11.078  1.00 31.13 ? 94  PHE D CD2   1 
ATOM   6243 C  CE1   . PHE D 2 47  ? 11.220  44.703  13.026  1.00 31.31 ? 94  PHE D CE1   1 
ATOM   6244 C  CE2   . PHE D 2 47  ? 12.877  44.797  11.286  1.00 32.05 ? 94  PHE D CE2   1 
ATOM   6245 C  CZ    . PHE D 2 47  ? 12.111  45.434  12.262  1.00 31.29 ? 94  PHE D CZ    1 
ATOM   6246 N  N     . SER D 2 48  ? 9.398   38.865  9.898   1.00 31.81 ? 95  SER D N     1 
ATOM   6247 C  CA    . SER D 2 48  ? 9.341   37.458  9.496   1.00 32.19 ? 95  SER D CA    1 
ATOM   6248 C  C     . SER D 2 48  ? 8.641   37.267  8.151   1.00 32.47 ? 95  SER D C     1 
ATOM   6249 O  O     . SER D 2 48  ? 8.153   36.176  7.839   1.00 32.63 ? 95  SER D O     1 
ATOM   6250 C  CB    . SER D 2 48  ? 8.685   36.621  10.593  1.00 32.23 ? 95  SER D CB    1 
ATOM   6251 O  OG    . SER D 2 48  ? 7.344   37.013  10.807  1.00 33.58 ? 95  SER D OG    1 
ATOM   6252 N  N     . GLU D 2 49  ? 8.654   38.312  7.325   1.00 32.86 ? 96  GLU D N     1 
ATOM   6253 C  CA    . GLU D 2 49  ? 7.904   38.305  6.072   1.00 33.28 ? 96  GLU D CA    1 
ATOM   6254 C  C     . GLU D 2 49  ? 8.464   37.279  5.070   1.00 33.09 ? 96  GLU D C     1 
ATOM   6255 O  O     . GLU D 2 49  ? 7.753   36.822  4.178   1.00 33.02 ? 96  GLU D O     1 
ATOM   6256 C  CB    . GLU D 2 49  ? 7.806   39.726  5.480   1.00 33.58 ? 96  GLU D CB    1 
ATOM   6257 C  CG    . GLU D 2 49  ? 9.086   40.289  4.834   1.00 35.97 ? 96  GLU D CG    1 
ATOM   6258 C  CD    . GLU D 2 49  ? 9.973   41.132  5.765   1.00 37.00 ? 96  GLU D CD    1 
ATOM   6259 O  OE1   . GLU D 2 49  ? 10.166  40.770  6.948   1.00 38.28 ? 96  GLU D OE1   1 
ATOM   6260 O  OE2   . GLU D 2 49  ? 10.498  42.159  5.286   1.00 38.34 ? 96  GLU D OE2   1 
ATOM   6261 N  N     . GLU D 2 50  ? 9.720   36.875  5.254   1.00 33.10 ? 97  GLU D N     1 
ATOM   6262 C  CA    . GLU D 2 50  ? 10.341  35.920  4.349   1.00 33.28 ? 97  GLU D CA    1 
ATOM   6263 C  C     . GLU D 2 50  ? 9.573   34.617  4.320   1.00 33.39 ? 97  GLU D C     1 
ATOM   6264 O  O     . GLU D 2 50  ? 9.624   33.900  3.337   1.00 33.91 ? 97  GLU D O     1 
ATOM   6265 C  CB    . GLU D 2 50  ? 11.835  35.690  4.665   1.00 33.42 ? 97  GLU D CB    1 
ATOM   6266 C  CG    . GLU D 2 50  ? 12.162  34.770  5.816   1.00 33.92 ? 97  GLU D CG    1 
ATOM   6267 C  CD    . GLU D 2 50  ? 11.973  35.414  7.183   1.00 35.68 ? 97  GLU D CD    1 
ATOM   6268 O  OE1   . GLU D 2 50  ? 11.548  36.594  7.226   1.00 35.32 ? 97  GLU D OE1   1 
ATOM   6269 O  OE2   . GLU D 2 50  ? 12.262  34.733  8.211   1.00 35.01 ? 97  GLU D OE2   1 
ATOM   6270 N  N     . ASN D 2 51  ? 8.858   34.310  5.393   1.00 33.69 ? 98  ASN D N     1 
ATOM   6271 C  CA    . ASN D 2 51  ? 8.071   33.094  5.443   1.00 33.75 ? 98  ASN D CA    1 
ATOM   6272 C  C     . ASN D 2 51  ? 6.943   33.110  4.432   1.00 34.24 ? 98  ASN D C     1 
ATOM   6273 O  O     . ASN D 2 51  ? 6.786   32.149  3.671   1.00 34.78 ? 98  ASN D O     1 
ATOM   6274 C  CB    . ASN D 2 51  ? 7.549   32.859  6.859   1.00 33.77 ? 98  ASN D CB    1 
ATOM   6275 C  CG    . ASN D 2 51  ? 8.661   32.521  7.827   1.00 34.20 ? 98  ASN D CG    1 
ATOM   6276 O  OD1   . ASN D 2 51  ? 9.689   31.993  7.418   1.00 36.27 ? 98  ASN D OD1   1 
ATOM   6277 N  ND2   . ASN D 2 51  ? 8.476   32.839  9.106   1.00 32.83 ? 98  ASN D ND2   1 
ATOM   6278 N  N     . ILE D 2 52  ? 6.166   34.190  4.408   1.00 34.48 ? 99  ILE D N     1 
ATOM   6279 C  CA    . ILE D 2 52  ? 5.105   34.314  3.419   1.00 34.77 ? 99  ILE D CA    1 
ATOM   6280 C  C     . ILE D 2 52  ? 5.654   34.516  2.002   1.00 35.29 ? 99  ILE D C     1 
ATOM   6281 O  O     . ILE D 2 52  ? 5.071   34.020  1.022   1.00 35.68 ? 99  ILE D O     1 
ATOM   6282 C  CB    . ILE D 2 52  ? 4.140   35.451  3.748   1.00 34.68 ? 99  ILE D CB    1 
ATOM   6283 C  CG1   . ILE D 2 52  ? 2.875   35.314  2.907   1.00 33.77 ? 99  ILE D CG1   1 
ATOM   6284 C  CG2   . ILE D 2 52  ? 4.798   36.813  3.531   1.00 35.15 ? 99  ILE D CG2   1 
ATOM   6285 C  CD1   . ILE D 2 52  ? 1.727   36.049  3.483   1.00 34.15 ? 99  ILE D CD1   1 
ATOM   6286 N  N     . GLU D 2 53  ? 6.764   35.239  1.881   1.00 35.29 ? 100 GLU D N     1 
ATOM   6287 C  CA    . GLU D 2 53  ? 7.325   35.480  0.558   1.00 35.66 ? 100 GLU D CA    1 
ATOM   6288 C  C     . GLU D 2 53  ? 7.769   34.139  -0.014  1.00 34.84 ? 100 GLU D C     1 
ATOM   6289 O  O     . GLU D 2 53  ? 7.600   33.885  -1.198  1.00 34.99 ? 100 GLU D O     1 
ATOM   6290 C  CB    . GLU D 2 53  ? 8.446   36.544  0.585   1.00 35.56 ? 100 GLU D CB    1 
ATOM   6291 C  CG    . GLU D 2 53  ? 7.902   37.978  0.845   1.00 37.24 ? 100 GLU D CG    1 
ATOM   6292 C  CD    . GLU D 2 53  ? 8.980   39.092  1.008   1.00 38.11 ? 100 GLU D CD    1 
ATOM   6293 O  OE1   . GLU D 2 53  ? 10.195  38.789  1.130   1.00 39.67 ? 100 GLU D OE1   1 
ATOM   6294 O  OE2   . GLU D 2 53  ? 8.584   40.294  1.003   1.00 41.61 ? 100 GLU D OE2   1 
ATOM   6295 N  N     . PHE D 2 54  ? 8.279   33.270  0.845   1.00 34.22 ? 101 PHE D N     1 
ATOM   6296 C  CA    . PHE D 2 54  ? 8.681   31.940  0.437   1.00 34.28 ? 101 PHE D CA    1 
ATOM   6297 C  C     . PHE D 2 54  ? 7.490   31.095  0.036   1.00 34.21 ? 101 PHE D C     1 
ATOM   6298 O  O     . PHE D 2 54  ? 7.509   30.446  -1.008  1.00 34.25 ? 101 PHE D O     1 
ATOM   6299 C  CB    . PHE D 2 54  ? 9.443   31.233  1.553   1.00 34.28 ? 101 PHE D CB    1 
ATOM   6300 C  CG    . PHE D 2 54  ? 9.841   29.834  1.206   1.00 34.65 ? 101 PHE D CG    1 
ATOM   6301 C  CD1   . PHE D 2 54  ? 10.722  29.591  0.169   1.00 35.35 ? 101 PHE D CD1   1 
ATOM   6302 C  CD2   . PHE D 2 54  ? 9.326   28.756  1.901   1.00 35.01 ? 101 PHE D CD2   1 
ATOM   6303 C  CE1   . PHE D 2 54  ? 11.088  28.295  -0.164  1.00 34.57 ? 101 PHE D CE1   1 
ATOM   6304 C  CE2   . PHE D 2 54  ? 9.700   27.465  1.578   1.00 34.66 ? 101 PHE D CE2   1 
ATOM   6305 C  CZ    . PHE D 2 54  ? 10.586  27.242  0.544   1.00 34.42 ? 101 PHE D CZ    1 
ATOM   6306 N  N     . TRP D 2 55  ? 6.464   31.097  0.874   1.00 34.23 ? 102 TRP D N     1 
ATOM   6307 C  CA    . TRP D 2 55  ? 5.233   30.373  0.586   1.00 34.24 ? 102 TRP D CA    1 
ATOM   6308 C  C     . TRP D 2 55  ? 4.660   30.788  -0.768  1.00 34.03 ? 102 TRP D C     1 
ATOM   6309 O  O     . TRP D 2 55  ? 4.243   29.943  -1.553  1.00 33.99 ? 102 TRP D O     1 
ATOM   6310 C  CB    . TRP D 2 55  ? 4.208   30.616  1.692   1.00 34.55 ? 102 TRP D CB    1 
ATOM   6311 C  CG    . TRP D 2 55  ? 2.975   29.771  1.574   1.00 34.49 ? 102 TRP D CG    1 
ATOM   6312 C  CD1   . TRP D 2 55  ? 2.822   28.481  1.982   1.00 34.61 ? 102 TRP D CD1   1 
ATOM   6313 C  CD2   . TRP D 2 55  ? 1.721   30.168  1.018   1.00 34.45 ? 102 TRP D CD2   1 
ATOM   6314 N  NE1   . TRP D 2 55  ? 1.547   28.042  1.704   1.00 34.55 ? 102 TRP D NE1   1 
ATOM   6315 C  CE2   . TRP D 2 55  ? 0.850   29.061  1.114   1.00 34.20 ? 102 TRP D CE2   1 
ATOM   6316 C  CE3   . TRP D 2 55  ? 1.254   31.347  0.433   1.00 34.93 ? 102 TRP D CE3   1 
ATOM   6317 C  CZ2   . TRP D 2 55  ? -0.465  29.101  0.655   1.00 34.79 ? 102 TRP D CZ2   1 
ATOM   6318 C  CZ3   . TRP D 2 55  ? -0.060  31.390  -0.025  1.00 35.06 ? 102 TRP D CZ3   1 
ATOM   6319 C  CH2   . TRP D 2 55  ? -0.904  30.270  0.089   1.00 34.88 ? 102 TRP D CH2   1 
ATOM   6320 N  N     . LEU D 2 56  ? 4.663   32.090  -1.042  1.00 33.95 ? 103 LEU D N     1 
ATOM   6321 C  CA    . LEU D 2 56  ? 4.168   32.604  -2.324  1.00 33.69 ? 103 LEU D CA    1 
ATOM   6322 C  C     . LEU D 2 56  ? 5.072   32.192  -3.474  1.00 33.65 ? 103 LEU D C     1 
ATOM   6323 O  O     . LEU D 2 56  ? 4.580   31.875  -4.566  1.00 33.82 ? 103 LEU D O     1 
ATOM   6324 C  CB    . LEU D 2 56  ? 4.011   34.125  -2.287  1.00 33.70 ? 103 LEU D CB    1 
ATOM   6325 C  CG    . LEU D 2 56  ? 2.827   34.583  -1.436  1.00 33.36 ? 103 LEU D CG    1 
ATOM   6326 C  CD1   . LEU D 2 56  ? 2.999   36.010  -0.961  1.00 32.01 ? 103 LEU D CD1   1 
ATOM   6327 C  CD2   . LEU D 2 56  ? 1.525   34.406  -2.212  1.00 32.99 ? 103 LEU D CD2   1 
ATOM   6328 N  N     . ALA D 2 57  ? 6.383   32.180  -3.236  1.00 33.45 ? 104 ALA D N     1 
ATOM   6329 C  CA    . ALA D 2 57  ? 7.325   31.735  -4.271  1.00 33.48 ? 104 ALA D CA    1 
ATOM   6330 C  C     . ALA D 2 57  ? 7.120   30.244  -4.624  1.00 33.44 ? 104 ALA D C     1 
ATOM   6331 O  O     . ALA D 2 57  ? 7.238   29.858  -5.790  1.00 33.56 ? 104 ALA D O     1 
ATOM   6332 C  CB    . ALA D 2 57  ? 8.757   32.008  -3.866  1.00 33.17 ? 104 ALA D CB    1 
ATOM   6333 N  N     . CYS D 2 58  ? 6.787   29.424  -3.629  1.00 33.26 ? 105 CYS D N     1 
ATOM   6334 C  CA    . CYS D 2 58  ? 6.475   28.019  -3.876  1.00 33.45 ? 105 CYS D CA    1 
ATOM   6335 C  C     . CYS D 2 58  ? 5.184   27.866  -4.668  1.00 33.38 ? 105 CYS D C     1 
ATOM   6336 O  O     . CYS D 2 58  ? 5.130   27.086  -5.614  1.00 33.48 ? 105 CYS D O     1 
ATOM   6337 C  CB    . CYS D 2 58  ? 6.375   27.245  -2.564  1.00 33.56 ? 105 CYS D CB    1 
ATOM   6338 S  SG    . CYS D 2 58  ? 7.938   27.159  -1.648  1.00 33.91 ? 105 CYS D SG    1 
ATOM   6339 N  N     . GLU D 2 59  ? 4.155   28.625  -4.301  1.00 33.23 ? 106 GLU D N     1 
ATOM   6340 C  CA    . GLU D 2 59  ? 2.887   28.595  -5.044  1.00 33.18 ? 106 GLU D CA    1 
ATOM   6341 C  C     . GLU D 2 59  ? 3.075   28.914  -6.530  1.00 33.00 ? 106 GLU D C     1 
ATOM   6342 O  O     . GLU D 2 59  ? 2.567   28.196  -7.373  1.00 33.10 ? 106 GLU D O     1 
ATOM   6343 C  CB    . GLU D 2 59  ? 1.846   29.533  -4.416  1.00 32.97 ? 106 GLU D CB    1 
ATOM   6344 C  CG    . GLU D 2 59  ? 1.243   28.998  -3.115  1.00 33.29 ? 106 GLU D CG    1 
ATOM   6345 C  CD    . GLU D 2 59  ? 0.439   27.711  -3.307  1.00 33.86 ? 106 GLU D CD    1 
ATOM   6346 O  OE1   . GLU D 2 59  ? 0.913   26.644  -2.846  1.00 33.53 ? 106 GLU D OE1   1 
ATOM   6347 O  OE2   . GLU D 2 59  ? -0.655  27.763  -3.928  1.00 33.88 ? 106 GLU D OE2   1 
ATOM   6348 N  N     . ASP D 2 60  ? 3.806   29.982  -6.843  1.00 33.05 ? 107 ASP D N     1 
ATOM   6349 C  CA    . ASP D 2 60  ? 4.089   30.334  -8.234  1.00 33.12 ? 107 ASP D CA    1 
ATOM   6350 C  C     . ASP D 2 60  ? 4.911   29.225  -8.886  1.00 33.06 ? 107 ASP D C     1 
ATOM   6351 O  O     . ASP D 2 60  ? 4.636   28.828  -10.025 1.00 32.59 ? 107 ASP D O     1 
ATOM   6352 C  CB    . ASP D 2 60  ? 4.821   31.680  -8.347  1.00 33.41 ? 107 ASP D CB    1 
ATOM   6353 C  CG    . ASP D 2 60  ? 5.384   31.931  -9.754  1.00 34.44 ? 107 ASP D CG    1 
ATOM   6354 O  OD1   . ASP D 2 60  ? 4.602   32.245  -10.696 1.00 35.58 ? 107 ASP D OD1   1 
ATOM   6355 O  OD2   . ASP D 2 60  ? 6.622   31.808  -9.918  1.00 35.44 ? 107 ASP D OD2   1 
ATOM   6356 N  N     . TYR D 2 61  ? 5.906   28.712  -8.160  1.00 33.03 ? 108 TYR D N     1 
ATOM   6357 C  CA    . TYR D 2 61  ? 6.725   27.621  -8.685  1.00 33.10 ? 108 TYR D CA    1 
ATOM   6358 C  C     . TYR D 2 61  ? 5.882   26.419  -9.124  1.00 33.26 ? 108 TYR D C     1 
ATOM   6359 O  O     . TYR D 2 61  ? 6.182   25.779  -10.129 1.00 33.30 ? 108 TYR D O     1 
ATOM   6360 C  CB    . TYR D 2 61  ? 7.743   27.165  -7.659  1.00 33.18 ? 108 TYR D CB    1 
ATOM   6361 C  CG    . TYR D 2 61  ? 8.554   25.985  -8.121  1.00 33.59 ? 108 TYR D CG    1 
ATOM   6362 C  CD1   . TYR D 2 61  ? 9.766   26.173  -8.778  1.00 33.83 ? 108 TYR D CD1   1 
ATOM   6363 C  CD2   . TYR D 2 61  ? 8.110   24.673  -7.909  1.00 33.37 ? 108 TYR D CD2   1 
ATOM   6364 C  CE1   . TYR D 2 61  ? 10.522  25.096  -9.209  1.00 33.50 ? 108 TYR D CE1   1 
ATOM   6365 C  CE2   . TYR D 2 61  ? 8.860   23.591  -8.338  1.00 32.99 ? 108 TYR D CE2   1 
ATOM   6366 C  CZ    . TYR D 2 61  ? 10.067  23.812  -8.990  1.00 33.02 ? 108 TYR D CZ    1 
ATOM   6367 O  OH    . TYR D 2 61  ? 10.830  22.757  -9.429  1.00 32.97 ? 108 TYR D OH    1 
ATOM   6368 N  N     . LYS D 2 62  ? 4.830   26.112  -8.375  1.00 33.49 ? 109 LYS D N     1 
ATOM   6369 C  CA    . LYS D 2 62  ? 3.954   24.989  -8.726  1.00 33.90 ? 109 LYS D CA    1 
ATOM   6370 C  C     . LYS D 2 62  ? 3.212   25.203  -10.040 1.00 33.96 ? 109 LYS D C     1 
ATOM   6371 O  O     . LYS D 2 62  ? 3.043   24.263  -10.817 1.00 33.94 ? 109 LYS D O     1 
ATOM   6372 C  CB    . LYS D 2 62  ? 2.920   24.729  -7.637  1.00 33.92 ? 109 LYS D CB    1 
ATOM   6373 C  CG    . LYS D 2 62  ? 3.484   24.118  -6.404  1.00 34.60 ? 109 LYS D CG    1 
ATOM   6374 C  CD    . LYS D 2 62  ? 2.466   24.111  -5.284  1.00 35.55 ? 109 LYS D CD    1 
ATOM   6375 C  CE    . LYS D 2 62  ? 3.135   23.851  -3.955  1.00 35.40 ? 109 LYS D CE    1 
ATOM   6376 N  NZ    . LYS D 2 62  ? 2.146   23.915  -2.866  1.00 35.78 ? 109 LYS D NZ    1 
ATOM   6377 N  N     . LYS D 2 63  ? 2.749   26.429  -10.275 1.00 34.07 ? 110 LYS D N     1 
ATOM   6378 C  CA    . LYS D 2 63  ? 2.056   26.758  -11.531 1.00 34.17 ? 110 LYS D CA    1 
ATOM   6379 C  C     . LYS D 2 63  ? 3.036   26.966  -12.695 1.00 34.01 ? 110 LYS D C     1 
ATOM   6380 O  O     . LYS D 2 63  ? 2.623   27.010  -13.846 1.00 34.06 ? 110 LYS D O     1 
ATOM   6381 C  CB    . LYS D 2 63  ? 1.198   28.016  -11.361 1.00 34.21 ? 110 LYS D CB    1 
ATOM   6382 C  CG    . LYS D 2 63  ? 0.174   27.953  -10.219 1.00 34.48 ? 110 LYS D CG    1 
ATOM   6383 C  CD    . LYS D 2 63  ? -0.389  29.350  -9.905  1.00 34.71 ? 110 LYS D CD    1 
ATOM   6384 C  CE    . LYS D 2 63  ? -0.839  29.493  -8.442  1.00 35.16 ? 110 LYS D CE    1 
ATOM   6385 N  NZ    . LYS D 2 63  ? -0.752  30.913  -7.961  1.00 35.20 ? 110 LYS D NZ    1 
ATOM   6386 N  N     . THR D 2 64  ? 4.326   27.103  -12.385 1.00 34.15 ? 111 THR D N     1 
ATOM   6387 C  CA    . THR D 2 64  ? 5.371   27.315  -13.386 1.00 34.17 ? 111 THR D CA    1 
ATOM   6388 C  C     . THR D 2 64  ? 5.515   26.101  -14.311 1.00 34.21 ? 111 THR D C     1 
ATOM   6389 O  O     . THR D 2 64  ? 5.187   24.971  -13.943 1.00 33.95 ? 111 THR D O     1 
ATOM   6390 C  CB    . THR D 2 64  ? 6.730   27.613  -12.700 1.00 34.07 ? 111 THR D CB    1 
ATOM   6391 O  OG1   . THR D 2 64  ? 6.660   28.866  -12.006 1.00 34.48 ? 111 THR D OG1   1 
ATOM   6392 C  CG2   . THR D 2 64  ? 7.856   27.671  -13.703 1.00 34.30 ? 111 THR D CG2   1 
ATOM   6393 N  N     . GLU D 2 65  ? 6.019   26.346  -15.514 1.00 34.44 ? 112 GLU D N     1 
ATOM   6394 C  CA    . GLU D 2 65  ? 5.952   25.347  -16.561 1.00 34.74 ? 112 GLU D CA    1 
ATOM   6395 C  C     . GLU D 2 65  ? 7.150   24.415  -16.515 1.00 34.62 ? 112 GLU D C     1 
ATOM   6396 O  O     . GLU D 2 65  ? 8.278   24.824  -16.217 1.00 34.52 ? 112 GLU D O     1 
ATOM   6397 C  CB    . GLU D 2 65  ? 5.781   25.993  -17.939 1.00 34.88 ? 112 GLU D CB    1 
ATOM   6398 C  CG    . GLU D 2 65  ? 4.846   25.214  -18.887 1.00 36.61 ? 112 GLU D CG    1 
ATOM   6399 C  CD    . GLU D 2 65  ? 3.486   24.881  -18.255 1.00 38.07 ? 112 GLU D CD    1 
ATOM   6400 O  OE1   . GLU D 2 65  ? 3.441   24.007  -17.329 1.00 38.31 ? 112 GLU D OE1   1 
ATOM   6401 O  OE2   . GLU D 2 65  ? 2.463   25.485  -18.690 1.00 38.94 ? 112 GLU D OE2   1 
ATOM   6402 N  N     . SER D 2 66  ? 6.868   23.147  -16.794 1.00 34.69 ? 113 SER D N     1 
ATOM   6403 C  CA    . SER D 2 66  ? 7.875   22.096  -16.848 1.00 34.69 ? 113 SER D CA    1 
ATOM   6404 C  C     . SER D 2 66  ? 9.248   22.631  -17.264 1.00 34.65 ? 113 SER D C     1 
ATOM   6405 O  O     . SER D 2 66  ? 10.242  22.436  -16.558 1.00 34.59 ? 113 SER D O     1 
ATOM   6406 C  CB    . SER D 2 66  ? 7.394   21.010  -17.820 1.00 34.56 ? 113 SER D CB    1 
ATOM   6407 O  OG    . SER D 2 66  ? 8.436   20.119  -18.174 1.00 34.98 ? 113 SER D OG    1 
ATOM   6408 N  N     . ASP D 2 67  ? 9.266   23.350  -18.386 1.00 34.58 ? 114 ASP D N     1 
ATOM   6409 C  CA    . ASP D 2 67  ? 10.500  23.796  -19.037 1.00 34.45 ? 114 ASP D CA    1 
ATOM   6410 C  C     . ASP D 2 67  ? 11.411  24.636  -18.144 1.00 34.21 ? 114 ASP D C     1 
ATOM   6411 O  O     . ASP D 2 67  ? 12.617  24.405  -18.099 1.00 33.98 ? 114 ASP D O     1 
ATOM   6412 C  CB    . ASP D 2 67  ? 10.166  24.616  -20.289 1.00 34.56 ? 114 ASP D CB    1 
ATOM   6413 C  CG    . ASP D 2 67  ? 9.231   23.885  -21.252 1.00 34.69 ? 114 ASP D CG    1 
ATOM   6414 O  OD1   . ASP D 2 67  ? 8.478   22.981  -20.814 1.00 35.01 ? 114 ASP D OD1   1 
ATOM   6415 O  OD2   . ASP D 2 67  ? 9.237   24.235  -22.451 1.00 34.53 ? 114 ASP D OD2   1 
ATOM   6416 N  N     . LEU D 2 68  ? 10.827  25.607  -17.444 1.00 34.10 ? 115 LEU D N     1 
ATOM   6417 C  CA    . LEU D 2 68  ? 11.594  26.630  -16.717 1.00 33.95 ? 115 LEU D CA    1 
ATOM   6418 C  C     . LEU D 2 68  ? 11.816  26.339  -15.227 1.00 33.98 ? 115 LEU D C     1 
ATOM   6419 O  O     . LEU D 2 68  ? 12.323  27.192  -14.502 1.00 33.95 ? 115 LEU D O     1 
ATOM   6420 C  CB    . LEU D 2 68  ? 10.905  27.988  -16.874 1.00 33.96 ? 115 LEU D CB    1 
ATOM   6421 N  N     . LEU D 2 69  ? 11.466  25.134  -14.777 1.00 34.14 ? 116 LEU D N     1 
ATOM   6422 C  CA    . LEU D 2 69  ? 11.563  24.778  -13.353 1.00 34.18 ? 116 LEU D CA    1 
ATOM   6423 C  C     . LEU D 2 69  ? 12.998  24.728  -12.804 1.00 34.45 ? 116 LEU D C     1 
ATOM   6424 O  O     . LEU D 2 69  ? 13.228  25.128  -11.667 1.00 34.59 ? 116 LEU D O     1 
ATOM   6425 C  CB    . LEU D 2 69  ? 10.851  23.451  -13.069 1.00 34.15 ? 116 LEU D CB    1 
ATOM   6426 C  CG    . LEU D 2 69  ? 9.344   23.420  -13.350 1.00 34.07 ? 116 LEU D CG    1 
ATOM   6427 C  CD1   . LEU D 2 69  ? 8.826   21.996  -13.319 1.00 33.81 ? 116 LEU D CD1   1 
ATOM   6428 C  CD2   . LEU D 2 69  ? 8.570   24.297  -12.383 1.00 33.21 ? 116 LEU D CD2   1 
ATOM   6429 N  N     . PRO D 2 70  ? 13.964  24.225  -13.593 1.00 34.73 ? 117 PRO D N     1 
ATOM   6430 C  CA    . PRO D 2 70  ? 15.358  24.232  -13.138 1.00 34.98 ? 117 PRO D CA    1 
ATOM   6431 C  C     . PRO D 2 70  ? 15.864  25.593  -12.654 1.00 35.29 ? 117 PRO D C     1 
ATOM   6432 O  O     . PRO D 2 70  ? 16.535  25.669  -11.621 1.00 35.01 ? 117 PRO D O     1 
ATOM   6433 C  CB    . PRO D 2 70  ? 16.127  23.803  -14.391 1.00 34.90 ? 117 PRO D CB    1 
ATOM   6434 C  CG    . PRO D 2 70  ? 15.167  22.950  -15.124 1.00 34.77 ? 117 PRO D CG    1 
ATOM   6435 C  CD    . PRO D 2 70  ? 13.835  23.593  -14.919 1.00 34.68 ? 117 PRO D CD    1 
ATOM   6436 N  N     . CYS D 2 71  ? 15.539  26.644  -13.403 1.00 35.66 ? 118 CYS D N     1 
ATOM   6437 C  CA    . CYS D 2 71  ? 15.934  28.012  -13.066 1.00 36.22 ? 118 CYS D CA    1 
ATOM   6438 C  C     . CYS D 2 71  ? 15.146  28.582  -11.905 1.00 36.00 ? 118 CYS D C     1 
ATOM   6439 O  O     . CYS D 2 71  ? 15.710  29.230  -11.022 1.00 35.74 ? 118 CYS D O     1 
ATOM   6440 C  CB    . CYS D 2 71  ? 15.708  28.940  -14.256 1.00 36.29 ? 118 CYS D CB    1 
ATOM   6441 S  SG    . CYS D 2 71  ? 17.093  29.027  -15.357 1.00 38.82 ? 118 CYS D SG    1 
ATOM   6442 N  N     . LYS D 2 72  ? 13.832  28.383  -11.951 1.00 36.05 ? 119 LYS D N     1 
ATOM   6443 C  CA    . LYS D 2 72  ? 12.949  28.817  -10.869 1.00 36.35 ? 119 LYS D CA    1 
ATOM   6444 C  C     . LYS D 2 72  ? 13.356  28.129  -9.558  1.00 36.19 ? 119 LYS D C     1 
ATOM   6445 O  O     . LYS D 2 72  ? 13.440  28.778  -8.523  1.00 36.19 ? 119 LYS D O     1 
ATOM   6446 C  CB    . LYS D 2 72  ? 11.475  28.525  -11.201 1.00 36.53 ? 119 LYS D CB    1 
ATOM   6447 C  CG    . LYS D 2 72  ? 10.475  29.586  -10.718 1.00 36.60 ? 119 LYS D CG    1 
ATOM   6448 C  CD    . LYS D 2 72  ? 10.075  30.543  -11.858 1.00 35.70 ? 119 LYS D CD    1 
ATOM   6449 N  N     . ALA D 2 73  ? 13.655  26.834  -9.616  1.00 36.25 ? 120 ALA D N     1 
ATOM   6450 C  CA    . ALA D 2 73  ? 14.093  26.103  -8.423  1.00 36.67 ? 120 ALA D CA    1 
ATOM   6451 C  C     . ALA D 2 73  ? 15.403  26.656  -7.861  1.00 37.04 ? 120 ALA D C     1 
ATOM   6452 O  O     . ALA D 2 73  ? 15.515  26.875  -6.664  1.00 36.93 ? 120 ALA D O     1 
ATOM   6453 C  CB    . ALA D 2 73  ? 14.231  24.617  -8.709  1.00 36.40 ? 120 ALA D CB    1 
ATOM   6454 N  N     . GLU D 2 74  ? 16.388  26.881  -8.726  1.00 37.59 ? 121 GLU D N     1 
ATOM   6455 C  CA    . GLU D 2 74  ? 17.685  27.407  -8.292  1.00 38.05 ? 121 GLU D CA    1 
ATOM   6456 C  C     . GLU D 2 74  ? 17.519  28.785  -7.681  1.00 37.92 ? 121 GLU D C     1 
ATOM   6457 O  O     . GLU D 2 74  ? 18.105  29.080  -6.642  1.00 38.57 ? 121 GLU D O     1 
ATOM   6458 C  CB    . GLU D 2 74  ? 18.656  27.474  -9.481  1.00 38.04 ? 121 GLU D CB    1 
ATOM   6459 C  CG    . GLU D 2 74  ? 20.142  27.618  -9.123  1.00 38.43 ? 121 GLU D CG    1 
ATOM   6460 C  CD    . GLU D 2 74  ? 21.051  27.047  -10.223 1.00 39.47 ? 121 GLU D CD    1 
ATOM   6461 O  OE1   . GLU D 2 74  ? 21.787  27.828  -10.876 1.00 41.12 ? 121 GLU D OE1   1 
ATOM   6462 O  OE2   . GLU D 2 74  ? 21.007  25.811  -10.460 1.00 40.57 ? 121 GLU D OE2   1 
ATOM   6463 N  N     . GLU D 2 75  ? 16.709  29.615  -8.329  1.00 37.77 ? 122 GLU D N     1 
ATOM   6464 C  CA    . GLU D 2 75  ? 16.424  30.979  -7.867  1.00 37.86 ? 122 GLU D CA    1 
ATOM   6465 C  C     . GLU D 2 75  ? 15.855  31.012  -6.440  1.00 37.00 ? 122 GLU D C     1 
ATOM   6466 O  O     . GLU D 2 75  ? 16.292  31.793  -5.600  1.00 36.99 ? 122 GLU D O     1 
ATOM   6467 C  CB    . GLU D 2 75  ? 15.424  31.631  -8.835  1.00 38.02 ? 122 GLU D CB    1 
ATOM   6468 C  CG    . GLU D 2 75  ? 14.934  33.035  -8.455  1.00 38.97 ? 122 GLU D CG    1 
ATOM   6469 C  CD    . GLU D 2 75  ? 13.794  33.523  -9.362  1.00 39.08 ? 122 GLU D CD    1 
ATOM   6470 O  OE1   . GLU D 2 75  ? 12.760  33.957  -8.798  1.00 40.60 ? 122 GLU D OE1   1 
ATOM   6471 O  OE2   . GLU D 2 75  ? 13.925  33.464  -10.617 1.00 38.40 ? 122 GLU D OE2   1 
ATOM   6472 N  N     . ILE D 2 76  ? 14.874  30.157  -6.190  1.00 36.20 ? 123 ILE D N     1 
ATOM   6473 C  CA    . ILE D 2 76  ? 14.185  30.095  -4.906  1.00 35.51 ? 123 ILE D CA    1 
ATOM   6474 C  C     . ILE D 2 76  ? 15.091  29.509  -3.844  1.00 35.12 ? 123 ILE D C     1 
ATOM   6475 O  O     . ILE D 2 76  ? 15.091  29.965  -2.695  1.00 34.58 ? 123 ILE D O     1 
ATOM   6476 C  CB    . ILE D 2 76  ? 12.922  29.209  -4.976  1.00 35.55 ? 123 ILE D CB    1 
ATOM   6477 C  CG1   . ILE D 2 76  ? 11.882  29.788  -5.940  1.00 35.90 ? 123 ILE D CG1   1 
ATOM   6478 C  CG2   . ILE D 2 76  ? 12.276  29.076  -3.614  1.00 35.55 ? 123 ILE D CG2   1 
ATOM   6479 C  CD1   . ILE D 2 76  ? 10.711  28.829  -6.206  1.00 35.38 ? 123 ILE D CD1   1 
ATOM   6480 N  N     . TYR D 2 77  ? 15.859  28.491  -4.223  1.00 34.64 ? 124 TYR D N     1 
ATOM   6481 C  CA    . TYR D 2 77  ? 16.844  27.923  -3.323  1.00 34.44 ? 124 TYR D CA    1 
ATOM   6482 C  C     . TYR D 2 77  ? 17.831  28.993  -2.837  1.00 34.34 ? 124 TYR D C     1 
ATOM   6483 O  O     . TYR D 2 77  ? 18.093  29.097  -1.636  1.00 34.37 ? 124 TYR D O     1 
ATOM   6484 C  CB    . TYR D 2 77  ? 17.606  26.809  -4.012  1.00 34.60 ? 124 TYR D CB    1 
ATOM   6485 C  CG    . TYR D 2 77  ? 18.565  26.124  -3.089  1.00 34.99 ? 124 TYR D CG    1 
ATOM   6486 C  CD1   . TYR D 2 77  ? 19.934  26.326  -3.195  1.00 35.29 ? 124 TYR D CD1   1 
ATOM   6487 C  CD2   . TYR D 2 77  ? 18.098  25.282  -2.088  1.00 34.80 ? 124 TYR D CD2   1 
ATOM   6488 C  CE1   . TYR D 2 77  ? 20.816  25.693  -2.331  1.00 35.55 ? 124 TYR D CE1   1 
ATOM   6489 C  CE2   . TYR D 2 77  ? 18.958  24.663  -1.223  1.00 35.24 ? 124 TYR D CE2   1 
ATOM   6490 C  CZ    . TYR D 2 77  ? 20.318  24.866  -1.341  1.00 35.65 ? 124 TYR D CZ    1 
ATOM   6491 O  OH    . TYR D 2 77  ? 21.166  24.231  -0.453  1.00 36.40 ? 124 TYR D OH    1 
ATOM   6492 N  N     . LYS D 2 78  ? 18.366  29.783  -3.772  1.00 33.87 ? 125 LYS D N     1 
ATOM   6493 C  CA    . LYS D 2 78  ? 19.354  30.813  -3.454  1.00 33.59 ? 125 LYS D CA    1 
ATOM   6494 C  C     . LYS D 2 78  ? 18.747  31.933  -2.637  1.00 33.34 ? 125 LYS D C     1 
ATOM   6495 O  O     . LYS D 2 78  ? 19.383  32.462  -1.717  1.00 33.50 ? 125 LYS D O     1 
ATOM   6496 C  CB    . LYS D 2 78  ? 19.977  31.407  -4.728  1.00 33.31 ? 125 LYS D CB    1 
ATOM   6497 N  N     . ALA D 2 79  ? 17.518  32.296  -2.972  1.00 32.85 ? 126 ALA D N     1 
ATOM   6498 C  CA    . ALA D 2 79  ? 16.882  33.452  -2.351  1.00 32.67 ? 126 ALA D CA    1 
ATOM   6499 C  C     . ALA D 2 79  ? 16.400  33.151  -0.938  1.00 32.48 ? 126 ALA D C     1 
ATOM   6500 O  O     . ALA D 2 79  ? 16.462  34.036  -0.078  1.00 33.01 ? 126 ALA D O     1 
ATOM   6501 C  CB    . ALA D 2 79  ? 15.726  33.951  -3.211  1.00 32.41 ? 126 ALA D CB    1 
ATOM   6502 N  N     . PHE D 2 80  ? 15.952  31.914  -0.696  1.00 32.30 ? 127 PHE D N     1 
ATOM   6503 C  CA    . PHE D 2 80  ? 15.308  31.540  0.576   1.00 32.24 ? 127 PHE D CA    1 
ATOM   6504 C  C     . PHE D 2 80  ? 15.887  30.355  1.356   1.00 32.38 ? 127 PHE D C     1 
ATOM   6505 O  O     . PHE D 2 80  ? 15.859  30.360  2.580   1.00 33.06 ? 127 PHE D O     1 
ATOM   6506 C  CB    . PHE D 2 80  ? 13.844  31.210  0.324   1.00 32.42 ? 127 PHE D CB    1 
ATOM   6507 C  CG    . PHE D 2 80  ? 13.025  32.373  -0.160  1.00 32.34 ? 127 PHE D CG    1 
ATOM   6508 C  CD1   . PHE D 2 80  ? 12.561  33.324  0.730   1.00 31.80 ? 127 PHE D CD1   1 
ATOM   6509 C  CD2   . PHE D 2 80  ? 12.684  32.487  -1.505  1.00 32.00 ? 127 PHE D CD2   1 
ATOM   6510 C  CE1   . PHE D 2 80  ? 11.792  34.370  0.296   1.00 32.71 ? 127 PHE D CE1   1 
ATOM   6511 C  CE2   . PHE D 2 80  ? 11.907  33.533  -1.949  1.00 31.43 ? 127 PHE D CE2   1 
ATOM   6512 C  CZ    . PHE D 2 80  ? 11.464  34.480  -1.055  1.00 32.11 ? 127 PHE D CZ    1 
ATOM   6513 N  N     . VAL D 2 81  ? 16.375  29.325  0.682   1.00 32.48 ? 128 VAL D N     1 
ATOM   6514 C  CA    . VAL D 2 81  ? 16.719  28.079  1.371   1.00 32.42 ? 128 VAL D CA    1 
ATOM   6515 C  C     . VAL D 2 81  ? 18.173  27.982  1.831   1.00 32.89 ? 128 VAL D C     1 
ATOM   6516 O  O     . VAL D 2 81  ? 18.440  27.552  2.949   1.00 33.20 ? 128 VAL D O     1 
ATOM   6517 C  CB    . VAL D 2 81  ? 16.433  26.865  0.482   1.00 32.26 ? 128 VAL D CB    1 
ATOM   6518 C  CG1   . VAL D 2 81  ? 16.758  25.589  1.240   1.00 31.59 ? 128 VAL D CG1   1 
ATOM   6519 C  CG2   . VAL D 2 81  ? 14.987  26.862  0.026   1.00 31.61 ? 128 VAL D CG2   1 
ATOM   6520 N  N     . HIS D 2 82  ? 19.110  28.354  0.958   1.00 33.27 ? 129 HIS D N     1 
ATOM   6521 C  CA    . HIS D 2 82  ? 20.555  28.228  1.234   1.00 33.29 ? 129 HIS D CA    1 
ATOM   6522 C  C     . HIS D 2 82  ? 20.959  28.922  2.539   1.00 33.28 ? 129 HIS D C     1 
ATOM   6523 O  O     . HIS D 2 82  ? 20.391  29.940  2.904   1.00 32.68 ? 129 HIS D O     1 
ATOM   6524 C  CB    . HIS D 2 82  ? 21.357  28.826  0.068   1.00 33.45 ? 129 HIS D CB    1 
ATOM   6525 C  CG    . HIS D 2 82  ? 22.811  28.456  0.053   1.00 33.75 ? 129 HIS D CG    1 
ATOM   6526 N  ND1   . HIS D 2 82  ? 23.787  29.244  0.622   1.00 34.95 ? 129 HIS D ND1   1 
ATOM   6527 C  CD2   . HIS D 2 82  ? 23.460  27.408  -0.509  1.00 34.07 ? 129 HIS D CD2   1 
ATOM   6528 C  CE1   . HIS D 2 82  ? 24.970  28.683  0.437   1.00 34.18 ? 129 HIS D CE1   1 
ATOM   6529 N  NE2   . HIS D 2 82  ? 24.799  27.569  -0.247  1.00 33.96 ? 129 HIS D NE2   1 
ATOM   6530 N  N     . SER D 2 83  ? 21.947  28.355  3.226   1.00 33.59 ? 130 SER D N     1 
ATOM   6531 C  CA    . SER D 2 83  ? 22.550  28.942  4.440   1.00 33.88 ? 130 SER D CA    1 
ATOM   6532 C  C     . SER D 2 83  ? 22.741  30.457  4.405   1.00 33.95 ? 130 SER D C     1 
ATOM   6533 O  O     . SER D 2 83  ? 22.563  31.147  5.403   1.00 33.61 ? 130 SER D O     1 
ATOM   6534 C  CB    . SER D 2 83  ? 23.952  28.343  4.662   1.00 33.86 ? 130 SER D CB    1 
ATOM   6535 O  OG    . SER D 2 83  ? 23.920  27.227  5.522   1.00 34.43 ? 130 SER D OG    1 
ATOM   6536 N  N     . ASP D 2 84  ? 23.161  30.956  3.252   1.00 34.45 ? 131 ASP D N     1 
ATOM   6537 C  CA    . ASP D 2 84  ? 23.544  32.360  3.099   1.00 34.74 ? 131 ASP D CA    1 
ATOM   6538 C  C     . ASP D 2 84  ? 22.469  33.210  2.435   1.00 34.61 ? 131 ASP D C     1 
ATOM   6539 O  O     . ASP D 2 84  ? 22.722  34.374  2.141   1.00 34.87 ? 131 ASP D O     1 
ATOM   6540 C  CB    . ASP D 2 84  ? 24.806  32.469  2.231   1.00 34.75 ? 131 ASP D CB    1 
ATOM   6541 C  CG    . ASP D 2 84  ? 26.003  31.737  2.820   1.00 35.92 ? 131 ASP D CG    1 
ATOM   6542 O  OD1   . ASP D 2 84  ? 26.228  31.843  4.053   1.00 37.65 ? 131 ASP D OD1   1 
ATOM   6543 O  OD2   . ASP D 2 84  ? 26.730  31.071  2.037   1.00 35.13 ? 131 ASP D OD2   1 
ATOM   6544 N  N     . ALA D 2 85  ? 21.292  32.636  2.172   1.00 34.24 ? 132 ALA D N     1 
ATOM   6545 C  CA    . ALA D 2 85  ? 20.186  33.382  1.581   1.00 33.88 ? 132 ALA D CA    1 
ATOM   6546 C  C     . ALA D 2 85  ? 19.901  34.623  2.407   1.00 34.00 ? 132 ALA D C     1 
ATOM   6547 O  O     . ALA D 2 85  ? 19.946  34.583  3.642   1.00 34.40 ? 132 ALA D O     1 
ATOM   6548 C  CB    . ALA D 2 85  ? 18.947  32.529  1.537   1.00 33.90 ? 132 ALA D CB    1 
ATOM   6549 N  N     . ALA D 2 86  ? 19.594  35.720  1.732   1.00 33.97 ? 133 ALA D N     1 
ATOM   6550 C  CA    . ALA D 2 86  ? 19.292  36.977  2.416   1.00 33.78 ? 133 ALA D CA    1 
ATOM   6551 C  C     . ALA D 2 86  ? 17.943  36.911  3.113   1.00 33.86 ? 133 ALA D C     1 
ATOM   6552 O  O     . ALA D 2 86  ? 17.744  37.590  4.114   1.00 33.84 ? 133 ALA D O     1 
ATOM   6553 C  CB    . ALA D 2 86  ? 19.352  38.166  1.453   1.00 33.90 ? 133 ALA D CB    1 
ATOM   6554 N  N     . LYS D 2 87  ? 17.031  36.089  2.591   1.00 34.14 ? 134 LYS D N     1 
ATOM   6555 C  CA    . LYS D 2 87  ? 15.723  35.891  3.194   1.00 34.19 ? 134 LYS D CA    1 
ATOM   6556 C  C     . LYS D 2 87  ? 15.574  34.413  3.634   1.00 34.27 ? 134 LYS D C     1 
ATOM   6557 O  O     . LYS D 2 87  ? 14.584  33.737  3.305   1.00 34.20 ? 134 LYS D O     1 
ATOM   6558 C  CB    . LYS D 2 87  ? 14.651  36.326  2.184   1.00 34.59 ? 134 LYS D CB    1 
ATOM   6559 C  CG    . LYS D 2 87  ? 14.850  37.746  1.611   1.00 33.37 ? 134 LYS D CG    1 
ATOM   6560 N  N     . GLN D 2 88  ? 16.576  33.937  4.381   1.00 33.92 ? 135 GLN D N     1 
ATOM   6561 C  CA    . GLN D 2 88  ? 16.708  32.522  4.732   1.00 33.87 ? 135 GLN D CA    1 
ATOM   6562 C  C     . GLN D 2 88  ? 15.584  32.093  5.652   1.00 33.97 ? 135 GLN D C     1 
ATOM   6563 O  O     . GLN D 2 88  ? 15.398  32.659  6.746   1.00 34.50 ? 135 GLN D O     1 
ATOM   6564 C  CB    . GLN D 2 88  ? 18.061  32.220  5.400   1.00 33.95 ? 135 GLN D CB    1 
ATOM   6565 C  CG    . GLN D 2 88  ? 18.268  30.735  5.839   1.00 33.52 ? 135 GLN D CG    1 
ATOM   6566 C  CD    . GLN D 2 88  ? 19.544  30.522  6.663   1.00 33.59 ? 135 GLN D CD    1 
ATOM   6567 O  OE1   . GLN D 2 88  ? 20.189  31.479  7.092   1.00 36.15 ? 135 GLN D OE1   1 
ATOM   6568 N  NE2   . GLN D 2 88  ? 19.912  29.271  6.879   1.00 31.49 ? 135 GLN D NE2   1 
ATOM   6569 N  N     . ILE D 2 89  ? 14.846  31.084  5.217   1.00 33.38 ? 136 ILE D N     1 
ATOM   6570 C  CA    . ILE D 2 89  ? 13.733  30.577  5.994   1.00 33.21 ? 136 ILE D CA    1 
ATOM   6571 C  C     . ILE D 2 89  ? 14.224  29.702  7.146   1.00 33.31 ? 136 ILE D C     1 
ATOM   6572 O  O     . ILE D 2 89  ? 15.244  29.026  7.034   1.00 33.59 ? 136 ILE D O     1 
ATOM   6573 C  CB    . ILE D 2 89  ? 12.719  29.811  5.082   1.00 33.48 ? 136 ILE D CB    1 
ATOM   6574 C  CG1   . ILE D 2 89  ? 13.407  28.667  4.317   1.00 33.30 ? 136 ILE D CG1   1 
ATOM   6575 C  CG2   . ILE D 2 89  ? 12.050  30.794  4.107   1.00 32.70 ? 136 ILE D CG2   1 
ATOM   6576 C  CD1   . ILE D 2 89  ? 12.468  27.804  3.527   1.00 33.29 ? 136 ILE D CD1   1 
ATOM   6577 N  N     . ASN D 2 90  ? 13.510  29.735  8.263   1.00 33.22 ? 137 ASN D N     1 
ATOM   6578 C  CA    . ASN D 2 90  ? 13.867  28.949  9.449   1.00 33.25 ? 137 ASN D CA    1 
ATOM   6579 C  C     . ASN D 2 90  ? 13.425  27.487  9.310   1.00 33.50 ? 137 ASN D C     1 
ATOM   6580 O  O     . ASN D 2 90  ? 12.329  27.114  9.704   1.00 33.41 ? 137 ASN D O     1 
ATOM   6581 C  CB    . ASN D 2 90  ? 13.241  29.581  10.705  1.00 32.98 ? 137 ASN D CB    1 
ATOM   6582 C  CG    . ASN D 2 90  ? 13.832  29.050  12.005  1.00 32.88 ? 137 ASN D CG    1 
ATOM   6583 O  OD1   . ASN D 2 90  ? 14.546  28.042  12.019  1.00 30.98 ? 137 ASN D OD1   1 
ATOM   6584 N  ND2   . ASN D 2 90  ? 13.545  29.751  13.116  1.00 30.91 ? 137 ASN D ND2   1 
ATOM   6585 N  N     . ILE D 2 91  ? 14.294  26.671  8.730   1.00 33.95 ? 138 ILE D N     1 
ATOM   6586 C  CA    . ILE D 2 91  ? 14.078  25.225  8.622   1.00 33.45 ? 138 ILE D CA    1 
ATOM   6587 C  C     . ILE D 2 91  ? 15.328  24.466  9.045   1.00 33.19 ? 138 ILE D C     1 
ATOM   6588 O  O     . ILE D 2 91  ? 16.465  24.978  8.975   1.00 33.63 ? 138 ILE D O     1 
ATOM   6589 C  CB    . ILE D 2 91  ? 13.728  24.811  7.188   1.00 33.35 ? 138 ILE D CB    1 
ATOM   6590 C  CG1   . ILE D 2 91  ? 14.840  25.169  6.212   1.00 33.06 ? 138 ILE D CG1   1 
ATOM   6591 C  CG2   . ILE D 2 91  ? 12.454  25.483  6.727   1.00 33.81 ? 138 ILE D CG2   1 
ATOM   6592 C  CD1   . ILE D 2 91  ? 14.516  24.640  4.807   1.00 34.56 ? 138 ILE D CD1   1 
ATOM   6593 N  N     . ASP D 2 92  ? 15.125  23.234  9.455   1.00 32.54 ? 139 ASP D N     1 
ATOM   6594 C  CA    . ASP D 2 92  ? 16.209  22.438  9.979   1.00 32.52 ? 139 ASP D CA    1 
ATOM   6595 C  C     . ASP D 2 92  ? 17.113  21.875  8.870   1.00 32.22 ? 139 ASP D C     1 
ATOM   6596 O  O     . ASP D 2 92  ? 16.815  21.991  7.674   1.00 31.75 ? 139 ASP D O     1 
ATOM   6597 C  CB    . ASP D 2 92  ? 15.639  21.338  10.894  1.00 32.52 ? 139 ASP D CB    1 
ATOM   6598 C  CG    . ASP D 2 92  ? 15.116  20.149  10.128  1.00 33.25 ? 139 ASP D CG    1 
ATOM   6599 O  OD1   . ASP D 2 92  ? 14.648  20.302  8.978   1.00 32.83 ? 139 ASP D OD1   1 
ATOM   6600 O  OD2   . ASP D 2 92  ? 15.171  19.043  10.699  1.00 38.03 ? 139 ASP D OD2   1 
ATOM   6601 N  N     . PHE D 2 93  ? 18.221  21.280  9.304   1.00 31.87 ? 140 PHE D N     1 
ATOM   6602 C  CA    . PHE D 2 93  ? 19.217  20.686  8.430   1.00 31.95 ? 140 PHE D CA    1 
ATOM   6603 C  C     . PHE D 2 93  ? 18.639  19.611  7.490   1.00 31.77 ? 140 PHE D C     1 
ATOM   6604 O  O     . PHE D 2 93  ? 18.836  19.682  6.282   1.00 31.79 ? 140 PHE D O     1 
ATOM   6605 C  CB    . PHE D 2 93  ? 20.339  20.107  9.299   1.00 32.19 ? 140 PHE D CB    1 
ATOM   6606 C  CG    . PHE D 2 93  ? 21.472  19.523  8.517   1.00 32.90 ? 140 PHE D CG    1 
ATOM   6607 C  CD1   . PHE D 2 93  ? 22.484  20.341  8.013   1.00 33.28 ? 140 PHE D CD1   1 
ATOM   6608 C  CD2   . PHE D 2 93  ? 21.539  18.156  8.285   1.00 33.33 ? 140 PHE D CD2   1 
ATOM   6609 C  CE1   . PHE D 2 93  ? 23.544  19.801  7.285   1.00 33.25 ? 140 PHE D CE1   1 
ATOM   6610 C  CE2   . PHE D 2 93  ? 22.603  17.605  7.546   1.00 33.45 ? 140 PHE D CE2   1 
ATOM   6611 C  CZ    . PHE D 2 93  ? 23.602  18.431  7.048   1.00 32.87 ? 140 PHE D CZ    1 
ATOM   6612 N  N     . ARG D 2 94  ? 17.924  18.630  8.033   1.00 31.85 ? 141 ARG D N     1 
ATOM   6613 C  CA    . ARG D 2 94  ? 17.402  17.532  7.214   1.00 32.11 ? 141 ARG D CA    1 
ATOM   6614 C  C     . ARG D 2 94  ? 16.503  18.033  6.080   1.00 32.30 ? 141 ARG D C     1 
ATOM   6615 O  O     . ARG D 2 94  ? 16.555  17.502  4.968   1.00 32.45 ? 141 ARG D O     1 
ATOM   6616 C  CB    . ARG D 2 94  ? 16.671  16.492  8.064   1.00 32.10 ? 141 ARG D CB    1 
ATOM   6617 C  CG    . ARG D 2 94  ? 17.576  15.396  8.632   1.00 32.74 ? 141 ARG D CG    1 
ATOM   6618 N  N     . THR D 2 95  ? 15.703  19.062  6.361   1.00 32.37 ? 142 THR D N     1 
ATOM   6619 C  CA    . THR D 2 95  ? 14.780  19.624  5.384   1.00 32.39 ? 142 THR D CA    1 
ATOM   6620 C  C     . THR D 2 95  ? 15.518  20.417  4.304   1.00 32.92 ? 142 THR D C     1 
ATOM   6621 O  O     . THR D 2 95  ? 15.155  20.371  3.120   1.00 32.68 ? 142 THR D O     1 
ATOM   6622 C  CB    . THR D 2 95  ? 13.776  20.520  6.087   1.00 32.26 ? 142 THR D CB    1 
ATOM   6623 O  OG1   . THR D 2 95  ? 13.104  19.742  7.071   1.00 30.84 ? 142 THR D OG1   1 
ATOM   6624 C  CG2   . THR D 2 95  ? 12.755  21.106  5.109   1.00 31.55 ? 142 THR D CG2   1 
ATOM   6625 N  N     . ARG D 2 96  ? 16.544  21.145  4.734   1.00 33.26 ? 143 ARG D N     1 
ATOM   6626 C  CA    . ARG D 2 96  ? 17.384  21.935  3.840   1.00 33.56 ? 143 ARG D CA    1 
ATOM   6627 C  C     . ARG D 2 96  ? 18.246  21.052  2.939   1.00 33.93 ? 143 ARG D C     1 
ATOM   6628 O  O     . ARG D 2 96  ? 18.468  21.380  1.783   1.00 33.80 ? 143 ARG D O     1 
ATOM   6629 C  CB    . ARG D 2 96  ? 18.282  22.865  4.662   1.00 33.50 ? 143 ARG D CB    1 
ATOM   6630 C  CG    . ARG D 2 96  ? 18.928  23.942  3.850   1.00 33.77 ? 143 ARG D CG    1 
ATOM   6631 C  CD    . ARG D 2 96  ? 19.754  24.886  4.682   1.00 34.48 ? 143 ARG D CD    1 
ATOM   6632 N  NE    . ARG D 2 96  ? 21.099  24.350  4.889   1.00 34.76 ? 143 ARG D NE    1 
ATOM   6633 C  CZ    . ARG D 2 96  ? 21.651  24.070  6.065   1.00 34.99 ? 143 ARG D CZ    1 
ATOM   6634 N  NH1   . ARG D 2 96  ? 22.880  23.571  6.079   1.00 36.13 ? 143 ARG D NH1   1 
ATOM   6635 N  NH2   . ARG D 2 96  ? 20.996  24.265  7.217   1.00 33.91 ? 143 ARG D NH2   1 
ATOM   6636 N  N     . GLU D 2 97  ? 18.744  19.947  3.485   1.00 34.51 ? 144 GLU D N     1 
ATOM   6637 C  CA    . GLU D 2 97  ? 19.514  18.981  2.709   1.00 35.10 ? 144 GLU D CA    1 
ATOM   6638 C  C     . GLU D 2 97  ? 18.675  18.275  1.660   1.00 34.84 ? 144 GLU D C     1 
ATOM   6639 O  O     . GLU D 2 97  ? 19.122  18.102  0.528   1.00 35.10 ? 144 GLU D O     1 
ATOM   6640 C  CB    . GLU D 2 97  ? 20.130  17.913  3.619   1.00 35.54 ? 144 GLU D CB    1 
ATOM   6641 C  CG    . GLU D 2 97  ? 21.385  18.359  4.347   1.00 37.54 ? 144 GLU D CG    1 
ATOM   6642 C  CD    . GLU D 2 97  ? 22.550  18.597  3.407   1.00 39.29 ? 144 GLU D CD    1 
ATOM   6643 O  OE1   . GLU D 2 97  ? 23.347  17.644  3.217   1.00 40.28 ? 144 GLU D OE1   1 
ATOM   6644 O  OE2   . GLU D 2 97  ? 22.652  19.724  2.855   1.00 39.15 ? 144 GLU D OE2   1 
ATOM   6645 N  N     . SER D 2 98  ? 17.476  17.843  2.035   1.00 34.44 ? 145 SER D N     1 
ATOM   6646 C  CA    . SER D 2 98  ? 16.628  17.117  1.097   1.00 34.23 ? 145 SER D CA    1 
ATOM   6647 C  C     . SER D 2 98  ? 16.074  18.072  0.026   1.00 34.06 ? 145 SER D C     1 
ATOM   6648 O  O     . SER D 2 98  ? 15.829  17.658  -1.108  1.00 34.56 ? 145 SER D O     1 
ATOM   6649 C  CB    . SER D 2 98  ? 15.523  16.325  1.805   1.00 34.17 ? 145 SER D CB    1 
ATOM   6650 O  OG    . SER D 2 98  ? 14.366  17.102  2.002   1.00 34.49 ? 145 SER D OG    1 
ATOM   6651 N  N     . THR D 2 99  ? 15.905  19.348  0.360   1.00 33.59 ? 146 THR D N     1 
ATOM   6652 C  CA    . THR D 2 99  ? 15.576  20.330  -0.662  1.00 33.42 ? 146 THR D CA    1 
ATOM   6653 C  C     . THR D 2 99  ? 16.768  20.519  -1.606  1.00 33.11 ? 146 THR D C     1 
ATOM   6654 O  O     . THR D 2 99  ? 16.612  20.497  -2.826  1.00 33.21 ? 146 THR D O     1 
ATOM   6655 C  CB    . THR D 2 99  ? 15.176  21.668  -0.062  1.00 33.24 ? 146 THR D CB    1 
ATOM   6656 O  OG1   . THR D 2 99  ? 14.007  21.500  0.739   1.00 33.89 ? 146 THR D OG1   1 
ATOM   6657 C  CG2   . THR D 2 99  ? 14.856  22.630  -1.147  1.00 33.31 ? 146 THR D CG2   1 
ATOM   6658 N  N     . ALA D 2 100 ? 17.954  20.675  -1.036  1.00 32.71 ? 147 ALA D N     1 
ATOM   6659 C  CA    . ALA D 2 100 ? 19.171  20.827  -1.818  1.00 32.79 ? 147 ALA D CA    1 
ATOM   6660 C  C     . ALA D 2 100 ? 19.340  19.733  -2.897  1.00 32.90 ? 147 ALA D C     1 
ATOM   6661 O  O     . ALA D 2 100 ? 19.641  20.051  -4.046  1.00 32.51 ? 147 ALA D O     1 
ATOM   6662 C  CB    . ALA D 2 100 ? 20.388  20.874  -0.898  1.00 32.44 ? 147 ALA D CB    1 
ATOM   6663 N  N     . LYS D 2 101 ? 19.128  18.469  -2.523  1.00 33.14 ? 148 LYS D N     1 
ATOM   6664 C  CA    . LYS D 2 101 ? 19.253  17.332  -3.447  1.00 33.53 ? 148 LYS D CA    1 
ATOM   6665 C  C     . LYS D 2 101 ? 18.235  17.393  -4.593  1.00 33.90 ? 148 LYS D C     1 
ATOM   6666 O  O     . LYS D 2 101 ? 18.511  16.894  -5.686  1.00 33.86 ? 148 LYS D O     1 
ATOM   6667 C  CB    . LYS D 2 101 ? 19.110  15.994  -2.705  1.00 33.54 ? 148 LYS D CB    1 
ATOM   6668 C  CG    . LYS D 2 101 ? 20.187  15.730  -1.663  1.00 33.68 ? 148 LYS D CG    1 
ATOM   6669 N  N     . LYS D 2 102 ? 17.075  18.005  -4.336  1.00 34.34 ? 149 LYS D N     1 
ATOM   6670 C  CA    . LYS D 2 102 ? 15.964  18.057  -5.297  1.00 34.61 ? 149 LYS D CA    1 
ATOM   6671 C  C     . LYS D 2 102 ? 16.094  19.175  -6.330  1.00 34.80 ? 149 LYS D C     1 
ATOM   6672 O  O     . LYS D 2 102 ? 15.418  19.150  -7.360  1.00 35.08 ? 149 LYS D O     1 
ATOM   6673 C  CB    . LYS D 2 102 ? 14.622  18.154  -4.531  1.00 34.96 ? 149 LYS D CB    1 
ATOM   6674 C  CG    . LYS D 2 102 ? 14.256  16.830  -3.776  1.00 34.53 ? 149 LYS D CG    1 
ATOM   6675 C  CD    . LYS D 2 102 ? 13.148  16.970  -2.696  1.00 34.44 ? 149 LYS D CD    1 
ATOM   6676 C  CE    . LYS D 2 102 ? 13.238  15.810  -1.644  1.00 34.83 ? 149 LYS D CE    1 
ATOM   6677 N  NZ    . LYS D 2 102 ? 11.958  15.060  -1.356  1.00 33.32 ? 149 LYS D NZ    1 
ATOM   6678 N  N     . ILE D 2 103 ? 16.980  20.131  -6.065  1.00 35.23 ? 150 ILE D N     1 
ATOM   6679 C  CA    . ILE D 2 103 ? 17.174  21.301  -6.933  1.00 35.51 ? 150 ILE D CA    1 
ATOM   6680 C  C     . ILE D 2 103 ? 17.816  20.914  -8.269  1.00 35.96 ? 150 ILE D C     1 
ATOM   6681 O  O     . ILE D 2 103 ? 17.556  21.549  -9.299  1.00 35.80 ? 150 ILE D O     1 
ATOM   6682 C  CB    . ILE D 2 103 ? 18.039  22.386  -6.219  1.00 35.58 ? 150 ILE D CB    1 
ATOM   6683 C  CG1   . ILE D 2 103 ? 17.320  22.928  -4.986  1.00 35.31 ? 150 ILE D CG1   1 
ATOM   6684 C  CG2   . ILE D 2 103 ? 18.373  23.564  -7.136  1.00 36.09 ? 150 ILE D CG2   1 
ATOM   6685 C  CD1   . ILE D 2 103 ? 15.940  23.502  -5.262  1.00 34.90 ? 150 ILE D CD1   1 
ATOM   6686 N  N     . LYS D 2 104 ? 18.623  19.851  -8.249  1.00 36.43 ? 151 LYS D N     1 
ATOM   6687 C  CA    . LYS D 2 104 ? 19.363  19.397  -9.438  1.00 36.33 ? 151 LYS D CA    1 
ATOM   6688 C  C     . LYS D 2 104 ? 18.428  18.958  -10.547 1.00 36.30 ? 151 LYS D C     1 
ATOM   6689 O  O     . LYS D 2 104 ? 18.581  19.385  -11.687 1.00 36.54 ? 151 LYS D O     1 
ATOM   6690 C  CB    . LYS D 2 104 ? 20.297  18.235  -9.092  1.00 36.46 ? 151 LYS D CB    1 
ATOM   6691 N  N     . ALA D 2 105 ? 17.466  18.098  -10.216 1.00 36.10 ? 152 ALA D N     1 
ATOM   6692 C  CA    . ALA D 2 105 ? 16.472  17.622  -11.199 1.00 35.83 ? 152 ALA D CA    1 
ATOM   6693 C  C     . ALA D 2 105 ? 15.080  17.877  -10.639 1.00 35.49 ? 152 ALA D C     1 
ATOM   6694 O  O     . ALA D 2 105 ? 14.427  16.966  -10.140 1.00 35.49 ? 152 ALA D O     1 
ATOM   6695 C  CB    . ALA D 2 105 ? 16.668  16.132  -11.500 1.00 35.71 ? 152 ALA D CB    1 
ATOM   6696 N  N     . PRO D 2 106 ? 14.616  19.128  -10.724 1.00 35.13 ? 153 PRO D N     1 
ATOM   6697 C  CA    . PRO D 2 106 ? 13.474  19.499  -9.913  1.00 34.87 ? 153 PRO D CA    1 
ATOM   6698 C  C     . PRO D 2 106 ? 12.147  19.188  -10.592 1.00 34.56 ? 153 PRO D C     1 
ATOM   6699 O  O     . PRO D 2 106 ? 11.995  19.406  -11.786 1.00 34.47 ? 153 PRO D O     1 
ATOM   6700 C  CB    . PRO D 2 106 ? 13.666  21.003  -9.716  1.00 34.54 ? 153 PRO D CB    1 
ATOM   6701 C  CG    . PRO D 2 106 ? 14.522  21.444  -10.844 1.00 35.11 ? 153 PRO D CG    1 
ATOM   6702 C  CD    . PRO D 2 106 ? 15.071  20.247  -11.561 1.00 34.90 ? 153 PRO D CD    1 
ATOM   6703 N  N     . THR D 2 107 ? 11.212  18.670  -9.802  1.00 34.43 ? 154 THR D N     1 
ATOM   6704 C  CA    . THR D 2 107 ? 9.839   18.431  -10.216 1.00 34.28 ? 154 THR D CA    1 
ATOM   6705 C  C     . THR D 2 107 ? 8.948   19.518  -9.581  1.00 34.56 ? 154 THR D C     1 
ATOM   6706 O  O     . THR D 2 107 ? 9.437   20.325  -8.779  1.00 34.52 ? 154 THR D O     1 
ATOM   6707 C  CB    . THR D 2 107 ? 9.388   17.049  -9.738  1.00 34.21 ? 154 THR D CB    1 
ATOM   6708 O  OG1   . THR D 2 107 ? 9.239   17.083  -8.320  1.00 33.31 ? 154 THR D OG1   1 
ATOM   6709 C  CG2   . THR D 2 107 ? 10.414  15.984  -10.114 1.00 33.71 ? 154 THR D CG2   1 
ATOM   6710 N  N     . PRO D 2 108 ? 7.648   19.554  -9.937  1.00 34.84 ? 155 PRO D N     1 
ATOM   6711 C  CA    . PRO D 2 108 ? 6.726   20.550  -9.376  1.00 35.06 ? 155 PRO D CA    1 
ATOM   6712 C  C     . PRO D 2 108 ? 6.522   20.504  -7.857  1.00 35.53 ? 155 PRO D C     1 
ATOM   6713 O  O     . PRO D 2 108 ? 6.201   21.531  -7.254  1.00 35.82 ? 155 PRO D O     1 
ATOM   6714 C  CB    . PRO D 2 108 ? 5.400   20.233  -10.081 1.00 35.25 ? 155 PRO D CB    1 
ATOM   6715 C  CG    . PRO D 2 108 ? 5.790   19.521  -11.327 1.00 34.74 ? 155 PRO D CG    1 
ATOM   6716 C  CD    . PRO D 2 108 ? 6.965   18.697  -10.927 1.00 34.78 ? 155 PRO D CD    1 
ATOM   6717 N  N     . THR D 2 109 ? 6.704   19.344  -7.234  1.00 35.76 ? 156 THR D N     1 
ATOM   6718 C  CA    . THR D 2 109 ? 6.535   19.236  -5.779  1.00 35.98 ? 156 THR D CA    1 
ATOM   6719 C  C     . THR D 2 109 ? 7.841   19.473  -5.005  1.00 36.32 ? 156 THR D C     1 
ATOM   6720 O  O     . THR D 2 109 ? 7.914   19.194  -3.802  1.00 36.34 ? 156 THR D O     1 
ATOM   6721 C  CB    . THR D 2 109 ? 5.939   17.858  -5.360  1.00 36.07 ? 156 THR D CB    1 
ATOM   6722 O  OG1   . THR D 2 109 ? 6.823   16.798  -5.745  1.00 35.62 ? 156 THR D OG1   1 
ATOM   6723 C  CG2   . THR D 2 109 ? 4.561   17.639  -5.991  1.00 35.68 ? 156 THR D CG2   1 
ATOM   6724 N  N     . CYS D 2 110 ? 8.855   20.010  -5.685  1.00 36.34 ? 157 CYS D N     1 
ATOM   6725 C  CA    . CYS D 2 110 ? 10.201  20.114  -5.135  1.00 36.26 ? 157 CYS D CA    1 
ATOM   6726 C  C     . CYS D 2 110 ? 10.251  20.726  -3.740  1.00 36.53 ? 157 CYS D C     1 
ATOM   6727 O  O     . CYS D 2 110 ? 10.946  20.214  -2.851  1.00 36.44 ? 157 CYS D O     1 
ATOM   6728 C  CB    . CYS D 2 110 ? 11.071  20.935  -6.081  1.00 36.49 ? 157 CYS D CB    1 
ATOM   6729 S  SG    . CYS D 2 110 ? 12.750  21.240  -5.507  1.00 36.42 ? 157 CYS D SG    1 
ATOM   6730 N  N     . PHE D 2 111 ? 9.522   21.824  -3.547  1.00 36.69 ? 158 PHE D N     1 
ATOM   6731 C  CA    . PHE D 2 111 ? 9.586   22.579  -2.295  1.00 36.34 ? 158 PHE D CA    1 
ATOM   6732 C  C     . PHE D 2 111 ? 8.446   22.264  -1.325  1.00 36.57 ? 158 PHE D C     1 
ATOM   6733 O  O     . PHE D 2 111 ? 8.349   22.901  -0.274  1.00 37.00 ? 158 PHE D O     1 
ATOM   6734 C  CB    . PHE D 2 111 ? 9.635   24.084  -2.582  1.00 36.30 ? 158 PHE D CB    1 
ATOM   6735 C  CG    . PHE D 2 111 ? 10.896  24.534  -3.282  1.00 36.43 ? 158 PHE D CG    1 
ATOM   6736 C  CD1   . PHE D 2 111 ? 12.096  24.646  -2.591  1.00 36.97 ? 158 PHE D CD1   1 
ATOM   6737 C  CD2   . PHE D 2 111 ? 10.881  24.870  -4.632  1.00 36.93 ? 158 PHE D CD2   1 
ATOM   6738 C  CE1   . PHE D 2 111 ? 13.262  25.069  -3.249  1.00 36.90 ? 158 PHE D CE1   1 
ATOM   6739 C  CE2   . PHE D 2 111 ? 12.037  25.289  -5.280  1.00 36.05 ? 158 PHE D CE2   1 
ATOM   6740 C  CZ    . PHE D 2 111 ? 13.224  25.379  -4.590  1.00 35.75 ? 158 PHE D CZ    1 
ATOM   6741 N  N     . ASP D 2 112 ? 7.608   21.278  -1.636  1.00 36.79 ? 159 ASP D N     1 
ATOM   6742 C  CA    . ASP D 2 112 ? 6.502   20.916  -0.729  1.00 37.19 ? 159 ASP D CA    1 
ATOM   6743 C  C     . ASP D 2 112 ? 6.959   20.742  0.722   1.00 37.12 ? 159 ASP D C     1 
ATOM   6744 O  O     . ASP D 2 112 ? 6.331   21.262  1.641   1.00 37.00 ? 159 ASP D O     1 
ATOM   6745 C  CB    . ASP D 2 112 ? 5.793   19.632  -1.177  1.00 37.05 ? 159 ASP D CB    1 
ATOM   6746 C  CG    . ASP D 2 112 ? 4.735   19.888  -2.228  1.00 38.47 ? 159 ASP D CG    1 
ATOM   6747 O  OD1   . ASP D 2 112 ? 4.503   21.070  -2.557  1.00 40.46 ? 159 ASP D OD1   1 
ATOM   6748 O  OD2   . ASP D 2 112 ? 4.127   18.911  -2.732  1.00 39.98 ? 159 ASP D OD2   1 
ATOM   6749 N  N     . GLU D 2 113 ? 8.044   20.001  0.918   1.00 37.13 ? 160 GLU D N     1 
ATOM   6750 C  CA    . GLU D 2 113 ? 8.561   19.733  2.259   1.00 37.46 ? 160 GLU D CA    1 
ATOM   6751 C  C     . GLU D 2 113 ? 8.847   21.015  3.032   1.00 37.19 ? 160 GLU D C     1 
ATOM   6752 O  O     . GLU D 2 113 ? 8.373   21.203  4.156   1.00 37.16 ? 160 GLU D O     1 
ATOM   6753 C  CB    . GLU D 2 113 ? 9.853   18.909  2.195   1.00 37.50 ? 160 GLU D CB    1 
ATOM   6754 C  CG    . GLU D 2 113 ? 9.749   17.553  2.855   1.00 38.20 ? 160 GLU D CG    1 
ATOM   6755 C  CD    . GLU D 2 113 ? 11.064  16.788  2.826   1.00 38.73 ? 160 GLU D CD    1 
ATOM   6756 O  OE1   . GLU D 2 113 ? 11.806  16.928  1.826   1.00 39.95 ? 160 GLU D OE1   1 
ATOM   6757 O  OE2   . GLU D 2 113 ? 11.354  16.047  3.803   1.00 40.78 ? 160 GLU D OE2   1 
ATOM   6758 N  N     . ALA D 2 114 ? 9.629   21.893  2.426   1.00 37.03 ? 161 ALA D N     1 
ATOM   6759 C  CA    . ALA D 2 114 ? 9.980   23.145  3.080   1.00 36.94 ? 161 ALA D CA    1 
ATOM   6760 C  C     . ALA D 2 114 ? 8.747   24.045  3.201   1.00 37.09 ? 161 ALA D C     1 
ATOM   6761 O  O     . ALA D 2 114 ? 8.578   24.742  4.209   1.00 37.53 ? 161 ALA D O     1 
ATOM   6762 C  CB    . ALA D 2 114 ? 11.116  23.858  2.339   1.00 36.70 ? 161 ALA D CB    1 
ATOM   6763 N  N     . GLN D 2 115 ? 7.876   24.024  2.196   1.00 36.99 ? 162 GLN D N     1 
ATOM   6764 C  CA    . GLN D 2 115 ? 6.658   24.821  2.260   1.00 37.13 ? 162 GLN D CA    1 
ATOM   6765 C  C     . GLN D 2 115 ? 5.800   24.420  3.471   1.00 37.38 ? 162 GLN D C     1 
ATOM   6766 O  O     . GLN D 2 115 ? 5.297   25.273  4.198   1.00 37.95 ? 162 GLN D O     1 
ATOM   6767 C  CB    . GLN D 2 115 ? 5.842   24.695  0.966   1.00 37.00 ? 162 GLN D CB    1 
ATOM   6768 C  CG    . GLN D 2 115 ? 4.599   25.576  0.956   1.00 36.73 ? 162 GLN D CG    1 
ATOM   6769 C  CD    . GLN D 2 115 ? 3.953   25.675  -0.417  1.00 37.04 ? 162 GLN D CD    1 
ATOM   6770 O  OE1   . GLN D 2 115 ? 3.893   24.695  -1.161  1.00 37.17 ? 162 GLN D OE1   1 
ATOM   6771 N  NE2   . GLN D 2 115 ? 3.455   26.865  -0.753  1.00 36.15 ? 162 GLN D NE2   1 
ATOM   6772 N  N     . LYS D 2 116 ? 5.632   23.126  3.687   1.00 37.32 ? 163 LYS D N     1 
ATOM   6773 C  CA    . LYS D 2 116 ? 4.830   22.666  4.813   1.00 37.66 ? 163 LYS D CA    1 
ATOM   6774 C  C     . LYS D 2 116 ? 5.387   23.178  6.142   1.00 37.64 ? 163 LYS D C     1 
ATOM   6775 O  O     . LYS D 2 116 ? 4.634   23.663  6.986   1.00 37.80 ? 163 LYS D O     1 
ATOM   6776 C  CB    . LYS D 2 116 ? 4.735   21.138  4.858   1.00 37.67 ? 163 LYS D CB    1 
ATOM   6777 C  CG    . LYS D 2 116 ? 3.986   20.623  6.088   1.00 37.99 ? 163 LYS D CG    1 
ATOM   6778 N  N     . VAL D 2 117 ? 6.703   23.079  6.314   1.00 37.42 ? 164 VAL D N     1 
ATOM   6779 C  CA    . VAL D 2 117 ? 7.346   23.525  7.553   1.00 37.20 ? 164 VAL D CA    1 
ATOM   6780 C  C     . VAL D 2 117 ? 7.212   25.033  7.779   1.00 37.04 ? 164 VAL D C     1 
ATOM   6781 O  O     . VAL D 2 117 ? 7.062   25.470  8.919   1.00 37.06 ? 164 VAL D O     1 
ATOM   6782 C  CB    . VAL D 2 117 ? 8.846   23.095  7.625   1.00 37.56 ? 164 VAL D CB    1 
ATOM   6783 C  CG1   . VAL D 2 117 ? 9.635   23.930  8.659   1.00 36.12 ? 164 VAL D CG1   1 
ATOM   6784 C  CG2   . VAL D 2 117 ? 8.949   21.589  7.926   1.00 36.99 ? 164 VAL D CG2   1 
ATOM   6785 N  N     . ILE D 2 118 ? 7.257   25.823  6.712   1.00 36.88 ? 165 ILE D N     1 
ATOM   6786 C  CA    . ILE D 2 118 ? 7.076   27.266  6.846   1.00 36.79 ? 165 ILE D CA    1 
ATOM   6787 C  C     . ILE D 2 118 ? 5.605   27.645  7.024   1.00 36.89 ? 165 ILE D C     1 
ATOM   6788 O  O     . ILE D 2 118 ? 5.299   28.604  7.715   1.00 37.50 ? 165 ILE D O     1 
ATOM   6789 C  CB    . ILE D 2 118 ? 7.737   28.036  5.690   1.00 36.81 ? 165 ILE D CB    1 
ATOM   6790 C  CG1   . ILE D 2 118 ? 9.259   27.823  5.729   1.00 36.51 ? 165 ILE D CG1   1 
ATOM   6791 C  CG2   . ILE D 2 118 ? 7.439   29.527  5.783   1.00 36.25 ? 165 ILE D CG2   1 
ATOM   6792 C  CD1   . ILE D 2 118 ? 9.928   28.244  7.046   1.00 34.01 ? 165 ILE D CD1   1 
ATOM   6793 N  N     . TYR D 2 119 ? 4.689   26.875  6.462   1.00 36.83 ? 166 TYR D N     1 
ATOM   6794 C  CA    . TYR D 2 119 ? 3.279   27.062  6.766   1.00 36.88 ? 166 TYR D CA    1 
ATOM   6795 C  C     . TYR D 2 119 ? 2.984   26.786  8.242   1.00 36.66 ? 166 TYR D C     1 
ATOM   6796 O  O     . TYR D 2 119 ? 2.347   27.583  8.922   1.00 36.88 ? 166 TYR D O     1 
ATOM   6797 C  CB    . TYR D 2 119 ? 2.444   26.138  5.897   1.00 37.11 ? 166 TYR D CB    1 
ATOM   6798 C  CG    . TYR D 2 119 ? 0.965   26.359  6.036   1.00 37.45 ? 166 TYR D CG    1 
ATOM   6799 C  CD1   . TYR D 2 119 ? 0.347   27.448  5.431   1.00 37.98 ? 166 TYR D CD1   1 
ATOM   6800 C  CD2   . TYR D 2 119 ? 0.179   25.480  6.763   1.00 37.66 ? 166 TYR D CD2   1 
ATOM   6801 C  CE1   . TYR D 2 119 ? -1.027  27.657  5.546   1.00 38.20 ? 166 TYR D CE1   1 
ATOM   6802 C  CE2   . TYR D 2 119 ? -1.196  25.676  6.881   1.00 38.49 ? 166 TYR D CE2   1 
ATOM   6803 C  CZ    . TYR D 2 119 ? -1.795  26.767  6.272   1.00 37.95 ? 166 TYR D CZ    1 
ATOM   6804 O  OH    . TYR D 2 119 ? -3.156  26.959  6.392   1.00 37.59 ? 166 TYR D OH    1 
ATOM   6805 N  N     . THR D 2 120 ? 3.451   25.640  8.727   1.00 36.56 ? 167 THR D N     1 
ATOM   6806 C  CA    . THR D 2 120 ? 3.270   25.243  10.128  1.00 36.10 ? 167 THR D CA    1 
ATOM   6807 C  C     . THR D 2 120 ? 3.878   26.282  11.080  1.00 36.16 ? 167 THR D C     1 
ATOM   6808 O  O     . THR D 2 120 ? 3.292   26.583  12.115  1.00 36.23 ? 167 THR D O     1 
ATOM   6809 C  CB    . THR D 2 120 ? 3.824   23.791  10.365  1.00 36.14 ? 167 THR D CB    1 
ATOM   6810 O  OG1   . THR D 2 120 ? 3.067   22.859  9.574   1.00 33.93 ? 167 THR D OG1   1 
ATOM   6811 C  CG2   . THR D 2 120 ? 3.757   23.379  11.842  1.00 34.85 ? 167 THR D CG2   1 
ATOM   6812 N  N     . LEU D 2 121 ? 5.023   26.842  10.704  1.00 35.95 ? 168 LEU D N     1 
ATOM   6813 C  CA    . LEU D 2 121 ? 5.704   27.857  11.507  1.00 36.09 ? 168 LEU D CA    1 
ATOM   6814 C  C     . LEU D 2 121 ? 4.879   29.139  11.541  1.00 36.25 ? 168 LEU D C     1 
ATOM   6815 O  O     . LEU D 2 121 ? 4.740   29.749  12.595  1.00 36.56 ? 168 LEU D O     1 
ATOM   6816 C  CB    . LEU D 2 121 ? 7.126   28.117  10.959  1.00 36.19 ? 168 LEU D CB    1 
ATOM   6817 C  CG    . LEU D 2 121 ? 7.894   29.387  11.376  1.00 36.57 ? 168 LEU D CG    1 
ATOM   6818 C  CD1   . LEU D 2 121 ? 8.017   29.493  12.876  1.00 36.19 ? 168 LEU D CD1   1 
ATOM   6819 C  CD2   . LEU D 2 121 ? 9.286   29.450  10.719  1.00 35.84 ? 168 LEU D CD2   1 
ATOM   6820 N  N     . MET D 2 122 ? 4.356   29.554  10.390  1.00 36.29 ? 169 MET D N     1 
ATOM   6821 C  CA    . MET D 2 122 ? 3.479   30.719  10.323  1.00 36.36 ? 169 MET D CA    1 
ATOM   6822 C  C     . MET D 2 122 ? 2.198   30.416  11.082  1.00 36.03 ? 169 MET D C     1 
ATOM   6823 O  O     . MET D 2 122 ? 1.722   31.246  11.848  1.00 36.09 ? 169 MET D O     1 
ATOM   6824 C  CB    . MET D 2 122 ? 3.131   31.079  8.866   1.00 36.38 ? 169 MET D CB    1 
ATOM   6825 C  CG    . MET D 2 122 ? 4.231   31.818  8.097   1.00 36.60 ? 169 MET D CG    1 
ATOM   6826 S  SD    . MET D 2 122 ? 3.726   32.448  6.464   1.00 37.16 ? 169 MET D SD    1 
ATOM   6827 C  CE    . MET D 2 122 ? 3.129   30.969  5.637   1.00 35.84 ? 169 MET D CE    1 
ATOM   6828 N  N     . GLU D 2 123 ? 1.647   29.228  10.858  1.00 35.44 ? 170 GLU D N     1 
ATOM   6829 C  CA    . GLU D 2 123 ? 0.363   28.863  11.442  1.00 35.58 ? 170 GLU D CA    1 
ATOM   6830 C  C     . GLU D 2 123 ? 0.411   28.798  12.965  1.00 34.90 ? 170 GLU D C     1 
ATOM   6831 O  O     . GLU D 2 123 ? -0.510  29.272  13.621  1.00 34.60 ? 170 GLU D O     1 
ATOM   6832 C  CB    . GLU D 2 123 ? -0.132  27.525  10.862  1.00 35.60 ? 170 GLU D CB    1 
ATOM   6833 C  CG    . GLU D 2 123 ? -1.570  27.152  11.238  1.00 35.98 ? 170 GLU D CG    1 
ATOM   6834 C  CD    . GLU D 2 123 ? -1.965  25.723  10.829  1.00 36.64 ? 170 GLU D CD    1 
ATOM   6835 O  OE1   . GLU D 2 123 ? -1.119  24.975  10.280  1.00 37.11 ? 170 GLU D OE1   1 
ATOM   6836 O  OE2   . GLU D 2 123 ? -3.140  25.346  11.057  1.00 38.18 ? 170 GLU D OE2   1 
ATOM   6837 N  N     . LYS D 2 124 ? 1.471   28.209  13.515  1.00 34.46 ? 171 LYS D N     1 
ATOM   6838 C  CA    . LYS D 2 124 ? 1.568   27.989  14.963  1.00 34.38 ? 171 LYS D CA    1 
ATOM   6839 C  C     . LYS D 2 124 ? 2.080   29.207  15.762  1.00 34.13 ? 171 LYS D C     1 
ATOM   6840 O  O     . LYS D 2 124 ? 1.678   29.379  16.907  1.00 34.30 ? 171 LYS D O     1 
ATOM   6841 C  CB    . LYS D 2 124 ? 2.405   26.728  15.264  1.00 34.20 ? 171 LYS D CB    1 
ATOM   6842 N  N     . ASP D 2 125 ? 2.930   30.053  15.166  1.00 33.89 ? 172 ASP D N     1 
ATOM   6843 C  CA    . ASP D 2 125 ? 3.550   31.183  15.893  1.00 33.80 ? 172 ASP D CA    1 
ATOM   6844 C  C     . ASP D 2 125 ? 2.975   32.556  15.507  1.00 34.08 ? 172 ASP D C     1 
ATOM   6845 O  O     . ASP D 2 125 ? 2.426   33.271  16.347  1.00 34.00 ? 172 ASP D O     1 
ATOM   6846 C  CB    . ASP D 2 125 ? 5.073   31.194  15.655  1.00 33.49 ? 172 ASP D CB    1 
ATOM   6847 C  CG    . ASP D 2 125 ? 5.809   32.157  16.580  1.00 32.84 ? 172 ASP D CG    1 
ATOM   6848 O  OD1   . ASP D 2 125 ? 5.560   32.121  17.805  1.00 31.20 ? 172 ASP D OD1   1 
ATOM   6849 O  OD2   . ASP D 2 125 ? 6.645   32.948  16.087  1.00 30.85 ? 172 ASP D OD2   1 
ATOM   6850 N  N     . SER D 2 126 ? 3.130   32.919  14.235  1.00 34.28 ? 173 SER D N     1 
ATOM   6851 C  CA    . SER D 2 126 ? 2.825   34.266  13.754  1.00 34.19 ? 173 SER D CA    1 
ATOM   6852 C  C     . SER D 2 126 ? 1.305   34.528  13.676  1.00 34.21 ? 173 SER D C     1 
ATOM   6853 O  O     . SER D 2 126 ? 0.820   35.600  14.045  1.00 34.68 ? 173 SER D O     1 
ATOM   6854 C  CB    . SER D 2 126 ? 3.482   34.471  12.387  1.00 34.19 ? 173 SER D CB    1 
ATOM   6855 O  OG    . SER D 2 126 ? 4.876   34.176  12.433  1.00 34.35 ? 173 SER D OG    1 
ATOM   6856 N  N     . TYR D 2 127 ? 0.559   33.530  13.232  1.00 33.80 ? 174 TYR D N     1 
ATOM   6857 C  CA    . TYR D 2 127 ? -0.866  33.675  12.954  1.00 33.67 ? 174 TYR D CA    1 
ATOM   6858 C  C     . TYR D 2 127 ? -1.728  33.896  14.201  1.00 33.59 ? 174 TYR D C     1 
ATOM   6859 O  O     . TYR D 2 127 ? -2.601  34.765  14.197  1.00 33.68 ? 174 TYR D O     1 
ATOM   6860 C  CB    . TYR D 2 127 ? -1.344  32.452  12.144  1.00 33.72 ? 174 TYR D CB    1 
ATOM   6861 C  CG    . TYR D 2 127 ? -2.836  32.303  11.934  1.00 33.41 ? 174 TYR D CG    1 
ATOM   6862 C  CD1   . TYR D 2 127 ? -3.544  33.174  11.112  1.00 33.31 ? 174 TYR D CD1   1 
ATOM   6863 C  CD2   . TYR D 2 127 ? -3.532  31.251  12.527  1.00 33.30 ? 174 TYR D CD2   1 
ATOM   6864 C  CE1   . TYR D 2 127 ? -4.924  33.010  10.909  1.00 33.31 ? 174 TYR D CE1   1 
ATOM   6865 C  CE2   . TYR D 2 127 ? -4.892  31.081  12.333  1.00 33.12 ? 174 TYR D CE2   1 
ATOM   6866 C  CZ    . TYR D 2 127 ? -5.586  31.956  11.527  1.00 33.26 ? 174 TYR D CZ    1 
ATOM   6867 O  OH    . TYR D 2 127 ? -6.943  31.759  11.347  1.00 33.40 ? 174 TYR D OH    1 
ATOM   6868 N  N     . PRO D 2 128 ? -1.489  33.131  15.277  1.00 33.54 ? 175 PRO D N     1 
ATOM   6869 C  CA    . PRO D 2 128 ? -2.282  33.409  16.494  1.00 33.46 ? 175 PRO D CA    1 
ATOM   6870 C  C     . PRO D 2 128 ? -2.110  34.839  16.996  1.00 33.27 ? 175 PRO D C     1 
ATOM   6871 O  O     . PRO D 2 128 ? -3.049  35.427  17.514  1.00 33.68 ? 175 PRO D O     1 
ATOM   6872 C  CB    . PRO D 2 128 ? -1.746  32.391  17.515  1.00 33.41 ? 175 PRO D CB    1 
ATOM   6873 C  CG    . PRO D 2 128 ? -1.119  31.281  16.660  1.00 33.65 ? 175 PRO D CG    1 
ATOM   6874 C  CD    . PRO D 2 128 ? -0.544  32.016  15.470  1.00 33.47 ? 175 PRO D CD    1 
ATOM   6875 N  N     . ARG D 2 129 ? -0.923  35.396  16.802  1.00 33.10 ? 176 ARG D N     1 
ATOM   6876 C  CA    . ARG D 2 129 ? -0.618  36.759  17.221  1.00 32.82 ? 176 ARG D CA    1 
ATOM   6877 C  C     . ARG D 2 129 ? -1.256  37.787  16.272  1.00 32.64 ? 176 ARG D C     1 
ATOM   6878 O  O     . ARG D 2 129 ? -1.857  38.768  16.728  1.00 32.82 ? 176 ARG D O     1 
ATOM   6879 C  CB    . ARG D 2 129 ? 0.901   36.930  17.295  1.00 32.84 ? 176 ARG D CB    1 
ATOM   6880 C  CG    . ARG D 2 129 ? 1.384   37.580  18.572  1.00 33.10 ? 176 ARG D CG    1 
ATOM   6881 C  CD    . ARG D 2 129 ? 2.784   37.112  18.973  1.00 32.51 ? 176 ARG D CD    1 
ATOM   6882 N  NE    . ARG D 2 129 ? 3.687   36.930  17.837  1.00 32.14 ? 176 ARG D NE    1 
ATOM   6883 C  CZ    . ARG D 2 129 ? 4.340   35.804  17.541  1.00 32.37 ? 176 ARG D CZ    1 
ATOM   6884 N  NH1   . ARG D 2 129 ? 4.214   34.711  18.289  1.00 31.88 ? 176 ARG D NH1   1 
ATOM   6885 N  NH2   . ARG D 2 129 ? 5.138   35.772  16.479  1.00 31.46 ? 176 ARG D NH2   1 
ATOM   6886 N  N     . PHE D 2 130 ? -1.144  37.548  14.963  1.00 32.28 ? 177 PHE D N     1 
ATOM   6887 C  CA    . PHE D 2 130 ? -1.849  38.352  13.954  1.00 32.24 ? 177 PHE D CA    1 
ATOM   6888 C  C     . PHE D 2 130 ? -3.293  38.637  14.378  1.00 32.19 ? 177 PHE D C     1 
ATOM   6889 O  O     . PHE D 2 130 ? -3.729  39.791  14.381  1.00 32.14 ? 177 PHE D O     1 
ATOM   6890 C  CB    . PHE D 2 130 ? -1.841  37.634  12.591  1.00 32.04 ? 177 PHE D CB    1 
ATOM   6891 C  CG    . PHE D 2 130 ? -2.682  38.312  11.525  1.00 31.87 ? 177 PHE D CG    1 
ATOM   6892 C  CD1   . PHE D 2 130 ? -2.322  39.561  11.024  1.00 32.22 ? 177 PHE D CD1   1 
ATOM   6893 C  CD2   . PHE D 2 130 ? -3.818  37.693  11.009  1.00 31.51 ? 177 PHE D CD2   1 
ATOM   6894 C  CE1   . PHE D 2 130 ? -3.094  40.194  10.039  1.00 31.50 ? 177 PHE D CE1   1 
ATOM   6895 C  CE2   . PHE D 2 130 ? -4.578  38.313  10.033  1.00 31.26 ? 177 PHE D CE2   1 
ATOM   6896 C  CZ    . PHE D 2 130 ? -4.215  39.567  9.547   1.00 31.07 ? 177 PHE D CZ    1 
ATOM   6897 N  N     . LEU D 2 131 ? -4.011  37.578  14.764  1.00 32.16 ? 178 LEU D N     1 
ATOM   6898 C  CA    . LEU D 2 131 ? -5.427  37.676  15.147  1.00 32.08 ? 178 LEU D CA    1 
ATOM   6899 C  C     . LEU D 2 131 ? -5.675  38.580  16.357  1.00 32.30 ? 178 LEU D C     1 
ATOM   6900 O  O     . LEU D 2 131 ? -6.804  38.994  16.591  1.00 32.61 ? 178 LEU D O     1 
ATOM   6901 C  CB    . LEU D 2 131 ? -6.024  36.278  15.410  1.00 31.93 ? 178 LEU D CB    1 
ATOM   6902 C  CG    . LEU D 2 131 ? -5.965  35.254  14.252  1.00 31.52 ? 178 LEU D CG    1 
ATOM   6903 C  CD1   . LEU D 2 131 ? -6.385  33.848  14.698  1.00 29.95 ? 178 LEU D CD1   1 
ATOM   6904 C  CD2   . LEU D 2 131 ? -6.788  35.706  13.057  1.00 30.98 ? 178 LEU D CD2   1 
ATOM   6905 N  N     . LYS D 2 132 ? -4.630  38.885  17.118  1.00 32.58 ? 179 LYS D N     1 
ATOM   6906 C  CA    . LYS D 2 132 ? -4.745  39.760  18.286  1.00 32.83 ? 179 LYS D CA    1 
ATOM   6907 C  C     . LYS D 2 132 ? -4.089  41.140  18.059  1.00 32.69 ? 179 LYS D C     1 
ATOM   6908 O  O     . LYS D 2 132 ? -3.932  41.920  19.009  1.00 32.42 ? 179 LYS D O     1 
ATOM   6909 C  CB    . LYS D 2 132 ? -4.108  39.067  19.509  1.00 32.99 ? 179 LYS D CB    1 
ATOM   6910 C  CG    . LYS D 2 132 ? -4.807  37.761  19.953  1.00 33.15 ? 179 LYS D CG    1 
ATOM   6911 C  CD    . LYS D 2 132 ? -3.930  36.950  20.926  1.00 32.97 ? 179 LYS D CD    1 
ATOM   6912 N  N     . SER D 2 133 ? -3.723  41.447  16.814  1.00 32.50 ? 180 SER D N     1 
ATOM   6913 C  CA    . SER D 2 133 ? -2.936  42.652  16.523  1.00 32.59 ? 180 SER D CA    1 
ATOM   6914 C  C     . SER D 2 133 ? -3.794  43.832  16.076  1.00 32.45 ? 180 SER D C     1 
ATOM   6915 O  O     . SER D 2 133 ? -4.908  43.645  15.605  1.00 32.52 ? 180 SER D O     1 
ATOM   6916 C  CB    . SER D 2 133 ? -1.874  42.348  15.460  1.00 32.63 ? 180 SER D CB    1 
ATOM   6917 O  OG    . SER D 2 133 ? -2.468  41.980  14.231  1.00 33.33 ? 180 SER D OG    1 
ATOM   6918 N  N     . ASP D 2 134 ? -3.262  45.042  16.239  1.00 32.53 ? 181 ASP D N     1 
ATOM   6919 C  CA    . ASP D 2 134 ? -3.922  46.270  15.776  1.00 32.66 ? 181 ASP D CA    1 
ATOM   6920 C  C     . ASP D 2 134 ? -4.323  46.185  14.307  1.00 32.81 ? 181 ASP D C     1 
ATOM   6921 O  O     . ASP D 2 134 ? -5.440  46.529  13.939  1.00 32.93 ? 181 ASP D O     1 
ATOM   6922 C  CB    . ASP D 2 134 ? -2.989  47.477  15.924  1.00 32.64 ? 181 ASP D CB    1 
ATOM   6923 C  CG    . ASP D 2 134 ? -2.838  47.941  17.356  1.00 32.74 ? 181 ASP D CG    1 
ATOM   6924 O  OD1   . ASP D 2 134 ? -3.868  48.248  18.012  1.00 31.53 ? 181 ASP D OD1   1 
ATOM   6925 O  OD2   . ASP D 2 134 ? -1.672  48.035  17.804  1.00 32.53 ? 181 ASP D OD2   1 
ATOM   6926 N  N     . ILE D 2 135 ? -3.393  45.736  13.471  1.00 33.01 ? 182 ILE D N     1 
ATOM   6927 C  CA    . ILE D 2 135 ? -3.616  45.653  12.029  1.00 33.27 ? 182 ILE D CA    1 
ATOM   6928 C  C     . ILE D 2 135 ? -4.944  44.944  11.744  1.00 33.41 ? 182 ILE D C     1 
ATOM   6929 O  O     . ILE D 2 135 ? -5.859  45.546  11.165  1.00 33.28 ? 182 ILE D O     1 
ATOM   6930 C  CB    . ILE D 2 135 ? -2.415  44.963  11.305  1.00 33.46 ? 182 ILE D CB    1 
ATOM   6931 C  CG1   . ILE D 2 135 ? -1.163  45.865  11.378  1.00 33.95 ? 182 ILE D CG1   1 
ATOM   6932 C  CG2   . ILE D 2 135 ? -2.744  44.682  9.843   1.00 33.31 ? 182 ILE D CG2   1 
ATOM   6933 C  CD1   . ILE D 2 135 ? 0.179   45.125  11.429  1.00 33.99 ? 182 ILE D CD1   1 
ATOM   6934 N  N     . TYR D 2 136 ? -5.058  43.695  12.198  1.00 33.53 ? 183 TYR D N     1 
ATOM   6935 C  CA    . TYR D 2 136 ? -6.295  42.915  12.041  1.00 33.59 ? 183 TYR D CA    1 
ATOM   6936 C  C     . TYR D 2 136 ? -7.503  43.541  12.748  1.00 33.76 ? 183 TYR D C     1 
ATOM   6937 O  O     . TYR D 2 136 ? -8.558  43.707  12.134  1.00 33.87 ? 183 TYR D O     1 
ATOM   6938 C  CB    . TYR D 2 136 ? -6.103  41.480  12.540  1.00 33.54 ? 183 TYR D CB    1 
ATOM   6939 C  CG    . TYR D 2 136 ? -7.315  40.595  12.336  1.00 33.37 ? 183 TYR D CG    1 
ATOM   6940 C  CD1   . TYR D 2 136 ? -7.663  40.136  11.069  1.00 33.18 ? 183 TYR D CD1   1 
ATOM   6941 C  CD2   . TYR D 2 136 ? -8.112  40.212  13.413  1.00 33.85 ? 183 TYR D CD2   1 
ATOM   6942 C  CE1   . TYR D 2 136 ? -8.777  39.316  10.878  1.00 33.34 ? 183 TYR D CE1   1 
ATOM   6943 C  CE2   . TYR D 2 136 ? -9.231  39.394  13.233  1.00 33.23 ? 183 TYR D CE2   1 
ATOM   6944 C  CZ    . TYR D 2 136 ? -9.558  38.953  11.965  1.00 33.31 ? 183 TYR D CZ    1 
ATOM   6945 O  OH    . TYR D 2 136 ? -10.663 38.146  11.788  1.00 33.11 ? 183 TYR D OH    1 
ATOM   6946 N  N     . LEU D 2 137 ? -7.356  43.885  14.027  1.00 33.91 ? 184 LEU D N     1 
ATOM   6947 C  CA    . LEU D 2 137 ? -8.486  44.409  14.797  1.00 34.27 ? 184 LEU D CA    1 
ATOM   6948 C  C     . LEU D 2 137 ? -9.006  45.733  14.242  1.00 34.36 ? 184 LEU D C     1 
ATOM   6949 O  O     . LEU D 2 137 ? -10.214 45.928  14.171  1.00 34.43 ? 184 LEU D O     1 
ATOM   6950 C  CB    . LEU D 2 137 ? -8.135  44.562  16.282  1.00 34.26 ? 184 LEU D CB    1 
ATOM   6951 C  CG    . LEU D 2 137 ? -8.060  43.276  17.111  1.00 34.52 ? 184 LEU D CG    1 
ATOM   6952 C  CD1   . LEU D 2 137 ? -7.610  43.590  18.533  1.00 34.48 ? 184 LEU D CD1   1 
ATOM   6953 C  CD2   . LEU D 2 137 ? -9.401  42.548  17.127  1.00 34.29 ? 184 LEU D CD2   1 
ATOM   6954 N  N     . ASN D 2 138 ? -8.098  46.626  13.847  1.00 34.53 ? 185 ASN D N     1 
ATOM   6955 C  CA    . ASN D 2 138 ? -8.479  47.907  13.244  1.00 34.71 ? 185 ASN D CA    1 
ATOM   6956 C  C     . ASN D 2 138 ? -9.194  47.720  11.914  1.00 34.92 ? 185 ASN D C     1 
ATOM   6957 O  O     . ASN D 2 138 ? -10.133 48.459  11.602  1.00 35.17 ? 185 ASN D O     1 
ATOM   6958 C  CB    . ASN D 2 138 ? -7.265  48.818  13.031  1.00 34.68 ? 185 ASN D CB    1 
ATOM   6959 C  CG    . ASN D 2 138 ? -6.624  49.259  14.333  1.00 34.58 ? 185 ASN D CG    1 
ATOM   6960 O  OD1   . ASN D 2 138 ? -7.259  49.265  15.386  1.00 34.01 ? 185 ASN D OD1   1 
ATOM   6961 N  ND2   . ASN D 2 138 ? -5.348  49.628  14.264  1.00 34.55 ? 185 ASN D ND2   1 
ATOM   6962 N  N     . LEU D 2 139 ? -8.749  46.734  11.136  1.00 35.11 ? 186 LEU D N     1 
ATOM   6963 C  CA    . LEU D 2 139 ? -9.404  46.409  9.874   1.00 35.28 ? 186 LEU D CA    1 
ATOM   6964 C  C     . LEU D 2 139 ? -10.822 45.899  10.157  1.00 35.53 ? 186 LEU D C     1 
ATOM   6965 O  O     . LEU D 2 139 ? -11.798 46.450  9.649   1.00 35.56 ? 186 LEU D O     1 
ATOM   6966 C  CB    . LEU D 2 139 ? -8.584  45.377  9.084   1.00 35.13 ? 186 LEU D CB    1 
ATOM   6967 C  CG    . LEU D 2 139 ? -8.803  45.414  7.569   1.00 35.14 ? 186 LEU D CG    1 
ATOM   6968 C  CD1   . LEU D 2 139 ? -8.038  46.577  6.942   1.00 35.02 ? 186 LEU D CD1   1 
ATOM   6969 C  CD2   . LEU D 2 139 ? -8.405  44.105  6.920   1.00 34.60 ? 186 LEU D CD2   1 
ATOM   6970 N  N     . LEU D 2 140 ? -10.918 44.878  11.006  1.00 35.90 ? 187 LEU D N     1 
ATOM   6971 C  CA    . LEU D 2 140 ? -12.200 44.277  11.376  1.00 36.21 ? 187 LEU D CA    1 
ATOM   6972 C  C     . LEU D 2 140 ? -13.185 45.310  11.909  1.00 36.53 ? 187 LEU D C     1 
ATOM   6973 O  O     . LEU D 2 140 ? -14.325 45.378  11.452  1.00 36.64 ? 187 LEU D O     1 
ATOM   6974 C  CB    . LEU D 2 140 ? -11.989 43.198  12.449  1.00 36.23 ? 187 LEU D CB    1 
ATOM   6975 C  CG    . LEU D 2 140 ? -13.214 42.356  12.832  1.00 36.31 ? 187 LEU D CG    1 
ATOM   6976 C  CD1   . LEU D 2 140 ? -13.385 41.188  11.862  1.00 36.07 ? 187 LEU D CD1   1 
ATOM   6977 C  CD2   . LEU D 2 140 ? -13.117 41.854  14.271  1.00 36.42 ? 187 LEU D CD2   1 
ATOM   6978 N  N     . ASN D 2 141 ? -12.742 46.110  12.875  1.00 36.97 ? 188 ASN D N     1 
ATOM   6979 C  CA    . ASN D 2 141 ? -13.651 47.018  13.578  1.00 37.35 ? 188 ASN D CA    1 
ATOM   6980 C  C     . ASN D 2 141 ? -14.089 48.227  12.761  1.00 37.63 ? 188 ASN D C     1 
ATOM   6981 O  O     . ASN D 2 141 ? -15.174 48.749  12.979  1.00 37.41 ? 188 ASN D O     1 
ATOM   6982 C  CB    . ASN D 2 141 ? -13.080 47.461  14.932  1.00 37.38 ? 188 ASN D CB    1 
ATOM   6983 C  CG    . ASN D 2 141 ? -13.925 46.966  16.099  1.00 37.49 ? 188 ASN D CG    1 
ATOM   6984 O  OD1   . ASN D 2 141 ? -15.065 47.411  16.287  1.00 37.30 ? 188 ASN D OD1   1 
ATOM   6985 N  ND2   . ASN D 2 141 ? -13.379 46.035  16.877  1.00 37.26 ? 188 ASN D ND2   1 
ATOM   6986 N  N     . ASP D 2 142 ? -13.251 48.659  11.824  1.00 38.18 ? 189 ASP D N     1 
ATOM   6987 C  CA    . ASP D 2 142 ? -13.583 49.787  10.962  1.00 38.61 ? 189 ASP D CA    1 
ATOM   6988 C  C     . ASP D 2 142 ? -14.627 49.446  9.887   1.00 38.90 ? 189 ASP D C     1 
ATOM   6989 O  O     . ASP D 2 142 ? -15.230 50.352  9.304   1.00 39.06 ? 189 ASP D O     1 
ATOM   6990 C  CB    . ASP D 2 142 ? -12.309 50.326  10.295  1.00 38.52 ? 189 ASP D CB    1 
ATOM   6991 N  N     . LEU D 2 143 ? -14.843 48.156  9.623   1.00 39.09 ? 190 LEU D N     1 
ATOM   6992 C  CA    . LEU D 2 143 ? -15.832 47.733  8.617   1.00 39.22 ? 190 LEU D CA    1 
ATOM   6993 C  C     . LEU D 2 143 ? -17.235 47.478  9.196   1.00 39.41 ? 190 LEU D C     1 
ATOM   6994 O  O     . LEU D 2 143 ? -18.156 47.132  8.445   1.00 39.64 ? 190 LEU D O     1 
ATOM   6995 C  CB    . LEU D 2 143 ? -15.353 46.475  7.875   1.00 39.24 ? 190 LEU D CB    1 
ATOM   6996 C  CG    . LEU D 2 143 ? -13.874 46.395  7.459   1.00 39.31 ? 190 LEU D CG    1 
ATOM   6997 C  CD1   . LEU D 2 143 ? -13.653 45.234  6.500   1.00 39.15 ? 190 LEU D CD1   1 
ATOM   6998 C  CD2   . LEU D 2 143 ? -13.356 47.704  6.848   1.00 39.03 ? 190 LEU D CD2   1 
ATOM   6999 N  N     . GLN D 2 144 ? -17.409 47.659  10.507  1.00 39.43 ? 191 GLN D N     1 
ATOM   7000 C  CA    . GLN D 2 144 ? -18.682 47.366  11.176  1.00 39.32 ? 191 GLN D CA    1 
ATOM   7001 C  C     . GLN D 2 144 ? -19.331 48.638  11.712  1.00 39.23 ? 191 GLN D C     1 
ATOM   7002 O  O     . GLN D 2 144 ? -20.136 49.288  10.972  1.00 39.11 ? 191 GLN D O     1 
ATOM   7003 C  CB    . GLN D 2 144 ? -18.453 46.376  12.317  1.00 39.34 ? 191 GLN D CB    1 
ATOM   7004 C  CG    . GLN D 2 144 ? -17.830 45.056  11.864  1.00 39.27 ? 191 GLN D CG    1 
ATOM   7005 C  CD    . GLN D 2 144 ? -17.221 44.265  13.007  1.00 39.32 ? 191 GLN D CD    1 
ATOM   7006 O  OE1   . GLN D 2 144 ? -16.488 44.808  13.836  1.00 39.41 ? 191 GLN D OE1   1 
ATOM   7007 N  NE2   . GLN D 2 144 ? -17.507 42.969  13.045  1.00 39.02 ? 191 GLN D NE2   1 
HETATM 7008 AL AL    . ALF E 3 .   ? 13.329  29.487  19.363  1.00 33.98 ? 355 ALF A AL    1 
HETATM 7009 F  F1    . ALF E 3 .   ? 12.518  30.953  19.829  1.00 33.91 ? 355 ALF A F1    1 
HETATM 7010 F  F2    . ALF E 3 .   ? 14.048  27.927  18.875  1.00 35.94 ? 355 ALF A F2    1 
HETATM 7011 F  F3    . ALF E 3 .   ? 11.616  29.036  19.006  1.00 39.40 ? 355 ALF A F3    1 
HETATM 7012 F  F4    . ALF E 3 .   ? 14.832  30.458  19.556  1.00 31.99 ? 355 ALF A F4    1 
HETATM 7013 MG MG    . MG  F 4 .   ? 11.113  31.476  21.324  1.00 33.52 ? 401 MG  A MG    1 
HETATM 7014 P  PB    . GDP G 5 .   ? 13.176  29.755  22.670  1.00 36.10 ? 402 GDP A PB    1 
HETATM 7015 O  O1B   . GDP G 5 .   ? 12.025  30.753  22.716  1.00 32.02 ? 402 GDP A O1B   1 
HETATM 7016 O  O2B   . GDP G 5 .   ? 13.456  29.196  21.284  1.00 35.72 ? 402 GDP A O2B   1 
HETATM 7017 O  O3B   . GDP G 5 .   ? 14.474  30.344  23.206  1.00 33.06 ? 402 GDP A O3B   1 
HETATM 7018 O  O3A   . GDP G 5 .   ? 12.853  28.524  23.685  1.00 37.46 ? 402 GDP A O3A   1 
HETATM 7019 P  PA    . GDP G 5 .   ? 11.391  28.325  24.350  1.00 38.21 ? 402 GDP A PA    1 
HETATM 7020 O  O1A   . GDP G 5 .   ? 10.372  28.278  23.255  1.00 37.31 ? 402 GDP A O1A   1 
HETATM 7021 O  O2A   . GDP G 5 .   ? 11.019  29.388  25.369  1.00 36.49 ? 402 GDP A O2A   1 
HETATM 7022 O  "O5'" . GDP G 5 .   ? 11.536  26.927  25.112  1.00 38.34 ? 402 GDP A "O5'" 1 
HETATM 7023 C  "C5'" . GDP G 5 .   ? 11.687  25.693  24.432  1.00 39.36 ? 402 GDP A "C5'" 1 
HETATM 7024 C  "C4'" . GDP G 5 .   ? 11.036  24.596  25.254  1.00 39.01 ? 402 GDP A "C4'" 1 
HETATM 7025 O  "O4'" . GDP G 5 .   ? 11.835  24.318  26.387  1.00 37.35 ? 402 GDP A "O4'" 1 
HETATM 7026 C  "C3'" . GDP G 5 .   ? 9.649   24.981  25.767  1.00 40.14 ? 402 GDP A "C3'" 1 
HETATM 7027 O  "O3'" . GDP G 5 .   ? 8.761   23.856  25.679  1.00 39.83 ? 402 GDP A "O3'" 1 
HETATM 7028 C  "C2'" . GDP G 5 .   ? 9.864   25.340  27.212  1.00 41.39 ? 402 GDP A "C2'" 1 
HETATM 7029 O  "O2'" . GDP G 5 .   ? 8.741   24.979  28.015  1.00 44.73 ? 402 GDP A "O2'" 1 
HETATM 7030 C  "C1'" . GDP G 5 .   ? 11.083  24.520  27.590  1.00 39.48 ? 402 GDP A "C1'" 1 
HETATM 7031 N  N9    . GDP G 5 .   ? 11.952  25.182  28.586  1.00 38.95 ? 402 GDP A N9    1 
HETATM 7032 C  C8    . GDP G 5 .   ? 12.510  26.397  28.503  1.00 39.20 ? 402 GDP A C8    1 
HETATM 7033 N  N7    . GDP G 5 .   ? 13.287  26.660  29.597  1.00 38.90 ? 402 GDP A N7    1 
HETATM 7034 C  C5    . GDP G 5 .   ? 13.223  25.590  30.393  1.00 39.16 ? 402 GDP A C5    1 
HETATM 7035 C  C6    . GDP G 5 .   ? 13.792  25.184  31.692  1.00 39.79 ? 402 GDP A C6    1 
HETATM 7036 O  O6    . GDP G 5 .   ? 14.550  25.957  32.336  1.00 39.76 ? 402 GDP A O6    1 
HETATM 7037 N  N1    . GDP G 5 .   ? 13.466  23.978  32.173  1.00 39.15 ? 402 GDP A N1    1 
HETATM 7038 C  C2    . GDP G 5 .   ? 12.672  23.132  31.506  1.00 39.05 ? 402 GDP A C2    1 
HETATM 7039 N  N2    . GDP G 5 .   ? 12.396  21.919  32.033  1.00 39.34 ? 402 GDP A N2    1 
HETATM 7040 N  N3    . GDP G 5 .   ? 12.118  23.440  30.323  1.00 39.34 ? 402 GDP A N3    1 
HETATM 7041 C  C4    . GDP G 5 .   ? 12.355  24.622  29.720  1.00 39.65 ? 402 GDP A C4    1 
HETATM 7042 AL AL    . ALF H 3 .   ? -37.537 10.737  52.943  1.00 39.80 ? 355 ALF B AL    1 
HETATM 7043 F  F1    . ALF H 3 .   ? -37.143 9.020   53.289  1.00 36.14 ? 355 ALF B F1    1 
HETATM 7044 F  F2    . ALF H 3 .   ? -37.757 12.376  52.366  1.00 37.34 ? 355 ALF B F2    1 
HETATM 7045 F  F3    . ALF H 3 .   ? -35.918 11.299  53.448  1.00 38.59 ? 355 ALF B F3    1 
HETATM 7046 F  F4    . ALF H 3 .   ? -39.212 10.309  52.478  1.00 37.36 ? 355 ALF B F4    1 
HETATM 7047 MG MG    . MG  I 4 .   ? -35.836 12.649  55.011  1.00 28.35 ? 402 MG  B MG    1 
HETATM 7048 P  PB    . GDP J 5 .   ? -37.904 11.140  56.165  1.00 34.41 ? 403 GDP B PB    1 
HETATM 7049 O  O1B   . GDP J 5 .   ? -36.673 11.990  56.397  1.00 34.17 ? 403 GDP B O1B   1 
HETATM 7050 O  O2B   . GDP J 5 .   ? -38.186 11.061  54.679  1.00 31.91 ? 403 GDP B O2B   1 
HETATM 7051 O  O3B   . GDP J 5 .   ? -37.666 9.789   56.809  1.00 32.51 ? 403 GDP B O3B   1 
HETATM 7052 O  O3A   . GDP J 5 .   ? -39.197 11.787  56.886  1.00 36.50 ? 403 GDP B O3A   1 
HETATM 7053 P  PA    . GDP J 5 .   ? -39.183 13.260  57.566  1.00 35.65 ? 403 GDP B PA    1 
HETATM 7054 O  O1A   . GDP J 5 .   ? -39.007 14.272  56.484  1.00 35.20 ? 403 GDP B O1A   1 
HETATM 7055 O  O2A   . GDP J 5 .   ? -38.101 13.438  58.612  1.00 32.56 ? 403 GDP B O2A   1 
HETATM 7056 O  "O5'" . GDP J 5 .   ? -40.644 13.297  58.235  1.00 37.58 ? 403 GDP B "O5'" 1 
HETATM 7057 C  "C5'" . GDP J 5 .   ? -41.848 13.149  57.501  1.00 37.83 ? 403 GDP B "C5'" 1 
HETATM 7058 C  "C4'" . GDP J 5 .   ? -42.890 14.151  57.982  1.00 38.18 ? 403 GDP B "C4'" 1 
HETATM 7059 O  "O4'" . GDP J 5 .   ? -43.490 13.722  59.208  1.00 38.81 ? 403 GDP B "O4'" 1 
HETATM 7060 C  "C3'" . GDP J 5 .   ? -42.310 15.515  58.288  1.00 39.97 ? 403 GDP B "C3'" 1 
HETATM 7061 O  "O3'" . GDP J 5 .   ? -43.282 16.492  57.905  1.00 42.04 ? 403 GDP B "O3'" 1 
HETATM 7062 C  "C2'" . GDP J 5 .   ? -42.052 15.516  59.798  1.00 40.03 ? 403 GDP B "C2'" 1 
HETATM 7063 O  "O2'" . GDP J 5 .   ? -42.167 16.770  60.473  1.00 39.24 ? 403 GDP B "O2'" 1 
HETATM 7064 C  "C1'" . GDP J 5 .   ? -43.142 14.600  60.299  1.00 38.65 ? 403 GDP B "C1'" 1 
HETATM 7065 N  N9    . GDP J 5 .   ? -42.706 13.771  61.447  1.00 38.06 ? 403 GDP B N9    1 
HETATM 7066 C  C8    . GDP J 5 .   ? -41.583 13.048  61.570  1.00 37.96 ? 403 GDP B C8    1 
HETATM 7067 N  N7    . GDP J 5 .   ? -41.573 12.370  62.755  1.00 37.92 ? 403 GDP B N7    1 
HETATM 7068 C  C5    . GDP J 5 .   ? -42.695 12.661  63.396  1.00 37.55 ? 403 GDP B C5    1 
HETATM 7069 C  C6    . GDP J 5 .   ? -43.294 12.288  64.680  1.00 38.03 ? 403 GDP B C6    1 
HETATM 7070 O  O6    . GDP J 5 .   ? -42.721 11.506  65.479  1.00 38.53 ? 403 GDP B O6    1 
HETATM 7071 N  N1    . GDP J 5 .   ? -44.479 12.810  64.952  1.00 37.07 ? 403 GDP B N1    1 
HETATM 7072 C  C2    . GDP J 5 .   ? -45.132 13.642  64.120  1.00 37.34 ? 403 GDP B C2    1 
HETATM 7073 N  N2    . GDP J 5 .   ? -46.346 14.102  64.500  1.00 38.36 ? 403 GDP B N2    1 
HETATM 7074 N  N3    . GDP J 5 .   ? -44.652 14.052  62.930  1.00 36.19 ? 403 GDP B N3    1 
HETATM 7075 C  C4    . GDP J 5 .   ? -43.452 13.579  62.526  1.00 38.14 ? 403 GDP B C4    1 
HETATM 7076 O  O     . HOH K 6 .   ? 9.660   29.852  21.328  1.00 32.56 ? 403 HOH A O     1 
HETATM 7077 O  O     . HOH K 6 .   ? 11.969  33.278  21.263  1.00 34.65 ? 404 HOH A O     1 
HETATM 7078 O  O     . HOH K 6 .   ? 13.162  30.479  17.528  1.00 25.27 ? 405 HOH A O     1 
HETATM 7079 O  O     . HOH K 6 .   ? 19.012  9.711   12.473  1.00 43.20 ? 406 HOH A O     1 
HETATM 7080 O  O     . HOH K 6 .   ? 3.684   26.557  37.254  1.00 36.21 ? 407 HOH A O     1 
HETATM 7081 O  O     . HOH K 6 .   ? 12.879  22.621  23.410  1.00 38.38 ? 408 HOH A O     1 
HETATM 7082 O  O     . HOH K 6 .   ? 21.928  2.721   15.815  1.00 38.29 ? 409 HOH A O     1 
HETATM 7083 O  O     . HOH K 6 .   ? -8.830  17.358  20.835  1.00 47.42 ? 410 HOH A O     1 
HETATM 7084 O  O     . HOH K 6 .   ? 31.866  39.138  34.851  1.00 41.69 ? 411 HOH A O     1 
HETATM 7085 O  O     . HOH K 6 .   ? 22.200  19.408  44.088  1.00 28.41 ? 412 HOH A O     1 
HETATM 7086 O  O     . HOH K 6 .   ? 31.760  35.042  38.360  1.00 40.65 ? 413 HOH A O     1 
HETATM 7087 O  O     . HOH K 6 .   ? 34.070  32.098  19.800  1.00 51.44 ? 414 HOH A O     1 
HETATM 7088 O  O     . HOH K 6 .   ? 14.115  25.431  39.977  1.00 44.14 ? 415 HOH A O     1 
HETATM 7089 O  O     . HOH K 6 .   ? 9.642   13.788  33.294  1.00 54.60 ? 416 HOH A O     1 
HETATM 7090 O  O     . HOH K 6 .   ? 31.540  45.290  18.054  1.00 48.75 ? 417 HOH A O     1 
HETATM 7091 O  O     . HOH K 6 .   ? 19.066  3.525   25.134  1.00 39.35 ? 418 HOH A O     1 
HETATM 7092 O  O     . HOH K 6 .   ? 6.961   28.490  41.013  1.00 44.71 ? 419 HOH A O     1 
HETATM 7093 O  O     . HOH K 6 .   ? 24.490  54.691  36.736  1.00 58.52 ? 420 HOH A O     1 
HETATM 7094 O  O     . HOH K 6 .   ? 8.690   6.891   31.393  1.00 35.07 ? 421 HOH A O     1 
HETATM 7095 O  O     . HOH K 6 .   ? 18.016  2.810   27.660  1.00 58.20 ? 422 HOH A O     1 
HETATM 7096 O  O     . HOH K 6 .   ? -2.997  26.473  36.838  1.00 51.24 ? 423 HOH A O     1 
HETATM 7097 O  O     . HOH K 6 .   ? 38.265  35.971  26.150  1.00 48.48 ? 424 HOH A O     1 
HETATM 7098 O  O     . HOH K 6 .   ? 3.770   49.424  30.067  1.00 40.38 ? 425 HOH A O     1 
HETATM 7099 O  O     . HOH K 6 .   ? 37.831  23.442  28.264  1.00 49.34 ? 426 HOH A O     1 
HETATM 7100 O  O     . HOH K 6 .   ? 0.917   24.773  37.349  1.00 50.37 ? 427 HOH A O     1 
HETATM 7101 O  O     . HOH K 6 .   ? -6.173  2.512   21.311  1.00 36.88 ? 428 HOH A O     1 
HETATM 7102 O  O     . HOH K 6 .   ? 7.711   20.361  37.030  1.00 49.96 ? 429 HOH A O     1 
HETATM 7103 O  O     . HOH K 6 .   ? 25.410  50.525  24.684  1.00 51.60 ? 430 HOH A O     1 
HETATM 7104 O  O     . HOH K 6 .   ? 21.378  2.499   11.180  1.00 58.68 ? 431 HOH A O     1 
HETATM 7105 O  O     . HOH K 6 .   ? 22.163  49.300  22.055  1.00 31.32 ? 432 HOH A O     1 
HETATM 7106 O  O     . HOH K 6 .   ? 7.564   4.611   29.912  1.00 44.61 ? 433 HOH A O     1 
HETATM 7107 O  O     . HOH K 6 .   ? 28.567  36.745  37.266  1.00 51.98 ? 434 HOH A O     1 
HETATM 7108 O  O     . HOH K 6 .   ? 14.543  32.974  9.631   1.00 32.00 ? 435 HOH A O     1 
HETATM 7109 O  O     . HOH K 6 .   ? 10.789  21.930  36.682  1.00 39.45 ? 436 HOH A O     1 
HETATM 7110 O  O     . HOH K 6 .   ? 33.108  14.322  32.783  1.00 53.99 ? 437 HOH A O     1 
HETATM 7111 O  O     . HOH K 6 .   ? 16.785  35.005  7.737   1.00 40.33 ? 438 HOH A O     1 
HETATM 7112 O  O     . HOH K 6 .   ? 15.255  -2.585  14.044  1.00 48.68 ? 439 HOH A O     1 
HETATM 7113 O  O     . HOH K 6 .   ? 34.167  41.583  34.775  1.00 44.74 ? 440 HOH A O     1 
HETATM 7114 O  O     . HOH K 6 .   ? 5.391   14.906  34.302  1.00 47.20 ? 441 HOH A O     1 
HETATM 7115 O  O     . HOH K 6 .   ? 35.572  29.787  27.743  1.00 54.03 ? 442 HOH A O     1 
HETATM 7116 O  O     . HOH K 6 .   ? 37.567  31.256  34.618  1.00 50.26 ? 443 HOH A O     1 
HETATM 7117 O  O     . HOH K 6 .   ? 35.580  26.786  32.918  1.00 50.48 ? 444 HOH A O     1 
HETATM 7118 O  O     . HOH K 6 .   ? 22.106  51.443  29.266  1.00 37.32 ? 445 HOH A O     1 
HETATM 7119 O  O     . HOH K 6 .   ? 37.621  33.571  22.711  1.00 53.17 ? 446 HOH A O     1 
HETATM 7120 O  O     . HOH K 6 .   ? 32.533  12.057  38.352  1.00 40.01 ? 447 HOH A O     1 
HETATM 7121 O  O     . HOH K 6 .   ? 33.273  11.926  26.583  1.00 47.11 ? 448 HOH A O     1 
HETATM 7122 O  O     . HOH K 6 .   ? 14.158  4.825   30.624  1.00 53.22 ? 449 HOH A O     1 
HETATM 7123 O  O     . HOH K 6 .   ? 16.012  20.431  22.655  1.00 71.43 ? 450 HOH A O     1 
HETATM 7124 O  O     . HOH K 6 .   ? 11.721  19.190  35.487  1.00 45.43 ? 451 HOH A O     1 
HETATM 7125 O  O     . HOH K 6 .   ? 18.598  53.510  29.857  1.00 53.83 ? 452 HOH A O     1 
HETATM 7126 O  O     . HOH K 6 .   ? 6.929   34.780  21.887  1.00 40.16 ? 453 HOH A O     1 
HETATM 7127 O  O     . HOH K 6 .   ? 23.857  8.175   22.055  1.00 48.28 ? 454 HOH A O     1 
HETATM 7128 O  O     . HOH K 6 .   ? -9.768  12.081  25.332  1.00 49.20 ? 455 HOH A O     1 
HETATM 7129 O  O     . HOH K 6 .   ? -11.246 27.640  38.046  1.00 55.32 ? 456 HOH A O     1 
HETATM 7130 O  O     . HOH K 6 .   ? 17.250  -2.958  18.644  1.00 49.47 ? 457 HOH A O     1 
HETATM 7131 O  O     . HOH K 6 .   ? 19.573  0.780   21.617  1.00 46.27 ? 458 HOH A O     1 
HETATM 7132 O  O     . HOH K 6 .   ? 38.690  21.038  34.468  1.00 59.45 ? 459 HOH A O     1 
HETATM 7133 O  O     . HOH K 6 .   ? 31.990  34.158  17.996  1.00 56.58 ? 460 HOH A O     1 
HETATM 7134 O  O     . HOH K 6 .   ? 20.427  0.293   17.028  1.00 46.10 ? 461 HOH A O     1 
HETATM 7135 O  O     . HOH K 6 .   ? 29.379  45.778  16.497  1.00 45.15 ? 462 HOH A O     1 
HETATM 7136 O  O     . HOH K 6 .   ? 17.071  54.407  38.300  1.00 47.92 ? 463 HOH A O     1 
HETATM 7137 O  O     . HOH K 6 .   ? 7.704   24.676  38.728  1.00 36.39 ? 464 HOH A O     1 
HETATM 7138 O  O     . HOH L 6 .   ? -33.964 11.741  54.911  1.00 40.43 ? 404 HOH B O     1 
HETATM 7139 O  O     . HOH L 6 .   ? -37.235 14.204  54.560  1.00 25.76 ? 405 HOH B O     1 
HETATM 7140 O  O     . HOH L 6 .   ? -36.982 10.429  50.846  1.00 38.30 ? 406 HOH B O     1 
HETATM 7141 O  O     . HOH L 6 .   ? -55.879 38.674  50.090  1.00 41.36 ? 407 HOH B O     1 
HETATM 7142 O  O     . HOH L 6 .   ? -46.318 -9.189  67.087  1.00 49.54 ? 408 HOH B O     1 
HETATM 7143 O  O     . HOH L 6 .   ? -59.412 3.117   59.099  1.00 49.98 ? 409 HOH B O     1 
HETATM 7144 O  O     . HOH L 6 .   ? -56.884 11.279  45.536  1.00 49.50 ? 410 HOH B O     1 
HETATM 7145 O  O     . HOH L 6 .   ? -47.050 -4.396  45.788  1.00 51.14 ? 411 HOH B O     1 
HETATM 7146 O  O     . HOH L 6 .   ? -53.003 -1.388  53.711  1.00 37.79 ? 412 HOH B O     1 
HETATM 7147 O  O     . HOH L 6 .   ? -26.013 22.490  72.068  1.00 45.74 ? 413 HOH B O     1 
HETATM 7148 O  O     . HOH L 6 .   ? -52.278 -5.932  54.556  1.00 51.18 ? 414 HOH B O     1 
HETATM 7149 O  O     . HOH L 6 .   ? -47.824 11.221  53.616  1.00 44.24 ? 415 HOH B O     1 
HETATM 7150 O  O     . HOH L 6 .   ? -21.083 -0.065  67.916  1.00 37.15 ? 416 HOH B O     1 
HETATM 7151 O  O     . HOH L 6 .   ? -39.514 12.286  76.711  1.00 37.51 ? 417 HOH B O     1 
HETATM 7152 O  O     . HOH L 6 .   ? -27.933 10.334  81.073  1.00 51.89 ? 418 HOH B O     1 
HETATM 7153 O  O     . HOH L 6 .   ? -32.093 16.187  55.247  1.00 36.14 ? 419 HOH B O     1 
HETATM 7154 O  O     . HOH L 6 .   ? -54.338 9.755   73.560  1.00 51.33 ? 420 HOH B O     1 
HETATM 7155 O  O     . HOH L 6 .   ? -55.281 -4.213  75.150  1.00 45.06 ? 421 HOH B O     1 
HETATM 7156 O  O     . HOH L 6 .   ? -67.640 8.480   49.422  1.00 50.05 ? 422 HOH B O     1 
HETATM 7157 O  O     . HOH L 6 .   ? -62.469 3.267   60.716  1.00 51.09 ? 423 HOH B O     1 
HETATM 7158 O  O     . HOH L 6 .   ? -40.800 4.025   51.076  1.00 34.52 ? 424 HOH B O     1 
HETATM 7159 O  O     . HOH L 6 .   ? -29.814 -4.694  53.446  1.00 33.99 ? 425 HOH B O     1 
HETATM 7160 O  O     . HOH L 6 .   ? -39.687 28.485  68.578  1.00 41.20 ? 426 HOH B O     1 
HETATM 7161 O  O     . HOH L 6 .   ? -39.183 4.647   44.693  1.00 28.46 ? 427 HOH B O     1 
HETATM 7162 O  O     . HOH L 6 .   ? -23.223 -12.933 61.994  1.00 58.27 ? 428 HOH B O     1 
HETATM 7163 O  O     . HOH L 6 .   ? -35.542 -2.513  49.653  1.00 54.27 ? 429 HOH B O     1 
HETATM 7164 O  O     . HOH L 6 .   ? -57.885 -7.615  66.761  1.00 45.99 ? 430 HOH B O     1 
HETATM 7165 O  O     . HOH L 6 .   ? -11.099 12.985  60.649  1.00 55.77 ? 431 HOH B O     1 
HETATM 7166 O  O     . HOH L 6 .   ? -31.370 -18.633 68.446  1.00 51.33 ? 432 HOH B O     1 
HETATM 7167 O  O     . HOH L 6 .   ? -59.511 -4.664  59.429  1.00 42.74 ? 433 HOH B O     1 
HETATM 7168 O  O     . HOH L 6 .   ? -23.075 15.288  52.407  1.00 41.31 ? 434 HOH B O     1 
HETATM 7169 O  O     . HOH L 6 .   ? -49.113 -5.923  42.700  1.00 49.74 ? 435 HOH B O     1 
HETATM 7170 O  O     . HOH L 6 .   ? -17.685 15.032  63.786  1.00 45.60 ? 436 HOH B O     1 
HETATM 7171 O  O     . HOH L 6 .   ? -16.144 14.131  55.767  1.00 49.76 ? 437 HOH B O     1 
HETATM 7172 O  O     . HOH L 6 .   ? -60.458 -3.041  70.320  1.00 45.98 ? 438 HOH B O     1 
HETATM 7173 O  O     . HOH L 6 .   ? -57.452 -6.996  74.506  1.00 35.93 ? 439 HOH B O     1 
HETATM 7174 O  O     . HOH L 6 .   ? -20.298 -1.174  57.973  1.00 38.36 ? 440 HOH B O     1 
HETATM 7175 O  O     . HOH L 6 .   ? -57.140 -4.660  65.225  1.00 52.15 ? 441 HOH B O     1 
HETATM 7176 O  O     . HOH L 6 .   ? -45.569 31.876  65.021  1.00 49.56 ? 442 HOH B O     1 
HETATM 7177 O  O     . HOH L 6 .   ? -32.494 -5.812  49.853  1.00 59.97 ? 443 HOH B O     1 
HETATM 7178 O  O     . HOH L 6 .   ? -40.538 19.892  71.267  1.00 46.30 ? 444 HOH B O     1 
HETATM 7179 O  O     . HOH L 6 .   ? -59.679 20.251  62.667  1.00 40.16 ? 445 HOH B O     1 
HETATM 7180 O  O     . HOH L 6 .   ? -16.377 18.343  61.161  1.00 57.69 ? 446 HOH B O     1 
HETATM 7181 O  O     . HOH L 6 .   ? -47.138 -4.244  43.120  1.00 51.20 ? 447 HOH B O     1 
HETATM 7182 O  O     . HOH L 6 .   ? -69.906 21.738  56.851  1.00 48.87 ? 448 HOH B O     1 
HETATM 7183 O  O     . HOH L 6 .   ? -65.243 11.744  39.811  1.00 47.53 ? 449 HOH B O     1 
HETATM 7184 O  O     . HOH L 6 .   ? -27.360 14.724  57.467  1.00 44.03 ? 450 HOH B O     1 
HETATM 7185 O  O     . HOH L 6 .   ? -48.698 -5.182  51.917  1.00 58.76 ? 451 HOH B O     1 
HETATM 7186 O  O     . HOH L 6 .   ? -38.416 -10.981 69.328  1.00 65.84 ? 452 HOH B O     1 
HETATM 7187 O  O     . HOH L 6 .   ? -25.540 1.128   43.820  1.00 41.17 ? 453 HOH B O     1 
HETATM 7188 O  O     . HOH L 6 .   ? -12.483 14.114  63.939  1.00 45.94 ? 454 HOH B O     1 
HETATM 7189 O  O     . HOH M 6 .   ? -15.117 26.946  51.273  1.00 72.93 ? 193 HOH C O     1 
HETATM 7190 O  O     . HOH M 6 .   ? -21.766 31.279  31.129  1.00 58.95 ? 194 HOH C O     1 
HETATM 7191 O  O     . HOH M 6 .   ? -25.881 27.392  28.445  1.00 59.67 ? 195 HOH C O     1 
HETATM 7192 O  O     . HOH M 6 .   ? -45.242 1.010   37.528  1.00 45.89 ? 196 HOH C O     1 
HETATM 7193 O  O     . HOH M 6 .   ? -29.646 15.822  46.927  1.00 40.73 ? 197 HOH C O     1 
HETATM 7194 O  O     . HOH M 6 .   ? -32.234 5.538   41.783  1.00 43.22 ? 198 HOH C O     1 
HETATM 7195 O  O     . HOH M 6 .   ? -34.700 10.877  42.263  1.00 35.18 ? 199 HOH C O     1 
HETATM 7196 O  O     . HOH M 6 .   ? -48.540 14.903  27.190  1.00 65.63 ? 200 HOH C O     1 
HETATM 7197 O  O     . HOH M 6 .   ? -30.062 18.052  27.214  1.00 52.97 ? 201 HOH C O     1 
HETATM 7198 O  O     . HOH M 6 .   ? -40.617 2.696   43.129  1.00 31.61 ? 202 HOH C O     1 
HETATM 7199 O  O     . HOH M 6 .   ? -31.793 7.105   28.141  1.00 64.62 ? 203 HOH C O     1 
HETATM 7200 O  O     . HOH M 6 .   ? -42.041 0.286   36.217  1.00 47.24 ? 204 HOH C O     1 
HETATM 7201 O  O     . HOH M 6 .   ? -36.317 12.797  10.322  1.00 55.04 ? 205 HOH C O     1 
HETATM 7202 O  O     . HOH M 6 .   ? -13.595 24.496  51.109  1.00 61.59 ? 206 HOH C O     1 
HETATM 7203 O  O     . HOH N 6 .   ? 21.206  27.602  9.065   1.00 38.99 ? 193 HOH D O     1 
HETATM 7204 O  O     . HOH N 6 .   ? -12.895 52.503  7.967   1.00 58.43 ? 194 HOH D O     1 
HETATM 7205 O  O     . HOH N 6 .   ? 11.973  31.854  8.747   1.00 30.33 ? 195 HOH D O     1 
HETATM 7206 O  O     . HOH N 6 .   ? 22.253  30.477  8.466   1.00 57.29 ? 196 HOH D O     1 
HETATM 7207 O  O     . HOH N 6 .   ? 22.440  31.918  -1.029  1.00 51.74 ? 197 HOH D O     1 
HETATM 7208 O  O     . HOH N 6 .   ? -15.012 30.458  13.874  1.00 64.91 ? 198 HOH D O     1 
HETATM 7209 O  O     . HOH N 6 .   ? 10.257  18.196  -1.474  1.00 55.74 ? 199 HOH D O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ARG 1   32  32  ARG ARG A . n 
A 1 2   GLU 2   33  33  GLU GLU A . n 
A 1 3   VAL 3   34  34  VAL VAL A . n 
A 1 4   LYS 4   35  35  LYS LYS A . n 
A 1 5   LEU 5   36  36  LEU LEU A . n 
A 1 6   LEU 6   37  37  LEU LEU A . n 
A 1 7   LEU 7   38  38  LEU LEU A . n 
A 1 8   LEU 8   39  39  LEU LEU A . n 
A 1 9   GLY 9   40  40  GLY GLY A . n 
A 1 10  ALA 10  41  41  ALA ALA A . n 
A 1 11  GLY 11  42  42  GLY GLY A . n 
A 1 12  GLU 12  43  43  GLU GLU A . n 
A 1 13  SER 13  44  44  SER SER A . n 
A 1 14  GLY 14  45  45  GLY GLY A . n 
A 1 15  LYS 15  46  46  LYS LYS A . n 
A 1 16  SER 16  47  47  SER SER A . n 
A 1 17  THR 17  48  48  THR THR A . n 
A 1 18  ILE 18  49  49  ILE ILE A . n 
A 1 19  VAL 19  50  50  VAL VAL A . n 
A 1 20  LYS 20  51  51  LYS LYS A . n 
A 1 21  GLN 21  52  52  GLN GLN A . n 
A 1 22  MET 22  53  53  MET MET A . n 
A 1 23  LYS 23  54  54  LYS LYS A . n 
A 1 24  ILE 24  55  55  ILE ILE A . n 
A 1 25  ILE 25  56  56  ILE ILE A . n 
A 1 26  HIS 26  57  57  HIS HIS A . n 
A 1 27  GLU 27  58  58  GLU GLU A . n 
A 1 28  ALA 28  59  59  ALA ALA A . n 
A 1 29  GLY 29  60  60  GLY GLY A . n 
A 1 30  TYR 30  61  61  TYR TYR A . n 
A 1 31  SER 31  62  62  SER SER A . n 
A 1 32  GLU 32  63  63  GLU GLU A . n 
A 1 33  GLU 33  64  64  GLU GLU A . n 
A 1 34  GLU 34  65  65  GLU GLU A . n 
A 1 35  CYS 35  66  66  CYS CYS A . n 
A 1 36  LYS 36  67  67  LYS LYS A . n 
A 1 37  GLN 37  68  68  GLN GLN A . n 
A 1 38  TYR 38  69  69  TYR TYR A . n 
A 1 39  LYS 39  70  70  LYS LYS A . n 
A 1 40  ALA 40  71  71  ALA ALA A . n 
A 1 41  VAL 41  72  72  VAL VAL A . n 
A 1 42  VAL 42  73  73  VAL VAL A . n 
A 1 43  TYR 43  74  74  TYR TYR A . n 
A 1 44  SER 44  75  75  SER SER A . n 
A 1 45  ASN 45  76  76  ASN ASN A . n 
A 1 46  THR 46  77  77  THR THR A . n 
A 1 47  ILE 47  78  78  ILE ILE A . n 
A 1 48  GLN 48  79  79  GLN GLN A . n 
A 1 49  SER 49  80  80  SER SER A . n 
A 1 50  ILE 50  81  81  ILE ILE A . n 
A 1 51  ILE 51  82  82  ILE ILE A . n 
A 1 52  ALA 52  83  83  ALA ALA A . n 
A 1 53  ILE 53  84  84  ILE ILE A . n 
A 1 54  ILE 54  85  85  ILE ILE A . n 
A 1 55  ARG 55  86  86  ARG ARG A . n 
A 1 56  ALA 56  87  87  ALA ALA A . n 
A 1 57  MET 57  88  88  MET MET A . n 
A 1 58  GLY 58  89  89  GLY GLY A . n 
A 1 59  ARG 59  90  90  ARG ARG A . n 
A 1 60  LEU 60  91  91  LEU LEU A . n 
A 1 61  LYS 61  92  92  LYS LYS A . n 
A 1 62  ILE 62  93  93  ILE ILE A . n 
A 1 63  ASP 63  94  94  ASP ASP A . n 
A 1 64  PHE 64  95  95  PHE PHE A . n 
A 1 65  GLY 65  96  96  GLY GLY A . n 
A 1 66  ASP 66  97  97  ASP ASP A . n 
A 1 67  SER 67  98  98  SER SER A . n 
A 1 68  ALA 68  99  99  ALA ALA A . n 
A 1 69  ARG 69  100 100 ARG ARG A . n 
A 1 70  ALA 70  101 101 ALA ALA A . n 
A 1 71  ASP 71  102 102 ASP ASP A . n 
A 1 72  ASP 72  103 103 ASP ASP A . n 
A 1 73  ALA 73  104 104 ALA ALA A . n 
A 1 74  ARG 74  105 105 ARG ARG A . n 
A 1 75  GLN 75  106 106 GLN GLN A . n 
A 1 76  LEU 76  107 107 LEU LEU A . n 
A 1 77  PHE 77  108 108 PHE PHE A . n 
A 1 78  VAL 78  109 109 VAL VAL A . n 
A 1 79  LEU 79  110 110 LEU LEU A . n 
A 1 80  ALA 80  111 111 ALA ALA A . n 
A 1 81  GLY 81  112 ?   ?   ?   A . n 
A 1 82  ALA 82  113 ?   ?   ?   A . n 
A 1 83  ALA 83  114 ?   ?   ?   A . n 
A 1 84  GLU 84  115 ?   ?   ?   A . n 
A 1 85  GLU 85  116 ?   ?   ?   A . n 
A 1 86  GLY 86  117 ?   ?   ?   A . n 
A 1 87  PHE 87  118 ?   ?   ?   A . n 
A 1 88  MET 88  119 119 MET MET A . n 
A 1 89  THR 89  120 120 THR THR A . n 
A 1 90  ALA 90  121 121 ALA ALA A . n 
A 1 91  GLU 91  122 122 GLU GLU A . n 
A 1 92  LEU 92  123 123 LEU LEU A . n 
A 1 93  ALA 93  124 124 ALA ALA A . n 
A 1 94  GLY 94  125 125 GLY GLY A . n 
A 1 95  VAL 95  126 126 VAL VAL A . n 
A 1 96  ILE 96  127 127 ILE ILE A . n 
A 1 97  LYS 97  128 128 LYS LYS A . n 
A 1 98  ARG 98  129 129 ARG ARG A . n 
A 1 99  LEU 99  130 130 LEU LEU A . n 
A 1 100 TRP 100 131 131 TRP TRP A . n 
A 1 101 LYS 101 132 132 LYS LYS A . n 
A 1 102 ASP 102 133 133 ASP ASP A . n 
A 1 103 SER 103 134 134 SER SER A . n 
A 1 104 GLY 104 135 135 GLY GLY A . n 
A 1 105 VAL 105 136 136 VAL VAL A . n 
A 1 106 GLN 106 137 137 GLN GLN A . n 
A 1 107 ALA 107 138 138 ALA ALA A . n 
A 1 108 CYS 108 139 139 CYS CYS A . n 
A 1 109 PHE 109 140 140 PHE PHE A . n 
A 1 110 ASN 110 141 141 ASN ASN A . n 
A 1 111 ARG 111 142 142 ARG ARG A . n 
A 1 112 SER 112 143 143 SER SER A . n 
A 1 113 ARG 113 144 144 ARG ARG A . n 
A 1 114 GLU 114 145 145 GLU GLU A . n 
A 1 115 TYR 115 146 146 TYR TYR A . n 
A 1 116 GLN 116 147 147 GLN GLN A . n 
A 1 117 LEU 117 148 148 LEU LEU A . n 
A 1 118 ASN 118 149 149 ASN ASN A . n 
A 1 119 ASP 119 150 150 ASP ASP A . n 
A 1 120 SER 120 151 151 SER SER A . n 
A 1 121 ALA 121 152 152 ALA ALA A . n 
A 1 122 ALA 122 153 153 ALA ALA A . n 
A 1 123 TYR 123 154 154 TYR TYR A . n 
A 1 124 TYR 124 155 155 TYR TYR A . n 
A 1 125 LEU 125 156 156 LEU LEU A . n 
A 1 126 ASN 126 157 157 ASN ASN A . n 
A 1 127 ASP 127 158 158 ASP ASP A . n 
A 1 128 LEU 128 159 159 LEU LEU A . n 
A 1 129 ASP 129 160 160 ASP ASP A . n 
A 1 130 ARG 130 161 161 ARG ARG A . n 
A 1 131 ILE 131 162 162 ILE ILE A . n 
A 1 132 ALA 132 163 163 ALA ALA A . n 
A 1 133 GLN 133 164 164 GLN GLN A . n 
A 1 134 PRO 134 165 165 PRO PRO A . n 
A 1 135 ASN 135 166 166 ASN ASN A . n 
A 1 136 TYR 136 167 167 TYR TYR A . n 
A 1 137 ILE 137 168 168 ILE ILE A . n 
A 1 138 PRO 138 169 169 PRO PRO A . n 
A 1 139 THR 139 170 170 THR THR A . n 
A 1 140 GLN 140 171 171 GLN GLN A . n 
A 1 141 GLN 141 172 172 GLN GLN A . n 
A 1 142 ASP 142 173 173 ASP ASP A . n 
A 1 143 VAL 143 174 174 VAL VAL A . n 
A 1 144 LEU 144 175 175 LEU LEU A . n 
A 1 145 ARG 145 176 176 ARG ARG A . n 
A 1 146 THR 146 177 177 THR THR A . n 
A 1 147 ARG 147 178 178 ARG ARG A . n 
A 1 148 VAL 148 179 179 VAL VAL A . n 
A 1 149 LYS 149 180 180 LYS LYS A . n 
A 1 150 THR 150 181 181 THR THR A . n 
A 1 151 THR 151 182 182 THR THR A . n 
A 1 152 GLY 152 183 183 GLY GLY A . n 
A 1 153 ILE 153 184 184 ILE ILE A . n 
A 1 154 VAL 154 185 185 VAL VAL A . n 
A 1 155 GLU 155 186 186 GLU GLU A . n 
A 1 156 THR 156 187 187 THR THR A . n 
A 1 157 HIS 157 188 188 HIS HIS A . n 
A 1 158 PHE 158 189 189 PHE PHE A . n 
A 1 159 THR 159 190 190 THR THR A . n 
A 1 160 PHE 160 191 191 PHE PHE A . n 
A 1 161 LYS 161 192 192 LYS LYS A . n 
A 1 162 ASP 162 193 193 ASP ASP A . n 
A 1 163 LEU 163 194 194 LEU LEU A . n 
A 1 164 HIS 164 195 195 HIS HIS A . n 
A 1 165 PHE 165 196 196 PHE PHE A . n 
A 1 166 LYS 166 197 197 LYS LYS A . n 
A 1 167 MET 167 198 198 MET MET A . n 
A 1 168 PHE 168 199 199 PHE PHE A . n 
A 1 169 ASP 169 200 200 ASP ASP A . n 
A 1 170 VAL 170 201 201 VAL VAL A . n 
A 1 171 GLY 171 202 202 GLY GLY A . n 
A 1 172 GLY 172 203 203 GLY GLY A . n 
A 1 173 GLN 173 204 204 GLN GLN A . n 
A 1 174 ARG 174 205 205 ARG ARG A . n 
A 1 175 SER 175 206 206 SER SER A . n 
A 1 176 GLU 176 207 207 GLU GLU A . n 
A 1 177 ARG 177 208 208 ARG ARG A . n 
A 1 178 LYS 178 209 209 LYS LYS A . n 
A 1 179 LYS 179 210 210 LYS LYS A . n 
A 1 180 TRP 180 211 211 TRP TRP A . n 
A 1 181 ILE 181 212 212 ILE ILE A . n 
A 1 182 HIS 182 213 213 HIS HIS A . n 
A 1 183 CYS 183 214 214 CYS CYS A . n 
A 1 184 PHE 184 215 215 PHE PHE A . n 
A 1 185 GLU 185 216 216 GLU GLU A . n 
A 1 186 GLY 186 217 217 GLY GLY A . n 
A 1 187 VAL 187 218 218 VAL VAL A . n 
A 1 188 THR 188 219 219 THR THR A . n 
A 1 189 ALA 189 220 220 ALA ALA A . n 
A 1 190 ILE 190 221 221 ILE ILE A . n 
A 1 191 ILE 191 222 222 ILE ILE A . n 
A 1 192 PHE 192 223 223 PHE PHE A . n 
A 1 193 CYS 193 224 224 CYS CYS A . n 
A 1 194 VAL 194 225 225 VAL VAL A . n 
A 1 195 ALA 195 226 226 ALA ALA A . n 
A 1 196 LEU 196 227 227 LEU LEU A . n 
A 1 197 SER 197 228 228 SER SER A . n 
A 1 198 ASP 198 229 229 ASP ASP A . n 
A 1 199 TYR 199 230 230 TYR TYR A . n 
A 1 200 ASP 200 231 231 ASP ASP A . n 
A 1 201 LEU 201 232 232 LEU LEU A . n 
A 1 202 VAL 202 233 233 VAL VAL A . n 
A 1 203 LEU 203 234 234 LEU LEU A . n 
A 1 204 ALA 204 235 235 ALA ALA A . n 
A 1 205 GLU 205 236 236 GLU GLU A . n 
A 1 206 ASP 206 237 237 ASP ASP A . n 
A 1 207 GLU 207 238 238 GLU GLU A . n 
A 1 208 GLU 208 239 239 GLU GLU A . n 
A 1 209 MET 209 240 240 MET MET A . n 
A 1 210 ASN 210 241 241 ASN ASN A . n 
A 1 211 ARG 211 242 242 ARG ARG A . n 
A 1 212 MET 212 243 243 MET MET A . n 
A 1 213 HIS 213 244 244 HIS HIS A . n 
A 1 214 GLU 214 245 245 GLU GLU A . n 
A 1 215 SER 215 246 246 SER SER A . n 
A 1 216 MET 216 247 247 MET MET A . n 
A 1 217 LYS 217 248 248 LYS LYS A . n 
A 1 218 LEU 218 249 249 LEU LEU A . n 
A 1 219 PHE 219 250 250 PHE PHE A . n 
A 1 220 ASP 220 251 251 ASP ASP A . n 
A 1 221 SER 221 252 252 SER SER A . n 
A 1 222 ILE 222 253 253 ILE ILE A . n 
A 1 223 CYS 223 254 254 CYS CYS A . n 
A 1 224 ASN 224 255 255 ASN ASN A . n 
A 1 225 ASN 225 256 256 ASN ASN A . n 
A 1 226 LYS 226 257 257 LYS LYS A . n 
A 1 227 TRP 227 258 258 TRP TRP A . n 
A 1 228 PHE 228 259 259 PHE PHE A . n 
A 1 229 THR 229 260 260 THR THR A . n 
A 1 230 ASP 230 261 261 ASP ASP A . n 
A 1 231 THR 231 262 262 THR THR A . n 
A 1 232 SER 232 263 263 SER SER A . n 
A 1 233 ILE 233 264 264 ILE ILE A . n 
A 1 234 ILE 234 265 265 ILE ILE A . n 
A 1 235 LEU 235 266 266 LEU LEU A . n 
A 1 236 PHE 236 267 267 PHE PHE A . n 
A 1 237 LEU 237 268 268 LEU LEU A . n 
A 1 238 ASN 238 269 269 ASN ASN A . n 
A 1 239 LYS 239 270 270 LYS LYS A . n 
A 1 240 LYS 240 271 271 LYS LYS A . n 
A 1 241 ASP 241 272 272 ASP ASP A . n 
A 1 242 LEU 242 273 273 LEU LEU A . n 
A 1 243 PHE 243 274 274 PHE PHE A . n 
A 1 244 GLU 244 275 275 GLU GLU A . n 
A 1 245 GLU 245 276 276 GLU GLU A . n 
A 1 246 LYS 246 277 277 LYS LYS A . n 
A 1 247 ILE 247 278 278 ILE ILE A . n 
A 1 248 LYS 248 279 279 LYS LYS A . n 
A 1 249 LYS 249 280 280 LYS LYS A . n 
A 1 250 SER 250 281 281 SER SER A . n 
A 1 251 PRO 251 282 282 PRO PRO A . n 
A 1 252 LEU 252 283 283 LEU LEU A . n 
A 1 253 THR 253 284 284 THR THR A . n 
A 1 254 ILE 254 285 285 ILE ILE A . n 
A 1 255 CYS 255 286 286 CYS CYS A . n 
A 1 256 TYR 256 287 287 TYR TYR A . n 
A 1 257 PRO 257 288 288 PRO PRO A . n 
A 1 258 GLU 258 289 289 GLU GLU A . n 
A 1 259 TYR 259 290 290 TYR TYR A . n 
A 1 260 ALA 260 291 291 ALA ALA A . n 
A 1 261 GLY 261 292 292 GLY GLY A . n 
A 1 262 SER 262 293 293 SER SER A . n 
A 1 263 ASN 263 294 294 ASN ASN A . n 
A 1 264 THR 264 295 295 THR THR A . n 
A 1 265 TYR 265 296 296 TYR TYR A . n 
A 1 266 GLU 266 297 297 GLU GLU A . n 
A 1 267 GLU 267 298 298 GLU GLU A . n 
A 1 268 ALA 268 299 299 ALA ALA A . n 
A 1 269 ALA 269 300 300 ALA ALA A . n 
A 1 270 ALA 270 301 301 ALA ALA A . n 
A 1 271 TYR 271 302 302 TYR TYR A . n 
A 1 272 ILE 272 303 303 ILE ILE A . n 
A 1 273 GLN 273 304 304 GLN GLN A . n 
A 1 274 CYS 274 305 305 CYS CYS A . n 
A 1 275 GLN 275 306 306 GLN GLN A . n 
A 1 276 PHE 276 307 307 PHE PHE A . n 
A 1 277 GLU 277 308 308 GLU GLU A . n 
A 1 278 ASP 278 309 309 ASP ASP A . n 
A 1 279 LEU 279 310 310 LEU LEU A . n 
A 1 280 ASN 280 311 311 ASN ASN A . n 
A 1 281 LYS 281 312 312 LYS LYS A . n 
A 1 282 ARG 282 313 313 ARG ARG A . n 
A 1 283 LYS 283 314 314 LYS LYS A . n 
A 1 284 ASP 284 315 315 ASP ASP A . n 
A 1 285 THR 285 316 316 THR THR A . n 
A 1 286 LYS 286 317 317 LYS LYS A . n 
A 1 287 GLU 287 318 318 GLU GLU A . n 
A 1 288 ILE 288 319 319 ILE ILE A . n 
A 1 289 TYR 289 320 320 TYR TYR A . n 
A 1 290 THR 290 321 321 THR THR A . n 
A 1 291 HIS 291 322 322 HIS HIS A . n 
A 1 292 PHE 292 323 323 PHE PHE A . n 
A 1 293 THR 293 324 324 THR THR A . n 
A 1 294 CYS 294 325 325 CYS CYS A . n 
A 1 295 ALA 295 326 326 ALA ALA A . n 
A 1 296 THR 296 327 327 THR THR A . n 
A 1 297 ASP 297 328 328 ASP ASP A . n 
A 1 298 THR 298 329 329 THR THR A . n 
A 1 299 LYS 299 330 330 LYS LYS A . n 
A 1 300 ASN 300 331 331 ASN ASN A . n 
A 1 301 VAL 301 332 332 VAL VAL A . n 
A 1 302 GLN 302 333 333 GLN GLN A . n 
A 1 303 PHE 303 334 334 PHE PHE A . n 
A 1 304 VAL 304 335 335 VAL VAL A . n 
A 1 305 PHE 305 336 336 PHE PHE A . n 
A 1 306 ASP 306 337 337 ASP ASP A . n 
A 1 307 ALA 307 338 338 ALA ALA A . n 
A 1 308 VAL 308 339 339 VAL VAL A . n 
A 1 309 THR 309 340 340 THR THR A . n 
A 1 310 ASP 310 341 341 ASP ASP A . n 
A 1 311 VAL 311 342 342 VAL VAL A . n 
A 1 312 ILE 312 343 343 ILE ILE A . n 
A 1 313 ILE 313 344 344 ILE ILE A . n 
A 1 314 LYS 314 345 345 LYS LYS A . n 
A 1 315 ASN 315 346 346 ASN ASN A . n 
A 1 316 ASN 316 347 347 ASN ASN A . n 
A 1 317 LEU 317 348 348 LEU LEU A . n 
A 1 318 LYS 318 349 ?   ?   ?   A . n 
A 1 319 ASP 319 350 ?   ?   ?   A . n 
A 1 320 CYS 320 351 ?   ?   ?   A . n 
A 1 321 GLY 321 352 ?   ?   ?   A . n 
A 1 322 LEU 322 353 ?   ?   ?   A . n 
A 1 323 PHE 323 354 ?   ?   ?   A . n 
B 1 1   ARG 1   32  32  ARG ARG B . n 
B 1 2   GLU 2   33  33  GLU GLU B . n 
B 1 3   VAL 3   34  34  VAL VAL B . n 
B 1 4   LYS 4   35  35  LYS LYS B . n 
B 1 5   LEU 5   36  36  LEU LEU B . n 
B 1 6   LEU 6   37  37  LEU LEU B . n 
B 1 7   LEU 7   38  38  LEU LEU B . n 
B 1 8   LEU 8   39  39  LEU LEU B . n 
B 1 9   GLY 9   40  40  GLY GLY B . n 
B 1 10  ALA 10  41  41  ALA ALA B . n 
B 1 11  GLY 11  42  42  GLY GLY B . n 
B 1 12  GLU 12  43  43  GLU GLU B . n 
B 1 13  SER 13  44  44  SER SER B . n 
B 1 14  GLY 14  45  45  GLY GLY B . n 
B 1 15  LYS 15  46  46  LYS LYS B . n 
B 1 16  SER 16  47  47  SER SER B . n 
B 1 17  THR 17  48  48  THR THR B . n 
B 1 18  ILE 18  49  49  ILE ILE B . n 
B 1 19  VAL 19  50  50  VAL VAL B . n 
B 1 20  LYS 20  51  51  LYS LYS B . n 
B 1 21  GLN 21  52  52  GLN GLN B . n 
B 1 22  MET 22  53  53  MET MET B . n 
B 1 23  LYS 23  54  54  LYS LYS B . n 
B 1 24  ILE 24  55  55  ILE ILE B . n 
B 1 25  ILE 25  56  56  ILE ILE B . n 
B 1 26  HIS 26  57  57  HIS HIS B . n 
B 1 27  GLU 27  58  58  GLU GLU B . n 
B 1 28  ALA 28  59  59  ALA ALA B . n 
B 1 29  GLY 29  60  60  GLY GLY B . n 
B 1 30  TYR 30  61  61  TYR TYR B . n 
B 1 31  SER 31  62  62  SER SER B . n 
B 1 32  GLU 32  63  63  GLU GLU B . n 
B 1 33  GLU 33  64  64  GLU GLU B . n 
B 1 34  GLU 34  65  65  GLU GLU B . n 
B 1 35  CYS 35  66  66  CYS CYS B . n 
B 1 36  LYS 36  67  67  LYS LYS B . n 
B 1 37  GLN 37  68  68  GLN GLN B . n 
B 1 38  TYR 38  69  69  TYR TYR B . n 
B 1 39  LYS 39  70  70  LYS LYS B . n 
B 1 40  ALA 40  71  71  ALA ALA B . n 
B 1 41  VAL 41  72  72  VAL VAL B . n 
B 1 42  VAL 42  73  73  VAL VAL B . n 
B 1 43  TYR 43  74  74  TYR TYR B . n 
B 1 44  SER 44  75  75  SER SER B . n 
B 1 45  ASN 45  76  76  ASN ASN B . n 
B 1 46  THR 46  77  77  THR THR B . n 
B 1 47  ILE 47  78  78  ILE ILE B . n 
B 1 48  GLN 48  79  79  GLN GLN B . n 
B 1 49  SER 49  80  80  SER SER B . n 
B 1 50  ILE 50  81  81  ILE ILE B . n 
B 1 51  ILE 51  82  82  ILE ILE B . n 
B 1 52  ALA 52  83  83  ALA ALA B . n 
B 1 53  ILE 53  84  84  ILE ILE B . n 
B 1 54  ILE 54  85  85  ILE ILE B . n 
B 1 55  ARG 55  86  86  ARG ARG B . n 
B 1 56  ALA 56  87  87  ALA ALA B . n 
B 1 57  MET 57  88  88  MET MET B . n 
B 1 58  GLY 58  89  89  GLY GLY B . n 
B 1 59  ARG 59  90  90  ARG ARG B . n 
B 1 60  LEU 60  91  91  LEU LEU B . n 
B 1 61  LYS 61  92  92  LYS LYS B . n 
B 1 62  ILE 62  93  93  ILE ILE B . n 
B 1 63  ASP 63  94  94  ASP ASP B . n 
B 1 64  PHE 64  95  95  PHE PHE B . n 
B 1 65  GLY 65  96  96  GLY GLY B . n 
B 1 66  ASP 66  97  97  ASP ASP B . n 
B 1 67  SER 67  98  98  SER SER B . n 
B 1 68  ALA 68  99  99  ALA ALA B . n 
B 1 69  ARG 69  100 100 ARG ARG B . n 
B 1 70  ALA 70  101 101 ALA ALA B . n 
B 1 71  ASP 71  102 102 ASP ASP B . n 
B 1 72  ASP 72  103 103 ASP ASP B . n 
B 1 73  ALA 73  104 104 ALA ALA B . n 
B 1 74  ARG 74  105 105 ARG ARG B . n 
B 1 75  GLN 75  106 106 GLN GLN B . n 
B 1 76  LEU 76  107 107 LEU LEU B . n 
B 1 77  PHE 77  108 108 PHE PHE B . n 
B 1 78  VAL 78  109 109 VAL VAL B . n 
B 1 79  LEU 79  110 110 LEU LEU B . n 
B 1 80  ALA 80  111 111 ALA ALA B . n 
B 1 81  GLY 81  112 112 GLY GLY B . n 
B 1 82  ALA 82  113 113 ALA ALA B . n 
B 1 83  ALA 83  114 114 ALA ALA B . n 
B 1 84  GLU 84  115 115 GLU GLU B . n 
B 1 85  GLU 85  116 116 GLU GLU B . n 
B 1 86  GLY 86  117 117 GLY GLY B . n 
B 1 87  PHE 87  118 118 PHE PHE B . n 
B 1 88  MET 88  119 119 MET MET B . n 
B 1 89  THR 89  120 120 THR THR B . n 
B 1 90  ALA 90  121 121 ALA ALA B . n 
B 1 91  GLU 91  122 122 GLU GLU B . n 
B 1 92  LEU 92  123 123 LEU LEU B . n 
B 1 93  ALA 93  124 124 ALA ALA B . n 
B 1 94  GLY 94  125 125 GLY GLY B . n 
B 1 95  VAL 95  126 126 VAL VAL B . n 
B 1 96  ILE 96  127 127 ILE ILE B . n 
B 1 97  LYS 97  128 128 LYS LYS B . n 
B 1 98  ARG 98  129 129 ARG ARG B . n 
B 1 99  LEU 99  130 130 LEU LEU B . n 
B 1 100 TRP 100 131 131 TRP TRP B . n 
B 1 101 LYS 101 132 132 LYS LYS B . n 
B 1 102 ASP 102 133 133 ASP ASP B . n 
B 1 103 SER 103 134 134 SER SER B . n 
B 1 104 GLY 104 135 135 GLY GLY B . n 
B 1 105 VAL 105 136 136 VAL VAL B . n 
B 1 106 GLN 106 137 137 GLN GLN B . n 
B 1 107 ALA 107 138 138 ALA ALA B . n 
B 1 108 CYS 108 139 139 CYS CYS B . n 
B 1 109 PHE 109 140 140 PHE PHE B . n 
B 1 110 ASN 110 141 141 ASN ASN B . n 
B 1 111 ARG 111 142 142 ARG ARG B . n 
B 1 112 SER 112 143 143 SER SER B . n 
B 1 113 ARG 113 144 144 ARG ARG B . n 
B 1 114 GLU 114 145 145 GLU GLU B . n 
B 1 115 TYR 115 146 146 TYR TYR B . n 
B 1 116 GLN 116 147 147 GLN GLN B . n 
B 1 117 LEU 117 148 148 LEU LEU B . n 
B 1 118 ASN 118 149 149 ASN ASN B . n 
B 1 119 ASP 119 150 150 ASP ASP B . n 
B 1 120 SER 120 151 151 SER SER B . n 
B 1 121 ALA 121 152 152 ALA ALA B . n 
B 1 122 ALA 122 153 153 ALA ALA B . n 
B 1 123 TYR 123 154 154 TYR TYR B . n 
B 1 124 TYR 124 155 155 TYR TYR B . n 
B 1 125 LEU 125 156 156 LEU LEU B . n 
B 1 126 ASN 126 157 157 ASN ASN B . n 
B 1 127 ASP 127 158 158 ASP ASP B . n 
B 1 128 LEU 128 159 159 LEU LEU B . n 
B 1 129 ASP 129 160 160 ASP ASP B . n 
B 1 130 ARG 130 161 161 ARG ARG B . n 
B 1 131 ILE 131 162 162 ILE ILE B . n 
B 1 132 ALA 132 163 163 ALA ALA B . n 
B 1 133 GLN 133 164 164 GLN GLN B . n 
B 1 134 PRO 134 165 165 PRO PRO B . n 
B 1 135 ASN 135 166 166 ASN ASN B . n 
B 1 136 TYR 136 167 167 TYR TYR B . n 
B 1 137 ILE 137 168 168 ILE ILE B . n 
B 1 138 PRO 138 169 169 PRO PRO B . n 
B 1 139 THR 139 170 170 THR THR B . n 
B 1 140 GLN 140 171 171 GLN GLN B . n 
B 1 141 GLN 141 172 172 GLN GLN B . n 
B 1 142 ASP 142 173 173 ASP ASP B . n 
B 1 143 VAL 143 174 174 VAL VAL B . n 
B 1 144 LEU 144 175 175 LEU LEU B . n 
B 1 145 ARG 145 176 176 ARG ARG B . n 
B 1 146 THR 146 177 177 THR THR B . n 
B 1 147 ARG 147 178 178 ARG ARG B . n 
B 1 148 VAL 148 179 179 VAL VAL B . n 
B 1 149 LYS 149 180 180 LYS LYS B . n 
B 1 150 THR 150 181 181 THR THR B . n 
B 1 151 THR 151 182 182 THR THR B . n 
B 1 152 GLY 152 183 183 GLY GLY B . n 
B 1 153 ILE 153 184 184 ILE ILE B . n 
B 1 154 VAL 154 185 185 VAL VAL B . n 
B 1 155 GLU 155 186 186 GLU GLU B . n 
B 1 156 THR 156 187 187 THR THR B . n 
B 1 157 HIS 157 188 188 HIS HIS B . n 
B 1 158 PHE 158 189 189 PHE PHE B . n 
B 1 159 THR 159 190 190 THR THR B . n 
B 1 160 PHE 160 191 191 PHE PHE B . n 
B 1 161 LYS 161 192 192 LYS LYS B . n 
B 1 162 ASP 162 193 193 ASP ASP B . n 
B 1 163 LEU 163 194 194 LEU LEU B . n 
B 1 164 HIS 164 195 195 HIS HIS B . n 
B 1 165 PHE 165 196 196 PHE PHE B . n 
B 1 166 LYS 166 197 197 LYS LYS B . n 
B 1 167 MET 167 198 198 MET MET B . n 
B 1 168 PHE 168 199 199 PHE PHE B . n 
B 1 169 ASP 169 200 200 ASP ASP B . n 
B 1 170 VAL 170 201 201 VAL VAL B . n 
B 1 171 GLY 171 202 202 GLY GLY B . n 
B 1 172 GLY 172 203 203 GLY GLY B . n 
B 1 173 GLN 173 204 204 GLN GLN B . n 
B 1 174 ARG 174 205 205 ARG ARG B . n 
B 1 175 SER 175 206 206 SER SER B . n 
B 1 176 GLU 176 207 207 GLU GLU B . n 
B 1 177 ARG 177 208 208 ARG ARG B . n 
B 1 178 LYS 178 209 209 LYS LYS B . n 
B 1 179 LYS 179 210 210 LYS LYS B . n 
B 1 180 TRP 180 211 211 TRP TRP B . n 
B 1 181 ILE 181 212 212 ILE ILE B . n 
B 1 182 HIS 182 213 213 HIS HIS B . n 
B 1 183 CYS 183 214 214 CYS CYS B . n 
B 1 184 PHE 184 215 215 PHE PHE B . n 
B 1 185 GLU 185 216 216 GLU GLU B . n 
B 1 186 GLY 186 217 217 GLY GLY B . n 
B 1 187 VAL 187 218 218 VAL VAL B . n 
B 1 188 THR 188 219 219 THR THR B . n 
B 1 189 ALA 189 220 220 ALA ALA B . n 
B 1 190 ILE 190 221 221 ILE ILE B . n 
B 1 191 ILE 191 222 222 ILE ILE B . n 
B 1 192 PHE 192 223 223 PHE PHE B . n 
B 1 193 CYS 193 224 224 CYS CYS B . n 
B 1 194 VAL 194 225 225 VAL VAL B . n 
B 1 195 ALA 195 226 226 ALA ALA B . n 
B 1 196 LEU 196 227 227 LEU LEU B . n 
B 1 197 SER 197 228 228 SER SER B . n 
B 1 198 ASP 198 229 229 ASP ASP B . n 
B 1 199 TYR 199 230 230 TYR TYR B . n 
B 1 200 ASP 200 231 231 ASP ASP B . n 
B 1 201 LEU 201 232 232 LEU LEU B . n 
B 1 202 VAL 202 233 233 VAL VAL B . n 
B 1 203 LEU 203 234 234 LEU LEU B . n 
B 1 204 ALA 204 235 235 ALA ALA B . n 
B 1 205 GLU 205 236 236 GLU GLU B . n 
B 1 206 ASP 206 237 237 ASP ASP B . n 
B 1 207 GLU 207 238 238 GLU GLU B . n 
B 1 208 GLU 208 239 239 GLU GLU B . n 
B 1 209 MET 209 240 240 MET MET B . n 
B 1 210 ASN 210 241 241 ASN ASN B . n 
B 1 211 ARG 211 242 242 ARG ARG B . n 
B 1 212 MET 212 243 243 MET MET B . n 
B 1 213 HIS 213 244 244 HIS HIS B . n 
B 1 214 GLU 214 245 245 GLU GLU B . n 
B 1 215 SER 215 246 246 SER SER B . n 
B 1 216 MET 216 247 247 MET MET B . n 
B 1 217 LYS 217 248 248 LYS LYS B . n 
B 1 218 LEU 218 249 249 LEU LEU B . n 
B 1 219 PHE 219 250 250 PHE PHE B . n 
B 1 220 ASP 220 251 251 ASP ASP B . n 
B 1 221 SER 221 252 252 SER SER B . n 
B 1 222 ILE 222 253 253 ILE ILE B . n 
B 1 223 CYS 223 254 254 CYS CYS B . n 
B 1 224 ASN 224 255 255 ASN ASN B . n 
B 1 225 ASN 225 256 256 ASN ASN B . n 
B 1 226 LYS 226 257 257 LYS LYS B . n 
B 1 227 TRP 227 258 258 TRP TRP B . n 
B 1 228 PHE 228 259 259 PHE PHE B . n 
B 1 229 THR 229 260 260 THR THR B . n 
B 1 230 ASP 230 261 261 ASP ASP B . n 
B 1 231 THR 231 262 262 THR THR B . n 
B 1 232 SER 232 263 263 SER SER B . n 
B 1 233 ILE 233 264 264 ILE ILE B . n 
B 1 234 ILE 234 265 265 ILE ILE B . n 
B 1 235 LEU 235 266 266 LEU LEU B . n 
B 1 236 PHE 236 267 267 PHE PHE B . n 
B 1 237 LEU 237 268 268 LEU LEU B . n 
B 1 238 ASN 238 269 269 ASN ASN B . n 
B 1 239 LYS 239 270 270 LYS LYS B . n 
B 1 240 LYS 240 271 271 LYS LYS B . n 
B 1 241 ASP 241 272 272 ASP ASP B . n 
B 1 242 LEU 242 273 273 LEU LEU B . n 
B 1 243 PHE 243 274 274 PHE PHE B . n 
B 1 244 GLU 244 275 275 GLU GLU B . n 
B 1 245 GLU 245 276 276 GLU GLU B . n 
B 1 246 LYS 246 277 277 LYS LYS B . n 
B 1 247 ILE 247 278 278 ILE ILE B . n 
B 1 248 LYS 248 279 279 LYS LYS B . n 
B 1 249 LYS 249 280 280 LYS LYS B . n 
B 1 250 SER 250 281 281 SER SER B . n 
B 1 251 PRO 251 282 282 PRO PRO B . n 
B 1 252 LEU 252 283 283 LEU LEU B . n 
B 1 253 THR 253 284 284 THR THR B . n 
B 1 254 ILE 254 285 285 ILE ILE B . n 
B 1 255 CYS 255 286 286 CYS CYS B . n 
B 1 256 TYR 256 287 287 TYR TYR B . n 
B 1 257 PRO 257 288 288 PRO PRO B . n 
B 1 258 GLU 258 289 289 GLU GLU B . n 
B 1 259 TYR 259 290 290 TYR TYR B . n 
B 1 260 ALA 260 291 291 ALA ALA B . n 
B 1 261 GLY 261 292 292 GLY GLY B . n 
B 1 262 SER 262 293 293 SER SER B . n 
B 1 263 ASN 263 294 294 ASN ASN B . n 
B 1 264 THR 264 295 295 THR THR B . n 
B 1 265 TYR 265 296 296 TYR TYR B . n 
B 1 266 GLU 266 297 297 GLU GLU B . n 
B 1 267 GLU 267 298 298 GLU GLU B . n 
B 1 268 ALA 268 299 299 ALA ALA B . n 
B 1 269 ALA 269 300 300 ALA ALA B . n 
B 1 270 ALA 270 301 301 ALA ALA B . n 
B 1 271 TYR 271 302 302 TYR TYR B . n 
B 1 272 ILE 272 303 303 ILE ILE B . n 
B 1 273 GLN 273 304 304 GLN GLN B . n 
B 1 274 CYS 274 305 305 CYS CYS B . n 
B 1 275 GLN 275 306 306 GLN GLN B . n 
B 1 276 PHE 276 307 307 PHE PHE B . n 
B 1 277 GLU 277 308 308 GLU GLU B . n 
B 1 278 ASP 278 309 309 ASP ASP B . n 
B 1 279 LEU 279 310 310 LEU LEU B . n 
B 1 280 ASN 280 311 311 ASN ASN B . n 
B 1 281 LYS 281 312 312 LYS LYS B . n 
B 1 282 ARG 282 313 313 ARG ARG B . n 
B 1 283 LYS 283 314 314 LYS LYS B . n 
B 1 284 ASP 284 315 315 ASP ASP B . n 
B 1 285 THR 285 316 316 THR THR B . n 
B 1 286 LYS 286 317 317 LYS LYS B . n 
B 1 287 GLU 287 318 318 GLU GLU B . n 
B 1 288 ILE 288 319 319 ILE ILE B . n 
B 1 289 TYR 289 320 320 TYR TYR B . n 
B 1 290 THR 290 321 321 THR THR B . n 
B 1 291 HIS 291 322 322 HIS HIS B . n 
B 1 292 PHE 292 323 323 PHE PHE B . n 
B 1 293 THR 293 324 324 THR THR B . n 
B 1 294 CYS 294 325 325 CYS CYS B . n 
B 1 295 ALA 295 326 326 ALA ALA B . n 
B 1 296 THR 296 327 327 THR THR B . n 
B 1 297 ASP 297 328 328 ASP ASP B . n 
B 1 298 THR 298 329 329 THR THR B . n 
B 1 299 LYS 299 330 330 LYS LYS B . n 
B 1 300 ASN 300 331 331 ASN ASN B . n 
B 1 301 VAL 301 332 332 VAL VAL B . n 
B 1 302 GLN 302 333 333 GLN GLN B . n 
B 1 303 PHE 303 334 334 PHE PHE B . n 
B 1 304 VAL 304 335 335 VAL VAL B . n 
B 1 305 PHE 305 336 336 PHE PHE B . n 
B 1 306 ASP 306 337 337 ASP ASP B . n 
B 1 307 ALA 307 338 338 ALA ALA B . n 
B 1 308 VAL 308 339 339 VAL VAL B . n 
B 1 309 THR 309 340 340 THR THR B . n 
B 1 310 ASP 310 341 341 ASP ASP B . n 
B 1 311 VAL 311 342 342 VAL VAL B . n 
B 1 312 ILE 312 343 343 ILE ILE B . n 
B 1 313 ILE 313 344 344 ILE ILE B . n 
B 1 314 LYS 314 345 345 LYS LYS B . n 
B 1 315 ASN 315 346 346 ASN ASN B . n 
B 1 316 ASN 316 347 347 ASN ASN B . n 
B 1 317 LEU 317 348 348 LEU LEU B . n 
B 1 318 LYS 318 349 ?   ?   ?   B . n 
B 1 319 ASP 319 350 ?   ?   ?   B . n 
B 1 320 CYS 320 351 ?   ?   ?   B . n 
B 1 321 GLY 321 352 ?   ?   ?   B . n 
B 1 322 LEU 322 353 ?   ?   ?   B . n 
B 1 323 PHE 323 354 ?   ?   ?   B . n 
C 2 1   SER 1   48  ?   ?   ?   C . n 
C 2 2   MET 2   49  ?   ?   ?   C . n 
C 2 3   SER 3   50  ?   ?   ?   C . n 
C 2 4   GLY 4   51  ?   ?   ?   C . n 
C 2 5   MET 5   52  ?   ?   ?   C . n 
C 2 6   LYS 6   53  ?   ?   ?   C . n 
C 2 7   SER 7   54  ?   ?   ?   C . n 
C 2 8   SER 8   55  ?   ?   ?   C . n 
C 2 9   LYS 9   56  ?   ?   ?   C . n 
C 2 10  SER 10  57  ?   ?   ?   C . n 
C 2 11  LYS 11  58  ?   ?   ?   C . n 
C 2 12  ASP 12  59  ?   ?   ?   C . n 
C 2 13  VAL 13  60  60  VAL VAL C . n 
C 2 14  LEU 14  61  61  LEU LEU C . n 
C 2 15  SER 15  62  62  SER SER C . n 
C 2 16  ALA 16  63  63  ALA ALA C . n 
C 2 17  ALA 17  64  64  ALA ALA C . n 
C 2 18  GLU 18  65  65  GLU GLU C . n 
C 2 19  VAL 19  66  66  VAL VAL C . n 
C 2 20  MET 20  67  67  MET MET C . n 
C 2 21  GLN 21  68  68  GLN GLN C . n 
C 2 22  TRP 22  69  69  TRP TRP C . n 
C 2 23  SER 23  70  70  SER SER C . n 
C 2 24  GLN 24  71  71  GLN GLN C . n 
C 2 25  SER 25  72  72  SER SER C . n 
C 2 26  LEU 26  73  73  LEU LEU C . n 
C 2 27  GLU 27  74  74  GLU GLU C . n 
C 2 28  LYS 28  75  75  LYS LYS C . n 
C 2 29  LEU 29  76  76  LEU LEU C . n 
C 2 30  LEU 30  77  77  LEU LEU C . n 
C 2 31  ALA 31  78  78  ALA ALA C . n 
C 2 32  ASN 32  79  79  ASN ASN C . n 
C 2 33  GLN 33  80  80  GLN GLN C . n 
C 2 34  THR 34  81  81  THR THR C . n 
C 2 35  GLY 35  82  82  GLY GLY C . n 
C 2 36  GLN 36  83  83  GLN GLN C . n 
C 2 37  ASN 37  84  84  ASN ASN C . n 
C 2 38  VAL 38  85  85  VAL VAL C . n 
C 2 39  PHE 39  86  86  PHE PHE C . n 
C 2 40  GLY 40  87  87  GLY GLY C . n 
C 2 41  SER 41  88  88  SER SER C . n 
C 2 42  PHE 42  89  89  PHE PHE C . n 
C 2 43  LEU 43  90  90  LEU LEU C . n 
C 2 44  LYS 44  91  91  LYS LYS C . n 
C 2 45  SER 45  92  92  SER SER C . n 
C 2 46  GLU 46  93  93  GLU GLU C . n 
C 2 47  PHE 47  94  94  PHE PHE C . n 
C 2 48  SER 48  95  95  SER SER C . n 
C 2 49  GLU 49  96  96  GLU GLU C . n 
C 2 50  GLU 50  97  97  GLU GLU C . n 
C 2 51  ASN 51  98  98  ASN ASN C . n 
C 2 52  ILE 52  99  99  ILE ILE C . n 
C 2 53  GLU 53  100 100 GLU GLU C . n 
C 2 54  PHE 54  101 101 PHE PHE C . n 
C 2 55  TRP 55  102 102 TRP TRP C . n 
C 2 56  LEU 56  103 103 LEU LEU C . n 
C 2 57  ALA 57  104 104 ALA ALA C . n 
C 2 58  CYS 58  105 105 CYS CYS C . n 
C 2 59  GLU 59  106 106 GLU GLU C . n 
C 2 60  ASP 60  107 107 ASP ASP C . n 
C 2 61  TYR 61  108 108 TYR TYR C . n 
C 2 62  LYS 62  109 109 LYS LYS C . n 
C 2 63  LYS 63  110 110 LYS LYS C . n 
C 2 64  THR 64  111 111 THR THR C . n 
C 2 65  GLU 65  112 112 GLU GLU C . n 
C 2 66  SER 66  113 113 SER SER C . n 
C 2 67  ASP 67  114 114 ASP ASP C . n 
C 2 68  LEU 68  115 115 LEU LEU C . n 
C 2 69  LEU 69  116 116 LEU LEU C . n 
C 2 70  PRO 70  117 117 PRO PRO C . n 
C 2 71  CYS 71  118 118 CYS CYS C . n 
C 2 72  LYS 72  119 119 LYS LYS C . n 
C 2 73  ALA 73  120 120 ALA ALA C . n 
C 2 74  GLU 74  121 121 GLU GLU C . n 
C 2 75  GLU 75  122 122 GLU GLU C . n 
C 2 76  ILE 76  123 123 ILE ILE C . n 
C 2 77  TYR 77  124 124 TYR TYR C . n 
C 2 78  LYS 78  125 125 LYS LYS C . n 
C 2 79  ALA 79  126 126 ALA ALA C . n 
C 2 80  PHE 80  127 127 PHE PHE C . n 
C 2 81  VAL 81  128 128 VAL VAL C . n 
C 2 82  HIS 82  129 129 HIS HIS C . n 
C 2 83  SER 83  130 130 SER SER C . n 
C 2 84  ASP 84  131 131 ASP ASP C . n 
C 2 85  ALA 85  132 132 ALA ALA C . n 
C 2 86  ALA 86  133 133 ALA ALA C . n 
C 2 87  LYS 87  134 134 LYS LYS C . n 
C 2 88  GLN 88  135 135 GLN GLN C . n 
C 2 89  ILE 89  136 136 ILE ILE C . n 
C 2 90  ASN 90  137 137 ASN ASN C . n 
C 2 91  ILE 91  138 138 ILE ILE C . n 
C 2 92  ASP 92  139 139 ASP ASP C . n 
C 2 93  PHE 93  140 140 PHE PHE C . n 
C 2 94  ARG 94  141 141 ARG ARG C . n 
C 2 95  THR 95  142 142 THR THR C . n 
C 2 96  ARG 96  143 143 ARG ARG C . n 
C 2 97  GLU 97  144 144 GLU GLU C . n 
C 2 98  SER 98  145 145 SER SER C . n 
C 2 99  THR 99  146 146 THR THR C . n 
C 2 100 ALA 100 147 147 ALA ALA C . n 
C 2 101 LYS 101 148 148 LYS LYS C . n 
C 2 102 LYS 102 149 149 LYS LYS C . n 
C 2 103 ILE 103 150 150 ILE ILE C . n 
C 2 104 LYS 104 151 151 LYS LYS C . n 
C 2 105 ALA 105 152 152 ALA ALA C . n 
C 2 106 PRO 106 153 153 PRO PRO C . n 
C 2 107 THR 107 154 154 THR THR C . n 
C 2 108 PRO 108 155 155 PRO PRO C . n 
C 2 109 THR 109 156 156 THR THR C . n 
C 2 110 CYS 110 157 157 CYS CYS C . n 
C 2 111 PHE 111 158 158 PHE PHE C . n 
C 2 112 ASP 112 159 159 ASP ASP C . n 
C 2 113 GLU 113 160 160 GLU GLU C . n 
C 2 114 ALA 114 161 161 ALA ALA C . n 
C 2 115 GLN 115 162 162 GLN GLN C . n 
C 2 116 LYS 116 163 163 LYS LYS C . n 
C 2 117 VAL 117 164 164 VAL VAL C . n 
C 2 118 ILE 118 165 165 ILE ILE C . n 
C 2 119 TYR 119 166 166 TYR TYR C . n 
C 2 120 THR 120 167 167 THR THR C . n 
C 2 121 LEU 121 168 168 LEU LEU C . n 
C 2 122 MET 122 169 169 MET MET C . n 
C 2 123 GLU 123 170 170 GLU GLU C . n 
C 2 124 LYS 124 171 171 LYS LYS C . n 
C 2 125 ASP 125 172 172 ASP ASP C . n 
C 2 126 SER 126 173 173 SER SER C . n 
C 2 127 TYR 127 174 174 TYR TYR C . n 
C 2 128 PRO 128 175 175 PRO PRO C . n 
C 2 129 ARG 129 176 176 ARG ARG C . n 
C 2 130 PHE 130 177 177 PHE PHE C . n 
C 2 131 LEU 131 178 178 LEU LEU C . n 
C 2 132 LYS 132 179 179 LYS LYS C . n 
C 2 133 SER 133 180 180 SER SER C . n 
C 2 134 ASP 134 181 181 ASP ASP C . n 
C 2 135 ILE 135 182 182 ILE ILE C . n 
C 2 136 TYR 136 183 183 TYR TYR C . n 
C 2 137 LEU 137 184 184 LEU LEU C . n 
C 2 138 ASN 138 185 185 ASN ASN C . n 
C 2 139 LEU 139 186 186 LEU LEU C . n 
C 2 140 LEU 140 187 187 LEU LEU C . n 
C 2 141 ASN 141 188 188 ASN ASN C . n 
C 2 142 ASP 142 189 189 ASP ASP C . n 
C 2 143 LEU 143 190 190 LEU LEU C . n 
C 2 144 GLN 144 191 191 GLN GLN C . n 
C 2 145 ALA 145 192 ?   ?   ?   C . n 
D 2 1   SER 1   48  ?   ?   ?   D . n 
D 2 2   MET 2   49  ?   ?   ?   D . n 
D 2 3   SER 3   50  ?   ?   ?   D . n 
D 2 4   GLY 4   51  ?   ?   ?   D . n 
D 2 5   MET 5   52  ?   ?   ?   D . n 
D 2 6   LYS 6   53  ?   ?   ?   D . n 
D 2 7   SER 7   54  ?   ?   ?   D . n 
D 2 8   SER 8   55  ?   ?   ?   D . n 
D 2 9   LYS 9   56  ?   ?   ?   D . n 
D 2 10  SER 10  57  ?   ?   ?   D . n 
D 2 11  LYS 11  58  ?   ?   ?   D . n 
D 2 12  ASP 12  59  ?   ?   ?   D . n 
D 2 13  VAL 13  60  60  VAL VAL D . n 
D 2 14  LEU 14  61  61  LEU LEU D . n 
D 2 15  SER 15  62  62  SER SER D . n 
D 2 16  ALA 16  63  63  ALA ALA D . n 
D 2 17  ALA 17  64  64  ALA ALA D . n 
D 2 18  GLU 18  65  65  GLU GLU D . n 
D 2 19  VAL 19  66  66  VAL VAL D . n 
D 2 20  MET 20  67  67  MET MET D . n 
D 2 21  GLN 21  68  68  GLN GLN D . n 
D 2 22  TRP 22  69  69  TRP TRP D . n 
D 2 23  SER 23  70  70  SER SER D . n 
D 2 24  GLN 24  71  71  GLN GLN D . n 
D 2 25  SER 25  72  72  SER SER D . n 
D 2 26  LEU 26  73  73  LEU LEU D . n 
D 2 27  GLU 27  74  74  GLU GLU D . n 
D 2 28  LYS 28  75  75  LYS LYS D . n 
D 2 29  LEU 29  76  76  LEU LEU D . n 
D 2 30  LEU 30  77  77  LEU LEU D . n 
D 2 31  ALA 31  78  78  ALA ALA D . n 
D 2 32  ASN 32  79  79  ASN ASN D . n 
D 2 33  GLN 33  80  80  GLN GLN D . n 
D 2 34  THR 34  81  81  THR THR D . n 
D 2 35  GLY 35  82  82  GLY GLY D . n 
D 2 36  GLN 36  83  83  GLN GLN D . n 
D 2 37  ASN 37  84  84  ASN ASN D . n 
D 2 38  VAL 38  85  85  VAL VAL D . n 
D 2 39  PHE 39  86  86  PHE PHE D . n 
D 2 40  GLY 40  87  87  GLY GLY D . n 
D 2 41  SER 41  88  88  SER SER D . n 
D 2 42  PHE 42  89  89  PHE PHE D . n 
D 2 43  LEU 43  90  90  LEU LEU D . n 
D 2 44  LYS 44  91  91  LYS LYS D . n 
D 2 45  SER 45  92  92  SER SER D . n 
D 2 46  GLU 46  93  93  GLU GLU D . n 
D 2 47  PHE 47  94  94  PHE PHE D . n 
D 2 48  SER 48  95  95  SER SER D . n 
D 2 49  GLU 49  96  96  GLU GLU D . n 
D 2 50  GLU 50  97  97  GLU GLU D . n 
D 2 51  ASN 51  98  98  ASN ASN D . n 
D 2 52  ILE 52  99  99  ILE ILE D . n 
D 2 53  GLU 53  100 100 GLU GLU D . n 
D 2 54  PHE 54  101 101 PHE PHE D . n 
D 2 55  TRP 55  102 102 TRP TRP D . n 
D 2 56  LEU 56  103 103 LEU LEU D . n 
D 2 57  ALA 57  104 104 ALA ALA D . n 
D 2 58  CYS 58  105 105 CYS CYS D . n 
D 2 59  GLU 59  106 106 GLU GLU D . n 
D 2 60  ASP 60  107 107 ASP ASP D . n 
D 2 61  TYR 61  108 108 TYR TYR D . n 
D 2 62  LYS 62  109 109 LYS LYS D . n 
D 2 63  LYS 63  110 110 LYS LYS D . n 
D 2 64  THR 64  111 111 THR THR D . n 
D 2 65  GLU 65  112 112 GLU GLU D . n 
D 2 66  SER 66  113 113 SER SER D . n 
D 2 67  ASP 67  114 114 ASP ASP D . n 
D 2 68  LEU 68  115 115 LEU LEU D . n 
D 2 69  LEU 69  116 116 LEU LEU D . n 
D 2 70  PRO 70  117 117 PRO PRO D . n 
D 2 71  CYS 71  118 118 CYS CYS D . n 
D 2 72  LYS 72  119 119 LYS LYS D . n 
D 2 73  ALA 73  120 120 ALA ALA D . n 
D 2 74  GLU 74  121 121 GLU GLU D . n 
D 2 75  GLU 75  122 122 GLU GLU D . n 
D 2 76  ILE 76  123 123 ILE ILE D . n 
D 2 77  TYR 77  124 124 TYR TYR D . n 
D 2 78  LYS 78  125 125 LYS LYS D . n 
D 2 79  ALA 79  126 126 ALA ALA D . n 
D 2 80  PHE 80  127 127 PHE PHE D . n 
D 2 81  VAL 81  128 128 VAL VAL D . n 
D 2 82  HIS 82  129 129 HIS HIS D . n 
D 2 83  SER 83  130 130 SER SER D . n 
D 2 84  ASP 84  131 131 ASP ASP D . n 
D 2 85  ALA 85  132 132 ALA ALA D . n 
D 2 86  ALA 86  133 133 ALA ALA D . n 
D 2 87  LYS 87  134 134 LYS LYS D . n 
D 2 88  GLN 88  135 135 GLN GLN D . n 
D 2 89  ILE 89  136 136 ILE ILE D . n 
D 2 90  ASN 90  137 137 ASN ASN D . n 
D 2 91  ILE 91  138 138 ILE ILE D . n 
D 2 92  ASP 92  139 139 ASP ASP D . n 
D 2 93  PHE 93  140 140 PHE PHE D . n 
D 2 94  ARG 94  141 141 ARG ARG D . n 
D 2 95  THR 95  142 142 THR THR D . n 
D 2 96  ARG 96  143 143 ARG ARG D . n 
D 2 97  GLU 97  144 144 GLU GLU D . n 
D 2 98  SER 98  145 145 SER SER D . n 
D 2 99  THR 99  146 146 THR THR D . n 
D 2 100 ALA 100 147 147 ALA ALA D . n 
D 2 101 LYS 101 148 148 LYS LYS D . n 
D 2 102 LYS 102 149 149 LYS LYS D . n 
D 2 103 ILE 103 150 150 ILE ILE D . n 
D 2 104 LYS 104 151 151 LYS LYS D . n 
D 2 105 ALA 105 152 152 ALA ALA D . n 
D 2 106 PRO 106 153 153 PRO PRO D . n 
D 2 107 THR 107 154 154 THR THR D . n 
D 2 108 PRO 108 155 155 PRO PRO D . n 
D 2 109 THR 109 156 156 THR THR D . n 
D 2 110 CYS 110 157 157 CYS CYS D . n 
D 2 111 PHE 111 158 158 PHE PHE D . n 
D 2 112 ASP 112 159 159 ASP ASP D . n 
D 2 113 GLU 113 160 160 GLU GLU D . n 
D 2 114 ALA 114 161 161 ALA ALA D . n 
D 2 115 GLN 115 162 162 GLN GLN D . n 
D 2 116 LYS 116 163 163 LYS LYS D . n 
D 2 117 VAL 117 164 164 VAL VAL D . n 
D 2 118 ILE 118 165 165 ILE ILE D . n 
D 2 119 TYR 119 166 166 TYR TYR D . n 
D 2 120 THR 120 167 167 THR THR D . n 
D 2 121 LEU 121 168 168 LEU LEU D . n 
D 2 122 MET 122 169 169 MET MET D . n 
D 2 123 GLU 123 170 170 GLU GLU D . n 
D 2 124 LYS 124 171 171 LYS LYS D . n 
D 2 125 ASP 125 172 172 ASP ASP D . n 
D 2 126 SER 126 173 173 SER SER D . n 
D 2 127 TYR 127 174 174 TYR TYR D . n 
D 2 128 PRO 128 175 175 PRO PRO D . n 
D 2 129 ARG 129 176 176 ARG ARG D . n 
D 2 130 PHE 130 177 177 PHE PHE D . n 
D 2 131 LEU 131 178 178 LEU LEU D . n 
D 2 132 LYS 132 179 179 LYS LYS D . n 
D 2 133 SER 133 180 180 SER SER D . n 
D 2 134 ASP 134 181 181 ASP ASP D . n 
D 2 135 ILE 135 182 182 ILE ILE D . n 
D 2 136 TYR 136 183 183 TYR TYR D . n 
D 2 137 LEU 137 184 184 LEU LEU D . n 
D 2 138 ASN 138 185 185 ASN ASN D . n 
D 2 139 LEU 139 186 186 LEU LEU D . n 
D 2 140 LEU 140 187 187 LEU LEU D . n 
D 2 141 ASN 141 188 188 ASN ASN D . n 
D 2 142 ASP 142 189 189 ASP ASP D . n 
D 2 143 LEU 143 190 190 LEU LEU D . n 
D 2 144 GLN 144 191 191 GLN GLN D . n 
D 2 145 ALA 145 192 ?   ?   ?   D . n 
# 
_pdbx_SG_project.id                    1 
_pdbx_SG_project.project_name          ? 
_pdbx_SG_project.full_name_of_center   'Structural Genomics Consortium' 
_pdbx_SG_project.initial_of_center     SGC 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 3 ALF 1  355 1   ALF ALF A . 
F 4 MG  1  401 1   MG  MG  A . 
G 5 GDP 1  402 1   GDP GDP A . 
H 3 ALF 1  355 2   ALF ALF B . 
I 4 MG  1  402 2   MG  MG  B . 
J 5 GDP 1  403 2   GDP GDP B . 
K 6 HOH 1  403 1   HOH HOH A . 
K 6 HOH 2  404 2   HOH HOH A . 
K 6 HOH 3  405 5   HOH HOH A . 
K 6 HOH 4  406 7   HOH HOH A . 
K 6 HOH 5  407 8   HOH HOH A . 
K 6 HOH 6  408 11  HOH HOH A . 
K 6 HOH 7  409 12  HOH HOH A . 
K 6 HOH 8  410 13  HOH HOH A . 
K 6 HOH 9  411 17  HOH HOH A . 
K 6 HOH 10 412 18  HOH HOH A . 
K 6 HOH 11 413 19  HOH HOH A . 
K 6 HOH 12 414 22  HOH HOH A . 
K 6 HOH 13 415 23  HOH HOH A . 
K 6 HOH 14 416 24  HOH HOH A . 
K 6 HOH 15 417 25  HOH HOH A . 
K 6 HOH 16 418 31  HOH HOH A . 
K 6 HOH 17 419 32  HOH HOH A . 
K 6 HOH 18 420 34  HOH HOH A . 
K 6 HOH 19 421 35  HOH HOH A . 
K 6 HOH 20 422 37  HOH HOH A . 
K 6 HOH 21 423 42  HOH HOH A . 
K 6 HOH 22 424 43  HOH HOH A . 
K 6 HOH 23 425 45  HOH HOH A . 
K 6 HOH 24 426 50  HOH HOH A . 
K 6 HOH 25 427 51  HOH HOH A . 
K 6 HOH 26 428 57  HOH HOH A . 
K 6 HOH 27 429 62  HOH HOH A . 
K 6 HOH 28 430 63  HOH HOH A . 
K 6 HOH 29 431 67  HOH HOH A . 
K 6 HOH 30 432 70  HOH HOH A . 
K 6 HOH 31 433 75  HOH HOH A . 
K 6 HOH 32 434 79  HOH HOH A . 
K 6 HOH 33 435 84  HOH HOH A . 
K 6 HOH 34 436 85  HOH HOH A . 
K 6 HOH 35 437 87  HOH HOH A . 
K 6 HOH 36 438 88  HOH HOH A . 
K 6 HOH 37 439 91  HOH HOH A . 
K 6 HOH 38 440 100 HOH HOH A . 
K 6 HOH 39 441 102 HOH HOH A . 
K 6 HOH 40 442 104 HOH HOH A . 
K 6 HOH 41 443 107 HOH HOH A . 
K 6 HOH 42 444 108 HOH HOH A . 
K 6 HOH 43 445 109 HOH HOH A . 
K 6 HOH 44 446 110 HOH HOH A . 
K 6 HOH 45 447 111 HOH HOH A . 
K 6 HOH 46 448 113 HOH HOH A . 
K 6 HOH 47 449 116 HOH HOH A . 
K 6 HOH 48 450 118 HOH HOH A . 
K 6 HOH 49 451 120 HOH HOH A . 
K 6 HOH 50 452 126 HOH HOH A . 
K 6 HOH 51 453 131 HOH HOH A . 
K 6 HOH 52 454 133 HOH HOH A . 
K 6 HOH 53 455 136 HOH HOH A . 
K 6 HOH 54 456 139 HOH HOH A . 
K 6 HOH 55 457 140 HOH HOH A . 
K 6 HOH 56 458 141 HOH HOH A . 
K 6 HOH 57 459 144 HOH HOH A . 
K 6 HOH 58 460 145 HOH HOH A . 
K 6 HOH 59 461 148 HOH HOH A . 
K 6 HOH 60 462 149 HOH HOH A . 
K 6 HOH 61 463 150 HOH HOH A . 
K 6 HOH 62 464 154 HOH HOH A . 
L 6 HOH 1  404 3   HOH HOH B . 
L 6 HOH 2  405 4   HOH HOH B . 
L 6 HOH 3  406 6   HOH HOH B . 
L 6 HOH 4  407 9   HOH HOH B . 
L 6 HOH 5  408 10  HOH HOH B . 
L 6 HOH 6  409 16  HOH HOH B . 
L 6 HOH 7  410 20  HOH HOH B . 
L 6 HOH 8  411 21  HOH HOH B . 
L 6 HOH 9  412 27  HOH HOH B . 
L 6 HOH 10 413 28  HOH HOH B . 
L 6 HOH 11 414 30  HOH HOH B . 
L 6 HOH 12 415 33  HOH HOH B . 
L 6 HOH 13 416 36  HOH HOH B . 
L 6 HOH 14 417 38  HOH HOH B . 
L 6 HOH 15 418 40  HOH HOH B . 
L 6 HOH 16 419 41  HOH HOH B . 
L 6 HOH 17 420 46  HOH HOH B . 
L 6 HOH 18 421 49  HOH HOH B . 
L 6 HOH 19 422 52  HOH HOH B . 
L 6 HOH 20 423 54  HOH HOH B . 
L 6 HOH 21 424 58  HOH HOH B . 
L 6 HOH 22 425 59  HOH HOH B . 
L 6 HOH 23 426 60  HOH HOH B . 
L 6 HOH 24 427 61  HOH HOH B . 
L 6 HOH 25 428 65  HOH HOH B . 
L 6 HOH 26 429 66  HOH HOH B . 
L 6 HOH 27 430 71  HOH HOH B . 
L 6 HOH 28 431 72  HOH HOH B . 
L 6 HOH 29 432 73  HOH HOH B . 
L 6 HOH 30 433 76  HOH HOH B . 
L 6 HOH 31 434 77  HOH HOH B . 
L 6 HOH 32 435 78  HOH HOH B . 
L 6 HOH 33 436 80  HOH HOH B . 
L 6 HOH 34 437 81  HOH HOH B . 
L 6 HOH 35 438 89  HOH HOH B . 
L 6 HOH 36 439 90  HOH HOH B . 
L 6 HOH 37 440 93  HOH HOH B . 
L 6 HOH 38 441 98  HOH HOH B . 
L 6 HOH 39 442 112 HOH HOH B . 
L 6 HOH 40 443 121 HOH HOH B . 
L 6 HOH 41 444 122 HOH HOH B . 
L 6 HOH 42 445 124 HOH HOH B . 
L 6 HOH 43 446 129 HOH HOH B . 
L 6 HOH 44 447 132 HOH HOH B . 
L 6 HOH 45 448 134 HOH HOH B . 
L 6 HOH 46 449 135 HOH HOH B . 
L 6 HOH 47 450 137 HOH HOH B . 
L 6 HOH 48 451 146 HOH HOH B . 
L 6 HOH 49 452 147 HOH HOH B . 
L 6 HOH 50 453 153 HOH HOH B . 
L 6 HOH 51 454 155 HOH HOH B . 
M 6 HOH 1  193 53  HOH HOH C . 
M 6 HOH 2  194 55  HOH HOH C . 
M 6 HOH 3  195 64  HOH HOH C . 
M 6 HOH 4  196 68  HOH HOH C . 
M 6 HOH 5  197 69  HOH HOH C . 
M 6 HOH 6  198 74  HOH HOH C . 
M 6 HOH 7  199 82  HOH HOH C . 
M 6 HOH 8  200 86  HOH HOH C . 
M 6 HOH 9  201 94  HOH HOH C . 
M 6 HOH 10 202 115 HOH HOH C . 
M 6 HOH 11 203 117 HOH HOH C . 
M 6 HOH 12 204 130 HOH HOH C . 
M 6 HOH 13 205 142 HOH HOH C . 
M 6 HOH 14 206 152 HOH HOH C . 
N 6 HOH 1  193 29  HOH HOH D . 
N 6 HOH 2  194 39  HOH HOH D . 
N 6 HOH 3  195 95  HOH HOH D . 
N 6 HOH 4  196 97  HOH HOH D . 
N 6 HOH 5  197 105 HOH HOH D . 
N 6 HOH 6  198 114 HOH HOH D . 
N 6 HOH 7  199 125 HOH HOH D . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_defined_assembly ? dimeric 2 
2 author_defined_assembly ? dimeric 2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,D,E,F,G,K,N 
2 1 B,C,H,I,J,L,M 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1   O2B ? G GDP .   ? A GDP 402 ? 1_555 AL ? E ALF . ? A ALF 355 ? 1_555 F1  ? E ALF .   ? A ALF 355 ? 1_555 83.8  ? 
2   O2B ? G GDP .   ? A GDP 402 ? 1_555 AL ? E ALF . ? A ALF 355 ? 1_555 F2  ? E ALF .   ? A ALF 355 ? 1_555 96.5  ? 
3   F1  ? E ALF .   ? A ALF 355 ? 1_555 AL ? E ALF . ? A ALF 355 ? 1_555 F2  ? E ALF .   ? A ALF 355 ? 1_555 175.9 ? 
4   O2B ? G GDP .   ? A GDP 402 ? 1_555 AL ? E ALF . ? A ALF 355 ? 1_555 F3  ? E ALF .   ? A ALF 355 ? 1_555 102.7 ? 
5   F1  ? E ALF .   ? A ALF 355 ? 1_555 AL ? E ALF . ? A ALF 355 ? 1_555 F3  ? E ALF .   ? A ALF 355 ? 1_555 79.7  ? 
6   F2  ? E ALF .   ? A ALF 355 ? 1_555 AL ? E ALF . ? A ALF 355 ? 1_555 F3  ? E ALF .   ? A ALF 355 ? 1_555 96.3  ? 
7   O2B ? G GDP .   ? A GDP 402 ? 1_555 AL ? E ALF . ? A ALF 355 ? 1_555 F4  ? E ALF .   ? A ALF 355 ? 1_555 85.4  ? 
8   F1  ? E ALF .   ? A ALF 355 ? 1_555 AL ? E ALF . ? A ALF 355 ? 1_555 F4  ? E ALF .   ? A ALF 355 ? 1_555 84.6  ? 
9   F2  ? E ALF .   ? A ALF 355 ? 1_555 AL ? E ALF . ? A ALF 355 ? 1_555 F4  ? E ALF .   ? A ALF 355 ? 1_555 99.5  ? 
10  F3  ? E ALF .   ? A ALF 355 ? 1_555 AL ? E ALF . ? A ALF 355 ? 1_555 F4  ? E ALF .   ? A ALF 355 ? 1_555 161.4 ? 
11  O2B ? G GDP .   ? A GDP 402 ? 1_555 AL ? E ALF . ? A ALF 355 ? 1_555 NH2 ? A ARG 147 ? A ARG 178 ? 1_555 92.7  ? 
12  F1  ? E ALF .   ? A ALF 355 ? 1_555 AL ? E ALF . ? A ALF 355 ? 1_555 NH2 ? A ARG 147 ? A ARG 178 ? 1_555 130.6 ? 
13  F2  ? E ALF .   ? A ALF 355 ? 1_555 AL ? E ALF . ? A ALF 355 ? 1_555 NH2 ? A ARG 147 ? A ARG 178 ? 1_555 45.4  ? 
14  F3  ? E ALF .   ? A ALF 355 ? 1_555 AL ? E ALF . ? A ALF 355 ? 1_555 NH2 ? A ARG 147 ? A ARG 178 ? 1_555 52.9  ? 
15  F4  ? E ALF .   ? A ALF 355 ? 1_555 AL ? E ALF . ? A ALF 355 ? 1_555 NH2 ? A ARG 147 ? A ARG 178 ? 1_555 144.5 ? 
16  O2B ? G GDP .   ? A GDP 402 ? 1_555 AL ? E ALF . ? A ALF 355 ? 1_555 NH1 ? A ARG 147 ? A ARG 178 ? 1_555 61.6  ? 
17  F1  ? E ALF .   ? A ALF 355 ? 1_555 AL ? E ALF . ? A ALF 355 ? 1_555 NH1 ? A ARG 147 ? A ARG 178 ? 1_555 104.4 ? 
18  F2  ? E ALF .   ? A ALF 355 ? 1_555 AL ? E ALF . ? A ALF 355 ? 1_555 NH1 ? A ARG 147 ? A ARG 178 ? 1_555 72.3  ? 
19  F3  ? E ALF .   ? A ALF 355 ? 1_555 AL ? E ALF . ? A ALF 355 ? 1_555 NH1 ? A ARG 147 ? A ARG 178 ? 1_555 51.5  ? 
20  F4  ? E ALF .   ? A ALF 355 ? 1_555 AL ? E ALF . ? A ALF 355 ? 1_555 NH1 ? A ARG 147 ? A ARG 178 ? 1_555 143.9 ? 
21  NH2 ? A ARG 147 ? A ARG 178 ? 1_555 AL ? E ALF . ? A ALF 355 ? 1_555 NH1 ? A ARG 147 ? A ARG 178 ? 1_555 36.8  ? 
22  O2B ? G GDP .   ? A GDP 402 ? 1_555 AL ? E ALF . ? A ALF 355 ? 1_555 MG  ? F MG  .   ? A MG  401 ? 1_555 65.2  ? 
23  F1  ? E ALF .   ? A ALF 355 ? 1_555 AL ? E ALF . ? A ALF 355 ? 1_555 MG  ? F MG  .   ? A MG  401 ? 1_555 24.8  ? 
24  F2  ? E ALF .   ? A ALF 355 ? 1_555 AL ? E ALF . ? A ALF 355 ? 1_555 MG  ? F MG  .   ? A MG  401 ? 1_555 152.6 ? 
25  F3  ? E ALF .   ? A ALF 355 ? 1_555 AL ? E ALF . ? A ALF 355 ? 1_555 MG  ? F MG  .   ? A MG  401 ? 1_555 70.0  ? 
26  F4  ? E ALF .   ? A ALF 355 ? 1_555 AL ? E ALF . ? A ALF 355 ? 1_555 MG  ? F MG  .   ? A MG  401 ? 1_555 99.2  ? 
27  NH2 ? A ARG 147 ? A ARG 178 ? 1_555 AL ? E ALF . ? A ALF 355 ? 1_555 MG  ? F MG  .   ? A MG  401 ? 1_555 112.2 ? 
28  NH1 ? A ARG 147 ? A ARG 178 ? 1_555 AL ? E ALF . ? A ALF 355 ? 1_555 MG  ? F MG  .   ? A MG  401 ? 1_555 80.8  ? 
29  O2B ? G GDP .   ? A GDP 402 ? 1_555 AL ? E ALF . ? A ALF 355 ? 1_555 N   ? A GLU 12  ? A GLU 43  ? 1_555 53.9  ? 
30  F1  ? E ALF .   ? A ALF 355 ? 1_555 AL ? E ALF . ? A ALF 355 ? 1_555 N   ? A GLU 12  ? A GLU 43  ? 1_555 132.2 ? 
31  F2  ? E ALF .   ? A ALF 355 ? 1_555 AL ? E ALF . ? A ALF 355 ? 1_555 N   ? A GLU 12  ? A GLU 43  ? 1_555 49.9  ? 
32  F3  ? E ALF .   ? A ALF 355 ? 1_555 AL ? E ALF . ? A ALF 355 ? 1_555 N   ? A GLU 12  ? A GLU 43  ? 1_555 126.1 ? 
33  F4  ? E ALF .   ? A ALF 355 ? 1_555 AL ? E ALF . ? A ALF 355 ? 1_555 N   ? A GLU 12  ? A GLU 43  ? 1_555 72.2  ? 
34  NH2 ? A ARG 147 ? A ARG 178 ? 1_555 AL ? E ALF . ? A ALF 355 ? 1_555 N   ? A GLU 12  ? A GLU 43  ? 1_555 78.2  ? 
35  NH1 ? A ARG 147 ? A ARG 178 ? 1_555 AL ? E ALF . ? A ALF 355 ? 1_555 N   ? A GLU 12  ? A GLU 43  ? 1_555 76.4  ? 
36  MG  ? F MG  .   ? A MG  401 ? 1_555 AL ? E ALF . ? A ALF 355 ? 1_555 N   ? A GLU 12  ? A GLU 43  ? 1_555 118.8 ? 
37  O2B ? G GDP .   ? A GDP 402 ? 1_555 AL ? E ALF . ? A ALF 355 ? 1_555 O   ? K HOH .   ? A HOH 405 ? 1_555 160.3 ? 
38  F1  ? E ALF .   ? A ALF 355 ? 1_555 AL ? E ALF . ? A ALF 355 ? 1_555 O   ? K HOH .   ? A HOH 405 ? 1_555 78.4  ? 
39  F2  ? E ALF .   ? A ALF 355 ? 1_555 AL ? E ALF . ? A ALF 355 ? 1_555 O   ? K HOH .   ? A HOH 405 ? 1_555 101.9 ? 
40  F3  ? E ALF .   ? A ALF 355 ? 1_555 AL ? E ALF . ? A ALF 355 ? 1_555 O   ? K HOH .   ? A HOH 405 ? 1_555 82.5  ? 
41  F4  ? E ALF .   ? A ALF 355 ? 1_555 AL ? E ALF . ? A ALF 355 ? 1_555 O   ? K HOH .   ? A HOH 405 ? 1_555 84.5  ? 
42  NH2 ? A ARG 147 ? A ARG 178 ? 1_555 AL ? E ALF . ? A ALF 355 ? 1_555 O   ? K HOH .   ? A HOH 405 ? 1_555 105.3 ? 
43  NH1 ? A ARG 147 ? A ARG 178 ? 1_555 AL ? E ALF . ? A ALF 355 ? 1_555 O   ? K HOH .   ? A HOH 405 ? 1_555 131.3 ? 
44  MG  ? F MG  .   ? A MG  401 ? 1_555 AL ? E ALF . ? A ALF 355 ? 1_555 O   ? K HOH .   ? A HOH 405 ? 1_555 99.7  ? 
45  N   ? A GLU 12  ? A GLU 43  ? 1_555 AL ? E ALF . ? A ALF 355 ? 1_555 O   ? K HOH .   ? A HOH 405 ? 1_555 137.2 ? 
46  OG1 ? A THR 150 ? A THR 181 ? 1_555 MG ? F MG  . ? A MG  401 ? 1_555 O1B ? G GDP .   ? A GDP 402 ? 1_555 167.7 ? 
47  OG1 ? A THR 150 ? A THR 181 ? 1_555 MG ? F MG  . ? A MG  401 ? 1_555 F1  ? E ALF .   ? A ALF 355 ? 1_555 90.0  ? 
48  O1B ? G GDP .   ? A GDP 402 ? 1_555 MG ? F MG  . ? A MG  401 ? 1_555 F1  ? E ALF .   ? A ALF 355 ? 1_555 96.3  ? 
49  OG1 ? A THR 150 ? A THR 181 ? 1_555 MG ? F MG  . ? A MG  401 ? 1_555 O   ? K HOH .   ? A HOH 403 ? 1_555 76.0  ? 
50  O1B ? G GDP .   ? A GDP 402 ? 1_555 MG ? F MG  . ? A MG  401 ? 1_555 O   ? K HOH .   ? A HOH 403 ? 1_555 92.1  ? 
51  F1  ? E ALF .   ? A ALF 355 ? 1_555 MG ? F MG  . ? A MG  401 ? 1_555 O   ? K HOH .   ? A HOH 403 ? 1_555 105.1 ? 
52  OG1 ? A THR 150 ? A THR 181 ? 1_555 MG ? F MG  . ? A MG  401 ? 1_555 O   ? K HOH .   ? A HOH 404 ? 1_555 91.4  ? 
53  O1B ? G GDP .   ? A GDP 402 ? 1_555 MG ? F MG  . ? A MG  401 ? 1_555 O   ? K HOH .   ? A HOH 404 ? 1_555 99.7  ? 
54  F1  ? E ALF .   ? A ALF 355 ? 1_555 MG ? F MG  . ? A MG  401 ? 1_555 O   ? K HOH .   ? A HOH 404 ? 1_555 85.2  ? 
55  O   ? K HOH .   ? A HOH 403 ? 1_555 MG ? F MG  . ? A MG  401 ? 1_555 O   ? K HOH .   ? A HOH 404 ? 1_555 163.5 ? 
56  OG1 ? A THR 150 ? A THR 181 ? 1_555 MG ? F MG  . ? A MG  401 ? 1_555 OG  ? A SER 16  ? A SER 47  ? 1_555 79.3  ? 
57  O1B ? G GDP .   ? A GDP 402 ? 1_555 MG ? F MG  . ? A MG  401 ? 1_555 OG  ? A SER 16  ? A SER 47  ? 1_555 95.6  ? 
58  F1  ? E ALF .   ? A ALF 355 ? 1_555 MG ? F MG  . ? A MG  401 ? 1_555 OG  ? A SER 16  ? A SER 47  ? 1_555 167.1 ? 
59  O   ? K HOH .   ? A HOH 403 ? 1_555 MG ? F MG  . ? A MG  401 ? 1_555 OG  ? A SER 16  ? A SER 47  ? 1_555 79.4  ? 
60  O   ? K HOH .   ? A HOH 404 ? 1_555 MG ? F MG  . ? A MG  401 ? 1_555 OG  ? A SER 16  ? A SER 47  ? 1_555 88.0  ? 
61  O2B ? J GDP .   ? B GDP 403 ? 1_555 AL ? H ALF . ? B ALF 355 ? 1_555 F1  ? H ALF .   ? B ALF 355 ? 1_555 93.6  ? 
62  O2B ? J GDP .   ? B GDP 403 ? 1_555 AL ? H ALF . ? B ALF 355 ? 1_555 F2  ? H ALF .   ? B ALF 355 ? 1_555 95.7  ? 
63  F1  ? H ALF .   ? B ALF 355 ? 1_555 AL ? H ALF . ? B ALF 355 ? 1_555 F2  ? H ALF .   ? B ALF 355 ? 1_555 170.4 ? 
64  O2B ? J GDP .   ? B GDP 403 ? 1_555 AL ? H ALF . ? B ALF 355 ? 1_555 F3  ? H ALF .   ? B ALF 355 ? 1_555 89.9  ? 
65  F1  ? H ALF .   ? B ALF 355 ? 1_555 AL ? H ALF . ? B ALF 355 ? 1_555 F3  ? H ALF .   ? B ALF 355 ? 1_555 92.7  ? 
66  F2  ? H ALF .   ? B ALF 355 ? 1_555 AL ? H ALF . ? B ALF 355 ? 1_555 F3  ? H ALF .   ? B ALF 355 ? 1_555 85.0  ? 
67  O2B ? J GDP .   ? B GDP 403 ? 1_555 AL ? H ALF . ? B ALF 355 ? 1_555 F4  ? H ALF .   ? B ALF 355 ? 1_555 87.6  ? 
68  F1  ? H ALF .   ? B ALF 355 ? 1_555 AL ? H ALF . ? B ALF 355 ? 1_555 F4  ? H ALF .   ? B ALF 355 ? 1_555 91.5  ? 
69  F2  ? H ALF .   ? B ALF 355 ? 1_555 AL ? H ALF . ? B ALF 355 ? 1_555 F4  ? H ALF .   ? B ALF 355 ? 1_555 91.2  ? 
70  F3  ? H ALF .   ? B ALF 355 ? 1_555 AL ? H ALF . ? B ALF 355 ? 1_555 F4  ? H ALF .   ? B ALF 355 ? 1_555 175.2 ? 
71  O2B ? J GDP .   ? B GDP 403 ? 1_555 AL ? H ALF . ? B ALF 355 ? 1_555 MG  ? I MG  .   ? B MG  402 ? 1_555 59.9  ? 
72  F1  ? H ALF .   ? B ALF 355 ? 1_555 AL ? H ALF . ? B ALF 355 ? 1_555 MG  ? I MG  .   ? B MG  402 ? 1_555 108.7 ? 
73  F2  ? H ALF .   ? B ALF 355 ? 1_555 AL ? H ALF . ? B ALF 355 ? 1_555 MG  ? I MG  .   ? B MG  402 ? 1_555 74.2  ? 
74  F3  ? H ALF .   ? B ALF 355 ? 1_555 AL ? H ALF . ? B ALF 355 ? 1_555 MG  ? I MG  .   ? B MG  402 ? 1_555 34.0  ? 
75  F4  ? H ALF .   ? B ALF 355 ? 1_555 AL ? H ALF . ? B ALF 355 ? 1_555 MG  ? I MG  .   ? B MG  402 ? 1_555 141.8 ? 
76  O2B ? J GDP .   ? B GDP 403 ? 1_555 AL ? H ALF . ? B ALF 355 ? 1_555 O   ? L HOH .   ? B HOH 406 ? 1_555 174.1 ? 
77  F1  ? H ALF .   ? B ALF 355 ? 1_555 AL ? H ALF . ? B ALF 355 ? 1_555 O   ? L HOH .   ? B HOH 406 ? 1_555 89.7  ? 
78  F2  ? H ALF .   ? B ALF 355 ? 1_555 AL ? H ALF . ? B ALF 355 ? 1_555 O   ? L HOH .   ? B HOH 406 ? 1_555 81.3  ? 
79  F3  ? H ALF .   ? B ALF 355 ? 1_555 AL ? H ALF . ? B ALF 355 ? 1_555 O   ? L HOH .   ? B HOH 406 ? 1_555 94.9  ? 
80  F4  ? H ALF .   ? B ALF 355 ? 1_555 AL ? H ALF . ? B ALF 355 ? 1_555 O   ? L HOH .   ? B HOH 406 ? 1_555 87.4  ? 
81  MG  ? I MG  .   ? B MG  402 ? 1_555 AL ? H ALF . ? B ALF 355 ? 1_555 O   ? L HOH .   ? B HOH 406 ? 1_555 123.5 ? 
82  OG  ? B SER 16  ? B SER 47  ? 1_555 MG ? I MG  . ? B MG  402 ? 1_555 OG1 ? B THR 150 ? B THR 181 ? 1_555 76.9  ? 
83  OG  ? B SER 16  ? B SER 47  ? 1_555 MG ? I MG  . ? B MG  402 ? 1_555 O   ? L HOH .   ? B HOH 404 ? 1_555 73.5  ? 
84  OG1 ? B THR 150 ? B THR 181 ? 1_555 MG ? I MG  . ? B MG  402 ? 1_555 O   ? L HOH .   ? B HOH 404 ? 1_555 76.3  ? 
85  OG  ? B SER 16  ? B SER 47  ? 1_555 MG ? I MG  . ? B MG  402 ? 1_555 O   ? L HOH .   ? B HOH 405 ? 1_555 93.2  ? 
86  OG1 ? B THR 150 ? B THR 181 ? 1_555 MG ? I MG  . ? B MG  402 ? 1_555 O   ? L HOH .   ? B HOH 405 ? 1_555 78.3  ? 
87  O   ? L HOH .   ? B HOH 404 ? 1_555 MG ? I MG  . ? B MG  402 ? 1_555 O   ? L HOH .   ? B HOH 405 ? 1_555 153.4 ? 
88  OG  ? B SER 16  ? B SER 47  ? 1_555 MG ? I MG  . ? B MG  402 ? 1_555 O2B ? J GDP .   ? B GDP 403 ? 1_555 158.6 ? 
89  OG1 ? B THR 150 ? B THR 181 ? 1_555 MG ? I MG  . ? B MG  402 ? 1_555 O2B ? J GDP .   ? B GDP 403 ? 1_555 121.3 ? 
90  O   ? L HOH .   ? B HOH 404 ? 1_555 MG ? I MG  . ? B MG  402 ? 1_555 O2B ? J GDP .   ? B GDP 403 ? 1_555 119.4 ? 
91  O   ? L HOH .   ? B HOH 405 ? 1_555 MG ? I MG  . ? B MG  402 ? 1_555 O2B ? J GDP .   ? B GDP 403 ? 1_555 80.9  ? 
92  OG  ? B SER 16  ? B SER 47  ? 1_555 MG ? I MG  . ? B MG  402 ? 1_555 O1B ? J GDP .   ? B GDP 403 ? 1_555 101.7 ? 
93  OG1 ? B THR 150 ? B THR 181 ? 1_555 MG ? I MG  . ? B MG  402 ? 1_555 O1B ? J GDP .   ? B GDP 403 ? 1_555 175.3 ? 
94  O   ? L HOH .   ? B HOH 404 ? 1_555 MG ? I MG  . ? B MG  402 ? 1_555 O1B ? J GDP .   ? B GDP 403 ? 1_555 107.7 ? 
95  O   ? L HOH .   ? B HOH 405 ? 1_555 MG ? I MG  . ? B MG  402 ? 1_555 O1B ? J GDP .   ? B GDP 403 ? 1_555 97.4  ? 
96  O2B ? J GDP .   ? B GDP 403 ? 1_555 MG ? I MG  . ? B MG  402 ? 1_555 O1B ? J GDP .   ? B GDP 403 ? 1_555 59.2  ? 
97  OG  ? B SER 16  ? B SER 47  ? 1_555 MG ? I MG  . ? B MG  402 ? 1_555 F3  ? H ALF .   ? B ALF 355 ? 1_555 139.8 ? 
98  OG1 ? B THR 150 ? B THR 181 ? 1_555 MG ? I MG  . ? B MG  402 ? 1_555 F3  ? H ALF .   ? B ALF 355 ? 1_555 73.8  ? 
99  O   ? L HOH .   ? B HOH 404 ? 1_555 MG ? I MG  . ? B MG  402 ? 1_555 F3  ? H ALF .   ? B ALF 355 ? 1_555 73.4  ? 
100 O   ? L HOH .   ? B HOH 405 ? 1_555 MG ? I MG  . ? B MG  402 ? 1_555 F3  ? H ALF .   ? B ALF 355 ? 1_555 106.8 ? 
101 O2B ? J GDP .   ? B GDP 403 ? 1_555 MG ? I MG  . ? B MG  402 ? 1_555 F3  ? H ALF .   ? B ALF 355 ? 1_555 61.1  ? 
102 O1B ? J GDP .   ? B GDP 403 ? 1_555 MG ? I MG  . ? B MG  402 ? 1_555 F3  ? H ALF .   ? B ALF 355 ? 1_555 109.5 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2006-05-23 
2 'Structure model' 1 1 2008-05-01 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' Advisory                    
3 3 'Structure model' 'Version format compliance' 
# 
loop_
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.pdbx_refine_id 
1  ? refined 11.0020  38.2410 28.7370 0.1011 0.0618 0.0238  -0.0169 0.0368  -0.0582 3.8665 1.1192 5.1109  0.9861  -1.2123 0.1029  
-0.1270 -0.0493 0.1276  0.1623  0.1417  0.6740  -0.0094 -0.4248 -0.0147 'X-RAY DIFFRACTION' 
2  ? refined 3.9270   11.0230 22.6200 0.1983 0.1866 0.0405  -0.1823 0.0241  0.0201  2.7559 3.4638 2.6506  0.6187  -0.0510 2.3064  
0.1023  -0.2095 -0.1416 0.0985  -0.1266 0.3060  0.2266  -0.3260 0.0242  'X-RAY DIFFRACTION' 
3  ? refined 18.0190  35.3800 23.3930 0.1588 0.1058 -0.0048 -0.0365 0.0342  -0.0126 0.8688 2.5816 1.3515  1.1075  0.3399  0.2816  
-0.0428 0.1146  0.1004  -0.1226 0.0393  0.0906  -0.0484 -0.1412 0.0034  'X-RAY DIFFRACTION' 
4  ? refined 24.9300  30.1900 34.4890 0.1567 0.1139 -0.0331 -0.0349 0.0050  -0.0366 1.9684 3.0003 2.2475  0.1470  -0.0045 -0.5296 
0.0244  -0.0941 -0.0545 0.3850  0.0228  -0.1354 0.0738  0.0867  -0.0472 'X-RAY DIFFRACTION' 
5  ? refined -39.0020 18.6560 57.8290 0.1744 0.0572 0.0729  -0.0429 0.0037  -0.0071 2.4553 1.4700 1.9111  -1.8963 0.6698  -0.6148 
0.1368  -0.0371 0.5164  -0.0546 -0.1761 -0.1891 -0.2326 0.0525  0.0393  'X-RAY DIFFRACTION' 
6  ? refined -59.2200 22.5500 50.8480 0.0975 0.1940 0.0327  0.1119  -0.0102 -0.0967 3.6533 4.1758 5.9506  -1.9902 1.5562  -0.1710 
0.1237  -0.1949 0.3224  0.0335  -0.1997 0.0181  -0.5160 -0.4106 0.0760  'X-RAY DIFFRACTION' 
7  ? refined -34.4940 15.6620 58.5530 0.1635 0.0700 0.0497  -0.0401 -0.0138 -0.0357 2.0639 0.8699 1.2470  -0.5475 0.3088  -0.3412 
0.0200  -0.1856 0.3723  -0.0059 -0.0705 -0.2483 -0.0712 0.0665  0.0505  'X-RAY DIFFRACTION' 
8  ? refined -39.9400 0.0020  64.6660 0.1696 0.0743 -0.0036 -0.0633 0.0054  0.0169  3.4121 1.5881 2.3735  0.3882  -0.1330 -0.1496 
0.0543  -0.2643 -0.2542 0.0427  -0.0566 -0.0268 0.2263  0.0722  0.0023  'X-RAY DIFFRACTION' 
9  ? refined -25.5570 27.8440 38.1020 0.4995 0.2363 0.4057  -0.0328 0.2321  0.2216  7.6887 3.3290 5.6397  2.1366  2.0541  -3.1608 
-0.1967 0.8905  1.5000  -0.7483 0.4996  -0.2796 -0.5470 0.3861  -0.3030 'X-RAY DIFFRACTION' 
10 ? refined -33.7920 12.4190 29.9770 0.3930 0.3805 -0.0242 0.1159  0.0705  0.0921  6.3992 2.3194 9.6747  0.6253  6.9006  0.0028  
-0.1056 1.2479  0.1321  -0.5990 -0.1137 -0.0201 -0.1923 1.0168  0.2193  'X-RAY DIFFRACTION' 
11 ? refined -38.7050 5.2880  37.7570 0.1257 0.1817 -0.0726 0.0797  0.0078  -0.0091 4.4940 8.5252 6.6977  -5.4379 -2.8010 0.2855  
0.2655  0.7490  -0.1100 -0.3767 -0.4359 0.3274  0.1877  -0.1461 0.1704  'X-RAY DIFFRACTION' 
12 ? refined -33.9690 19.3400 39.2560 0.2011 0.0786 0.0524  0.1051  0.1118  0.1362  5.1050 8.1026 5.5453  3.5126  2.5088  2.3710  
-0.0648 0.1551  0.5646  -0.3253 -0.2638 -0.0246 -0.5268 -0.1282 0.3286  'X-RAY DIFFRACTION' 
13 ? refined -6.9390  37.0710 5.1940  0.3427 0.7093 0.5663  0.0320  -0.3728 0.1194  1.8550 5.2277 8.7425  2.0603  3.7606  2.3634  
-0.0242 0.3175  0.6113  -0.9161 0.2945  1.6380  -0.2110 -1.9722 -0.2703 'X-RAY DIFFRACTION' 
14 ? refined 10.1370  30.7750 -3.1030 0.6902 0.1748 0.0321  -0.1671 -0.0739 0.1155  4.4547 6.6027 10.2856 -0.9412 0.4827  5.2139  
0.0718  0.5731  -0.0910 -1.1534 -0.0582 0.3875  0.2271  -0.5111 -0.0136 'X-RAY DIFFRACTION' 
15 ? refined 16.2740  23.0930 0.8060  0.5838 0.1719 0.0280  -0.1667 -0.0181 -0.0475 2.9155 8.2081 10.8541 1.6060  -0.1202 -0.2412 
-0.0070 0.2250  -0.1787 -1.2502 0.3045  -0.0396 1.5230  0.2083  -0.2976 'X-RAY DIFFRACTION' 
16 ? refined -1.2470  34.4790 10.1320 0.1984 0.3364 0.3146  -0.1021 -0.1399 0.0695  8.7745 3.5103 7.5451  -0.9836 -2.4854 1.7652  
-0.0947 -0.2034 0.7046  -0.3964 0.1258  1.0191  -0.1781 -1.0420 -0.0311 'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.selection_details 
1  1  A 32  A 1   A 59  A 28  ? 'X-RAY DIFFRACTION' ? 
2  2  A 60  A 29  A 168 A 137 ? 'X-RAY DIFFRACTION' ? 
3  3  A 169 A 138 A 268 A 237 ? 'X-RAY DIFFRACTION' ? 
4  4  A 269 A 238 A 348 A 317 ? 'X-RAY DIFFRACTION' ? 
5  5  B 32  B 1   B 90  B 59  ? 'X-RAY DIFFRACTION' ? 
6  6  B 91  B 60  B 150 B 119 ? 'X-RAY DIFFRACTION' ? 
7  7  B 151 B 120 B 221 B 190 ? 'X-RAY DIFFRACTION' ? 
8  8  B 222 B 191 B 348 B 317 ? 'X-RAY DIFFRACTION' ? 
9  9  C 60  C 13  C 90  C 43  ? 'X-RAY DIFFRACTION' ? 
10 10 C 91  C 44  C 124 C 77  ? 'X-RAY DIFFRACTION' ? 
11 11 C 125 C 78  C 142 C 95  ? 'X-RAY DIFFRACTION' ? 
12 12 C 143 C 96  C 191 C 144 ? 'X-RAY DIFFRACTION' ? 
13 13 D 60  D 13  D 90  D 43  ? 'X-RAY DIFFRACTION' ? 
14 14 D 91  D 44  D 130 D 83  ? 'X-RAY DIFFRACTION' ? 
15 15 D 131 D 84  D 156 D 109 ? 'X-RAY DIFFRACTION' ? 
16 16 D 157 D 110 D 191 D 144 ? 'X-RAY DIFFRACTION' ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC   refinement     5.2.0019 ? 1 
HKL-2000 'data scaling' .        ? 2 
PHASER   phasing        .        ? 3 
# 
_pdbx_validate_rmsd_bond.id                        1 
_pdbx_validate_rmsd_bond.PDB_model_num             1 
_pdbx_validate_rmsd_bond.auth_atom_id_1            CB 
_pdbx_validate_rmsd_bond.auth_asym_id_1            A 
_pdbx_validate_rmsd_bond.auth_comp_id_1            CYS 
_pdbx_validate_rmsd_bond.auth_seq_id_1             214 
_pdbx_validate_rmsd_bond.PDB_ins_code_1            ? 
_pdbx_validate_rmsd_bond.label_alt_id_1            ? 
_pdbx_validate_rmsd_bond.auth_atom_id_2            SG 
_pdbx_validate_rmsd_bond.auth_asym_id_2            A 
_pdbx_validate_rmsd_bond.auth_comp_id_2            CYS 
_pdbx_validate_rmsd_bond.auth_seq_id_2             214 
_pdbx_validate_rmsd_bond.PDB_ins_code_2            ? 
_pdbx_validate_rmsd_bond.label_alt_id_2            ? 
_pdbx_validate_rmsd_bond.bond_value                1.635 
_pdbx_validate_rmsd_bond.bond_target_value         1.812 
_pdbx_validate_rmsd_bond.bond_deviation            -0.177 
_pdbx_validate_rmsd_bond.bond_standard_deviation   0.016 
_pdbx_validate_rmsd_bond.linker_flag               N 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             CB 
_pdbx_validate_rmsd_angle.auth_asym_id_1             A 
_pdbx_validate_rmsd_angle.auth_comp_id_1             CYS 
_pdbx_validate_rmsd_angle.auth_seq_id_1              214 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             CA 
_pdbx_validate_rmsd_angle.auth_asym_id_2             A 
_pdbx_validate_rmsd_angle.auth_comp_id_2             CYS 
_pdbx_validate_rmsd_angle.auth_seq_id_2              214 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             C 
_pdbx_validate_rmsd_angle.auth_asym_id_3             A 
_pdbx_validate_rmsd_angle.auth_comp_id_3             CYS 
_pdbx_validate_rmsd_angle.auth_seq_id_3              214 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                97.79 
_pdbx_validate_rmsd_angle.angle_target_value         110.40 
_pdbx_validate_rmsd_angle.angle_deviation            -12.61 
_pdbx_validate_rmsd_angle.angle_standard_deviation   2.00 
_pdbx_validate_rmsd_angle.linker_flag                N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ASN A 166 ? ? -94.00  32.81   
2  1 ASP A 237 ? ? -163.44 97.79   
3  1 ALA B 59  ? ? 63.34   63.66   
4  1 ALA B 114 ? ? -57.83  -150.97 
5  1 ASN B 166 ? ? -95.99  33.40   
6  1 ASP B 237 ? ? -161.21 97.24   
7  1 SER C 113 ? ? -25.54  -48.89  
8  1 SER D 113 ? ? -29.30  -52.33  
9  1 LYS D 134 ? ? -117.16 51.02   
10 1 ASP D 172 ? ? -106.88 -61.78  
# 
_pdbx_validate_peptide_omega.id               1 
_pdbx_validate_peptide_omega.PDB_model_num    1 
_pdbx_validate_peptide_omega.auth_comp_id_1   GLY 
_pdbx_validate_peptide_omega.auth_asym_id_1   A 
_pdbx_validate_peptide_omega.auth_seq_id_1    202 
_pdbx_validate_peptide_omega.PDB_ins_code_1   ? 
_pdbx_validate_peptide_omega.label_alt_id_1   ? 
_pdbx_validate_peptide_omega.auth_comp_id_2   GLY 
_pdbx_validate_peptide_omega.auth_asym_id_2   A 
_pdbx_validate_peptide_omega.auth_seq_id_2    203 
_pdbx_validate_peptide_omega.PDB_ins_code_2   ? 
_pdbx_validate_peptide_omega.label_alt_id_2   ? 
_pdbx_validate_peptide_omega.omega            32.32 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1   1 Y 1 A LYS 54  ? CD  ? A LYS 23  CD  
2   1 Y 1 A LYS 54  ? CE  ? A LYS 23  CE  
3   1 Y 1 A LYS 54  ? NZ  ? A LYS 23  NZ  
4   1 Y 1 A GLU 58  ? CG  ? A GLU 27  CG  
5   1 Y 1 A GLU 58  ? CD  ? A GLU 27  CD  
6   1 Y 1 A GLU 58  ? OE1 ? A GLU 27  OE1 
7   1 Y 1 A GLU 58  ? OE2 ? A GLU 27  OE2 
8   1 Y 1 A ALA 59  ? CB  ? A ALA 28  CB  
9   1 Y 1 A GLU 64  ? CG  ? A GLU 33  CG  
10  1 Y 1 A GLU 64  ? CD  ? A GLU 33  CD  
11  1 Y 1 A GLU 64  ? OE1 ? A GLU 33  OE1 
12  1 Y 1 A GLU 64  ? OE2 ? A GLU 33  OE2 
13  1 Y 1 A LYS 67  ? CG  ? A LYS 36  CG  
14  1 Y 1 A LYS 67  ? CD  ? A LYS 36  CD  
15  1 Y 1 A LYS 67  ? CE  ? A LYS 36  CE  
16  1 Y 1 A LYS 67  ? NZ  ? A LYS 36  NZ  
17  1 Y 1 A LYS 70  ? CE  ? A LYS 39  CE  
18  1 Y 1 A LYS 70  ? NZ  ? A LYS 39  NZ  
19  1 Y 1 A GLN 79  ? CG  ? A GLN 48  CG  
20  1 Y 1 A GLN 79  ? CD  ? A GLN 48  CD  
21  1 Y 1 A GLN 79  ? OE1 ? A GLN 48  OE1 
22  1 Y 1 A GLN 79  ? NE2 ? A GLN 48  NE2 
23  1 Y 1 A LYS 132 ? CD  ? A LYS 101 CD  
24  1 Y 1 A LYS 132 ? CE  ? A LYS 101 CE  
25  1 Y 1 A LYS 132 ? NZ  ? A LYS 101 NZ  
26  1 Y 1 A LYS 180 ? CE  ? A LYS 149 CE  
27  1 Y 1 A LYS 180 ? NZ  ? A LYS 149 NZ  
28  1 Y 1 A GLU 238 ? CG  ? A GLU 207 CG  
29  1 Y 1 A GLU 238 ? CD  ? A GLU 207 CD  
30  1 Y 1 A GLU 238 ? OE1 ? A GLU 207 OE1 
31  1 Y 1 A GLU 238 ? OE2 ? A GLU 207 OE2 
32  1 Y 1 A LYS 248 ? CG  ? A LYS 217 CG  
33  1 Y 1 A LYS 248 ? CD  ? A LYS 217 CD  
34  1 Y 1 A LYS 248 ? CE  ? A LYS 217 CE  
35  1 Y 1 A LYS 248 ? NZ  ? A LYS 217 NZ  
36  1 Y 1 A LYS 279 ? CD  ? A LYS 248 CD  
37  1 Y 1 A LYS 279 ? CE  ? A LYS 248 CE  
38  1 Y 1 A LYS 279 ? NZ  ? A LYS 248 NZ  
39  1 Y 1 A LYS 280 ? CE  ? A LYS 249 CE  
40  1 Y 1 A LYS 280 ? NZ  ? A LYS 249 NZ  
41  1 Y 1 A GLU 289 ? CG  ? A GLU 258 CG  
42  1 Y 1 A GLU 289 ? CD  ? A GLU 258 CD  
43  1 Y 1 A GLU 289 ? OE1 ? A GLU 258 OE1 
44  1 Y 1 A GLU 289 ? OE2 ? A GLU 258 OE2 
45  1 Y 1 A LYS 330 ? CD  ? A LYS 299 CD  
46  1 Y 1 A LYS 330 ? CE  ? A LYS 299 CE  
47  1 Y 1 A LYS 330 ? NZ  ? A LYS 299 NZ  
48  1 Y 1 A LYS 345 ? CG  ? A LYS 314 CG  
49  1 Y 1 A LYS 345 ? CD  ? A LYS 314 CD  
50  1 Y 1 A LYS 345 ? CE  ? A LYS 314 CE  
51  1 Y 1 A LYS 345 ? NZ  ? A LYS 314 NZ  
52  1 Y 1 B ARG 32  ? CG  ? B ARG 1   CG  
53  1 Y 1 B ARG 32  ? CD  ? B ARG 1   CD  
54  1 Y 1 B ARG 32  ? NE  ? B ARG 1   NE  
55  1 Y 1 B ARG 32  ? CZ  ? B ARG 1   CZ  
56  1 Y 1 B ARG 32  ? NH1 ? B ARG 1   NH1 
57  1 Y 1 B ARG 32  ? NH2 ? B ARG 1   NH2 
58  1 Y 1 B LYS 54  ? CG  ? B LYS 23  CG  
59  1 Y 1 B LYS 54  ? CD  ? B LYS 23  CD  
60  1 Y 1 B LYS 54  ? CE  ? B LYS 23  CE  
61  1 Y 1 B LYS 54  ? NZ  ? B LYS 23  NZ  
62  1 Y 1 B GLU 65  ? CG  ? B GLU 34  CG  
63  1 Y 1 B GLU 65  ? CD  ? B GLU 34  CD  
64  1 Y 1 B GLU 65  ? OE1 ? B GLU 34  OE1 
65  1 Y 1 B GLU 65  ? OE2 ? B GLU 34  OE2 
66  1 Y 1 B LYS 67  ? CD  ? B LYS 36  CD  
67  1 Y 1 B LYS 67  ? CE  ? B LYS 36  CE  
68  1 Y 1 B LYS 67  ? NZ  ? B LYS 36  NZ  
69  1 Y 1 B GLN 68  ? CD  ? B GLN 37  CD  
70  1 Y 1 B GLN 68  ? OE1 ? B GLN 37  OE1 
71  1 Y 1 B GLN 68  ? NE2 ? B GLN 37  NE2 
72  1 Y 1 B GLN 79  ? CG  ? B GLN 48  CG  
73  1 Y 1 B GLN 79  ? CD  ? B GLN 48  CD  
74  1 Y 1 B GLN 79  ? OE1 ? B GLN 48  OE1 
75  1 Y 1 B GLN 79  ? NE2 ? B GLN 48  NE2 
76  1 Y 1 B LYS 92  ? CD  ? B LYS 61  CD  
77  1 Y 1 B LYS 92  ? CE  ? B LYS 61  CE  
78  1 Y 1 B LYS 92  ? NZ  ? B LYS 61  NZ  
79  1 Y 1 B LYS 180 ? CE  ? B LYS 149 CE  
80  1 Y 1 B LYS 180 ? NZ  ? B LYS 149 NZ  
81  1 Y 1 B GLU 238 ? CG  ? B GLU 207 CG  
82  1 Y 1 B GLU 238 ? CD  ? B GLU 207 CD  
83  1 Y 1 B GLU 238 ? OE1 ? B GLU 207 OE1 
84  1 Y 1 B GLU 238 ? OE2 ? B GLU 207 OE2 
85  1 Y 1 B LYS 248 ? CD  ? B LYS 217 CD  
86  1 Y 1 B LYS 248 ? CE  ? B LYS 217 CE  
87  1 Y 1 B LYS 248 ? NZ  ? B LYS 217 NZ  
88  1 Y 1 B LYS 280 ? CD  ? B LYS 249 CD  
89  1 Y 1 B LYS 280 ? CE  ? B LYS 249 CE  
90  1 Y 1 B LYS 280 ? NZ  ? B LYS 249 NZ  
91  1 Y 1 B GLU 289 ? CG  ? B GLU 258 CG  
92  1 Y 1 B GLU 289 ? CD  ? B GLU 258 CD  
93  1 Y 1 B GLU 289 ? OE1 ? B GLU 258 OE1 
94  1 Y 1 B GLU 289 ? OE2 ? B GLU 258 OE2 
95  1 Y 1 B LYS 312 ? CG  ? B LYS 281 CG  
96  1 Y 1 B LYS 312 ? CD  ? B LYS 281 CD  
97  1 Y 1 B LYS 312 ? CE  ? B LYS 281 CE  
98  1 Y 1 B LYS 312 ? NZ  ? B LYS 281 NZ  
99  1 Y 1 B LYS 330 ? CG  ? B LYS 299 CG  
100 1 Y 1 B LYS 330 ? CD  ? B LYS 299 CD  
101 1 Y 1 B LYS 330 ? CE  ? B LYS 299 CE  
102 1 Y 1 B LYS 330 ? NZ  ? B LYS 299 NZ  
103 1 Y 1 B LYS 345 ? CG  ? B LYS 314 CG  
104 1 Y 1 B LYS 345 ? CD  ? B LYS 314 CD  
105 1 Y 1 B LYS 345 ? CE  ? B LYS 314 CE  
106 1 Y 1 B LYS 345 ? NZ  ? B LYS 314 NZ  
107 1 Y 1 B ASN 347 ? CG  ? B ASN 316 CG  
108 1 Y 1 B ASN 347 ? OD1 ? B ASN 316 OD1 
109 1 Y 1 B ASN 347 ? ND2 ? B ASN 316 ND2 
110 1 Y 1 B LEU 348 ? CG  ? B LEU 317 CG  
111 1 Y 1 B LEU 348 ? CD1 ? B LEU 317 CD1 
112 1 Y 1 B LEU 348 ? CD2 ? B LEU 317 CD2 
113 1 Y 1 C GLN 68  ? CD  ? C GLN 21  CD  
114 1 Y 1 C GLN 68  ? OE1 ? C GLN 21  OE1 
115 1 Y 1 C GLN 68  ? NE2 ? C GLN 21  NE2 
116 1 Y 1 C LYS 75  ? CD  ? C LYS 28  CD  
117 1 Y 1 C LYS 75  ? CE  ? C LYS 28  CE  
118 1 Y 1 C LYS 75  ? NZ  ? C LYS 28  NZ  
119 1 Y 1 C LYS 110 ? CD  ? C LYS 63  CD  
120 1 Y 1 C LYS 110 ? CE  ? C LYS 63  CE  
121 1 Y 1 C LYS 110 ? NZ  ? C LYS 63  NZ  
122 1 Y 1 C GLU 112 ? CG  ? C GLU 65  CG  
123 1 Y 1 C GLU 112 ? CD  ? C GLU 65  CD  
124 1 Y 1 C GLU 112 ? OE1 ? C GLU 65  OE1 
125 1 Y 1 C GLU 112 ? OE2 ? C GLU 65  OE2 
126 1 Y 1 C LYS 119 ? NZ  ? C LYS 72  NZ  
127 1 Y 1 C ARG 141 ? CD  ? C ARG 94  CD  
128 1 Y 1 C ARG 141 ? NE  ? C ARG 94  NE  
129 1 Y 1 C ARG 141 ? CZ  ? C ARG 94  CZ  
130 1 Y 1 C ARG 141 ? NH1 ? C ARG 94  NH1 
131 1 Y 1 C ARG 141 ? NH2 ? C ARG 94  NH2 
132 1 Y 1 C LYS 148 ? CD  ? C LYS 101 CD  
133 1 Y 1 C LYS 148 ? CE  ? C LYS 101 CE  
134 1 Y 1 C LYS 148 ? NZ  ? C LYS 101 NZ  
135 1 Y 1 C LYS 151 ? CE  ? C LYS 104 CE  
136 1 Y 1 C LYS 151 ? NZ  ? C LYS 104 NZ  
137 1 Y 1 C LYS 163 ? CD  ? C LYS 116 CD  
138 1 Y 1 C LYS 163 ? CE  ? C LYS 116 CE  
139 1 Y 1 C LYS 163 ? NZ  ? C LYS 116 NZ  
140 1 Y 1 C LYS 171 ? CD  ? C LYS 124 CD  
141 1 Y 1 C LYS 171 ? CE  ? C LYS 124 CE  
142 1 Y 1 C LYS 171 ? NZ  ? C LYS 124 NZ  
143 1 Y 1 C LYS 179 ? CE  ? C LYS 132 CE  
144 1 Y 1 C LYS 179 ? NZ  ? C LYS 132 NZ  
145 1 Y 1 C ASN 188 ? CG  ? C ASN 141 CG  
146 1 Y 1 C ASN 188 ? OD1 ? C ASN 141 OD1 
147 1 Y 1 C ASN 188 ? ND2 ? C ASN 141 ND2 
148 1 Y 1 D MET 67  ? CG  ? D MET 20  CG  
149 1 Y 1 D MET 67  ? SD  ? D MET 20  SD  
150 1 Y 1 D MET 67  ? CE  ? D MET 20  CE  
151 1 Y 1 D LYS 75  ? CD  ? D LYS 28  CD  
152 1 Y 1 D LYS 75  ? CE  ? D LYS 28  CE  
153 1 Y 1 D LYS 75  ? NZ  ? D LYS 28  NZ  
154 1 Y 1 D LYS 91  ? CD  ? D LYS 44  CD  
155 1 Y 1 D LYS 91  ? CE  ? D LYS 44  CE  
156 1 Y 1 D LYS 91  ? NZ  ? D LYS 44  NZ  
157 1 Y 1 D LEU 115 ? CG  ? D LEU 68  CG  
158 1 Y 1 D LEU 115 ? CD1 ? D LEU 68  CD1 
159 1 Y 1 D LEU 115 ? CD2 ? D LEU 68  CD2 
160 1 Y 1 D LYS 119 ? CE  ? D LYS 72  CE  
161 1 Y 1 D LYS 119 ? NZ  ? D LYS 72  NZ  
162 1 Y 1 D LYS 125 ? CG  ? D LYS 78  CG  
163 1 Y 1 D LYS 125 ? CD  ? D LYS 78  CD  
164 1 Y 1 D LYS 125 ? CE  ? D LYS 78  CE  
165 1 Y 1 D LYS 125 ? NZ  ? D LYS 78  NZ  
166 1 Y 1 D LYS 134 ? CD  ? D LYS 87  CD  
167 1 Y 1 D LYS 134 ? CE  ? D LYS 87  CE  
168 1 Y 1 D LYS 134 ? NZ  ? D LYS 87  NZ  
169 1 Y 1 D ARG 141 ? CD  ? D ARG 94  CD  
170 1 Y 1 D ARG 141 ? NE  ? D ARG 94  NE  
171 1 Y 1 D ARG 141 ? CZ  ? D ARG 94  CZ  
172 1 Y 1 D ARG 141 ? NH1 ? D ARG 94  NH1 
173 1 Y 1 D ARG 141 ? NH2 ? D ARG 94  NH2 
174 1 Y 1 D LYS 148 ? CD  ? D LYS 101 CD  
175 1 Y 1 D LYS 148 ? CE  ? D LYS 101 CE  
176 1 Y 1 D LYS 148 ? NZ  ? D LYS 101 NZ  
177 1 Y 1 D LYS 151 ? CG  ? D LYS 104 CG  
178 1 Y 1 D LYS 151 ? CD  ? D LYS 104 CD  
179 1 Y 1 D LYS 151 ? CE  ? D LYS 104 CE  
180 1 Y 1 D LYS 151 ? NZ  ? D LYS 104 NZ  
181 1 Y 1 D LYS 163 ? CD  ? D LYS 116 CD  
182 1 Y 1 D LYS 163 ? CE  ? D LYS 116 CE  
183 1 Y 1 D LYS 163 ? NZ  ? D LYS 116 NZ  
184 1 Y 1 D LYS 171 ? CG  ? D LYS 124 CG  
185 1 Y 1 D LYS 171 ? CD  ? D LYS 124 CD  
186 1 Y 1 D LYS 171 ? CE  ? D LYS 124 CE  
187 1 Y 1 D LYS 171 ? NZ  ? D LYS 124 NZ  
188 1 Y 1 D LYS 179 ? CE  ? D LYS 132 CE  
189 1 Y 1 D LYS 179 ? NZ  ? D LYS 132 NZ  
190 1 Y 1 D ASP 189 ? CG  ? D ASP 142 CG  
191 1 Y 1 D ASP 189 ? OD1 ? D ASP 142 OD1 
192 1 Y 1 D ASP 189 ? OD2 ? D ASP 142 OD2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY 112 ? A GLY 81  
2  1 Y 1 A ALA 113 ? A ALA 82  
3  1 Y 1 A ALA 114 ? A ALA 83  
4  1 Y 1 A GLU 115 ? A GLU 84  
5  1 Y 1 A GLU 116 ? A GLU 85  
6  1 Y 1 A GLY 117 ? A GLY 86  
7  1 Y 1 A PHE 118 ? A PHE 87  
8  1 Y 1 A LYS 349 ? A LYS 318 
9  1 Y 1 A ASP 350 ? A ASP 319 
10 1 Y 1 A CYS 351 ? A CYS 320 
11 1 Y 1 A GLY 352 ? A GLY 321 
12 1 Y 1 A LEU 353 ? A LEU 322 
13 1 Y 1 A PHE 354 ? A PHE 323 
14 1 Y 1 B LYS 349 ? B LYS 318 
15 1 Y 1 B ASP 350 ? B ASP 319 
16 1 Y 1 B CYS 351 ? B CYS 320 
17 1 Y 1 B GLY 352 ? B GLY 321 
18 1 Y 1 B LEU 353 ? B LEU 322 
19 1 Y 1 B PHE 354 ? B PHE 323 
20 1 Y 1 C SER 48  ? C SER 1   
21 1 Y 1 C MET 49  ? C MET 2   
22 1 Y 1 C SER 50  ? C SER 3   
23 1 Y 1 C GLY 51  ? C GLY 4   
24 1 Y 1 C MET 52  ? C MET 5   
25 1 Y 1 C LYS 53  ? C LYS 6   
26 1 Y 1 C SER 54  ? C SER 7   
27 1 Y 1 C SER 55  ? C SER 8   
28 1 Y 1 C LYS 56  ? C LYS 9   
29 1 Y 1 C SER 57  ? C SER 10  
30 1 Y 1 C LYS 58  ? C LYS 11  
31 1 Y 1 C ASP 59  ? C ASP 12  
32 1 Y 1 C ALA 192 ? C ALA 145 
33 1 Y 1 D SER 48  ? D SER 1   
34 1 Y 1 D MET 49  ? D MET 2   
35 1 Y 1 D SER 50  ? D SER 3   
36 1 Y 1 D GLY 51  ? D GLY 4   
37 1 Y 1 D MET 52  ? D MET 5   
38 1 Y 1 D LYS 53  ? D LYS 6   
39 1 Y 1 D SER 54  ? D SER 7   
40 1 Y 1 D SER 55  ? D SER 8   
41 1 Y 1 D LYS 56  ? D LYS 9   
42 1 Y 1 D SER 57  ? D SER 10  
43 1 Y 1 D LYS 58  ? D LYS 11  
44 1 Y 1 D ASP 59  ? D ASP 12  
45 1 Y 1 D ALA 192 ? D ALA 145 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 'TETRAFLUOROALUMINATE ION' ALF 
4 'MAGNESIUM ION'            MG  
5 "GUANOSINE-5'-DIPHOSPHATE" GDP 
6 water                      HOH 
#