data_2I59
# 
_entry.id   2I59 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.323 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2I59         
RCSB  RCSB039153   
WWPDB D_1000039153 
BMRB  7272         
# 
_pdbx_database_related.db_name        BMRB 
_pdbx_database_related.db_id          7272 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2I59 
_pdbx_database_status.recvd_initial_deposition_date   2006-08-24 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  REL 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Fedorov, O.'                          1  
'Higman, V.A.'                         2  
'Diehl, A.'                            3  
'Leidert, M.'                          4  
'Lemak, A.'                            5  
'Schmieder, P.'                        6  
'Oschkinat, H.'                        7  
'Elkins, J.'                           8  
'Soundarajan, M.'                      9  
'Doyle, D.A.'                          10 
'Arrowsmith, C.'                       11 
'Sundstrom, M.'                        12 
'Weigelt, J.'                          13 
'Edwards, A.'                          14 
'Ball, L.J.'                           15 
'Structural Genomics Consortium (SGC)' 16 
# 
_citation.id                        primary 
_citation.title                     
'Structural diversity in the RGS domain and its interaction with heterotrimeric G protein alpha-subunits.' 
_citation.journal_abbrev            Proc.Natl.Acad.Sci.Usa 
_citation.journal_volume            105 
_citation.page_first                6457 
_citation.page_last                 6462 
_citation.year                      2008 
_citation.journal_id_ASTM           PNASA6 
_citation.country                   US 
_citation.journal_id_ISSN           0027-8424 
_citation.journal_id_CSD            0040 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   18434541 
_citation.pdbx_database_id_DOI      10.1073/pnas.0801508105 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Soundararajan, M.' 1  ? 
primary 'Willard, F.S.'     2  ? 
primary 'Kimple, A.J.'      3  ? 
primary 'Turnbull, A.P.'    4  ? 
primary 'Ball, L.J.'        5  ? 
primary 'Schoch, G.A.'      6  ? 
primary 'Gileadi, C.'       7  ? 
primary 'Fedorov, O.Y.'     8  ? 
primary 'Dowler, E.F.'      9  ? 
primary 'Higman, V.A.'      10 ? 
primary 'Hutsell, S.Q.'     11 ? 
primary 'Sundstrom, M.'     12 ? 
primary 'Doyle, D.A.'       13 ? 
primary 'Siderovski, D.P.'  14 ? 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'Regulator of G-protein signaling 10' 
_entity.formula_weight             16510.805 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              'Regulator of G-protein signaling domain' 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        RGS10 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;SMQSLKSTAKWAASLENLLEDPEGVKRFREFLKKEFSEENVLFWLACEDFKKMQDKTQMQEKAKEIYMTFLSSKASSQVN
VEGQSRLNEKILEEPHPLMFQKLQDQIFNLMKYDSYSRFLKSDLFLKHKRTEEEEEDL
;
_entity_poly.pdbx_seq_one_letter_code_can   
;SMQSLKSTAKWAASLENLLEDPEGVKRFREFLKKEFSEENVLFWLACEDFKKMQDKTQMQEKAKEIYMTFLSSKASSQVN
VEGQSRLNEKILEEPHPLMFQKLQDQIFNLMKYDSYSRFLKSDLFLKHKRTEEEEEDL
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   MET n 
1 3   GLN n 
1 4   SER n 
1 5   LEU n 
1 6   LYS n 
1 7   SER n 
1 8   THR n 
1 9   ALA n 
1 10  LYS n 
1 11  TRP n 
1 12  ALA n 
1 13  ALA n 
1 14  SER n 
1 15  LEU n 
1 16  GLU n 
1 17  ASN n 
1 18  LEU n 
1 19  LEU n 
1 20  GLU n 
1 21  ASP n 
1 22  PRO n 
1 23  GLU n 
1 24  GLY n 
1 25  VAL n 
1 26  LYS n 
1 27  ARG n 
1 28  PHE n 
1 29  ARG n 
1 30  GLU n 
1 31  PHE n 
1 32  LEU n 
1 33  LYS n 
1 34  LYS n 
1 35  GLU n 
1 36  PHE n 
1 37  SER n 
1 38  GLU n 
1 39  GLU n 
1 40  ASN n 
1 41  VAL n 
1 42  LEU n 
1 43  PHE n 
1 44  TRP n 
1 45  LEU n 
1 46  ALA n 
1 47  CYS n 
1 48  GLU n 
1 49  ASP n 
1 50  PHE n 
1 51  LYS n 
1 52  LYS n 
1 53  MET n 
1 54  GLN n 
1 55  ASP n 
1 56  LYS n 
1 57  THR n 
1 58  GLN n 
1 59  MET n 
1 60  GLN n 
1 61  GLU n 
1 62  LYS n 
1 63  ALA n 
1 64  LYS n 
1 65  GLU n 
1 66  ILE n 
1 67  TYR n 
1 68  MET n 
1 69  THR n 
1 70  PHE n 
1 71  LEU n 
1 72  SER n 
1 73  SER n 
1 74  LYS n 
1 75  ALA n 
1 76  SER n 
1 77  SER n 
1 78  GLN n 
1 79  VAL n 
1 80  ASN n 
1 81  VAL n 
1 82  GLU n 
1 83  GLY n 
1 84  GLN n 
1 85  SER n 
1 86  ARG n 
1 87  LEU n 
1 88  ASN n 
1 89  GLU n 
1 90  LYS n 
1 91  ILE n 
1 92  LEU n 
1 93  GLU n 
1 94  GLU n 
1 95  PRO n 
1 96  HIS n 
1 97  PRO n 
1 98  LEU n 
1 99  MET n 
1 100 PHE n 
1 101 GLN n 
1 102 LYS n 
1 103 LEU n 
1 104 GLN n 
1 105 ASP n 
1 106 GLN n 
1 107 ILE n 
1 108 PHE n 
1 109 ASN n 
1 110 LEU n 
1 111 MET n 
1 112 LYS n 
1 113 TYR n 
1 114 ASP n 
1 115 SER n 
1 116 TYR n 
1 117 SER n 
1 118 ARG n 
1 119 PHE n 
1 120 LEU n 
1 121 LYS n 
1 122 SER n 
1 123 ASP n 
1 124 LEU n 
1 125 PHE n 
1 126 LEU n 
1 127 LYS n 
1 128 HIS n 
1 129 LYS n 
1 130 ARG n 
1 131 THR n 
1 132 GLU n 
1 133 GLU n 
1 134 GLU n 
1 135 GLU n 
1 136 GLU n 
1 137 ASP n 
1 138 LEU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 RGS10 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    RGS10_HUMAN 
_struct_ref.pdbx_db_accession          O43665 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_align_begin           20 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2I59 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 3 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 138 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             O43665 
_struct_ref_seq.db_align_beg                  20 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  157 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       3 
_struct_ref_seq.pdbx_auth_seq_align_end       138 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2I59 SER A 1 ? UNP O43665 ? ? 'cloning artifact' 1 1 
1 2I59 MET A 2 ? UNP O43665 ? ? 'cloning artifact' 2 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
_pdbx_nmr_exptl.solution_id 
1 1 3D_13C-separated_NOESY 1 
2 1 3D_15N-separated_NOESY 1 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         298 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pH                  7.0 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      '50 mM NaCl, 20 mM phosphate' 
_pdbx_nmr_exptl_sample_conditions.pressure_units      . 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.contents         'U-15N, 13C RGS10, 20 mM Phosphate, 50 mM NaCl, 90% H2O, 10% D2O' 
_pdbx_nmr_sample_details.solvent_system   '90% H2O/10% D2O' 
# 
loop_
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.field_strength 
_pdbx_nmr_spectrometer.type 
1 DMX Bruker 750 ? 
2 DMX Bruker 600 ? 
# 
_pdbx_nmr_refine.entry_id           2I59 
_pdbx_nmr_refine.method             'simulated annealing' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.entry_id                                      2I59 
_pdbx_nmr_ensemble.conformers_calculated_total_number            100 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the lowest energy' 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             2I59 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
refinement           CNS       1.0  BRUNGER 1 
'structure solution' CYANA     2.1  Guntert 2 
'structure solution' XPLOR-NIH 2.14 BRUNGER 3 
# 
_exptl.entry_id          2I59 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      ? 
_exptl_crystal.density_percent_sol   ? 
_exptl_crystal.description           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             ? 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_struct.entry_id                  2I59 
_struct.title                     'Solution structure of RGS10' 
_struct.pdbx_descriptor           'Regulator of G-protein signaling 10' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            N 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2I59 
_struct_keywords.pdbx_keywords   'SIGNALING PROTEIN' 
_struct_keywords.text            
'Regulator of G-protein signaling, Structural Genomics, Structural Genomics Consortium, SGC, SIGNALING PROTEIN' 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 SER A 4  ? ALA A 12  ? SER A 4  ALA A 12  1 ? 9  
HELX_P HELX_P2 2 SER A 14 ? ASP A 21  ? SER A 14 ASP A 21  1 ? 8  
HELX_P HELX_P3 3 ASP A 21 ? PHE A 36  ? ASP A 21 PHE A 36  1 ? 16 
HELX_P HELX_P4 4 SER A 37 ? MET A 53  ? SER A 37 MET A 53  1 ? 17 
HELX_P HELX_P5 5 ASP A 55 ? LEU A 71  ? ASP A 55 LEU A 71  1 ? 17 
HELX_P HELX_P6 6 LYS A 74 ? GLN A 78  ? LYS A 74 GLN A 78  5 ? 5  
HELX_P HELX_P7 7 ASN A 88 ? GLU A 93  ? ASN A 88 GLU A 93  1 ? 6  
HELX_P HELX_P8 8 HIS A 96 ? LEU A 120 ? HIS A 96 LEU A 120 1 ? 25 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_database_PDB_matrix.entry_id          2I59 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2I59 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . SER A 1 1   ? 98.546  -9.228  14.770  1.00 0.00 ? 1   SER A N    1  
ATOM 2     C CA   . SER A 1 1   ? 98.784  -8.449  13.536  1.00 0.00 ? 1   SER A CA   1  
ATOM 3     C C    . SER A 1 1   ? 97.688  -8.721  12.500  1.00 0.00 ? 1   SER A C    1  
ATOM 4     O O    . SER A 1 1   ? 97.424  -9.876  12.152  1.00 0.00 ? 1   SER A O    1  
ATOM 5     C CB   . SER A 1 1   ? 100.158 -8.805  12.960  1.00 0.00 ? 1   SER A CB   1  
ATOM 6     O OG   . SER A 1 1   ? 101.178 -8.600  13.922  1.00 0.00 ? 1   SER A OG   1  
ATOM 7     H H1   . SER A 1 1   ? 99.340  -9.102  15.431  1.00 0.00 ? 1   SER A H1   1  
ATOM 8     H H2   . SER A 1 1   ? 98.451  -10.240 14.545  1.00 0.00 ? 1   SER A H2   1  
ATOM 9     H H3   . SER A 1 1   ? 97.674  -8.907  15.232  1.00 0.00 ? 1   SER A H3   1  
ATOM 10    H HA   . SER A 1 1   ? 98.769  -7.398  13.793  1.00 0.00 ? 1   SER A HA   1  
ATOM 11    H HB2  . SER A 1 1   ? 100.165 -9.845  12.665  1.00 0.00 ? 1   SER A HB2  1  
ATOM 12    H HB3  . SER A 1 1   ? 100.360 -8.185  12.100  1.00 0.00 ? 1   SER A HB3  1  
ATOM 13    H HG   . SER A 1 1   ? 101.722 -7.846  13.661  1.00 0.00 ? 1   SER A HG   1  
ATOM 14    N N    . MET A 1 2   ? 97.061  -7.655  12.002  1.00 0.00 ? 2   MET A N    1  
ATOM 15    C CA   . MET A 1 2   ? 95.988  -7.773  11.009  1.00 0.00 ? 2   MET A CA   1  
ATOM 16    C C    . MET A 1 2   ? 96.535  -7.602  9.592   1.00 0.00 ? 2   MET A C    1  
ATOM 17    O O    . MET A 1 2   ? 95.773  -7.507  8.628   1.00 0.00 ? 2   MET A O    1  
ATOM 18    C CB   . MET A 1 2   ? 94.912  -6.711  11.264  1.00 0.00 ? 2   MET A CB   1  
ATOM 19    C CG   . MET A 1 2   ? 94.240  -6.811  12.625  1.00 0.00 ? 2   MET A CG   1  
ATOM 20    S SD   . MET A 1 2   ? 93.003  -5.521  12.866  1.00 0.00 ? 2   MET A SD   1  
ATOM 21    C CE   . MET A 1 2   ? 92.477  -5.866  14.543  1.00 0.00 ? 2   MET A CE   1  
ATOM 22    H H    . MET A 1 2   ? 97.322  -6.757  12.313  1.00 0.00 ? 2   MET A H    1  
ATOM 23    H HA   . MET A 1 2   ? 95.545  -8.755  11.100  1.00 0.00 ? 2   MET A HA   1  
ATOM 24    H HB2  . MET A 1 2   ? 95.366  -5.733  11.187  1.00 0.00 ? 2   MET A HB2  1  
ATOM 25    H HB3  . MET A 1 2   ? 94.149  -6.801  10.504  1.00 0.00 ? 2   MET A HB3  1  
ATOM 26    H HG2  . MET A 1 2   ? 93.757  -7.775  12.705  1.00 0.00 ? 2   MET A HG2  1  
ATOM 27    H HG3  . MET A 1 2   ? 94.993  -6.721  13.396  1.00 0.00 ? 2   MET A HG3  1  
ATOM 28    H HE1  . MET A 1 2   ? 92.081  -6.870  14.596  1.00 0.00 ? 2   MET A HE1  1  
ATOM 29    H HE2  . MET A 1 2   ? 91.710  -5.161  14.831  1.00 0.00 ? 2   MET A HE2  1  
ATOM 30    H HE3  . MET A 1 2   ? 93.320  -5.774  15.211  1.00 0.00 ? 2   MET A HE3  1  
ATOM 31    N N    . GLN A 1 3   ? 97.855  -7.565  9.471   1.00 0.00 ? 3   GLN A N    1  
ATOM 32    C CA   . GLN A 1 3   ? 98.503  -7.287  8.195   1.00 0.00 ? 3   GLN A CA   1  
ATOM 33    C C    . GLN A 1 3   ? 98.480  -8.505  7.276   1.00 0.00 ? 3   GLN A C    1  
ATOM 34    O O    . GLN A 1 3   ? 99.245  -9.455  7.465   1.00 0.00 ? 3   GLN A O    1  
ATOM 35    C CB   . GLN A 1 3   ? 99.946  -6.812  8.408   1.00 0.00 ? 3   GLN A CB   1  
ATOM 36    C CG   . GLN A 1 3   ? 100.058 -5.465  9.113   1.00 0.00 ? 3   GLN A CG   1  
ATOM 37    C CD   . GLN A 1 3   ? 99.617  -5.508  10.567  1.00 0.00 ? 3   GLN A CD   1  
ATOM 38    O OE1  . GLN A 1 3   ? 98.450  -5.279  10.886  1.00 0.00 ? 3   GLN A OE1  1  
ATOM 39    N NE2  . GLN A 1 3   ? 100.547 -5.821  11.454  1.00 0.00 ? 3   GLN A NE2  1  
ATOM 40    H H    . GLN A 1 3   ? 98.408  -7.729  10.259  1.00 0.00 ? 3   GLN A H    1  
ATOM 41    H HA   . GLN A 1 3   ? 97.951  -6.490  7.716   1.00 0.00 ? 3   GLN A HA   1  
ATOM 42    H HB2  . GLN A 1 3   ? 100.472 -7.548  9.000   1.00 0.00 ? 3   GLN A HB2  1  
ATOM 43    H HB3  . GLN A 1 3   ? 100.431 -6.728  7.445   1.00 0.00 ? 3   GLN A HB3  1  
ATOM 44    H HG2  . GLN A 1 3   ? 101.087 -5.140  9.077   1.00 0.00 ? 3   GLN A HG2  1  
ATOM 45    H HG3  . GLN A 1 3   ? 99.442  -4.748  8.588   1.00 0.00 ? 3   GLN A HG3  1  
ATOM 46    H HE21 . GLN A 1 3   ? 101.456 -6.011  11.127  1.00 0.00 ? 3   GLN A HE21 1  
ATOM 47    H HE22 . GLN A 1 3   ? 100.303 -5.829  12.404  1.00 0.00 ? 3   GLN A HE22 1  
ATOM 48    N N    . SER A 1 4   ? 97.580  -8.471  6.298   1.00 0.00 ? 4   SER A N    1  
ATOM 49    C CA   . SER A 1 4   ? 97.498  -9.500  5.267   1.00 0.00 ? 4   SER A CA   1  
ATOM 50    C C    . SER A 1 4   ? 96.761  -8.965  4.032   1.00 0.00 ? 4   SER A C    1  
ATOM 51    O O    . SER A 1 4   ? 97.366  -8.769  2.981   1.00 0.00 ? 4   SER A O    1  
ATOM 52    C CB   . SER A 1 4   ? 96.785  -10.759 5.792   1.00 0.00 ? 4   SER A CB   1  
ATOM 53    O OG   . SER A 1 4   ? 97.561  -11.436 6.772   1.00 0.00 ? 4   SER A OG   1  
ATOM 54    H H    . SER A 1 4   ? 96.945  -7.723  6.269   1.00 0.00 ? 4   SER A H    1  
ATOM 55    H HA   . SER A 1 4   ? 98.513  -9.760  4.983   1.00 0.00 ? 4   SER A HA   1  
ATOM 56    H HB2  . SER A 1 4   ? 95.842  -10.476 6.237   1.00 0.00 ? 4   SER A HB2  1  
ATOM 57    H HB3  . SER A 1 4   ? 96.602  -11.436 4.969   1.00 0.00 ? 4   SER A HB3  1  
ATOM 58    H HG   . SER A 1 4   ? 97.886  -10.801 7.417   1.00 0.00 ? 4   SER A HG   1  
ATOM 59    N N    . LEU A 1 5   ? 95.463  -8.689  4.185   1.00 0.00 ? 5   LEU A N    1  
ATOM 60    C CA   . LEU A 1 5   ? 94.606  -8.326  3.052   1.00 0.00 ? 5   LEU A CA   1  
ATOM 61    C C    . LEU A 1 5   ? 94.876  -6.905  2.602   1.00 0.00 ? 5   LEU A C    1  
ATOM 62    O O    . LEU A 1 5   ? 95.530  -6.648  1.584   1.00 0.00 ? 5   LEU A O    1  
ATOM 63    C CB   . LEU A 1 5   ? 93.104  -8.442  3.395   1.00 0.00 ? 5   LEU A CB   1  
ATOM 64    C CG   . LEU A 1 5   ? 92.620  -9.757  4.024   1.00 0.00 ? 5   LEU A CG   1  
ATOM 65    C CD1  . LEU A 1 5   ? 93.102  -9.881  5.466   1.00 0.00 ? 5   LEU A CD1  1  
ATOM 66    C CD2  . LEU A 1 5   ? 91.097  -9.829  3.957   1.00 0.00 ? 5   LEU A CD2  1  
ATOM 67    H H    . LEU A 1 5   ? 95.078  -8.706  5.085   1.00 0.00 ? 5   LEU A H    1  
ATOM 68    H HA   . LEU A 1 5   ? 94.826  -8.982  2.245   1.00 0.00 ? 5   LEU A HA   1  
ATOM 69    H HB2  . LEU A 1 5   ? 92.853  -7.641  4.075   1.00 0.00 ? 5   LEU A HB2  1  
ATOM 70    H HB3  . LEU A 1 5   ? 92.548  -8.287  2.480   1.00 0.00 ? 5   LEU A HB3  1  
ATOM 71    H HG   . LEU A 1 5   ? 93.020  -10.589 3.463   1.00 0.00 ? 5   LEU A HG   1  
ATOM 72    H HD11 . LEU A 1 5   ? 92.760  -9.027  6.035   1.00 0.00 ? 5   LEU A HD11 1  
ATOM 73    H HD12 . LEU A 1 5   ? 94.181  -9.913  5.481   1.00 0.00 ? 5   LEU A HD12 1  
ATOM 74    H HD13 . LEU A 1 5   ? 92.709  -10.787 5.903   1.00 0.00 ? 5   LEU A HD13 1  
ATOM 75    H HD21 . LEU A 1 5   ? 90.782  -9.814  2.924   1.00 0.00 ? 5   LEU A HD21 1  
ATOM 76    H HD22 . LEU A 1 5   ? 90.673  -8.978  4.473   1.00 0.00 ? 5   LEU A HD22 1  
ATOM 77    H HD23 . LEU A 1 5   ? 90.756  -10.741 4.425   1.00 0.00 ? 5   LEU A HD23 1  
ATOM 78    N N    . LYS A 1 6   ? 94.362  -5.996  3.396   1.00 0.00 ? 6   LYS A N    1  
ATOM 79    C CA   . LYS A 1 6   ? 94.399  -4.580  3.088   1.00 0.00 ? 6   LYS A CA   1  
ATOM 80    C C    . LYS A 1 6   ? 95.837  -4.093  3.013   1.00 0.00 ? 6   LYS A C    1  
ATOM 81    O O    . LYS A 1 6   ? 96.166  -3.205  2.228   1.00 0.00 ? 6   LYS A O    1  
ATOM 82    C CB   . LYS A 1 6   ? 93.617  -3.781  4.139   1.00 0.00 ? 6   LYS A CB   1  
ATOM 83    C CG   . LYS A 1 6   ? 92.108  -3.999  4.082   1.00 0.00 ? 6   LYS A CG   1  
ATOM 84    C CD   . LYS A 1 6   ? 91.375  -3.151  5.119   1.00 0.00 ? 6   LYS A CD   1  
ATOM 85    C CE   . LYS A 1 6   ? 89.863  -3.325  5.029   1.00 0.00 ? 6   LYS A CE   1  
ATOM 86    N NZ   . LYS A 1 6   ? 89.439  -4.729  5.285   1.00 0.00 ? 6   LYS A NZ   1  
ATOM 87    H H    . LYS A 1 6   ? 93.951  -6.295  4.224   1.00 0.00 ? 6   LYS A H    1  
ATOM 88    H HA   . LYS A 1 6   ? 93.928  -4.451  2.126   1.00 0.00 ? 6   LYS A HA   1  
ATOM 89    H HB2  . LYS A 1 6   ? 93.962  -4.073  5.122   1.00 0.00 ? 6   LYS A HB2  1  
ATOM 90    H HB3  . LYS A 1 6   ? 93.813  -2.727  3.997   1.00 0.00 ? 6   LYS A HB3  1  
ATOM 91    H HG2  . LYS A 1 6   ? 91.752  -3.732  3.097   1.00 0.00 ? 6   LYS A HG2  1  
ATOM 92    H HG3  . LYS A 1 6   ? 91.898  -5.043  4.270   1.00 0.00 ? 6   LYS A HG3  1  
ATOM 93    H HD2  . LYS A 1 6   ? 91.701  -3.447  6.107   1.00 0.00 ? 6   LYS A HD2  1  
ATOM 94    H HD3  . LYS A 1 6   ? 91.619  -2.110  4.957   1.00 0.00 ? 6   LYS A HD3  1  
ATOM 95    H HE2  . LYS A 1 6   ? 89.395  -2.682  5.759   1.00 0.00 ? 6   LYS A HE2  1  
ATOM 96    H HE3  . LYS A 1 6   ? 89.538  -3.037  4.039   1.00 0.00 ? 6   LYS A HE3  1  
ATOM 97    H HZ1  . LYS A 1 6   ? 89.760  -5.037  6.226   1.00 0.00 ? 6   LYS A HZ1  1  
ATOM 98    H HZ2  . LYS A 1 6   ? 89.841  -5.366  4.568   1.00 0.00 ? 6   LYS A HZ2  1  
ATOM 99    H HZ3  . LYS A 1 6   ? 88.404  -4.802  5.248   1.00 0.00 ? 6   LYS A HZ3  1  
ATOM 100   N N    . SER A 1 7   ? 96.688  -4.702  3.829   1.00 0.00 ? 7   SER A N    1  
ATOM 101   C CA   . SER A 1 7   ? 98.095  -4.347  3.891   1.00 0.00 ? 7   SER A CA   1  
ATOM 102   C C    . SER A 1 7   ? 98.782  -4.531  2.535   1.00 0.00 ? 7   SER A C    1  
ATOM 103   O O    . SER A 1 7   ? 99.476  -3.630  2.061   1.00 0.00 ? 7   SER A O    1  
ATOM 104   C CB   . SER A 1 7   ? 98.783  -5.184  4.966   1.00 0.00 ? 7   SER A CB   1  
ATOM 105   O OG   . SER A 1 7   ? 98.160  -4.989  6.222   1.00 0.00 ? 7   SER A OG   1  
ATOM 106   H H    . SER A 1 7   ? 96.354  -5.411  4.417   1.00 0.00 ? 7   SER A H    1  
ATOM 107   H HA   . SER A 1 7   ? 98.158  -3.304  4.171   1.00 0.00 ? 7   SER A HA   1  
ATOM 108   H HB2  . SER A 1 7   ? 98.721  -6.232  4.706   1.00 0.00 ? 7   SER A HB2  1  
ATOM 109   H HB3  . SER A 1 7   ? 99.819  -4.891  5.044   1.00 0.00 ? 7   SER A HB3  1  
ATOM 110   H HG   . SER A 1 7   ? 98.509  -4.183  6.627   1.00 0.00 ? 7   SER A HG   1  
ATOM 111   N N    . THR A 1 8   ? 98.577  -5.683  1.898   1.00 0.00 ? 8   THR A N    1  
ATOM 112   C CA   . THR A 1 8   ? 99.196  -5.944  0.603   1.00 0.00 ? 8   THR A CA   1  
ATOM 113   C C    . THR A 1 8   ? 98.663  -4.963  -0.438  1.00 0.00 ? 8   THR A C    1  
ATOM 114   O O    . THR A 1 8   ? 99.408  -4.484  -1.299  1.00 0.00 ? 8   THR A O    1  
ATOM 115   C CB   . THR A 1 8   ? 98.965  -7.401  0.138   1.00 0.00 ? 8   THR A CB   1  
ATOM 116   O OG1  . THR A 1 8   ? 97.566  -7.709  0.151   1.00 0.00 ? 8   THR A OG1  1  
ATOM 117   C CG2  . THR A 1 8   ? 99.716  -8.384  1.032   1.00 0.00 ? 8   THR A CG2  1  
ATOM 118   H H    . THR A 1 8   ? 97.989  -6.361  2.296   1.00 0.00 ? 8   THR A H    1  
ATOM 119   H HA   . THR A 1 8   ? 100.262 -5.787  0.710   1.00 0.00 ? 8   THR A HA   1  
ATOM 120   H HB   . THR A 1 8   ? 99.337  -7.505  -0.874  1.00 0.00 ? 8   THR A HB   1  
ATOM 121   H HG1  . THR A 1 8   ? 97.254  -7.813  -0.758  1.00 0.00 ? 8   THR A HG1  1  
ATOM 122   H HG21 . THR A 1 8   ? 100.776 -8.175  0.989   1.00 0.00 ? 8   THR A HG21 1  
ATOM 123   H HG22 . THR A 1 8   ? 99.535  -9.393  0.691   1.00 0.00 ? 8   THR A HG22 1  
ATOM 124   H HG23 . THR A 1 8   ? 99.371  -8.282  2.051   1.00 0.00 ? 8   THR A HG23 1  
ATOM 125   N N    . ALA A 1 9   ? 97.372  -4.646  -0.329  1.00 0.00 ? 9   ALA A N    1  
ATOM 126   C CA   . ALA A 1 9   ? 96.747  -3.650  -1.196  1.00 0.00 ? 9   ALA A CA   1  
ATOM 127   C C    . ALA A 1 9   ? 97.418  -2.286  -1.017  1.00 0.00 ? 9   ALA A C    1  
ATOM 128   O O    . ALA A 1 9   ? 97.638  -1.559  -1.987  1.00 0.00 ? 9   ALA A O    1  
ATOM 129   C CB   . ALA A 1 9   ? 95.251  -3.555  -0.907  1.00 0.00 ? 9   ALA A CB   1  
ATOM 130   H H    . ALA A 1 9   ? 96.824  -5.103  0.350   1.00 0.00 ? 9   ALA A H    1  
ATOM 131   H HA   . ALA A 1 9   ? 96.874  -3.974  -2.220  1.00 0.00 ? 9   ALA A HA   1  
ATOM 132   H HB1  . ALA A 1 9   ? 94.797  -2.841  -1.580  1.00 0.00 ? 9   ALA A HB1  1  
ATOM 133   H HB2  . ALA A 1 9   ? 95.099  -3.233  0.114   1.00 0.00 ? 9   ALA A HB2  1  
ATOM 134   H HB3  . ALA A 1 9   ? 94.794  -4.523  -1.049  1.00 0.00 ? 9   ALA A HB3  1  
ATOM 135   N N    . LYS A 1 10  ? 97.752  -1.962  0.232   1.00 0.00 ? 10  LYS A N    1  
ATOM 136   C CA   . LYS A 1 10  ? 98.424  -0.704  0.572   1.00 0.00 ? 10  LYS A CA   1  
ATOM 137   C C    . LYS A 1 10  ? 99.720  -0.536  -0.207  1.00 0.00 ? 10  LYS A C    1  
ATOM 138   O O    . LYS A 1 10  ? 99.895  0.413   -0.981  1.00 0.00 ? 10  LYS A O    1  
ATOM 139   C CB   . LYS A 1 10  ? 98.760  -0.673  2.071   1.00 0.00 ? 10  LYS A CB   1  
ATOM 140   C CG   . LYS A 1 10  ? 97.545  -0.543  2.982   1.00 0.00 ? 10  LYS A CG   1  
ATOM 141   C CD   . LYS A 1 10  ? 97.946  -0.509  4.455   1.00 0.00 ? 10  LYS A CD   1  
ATOM 142   C CE   . LYS A 1 10  ? 96.741  -0.299  5.366   1.00 0.00 ? 10  LYS A CE   1  
ATOM 143   N NZ   . LYS A 1 10  ? 96.060  0.997   5.103   1.00 0.00 ? 10  LYS A NZ   1  
ATOM 144   H H    . LYS A 1 10  ? 97.538  -2.592  0.953   1.00 0.00 ? 10  LYS A H    1  
ATOM 145   H HA   . LYS A 1 10  ? 97.756  0.113   0.341   1.00 0.00 ? 10  LYS A HA   1  
ATOM 146   H HB2  . LYS A 1 10  ? 99.283  -1.595  2.324   1.00 0.00 ? 10  LYS A HB2  1  
ATOM 147   H HB3  . LYS A 1 10  ? 99.420  0.161   2.263   1.00 0.00 ? 10  LYS A HB3  1  
ATOM 148   H HG2  . LYS A 1 10  ? 97.023  0.372   2.740   1.00 0.00 ? 10  LYS A HG2  1  
ATOM 149   H HG3  . LYS A 1 10  ? 96.891  -1.386  2.815   1.00 0.00 ? 10  LYS A HG3  1  
ATOM 150   H HD2  . LYS A 1 10  ? 98.419  -1.446  4.712   1.00 0.00 ? 10  LYS A HD2  1  
ATOM 151   H HD3  . LYS A 1 10  ? 98.646  0.301   4.608   1.00 0.00 ? 10  LYS A HD3  1  
ATOM 152   H HE2  . LYS A 1 10  ? 96.037  -1.103  5.204   1.00 0.00 ? 10  LYS A HE2  1  
ATOM 153   H HE3  . LYS A 1 10  ? 97.075  -0.317  6.394   1.00 0.00 ? 10  LYS A HE3  1  
ATOM 154   H HZ1  . LYS A 1 10  ? 95.656  1.004   4.142   1.00 0.00 ? 10  LYS A HZ1  1  
ATOM 155   H HZ2  . LYS A 1 10  ? 96.738  1.781   5.187   1.00 0.00 ? 10  LYS A HZ2  1  
ATOM 156   H HZ3  . LYS A 1 10  ? 95.294  1.146   5.789   1.00 0.00 ? 10  LYS A HZ3  1  
ATOM 157   N N    . TRP A 1 11  ? 100.625 -1.474  0.014   1.00 0.00 ? 11  TRP A N    1  
ATOM 158   C CA   . TRP A 1 11  ? 101.984 -1.373  -0.488  1.00 0.00 ? 11  TRP A CA   1  
ATOM 159   C C    . TRP A 1 11  ? 102.028 -1.519  -2.007  1.00 0.00 ? 11  TRP A C    1  
ATOM 160   O O    . TRP A 1 11  ? 102.859 -0.899  -2.670  1.00 0.00 ? 11  TRP A O    1  
ATOM 161   C CB   . TRP A 1 11  ? 102.857 -2.428  0.189   1.00 0.00 ? 11  TRP A CB   1  
ATOM 162   C CG   . TRP A 1 11  ? 102.686 -2.466  1.684   1.00 0.00 ? 11  TRP A CG   1  
ATOM 163   C CD1  . TRP A 1 11  ? 102.696 -1.408  2.550   1.00 0.00 ? 11  TRP A CD1  1  
ATOM 164   C CD2  . TRP A 1 11  ? 102.480 -3.630  2.482   1.00 0.00 ? 11  TRP A CD2  1  
ATOM 165   N NE1  . TRP A 1 11  ? 102.521 -1.855  3.839   1.00 0.00 ? 11  TRP A NE1  1  
ATOM 166   C CE2  . TRP A 1 11  ? 102.390 -3.217  3.820   1.00 0.00 ? 11  TRP A CE2  1  
ATOM 167   C CE3  . TRP A 1 11  ? 102.370 -4.981  2.186   1.00 0.00 ? 11  TRP A CE3  1  
ATOM 168   C CZ2  . TRP A 1 11  ? 102.197 -4.116  4.865   1.00 0.00 ? 11  TRP A CZ2  1  
ATOM 169   C CZ3  . TRP A 1 11  ? 102.176 -5.878  3.217   1.00 0.00 ? 11  TRP A CZ3  1  
ATOM 170   C CH2  . TRP A 1 11  ? 102.094 -5.443  4.545   1.00 0.00 ? 11  TRP A CH2  1  
ATOM 171   H H    . TRP A 1 11  ? 100.370 -2.264  0.540   1.00 0.00 ? 11  TRP A H    1  
ATOM 172   H HA   . TRP A 1 11  ? 102.359 -0.394  -0.225  1.00 0.00 ? 11  TRP A HA   1  
ATOM 173   H HB2  . TRP A 1 11  ? 102.603 -3.404  -0.202  1.00 0.00 ? 11  TRP A HB2  1  
ATOM 174   H HB3  . TRP A 1 11  ? 103.896 -2.220  -0.024  1.00 0.00 ? 11  TRP A HB3  1  
ATOM 175   H HD1  . TRP A 1 11  ? 102.825 -0.378  2.253   1.00 0.00 ? 11  TRP A HD1  1  
ATOM 176   H HE1  . TRP A 1 11  ? 102.498 -1.290  4.644   1.00 0.00 ? 11  TRP A HE1  1  
ATOM 177   H HE3  . TRP A 1 11  ? 102.418 -5.324  1.169   1.00 0.00 ? 11  TRP A HE3  1  
ATOM 178   H HZ2  . TRP A 1 11  ? 102.132 -3.793  5.892   1.00 0.00 ? 11  TRP A HZ2  1  
ATOM 179   H HZ3  . TRP A 1 11  ? 102.089 -6.931  3.002   1.00 0.00 ? 11  TRP A HZ3  1  
ATOM 180   H HH2  . TRP A 1 11  ? 101.942 -6.178  5.322   1.00 0.00 ? 11  TRP A HH2  1  
ATOM 181   N N    . ALA A 1 12  ? 101.125 -2.329  -2.560  1.00 0.00 ? 12  ALA A N    1  
ATOM 182   C CA   . ALA A 1 12  ? 101.037 -2.486  -4.011  1.00 0.00 ? 12  ALA A CA   1  
ATOM 183   C C    . ALA A 1 12  ? 100.143 -1.394  -4.620  1.00 0.00 ? 12  ALA A C    1  
ATOM 184   O O    . ALA A 1 12  ? 99.974  -1.331  -5.839  1.00 0.00 ? 12  ALA A O    1  
ATOM 185   C CB   . ALA A 1 12  ? 100.574 -3.902  -4.388  1.00 0.00 ? 12  ALA A CB   1  
ATOM 186   H H    . ALA A 1 12  ? 100.510 -2.833  -1.983  1.00 0.00 ? 12  ALA A H    1  
ATOM 187   H HA   . ALA A 1 12  ? 102.036 -2.354  -4.410  1.00 0.00 ? 12  ALA A HA   1  
ATOM 188   H HB1  . ALA A 1 12  ? 101.272 -4.626  -3.984  1.00 0.00 ? 12  ALA A HB1  1  
ATOM 189   H HB2  . ALA A 1 12  ? 100.547 -4.002  -5.464  1.00 0.00 ? 12  ALA A HB2  1  
ATOM 190   H HB3  . ALA A 1 12  ? 99.592  -4.095  -3.984  1.00 0.00 ? 12  ALA A HB3  1  
ATOM 191   N N    . ALA A 1 13  ? 99.579  -0.526  -3.762  1.00 0.00 ? 13  ALA A N    1  
ATOM 192   C CA   . ALA A 1 13  ? 98.884  0.680   -4.229  1.00 0.00 ? 13  ALA A CA   1  
ATOM 193   C C    . ALA A 1 13  ? 99.909  1.732   -4.624  1.00 0.00 ? 13  ALA A C    1  
ATOM 194   O O    . ALA A 1 13  ? 99.905  2.232   -5.753  1.00 0.00 ? 13  ALA A O    1  
ATOM 195   C CB   . ALA A 1 13  ? 97.941  1.260   -3.165  1.00 0.00 ? 13  ALA A CB   1  
ATOM 196   H H    . ALA A 1 13  ? 99.629  -0.707  -2.800  1.00 0.00 ? 13  ALA A H    1  
ATOM 197   H HA   . ALA A 1 13  ? 98.297  0.415   -5.099  1.00 0.00 ? 13  ALA A HA   1  
ATOM 198   H HB1  . ALA A 1 13  ? 97.476  2.160   -3.550  1.00 0.00 ? 13  ALA A HB1  1  
ATOM 199   H HB2  . ALA A 1 13  ? 98.501  1.506   -2.273  1.00 0.00 ? 13  ALA A HB2  1  
ATOM 200   H HB3  . ALA A 1 13  ? 97.171  0.543   -2.920  1.00 0.00 ? 13  ALA A HB3  1  
ATOM 201   N N    . SER A 1 14  ? 100.795 2.059   -3.686  1.00 0.00 ? 14  SER A N    1  
ATOM 202   C CA   . SER A 1 14  ? 101.820 3.066   -3.911  1.00 0.00 ? 14  SER A CA   1  
ATOM 203   C C    . SER A 1 14  ? 103.044 2.784   -3.045  1.00 0.00 ? 14  SER A C    1  
ATOM 204   O O    . SER A 1 14  ? 102.918 2.384   -1.882  1.00 0.00 ? 14  SER A O    1  
ATOM 205   C CB   . SER A 1 14  ? 101.264 4.466   -3.615  1.00 0.00 ? 14  SER A CB   1  
ATOM 206   O OG   . SER A 1 14  ? 100.132 4.748   -4.424  1.00 0.00 ? 14  SER A OG   1  
ATOM 207   H H    . SER A 1 14  ? 100.764 1.603   -2.816  1.00 0.00 ? 14  SER A H    1  
ATOM 208   H HA   . SER A 1 14  ? 102.114 3.014   -4.949  1.00 0.00 ? 14  SER A HA   1  
ATOM 209   H HB2  . SER A 1 14  ? 100.969 4.523   -2.576  1.00 0.00 ? 14  SER A HB2  1  
ATOM 210   H HB3  . SER A 1 14  ? 102.025 5.206   -3.813  1.00 0.00 ? 14  SER A HB3  1  
ATOM 211   H HG   . SER A 1 14  ? 100.175 4.216   -5.229  1.00 0.00 ? 14  SER A HG   1  
ATOM 212   N N    . LEU A 1 15  ? 104.222 3.002   -3.622  1.00 0.00 ? 15  LEU A N    1  
ATOM 213   C CA   . LEU A 1 15  ? 105.486 2.766   -2.938  1.00 0.00 ? 15  LEU A CA   1  
ATOM 214   C C    . LEU A 1 15  ? 105.582 3.640   -1.691  1.00 0.00 ? 15  LEU A C    1  
ATOM 215   O O    . LEU A 1 15  ? 106.234 3.274   -0.714  1.00 0.00 ? 15  LEU A O    1  
ATOM 216   C CB   . LEU A 1 15  ? 106.662 3.048   -3.888  1.00 0.00 ? 15  LEU A CB   1  
ATOM 217   C CG   . LEU A 1 15  ? 108.063 2.748   -3.325  1.00 0.00 ? 15  LEU A CG   1  
ATOM 218   C CD1  . LEU A 1 15  ? 108.198 1.271   -2.957  1.00 0.00 ? 15  LEU A CD1  1  
ATOM 219   C CD2  . LEU A 1 15  ? 109.144 3.157   -4.325  1.00 0.00 ? 15  LEU A CD2  1  
ATOM 220   H H    . LEU A 1 15  ? 104.242 3.338   -4.545  1.00 0.00 ? 15  LEU A H    1  
ATOM 221   H HA   . LEU A 1 15  ? 105.514 1.727   -2.640  1.00 0.00 ? 15  LEU A HA   1  
ATOM 222   H HB2  . LEU A 1 15  ? 106.522 2.455   -4.782  1.00 0.00 ? 15  LEU A HB2  1  
ATOM 223   H HB3  . LEU A 1 15  ? 106.626 4.093   -4.166  1.00 0.00 ? 15  LEU A HB3  1  
ATOM 224   H HG   . LEU A 1 15  ? 108.210 3.326   -2.423  1.00 0.00 ? 15  LEU A HG   1  
ATOM 225   H HD11 . LEU A 1 15  ? 109.186 1.086   -2.559  1.00 0.00 ? 15  LEU A HD11 1  
ATOM 226   H HD12 . LEU A 1 15  ? 108.046 0.662   -3.837  1.00 0.00 ? 15  LEU A HD12 1  
ATOM 227   H HD13 . LEU A 1 15  ? 107.459 1.016   -2.212  1.00 0.00 ? 15  LEU A HD13 1  
ATOM 228   H HD21 . LEU A 1 15  ? 109.056 4.213   -4.539  1.00 0.00 ? 15  LEU A HD21 1  
ATOM 229   H HD22 . LEU A 1 15  ? 109.024 2.594   -5.240  1.00 0.00 ? 15  LEU A HD22 1  
ATOM 230   H HD23 . LEU A 1 15  ? 110.119 2.956   -3.906  1.00 0.00 ? 15  LEU A HD23 1  
ATOM 231   N N    . GLU A 1 16  ? 104.905 4.787   -1.724  1.00 0.00 ? 16  GLU A N    1  
ATOM 232   C CA   . GLU A 1 16  ? 104.888 5.689   -0.578  1.00 0.00 ? 16  GLU A CA   1  
ATOM 233   C C    . GLU A 1 16  ? 104.202 5.014   0.606   1.00 0.00 ? 16  GLU A C    1  
ATOM 234   O O    . GLU A 1 16  ? 104.695 5.076   1.729   1.00 0.00 ? 16  GLU A O    1  
ATOM 235   C CB   . GLU A 1 16  ? 104.189 7.015   -0.910  1.00 0.00 ? 16  GLU A CB   1  
ATOM 236   C CG   . GLU A 1 16  ? 104.183 7.998   0.261   1.00 0.00 ? 16  GLU A CG   1  
ATOM 237   C CD   . GLU A 1 16  ? 103.568 9.341   -0.088  1.00 0.00 ? 16  GLU A CD   1  
ATOM 238   O OE1  . GLU A 1 16  ? 102.338 9.498   0.065   1.00 0.00 ? 16  GLU A OE1  1  
ATOM 239   O OE2  . GLU A 1 16  ? 104.313 10.249  -0.513  1.00 0.00 ? 16  GLU A OE2  1  
ATOM 240   H H    . GLU A 1 16  ? 104.408 5.027   -2.537  1.00 0.00 ? 16  GLU A H    1  
ATOM 241   H HA   . GLU A 1 16  ? 105.916 5.894   -0.309  1.00 0.00 ? 16  GLU A HA   1  
ATOM 242   H HB2  . GLU A 1 16  ? 104.698 7.480   -1.743  1.00 0.00 ? 16  GLU A HB2  1  
ATOM 243   H HB3  . GLU A 1 16  ? 103.165 6.813   -1.191  1.00 0.00 ? 16  GLU A HB3  1  
ATOM 244   H HG2  . GLU A 1 16  ? 103.618 7.563   1.074   1.00 0.00 ? 16  GLU A HG2  1  
ATOM 245   H HG3  . GLU A 1 16  ? 105.202 8.157   0.585   1.00 0.00 ? 16  GLU A HG3  1  
ATOM 246   N N    . ASN A 1 17  ? 103.072 4.350   0.339   1.00 0.00 ? 17  ASN A N    1  
ATOM 247   C CA   . ASN A 1 17  ? 102.356 3.605   1.368   1.00 0.00 ? 17  ASN A CA   1  
ATOM 248   C C    . ASN A 1 17  ? 103.287 2.597   2.016   1.00 0.00 ? 17  ASN A C    1  
ATOM 249   O O    . ASN A 1 17  ? 103.321 2.453   3.235   1.00 0.00 ? 17  ASN A O    1  
ATOM 250   C CB   . ASN A 1 17  ? 101.159 2.864   0.767   1.00 0.00 ? 17  ASN A CB   1  
ATOM 251   C CG   . ASN A 1 17  ? 100.076 3.786   0.238   1.00 0.00 ? 17  ASN A CG   1  
ATOM 252   O OD1  . ASN A 1 17  ? 99.912  4.913   0.705   1.00 0.00 ? 17  ASN A OD1  1  
ATOM 253   N ND2  . ASN A 1 17  ? 99.315  3.297   -0.729  1.00 0.00 ? 17  ASN A ND2  1  
ATOM 254   H H    . ASN A 1 17  ? 102.718 4.352   -0.571  1.00 0.00 ? 17  ASN A H    1  
ATOM 255   H HA   . ASN A 1 17  ? 102.008 4.304   2.116   1.00 0.00 ? 17  ASN A HA   1  
ATOM 256   H HB2  . ASN A 1 17  ? 101.505 2.248   -0.051  1.00 0.00 ? 17  ASN A HB2  1  
ATOM 257   H HB3  . ASN A 1 17  ? 100.730 2.230   1.519   1.00 0.00 ? 17  ASN A HB3  1  
ATOM 258   H HD21 . ASN A 1 17  ? 99.492  2.381   -1.037  1.00 0.00 ? 17  ASN A HD21 1  
ATOM 259   H HD22 . ASN A 1 17  ? 98.604  3.868   -1.097  1.00 0.00 ? 17  ASN A HD22 1  
ATOM 260   N N    . LEU A 1 18  ? 104.040 1.906   1.171   1.00 0.00 ? 18  LEU A N    1  
ATOM 261   C CA   . LEU A 1 18  ? 105.027 0.928   1.620   1.00 0.00 ? 18  LEU A CA   1  
ATOM 262   C C    . LEU A 1 18  ? 106.068 1.598   2.521   1.00 0.00 ? 18  LEU A C    1  
ATOM 263   O O    . LEU A 1 18  ? 106.338 1.133   3.628   1.00 0.00 ? 18  LEU A O    1  
ATOM 264   C CB   . LEU A 1 18  ? 105.692 0.273   0.391   1.00 0.00 ? 18  LEU A CB   1  
ATOM 265   C CG   . LEU A 1 18  ? 106.519 -1.005  0.648   1.00 0.00 ? 18  LEU A CG   1  
ATOM 266   C CD1  . LEU A 1 18  ? 106.832 -1.707  -0.672  1.00 0.00 ? 18  LEU A CD1  1  
ATOM 267   C CD2  . LEU A 1 18  ? 107.816 -0.694  1.397   1.00 0.00 ? 18  LEU A CD2  1  
ATOM 268   H H    . LEU A 1 18  ? 103.918 2.053   0.205   1.00 0.00 ? 18  LEU A H    1  
ATOM 269   H HA   . LEU A 1 18  ? 104.511 0.169   2.187   1.00 0.00 ? 18  LEU A HA   1  
ATOM 270   H HB2  . LEU A 1 18  ? 104.911 0.026   -0.315  1.00 0.00 ? 18  LEU A HB2  1  
ATOM 271   H HB3  . LEU A 1 18  ? 106.341 1.005   -0.071  1.00 0.00 ? 18  LEU A HB3  1  
ATOM 272   H HG   . LEU A 1 18  ? 105.938 -1.686  1.255   1.00 0.00 ? 18  LEU A HG   1  
ATOM 273   H HD11 . LEU A 1 18  ? 107.396 -2.608  -0.477  1.00 0.00 ? 18  LEU A HD11 1  
ATOM 274   H HD12 . LEU A 1 18  ? 107.412 -1.049  -1.303  1.00 0.00 ? 18  LEU A HD12 1  
ATOM 275   H HD13 . LEU A 1 18  ? 105.909 -1.963  -1.172  1.00 0.00 ? 18  LEU A HD13 1  
ATOM 276   H HD21 . LEU A 1 18  ? 107.583 -0.272  2.363   1.00 0.00 ? 18  LEU A HD21 1  
ATOM 277   H HD22 . LEU A 1 18  ? 108.403 0.013   0.828   1.00 0.00 ? 18  LEU A HD22 1  
ATOM 278   H HD23 . LEU A 1 18  ? 108.381 -1.604  1.531   1.00 0.00 ? 18  LEU A HD23 1  
ATOM 279   N N    . LEU A 1 19  ? 106.630 2.702   2.043   1.00 0.00 ? 19  LEU A N    1  
ATOM 280   C CA   . LEU A 1 19  ? 107.699 3.406   2.752   1.00 0.00 ? 19  LEU A CA   1  
ATOM 281   C C    . LEU A 1 19  ? 107.145 4.303   3.864   1.00 0.00 ? 19  LEU A C    1  
ATOM 282   O O    . LEU A 1 19  ? 107.895 5.035   4.515   1.00 0.00 ? 19  LEU A O    1  
ATOM 283   C CB   . LEU A 1 19  ? 108.522 4.234   1.754   1.00 0.00 ? 19  LEU A CB   1  
ATOM 284   C CG   . LEU A 1 19  ? 109.215 3.417   0.647   1.00 0.00 ? 19  LEU A CG   1  
ATOM 285   C CD1  . LEU A 1 19  ? 109.895 4.337   -0.364  1.00 0.00 ? 19  LEU A CD1  1  
ATOM 286   C CD2  . LEU A 1 19  ? 110.223 2.436   1.247   1.00 0.00 ? 19  LEU A CD2  1  
ATOM 287   H H    . LEU A 1 19  ? 106.321 3.055   1.182   1.00 0.00 ? 19  LEU A H    1  
ATOM 288   H HA   . LEU A 1 19  ? 108.343 2.662   3.201   1.00 0.00 ? 19  LEU A HA   1  
ATOM 289   H HB2  . LEU A 1 19  ? 107.863 4.953   1.286   1.00 0.00 ? 19  LEU A HB2  1  
ATOM 290   H HB3  . LEU A 1 19  ? 109.282 4.772   2.303   1.00 0.00 ? 19  LEU A HB3  1  
ATOM 291   H HG   . LEU A 1 19  ? 108.468 2.842   0.117   1.00 0.00 ? 19  LEU A HG   1  
ATOM 292   H HD11 . LEU A 1 19  ? 110.358 3.742   -1.138  1.00 0.00 ? 19  LEU A HD11 1  
ATOM 293   H HD12 . LEU A 1 19  ? 110.649 4.929   0.133   1.00 0.00 ? 19  LEU A HD12 1  
ATOM 294   H HD13 . LEU A 1 19  ? 109.159 4.991   -0.808  1.00 0.00 ? 19  LEU A HD13 1  
ATOM 295   H HD21 . LEU A 1 19  ? 110.977 2.980   1.797   1.00 0.00 ? 19  LEU A HD21 1  
ATOM 296   H HD22 . LEU A 1 19  ? 110.693 1.872   0.454   1.00 0.00 ? 19  LEU A HD22 1  
ATOM 297   H HD23 . LEU A 1 19  ? 109.711 1.756   1.913   1.00 0.00 ? 19  LEU A HD23 1  
ATOM 298   N N    . GLU A 1 20  ? 105.833 4.252   4.069   1.00 0.00 ? 20  GLU A N    1  
ATOM 299   C CA   . GLU A 1 20  ? 105.179 5.012   5.134   1.00 0.00 ? 20  GLU A CA   1  
ATOM 300   C C    . GLU A 1 20  ? 104.727 4.075   6.252   1.00 0.00 ? 20  GLU A C    1  
ATOM 301   O O    . GLU A 1 20  ? 105.015 4.304   7.430   1.00 0.00 ? 20  GLU A O    1  
ATOM 302   C CB   . GLU A 1 20  ? 103.977 5.780   4.569   1.00 0.00 ? 20  GLU A CB   1  
ATOM 303   C CG   . GLU A 1 20  ? 103.201 6.578   5.610   1.00 0.00 ? 20  GLU A CG   1  
ATOM 304   C CD   . GLU A 1 20  ? 102.011 7.309   5.013   1.00 0.00 ? 20  GLU A CD   1  
ATOM 305   O OE1  . GLU A 1 20  ? 100.925 6.695   4.906   1.00 0.00 ? 20  GLU A OE1  1  
ATOM 306   O OE2  . GLU A 1 20  ? 102.154 8.496   4.645   1.00 0.00 ? 20  GLU A OE2  1  
ATOM 307   H H    . GLU A 1 20  ? 105.285 3.692   3.483   1.00 0.00 ? 20  GLU A H    1  
ATOM 308   H HA   . GLU A 1 20  ? 105.894 5.719   5.535   1.00 0.00 ? 20  GLU A HA   1  
ATOM 309   H HB2  . GLU A 1 20  ? 104.329 6.465   3.811   1.00 0.00 ? 20  GLU A HB2  1  
ATOM 310   H HB3  . GLU A 1 20  ? 103.298 5.073   4.110   1.00 0.00 ? 20  GLU A HB3  1  
ATOM 311   H HG2  . GLU A 1 20  ? 102.845 5.901   6.374   1.00 0.00 ? 20  GLU A HG2  1  
ATOM 312   H HG3  . GLU A 1 20  ? 103.866 7.304   6.059   1.00 0.00 ? 20  GLU A HG3  1  
ATOM 313   N N    . ASP A 1 21  ? 104.031 3.011   5.865   1.00 0.00 ? 21  ASP A N    1  
ATOM 314   C CA   . ASP A 1 21  ? 103.505 2.033   6.813   1.00 0.00 ? 21  ASP A CA   1  
ATOM 315   C C    . ASP A 1 21  ? 104.641 1.195   7.396   1.00 0.00 ? 21  ASP A C    1  
ATOM 316   O O    . ASP A 1 21  ? 105.400 0.572   6.649   1.00 0.00 ? 21  ASP A O    1  
ATOM 317   C CB   . ASP A 1 21  ? 102.472 1.127   6.124   1.00 0.00 ? 21  ASP A CB   1  
ATOM 318   C CG   . ASP A 1 21  ? 101.956 0.017   7.032   1.00 0.00 ? 21  ASP A CG   1  
ATOM 319   O OD1  . ASP A 1 21  ? 101.206 0.319   7.986   1.00 0.00 ? 21  ASP A OD1  1  
ATOM 320   O OD2  . ASP A 1 21  ? 102.284 -1.162  6.787   1.00 0.00 ? 21  ASP A OD2  1  
ATOM 321   H H    . ASP A 1 21  ? 103.884 2.867   4.910   1.00 0.00 ? 21  ASP A H    1  
ATOM 322   H HA   . ASP A 1 21  ? 103.018 2.576   7.611   1.00 0.00 ? 21  ASP A HA   1  
ATOM 323   H HB2  . ASP A 1 21  ? 101.630 1.727   5.810   1.00 0.00 ? 21  ASP A HB2  1  
ATOM 324   H HB3  . ASP A 1 21  ? 102.926 0.675   5.252   1.00 0.00 ? 21  ASP A HB3  1  
ATOM 325   N N    . PRO A 1 22  ? 104.779 1.174   8.738   1.00 0.00 ? 22  PRO A N    1  
ATOM 326   C CA   . PRO A 1 22  ? 105.852 0.437   9.415   1.00 0.00 ? 22  PRO A CA   1  
ATOM 327   C C    . PRO A 1 22  ? 105.930 -1.016  8.951   1.00 0.00 ? 22  PRO A C    1  
ATOM 328   O O    . PRO A 1 22  ? 106.989 -1.482  8.534   1.00 0.00 ? 22  PRO A O    1  
ATOM 329   C CB   . PRO A 1 22  ? 105.482 0.523   10.910  1.00 0.00 ? 22  PRO A CB   1  
ATOM 330   C CG   . PRO A 1 22  ? 104.076 1.034   10.946  1.00 0.00 ? 22  PRO A CG   1  
ATOM 331   C CD   . PRO A 1 22  ? 103.906 1.861   9.703   1.00 0.00 ? 22  PRO A CD   1  
ATOM 332   H HA   . PRO A 1 22  ? 106.811 0.911   9.252   1.00 0.00 ? 22  PRO A HA   1  
ATOM 333   H HB2  . PRO A 1 22  ? 105.557 -0.456  11.364  1.00 0.00 ? 22  PRO A HB2  1  
ATOM 334   H HB3  . PRO A 1 22  ? 106.158 1.203   11.411  1.00 0.00 ? 22  PRO A HB3  1  
ATOM 335   H HG2  . PRO A 1 22  ? 103.382 0.203   10.942  1.00 0.00 ? 22  PRO A HG2  1  
ATOM 336   H HG3  . PRO A 1 22  ? 103.927 1.642   11.827  1.00 0.00 ? 22  PRO A HG3  1  
ATOM 337   H HD2  . PRO A 1 22  ? 102.875 1.848   9.375   1.00 0.00 ? 22  PRO A HD2  1  
ATOM 338   H HD3  . PRO A 1 22  ? 104.238 2.876   9.871   1.00 0.00 ? 22  PRO A HD3  1  
ATOM 339   N N    . GLU A 1 23  ? 104.793 -1.712  9.001   1.00 0.00 ? 23  GLU A N    1  
ATOM 340   C CA   . GLU A 1 23  ? 104.721 -3.118  8.599   1.00 0.00 ? 23  GLU A CA   1  
ATOM 341   C C    . GLU A 1 23  ? 105.158 -3.295  7.152   1.00 0.00 ? 23  GLU A C    1  
ATOM 342   O O    . GLU A 1 23  ? 105.735 -4.324  6.790   1.00 0.00 ? 23  GLU A O    1  
ATOM 343   C CB   . GLU A 1 23  ? 103.302 -3.658  8.800   1.00 0.00 ? 23  GLU A CB   1  
ATOM 344   C CG   . GLU A 1 23  ? 102.973 -3.969  10.253  1.00 0.00 ? 23  GLU A CG   1  
ATOM 345   C CD   . GLU A 1 23  ? 103.751 -5.166  10.778  1.00 0.00 ? 23  GLU A CD   1  
ATOM 346   O OE1  . GLU A 1 23  ? 103.376 -6.314  10.448  1.00 0.00 ? 23  GLU A OE1  1  
ATOM 347   O OE2  . GLU A 1 23  ? 104.736 -4.965  11.521  1.00 0.00 ? 23  GLU A OE2  1  
ATOM 348   H H    . GLU A 1 23  ? 103.976 -1.264  9.304   1.00 0.00 ? 23  GLU A H    1  
ATOM 349   H HA   . GLU A 1 23  ? 105.399 -3.674  9.232   1.00 0.00 ? 23  GLU A HA   1  
ATOM 350   H HB2  . GLU A 1 23  ? 102.594 -2.923  8.441   1.00 0.00 ? 23  GLU A HB2  1  
ATOM 351   H HB3  . GLU A 1 23  ? 103.185 -4.566  8.224   1.00 0.00 ? 23  GLU A HB3  1  
ATOM 352   H HG2  . GLU A 1 23  ? 103.210 -3.104  10.858  1.00 0.00 ? 23  GLU A HG2  1  
ATOM 353   H HG3  . GLU A 1 23  ? 101.916 -4.180  10.333  1.00 0.00 ? 23  GLU A HG3  1  
ATOM 354   N N    . GLY A 1 24  ? 104.879 -2.289  6.332   1.00 0.00 ? 24  GLY A N    1  
ATOM 355   C CA   . GLY A 1 24  ? 105.357 -2.289  4.966   1.00 0.00 ? 24  GLY A CA   1  
ATOM 356   C C    . GLY A 1 24  ? 106.861 -2.373  4.915   1.00 0.00 ? 24  GLY A C    1  
ATOM 357   O O    . GLY A 1 24  ? 107.419 -3.313  4.356   1.00 0.00 ? 24  GLY A O    1  
ATOM 358   H H    . GLY A 1 24  ? 104.334 -1.540  6.658   1.00 0.00 ? 24  GLY A H    1  
ATOM 359   H HA2  . GLY A 1 24  ? 104.934 -3.135  4.442   1.00 0.00 ? 24  GLY A HA2  1  
ATOM 360   H HA3  . GLY A 1 24  ? 105.038 -1.379  4.482   1.00 0.00 ? 24  GLY A HA3  1  
ATOM 361   N N    . VAL A 1 25  ? 107.512 -1.405  5.544   1.00 0.00 ? 25  VAL A N    1  
ATOM 362   C CA   . VAL A 1 25  ? 108.968 -1.356  5.595   1.00 0.00 ? 25  VAL A CA   1  
ATOM 363   C C    . VAL A 1 25  ? 109.538 -2.613  6.262   1.00 0.00 ? 25  VAL A C    1  
ATOM 364   O O    . VAL A 1 25  ? 110.626 -3.077  5.909   1.00 0.00 ? 25  VAL A O    1  
ATOM 365   C CB   . VAL A 1 25  ? 109.457 -0.097  6.353   1.00 0.00 ? 25  VAL A CB   1  
ATOM 366   C CG1  . VAL A 1 25  ? 110.980 -0.061  6.417   1.00 0.00 ? 25  VAL A CG1  1  
ATOM 367   C CG2  . VAL A 1 25  ? 108.910 1.173   5.699   1.00 0.00 ? 25  VAL A CG2  1  
ATOM 368   H H    . VAL A 1 25  ? 106.995 -0.695  5.986   1.00 0.00 ? 25  VAL A H    1  
ATOM 369   H HA   . VAL A 1 25  ? 109.333 -1.304  4.578   1.00 0.00 ? 25  VAL A HA   1  
ATOM 370   H HB   . VAL A 1 25  ? 109.080 -0.143  7.366   1.00 0.00 ? 25  VAL A HB   1  
ATOM 371   H HG11 . VAL A 1 25  ? 111.341 -0.931  6.948   1.00 0.00 ? 25  VAL A HG11 1  
ATOM 372   H HG12 . VAL A 1 25  ? 111.301 0.832   6.935   1.00 0.00 ? 25  VAL A HG12 1  
ATOM 373   H HG13 . VAL A 1 25  ? 111.385 -0.060  5.414   1.00 0.00 ? 25  VAL A HG13 1  
ATOM 374   H HG21 . VAL A 1 25  ? 107.830 1.154   5.720   1.00 0.00 ? 25  VAL A HG21 1  
ATOM 375   H HG22 . VAL A 1 25  ? 109.247 1.225   4.673   1.00 0.00 ? 25  VAL A HG22 1  
ATOM 376   H HG23 . VAL A 1 25  ? 109.265 2.040   6.238   1.00 0.00 ? 25  VAL A HG23 1  
ATOM 377   N N    . LYS A 1 26  ? 108.799 -3.166  7.221   1.00 0.00 ? 26  LYS A N    1  
ATOM 378   C CA   . LYS A 1 26  ? 109.232 -4.375  7.917   1.00 0.00 ? 26  LYS A CA   1  
ATOM 379   C C    . LYS A 1 26  ? 109.227 -5.573  6.963   1.00 0.00 ? 26  LYS A C    1  
ATOM 380   O O    . LYS A 1 26  ? 110.284 -6.065  6.564   1.00 0.00 ? 26  LYS A O    1  
ATOM 381   C CB   . LYS A 1 26  ? 108.332 -4.676  9.131   1.00 0.00 ? 26  LYS A CB   1  
ATOM 382   C CG   . LYS A 1 26  ? 108.298 -3.593  10.217  1.00 0.00 ? 26  LYS A CG   1  
ATOM 383   C CD   . LYS A 1 26  ? 109.686 -3.244  10.766  1.00 0.00 ? 26  LYS A CD   1  
ATOM 384   C CE   . LYS A 1 26  ? 110.259 -1.974  10.136  1.00 0.00 ? 26  LYS A CE   1  
ATOM 385   N NZ   . LYS A 1 26  ? 111.655 -1.712  10.580  1.00 0.00 ? 26  LYS A NZ   1  
ATOM 386   H H    . LYS A 1 26  ? 107.942 -2.754  7.461   1.00 0.00 ? 26  LYS A H    1  
ATOM 387   H HA   . LYS A 1 26  ? 110.243 -4.212  8.264   1.00 0.00 ? 26  LYS A HA   1  
ATOM 388   H HB2  . LYS A 1 26  ? 107.320 -4.820  8.778   1.00 0.00 ? 26  LYS A HB2  1  
ATOM 389   H HB3  . LYS A 1 26  ? 108.670 -5.596  9.587   1.00 0.00 ? 26  LYS A HB3  1  
ATOM 390   H HG2  . LYS A 1 26  ? 107.855 -2.701  9.802   1.00 0.00 ? 26  LYS A HG2  1  
ATOM 391   H HG3  . LYS A 1 26  ? 107.680 -3.946  11.032  1.00 0.00 ? 26  LYS A HG3  1  
ATOM 392   H HD2  . LYS A 1 26  ? 109.611 -3.093  11.834  1.00 0.00 ? 26  LYS A HD2  1  
ATOM 393   H HD3  . LYS A 1 26  ? 110.360 -4.066  10.569  1.00 0.00 ? 26  LYS A HD3  1  
ATOM 394   H HE2  . LYS A 1 26  ? 110.249 -2.083  9.061   1.00 0.00 ? 26  LYS A HE2  1  
ATOM 395   H HE3  . LYS A 1 26  ? 109.638 -1.135  10.417  1.00 0.00 ? 26  LYS A HE3  1  
ATOM 396   H HZ1  . LYS A 1 26  ? 112.288 -2.463  10.231  1.00 0.00 ? 26  LYS A HZ1  1  
ATOM 397   H HZ2  . LYS A 1 26  ? 111.704 -1.690  11.616  1.00 0.00 ? 26  LYS A HZ2  1  
ATOM 398   H HZ3  . LYS A 1 26  ? 111.985 -0.797  10.212  1.00 0.00 ? 26  LYS A HZ3  1  
ATOM 399   N N    . ARG A 1 27  ? 108.028 -6.000  6.570   1.00 0.00 ? 27  ARG A N    1  
ATOM 400   C CA   . ARG A 1 27  ? 107.845 -7.224  5.786   1.00 0.00 ? 27  ARG A CA   1  
ATOM 401   C C    . ARG A 1 27  ? 108.506 -7.112  4.407   1.00 0.00 ? 27  ARG A C    1  
ATOM 402   O O    . ARG A 1 27  ? 109.026 -8.099  3.875   1.00 0.00 ? 27  ARG A O    1  
ATOM 403   C CB   . ARG A 1 27  ? 106.344 -7.547  5.662   1.00 0.00 ? 27  ARG A CB   1  
ATOM 404   C CG   . ARG A 1 27  ? 105.664 -7.736  7.021   1.00 0.00 ? 27  ARG A CG   1  
ATOM 405   C CD   . ARG A 1 27  ? 104.172 -8.060  6.918   1.00 0.00 ? 27  ARG A CD   1  
ATOM 406   N NE   . ARG A 1 27  ? 103.586 -8.279  8.246   1.00 0.00 ? 27  ARG A NE   1  
ATOM 407   C CZ   . ARG A 1 27  ? 102.554 -9.084  8.496   1.00 0.00 ? 27  ARG A CZ   1  
ATOM 408   N NH1  . ARG A 1 27  ? 101.930 -9.706  7.502   1.00 0.00 ? 27  ARG A NH1  1  
ATOM 409   N NH2  . ARG A 1 27  ? 102.143 -9.257  9.745   1.00 0.00 ? 27  ARG A NH2  1  
ATOM 410   H H    . ARG A 1 27  ? 107.238 -5.468  6.806   1.00 0.00 ? 27  ARG A H    1  
ATOM 411   H HA   . ARG A 1 27  ? 108.325 -8.028  6.328   1.00 0.00 ? 27  ARG A HA   1  
ATOM 412   H HB2  . ARG A 1 27  ? 105.852 -6.737  5.140   1.00 0.00 ? 27  ARG A HB2  1  
ATOM 413   H HB3  . ARG A 1 27  ? 106.226 -8.459  5.091   1.00 0.00 ? 27  ARG A HB3  1  
ATOM 414   H HG2  . ARG A 1 27  ? 106.152 -8.548  7.540   1.00 0.00 ? 27  ARG A HG2  1  
ATOM 415   H HG3  . ARG A 1 27  ? 105.783 -6.827  7.596   1.00 0.00 ? 27  ARG A HG3  1  
ATOM 416   H HD2  . ARG A 1 27  ? 103.660 -7.234  6.441   1.00 0.00 ? 27  ARG A HD2  1  
ATOM 417   H HD3  . ARG A 1 27  ? 104.042 -8.954  6.324   1.00 0.00 ? 27  ARG A HD3  1  
ATOM 418   H HE   . ARG A 1 27  ? 104.005 -7.803  9.004   1.00 0.00 ? 27  ARG A HE   1  
ATOM 419   H HH11 . ARG A 1 27  ? 102.236 -9.579  6.560   1.00 0.00 ? 27  ARG A HH11 1  
ATOM 420   H HH12 . ARG A 1 27  ? 101.141 -10.296 7.694   1.00 0.00 ? 27  ARG A HH12 1  
ATOM 421   H HH21 . ARG A 1 27  ? 102.615 -8.782  10.500  1.00 0.00 ? 27  ARG A HH21 1  
ATOM 422   H HH22 . ARG A 1 27  ? 101.372 -9.869  9.946   1.00 0.00 ? 27  ARG A HH22 1  
ATOM 423   N N    . PHE A 1 28  ? 108.498 -5.908  3.841   1.00 0.00 ? 28  PHE A N    1  
ATOM 424   C CA   . PHE A 1 28  ? 109.152 -5.660  2.557   1.00 0.00 ? 28  PHE A CA   1  
ATOM 425   C C    . PHE A 1 28  ? 110.662 -5.807  2.691   1.00 0.00 ? 28  PHE A C    1  
ATOM 426   O O    . PHE A 1 28  ? 111.320 -6.351  1.796   1.00 0.00 ? 28  PHE A O    1  
ATOM 427   C CB   . PHE A 1 28  ? 108.789 -4.268  2.026   1.00 0.00 ? 28  PHE A CB   1  
ATOM 428   C CG   . PHE A 1 28  ? 109.631 -3.789  0.867   1.00 0.00 ? 28  PHE A CG   1  
ATOM 429   C CD1  . PHE A 1 28  ? 109.514 -4.365  -0.391  1.00 0.00 ? 28  PHE A CD1  1  
ATOM 430   C CD2  . PHE A 1 28  ? 110.526 -2.740  1.036   1.00 0.00 ? 28  PHE A CD2  1  
ATOM 431   C CE1  . PHE A 1 28  ? 110.271 -3.904  -1.452  1.00 0.00 ? 28  PHE A CE1  1  
ATOM 432   C CE2  . PHE A 1 28  ? 111.285 -2.279  -0.019  1.00 0.00 ? 28  PHE A CE2  1  
ATOM 433   C CZ   . PHE A 1 28  ? 111.157 -2.860  -1.265  1.00 0.00 ? 28  PHE A CZ   1  
ATOM 434   H H    . PHE A 1 28  ? 108.044 -5.167  4.297   1.00 0.00 ? 28  PHE A H    1  
ATOM 435   H HA   . PHE A 1 28  ? 108.795 -6.404  1.858   1.00 0.00 ? 28  PHE A HA   1  
ATOM 436   H HB2  . PHE A 1 28  ? 107.760 -4.279  1.697   1.00 0.00 ? 28  PHE A HB2  1  
ATOM 437   H HB3  . PHE A 1 28  ? 108.890 -3.550  2.830   1.00 0.00 ? 28  PHE A HB3  1  
ATOM 438   H HD1  . PHE A 1 28  ? 108.826 -5.184  -0.538  1.00 0.00 ? 28  PHE A HD1  1  
ATOM 439   H HD2  . PHE A 1 28  ? 110.629 -2.284  2.010   1.00 0.00 ? 28  PHE A HD2  1  
ATOM 440   H HE1  . PHE A 1 28  ? 110.172 -4.361  -2.426  1.00 0.00 ? 28  PHE A HE1  1  
ATOM 441   H HE2  . PHE A 1 28  ? 111.976 -1.462  0.131   1.00 0.00 ? 28  PHE A HE2  1  
ATOM 442   H HZ   . PHE A 1 28  ? 111.749 -2.499  -2.093  1.00 0.00 ? 28  PHE A HZ   1  
ATOM 443   N N    . ARG A 1 29  ? 111.218 -5.332  3.809   1.00 0.00 ? 29  ARG A N    1  
ATOM 444   C CA   . ARG A 1 29  ? 112.639 -5.480  4.044   1.00 0.00 ? 29  ARG A CA   1  
ATOM 445   C C    . ARG A 1 29  ? 113.002 -6.946  4.094   1.00 0.00 ? 29  ARG A C    1  
ATOM 446   O O    . ARG A 1 29  ? 113.927 -7.363  3.419   1.00 0.00 ? 29  ARG A O    1  
ATOM 447   C CB   . ARG A 1 29  ? 113.084 -4.821  5.346   1.00 0.00 ? 29  ARG A CB   1  
ATOM 448   C CG   . ARG A 1 29  ? 114.580 -4.990  5.611   1.00 0.00 ? 29  ARG A CG   1  
ATOM 449   C CD   . ARG A 1 29  ? 114.945 -4.611  7.034   1.00 0.00 ? 29  ARG A CD   1  
ATOM 450   N NE   . ARG A 1 29  ? 114.425 -5.588  7.991   1.00 0.00 ? 29  ARG A NE   1  
ATOM 451   C CZ   . ARG A 1 29  ? 114.895 -5.773  9.223   1.00 0.00 ? 29  ARG A CZ   1  
ATOM 452   N NH1  . ARG A 1 29  ? 115.928 -5.069  9.667   1.00 0.00 ? 29  ARG A NH1  1  
ATOM 453   N NH2  . ARG A 1 29  ? 114.336 -6.690  9.999   1.00 0.00 ? 29  ARG A NH2  1  
ATOM 454   H H    . ARG A 1 29  ? 110.663 -4.880  4.482   1.00 0.00 ? 29  ARG A H    1  
ATOM 455   H HA   . ARG A 1 29  ? 113.161 -5.017  3.218   1.00 0.00 ? 29  ARG A HA   1  
ATOM 456   H HB2  . ARG A 1 29  ? 112.859 -3.765  5.299   1.00 0.00 ? 29  ARG A HB2  1  
ATOM 457   H HB3  . ARG A 1 29  ? 112.538 -5.262  6.169   1.00 0.00 ? 29  ARG A HB3  1  
ATOM 458   H HG2  . ARG A 1 29  ? 114.851 -6.025  5.449   1.00 0.00 ? 29  ARG A HG2  1  
ATOM 459   H HG3  . ARG A 1 29  ? 115.134 -4.366  4.924   1.00 0.00 ? 29  ARG A HG3  1  
ATOM 460   H HD2  . ARG A 1 29  ? 116.021 -4.562  7.121   1.00 0.00 ? 29  ARG A HD2  1  
ATOM 461   H HD3  . ARG A 1 29  ? 114.516 -3.644  7.253   1.00 0.00 ? 29  ARG A HD3  1  
ATOM 462   H HE   . ARG A 1 29  ? 113.672 -6.150  7.691   1.00 0.00 ? 29  ARG A HE   1  
ATOM 463   H HH11 . ARG A 1 29  ? 116.374 -4.393  9.076   1.00 0.00 ? 29  ARG A HH11 1  
ATOM 464   H HH12 . ARG A 1 29  ? 116.263 -5.201  10.604  1.00 0.00 ? 29  ARG A HH12 1  
ATOM 465   H HH21 . ARG A 1 29  ? 113.562 -7.236  9.653   1.00 0.00 ? 29  ARG A HH21 1  
ATOM 466   H HH22 . ARG A 1 29  ? 114.683 -6.853  10.926  1.00 0.00 ? 29  ARG A HH22 1  
ATOM 467   N N    . GLU A 1 30  ? 112.259 -7.721  4.890   1.00 0.00 ? 30  GLU A N    1  
ATOM 468   C CA   . GLU A 1 30  ? 112.561 -9.142  5.078   1.00 0.00 ? 30  GLU A CA   1  
ATOM 469   C C    . GLU A 1 30  ? 112.665 -9.842  3.721   1.00 0.00 ? 30  GLU A C    1  
ATOM 470   O O    . GLU A 1 30  ? 113.534 -10.691 3.515   1.00 0.00 ? 30  GLU A O    1  
ATOM 471   C CB   . GLU A 1 30  ? 111.499 -9.849  5.938   1.00 0.00 ? 30  GLU A CB   1  
ATOM 472   C CG   . GLU A 1 30  ? 110.973 -9.035  7.117   1.00 0.00 ? 30  GLU A CG   1  
ATOM 473   C CD   . GLU A 1 30  ? 112.040 -8.700  8.145   1.00 0.00 ? 30  GLU A CD   1  
ATOM 474   O OE1  . GLU A 1 30  ? 112.453 -9.607  8.901   1.00 0.00 ? 30  GLU A OE1  1  
ATOM 475   O OE2  . GLU A 1 30  ? 112.452 -7.526  8.223   1.00 0.00 ? 30  GLU A OE2  1  
ATOM 476   H H    . GLU A 1 30  ? 111.495 -7.325  5.365   1.00 0.00 ? 30  GLU A H    1  
ATOM 477   H HA   . GLU A 1 30  ? 113.519 -9.208  5.576   1.00 0.00 ? 30  GLU A HA   1  
ATOM 478   H HB2  . GLU A 1 30  ? 110.660 -10.115 5.314   1.00 0.00 ? 30  GLU A HB2  1  
ATOM 479   H HB3  . GLU A 1 30  ? 111.941 -10.757 6.335   1.00 0.00 ? 30  GLU A HB3  1  
ATOM 480   H HG2  . GLU A 1 30  ? 110.554 -8.114  6.739   1.00 0.00 ? 30  GLU A HG2  1  
ATOM 481   H HG3  . GLU A 1 30  ? 110.190 -9.602  7.605   1.00 0.00 ? 30  GLU A HG3  1  
ATOM 482   N N    . PHE A 1 31  ? 111.785 -9.462  2.794   1.00 0.00 ? 31  PHE A N    1  
ATOM 483   C CA   . PHE A 1 31  ? 111.799 -10.027 1.447   1.00 0.00 ? 31  PHE A CA   1  
ATOM 484   C C    . PHE A 1 31  ? 113.145 -9.774  0.766   1.00 0.00 ? 31  PHE A C    1  
ATOM 485   O O    . PHE A 1 31  ? 113.887 -10.713 0.461   1.00 0.00 ? 31  PHE A O    1  
ATOM 486   C CB   . PHE A 1 31  ? 110.668 -9.439  0.593   1.00 0.00 ? 31  PHE A CB   1  
ATOM 487   C CG   . PHE A 1 31  ? 110.616 -10.027 -0.794  1.00 0.00 ? 31  PHE A CG   1  
ATOM 488   C CD1  . PHE A 1 31  ? 110.008 -11.252 -1.016  1.00 0.00 ? 31  PHE A CD1  1  
ATOM 489   C CD2  . PHE A 1 31  ? 111.191 -9.365  -1.871  1.00 0.00 ? 31  PHE A CD2  1  
ATOM 490   C CE1  . PHE A 1 31  ? 109.972 -11.805 -2.278  1.00 0.00 ? 31  PHE A CE1  1  
ATOM 491   C CE2  . PHE A 1 31  ? 111.156 -9.914  -3.136  1.00 0.00 ? 31  PHE A CE2  1  
ATOM 492   C CZ   . PHE A 1 31  ? 110.547 -11.137 -3.340  1.00 0.00 ? 31  PHE A CZ   1  
ATOM 493   H H    . PHE A 1 31  ? 111.105 -8.789  3.026   1.00 0.00 ? 31  PHE A H    1  
ATOM 494   H HA   . PHE A 1 31  ? 111.650 -11.095 1.538   1.00 0.00 ? 31  PHE A HA   1  
ATOM 495   H HB2  . PHE A 1 31  ? 109.720 -9.632  1.076   1.00 0.00 ? 31  PHE A HB2  1  
ATOM 496   H HB3  . PHE A 1 31  ? 110.808 -8.371  0.503   1.00 0.00 ? 31  PHE A HB3  1  
ATOM 497   H HD1  . PHE A 1 31  ? 109.556 -11.778 -0.186  1.00 0.00 ? 31  PHE A HD1  1  
ATOM 498   H HD2  . PHE A 1 31  ? 111.669 -8.408  -1.712  1.00 0.00 ? 31  PHE A HD2  1  
ATOM 499   H HE1  . PHE A 1 31  ? 109.495 -12.761 -2.435  1.00 0.00 ? 31  PHE A HE1  1  
ATOM 500   H HE2  . PHE A 1 31  ? 111.606 -9.390  -3.966  1.00 0.00 ? 31  PHE A HE2  1  
ATOM 501   H HZ   . PHE A 1 31  ? 110.519 -11.569 -4.330  1.00 0.00 ? 31  PHE A HZ   1  
ATOM 502   N N    . LEU A 1 32  ? 113.457 -8.496  0.538   1.00 0.00 ? 32  LEU A N    1  
ATOM 503   C CA   . LEU A 1 32  ? 114.715 -8.109  -0.101  1.00 0.00 ? 32  LEU A CA   1  
ATOM 504   C C    . LEU A 1 32  ? 115.899 -8.637  0.704   1.00 0.00 ? 32  LEU A C    1  
ATOM 505   O O    . LEU A 1 32  ? 116.929 -8.997  0.157   1.00 0.00 ? 32  LEU A O    1  
ATOM 506   C CB   . LEU A 1 32  ? 114.819 -6.580  -0.226  1.00 0.00 ? 32  LEU A CB   1  
ATOM 507   C CG   . LEU A 1 32  ? 113.792 -5.903  -1.150  1.00 0.00 ? 32  LEU A CG   1  
ATOM 508   C CD1  . LEU A 1 32  ? 114.133 -4.425  -1.325  1.00 0.00 ? 32  LEU A CD1  1  
ATOM 509   C CD2  . LEU A 1 32  ? 113.726 -6.610  -2.502  1.00 0.00 ? 32  LEU A CD2  1  
ATOM 510   H H    . LEU A 1 32  ? 112.824 -7.795  0.813   1.00 0.00 ? 32  LEU A H    1  
ATOM 511   H HA   . LEU A 1 32  ? 114.738 -8.548  -1.089  1.00 0.00 ? 32  LEU A HA   1  
ATOM 512   H HB2  . LEU A 1 32  ? 114.709 -6.156  0.763   1.00 0.00 ? 32  LEU A HB2  1  
ATOM 513   H HB3  . LEU A 1 32  ? 115.807 -6.339  -0.590  1.00 0.00 ? 32  LEU A HB3  1  
ATOM 514   H HG   . LEU A 1 32  ? 112.811 -5.960  -0.695  1.00 0.00 ? 32  LEU A HG   1  
ATOM 515   H HD11 . LEU A 1 32  ? 114.118 -3.935  -0.362  1.00 0.00 ? 32  LEU A HD11 1  
ATOM 516   H HD12 . LEU A 1 32  ? 113.405 -3.961  -1.974  1.00 0.00 ? 32  LEU A HD12 1  
ATOM 517   H HD13 . LEU A 1 32  ? 115.117 -4.329  -1.762  1.00 0.00 ? 32  LEU A HD13 1  
ATOM 518   H HD21 . LEU A 1 32  ? 113.424 -7.638  -2.357  1.00 0.00 ? 32  LEU A HD21 1  
ATOM 519   H HD22 . LEU A 1 32  ? 114.698 -6.584  -2.973  1.00 0.00 ? 32  LEU A HD22 1  
ATOM 520   H HD23 . LEU A 1 32  ? 113.006 -6.111  -3.136  1.00 0.00 ? 32  LEU A HD23 1  
ATOM 521   N N    . LYS A 1 33  ? 115.707 -8.694  2.004   1.00 0.00 ? 33  LYS A N    1  
ATOM 522   C CA   . LYS A 1 33  ? 116.716 -9.130  2.961   1.00 0.00 ? 33  LYS A CA   1  
ATOM 523   C C    . LYS A 1 33  ? 117.155 -10.558 2.660   1.00 0.00 ? 33  LYS A C    1  
ATOM 524   O O    . LYS A 1 33  ? 118.343 -10.844 2.502   1.00 0.00 ? 33  LYS A O    1  
ATOM 525   C CB   . LYS A 1 33  ? 116.094 -9.027  4.357   1.00 0.00 ? 33  LYS A CB   1  
ATOM 526   C CG   . LYS A 1 33  ? 116.958 -9.460  5.529   1.00 0.00 ? 33  LYS A CG   1  
ATOM 527   C CD   . LYS A 1 33  ? 116.158 -9.335  6.825   1.00 0.00 ? 33  LYS A CD   1  
ATOM 528   C CE   . LYS A 1 33  ? 116.983 -9.655  8.056   1.00 0.00 ? 33  LYS A CE   1  
ATOM 529   N NZ   . LYS A 1 33  ? 118.163 -8.755  8.181   1.00 0.00 ? 33  LYS A NZ   1  
ATOM 530   H H    . LYS A 1 33  ? 114.828 -8.443  2.346   1.00 0.00 ? 33  LYS A H    1  
ATOM 531   H HA   . LYS A 1 33  ? 117.565 -8.468  2.894   1.00 0.00 ? 33  LYS A HA   1  
ATOM 532   H HB2  . LYS A 1 33  ? 115.814 -7.997  4.525   1.00 0.00 ? 33  LYS A HB2  1  
ATOM 533   H HB3  . LYS A 1 33  ? 115.194 -9.627  4.369   1.00 0.00 ? 33  LYS A HB3  1  
ATOM 534   H HG2  . LYS A 1 33  ? 117.259 -10.490 5.390   1.00 0.00 ? 33  LYS A HG2  1  
ATOM 535   H HG3  . LYS A 1 33  ? 117.831 -8.825  5.585   1.00 0.00 ? 33  LYS A HG3  1  
ATOM 536   H HD2  . LYS A 1 33  ? 115.791 -8.322  6.912   1.00 0.00 ? 33  LYS A HD2  1  
ATOM 537   H HD3  . LYS A 1 33  ? 115.317 -10.016 6.782   1.00 0.00 ? 33  LYS A HD3  1  
ATOM 538   H HE2  . LYS A 1 33  ? 116.355 -9.542  8.928   1.00 0.00 ? 33  LYS A HE2  1  
ATOM 539   H HE3  . LYS A 1 33  ? 117.321 -10.678 7.989   1.00 0.00 ? 33  LYS A HE3  1  
ATOM 540   H HZ1  . LYS A 1 33  ? 117.882 -7.765  8.014   1.00 0.00 ? 33  LYS A HZ1  1  
ATOM 541   H HZ2  . LYS A 1 33  ? 118.891 -9.017  7.487   1.00 0.00 ? 33  LYS A HZ2  1  
ATOM 542   H HZ3  . LYS A 1 33  ? 118.571 -8.829  9.136   1.00 0.00 ? 33  LYS A HZ3  1  
ATOM 543   N N    . LYS A 1 34  ? 116.175 -11.439 2.541   1.00 0.00 ? 34  LYS A N    1  
ATOM 544   C CA   . LYS A 1 34  ? 116.426 -12.852 2.287   1.00 0.00 ? 34  LYS A CA   1  
ATOM 545   C C    . LYS A 1 34  ? 116.802 -13.087 0.824   1.00 0.00 ? 34  LYS A C    1  
ATOM 546   O O    . LYS A 1 34  ? 117.406 -14.106 0.482   1.00 0.00 ? 34  LYS A O    1  
ATOM 547   C CB   . LYS A 1 34  ? 115.189 -13.667 2.676   1.00 0.00 ? 34  LYS A CB   1  
ATOM 548   C CG   . LYS A 1 34  ? 114.811 -13.493 4.147   1.00 0.00 ? 34  LYS A CG   1  
ATOM 549   C CD   . LYS A 1 34  ? 113.541 -14.248 4.529   1.00 0.00 ? 34  LYS A CD   1  
ATOM 550   C CE   . LYS A 1 34  ? 113.730 -15.759 4.481   1.00 0.00 ? 34  LYS A CE   1  
ATOM 551   N NZ   . LYS A 1 34  ? 112.596 -16.471 5.127   1.00 0.00 ? 34  LYS A NZ   1  
ATOM 552   H H    . LYS A 1 34  ? 115.247 -11.130 2.630   1.00 0.00 ? 34  LYS A H    1  
ATOM 553   H HA   . LYS A 1 34  ? 117.256 -13.158 2.910   1.00 0.00 ? 34  LYS A HA   1  
ATOM 554   H HB2  . LYS A 1 34  ? 114.353 -13.349 2.066   1.00 0.00 ? 34  LYS A HB2  1  
ATOM 555   H HB3  . LYS A 1 34  ? 115.384 -14.710 2.491   1.00 0.00 ? 34  LYS A HB3  1  
ATOM 556   H HG2  . LYS A 1 34  ? 115.624 -13.854 4.759   1.00 0.00 ? 34  LYS A HG2  1  
ATOM 557   H HG3  . LYS A 1 34  ? 114.661 -12.439 4.343   1.00 0.00 ? 34  LYS A HG3  1  
ATOM 558   H HD2  . LYS A 1 34  ? 113.259 -13.966 5.533   1.00 0.00 ? 34  LYS A HD2  1  
ATOM 559   H HD3  . LYS A 1 34  ? 112.751 -13.971 3.845   1.00 0.00 ? 34  LYS A HD3  1  
ATOM 560   H HE2  . LYS A 1 34  ? 113.799 -16.072 3.449   1.00 0.00 ? 34  LYS A HE2  1  
ATOM 561   H HE3  . LYS A 1 34  ? 114.645 -16.015 4.997   1.00 0.00 ? 34  LYS A HE3  1  
ATOM 562   H HZ1  . LYS A 1 34  ? 112.764 -17.495 5.124   1.00 0.00 ? 34  LYS A HZ1  1  
ATOM 563   H HZ2  . LYS A 1 34  ? 111.713 -16.278 4.617   1.00 0.00 ? 34  LYS A HZ2  1  
ATOM 564   H HZ3  . LYS A 1 34  ? 112.491 -16.150 6.113   1.00 0.00 ? 34  LYS A HZ3  1  
ATOM 565   N N    . GLU A 1 35  ? 116.432 -12.139 -0.033  1.00 0.00 ? 35  GLU A N    1  
ATOM 566   C CA   . GLU A 1 35  ? 116.807 -12.173 -1.451  1.00 0.00 ? 35  GLU A CA   1  
ATOM 567   C C    . GLU A 1 35  ? 118.121 -11.405 -1.676  1.00 0.00 ? 35  GLU A C    1  
ATOM 568   O O    . GLU A 1 35  ? 118.668 -11.386 -2.782  1.00 0.00 ? 35  GLU A O    1  
ATOM 569   C CB   . GLU A 1 35  ? 115.670 -11.586 -2.307  1.00 0.00 ? 35  GLU A CB   1  
ATOM 570   C CG   . GLU A 1 35  ? 115.830 -11.825 -3.806  1.00 0.00 ? 35  GLU A CG   1  
ATOM 571   C CD   . GLU A 1 35  ? 114.613 -11.393 -4.612  1.00 0.00 ? 35  GLU A CD   1  
ATOM 572   O OE1  . GLU A 1 35  ? 113.620 -12.156 -4.654  1.00 0.00 ? 35  GLU A OE1  1  
ATOM 573   O OE2  . GLU A 1 35  ? 114.644 -10.300 -5.216  1.00 0.00 ? 35  GLU A OE2  1  
ATOM 574   H H    . GLU A 1 35  ? 115.871 -11.405 0.293   1.00 0.00 ? 35  GLU A H    1  
ATOM 575   H HA   . GLU A 1 35  ? 116.959 -13.207 -1.730  1.00 0.00 ? 35  GLU A HA   1  
ATOM 576   H HB2  . GLU A 1 35  ? 114.736 -12.031 -1.993  1.00 0.00 ? 35  GLU A HB2  1  
ATOM 577   H HB3  . GLU A 1 35  ? 115.620 -10.519 -2.136  1.00 0.00 ? 35  GLU A HB3  1  
ATOM 578   H HG2  . GLU A 1 35  ? 116.691 -11.271 -4.155  1.00 0.00 ? 35  GLU A HG2  1  
ATOM 579   H HG3  . GLU A 1 35  ? 115.998 -12.880 -3.972  1.00 0.00 ? 35  GLU A HG3  1  
ATOM 580   N N    . PHE A 1 36  ? 118.611 -10.783 -0.602  1.00 0.00 ? 36  PHE A N    1  
ATOM 581   C CA   . PHE A 1 36  ? 119.874 -10.034 -0.596  1.00 0.00 ? 36  PHE A CA   1  
ATOM 582   C C    . PHE A 1 36  ? 119.773 -8.760  -1.436  1.00 0.00 ? 36  PHE A C    1  
ATOM 583   O O    . PHE A 1 36  ? 120.325 -8.654  -2.534  1.00 0.00 ? 36  PHE A O    1  
ATOM 584   C CB   . PHE A 1 36  ? 121.042 -10.914 -1.050  1.00 0.00 ? 36  PHE A CB   1  
ATOM 585   C CG   . PHE A 1 36  ? 122.402 -10.319 -0.784  1.00 0.00 ? 36  PHE A CG   1  
ATOM 586   C CD1  . PHE A 1 36  ? 122.768 -9.945  0.503   1.00 0.00 ? 36  PHE A CD1  1  
ATOM 587   C CD2  . PHE A 1 36  ? 123.315 -10.140 -1.811  1.00 0.00 ? 36  PHE A CD2  1  
ATOM 588   C CE1  . PHE A 1 36  ? 124.014 -9.404  0.754   1.00 0.00 ? 36  PHE A CE1  1  
ATOM 589   C CE2  . PHE A 1 36  ? 124.561 -9.602  -1.563  1.00 0.00 ? 36  PHE A CE2  1  
ATOM 590   C CZ   . PHE A 1 36  ? 124.912 -9.233  -0.279  1.00 0.00 ? 36  PHE A CZ   1  
ATOM 591   H H    . PHE A 1 36  ? 118.094 -10.820 0.228   1.00 0.00 ? 36  PHE A H    1  
ATOM 592   H HA   . PHE A 1 36  ? 120.053 -9.739  0.429   1.00 0.00 ? 36  PHE A HA   1  
ATOM 593   H HB2  . PHE A 1 36  ? 120.984 -11.850 -0.522  1.00 0.00 ? 36  PHE A HB2  1  
ATOM 594   H HB3  . PHE A 1 36  ? 120.954 -11.101 -2.111  1.00 0.00 ? 36  PHE A HB3  1  
ATOM 595   H HD1  . PHE A 1 36  ? 122.067 -10.077 1.314   1.00 0.00 ? 36  PHE A HD1  1  
ATOM 596   H HD2  . PHE A 1 36  ? 123.043 -10.427 -2.818  1.00 0.00 ? 36  PHE A HD2  1  
ATOM 597   H HE1  . PHE A 1 36  ? 124.286 -9.116  1.760   1.00 0.00 ? 36  PHE A HE1  1  
ATOM 598   H HE2  . PHE A 1 36  ? 125.263 -9.469  -2.374  1.00 0.00 ? 36  PHE A HE2  1  
ATOM 599   H HZ   . PHE A 1 36  ? 125.887 -8.812  -0.085  1.00 0.00 ? 36  PHE A HZ   1  
ATOM 600   N N    . SER A 1 37  ? 119.010 -7.821  -0.903  1.00 0.00 ? 37  SER A N    1  
ATOM 601   C CA   . SER A 1 37  ? 118.827 -6.485  -1.472  1.00 0.00 ? 37  SER A CA   1  
ATOM 602   C C    . SER A 1 37  ? 118.425 -5.523  -0.348  1.00 0.00 ? 37  SER A C    1  
ATOM 603   O O    . SER A 1 37  ? 117.851 -4.442  -0.575  1.00 0.00 ? 37  SER A O    1  
ATOM 604   C CB   . SER A 1 37  ? 117.759 -6.504  -2.577  1.00 0.00 ? 37  SER A CB   1  
ATOM 605   O OG   . SER A 1 37  ? 118.156 -7.322  -3.667  1.00 0.00 ? 37  SER A OG   1  
ATOM 606   H H    . SER A 1 37  ? 118.530 -8.045  -0.082  1.00 0.00 ? 37  SER A H    1  
ATOM 607   H HA   . SER A 1 37  ? 119.772 -6.161  -1.889  1.00 0.00 ? 37  SER A HA   1  
ATOM 608   H HB2  . SER A 1 37  ? 116.834 -6.891  -2.175  1.00 0.00 ? 37  SER A HB2  1  
ATOM 609   H HB3  . SER A 1 37  ? 117.600 -5.499  -2.939  1.00 0.00 ? 37  SER A HB3  1  
ATOM 610   H HG   . SER A 1 37  ? 118.797 -7.971  -3.367  1.00 0.00 ? 37  SER A HG   1  
ATOM 611   N N    . GLU A 1 38  ? 118.755 -5.926  0.878   1.00 0.00 ? 38  GLU A N    1  
ATOM 612   C CA   . GLU A 1 38  ? 118.448 -5.136  2.059   1.00 0.00 ? 38  GLU A CA   1  
ATOM 613   C C    . GLU A 1 38  ? 119.225 -3.824  1.998   1.00 0.00 ? 38  GLU A C    1  
ATOM 614   O O    . GLU A 1 38  ? 118.830 -2.819  2.587   1.00 0.00 ? 38  GLU A O    1  
ATOM 615   C CB   . GLU A 1 38  ? 118.799 -5.923  3.329   1.00 0.00 ? 38  GLU A CB   1  
ATOM 616   C CG   . GLU A 1 38  ? 118.391 -5.229  4.624   1.00 0.00 ? 38  GLU A CG   1  
ATOM 617   C CD   . GLU A 1 38  ? 118.780 -6.021  5.861   1.00 0.00 ? 38  GLU A CD   1  
ATOM 618   O OE1  . GLU A 1 38  ? 119.984 -6.271  6.050   1.00 0.00 ? 38  GLU A OE1  1  
ATOM 619   O OE2  . GLU A 1 38  ? 117.889 -6.385  6.658   1.00 0.00 ? 38  GLU A OE2  1  
ATOM 620   H H    . GLU A 1 38  ? 119.251 -6.766  0.985   1.00 0.00 ? 38  GLU A H    1  
ATOM 621   H HA   . GLU A 1 38  ? 117.388 -4.919  2.052   1.00 0.00 ? 38  GLU A HA   1  
ATOM 622   H HB2  . GLU A 1 38  ? 118.303 -6.882  3.289   1.00 0.00 ? 38  GLU A HB2  1  
ATOM 623   H HB3  . GLU A 1 38  ? 119.867 -6.085  3.353   1.00 0.00 ? 38  GLU A HB3  1  
ATOM 624   H HG2  . GLU A 1 38  ? 118.874 -4.263  4.668   1.00 0.00 ? 38  GLU A HG2  1  
ATOM 625   H HG3  . GLU A 1 38  ? 117.318 -5.091  4.620   1.00 0.00 ? 38  GLU A HG3  1  
ATOM 626   N N    . GLU A 1 39  ? 120.325 -3.853  1.251   1.00 0.00 ? 39  GLU A N    1  
ATOM 627   C CA   . GLU A 1 39  ? 121.131 -2.668  0.997   1.00 0.00 ? 39  GLU A CA   1  
ATOM 628   C C    . GLU A 1 39  ? 120.264 -1.592  0.343   1.00 0.00 ? 39  GLU A C    1  
ATOM 629   O O    . GLU A 1 39  ? 120.343 -0.414  0.687   1.00 0.00 ? 39  GLU A O    1  
ATOM 630   C CB   . GLU A 1 39  ? 122.328 -3.003  0.082   1.00 0.00 ? 39  GLU A CB   1  
ATOM 631   C CG   . GLU A 1 39  ? 123.156 -4.218  0.519   1.00 0.00 ? 39  GLU A CG   1  
ATOM 632   C CD   . GLU A 1 39  ? 122.549 -5.551  0.083   1.00 0.00 ? 39  GLU A CD   1  
ATOM 633   O OE1  . GLU A 1 39  ? 122.787 -5.963  -1.073  1.00 0.00 ? 39  GLU A OE1  1  
ATOM 634   O OE2  . GLU A 1 39  ? 121.826 -6.180  0.889   1.00 0.00 ? 39  GLU A OE2  1  
ATOM 635   H H    . GLU A 1 39  ? 120.603 -4.707  0.864   1.00 0.00 ? 39  GLU A H    1  
ATOM 636   H HA   . GLU A 1 39  ? 121.498 -2.301  1.946   1.00 0.00 ? 39  GLU A HA   1  
ATOM 637   H HB2  . GLU A 1 39  ? 121.958 -3.192  -0.915  1.00 0.00 ? 39  GLU A HB2  1  
ATOM 638   H HB3  . GLU A 1 39  ? 122.985 -2.143  0.049   1.00 0.00 ? 39  GLU A HB3  1  
ATOM 639   H HG2  . GLU A 1 39  ? 124.144 -4.135  0.089   1.00 0.00 ? 39  GLU A HG2  1  
ATOM 640   H HG3  . GLU A 1 39  ? 123.238 -4.211  1.598   1.00 0.00 ? 39  GLU A HG3  1  
ATOM 641   N N    . ASN A 1 40  ? 119.420 -2.032  -0.591  1.00 0.00 ? 40  ASN A N    1  
ATOM 642   C CA   . ASN A 1 40  ? 118.500 -1.146  -1.306  1.00 0.00 ? 40  ASN A CA   1  
ATOM 643   C C    . ASN A 1 40  ? 117.513 -0.500  -0.337  1.00 0.00 ? 40  ASN A C    1  
ATOM 644   O O    . ASN A 1 40  ? 117.459 0.730   -0.210  1.00 0.00 ? 40  ASN A O    1  
ATOM 645   C CB   . ASN A 1 40  ? 117.737 -1.942  -2.383  1.00 0.00 ? 40  ASN A CB   1  
ATOM 646   C CG   . ASN A 1 40  ? 116.644 -1.135  -3.075  1.00 0.00 ? 40  ASN A CG   1  
ATOM 647   O OD1  . ASN A 1 40  ? 116.762 0.073   -3.255  1.00 0.00 ? 40  ASN A OD1  1  
ATOM 648   N ND2  . ASN A 1 40  ? 115.565 -1.807  -3.462  1.00 0.00 ? 40  ASN A ND2  1  
ATOM 649   H H    . ASN A 1 40  ? 119.408 -2.988  -0.800  1.00 0.00 ? 40  ASN A H    1  
ATOM 650   H HA   . ASN A 1 40  ? 119.084 -0.372  -1.785  1.00 0.00 ? 40  ASN A HA   1  
ATOM 651   H HB2  . ASN A 1 40  ? 118.436 -2.273  -3.137  1.00 0.00 ? 40  ASN A HB2  1  
ATOM 652   H HB3  . ASN A 1 40  ? 117.282 -2.808  -1.922  1.00 0.00 ? 40  ASN A HB3  1  
ATOM 653   H HD21 . ASN A 1 40  ? 115.529 -2.770  -3.285  1.00 0.00 ? 40  ASN A HD21 1  
ATOM 654   H HD22 . ASN A 1 40  ? 114.846 -1.312  -3.909  1.00 0.00 ? 40  ASN A HD22 1  
ATOM 655   N N    . VAL A 1 41  ? 116.752 -1.338  0.369   1.00 0.00 ? 41  VAL A N    1  
ATOM 656   C CA   . VAL A 1 41  ? 115.699 -0.834  1.259   1.00 0.00 ? 41  VAL A CA   1  
ATOM 657   C C    . VAL A 1 41  ? 116.279 0.060   2.367   1.00 0.00 ? 41  VAL A C    1  
ATOM 658   O O    . VAL A 1 41  ? 115.724 1.120   2.682   1.00 0.00 ? 41  VAL A O    1  
ATOM 659   C CB   . VAL A 1 41  ? 114.858 -1.983  1.884   1.00 0.00 ? 41  VAL A CB   1  
ATOM 660   C CG1  . VAL A 1 41  ? 115.728 -2.932  2.701   1.00 0.00 ? 41  VAL A CG1  1  
ATOM 661   C CG2  . VAL A 1 41  ? 113.715 -1.424  2.735   1.00 0.00 ? 41  VAL A CG2  1  
ATOM 662   H H    . VAL A 1 41  ? 116.903 -2.312  0.289   1.00 0.00 ? 41  VAL A H    1  
ATOM 663   H HA   . VAL A 1 41  ? 115.034 -0.230  0.654   1.00 0.00 ? 41  VAL A HA   1  
ATOM 664   H HB   . VAL A 1 41  ? 114.420 -2.552  1.074   1.00 0.00 ? 41  VAL A HB   1  
ATOM 665   H HG11 . VAL A 1 41  ? 115.116 -3.728  3.103   1.00 0.00 ? 41  VAL A HG11 1  
ATOM 666   H HG12 . VAL A 1 41  ? 116.191 -2.391  3.514   1.00 0.00 ? 41  VAL A HG12 1  
ATOM 667   H HG13 . VAL A 1 41  ? 116.495 -3.355  2.068   1.00 0.00 ? 41  VAL A HG13 1  
ATOM 668   H HG21 . VAL A 1 41  ? 113.141 -2.239  3.150   1.00 0.00 ? 41  VAL A HG21 1  
ATOM 669   H HG22 . VAL A 1 41  ? 113.073 -0.811  2.120   1.00 0.00 ? 41  VAL A HG22 1  
ATOM 670   H HG23 . VAL A 1 41  ? 114.121 -0.824  3.538   1.00 0.00 ? 41  VAL A HG23 1  
ATOM 671   N N    . LEU A 1 42  ? 117.409 -0.357  2.937   1.00 0.00 ? 42  LEU A N    1  
ATOM 672   C CA   . LEU A 1 42  ? 118.054 0.401   4.008   1.00 0.00 ? 42  LEU A CA   1  
ATOM 673   C C    . LEU A 1 42  ? 118.636 1.708   3.487   1.00 0.00 ? 42  LEU A C    1  
ATOM 674   O O    . LEU A 1 42  ? 118.660 2.705   4.207   1.00 0.00 ? 42  LEU A O    1  
ATOM 675   C CB   . LEU A 1 42  ? 119.154 -0.428  4.690   1.00 0.00 ? 42  LEU A CB   1  
ATOM 676   C CG   . LEU A 1 42  ? 118.661 -1.491  5.682   1.00 0.00 ? 42  LEU A CG   1  
ATOM 677   C CD1  . LEU A 1 42  ? 119.842 -2.251  6.284   1.00 0.00 ? 42  LEU A CD1  1  
ATOM 678   C CD2  . LEU A 1 42  ? 117.817 -0.843  6.780   1.00 0.00 ? 42  LEU A CD2  1  
ATOM 679   H H    . LEU A 1 42  ? 117.823 -1.190  2.627   1.00 0.00 ? 42  LEU A H    1  
ATOM 680   H HA   . LEU A 1 42  ? 117.295 0.636   4.741   1.00 0.00 ? 42  LEU A HA   1  
ATOM 681   H HB2  . LEU A 1 42  ? 119.730 -0.924  3.920   1.00 0.00 ? 42  LEU A HB2  1  
ATOM 682   H HB3  . LEU A 1 42  ? 119.810 0.249   5.222   1.00 0.00 ? 42  LEU A HB3  1  
ATOM 683   H HG   . LEU A 1 42  ? 118.040 -2.204  5.157   1.00 0.00 ? 42  LEU A HG   1  
ATOM 684   H HD11 . LEU A 1 42  ? 120.484 -1.561  6.813   1.00 0.00 ? 42  LEU A HD11 1  
ATOM 685   H HD12 . LEU A 1 42  ? 120.402 -2.730  5.493   1.00 0.00 ? 42  LEU A HD12 1  
ATOM 686   H HD13 . LEU A 1 42  ? 119.477 -3.001  6.970   1.00 0.00 ? 42  LEU A HD13 1  
ATOM 687   H HD21 . LEU A 1 42  ? 116.939 -0.390  6.340   1.00 0.00 ? 42  LEU A HD21 1  
ATOM 688   H HD22 . LEU A 1 42  ? 118.398 -0.081  7.283   1.00 0.00 ? 42  LEU A HD22 1  
ATOM 689   H HD23 . LEU A 1 42  ? 117.513 -1.595  7.495   1.00 0.00 ? 42  LEU A HD23 1  
ATOM 690   N N    . PHE A 1 43  ? 119.102 1.703   2.239   1.00 0.00 ? 43  PHE A N    1  
ATOM 691   C CA   . PHE A 1 43  ? 119.687 2.900   1.642   1.00 0.00 ? 43  PHE A CA   1  
ATOM 692   C C    . PHE A 1 43  ? 118.680 4.042   1.644   1.00 0.00 ? 43  PHE A C    1  
ATOM 693   O O    . PHE A 1 43  ? 118.983 5.140   2.117   1.00 0.00 ? 43  PHE A O    1  
ATOM 694   C CB   . PHE A 1 43  ? 120.174 2.625   0.210   1.00 0.00 ? 43  PHE A CB   1  
ATOM 695   C CG   . PHE A 1 43  ? 120.758 3.840   -0.476  1.00 0.00 ? 43  PHE A CG   1  
ATOM 696   C CD1  . PHE A 1 43  ? 121.880 4.479   0.043   1.00 0.00 ? 43  PHE A CD1  1  
ATOM 697   C CD2  . PHE A 1 43  ? 120.188 4.344   -1.640  1.00 0.00 ? 43  PHE A CD2  1  
ATOM 698   C CE1  . PHE A 1 43  ? 122.416 5.590   -0.583  1.00 0.00 ? 43  PHE A CE1  1  
ATOM 699   C CE2  . PHE A 1 43  ? 120.722 5.455   -2.267  1.00 0.00 ? 43  PHE A CE2  1  
ATOM 700   C CZ   . PHE A 1 43  ? 121.836 6.078   -1.739  1.00 0.00 ? 43  PHE A CZ   1  
ATOM 701   H H    . PHE A 1 43  ? 119.052 0.878   1.710   1.00 0.00 ? 43  PHE A H    1  
ATOM 702   H HA   . PHE A 1 43  ? 120.535 3.186   2.249   1.00 0.00 ? 43  PHE A HA   1  
ATOM 703   H HB2  . PHE A 1 43  ? 120.937 1.860   0.239   1.00 0.00 ? 43  PHE A HB2  1  
ATOM 704   H HB3  . PHE A 1 43  ? 119.342 2.270   -0.383  1.00 0.00 ? 43  PHE A HB3  1  
ATOM 705   H HD1  . PHE A 1 43  ? 122.336 4.101   0.949   1.00 0.00 ? 43  PHE A HD1  1  
ATOM 706   H HD2  . PHE A 1 43  ? 119.316 3.859   -2.056  1.00 0.00 ? 43  PHE A HD2  1  
ATOM 707   H HE1  . PHE A 1 43  ? 123.287 6.076   -0.168  1.00 0.00 ? 43  PHE A HE1  1  
ATOM 708   H HE2  . PHE A 1 43  ? 120.268 5.835   -3.171  1.00 0.00 ? 43  PHE A HE2  1  
ATOM 709   H HZ   . PHE A 1 43  ? 122.253 6.946   -2.228  1.00 0.00 ? 43  PHE A HZ   1  
ATOM 710   N N    . TRP A 1 44  ? 117.478 3.775   1.135   1.00 0.00 ? 44  TRP A N    1  
ATOM 711   C CA   . TRP A 1 44  ? 116.442 4.802   1.065   1.00 0.00 ? 44  TRP A CA   1  
ATOM 712   C C    . TRP A 1 44  ? 116.084 5.299   2.465   1.00 0.00 ? 44  TRP A C    1  
ATOM 713   O O    . TRP A 1 44  ? 116.038 6.508   2.709   1.00 0.00 ? 44  TRP A O    1  
ATOM 714   C CB   . TRP A 1 44  ? 115.185 4.284   0.353   1.00 0.00 ? 44  TRP A CB   1  
ATOM 715   C CG   . TRP A 1 44  ? 114.198 5.375   0.033   1.00 0.00 ? 44  TRP A CG   1  
ATOM 716   C CD1  . TRP A 1 44  ? 114.134 6.110   -1.119  1.00 0.00 ? 44  TRP A CD1  1  
ATOM 717   C CD2  . TRP A 1 44  ? 113.145 5.864   0.877   1.00 0.00 ? 44  TRP A CD2  1  
ATOM 718   N NE1  . TRP A 1 44  ? 113.110 7.023   -1.041  1.00 0.00 ? 44  TRP A NE1  1  
ATOM 719   C CE2  . TRP A 1 44  ? 112.488 6.891   0.172   1.00 0.00 ? 44  TRP A CE2  1  
ATOM 720   C CE3  . TRP A 1 44  ? 112.694 5.533   2.158   1.00 0.00 ? 44  TRP A CE3  1  
ATOM 721   C CZ2  . TRP A 1 44  ? 111.408 7.587   0.707   1.00 0.00 ? 44  TRP A CZ2  1  
ATOM 722   C CZ3  . TRP A 1 44  ? 111.621 6.225   2.688   1.00 0.00 ? 44  TRP A CZ3  1  
ATOM 723   C CH2  . TRP A 1 44  ? 110.988 7.241   1.962   1.00 0.00 ? 44  TRP A CH2  1  
ATOM 724   H H    . TRP A 1 44  ? 117.288 2.869   0.795   1.00 0.00 ? 44  TRP A H    1  
ATOM 725   H HA   . TRP A 1 44  ? 116.846 5.631   0.498   1.00 0.00 ? 44  TRP A HA   1  
ATOM 726   H HB2  . TRP A 1 44  ? 115.474 3.811   -0.575  1.00 0.00 ? 44  TRP A HB2  1  
ATOM 727   H HB3  . TRP A 1 44  ? 114.692 3.558   0.983   1.00 0.00 ? 44  TRP A HB3  1  
ATOM 728   H HD1  . TRP A 1 44  ? 114.800 5.982   -1.960  1.00 0.00 ? 44  TRP A HD1  1  
ATOM 729   H HE1  . TRP A 1 44  ? 112.865 7.667   -1.743  1.00 0.00 ? 44  TRP A HE1  1  
ATOM 730   H HE3  . TRP A 1 44  ? 113.170 4.752   2.733   1.00 0.00 ? 44  TRP A HE3  1  
ATOM 731   H HZ2  . TRP A 1 44  ? 110.909 8.374   0.159   1.00 0.00 ? 44  TRP A HZ2  1  
ATOM 732   H HZ3  . TRP A 1 44  ? 111.258 5.983   3.677   1.00 0.00 ? 44  TRP A HZ3  1  
ATOM 733   H HH2  . TRP A 1 44  ? 110.153 7.757   2.416   1.00 0.00 ? 44  TRP A HH2  1  
ATOM 734   N N    . LEU A 1 45  ? 115.838 4.363   3.386   1.00 0.00 ? 45  LEU A N    1  
ATOM 735   C CA   . LEU A 1 45  ? 115.508 4.722   4.767   1.00 0.00 ? 45  LEU A CA   1  
ATOM 736   C C    . LEU A 1 45  ? 116.594 5.607   5.363   1.00 0.00 ? 45  LEU A C    1  
ATOM 737   O O    . LEU A 1 45  ? 116.306 6.634   5.985   1.00 0.00 ? 45  LEU A O    1  
ATOM 738   C CB   . LEU A 1 45  ? 115.346 3.480   5.652   1.00 0.00 ? 45  LEU A CB   1  
ATOM 739   C CG   . LEU A 1 45  ? 114.154 2.567   5.338   1.00 0.00 ? 45  LEU A CG   1  
ATOM 740   C CD1  . LEU A 1 45  ? 114.017 1.506   6.424   1.00 0.00 ? 45  LEU A CD1  1  
ATOM 741   C CD2  . LEU A 1 45  ? 112.862 3.375   5.203   1.00 0.00 ? 45  LEU A CD2  1  
ATOM 742   H H    . LEU A 1 45  ? 115.880 3.413   3.131   1.00 0.00 ? 45  LEU A H    1  
ATOM 743   H HA   . LEU A 1 45  ? 114.576 5.271   4.754   1.00 0.00 ? 45  LEU A HA   1  
ATOM 744   H HB2  . LEU A 1 45  ? 116.249 2.891   5.568   1.00 0.00 ? 45  LEU A HB2  1  
ATOM 745   H HB3  . LEU A 1 45  ? 115.253 3.809   6.679   1.00 0.00 ? 45  LEU A HB3  1  
ATOM 746   H HG   . LEU A 1 45  ? 114.333 2.056   4.400   1.00 0.00 ? 45  LEU A HG   1  
ATOM 747   H HD11 . LEU A 1 45  ? 113.218 0.830   6.166   1.00 0.00 ? 45  LEU A HD11 1  
ATOM 748   H HD12 . LEU A 1 45  ? 113.792 1.982   7.369   1.00 0.00 ? 45  LEU A HD12 1  
ATOM 749   H HD13 . LEU A 1 45  ? 114.942 0.958   6.512   1.00 0.00 ? 45  LEU A HD13 1  
ATOM 750   H HD21 . LEU A 1 45  ? 112.669 3.909   6.124   1.00 0.00 ? 45  LEU A HD21 1  
ATOM 751   H HD22 . LEU A 1 45  ? 112.038 2.708   4.997   1.00 0.00 ? 45  LEU A HD22 1  
ATOM 752   H HD23 . LEU A 1 45  ? 112.961 4.081   4.392   1.00 0.00 ? 45  LEU A HD23 1  
ATOM 753   N N    . ALA A 1 46  ? 117.841 5.196   5.159   1.00 0.00 ? 46  ALA A N    1  
ATOM 754   C CA   . ALA A 1 46  ? 118.984 5.889   5.730   1.00 0.00 ? 46  ALA A CA   1  
ATOM 755   C C    . ALA A 1 46  ? 119.099 7.298   5.176   1.00 0.00 ? 46  ALA A C    1  
ATOM 756   O O    . ALA A 1 46  ? 119.249 8.242   5.936   1.00 0.00 ? 46  ALA A O    1  
ATOM 757   C CB   . ALA A 1 46  ? 120.274 5.116   5.480   1.00 0.00 ? 46  ALA A CB   1  
ATOM 758   H H    . ALA A 1 46  ? 117.996 4.405   4.602   1.00 0.00 ? 46  ALA A H    1  
ATOM 759   H HA   . ALA A 1 46  ? 118.833 5.947   6.799   1.00 0.00 ? 46  ALA A HA   1  
ATOM 760   H HB1  . ALA A 1 46  ? 120.451 5.041   4.417   1.00 0.00 ? 46  ALA A HB1  1  
ATOM 761   H HB2  . ALA A 1 46  ? 120.188 4.123   5.903   1.00 0.00 ? 46  ALA A HB2  1  
ATOM 762   H HB3  . ALA A 1 46  ? 121.101 5.638   5.947   1.00 0.00 ? 46  ALA A HB3  1  
ATOM 763   N N    . CYS A 1 47  ? 119.007 7.439   3.856   1.00 0.00 ? 47  CYS A N    1  
ATOM 764   C CA   . CYS A 1 47  ? 119.175 8.740   3.214   1.00 0.00 ? 47  CYS A CA   1  
ATOM 765   C C    . CYS A 1 47  ? 118.010 9.677   3.545   1.00 0.00 ? 47  CYS A C    1  
ATOM 766   O O    . CYS A 1 47  ? 118.188 10.894  3.611   1.00 0.00 ? 47  CYS A O    1  
ATOM 767   C CB   . CYS A 1 47  ? 119.328 8.576   1.697   1.00 0.00 ? 47  CYS A CB   1  
ATOM 768   S SG   . CYS A 1 47  ? 117.975 7.680   0.906   1.00 0.00 ? 47  CYS A SG   1  
ATOM 769   H H    . CYS A 1 47  ? 118.819 6.651   3.300   1.00 0.00 ? 47  CYS A H    1  
ATOM 770   H HA   . CYS A 1 47  ? 120.084 9.178   3.605   1.00 0.00 ? 47  CYS A HA   1  
ATOM 771   H HB2  . CYS A 1 47  ? 119.384 9.553   1.238   1.00 0.00 ? 47  CYS A HB2  1  
ATOM 772   H HB3  . CYS A 1 47  ? 120.242 8.037   1.491   1.00 0.00 ? 47  CYS A HB3  1  
ATOM 773   H HG   . CYS A 1 47  ? 116.836 8.106   1.438   1.00 0.00 ? 47  CYS A HG   1  
ATOM 774   N N    . GLU A 1 48  ? 116.826 9.107   3.770   1.00 0.00 ? 48  GLU A N    1  
ATOM 775   C CA   . GLU A 1 48  ? 115.646 9.897   4.123   1.00 0.00 ? 48  GLU A CA   1  
ATOM 776   C C    . GLU A 1 48  ? 115.739 10.367  5.574   1.00 0.00 ? 48  GLU A C    1  
ATOM 777   O O    . GLU A 1 48  ? 115.450 11.522  5.887   1.00 0.00 ? 48  GLU A O    1  
ATOM 778   C CB   . GLU A 1 48  ? 114.366 9.078   3.902   1.00 0.00 ? 48  GLU A CB   1  
ATOM 779   C CG   . GLU A 1 48  ? 113.070 9.831   4.208   1.00 0.00 ? 48  GLU A CG   1  
ATOM 780   C CD   . GLU A 1 48  ? 112.934 11.149  3.450   1.00 0.00 ? 48  GLU A CD   1  
ATOM 781   O OE1  . GLU A 1 48  ? 112.960 11.138  2.202   1.00 0.00 ? 48  GLU A OE1  1  
ATOM 782   O OE2  . GLU A 1 48  ? 112.769 12.204  4.102   1.00 0.00 ? 48  GLU A OE2  1  
ATOM 783   H H    . GLU A 1 48  ? 116.743 8.131   3.692   1.00 0.00 ? 48  GLU A H    1  
ATOM 784   H HA   . GLU A 1 48  ? 115.624 10.765  3.477   1.00 0.00 ? 48  GLU A HA   1  
ATOM 785   H HB2  . GLU A 1 48  ? 114.333 8.757   2.870   1.00 0.00 ? 48  GLU A HB2  1  
ATOM 786   H HB3  . GLU A 1 48  ? 114.405 8.203   4.537   1.00 0.00 ? 48  GLU A HB3  1  
ATOM 787   H HG2  . GLU A 1 48  ? 112.233 9.200   3.943   1.00 0.00 ? 48  GLU A HG2  1  
ATOM 788   H HG3  . GLU A 1 48  ? 113.035 10.036  5.270   1.00 0.00 ? 48  GLU A HG3  1  
ATOM 789   N N    . ASP A 1 49  ? 116.160 9.468   6.457   1.00 0.00 ? 49  ASP A N    1  
ATOM 790   C CA   . ASP A 1 49  ? 116.341 9.807   7.869   1.00 0.00 ? 49  ASP A CA   1  
ATOM 791   C C    . ASP A 1 49  ? 117.505 10.784  8.004   1.00 0.00 ? 49  ASP A C    1  
ATOM 792   O O    . ASP A 1 49  ? 117.465 11.731  8.788   1.00 0.00 ? 49  ASP A O    1  
ATOM 793   C CB   . ASP A 1 49  ? 116.595 8.536   8.691   1.00 0.00 ? 49  ASP A CB   1  
ATOM 794   C CG   . ASP A 1 49  ? 116.538 8.780   10.191  1.00 0.00 ? 49  ASP A CG   1  
ATOM 795   O OD1  . ASP A 1 49  ? 115.472 9.205   10.686  1.00 0.00 ? 49  ASP A OD1  1  
ATOM 796   O OD2  . ASP A 1 49  ? 117.537 8.507   10.890  1.00 0.00 ? 49  ASP A OD2  1  
ATOM 797   H H    . ASP A 1 49  ? 116.361 8.557   6.154   1.00 0.00 ? 49  ASP A H    1  
ATOM 798   H HA   . ASP A 1 49  ? 115.435 10.284  8.215   1.00 0.00 ? 49  ASP A HA   1  
ATOM 799   H HB2  . ASP A 1 49  ? 115.845 7.799   8.439   1.00 0.00 ? 49  ASP A HB2  1  
ATOM 800   H HB3  . ASP A 1 49  ? 117.572 8.143   8.440   1.00 0.00 ? 49  ASP A HB3  1  
ATOM 801   N N    . PHE A 1 50  ? 118.518 10.537  7.185   1.00 0.00 ? 50  PHE A N    1  
ATOM 802   C CA   . PHE A 1 50  ? 119.693 11.397  7.040   1.00 0.00 ? 50  PHE A CA   1  
ATOM 803   C C    . PHE A 1 50  ? 119.274 12.791  6.566   1.00 0.00 ? 50  PHE A C    1  
ATOM 804   O O    . PHE A 1 50  ? 119.861 13.804  6.947   1.00 0.00 ? 50  PHE A O    1  
ATOM 805   C CB   . PHE A 1 50  ? 120.622 10.718  6.020   1.00 0.00 ? 50  PHE A CB   1  
ATOM 806   C CG   . PHE A 1 50  ? 121.863 11.467  5.629   1.00 0.00 ? 50  PHE A CG   1  
ATOM 807   C CD1  . PHE A 1 50  ? 122.999 11.406  6.412   1.00 0.00 ? 50  PHE A CD1  1  
ATOM 808   C CD2  . PHE A 1 50  ? 121.903 12.196  4.450   1.00 0.00 ? 50  PHE A CD2  1  
ATOM 809   C CE1  . PHE A 1 50  ? 124.150 12.064  6.034   1.00 0.00 ? 50  PHE A CE1  1  
ATOM 810   C CE2  . PHE A 1 50  ? 123.054 12.851  4.064   1.00 0.00 ? 50  PHE A CE2  1  
ATOM 811   C CZ   . PHE A 1 50  ? 124.179 12.786  4.858   1.00 0.00 ? 50  PHE A CZ   1  
ATOM 812   H H    . PHE A 1 50  ? 118.476 9.726   6.640   1.00 0.00 ? 50  PHE A H    1  
ATOM 813   H HA   . PHE A 1 50  ? 120.192 11.469  7.996   1.00 0.00 ? 50  PHE A HA   1  
ATOM 814   H HB2  . PHE A 1 50  ? 120.939 9.768   6.427   1.00 0.00 ? 50  PHE A HB2  1  
ATOM 815   H HB3  . PHE A 1 50  ? 120.054 10.527  5.118   1.00 0.00 ? 50  PHE A HB3  1  
ATOM 816   H HD1  . PHE A 1 50  ? 122.979 10.842  7.333   1.00 0.00 ? 50  PHE A HD1  1  
ATOM 817   H HD2  . PHE A 1 50  ? 121.020 12.249  3.831   1.00 0.00 ? 50  PHE A HD2  1  
ATOM 818   H HE1  . PHE A 1 50  ? 125.029 12.010  6.657   1.00 0.00 ? 50  PHE A HE1  1  
ATOM 819   H HE2  . PHE A 1 50  ? 123.073 13.415  3.143   1.00 0.00 ? 50  PHE A HE2  1  
ATOM 820   H HZ   . PHE A 1 50  ? 125.083 13.297  4.559   1.00 0.00 ? 50  PHE A HZ   1  
ATOM 821   N N    . LYS A 1 51  ? 118.247 12.813  5.724   1.00 0.00 ? 51  LYS A N    1  
ATOM 822   C CA   . LYS A 1 51  ? 117.665 14.046  5.206   1.00 0.00 ? 51  LYS A CA   1  
ATOM 823   C C    . LYS A 1 51  ? 116.892 14.784  6.301   1.00 0.00 ? 51  LYS A C    1  
ATOM 824   O O    . LYS A 1 51  ? 116.878 16.019  6.345   1.00 0.00 ? 51  LYS A O    1  
ATOM 825   C CB   . LYS A 1 51  ? 116.752 13.682  4.013   1.00 0.00 ? 51  LYS A CB   1  
ATOM 826   C CG   . LYS A 1 51  ? 115.838 14.790  3.477   1.00 0.00 ? 51  LYS A CG   1  
ATOM 827   C CD   . LYS A 1 51  ? 114.541 14.921  4.286   1.00 0.00 ? 51  LYS A CD   1  
ATOM 828   C CE   . LYS A 1 51  ? 113.372 15.405  3.432   1.00 0.00 ? 51  LYS A CE   1  
ATOM 829   N NZ   . LYS A 1 51  ? 113.004 14.410  2.386   1.00 0.00 ? 51  LYS A NZ   1  
ATOM 830   H H    . LYS A 1 51  ? 117.867 11.960  5.428   1.00 0.00 ? 51  LYS A H    1  
ATOM 831   H HA   . LYS A 1 51  ? 118.470 14.677  4.855   1.00 0.00 ? 51  LYS A HA   1  
ATOM 832   H HB2  . LYS A 1 51  ? 117.381 13.357  3.197   1.00 0.00 ? 51  LYS A HB2  1  
ATOM 833   H HB3  . LYS A 1 51  ? 116.128 12.849  4.309   1.00 0.00 ? 51  LYS A HB3  1  
ATOM 834   H HG2  . LYS A 1 51  ? 116.370 15.730  3.515   1.00 0.00 ? 51  LYS A HG2  1  
ATOM 835   H HG3  . LYS A 1 51  ? 115.589 14.563  2.449   1.00 0.00 ? 51  LYS A HG3  1  
ATOM 836   H HD2  . LYS A 1 51  ? 114.287 13.957  4.701   1.00 0.00 ? 51  LYS A HD2  1  
ATOM 837   H HD3  . LYS A 1 51  ? 114.700 15.626  5.091   1.00 0.00 ? 51  LYS A HD3  1  
ATOM 838   H HE2  . LYS A 1 51  ? 112.518 15.571  4.072   1.00 0.00 ? 51  LYS A HE2  1  
ATOM 839   H HE3  . LYS A 1 51  ? 113.648 16.333  2.953   1.00 0.00 ? 51  LYS A HE3  1  
ATOM 840   H HZ1  . LYS A 1 51  ? 113.772 14.315  1.694   1.00 0.00 ? 51  LYS A HZ1  1  
ATOM 841   H HZ2  . LYS A 1 51  ? 112.143 14.712  1.888   1.00 0.00 ? 51  LYS A HZ2  1  
ATOM 842   H HZ3  . LYS A 1 51  ? 112.829 13.478  2.822   1.00 0.00 ? 51  LYS A HZ3  1  
ATOM 843   N N    . LYS A 1 52  ? 116.254 14.021  7.182   1.00 0.00 ? 52  LYS A N    1  
ATOM 844   C CA   . LYS A 1 52  ? 115.369 14.585  8.197   1.00 0.00 ? 52  LYS A CA   1  
ATOM 845   C C    . LYS A 1 52  ? 116.134 15.104  9.410   1.00 0.00 ? 52  LYS A C    1  
ATOM 846   O O    . LYS A 1 52  ? 115.851 16.202  9.892   1.00 0.00 ? 52  LYS A O    1  
ATOM 847   C CB   . LYS A 1 52  ? 114.312 13.550  8.617   1.00 0.00 ? 52  LYS A CB   1  
ATOM 848   C CG   . LYS A 1 52  ? 113.286 13.250  7.522   1.00 0.00 ? 52  LYS A CG   1  
ATOM 849   C CD   . LYS A 1 52  ? 112.290 12.167  7.936   1.00 0.00 ? 52  LYS A CD   1  
ATOM 850   C CE   . LYS A 1 52  ? 112.959 10.806  8.093   1.00 0.00 ? 52  LYS A CE   1  
ATOM 851   N NZ   . LYS A 1 52  ? 111.989 9.744   8.467   1.00 0.00 ? 52  LYS A NZ   1  
ATOM 852   H H    . LYS A 1 52  ? 116.383 13.049  7.148   1.00 0.00 ? 52  LYS A H    1  
ATOM 853   H HA   . LYS A 1 52  ? 114.862 15.426  7.751   1.00 0.00 ? 52  LYS A HA   1  
ATOM 854   H HB2  . LYS A 1 52  ? 114.811 12.627  8.879   1.00 0.00 ? 52  LYS A HB2  1  
ATOM 855   H HB3  . LYS A 1 52  ? 113.782 13.922  9.483   1.00 0.00 ? 52  LYS A HB3  1  
ATOM 856   H HG2  . LYS A 1 52  ? 112.740 14.155  7.299   1.00 0.00 ? 52  LYS A HG2  1  
ATOM 857   H HG3  . LYS A 1 52  ? 113.811 12.922  6.634   1.00 0.00 ? 52  LYS A HG3  1  
ATOM 858   H HD2  . LYS A 1 52  ? 111.842 12.446  8.879   1.00 0.00 ? 52  LYS A HD2  1  
ATOM 859   H HD3  . LYS A 1 52  ? 111.520 12.094  7.181   1.00 0.00 ? 52  LYS A HD3  1  
ATOM 860   H HE2  . LYS A 1 52  ? 113.425 10.537  7.156   1.00 0.00 ? 52  LYS A HE2  1  
ATOM 861   H HE3  . LYS A 1 52  ? 113.716 10.876  8.861   1.00 0.00 ? 52  LYS A HE3  1  
ATOM 862   H HZ1  . LYS A 1 52  ? 111.642 9.899   9.436   1.00 0.00 ? 52  LYS A HZ1  1  
ATOM 863   H HZ2  . LYS A 1 52  ? 112.446 8.811   8.418   1.00 0.00 ? 52  LYS A HZ2  1  
ATOM 864   H HZ3  . LYS A 1 52  ? 111.178 9.754   7.817   1.00 0.00 ? 52  LYS A HZ3  1  
ATOM 865   N N    . MET A 1 53  ? 117.095 14.336  9.910   1.00 0.00 ? 53  MET A N    1  
ATOM 866   C CA   . MET A 1 53  ? 117.841 14.751  11.092  1.00 0.00 ? 53  MET A CA   1  
ATOM 867   C C    . MET A 1 53  ? 119.292 14.272  11.019  1.00 0.00 ? 53  MET A C    1  
ATOM 868   O O    . MET A 1 53  ? 119.551 13.160  10.553  1.00 0.00 ? 53  MET A O    1  
ATOM 869   C CB   . MET A 1 53  ? 117.170 14.182  12.352  1.00 0.00 ? 53  MET A CB   1  
ATOM 870   C CG   . MET A 1 53  ? 117.421 12.692  12.551  1.00 0.00 ? 53  MET A CG   1  
ATOM 871   S SD   . MET A 1 53  ? 118.990 12.366  13.394  1.00 0.00 ? 53  MET A SD   1  
ATOM 872   C CE   . MET A 1 53  ? 119.326 10.682  12.880  1.00 0.00 ? 53  MET A CE   1  
ATOM 873   H H    . MET A 1 53  ? 117.305 13.476  9.488   1.00 0.00 ? 53  MET A H    1  
ATOM 874   H HA   . MET A 1 53  ? 117.821 15.829  11.134  1.00 0.00 ? 53  MET A HA   1  
ATOM 875   H HB2  . MET A 1 53  ? 117.548 14.708  13.217  1.00 0.00 ? 53  MET A HB2  1  
ATOM 876   H HB3  . MET A 1 53  ? 116.103 14.343  12.283  1.00 0.00 ? 53  MET A HB3  1  
ATOM 877   H HG2  . MET A 1 53  ? 116.618 12.280  13.136  1.00 0.00 ? 53  MET A HG2  1  
ATOM 878   H HG3  . MET A 1 53  ? 117.441 12.209  11.583  1.00 0.00 ? 53  MET A HG3  1  
ATOM 879   H HE1  . MET A 1 53  ? 118.530 10.036  13.221  1.00 0.00 ? 53  MET A HE1  1  
ATOM 880   H HE2  . MET A 1 53  ? 120.264 10.356  13.308  1.00 0.00 ? 53  MET A HE2  1  
ATOM 881   H HE3  . MET A 1 53  ? 119.389 10.639  11.803  1.00 0.00 ? 53  MET A HE3  1  
ATOM 882   N N    . GLN A 1 54  ? 120.222 15.123  11.473  1.00 0.00 ? 54  GLN A N    1  
ATOM 883   C CA   . GLN A 1 54  ? 121.634 14.755  11.627  1.00 0.00 ? 54  GLN A CA   1  
ATOM 884   C C    . GLN A 1 54  ? 122.467 16.005  11.928  1.00 0.00 ? 54  GLN A C    1  
ATOM 885   O O    . GLN A 1 54  ? 122.201 17.078  11.381  1.00 0.00 ? 54  GLN A O    1  
ATOM 886   C CB   . GLN A 1 54  ? 122.184 14.068  10.359  1.00 0.00 ? 54  GLN A CB   1  
ATOM 887   C CG   . GLN A 1 54  ? 123.381 13.160  10.617  1.00 0.00 ? 54  GLN A CG   1  
ATOM 888   C CD   . GLN A 1 54  ? 123.036 11.939  11.456  1.00 0.00 ? 54  GLN A CD   1  
ATOM 889   O OE1  . GLN A 1 54  ? 122.676 10.885  10.932  1.00 0.00 ? 54  GLN A OE1  1  
ATOM 890   N NE2  . GLN A 1 54  ? 123.153 12.070  12.765  1.00 0.00 ? 54  GLN A NE2  1  
ATOM 891   H H    . GLN A 1 54  ? 119.949 16.037  11.706  1.00 0.00 ? 54  GLN A H    1  
ATOM 892   H HA   . GLN A 1 54  ? 121.709 14.074  12.464  1.00 0.00 ? 54  GLN A HA   1  
ATOM 893   H HB2  . GLN A 1 54  ? 121.401 13.473  9.915   1.00 0.00 ? 54  GLN A HB2  1  
ATOM 894   H HB3  . GLN A 1 54  ? 122.485 14.829  9.653   1.00 0.00 ? 54  GLN A HB3  1  
ATOM 895   H HG2  . GLN A 1 54  ? 123.772 12.824  9.667   1.00 0.00 ? 54  GLN A HG2  1  
ATOM 896   H HG3  . GLN A 1 54  ? 124.143 13.729  11.133  1.00 0.00 ? 54  GLN A HG3  1  
ATOM 897   H HE21 . GLN A 1 54  ? 123.452 12.931  13.121  1.00 0.00 ? 54  GLN A HE21 1  
ATOM 898   H HE22 . GLN A 1 54  ? 122.935 11.300  13.327  1.00 0.00 ? 54  GLN A HE22 1  
ATOM 899   N N    . ASP A 1 55  ? 123.455 15.875  12.814  1.00 0.00 ? 55  ASP A N    1  
ATOM 900   C CA   . ASP A 1 55  ? 124.395 16.967  13.091  1.00 0.00 ? 55  ASP A CA   1  
ATOM 901   C C    . ASP A 1 55  ? 125.403 17.085  11.946  1.00 0.00 ? 55  ASP A C    1  
ATOM 902   O O    . ASP A 1 55  ? 125.550 16.151  11.171  1.00 0.00 ? 55  ASP A O    1  
ATOM 903   C CB   . ASP A 1 55  ? 125.122 16.730  14.424  1.00 0.00 ? 55  ASP A CB   1  
ATOM 904   C CG   . ASP A 1 55  ? 126.119 17.832  14.746  1.00 0.00 ? 55  ASP A CG   1  
ATOM 905   O OD1  . ASP A 1 55  ? 125.687 18.920  15.185  1.00 0.00 ? 55  ASP A OD1  1  
ATOM 906   O OD2  . ASP A 1 55  ? 127.332 17.624  14.543  1.00 0.00 ? 55  ASP A OD2  1  
ATOM 907   H H    . ASP A 1 55  ? 123.553 15.028  13.297  1.00 0.00 ? 55  ASP A H    1  
ATOM 908   H HA   . ASP A 1 55  ? 123.830 17.887  13.154  1.00 0.00 ? 55  ASP A HA   1  
ATOM 909   H HB2  . ASP A 1 55  ? 124.393 16.684  15.221  1.00 0.00 ? 55  ASP A HB2  1  
ATOM 910   H HB3  . ASP A 1 55  ? 125.651 15.788  14.376  1.00 0.00 ? 55  ASP A HB3  1  
ATOM 911   N N    . LYS A 1 56  ? 126.091 18.224  11.842  1.00 0.00 ? 56  LYS A N    1  
ATOM 912   C CA   . LYS A 1 56  ? 127.026 18.470  10.734  1.00 0.00 ? 56  LYS A CA   1  
ATOM 913   C C    . LYS A 1 56  ? 128.086 17.370  10.605  1.00 0.00 ? 56  LYS A C    1  
ATOM 914   O O    . LYS A 1 56  ? 128.157 16.694  9.576   1.00 0.00 ? 56  LYS A O    1  
ATOM 915   C CB   . LYS A 1 56  ? 127.709 19.836  10.891  1.00 0.00 ? 56  LYS A CB   1  
ATOM 916   C CG   . LYS A 1 56  ? 126.794 21.024  10.607  1.00 0.00 ? 56  LYS A CG   1  
ATOM 917   C CD   . LYS A 1 56  ? 126.262 21.013  9.171   1.00 0.00 ? 56  LYS A CD   1  
ATOM 918   C CE   . LYS A 1 56  ? 127.380 21.091  8.131   1.00 0.00 ? 56  LYS A CE   1  
ATOM 919   N NZ   . LYS A 1 56  ? 128.260 22.273  8.330   1.00 0.00 ? 56  LYS A NZ   1  
ATOM 920   H H    . LYS A 1 56  ? 125.967 18.918  12.524  1.00 0.00 ? 56  LYS A H    1  
ATOM 921   H HA   . LYS A 1 56  ? 126.443 18.484  9.824   1.00 0.00 ? 56  LYS A HA   1  
ATOM 922   H HB2  . LYS A 1 56  ? 128.074 19.927  11.905  1.00 0.00 ? 56  LYS A HB2  1  
ATOM 923   H HB3  . LYS A 1 56  ? 128.550 19.888  10.213  1.00 0.00 ? 56  LYS A HB3  1  
ATOM 924   H HG2  . LYS A 1 56  ? 125.955 20.989  11.288  1.00 0.00 ? 56  LYS A HG2  1  
ATOM 925   H HG3  . LYS A 1 56  ? 127.348 21.938  10.769  1.00 0.00 ? 56  LYS A HG3  1  
ATOM 926   H HD2  . LYS A 1 56  ? 125.710 20.098  9.010   1.00 0.00 ? 56  LYS A HD2  1  
ATOM 927   H HD3  . LYS A 1 56  ? 125.602 21.859  9.037   1.00 0.00 ? 56  LYS A HD3  1  
ATOM 928   H HE2  . LYS A 1 56  ? 127.981 20.196  8.197   1.00 0.00 ? 56  LYS A HE2  1  
ATOM 929   H HE3  . LYS A 1 56  ? 126.935 21.149  7.148   1.00 0.00 ? 56  LYS A HE3  1  
ATOM 930   H HZ1  . LYS A 1 56  ? 128.877 22.405  7.501   1.00 0.00 ? 56  LYS A HZ1  1  
ATOM 931   H HZ2  . LYS A 1 56  ? 128.861 22.135  9.167   1.00 0.00 ? 56  LYS A HZ2  1  
ATOM 932   H HZ3  . LYS A 1 56  ? 127.691 23.130  8.466   1.00 0.00 ? 56  LYS A HZ3  1  
ATOM 933   N N    . THR A 1 57  ? 128.910 17.197  11.638  1.00 0.00 ? 57  THR A N    1  
ATOM 934   C CA   . THR A 1 57  ? 129.986 16.208  11.599  1.00 0.00 ? 57  THR A CA   1  
ATOM 935   C C    . THR A 1 57  ? 129.422 14.807  11.378  1.00 0.00 ? 57  THR A C    1  
ATOM 936   O O    . THR A 1 57  ? 129.869 14.075  10.490  1.00 0.00 ? 57  THR A O    1  
ATOM 937   C CB   . THR A 1 57  ? 130.822 16.235  12.900  1.00 0.00 ? 57  THR A CB   1  
ATOM 938   O OG1  . THR A 1 57  ? 129.949 16.290  14.036  1.00 0.00 ? 57  THR A OG1  1  
ATOM 939   C CG2  . THR A 1 57  ? 131.775 17.427  12.923  1.00 0.00 ? 57  THR A CG2  1  
ATOM 940   H H    . THR A 1 57  ? 128.785 17.735  12.449  1.00 0.00 ? 57  THR A H    1  
ATOM 941   H HA   . THR A 1 57  ? 130.637 16.457  10.771  1.00 0.00 ? 57  THR A HA   1  
ATOM 942   H HB   . THR A 1 57  ? 131.408 15.327  12.954  1.00 0.00 ? 57  THR A HB   1  
ATOM 943   H HG1  . THR A 1 57  ? 130.366 15.841  14.781  1.00 0.00 ? 57  THR A HG1  1  
ATOM 944   H HG21 . THR A 1 57  ? 132.340 17.420  13.844  1.00 0.00 ? 57  THR A HG21 1  
ATOM 945   H HG22 . THR A 1 57  ? 131.208 18.345  12.857  1.00 0.00 ? 57  THR A HG22 1  
ATOM 946   H HG23 . THR A 1 57  ? 132.455 17.364  12.085  1.00 0.00 ? 57  THR A HG23 1  
ATOM 947   N N    . GLN A 1 58  ? 128.418 14.458  12.177  1.00 0.00 ? 58  GLN A N    1  
ATOM 948   C CA   . GLN A 1 58  ? 127.742 13.170  12.065  1.00 0.00 ? 58  GLN A CA   1  
ATOM 949   C C    . GLN A 1 58  ? 127.274 12.932  10.633  1.00 0.00 ? 58  GLN A C    1  
ATOM 950   O O    . GLN A 1 58  ? 127.526 11.884  10.053  1.00 0.00 ? 58  GLN A O    1  
ATOM 951   C CB   . GLN A 1 58  ? 126.541 13.121  13.016  1.00 0.00 ? 58  GLN A CB   1  
ATOM 952   C CG   . GLN A 1 58  ? 126.916 13.218  14.492  1.00 0.00 ? 58  GLN A CG   1  
ATOM 953   C CD   . GLN A 1 58  ? 127.915 12.155  14.919  1.00 0.00 ? 58  GLN A CD   1  
ATOM 954   O OE1  . GLN A 1 58  ? 129.128 12.362  14.850  1.00 0.00 ? 58  GLN A OE1  1  
ATOM 955   N NE2  . GLN A 1 58  ? 127.419 11.011  15.365  1.00 0.00 ? 58  GLN A NE2  1  
ATOM 956   H H    . GLN A 1 58  ? 128.128 15.089  12.870  1.00 0.00 ? 58  GLN A H    1  
ATOM 957   H HA   . GLN A 1 58  ? 128.444 12.395  12.340  1.00 0.00 ? 58  GLN A HA   1  
ATOM 958   H HB2  . GLN A 1 58  ? 125.880 13.946  12.780  1.00 0.00 ? 58  GLN A HB2  1  
ATOM 959   H HB3  . GLN A 1 58  ? 126.008 12.197  12.856  1.00 0.00 ? 58  GLN A HB3  1  
ATOM 960   H HG2  . GLN A 1 58  ? 127.350 14.191  14.677  1.00 0.00 ? 58  GLN A HG2  1  
ATOM 961   H HG3  . GLN A 1 58  ? 126.020 13.111  15.087  1.00 0.00 ? 58  GLN A HG3  1  
ATOM 962   H HE21 . GLN A 1 58  ? 126.443 10.909  15.398  1.00 0.00 ? 58  GLN A HE21 1  
ATOM 963   H HE22 . GLN A 1 58  ? 128.046 10.311  15.646  1.00 0.00 ? 58  GLN A HE22 1  
ATOM 964   N N    . MET A 1 59  ? 126.610 13.936  10.082  1.00 0.00 ? 59  MET A N    1  
ATOM 965   C CA   . MET A 1 59  ? 126.057 13.883  8.728   1.00 0.00 ? 59  MET A CA   1  
ATOM 966   C C    . MET A 1 59  ? 127.124 13.529  7.711   1.00 0.00 ? 59  MET A C    1  
ATOM 967   O O    . MET A 1 59  ? 126.927 12.676  6.851   1.00 0.00 ? 59  MET A O    1  
ATOM 968   C CB   . MET A 1 59  ? 125.425 15.234  8.366   1.00 0.00 ? 59  MET A CB   1  
ATOM 969   C CG   . MET A 1 59  ? 124.722 15.255  7.016   1.00 0.00 ? 59  MET A CG   1  
ATOM 970   S SD   . MET A 1 59  ? 124.272 16.925  6.500   1.00 0.00 ? 59  MET A SD   1  
ATOM 971   C CE   . MET A 1 59  ? 125.889 17.696  6.391   1.00 0.00 ? 59  MET A CE   1  
ATOM 972   H H    . MET A 1 59  ? 126.479 14.744  10.610  1.00 0.00 ? 59  MET A H    1  
ATOM 973   H HA   . MET A 1 59  ? 125.301 13.126  8.712   1.00 0.00 ? 59  MET A HA   1  
ATOM 974   H HB2  . MET A 1 59  ? 124.702 15.493  9.125   1.00 0.00 ? 59  MET A HB2  1  
ATOM 975   H HB3  . MET A 1 59  ? 126.201 15.987  8.354   1.00 0.00 ? 59  MET A HB3  1  
ATOM 976   H HG2  . MET A 1 59  ? 125.380 14.827  6.273   1.00 0.00 ? 59  MET A HG2  1  
ATOM 977   H HG3  . MET A 1 59  ? 123.821 14.655  7.082   1.00 0.00 ? 59  MET A HG3  1  
ATOM 978   H HE1  . MET A 1 59  ? 125.777 18.721  6.070   1.00 0.00 ? 59  MET A HE1  1  
ATOM 979   H HE2  . MET A 1 59  ? 126.497 17.160  5.677   1.00 0.00 ? 59  MET A HE2  1  
ATOM 980   H HE3  . MET A 1 59  ? 126.366 17.673  7.360   1.00 0.00 ? 59  MET A HE3  1  
ATOM 981   N N    . GLN A 1 60  ? 128.255 14.184  7.828   1.00 0.00 ? 60  GLN A N    1  
ATOM 982   C CA   . GLN A 1 60  ? 129.364 13.972  6.907   1.00 0.00 ? 60  GLN A CA   1  
ATOM 983   C C    . GLN A 1 60  ? 129.880 12.538  7.016   1.00 0.00 ? 60  GLN A C    1  
ATOM 984   O O    . GLN A 1 60  ? 130.089 11.857  6.007   1.00 0.00 ? 60  GLN A O    1  
ATOM 985   C CB   . GLN A 1 60  ? 130.478 14.983  7.187   1.00 0.00 ? 60  GLN A CB   1  
ATOM 986   C CG   . GLN A 1 60  ? 130.047 16.430  6.948   1.00 0.00 ? 60  GLN A CG   1  
ATOM 987   C CD   . GLN A 1 60  ? 131.181 17.423  7.117   1.00 0.00 ? 60  GLN A CD   1  
ATOM 988   O OE1  . GLN A 1 60  ? 131.882 17.752  6.160   1.00 0.00 ? 60  GLN A OE1  1  
ATOM 989   N NE2  . GLN A 1 60  ? 131.368 17.908  8.334   1.00 0.00 ? 60  GLN A NE2  1  
ATOM 990   H H    . GLN A 1 60  ? 128.351 14.825  8.562   1.00 0.00 ? 60  GLN A H    1  
ATOM 991   H HA   . GLN A 1 60  ? 128.992 14.129  5.903   1.00 0.00 ? 60  GLN A HA   1  
ATOM 992   H HB2  . GLN A 1 60  ? 130.788 14.885  8.219   1.00 0.00 ? 60  GLN A HB2  1  
ATOM 993   H HB3  . GLN A 1 60  ? 131.318 14.764  6.547   1.00 0.00 ? 60  GLN A HB3  1  
ATOM 994   H HG2  . GLN A 1 60  ? 129.666 16.516  5.941   1.00 0.00 ? 60  GLN A HG2  1  
ATOM 995   H HG3  . GLN A 1 60  ? 129.260 16.681  7.648   1.00 0.00 ? 60  GLN A HG3  1  
ATOM 996   H HE21 . GLN A 1 60  ? 130.774 17.602  9.050   1.00 0.00 ? 60  GLN A HE21 1  
ATOM 997   H HE22 . GLN A 1 60  ? 132.096 18.550  8.470   1.00 0.00 ? 60  GLN A HE22 1  
ATOM 998   N N    . GLU A 1 61  ? 130.052 12.079  8.249   1.00 0.00 ? 61  GLU A N    1  
ATOM 999   C CA   . GLU A 1 61  ? 130.487 10.709  8.507   1.00 0.00 ? 61  GLU A CA   1  
ATOM 1000  C C    . GLU A 1 61  ? 129.402 9.704   8.103   1.00 0.00 ? 61  GLU A C    1  
ATOM 1001  O O    . GLU A 1 61  ? 129.697 8.556   7.770   1.00 0.00 ? 61  GLU A O    1  
ATOM 1002  C CB   . GLU A 1 61  ? 130.855 10.532  9.986   1.00 0.00 ? 61  GLU A CB   1  
ATOM 1003  C CG   . GLU A 1 61  ? 131.894 11.533  10.485  1.00 0.00 ? 61  GLU A CG   1  
ATOM 1004  C CD   . GLU A 1 61  ? 133.128 11.603  9.595   1.00 0.00 ? 61  GLU A CD   1  
ATOM 1005  O OE1  . GLU A 1 61  ? 133.902 10.625  9.561   1.00 0.00 ? 61  GLU A OE1  1  
ATOM 1006  O OE2  . GLU A 1 61  ? 133.337 12.645  8.931   1.00 0.00 ? 61  GLU A OE2  1  
ATOM 1007  H H    . GLU A 1 61  ? 129.902 12.686  9.006   1.00 0.00 ? 61  GLU A H    1  
ATOM 1008  H HA   . GLU A 1 61  ? 131.367 10.526  7.905   1.00 0.00 ? 61  GLU A HA   1  
ATOM 1009  H HB2  . GLU A 1 61  ? 129.962 10.644  10.585  1.00 0.00 ? 61  GLU A HB2  1  
ATOM 1010  H HB3  . GLU A 1 61  ? 131.249 9.535   10.131  1.00 0.00 ? 61  GLU A HB3  1  
ATOM 1011  H HG2  . GLU A 1 61  ? 131.439 12.513  10.524  1.00 0.00 ? 61  GLU A HG2  1  
ATOM 1012  H HG3  . GLU A 1 61  ? 132.202 11.245  11.481  1.00 0.00 ? 61  GLU A HG3  1  
ATOM 1013  N N    . LYS A 1 62  ? 128.145 10.142  8.133   1.00 0.00 ? 62  LYS A N    1  
ATOM 1014  C CA   . LYS A 1 62  ? 127.021 9.299   7.725   1.00 0.00 ? 62  LYS A CA   1  
ATOM 1015  C C    . LYS A 1 62  ? 126.891 9.285   6.206   1.00 0.00 ? 62  LYS A C    1  
ATOM 1016  O O    . LYS A 1 62  ? 126.407 8.313   5.625   1.00 0.00 ? 62  LYS A O    1  
ATOM 1017  C CB   . LYS A 1 62  ? 125.710 9.781   8.369   1.00 0.00 ? 62  LYS A CB   1  
ATOM 1018  C CG   . LYS A 1 62  ? 125.621 9.512   9.868   1.00 0.00 ? 62  LYS A CG   1  
ATOM 1019  C CD   . LYS A 1 62  ? 125.681 8.020   10.172  1.00 0.00 ? 62  LYS A CD   1  
ATOM 1020  C CE   . LYS A 1 62  ? 125.635 7.735   11.667  1.00 0.00 ? 62  LYS A CE   1  
ATOM 1021  N NZ   . LYS A 1 62  ? 125.763 6.281   11.949  1.00 0.00 ? 62  LYS A NZ   1  
ATOM 1022  H H    . LYS A 1 62  ? 127.968 11.056  8.439   1.00 0.00 ? 62  LYS A H    1  
ATOM 1023  H HA   . LYS A 1 62  ? 127.226 8.291   8.060   1.00 0.00 ? 62  LYS A HA   1  
ATOM 1024  H HB2  . LYS A 1 62  ? 125.615 10.847  8.212   1.00 0.00 ? 62  LYS A HB2  1  
ATOM 1025  H HB3  . LYS A 1 62  ? 124.879 9.284   7.888   1.00 0.00 ? 62  LYS A HB3  1  
ATOM 1026  H HG2  . LYS A 1 62  ? 126.445 10.005  10.364  1.00 0.00 ? 62  LYS A HG2  1  
ATOM 1027  H HG3  . LYS A 1 62  ? 124.687 9.909   10.241  1.00 0.00 ? 62  LYS A HG3  1  
ATOM 1028  H HD2  . LYS A 1 62  ? 124.840 7.533   9.700   1.00 0.00 ? 62  LYS A HD2  1  
ATOM 1029  H HD3  . LYS A 1 62  ? 126.600 7.617   9.768   1.00 0.00 ? 62  LYS A HD3  1  
ATOM 1030  H HE2  . LYS A 1 62  ? 126.447 8.260   12.150  1.00 0.00 ? 62  LYS A HE2  1  
ATOM 1031  H HE3  . LYS A 1 62  ? 124.691 8.089   12.062  1.00 0.00 ? 62  LYS A HE3  1  
ATOM 1032  H HZ1  . LYS A 1 62  ? 124.932 5.773   11.590  1.00 0.00 ? 62  LYS A HZ1  1  
ATOM 1033  H HZ2  . LYS A 1 62  ? 125.838 6.118   12.973  1.00 0.00 ? 62  LYS A HZ2  1  
ATOM 1034  H HZ3  . LYS A 1 62  ? 126.614 5.898   11.485  1.00 0.00 ? 62  LYS A HZ3  1  
ATOM 1035  N N    . ALA A 1 63  ? 127.346 10.362  5.572   1.00 0.00 ? 63  ALA A N    1  
ATOM 1036  C CA   . ALA A 1 63  ? 127.315 10.475  4.120   1.00 0.00 ? 63  ALA A CA   1  
ATOM 1037  C C    . ALA A 1 63  ? 128.209 9.409   3.503   1.00 0.00 ? 63  ALA A C    1  
ATOM 1038  O O    . ALA A 1 63  ? 127.797 8.654   2.618   1.00 0.00 ? 63  ALA A O    1  
ATOM 1039  C CB   . ALA A 1 63  ? 127.765 11.870  3.684   1.00 0.00 ? 63  ALA A CB   1  
ATOM 1040  H H    . ALA A 1 63  ? 127.720 11.101  6.099   1.00 0.00 ? 63  ALA A H    1  
ATOM 1041  H HA   . ALA A 1 63  ? 126.296 10.324  3.789   1.00 0.00 ? 63  ALA A HA   1  
ATOM 1042  H HB1  . ALA A 1 63  ? 128.795 12.024  3.972   1.00 0.00 ? 63  ALA A HB1  1  
ATOM 1043  H HB2  . ALA A 1 63  ? 127.146 12.616  4.159   1.00 0.00 ? 63  ALA A HB2  1  
ATOM 1044  H HB3  . ALA A 1 63  ? 127.675 11.962  2.608   1.00 0.00 ? 63  ALA A HB3  1  
ATOM 1045  N N    . LYS A 1 64  ? 129.436 9.346   4.000   1.00 0.00 ? 64  LYS A N    1  
ATOM 1046  C CA   . LYS A 1 64  ? 130.406 8.361   3.546   1.00 0.00 ? 64  LYS A CA   1  
ATOM 1047  C C    . LYS A 1 64  ? 130.023 6.967   4.035   1.00 0.00 ? 64  LYS A C    1  
ATOM 1048  O O    . LYS A 1 64  ? 130.309 5.970   3.373   1.00 0.00 ? 64  LYS A O    1  
ATOM 1049  C CB   . LYS A 1 64  ? 131.808 8.752   4.028   1.00 0.00 ? 64  LYS A CB   1  
ATOM 1050  C CG   . LYS A 1 64  ? 131.929 8.906   5.543   1.00 0.00 ? 64  LYS A CG   1  
ATOM 1051  C CD   . LYS A 1 64  ? 133.152 9.734   5.931   1.00 0.00 ? 64  LYS A CD   1  
ATOM 1052  C CE   . LYS A 1 64  ? 134.446 9.129   5.401   1.00 0.00 ? 64  LYS A CE   1  
ATOM 1053  N NZ   . LYS A 1 64  ? 135.610 10.021  5.632   1.00 0.00 ? 64  LYS A NZ   1  
ATOM 1054  H H    . LYS A 1 64  ? 129.698 9.989   4.695   1.00 0.00 ? 64  LYS A H    1  
ATOM 1055  H HA   . LYS A 1 64  ? 130.396 8.362   2.463   1.00 0.00 ? 64  LYS A HA   1  
ATOM 1056  H HB2  . LYS A 1 64  ? 132.507 7.993   3.709   1.00 0.00 ? 64  LYS A HB2  1  
ATOM 1057  H HB3  . LYS A 1 64  ? 132.080 9.691   3.569   1.00 0.00 ? 64  LYS A HB3  1  
ATOM 1058  H HG2  . LYS A 1 64  ? 131.042 9.398   5.918   1.00 0.00 ? 64  LYS A HG2  1  
ATOM 1059  H HG3  . LYS A 1 64  ? 132.011 7.925   5.990   1.00 0.00 ? 64  LYS A HG3  1  
ATOM 1060  H HD2  . LYS A 1 64  ? 133.040 10.729  5.526   1.00 0.00 ? 64  LYS A HD2  1  
ATOM 1061  H HD3  . LYS A 1 64  ? 133.206 9.791   7.010   1.00 0.00 ? 64  LYS A HD3  1  
ATOM 1062  H HE2  . LYS A 1 64  ? 134.622 8.188   5.900   1.00 0.00 ? 64  LYS A HE2  1  
ATOM 1063  H HE3  . LYS A 1 64  ? 134.343 8.956   4.339   1.00 0.00 ? 64  LYS A HE3  1  
ATOM 1064  H HZ1  . LYS A 1 64  ? 136.479 9.577   5.268   1.00 0.00 ? 64  LYS A HZ1  1  
ATOM 1065  H HZ2  . LYS A 1 64  ? 135.728 10.203  6.648   1.00 0.00 ? 64  LYS A HZ2  1  
ATOM 1066  H HZ3  . LYS A 1 64  ? 135.468 10.928  5.144   1.00 0.00 ? 64  LYS A HZ3  1  
ATOM 1067  N N    . GLU A 1 65  ? 129.360 6.912   5.191   1.00 0.00 ? 65  GLU A N    1  
ATOM 1068  C CA   . GLU A 1 65  ? 128.890 5.649   5.758   1.00 0.00 ? 65  GLU A CA   1  
ATOM 1069  C C    . GLU A 1 65  ? 127.911 4.963   4.803   1.00 0.00 ? 65  GLU A C    1  
ATOM 1070  O O    . GLU A 1 65  ? 128.164 3.849   4.340   1.00 0.00 ? 65  GLU A O    1  
ATOM 1071  C CB   . GLU A 1 65  ? 128.216 5.880   7.121   1.00 0.00 ? 65  GLU A CB   1  
ATOM 1072  C CG   . GLU A 1 65  ? 127.777 4.595   7.824   1.00 0.00 ? 65  GLU A CG   1  
ATOM 1073  C CD   . GLU A 1 65  ? 127.038 4.856   9.130   1.00 0.00 ? 65  GLU A CD   1  
ATOM 1074  O OE1  . GLU A 1 65  ? 127.699 5.138   10.154  1.00 0.00 ? 65  GLU A OE1  1  
ATOM 1075  O OE2  . GLU A 1 65  ? 125.790 4.788   9.139   1.00 0.00 ? 65  GLU A OE2  1  
ATOM 1076  H H    . GLU A 1 65  ? 129.196 7.745   5.680   1.00 0.00 ? 65  GLU A H    1  
ATOM 1077  H HA   . GLU A 1 65  ? 129.750 5.008   5.895   1.00 0.00 ? 65  GLU A HA   1  
ATOM 1078  H HB2  . GLU A 1 65  ? 128.909 6.399   7.768   1.00 0.00 ? 65  GLU A HB2  1  
ATOM 1079  H HB3  . GLU A 1 65  ? 127.343 6.501   6.975   1.00 0.00 ? 65  GLU A HB3  1  
ATOM 1080  H HG2  . GLU A 1 65  ? 127.125 4.042   7.162   1.00 0.00 ? 65  GLU A HG2  1  
ATOM 1081  H HG3  . GLU A 1 65  ? 128.655 3.999   8.036   1.00 0.00 ? 65  GLU A HG3  1  
ATOM 1082  N N    . ILE A 1 66  ? 126.802 5.640   4.496   1.00 0.00 ? 66  ILE A N    1  
ATOM 1083  C CA   . ILE A 1 66  ? 125.763 5.065   3.638   1.00 0.00 ? 66  ILE A CA   1  
ATOM 1084  C C    . ILE A 1 66  ? 126.305 4.771   2.242   1.00 0.00 ? 66  ILE A C    1  
ATOM 1085  O O    . ILE A 1 66  ? 125.927 3.778   1.615   1.00 0.00 ? 66  ILE A O    1  
ATOM 1086  C CB   . ILE A 1 66  ? 124.510 5.977   3.536   1.00 0.00 ? 66  ILE A CB   1  
ATOM 1087  C CG1  . ILE A 1 66  ? 124.879 7.374   3.006   1.00 0.00 ? 66  ILE A CG1  1  
ATOM 1088  C CG2  . ILE A 1 66  ? 123.814 6.078   4.891   1.00 0.00 ? 66  ILE A CG2  1  
ATOM 1089  C CD1  . ILE A 1 66  ? 123.704 8.331   2.922   1.00 0.00 ? 66  ILE A CD1  1  
ATOM 1090  H H    . ILE A 1 66  ? 126.681 6.546   4.852   1.00 0.00 ? 66  ILE A H    1  
ATOM 1091  H HA   . ILE A 1 66  ? 125.457 4.128   4.087   1.00 0.00 ? 66  ILE A HA   1  
ATOM 1092  H HB   . ILE A 1 66  ? 123.817 5.513   2.846   1.00 0.00 ? 66  ILE A HB   1  
ATOM 1093  H HG12 . ILE A 1 66  ? 125.617 7.818   3.656   1.00 0.00 ? 66  ILE A HG12 1  
ATOM 1094  H HG13 . ILE A 1 66  ? 125.296 7.277   2.013   1.00 0.00 ? 66  ILE A HG13 1  
ATOM 1095  H HG21 . ILE A 1 66  ? 123.532 5.090   5.226   1.00 0.00 ? 66  ILE A HG21 1  
ATOM 1096  H HG22 . ILE A 1 66  ? 122.928 6.689   4.796   1.00 0.00 ? 66  ILE A HG22 1  
ATOM 1097  H HG23 . ILE A 1 66  ? 124.484 6.525   5.611   1.00 0.00 ? 66  ILE A HG23 1  
ATOM 1098  H HD11 . ILE A 1 66  ? 122.946 7.917   2.273   1.00 0.00 ? 66  ILE A HD11 1  
ATOM 1099  H HD12 . ILE A 1 66  ? 124.040 9.277   2.524   1.00 0.00 ? 66  ILE A HD12 1  
ATOM 1100  H HD13 . ILE A 1 66  ? 123.291 8.483   3.909   1.00 0.00 ? 66  ILE A HD13 1  
ATOM 1101  N N    . TYR A 1 67  ? 127.204 5.624   1.762   1.00 0.00 ? 67  TYR A N    1  
ATOM 1102  C CA   . TYR A 1 67  ? 127.843 5.401   0.473   1.00 0.00 ? 67  TYR A CA   1  
ATOM 1103  C C    . TYR A 1 67  ? 128.677 4.120   0.514   1.00 0.00 ? 67  TYR A C    1  
ATOM 1104  O O    . TYR A 1 67  ? 128.544 3.261   -0.350  1.00 0.00 ? 67  TYR A O    1  
ATOM 1105  C CB   . TYR A 1 67  ? 128.720 6.603   0.083   1.00 0.00 ? 67  TYR A CB   1  
ATOM 1106  C CG   . TYR A 1 67  ? 129.523 6.393   -1.194  1.00 0.00 ? 67  TYR A CG   1  
ATOM 1107  C CD1  . TYR A 1 67  ? 128.895 6.064   -2.391  1.00 0.00 ? 67  TYR A CD1  1  
ATOM 1108  C CD2  . TYR A 1 67  ? 130.909 6.521   -1.198  1.00 0.00 ? 67  TYR A CD2  1  
ATOM 1109  C CE1  . TYR A 1 67  ? 129.623 5.867   -3.551  1.00 0.00 ? 67  TYR A CE1  1  
ATOM 1110  C CE2  . TYR A 1 67  ? 131.642 6.329   -2.354  1.00 0.00 ? 67  TYR A CE2  1  
ATOM 1111  C CZ   . TYR A 1 67  ? 130.996 6.000   -3.527  1.00 0.00 ? 67  TYR A CZ   1  
ATOM 1112  O OH   . TYR A 1 67  ? 131.726 5.806   -4.677  1.00 0.00 ? 67  TYR A OH   1  
ATOM 1113  H H    . TYR A 1 67  ? 127.439 6.422   2.285   1.00 0.00 ? 67  TYR A H    1  
ATOM 1114  H HA   . TYR A 1 67  ? 127.061 5.282   -0.266  1.00 0.00 ? 67  TYR A HA   1  
ATOM 1115  H HB2  . TYR A 1 67  ? 128.088 7.467   -0.064  1.00 0.00 ? 67  TYR A HB2  1  
ATOM 1116  H HB3  . TYR A 1 67  ? 129.415 6.807   0.886   1.00 0.00 ? 67  TYR A HB3  1  
ATOM 1117  H HD1  . TYR A 1 67  ? 127.819 5.960   -2.409  1.00 0.00 ? 67  TYR A HD1  1  
ATOM 1118  H HD2  . TYR A 1 67  ? 131.416 6.779   -0.279  1.00 0.00 ? 67  TYR A HD2  1  
ATOM 1119  H HE1  . TYR A 1 67  ? 129.115 5.613   -4.470  1.00 0.00 ? 67  TYR A HE1  1  
ATOM 1120  H HE2  . TYR A 1 67  ? 132.717 6.433   -2.335  1.00 0.00 ? 67  TYR A HE2  1  
ATOM 1121  H HH   . TYR A 1 67  ? 131.190 6.031   -5.446  1.00 0.00 ? 67  TYR A HH   1  
ATOM 1122  N N    . MET A 1 68  ? 129.502 3.988   1.545   1.00 0.00 ? 68  MET A N    1  
ATOM 1123  C CA   . MET A 1 68  ? 130.436 2.866   1.659   1.00 0.00 ? 68  MET A CA   1  
ATOM 1124  C C    . MET A 1 68  ? 129.708 1.544   1.929   1.00 0.00 ? 68  MET A C    1  
ATOM 1125  O O    . MET A 1 68  ? 130.174 0.477   1.520   1.00 0.00 ? 68  MET A O    1  
ATOM 1126  C CB   . MET A 1 68  ? 131.453 3.144   2.778   1.00 0.00 ? 68  MET A CB   1  
ATOM 1127  C CG   . MET A 1 68  ? 132.501 2.051   2.959   1.00 0.00 ? 68  MET A CG   1  
ATOM 1128  S SD   . MET A 1 68  ? 133.683 2.438   4.267   1.00 0.00 ? 68  MET A SD   1  
ATOM 1129  C CE   . MET A 1 68  ? 134.725 0.980   4.234   1.00 0.00 ? 68  MET A CE   1  
ATOM 1130  H H    . MET A 1 68  ? 129.485 4.663   2.257   1.00 0.00 ? 68  MET A H    1  
ATOM 1131  H HA   . MET A 1 68  ? 130.967 2.782   0.721   1.00 0.00 ? 68  MET A HA   1  
ATOM 1132  H HB2  . MET A 1 68  ? 131.967 4.069   2.556   1.00 0.00 ? 68  MET A HB2  1  
ATOM 1133  H HB3  . MET A 1 68  ? 130.920 3.259   3.712   1.00 0.00 ? 68  MET A HB3  1  
ATOM 1134  H HG2  . MET A 1 68  ? 132.001 1.127   3.208   1.00 0.00 ? 68  MET A HG2  1  
ATOM 1135  H HG3  . MET A 1 68  ? 133.041 1.928   2.030   1.00 0.00 ? 68  MET A HG3  1  
ATOM 1136  H HE1  . MET A 1 68  ? 134.127 0.105   4.438   1.00 0.00 ? 68  MET A HE1  1  
ATOM 1137  H HE2  . MET A 1 68  ? 135.496 1.072   4.984   1.00 0.00 ? 68  MET A HE2  1  
ATOM 1138  H HE3  . MET A 1 68  ? 135.182 0.885   3.259   1.00 0.00 ? 68  MET A HE3  1  
ATOM 1139  N N    . THR A 1 69  ? 128.571 1.615   2.610   1.00 0.00 ? 69  THR A N    1  
ATOM 1140  C CA   . THR A 1 69  ? 127.845 0.415   3.016   1.00 0.00 ? 69  THR A CA   1  
ATOM 1141  C C    . THR A 1 69  ? 126.887 -0.078  1.928   1.00 0.00 ? 69  THR A C    1  
ATOM 1142  O O    . THR A 1 69  ? 126.820 -1.278  1.652   1.00 0.00 ? 69  THR A O    1  
ATOM 1143  C CB   . THR A 1 69  ? 127.054 0.664   4.321   1.00 0.00 ? 69  THR A CB   1  
ATOM 1144  O OG1  . THR A 1 69  ? 126.280 1.864   4.195   1.00 0.00 ? 69  THR A OG1  1  
ATOM 1145  C CG2  . THR A 1 69  ? 127.989 0.784   5.521   1.00 0.00 ? 69  THR A CG2  1  
ATOM 1146  H H    . THR A 1 69  ? 128.210 2.495   2.851   1.00 0.00 ? 69  THR A H    1  
ATOM 1147  H HA   . THR A 1 69  ? 128.572 -0.362  3.211   1.00 0.00 ? 69  THR A HA   1  
ATOM 1148  H HB   . THR A 1 69  ? 126.384 -0.170  4.486   1.00 0.00 ? 69  THR A HB   1  
ATOM 1149  H HG1  . THR A 1 69  ? 126.747 2.589   4.620   1.00 0.00 ? 69  THR A HG1  1  
ATOM 1150  H HG21 . THR A 1 69  ? 128.572 -0.121  5.618   1.00 0.00 ? 69  THR A HG21 1  
ATOM 1151  H HG22 . THR A 1 69  ? 127.407 0.933   6.419   1.00 0.00 ? 69  THR A HG22 1  
ATOM 1152  H HG23 . THR A 1 69  ? 128.653 1.626   5.381   1.00 0.00 ? 69  THR A HG23 1  
ATOM 1153  N N    . PHE A 1 70  ? 126.152 0.841   1.305   1.00 0.00 ? 70  PHE A N    1  
ATOM 1154  C CA   . PHE A 1 70  ? 125.089 0.464   0.369   1.00 0.00 ? 70  PHE A CA   1  
ATOM 1155  C C    . PHE A 1 70  ? 125.543 0.574   -1.086  1.00 0.00 ? 70  PHE A C    1  
ATOM 1156  O O    . PHE A 1 70  ? 125.116 -0.212  -1.937  1.00 0.00 ? 70  PHE A O    1  
ATOM 1157  C CB   . PHE A 1 70  ? 123.847 1.334   0.605   1.00 0.00 ? 70  PHE A CB   1  
ATOM 1158  C CG   . PHE A 1 70  ? 123.350 1.293   2.031   1.00 0.00 ? 70  PHE A CG   1  
ATOM 1159  C CD1  . PHE A 1 70  ? 122.993 0.088   2.620   1.00 0.00 ? 70  PHE A CD1  1  
ATOM 1160  C CD2  . PHE A 1 70  ? 123.253 2.454   2.785   1.00 0.00 ? 70  PHE A CD2  1  
ATOM 1161  C CE1  . PHE A 1 70  ? 122.548 0.044   3.928   1.00 0.00 ? 70  PHE A CE1  1  
ATOM 1162  C CE2  . PHE A 1 70  ? 122.809 2.415   4.093   1.00 0.00 ? 70  PHE A CE2  1  
ATOM 1163  C CZ   . PHE A 1 70  ? 122.456 1.209   4.665   1.00 0.00 ? 70  PHE A CZ   1  
ATOM 1164  H H    . PHE A 1 70  ? 126.320 1.792   1.482   1.00 0.00 ? 70  PHE A H    1  
ATOM 1165  H HA   . PHE A 1 70  ? 124.828 -0.568  0.566   1.00 0.00 ? 70  PHE A HA   1  
ATOM 1166  H HB2  . PHE A 1 70  ? 124.082 2.361   0.360   1.00 0.00 ? 70  PHE A HB2  1  
ATOM 1167  H HB3  . PHE A 1 70  ? 123.047 0.991   -0.037  1.00 0.00 ? 70  PHE A HB3  1  
ATOM 1168  H HD1  . PHE A 1 70  ? 123.064 -0.825  2.047   1.00 0.00 ? 70  PHE A HD1  1  
ATOM 1169  H HD2  . PHE A 1 70  ? 123.526 3.400   2.340   1.00 0.00 ? 70  PHE A HD2  1  
ATOM 1170  H HE1  . PHE A 1 70  ? 122.273 -0.901  4.374   1.00 0.00 ? 70  PHE A HE1  1  
ATOM 1171  H HE2  . PHE A 1 70  ? 122.738 3.327   4.668   1.00 0.00 ? 70  PHE A HE2  1  
ATOM 1172  H HZ   . PHE A 1 70  ? 122.110 1.175   5.688   1.00 0.00 ? 70  PHE A HZ   1  
ATOM 1173  N N    . LEU A 1 71  ? 126.403 1.547   -1.374  1.00 0.00 ? 71  LEU A N    1  
ATOM 1174  C CA   . LEU A 1 71  ? 126.882 1.764   -2.738  1.00 0.00 ? 71  LEU A CA   1  
ATOM 1175  C C    . LEU A 1 71  ? 128.354 1.371   -2.861  1.00 0.00 ? 71  LEU A C    1  
ATOM 1176  O O    . LEU A 1 71  ? 128.670 0.224   -3.183  1.00 0.00 ? 71  LEU A O    1  
ATOM 1177  C CB   . LEU A 1 71  ? 126.674 3.229   -3.160  1.00 0.00 ? 71  LEU A CB   1  
ATOM 1178  C CG   . LEU A 1 71  ? 125.216 3.719   -3.154  1.00 0.00 ? 71  LEU A CG   1  
ATOM 1179  C CD1  . LEU A 1 71  ? 125.142 5.192   -3.546  1.00 0.00 ? 71  LEU A CD1  1  
ATOM 1180  C CD2  . LEU A 1 71  ? 124.353 2.867   -4.084  1.00 0.00 ? 71  LEU A CD2  1  
ATOM 1181  H H    . LEU A 1 71  ? 126.731 2.126   -0.655  1.00 0.00 ? 71  LEU A H    1  
ATOM 1182  H HA   . LEU A 1 71  ? 126.303 1.130   -3.398  1.00 0.00 ? 71  LEU A HA   1  
ATOM 1183  H HB2  . LEU A 1 71  ? 127.246 3.856   -2.489  1.00 0.00 ? 71  LEU A HB2  1  
ATOM 1184  H HB3  . LEU A 1 71  ? 127.068 3.353   -4.160  1.00 0.00 ? 71  LEU A HB3  1  
ATOM 1185  H HG   . LEU A 1 71  ? 124.819 3.625   -2.152  1.00 0.00 ? 71  LEU A HG   1  
ATOM 1186  H HD11 . LEU A 1 71  ? 125.540 5.323   -4.543  1.00 0.00 ? 71  LEU A HD11 1  
ATOM 1187  H HD12 . LEU A 1 71  ? 125.721 5.780   -2.849  1.00 0.00 ? 71  LEU A HD12 1  
ATOM 1188  H HD13 . LEU A 1 71  ? 124.113 5.520   -3.523  1.00 0.00 ? 71  LEU A HD13 1  
ATOM 1189  H HD21 . LEU A 1 71  ? 124.741 2.924   -5.092  1.00 0.00 ? 71  LEU A HD21 1  
ATOM 1190  H HD22 . LEU A 1 71  ? 123.337 3.234   -4.070  1.00 0.00 ? 71  LEU A HD22 1  
ATOM 1191  H HD23 . LEU A 1 71  ? 124.367 1.839   -3.750  1.00 0.00 ? 71  LEU A HD23 1  
ATOM 1192  N N    . SER A 1 72  ? 129.245 2.318   -2.571  1.00 0.00 ? 72  SER A N    1  
ATOM 1193  C CA   . SER A 1 72  ? 130.685 2.096   -2.666  1.00 0.00 ? 72  SER A CA   1  
ATOM 1194  C C    . SER A 1 72  ? 131.073 1.635   -4.077  1.00 0.00 ? 72  SER A C    1  
ATOM 1195  O O    . SER A 1 72  ? 130.291 1.761   -5.023  1.00 0.00 ? 72  SER A O    1  
ATOM 1196  C CB   . SER A 1 72  ? 131.121 1.064   -1.613  1.00 0.00 ? 72  SER A CB   1  
ATOM 1197  O OG   . SER A 1 72  ? 132.530 0.922   -1.578  1.00 0.00 ? 72  SER A OG   1  
ATOM 1198  H H    . SER A 1 72  ? 128.924 3.188   -2.264  1.00 0.00 ? 72  SER A H    1  
ATOM 1199  H HA   . SER A 1 72  ? 131.177 3.036   -2.462  1.00 0.00 ? 72  SER A HA   1  
ATOM 1200  H HB2  . SER A 1 72  ? 130.783 1.384   -0.638  1.00 0.00 ? 72  SER A HB2  1  
ATOM 1201  H HB3  . SER A 1 72  ? 130.681 0.105   -1.847  1.00 0.00 ? 72  SER A HB3  1  
ATOM 1202  H HG   . SER A 1 72  ? 132.763 0.178   -1.012  1.00 0.00 ? 72  SER A HG   1  
ATOM 1203  N N    . SER A 1 73  ? 132.292 1.130   -4.217  1.00 0.00 ? 73  SER A N    1  
ATOM 1204  C CA   . SER A 1 73  ? 132.754 0.577   -5.482  1.00 0.00 ? 73  SER A CA   1  
ATOM 1205  C C    . SER A 1 73  ? 132.408 -0.914  -5.568  1.00 0.00 ? 73  SER A C    1  
ATOM 1206  O O    . SER A 1 73  ? 132.383 -1.498  -6.654  1.00 0.00 ? 73  SER A O    1  
ATOM 1207  C CB   . SER A 1 73  ? 134.267 0.786   -5.615  1.00 0.00 ? 73  SER A CB   1  
ATOM 1208  O OG   . SER A 1 73  ? 134.614 2.147   -5.395  1.00 0.00 ? 73  SER A OG   1  
ATOM 1209  H H    . SER A 1 73  ? 132.904 1.140   -3.450  1.00 0.00 ? 73  SER A H    1  
ATOM 1210  H HA   . SER A 1 73  ? 132.253 1.101   -6.284  1.00 0.00 ? 73  SER A HA   1  
ATOM 1211  H HB2  . SER A 1 73  ? 134.780 0.176   -4.885  1.00 0.00 ? 73  SER A HB2  1  
ATOM 1212  H HB3  . SER A 1 73  ? 134.584 0.503   -6.608  1.00 0.00 ? 73  SER A HB3  1  
ATOM 1213  H HG   . SER A 1 73  ? 133.937 2.715   -5.780  1.00 0.00 ? 73  SER A HG   1  
ATOM 1214  N N    . LYS A 1 74  ? 132.135 -1.525  -4.413  1.00 0.00 ? 74  LYS A N    1  
ATOM 1215  C CA   . LYS A 1 74  ? 131.801 -2.947  -4.339  1.00 0.00 ? 74  LYS A CA   1  
ATOM 1216  C C    . LYS A 1 74  ? 130.684 -3.170  -3.323  1.00 0.00 ? 74  LYS A C    1  
ATOM 1217  O O    . LYS A 1 74  ? 129.608 -3.663  -3.668  1.00 0.00 ? 74  LYS A O    1  
ATOM 1218  C CB   . LYS A 1 74  ? 133.037 -3.779  -3.951  1.00 0.00 ? 74  LYS A CB   1  
ATOM 1219  C CG   . LYS A 1 74  ? 134.177 -3.706  -4.961  1.00 0.00 ? 74  LYS A CG   1  
ATOM 1220  C CD   . LYS A 1 74  ? 135.405 -4.488  -4.500  1.00 0.00 ? 74  LYS A CD   1  
ATOM 1221  C CE   . LYS A 1 74  ? 136.543 -4.393  -5.511  1.00 0.00 ? 74  LYS A CE   1  
ATOM 1222  N NZ   . LYS A 1 74  ? 136.959 -2.986  -5.754  1.00 0.00 ? 74  LYS A NZ   1  
ATOM 1223  H H    . LYS A 1 74  ? 132.147 -1.002  -3.586  1.00 0.00 ? 74  LYS A H    1  
ATOM 1224  H HA   . LYS A 1 74  ? 131.453 -3.263  -5.314  1.00 0.00 ? 74  LYS A HA   1  
ATOM 1225  H HB2  . LYS A 1 74  ? 133.406 -3.429  -2.997  1.00 0.00 ? 74  LYS A HB2  1  
ATOM 1226  H HB3  . LYS A 1 74  ? 132.741 -4.814  -3.850  1.00 0.00 ? 74  LYS A HB3  1  
ATOM 1227  H HG2  . LYS A 1 74  ? 133.837 -4.116  -5.901  1.00 0.00 ? 74  LYS A HG2  1  
ATOM 1228  H HG3  . LYS A 1 74  ? 134.454 -2.669  -5.101  1.00 0.00 ? 74  LYS A HG3  1  
ATOM 1229  H HD2  . LYS A 1 74  ? 135.742 -4.088  -3.555  1.00 0.00 ? 74  LYS A HD2  1  
ATOM 1230  H HD3  . LYS A 1 74  ? 135.132 -5.528  -4.375  1.00 0.00 ? 74  LYS A HD3  1  
ATOM 1231  H HE2  . LYS A 1 74  ? 137.391 -4.947  -5.134  1.00 0.00 ? 74  LYS A HE2  1  
ATOM 1232  H HE3  . LYS A 1 74  ? 136.217 -4.829  -6.445  1.00 0.00 ? 74  LYS A HE3  1  
ATOM 1233  H HZ1  . LYS A 1 74  ? 136.163 -2.434  -6.131  1.00 0.00 ? 74  LYS A HZ1  1  
ATOM 1234  H HZ2  . LYS A 1 74  ? 137.738 -2.956  -6.440  1.00 0.00 ? 74  LYS A HZ2  1  
ATOM 1235  H HZ3  . LYS A 1 74  ? 137.281 -2.548  -4.863  1.00 0.00 ? 74  LYS A HZ3  1  
ATOM 1236  N N    . ALA A 1 75  ? 130.958 -2.806  -2.066  1.00 0.00 ? 75  ALA A N    1  
ATOM 1237  C CA   . ALA A 1 75  ? 129.992 -2.951  -0.972  1.00 0.00 ? 75  ALA A CA   1  
ATOM 1238  C C    . ALA A 1 75  ? 129.501 -4.394  -0.857  1.00 0.00 ? 75  ALA A C    1  
ATOM 1239  O O    . ALA A 1 75  ? 128.375 -4.641  -0.422  1.00 0.00 ? 75  ALA A O    1  
ATOM 1240  C CB   . ALA A 1 75  ? 128.817 -1.997  -1.166  1.00 0.00 ? 75  ALA A CB   1  
ATOM 1241  H H    . ALA A 1 75  ? 131.841 -2.428  -1.866  1.00 0.00 ? 75  ALA A H    1  
ATOM 1242  H HA   . ALA A 1 75  ? 130.494 -2.683  -0.052  1.00 0.00 ? 75  ALA A HA   1  
ATOM 1243  H HB1  . ALA A 1 75  ? 128.142 -2.079  -0.325  1.00 0.00 ? 75  ALA A HB1  1  
ATOM 1244  H HB2  . ALA A 1 75  ? 128.290 -2.253  -2.075  1.00 0.00 ? 75  ALA A HB2  1  
ATOM 1245  H HB3  . ALA A 1 75  ? 129.183 -0.983  -1.236  1.00 0.00 ? 75  ALA A HB3  1  
ATOM 1246  N N    . SER A 1 76  ? 130.364 -5.332  -1.257  1.00 0.00 ? 76  SER A N    1  
ATOM 1247  C CA   . SER A 1 76  ? 130.062 -6.770  -1.266  1.00 0.00 ? 76  SER A CA   1  
ATOM 1248  C C    . SER A 1 76  ? 128.799 -7.102  -2.067  1.00 0.00 ? 76  SER A C    1  
ATOM 1249  O O    . SER A 1 76  ? 128.308 -8.234  -2.029  1.00 0.00 ? 76  SER A O    1  
ATOM 1250  C CB   . SER A 1 76  ? 129.983 -7.330  0.163   1.00 0.00 ? 76  SER A CB   1  
ATOM 1251  O OG   . SER A 1 76  ? 129.134 -6.567  1.009   1.00 0.00 ? 76  SER A OG   1  
ATOM 1252  H H    . SER A 1 76  ? 131.252 -5.048  -1.556  1.00 0.00 ? 76  SER A H    1  
ATOM 1253  H HA   . SER A 1 76  ? 130.892 -7.252  -1.765  1.00 0.00 ? 76  SER A HA   1  
ATOM 1254  H HB2  . SER A 1 76  ? 129.608 -8.339  0.127   1.00 0.00 ? 76  SER A HB2  1  
ATOM 1255  H HB3  . SER A 1 76  ? 130.972 -7.333  0.585   1.00 0.00 ? 76  SER A HB3  1  
ATOM 1256  H HG   . SER A 1 76  ? 128.353 -6.287  0.511   1.00 0.00 ? 76  SER A HG   1  
ATOM 1257  N N    . SER A 1 77  ? 128.311 -6.117  -2.812  1.00 0.00 ? 77  SER A N    1  
ATOM 1258  C CA   . SER A 1 77  ? 127.146 -6.288  -3.678  1.00 0.00 ? 77  SER A CA   1  
ATOM 1259  C C    . SER A 1 77  ? 126.774 -4.973  -4.358  1.00 0.00 ? 77  SER A C    1  
ATOM 1260  O O    . SER A 1 77  ? 127.049 -4.779  -5.546  1.00 0.00 ? 77  SER A O    1  
ATOM 1261  C CB   . SER A 1 77  ? 125.941 -6.828  -2.887  1.00 0.00 ? 77  SER A CB   1  
ATOM 1262  O OG   . SER A 1 77  ? 125.627 -5.996  -1.778  1.00 0.00 ? 77  SER A OG   1  
ATOM 1263  H H    . SER A 1 77  ? 128.756 -5.247  -2.781  1.00 0.00 ? 77  SER A H    1  
ATOM 1264  H HA   . SER A 1 77  ? 127.409 -7.005  -4.440  1.00 0.00 ? 77  SER A HA   1  
ATOM 1265  H HB2  . SER A 1 77  ? 125.079 -6.879  -3.534  1.00 0.00 ? 77  SER A HB2  1  
ATOM 1266  H HB3  . SER A 1 77  ? 126.171 -7.819  -2.521  1.00 0.00 ? 77  SER A HB3  1  
ATOM 1267  H HG   . SER A 1 77  ? 124.674 -6.037  -1.611  1.00 0.00 ? 77  SER A HG   1  
ATOM 1268  N N    . GLN A 1 78  ? 126.176 -4.071  -3.579  1.00 0.00 ? 78  GLN A N    1  
ATOM 1269  C CA   . GLN A 1 78  ? 125.615 -2.816  -4.086  1.00 0.00 ? 78  GLN A CA   1  
ATOM 1270  C C    . GLN A 1 78  ? 124.436 -3.085  -5.024  1.00 0.00 ? 78  GLN A C    1  
ATOM 1271  O O    . GLN A 1 78  ? 124.396 -4.095  -5.735  1.00 0.00 ? 78  GLN A O    1  
ATOM 1272  C CB   . GLN A 1 78  ? 126.673 -1.964  -4.812  1.00 0.00 ? 78  GLN A CB   1  
ATOM 1273  C CG   . GLN A 1 78  ? 126.118 -0.665  -5.399  1.00 0.00 ? 78  GLN A CG   1  
ATOM 1274  C CD   . GLN A 1 78  ? 127.141 0.143   -6.184  1.00 0.00 ? 78  GLN A CD   1  
ATOM 1275  O OE1  . GLN A 1 78  ? 126.794 0.847   -7.132  1.00 0.00 ? 78  GLN A OE1  1  
ATOM 1276  N NE2  . GLN A 1 78  ? 128.401 0.064   -5.792  1.00 0.00 ? 78  GLN A NE2  1  
ATOM 1277  H H    . GLN A 1 78  ? 126.103 -4.262  -2.619  1.00 0.00 ? 78  GLN A H    1  
ATOM 1278  H HA   . GLN A 1 78  ? 125.250 -2.261  -3.232  1.00 0.00 ? 78  GLN A HA   1  
ATOM 1279  H HB2  . GLN A 1 78  ? 127.455 -1.712  -4.111  1.00 0.00 ? 78  GLN A HB2  1  
ATOM 1280  H HB3  . GLN A 1 78  ? 127.096 -2.546  -5.616  1.00 0.00 ? 78  GLN A HB3  1  
ATOM 1281  H HG2  . GLN A 1 78  ? 125.300 -0.909  -6.061  1.00 0.00 ? 78  GLN A HG2  1  
ATOM 1282  H HG3  . GLN A 1 78  ? 125.746 -0.053  -4.589  1.00 0.00 ? 78  GLN A HG3  1  
ATOM 1283  H HE21 . GLN A 1 78  ? 128.613 -0.507  -5.023  1.00 0.00 ? 78  GLN A HE21 1  
ATOM 1284  H HE22 . GLN A 1 78  ? 129.071 0.596   -6.270  1.00 0.00 ? 78  GLN A HE22 1  
ATOM 1285  N N    . VAL A 1 79  ? 123.473 -2.179  -5.018  1.00 0.00 ? 79  VAL A N    1  
ATOM 1286  C CA   . VAL A 1 79  ? 122.348 -2.260  -5.938  1.00 0.00 ? 79  VAL A CA   1  
ATOM 1287  C C    . VAL A 1 79  ? 122.776 -1.764  -7.315  1.00 0.00 ? 79  VAL A C    1  
ATOM 1288  O O    . VAL A 1 79  ? 123.524 -0.793  -7.433  1.00 0.00 ? 79  VAL A O    1  
ATOM 1289  C CB   . VAL A 1 79  ? 121.117 -1.468  -5.427  1.00 0.00 ? 79  VAL A CB   1  
ATOM 1290  C CG1  . VAL A 1 79  ? 121.495 -0.038  -5.041  1.00 0.00 ? 79  VAL A CG1  1  
ATOM 1291  C CG2  . VAL A 1 79  ? 119.988 -1.476  -6.459  1.00 0.00 ? 79  VAL A CG2  1  
ATOM 1292  H H    . VAL A 1 79  ? 123.533 -1.429  -4.393  1.00 0.00 ? 79  VAL A H    1  
ATOM 1293  H HA   . VAL A 1 79  ? 122.066 -3.304  -6.021  1.00 0.00 ? 79  VAL A HA   1  
ATOM 1294  H HB   . VAL A 1 79  ? 120.756 -1.967  -4.543  1.00 0.00 ? 79  VAL A HB   1  
ATOM 1295  H HG11 . VAL A 1 79  ? 122.230 -0.059  -4.249  1.00 0.00 ? 79  VAL A HG11 1  
ATOM 1296  H HG12 . VAL A 1 79  ? 120.616 0.489   -4.700  1.00 0.00 ? 79  VAL A HG12 1  
ATOM 1297  H HG13 . VAL A 1 79  ? 121.907 0.470   -5.899  1.00 0.00 ? 79  VAL A HG13 1  
ATOM 1298  H HG21 . VAL A 1 79  ? 119.144 -0.921  -6.075  1.00 0.00 ? 79  VAL A HG21 1  
ATOM 1299  H HG22 . VAL A 1 79  ? 119.687 -2.495  -6.657  1.00 0.00 ? 79  VAL A HG22 1  
ATOM 1300  H HG23 . VAL A 1 79  ? 120.332 -1.020  -7.375  1.00 0.00 ? 79  VAL A HG23 1  
ATOM 1301  N N    . ASN A 1 80  ? 122.314 -2.455  -8.344  1.00 0.00 ? 80  ASN A N    1  
ATOM 1302  C CA   . ASN A 1 80  ? 122.740 -2.184  -9.719  1.00 0.00 ? 80  ASN A CA   1  
ATOM 1303  C C    . ASN A 1 80  ? 122.178 -0.856  -10.230 1.00 0.00 ? 80  ASN A C    1  
ATOM 1304  O O    . ASN A 1 80  ? 121.183 -0.815  -10.956 1.00 0.00 ? 80  ASN A O    1  
ATOM 1305  C CB   . ASN A 1 80  ? 122.358 -3.349  -10.651 1.00 0.00 ? 80  ASN A CB   1  
ATOM 1306  C CG   . ASN A 1 80  ? 120.908 -3.787  -10.505 1.00 0.00 ? 80  ASN A CG   1  
ATOM 1307  O OD1  . ASN A 1 80  ? 120.022 -3.317  -11.220 1.00 0.00 ? 80  ASN A OD1  1  
ATOM 1308  N ND2  . ASN A 1 80  ? 120.657 -4.698  -9.574  1.00 0.00 ? 80  ASN A ND2  1  
ATOM 1309  H H    . ASN A 1 80  ? 121.657 -3.162  -8.175  1.00 0.00 ? 80  ASN A H    1  
ATOM 1310  H HA   . ASN A 1 80  ? 123.820 -2.103  -9.706  1.00 0.00 ? 80  ASN A HA   1  
ATOM 1311  H HB2  . ASN A 1 80  ? 122.518 -3.048  -11.676 1.00 0.00 ? 80  ASN A HB2  1  
ATOM 1312  H HB3  . ASN A 1 80  ? 122.993 -4.197  -10.433 1.00 0.00 ? 80  ASN A HB3  1  
ATOM 1313  H HD21 . ASN A 1 80  ? 121.410 -5.037  -9.040  1.00 0.00 ? 80  ASN A HD21 1  
ATOM 1314  H HD22 . ASN A 1 80  ? 119.729 -4.996  -9.457  1.00 0.00 ? 80  ASN A HD22 1  
ATOM 1315  N N    . VAL A 1 81  ? 122.821 0.233   -9.813  1.00 0.00 ? 81  VAL A N    1  
ATOM 1316  C CA   . VAL A 1 81  ? 122.460 1.584   -10.237 1.00 0.00 ? 81  VAL A CA   1  
ATOM 1317  C C    . VAL A 1 81  ? 123.720 2.436   -10.376 1.00 0.00 ? 81  VAL A C    1  
ATOM 1318  O O    . VAL A 1 81  ? 124.840 1.922   -10.317 1.00 0.00 ? 81  VAL A O    1  
ATOM 1319  C CB   . VAL A 1 81  ? 121.497 2.277   -9.229  1.00 0.00 ? 81  VAL A CB   1  
ATOM 1320  C CG1  . VAL A 1 81  ? 120.165 1.537   -9.128  1.00 0.00 ? 81  VAL A CG1  1  
ATOM 1321  C CG2  . VAL A 1 81  ? 122.155 2.410   -7.855  1.00 0.00 ? 81  VAL A CG2  1  
ATOM 1322  H H    . VAL A 1 81  ? 123.575 0.125   -9.193  1.00 0.00 ? 81  VAL A H    1  
ATOM 1323  H HA   . VAL A 1 81  ? 121.969 1.522   -11.199 1.00 0.00 ? 81  VAL A HA   1  
ATOM 1324  H HB   . VAL A 1 81  ? 121.291 3.274   -9.596  1.00 0.00 ? 81  VAL A HB   1  
ATOM 1325  H HG11 . VAL A 1 81  ? 119.529 2.031   -8.406  1.00 0.00 ? 81  VAL A HG11 1  
ATOM 1326  H HG12 . VAL A 1 81  ? 120.340 0.519   -8.814  1.00 0.00 ? 81  VAL A HG12 1  
ATOM 1327  H HG13 . VAL A 1 81  ? 119.679 1.536   -10.093 1.00 0.00 ? 81  VAL A HG13 1  
ATOM 1328  H HG21 . VAL A 1 81  ? 123.022 3.052   -7.930  1.00 0.00 ? 81  VAL A HG21 1  
ATOM 1329  H HG22 . VAL A 1 81  ? 122.460 1.436   -7.504  1.00 0.00 ? 81  VAL A HG22 1  
ATOM 1330  H HG23 . VAL A 1 81  ? 121.450 2.840   -7.156  1.00 0.00 ? 81  VAL A HG23 1  
ATOM 1331  N N    . GLU A 1 82  ? 123.524 3.733   -10.568 1.00 0.00 ? 82  GLU A N    1  
ATOM 1332  C CA   . GLU A 1 82  ? 124.615 4.695   -10.612 1.00 0.00 ? 82  GLU A CA   1  
ATOM 1333  C C    . GLU A 1 82  ? 125.336 4.740   -9.259  1.00 0.00 ? 82  GLU A C    1  
ATOM 1334  O O    . GLU A 1 82  ? 124.789 5.246   -8.278  1.00 0.00 ? 82  GLU A O    1  
ATOM 1335  C CB   . GLU A 1 82  ? 124.044 6.074   -10.967 1.00 0.00 ? 82  GLU A CB   1  
ATOM 1336  C CG   . GLU A 1 82  ? 125.089 7.158   -11.167 1.00 0.00 ? 82  GLU A CG   1  
ATOM 1337  C CD   . GLU A 1 82  ? 124.469 8.499   -11.525 1.00 0.00 ? 82  GLU A CD   1  
ATOM 1338  O OE1  . GLU A 1 82  ? 123.882 8.614   -12.622 1.00 0.00 ? 82  GLU A OE1  1  
ATOM 1339  O OE2  . GLU A 1 82  ? 124.557 9.441   -10.713 1.00 0.00 ? 82  GLU A OE2  1  
ATOM 1340  H H    . GLU A 1 82  ? 122.607 4.057   -10.693 1.00 0.00 ? 82  GLU A H    1  
ATOM 1341  H HA   . GLU A 1 82  ? 125.311 4.387   -11.380 1.00 0.00 ? 82  GLU A HA   1  
ATOM 1342  H HB2  . GLU A 1 82  ? 123.474 5.985   -11.881 1.00 0.00 ? 82  GLU A HB2  1  
ATOM 1343  H HB3  . GLU A 1 82  ? 123.380 6.387   -10.174 1.00 0.00 ? 82  GLU A HB3  1  
ATOM 1344  H HG2  . GLU A 1 82  ? 125.656 7.267   -10.253 1.00 0.00 ? 82  GLU A HG2  1  
ATOM 1345  H HG3  . GLU A 1 82  ? 125.753 6.859   -11.966 1.00 0.00 ? 82  GLU A HG3  1  
ATOM 1346  N N    . GLY A 1 83  ? 126.552 4.192   -9.206  1.00 0.00 ? 83  GLY A N    1  
ATOM 1347  C CA   . GLY A 1 83  ? 127.294 4.156   -7.953  1.00 0.00 ? 83  GLY A CA   1  
ATOM 1348  C C    . GLY A 1 83  ? 128.732 3.692   -8.122  1.00 0.00 ? 83  GLY A C    1  
ATOM 1349  O O    . GLY A 1 83  ? 129.642 4.291   -7.553  1.00 0.00 ? 83  GLY A O    1  
ATOM 1350  H H    . GLY A 1 83  ? 126.942 3.812   -10.018 1.00 0.00 ? 83  GLY A H    1  
ATOM 1351  H HA2  . GLY A 1 83  ? 127.297 5.148   -7.522  1.00 0.00 ? 83  GLY A HA2  1  
ATOM 1352  H HA3  . GLY A 1 83  ? 126.791 3.483   -7.272  1.00 0.00 ? 83  GLY A HA3  1  
ATOM 1353  N N    . GLN A 1 84  ? 128.921 2.639   -8.927  1.00 0.00 ? 84  GLN A N    1  
ATOM 1354  C CA   . GLN A 1 84  ? 130.232 1.997   -9.144  1.00 0.00 ? 84  GLN A CA   1  
ATOM 1355  C C    . GLN A 1 84  ? 131.397 2.997   -9.142  1.00 0.00 ? 84  GLN A C    1  
ATOM 1356  O O    . GLN A 1 84  ? 132.267 2.950   -8.268  1.00 0.00 ? 84  GLN A O    1  
ATOM 1357  C CB   . GLN A 1 84  ? 130.205 1.225   -10.474 1.00 0.00 ? 84  GLN A CB   1  
ATOM 1358  C CG   . GLN A 1 84  ? 131.526 0.562   -10.861 1.00 0.00 ? 84  GLN A CG   1  
ATOM 1359  C CD   . GLN A 1 84  ? 132.000 -0.470  -9.852  1.00 0.00 ? 84  GLN A CD   1  
ATOM 1360  O OE1  . GLN A 1 84  ? 132.762 -0.160  -8.938  1.00 0.00 ? 84  GLN A OE1  1  
ATOM 1361  N NE2  . GLN A 1 84  ? 131.550 -1.705  -10.008 1.00 0.00 ? 84  GLN A NE2  1  
ATOM 1362  H H    . GLN A 1 84  ? 128.142 2.263   -9.388  1.00 0.00 ? 84  GLN A H    1  
ATOM 1363  H HA   . GLN A 1 84  ? 130.384 1.291   -8.341  1.00 0.00 ? 84  GLN A HA   1  
ATOM 1364  H HB2  . GLN A 1 84  ? 129.451 0.453   -10.409 1.00 0.00 ? 84  GLN A HB2  1  
ATOM 1365  H HB3  . GLN A 1 84  ? 129.929 1.911   -11.264 1.00 0.00 ? 84  GLN A HB3  1  
ATOM 1366  H HG2  . GLN A 1 84  ? 131.402 0.075   -11.817 1.00 0.00 ? 84  GLN A HG2  1  
ATOM 1367  H HG3  . GLN A 1 84  ? 132.284 1.330   -10.951 1.00 0.00 ? 84  GLN A HG3  1  
ATOM 1368  H HE21 . GLN A 1 84  ? 130.939 -1.885  -10.757 1.00 0.00 ? 84  GLN A HE21 1  
ATOM 1369  H HE22 . GLN A 1 84  ? 131.848 -2.394  -9.376  1.00 0.00 ? 84  GLN A HE22 1  
ATOM 1370  N N    . SER A 1 85  ? 131.414 3.892   -10.123 1.00 0.00 ? 85  SER A N    1  
ATOM 1371  C CA   . SER A 1 85  ? 132.472 4.896   -10.238 1.00 0.00 ? 85  SER A CA   1  
ATOM 1372  C C    . SER A 1 85  ? 131.897 6.296   -10.023 1.00 0.00 ? 85  SER A C    1  
ATOM 1373  O O    . SER A 1 85  ? 132.466 7.298   -10.471 1.00 0.00 ? 85  SER A O    1  
ATOM 1374  C CB   . SER A 1 85  ? 133.138 4.793   -11.617 1.00 0.00 ? 85  SER A CB   1  
ATOM 1375  O OG   . SER A 1 85  ? 133.601 3.471   -11.865 1.00 0.00 ? 85  SER A OG   1  
ATOM 1376  H H    . SER A 1 85  ? 130.695 3.882   -10.790 1.00 0.00 ? 85  SER A H    1  
ATOM 1377  H HA   . SER A 1 85  ? 133.212 4.702   -9.473  1.00 0.00 ? 85  SER A HA   1  
ATOM 1378  H HB2  . SER A 1 85  ? 132.423 5.057   -12.383 1.00 0.00 ? 85  SER A HB2  1  
ATOM 1379  H HB3  . SER A 1 85  ? 133.979 5.469   -11.662 1.00 0.00 ? 85  SER A HB3  1  
ATOM 1380  H HG   . SER A 1 85  ? 134.032 3.128   -11.067 1.00 0.00 ? 85  SER A HG   1  
ATOM 1381  N N    . ARG A 1 86  ? 130.777 6.356   -9.314  1.00 0.00 ? 86  ARG A N    1  
ATOM 1382  C CA   . ARG A 1 86  ? 130.080 7.612   -9.061  1.00 0.00 ? 86  ARG A CA   1  
ATOM 1383  C C    . ARG A 1 86  ? 130.393 8.093   -7.645  1.00 0.00 ? 86  ARG A C    1  
ATOM 1384  O O    . ARG A 1 86  ? 130.840 7.308   -6.807  1.00 0.00 ? 86  ARG A O    1  
ATOM 1385  C CB   . ARG A 1 86  ? 128.568 7.412   -9.241  1.00 0.00 ? 86  ARG A CB   1  
ATOM 1386  C CG   . ARG A 1 86  ? 127.763 8.702   -9.387  1.00 0.00 ? 86  ARG A CG   1  
ATOM 1387  C CD   . ARG A 1 86  ? 128.160 9.484   -10.633 1.00 0.00 ? 86  ARG A CD   1  
ATOM 1388  N NE   . ARG A 1 86  ? 127.206 10.553  -10.931 1.00 0.00 ? 86  ARG A NE   1  
ATOM 1389  C CZ   . ARG A 1 86  ? 127.543 11.798  -11.266 1.00 0.00 ? 86  ARG A CZ   1  
ATOM 1390  N NH1  . ARG A 1 86  ? 128.816 12.176  -11.250 1.00 0.00 ? 86  ARG A NH1  1  
ATOM 1391  N NH2  . ARG A 1 86  ? 126.599 12.669  -11.596 1.00 0.00 ? 86  ARG A NH2  1  
ATOM 1392  H H    . ARG A 1 86  ? 130.418 5.530   -8.925  1.00 0.00 ? 86  ARG A H    1  
ATOM 1393  H HA   . ARG A 1 86  ? 130.432 8.348   -9.772  1.00 0.00 ? 86  ARG A HA   1  
ATOM 1394  H HB2  . ARG A 1 86  ? 128.401 6.813   -10.124 1.00 0.00 ? 86  ARG A HB2  1  
ATOM 1395  H HB3  . ARG A 1 86  ? 128.187 6.876   -8.383  1.00 0.00 ? 86  ARG A HB3  1  
ATOM 1396  H HG2  . ARG A 1 86  ? 126.714 8.453   -9.452  1.00 0.00 ? 86  ARG A HG2  1  
ATOM 1397  H HG3  . ARG A 1 86  ? 127.932 9.320   -8.516  1.00 0.00 ? 86  ARG A HG3  1  
ATOM 1398  H HD2  . ARG A 1 86  ? 129.138 9.915   -10.478 1.00 0.00 ? 86  ARG A HD2  1  
ATOM 1399  H HD3  . ARG A 1 86  ? 128.197 8.806   -11.474 1.00 0.00 ? 86  ARG A HD3  1  
ATOM 1400  H HE   . ARG A 1 86  ? 126.251 10.316  -10.904 1.00 0.00 ? 86  ARG A HE   1  
ATOM 1401  H HH11 . ARG A 1 86  ? 129.534 11.527  -10.982 1.00 0.00 ? 86  ARG A HH11 1  
ATOM 1402  H HH12 . ARG A 1 86  ? 129.067 13.111  -11.508 1.00 0.00 ? 86  ARG A HH12 1  
ATOM 1403  H HH21 . ARG A 1 86  ? 125.634 12.392  -11.596 1.00 0.00 ? 86  ARG A HH21 1  
ATOM 1404  H HH22 . ARG A 1 86  ? 126.842 13.611  -11.843 1.00 0.00 ? 86  ARG A HH22 1  
ATOM 1405  N N    . LEU A 1 87  ? 130.142 9.374   -7.386  1.00 0.00 ? 87  LEU A N    1  
ATOM 1406  C CA   . LEU A 1 87  ? 130.444 9.999   -6.104  1.00 0.00 ? 87  LEU A CA   1  
ATOM 1407  C C    . LEU A 1 87  ? 131.945 9.980   -5.814  1.00 0.00 ? 87  LEU A C    1  
ATOM 1408  O O    . LEU A 1 87  ? 132.639 10.978  -6.030  1.00 0.00 ? 87  LEU A O    1  
ATOM 1409  C CB   . LEU A 1 87  ? 129.656 9.342   -4.953  1.00 0.00 ? 87  LEU A CB   1  
ATOM 1410  C CG   . LEU A 1 87  ? 128.177 9.761   -4.813  1.00 0.00 ? 87  LEU A CG   1  
ATOM 1411  C CD1  . LEU A 1 87  ? 127.352 9.317   -6.016  1.00 0.00 ? 87  LEU A CD1  1  
ATOM 1412  C CD2  . LEU A 1 87  ? 127.582 9.205   -3.520  1.00 0.00 ? 87  LEU A CD2  1  
ATOM 1413  H H    . LEU A 1 87  ? 129.736 9.921   -8.079  1.00 0.00 ? 87  LEU A H    1  
ATOM 1414  H HA   . LEU A 1 87  ? 130.140 11.025  -6.177  1.00 0.00 ? 87  LEU A HA   1  
ATOM 1415  H HB2  . LEU A 1 87  ? 129.693 8.270   -5.087  1.00 0.00 ? 87  LEU A HB2  1  
ATOM 1416  H HB3  . LEU A 1 87  ? 130.158 9.581   -4.034  1.00 0.00 ? 87  LEU A HB3  1  
ATOM 1417  H HG   . LEU A 1 87  ? 128.125 10.839  -4.761  1.00 0.00 ? 87  LEU A HG   1  
ATOM 1418  H HD11 . LEU A 1 87  ? 127.733 9.793   -6.908  1.00 0.00 ? 87  LEU A HD11 1  
ATOM 1419  H HD12 . LEU A 1 87  ? 126.320 9.602   -5.871  1.00 0.00 ? 87  LEU A HD12 1  
ATOM 1420  H HD13 . LEU A 1 87  ? 127.417 8.244   -6.126  1.00 0.00 ? 87  LEU A HD13 1  
ATOM 1421  H HD21 . LEU A 1 87  ? 127.618 8.125   -3.538  1.00 0.00 ? 87  LEU A HD21 1  
ATOM 1422  H HD22 . LEU A 1 87  ? 126.556 9.530   -3.426  1.00 0.00 ? 87  LEU A HD22 1  
ATOM 1423  H HD23 . LEU A 1 87  ? 128.152 9.569   -2.676  1.00 0.00 ? 87  LEU A HD23 1  
ATOM 1424  N N    . ASN A 1 88  ? 132.432 8.833   -5.354  1.00 0.00 ? 88  ASN A N    1  
ATOM 1425  C CA   . ASN A 1 88  ? 133.822 8.668   -4.909  1.00 0.00 ? 88  ASN A CA   1  
ATOM 1426  C C    . ASN A 1 88  ? 134.093 9.529   -3.671  1.00 0.00 ? 88  ASN A C    1  
ATOM 1427  O O    . ASN A 1 88  ? 133.455 10.564  -3.469  1.00 0.00 ? 88  ASN A O    1  
ATOM 1428  C CB   . ASN A 1 88  ? 134.828 9.010   -6.029  1.00 0.00 ? 88  ASN A CB   1  
ATOM 1429  C CG   . ASN A 1 88  ? 134.711 8.091   -7.240  1.00 0.00 ? 88  ASN A CG   1  
ATOM 1430  O OD1  . ASN A 1 88  ? 135.330 7.027   -7.294  1.00 0.00 ? 88  ASN A OD1  1  
ATOM 1431  N ND2  . ASN A 1 88  ? 133.934 8.506   -8.232  1.00 0.00 ? 88  ASN A ND2  1  
ATOM 1432  H H    . ASN A 1 88  ? 131.833 8.063   -5.316  1.00 0.00 ? 88  ASN A H    1  
ATOM 1433  H HA   . ASN A 1 88  ? 133.948 7.630   -4.633  1.00 0.00 ? 88  ASN A HA   1  
ATOM 1434  H HB2  . ASN A 1 88  ? 134.661 10.025  -6.356  1.00 0.00 ? 88  ASN A HB2  1  
ATOM 1435  H HB3  . ASN A 1 88  ? 135.833 8.928   -5.636  1.00 0.00 ? 88  ASN A HB3  1  
ATOM 1436  H HD21 . ASN A 1 88  ? 133.483 9.372   -8.136  1.00 0.00 ? 88  ASN A HD21 1  
ATOM 1437  H HD22 . ASN A 1 88  ? 133.843 7.933   -9.022  1.00 0.00 ? 88  ASN A HD22 1  
ATOM 1438  N N    . GLU A 1 89  ? 135.051 9.107   -2.849  1.00 0.00 ? 89  GLU A N    1  
ATOM 1439  C CA   . GLU A 1 89  ? 135.363 9.798   -1.592  1.00 0.00 ? 89  GLU A CA   1  
ATOM 1440  C C    . GLU A 1 89  ? 135.618 11.291  -1.822  1.00 0.00 ? 89  GLU A C    1  
ATOM 1441  O O    . GLU A 1 89  ? 135.407 12.111  -0.929  1.00 0.00 ? 89  GLU A O    1  
ATOM 1442  C CB   . GLU A 1 89  ? 136.587 9.161   -0.931  1.00 0.00 ? 89  GLU A CB   1  
ATOM 1443  C CG   . GLU A 1 89  ? 136.425 7.674   -0.639  1.00 0.00 ? 89  GLU A CG   1  
ATOM 1444  C CD   . GLU A 1 89  ? 137.687 7.056   -0.065  1.00 0.00 ? 89  GLU A CD   1  
ATOM 1445  O OE1  . GLU A 1 89  ? 137.905 7.168   1.162   1.00 0.00 ? 89  GLU A OE1  1  
ATOM 1446  O OE2  . GLU A 1 89  ? 138.475 6.468   -0.838  1.00 0.00 ? 89  GLU A OE2  1  
ATOM 1447  H H    . GLU A 1 89  ? 135.563 8.306   -3.090  1.00 0.00 ? 89  GLU A H    1  
ATOM 1448  H HA   . GLU A 1 89  ? 134.511 9.688   -0.935  1.00 0.00 ? 89  GLU A HA   1  
ATOM 1449  H HB2  . GLU A 1 89  ? 137.440 9.289   -1.582  1.00 0.00 ? 89  GLU A HB2  1  
ATOM 1450  H HB3  . GLU A 1 89  ? 136.782 9.670   0.004   1.00 0.00 ? 89  GLU A HB3  1  
ATOM 1451  H HG2  . GLU A 1 89  ? 135.621 7.544   0.072   1.00 0.00 ? 89  GLU A HG2  1  
ATOM 1452  H HG3  . GLU A 1 89  ? 136.175 7.164   -1.559  1.00 0.00 ? 89  GLU A HG3  1  
ATOM 1453  N N    . LYS A 1 90  ? 136.045 11.624  -3.036  1.00 0.00 ? 90  LYS A N    1  
ATOM 1454  C CA   . LYS A 1 90  ? 136.390 12.996  -3.404  1.00 0.00 ? 90  LYS A CA   1  
ATOM 1455  C C    . LYS A 1 90  ? 135.230 13.969  -3.153  1.00 0.00 ? 90  LYS A C    1  
ATOM 1456  O O    . LYS A 1 90  ? 135.455 15.142  -2.845  1.00 0.00 ? 90  LYS A O    1  
ATOM 1457  C CB   . LYS A 1 90  ? 136.828 13.038  -4.875  1.00 0.00 ? 90  LYS A CB   1  
ATOM 1458  C CG   . LYS A 1 90  ? 138.041 12.154  -5.162  1.00 0.00 ? 90  LYS A CG   1  
ATOM 1459  C CD   . LYS A 1 90  ? 138.453 12.193  -6.632  1.00 0.00 ? 90  LYS A CD   1  
ATOM 1460  C CE   . LYS A 1 90  ? 139.721 11.381  -6.879  1.00 0.00 ? 90  LYS A CE   1  
ATOM 1461  N NZ   . LYS A 1 90  ? 140.164 11.451  -8.297  1.00 0.00 ? 90  LYS A NZ   1  
ATOM 1462  H H    . LYS A 1 90  ? 136.137 10.921  -3.709  1.00 0.00 ? 90  LYS A H    1  
ATOM 1463  H HA   . LYS A 1 90  ? 137.226 13.296  -2.788  1.00 0.00 ? 90  LYS A HA   1  
ATOM 1464  H HB2  . LYS A 1 90  ? 136.007 12.704  -5.495  1.00 0.00 ? 90  LYS A HB2  1  
ATOM 1465  H HB3  . LYS A 1 90  ? 137.078 14.056  -5.139  1.00 0.00 ? 90  LYS A HB3  1  
ATOM 1466  H HG2  . LYS A 1 90  ? 138.871 12.498  -4.561  1.00 0.00 ? 90  LYS A HG2  1  
ATOM 1467  H HG3  . LYS A 1 90  ? 137.801 11.134  -4.892  1.00 0.00 ? 90  LYS A HG3  1  
ATOM 1468  H HD2  . LYS A 1 90  ? 137.653 11.784  -7.233  1.00 0.00 ? 90  LYS A HD2  1  
ATOM 1469  H HD3  . LYS A 1 90  ? 138.632 13.219  -6.920  1.00 0.00 ? 90  LYS A HD3  1  
ATOM 1470  H HE2  . LYS A 1 90  ? 140.510 11.765  -6.249  1.00 0.00 ? 90  LYS A HE2  1  
ATOM 1471  H HE3  . LYS A 1 90  ? 139.529 10.348  -6.622  1.00 0.00 ? 90  LYS A HE3  1  
ATOM 1472  H HZ1  . LYS A 1 90  ? 139.474 10.974  -8.915  1.00 0.00 ? 90  LYS A HZ1  1  
ATOM 1473  H HZ2  . LYS A 1 90  ? 141.088 10.988  -8.409  1.00 0.00 ? 90  LYS A HZ2  1  
ATOM 1474  H HZ3  . LYS A 1 90  ? 140.251 12.442  -8.598  1.00 0.00 ? 90  LYS A HZ3  1  
ATOM 1475  N N    . ILE A 1 91  ? 133.991 13.490  -3.281  1.00 0.00 ? 91  ILE A N    1  
ATOM 1476  C CA   . ILE A 1 91  ? 132.824 14.330  -3.001  1.00 0.00 ? 91  ILE A CA   1  
ATOM 1477  C C    . ILE A 1 91  ? 132.405 14.190  -1.535  1.00 0.00 ? 91  ILE A C    1  
ATOM 1478  O O    . ILE A 1 91  ? 131.786 15.089  -0.966  1.00 0.00 ? 91  ILE A O    1  
ATOM 1479  C CB   . ILE A 1 91  ? 131.622 13.999  -3.929  1.00 0.00 ? 91  ILE A CB   1  
ATOM 1480  C CG1  . ILE A 1 91  ? 130.517 15.060  -3.778  1.00 0.00 ? 91  ILE A CG1  1  
ATOM 1481  C CG2  . ILE A 1 91  ? 131.068 12.609  -3.635  1.00 0.00 ? 91  ILE A CG2  1  
ATOM 1482  C CD1  . ILE A 1 91  ? 129.297 14.806  -4.639  1.00 0.00 ? 91  ILE A CD1  1  
ATOM 1483  H H    . ILE A 1 91  ? 133.859 12.561  -3.571  1.00 0.00 ? 91  ILE A H    1  
ATOM 1484  H HA   . ILE A 1 91  ? 133.111 15.360  -3.177  1.00 0.00 ? 91  ILE A HA   1  
ATOM 1485  H HB   . ILE A 1 91  ? 131.977 14.006  -4.950  1.00 0.00 ? 91  ILE A HB   1  
ATOM 1486  H HG12 . ILE A 1 91  ? 130.191 15.088  -2.748  1.00 0.00 ? 91  ILE A HG12 1  
ATOM 1487  H HG13 . ILE A 1 91  ? 130.917 16.027  -4.048  1.00 0.00 ? 91  ILE A HG13 1  
ATOM 1488  H HG21 . ILE A 1 91  ? 130.692 12.576  -2.622  1.00 0.00 ? 91  ILE A HG21 1  
ATOM 1489  H HG22 . ILE A 1 91  ? 131.853 11.876  -3.750  1.00 0.00 ? 91  ILE A HG22 1  
ATOM 1490  H HG23 . ILE A 1 91  ? 130.266 12.386  -4.323  1.00 0.00 ? 91  ILE A HG23 1  
ATOM 1491  H HD11 . ILE A 1 91  ? 129.586 14.781  -5.679  1.00 0.00 ? 91  ILE A HD11 1  
ATOM 1492  H HD12 . ILE A 1 91  ? 128.578 15.597  -4.485  1.00 0.00 ? 91  ILE A HD12 1  
ATOM 1493  H HD13 . ILE A 1 91  ? 128.852 13.859  -4.366  1.00 0.00 ? 91  ILE A HD13 1  
ATOM 1494  N N    . LEU A 1 92  ? 132.773 13.066  -0.916  1.00 0.00 ? 92  LEU A N    1  
ATOM 1495  C CA   . LEU A 1 92  ? 132.465 12.830  0.498   1.00 0.00 ? 92  LEU A CA   1  
ATOM 1496  C C    . LEU A 1 92  ? 133.350 13.693  1.395   1.00 0.00 ? 92  LEU A C    1  
ATOM 1497  O O    . LEU A 1 92  ? 133.164 13.732  2.611   1.00 0.00 ? 92  LEU A O    1  
ATOM 1498  C CB   . LEU A 1 92  ? 132.622 11.343  0.874   1.00 0.00 ? 92  LEU A CB   1  
ATOM 1499  C CG   . LEU A 1 92  ? 131.498 10.402  0.395   1.00 0.00 ? 92  LEU A CG   1  
ATOM 1500  C CD1  . LEU A 1 92  ? 130.127 10.937  0.802   1.00 0.00 ? 92  LEU A CD1  1  
ATOM 1501  C CD2  . LEU A 1 92  ? 131.565 10.178  -1.111  1.00 0.00 ? 92  LEU A CD2  1  
ATOM 1502  H H    . LEU A 1 92  ? 133.271 12.386  -1.416  1.00 0.00 ? 92  LEU A H    1  
ATOM 1503  H HA   . LEU A 1 92  ? 131.435 13.121  0.658   1.00 0.00 ? 92  LEU A HA   1  
ATOM 1504  H HB2  . LEU A 1 92  ? 133.558 10.989  0.464   1.00 0.00 ? 92  LEU A HB2  1  
ATOM 1505  H HB3  . LEU A 1 92  ? 132.678 11.273  1.952   1.00 0.00 ? 92  LEU A HB3  1  
ATOM 1506  H HG   . LEU A 1 92  ? 131.625 9.441   0.875   1.00 0.00 ? 92  LEU A HG   1  
ATOM 1507  H HD11 . LEU A 1 92  ? 129.963 11.903  0.346   1.00 0.00 ? 92  LEU A HD11 1  
ATOM 1508  H HD12 . LEU A 1 92  ? 130.083 11.036  1.877   1.00 0.00 ? 92  LEU A HD12 1  
ATOM 1509  H HD13 . LEU A 1 92  ? 129.359 10.250  0.475   1.00 0.00 ? 92  LEU A HD13 1  
ATOM 1510  H HD21 . LEU A 1 92  ? 130.751 9.537   -1.418  1.00 0.00 ? 92  LEU A HD21 1  
ATOM 1511  H HD22 . LEU A 1 92  ? 132.504 9.708   -1.364  1.00 0.00 ? 92  LEU A HD22 1  
ATOM 1512  H HD23 . LEU A 1 92  ? 131.489 11.126  -1.623  1.00 0.00 ? 92  LEU A HD23 1  
ATOM 1513  N N    . GLU A 1 93  ? 134.320 14.372  0.788   1.00 0.00 ? 93  GLU A N    1  
ATOM 1514  C CA   . GLU A 1 93  ? 135.159 15.325  1.508   1.00 0.00 ? 93  GLU A CA   1  
ATOM 1515  C C    . GLU A 1 93  ? 134.437 16.669  1.639   1.00 0.00 ? 93  GLU A C    1  
ATOM 1516  O O    . GLU A 1 93  ? 134.889 17.563  2.357   1.00 0.00 ? 93  GLU A O    1  
ATOM 1517  C CB   . GLU A 1 93  ? 136.504 15.498  0.792   1.00 0.00 ? 93  GLU A CB   1  
ATOM 1518  C CG   . GLU A 1 93  ? 137.299 14.200  0.680   1.00 0.00 ? 93  GLU A CG   1  
ATOM 1519  C CD   . GLU A 1 93  ? 138.628 14.382  -0.032  1.00 0.00 ? 93  GLU A CD   1  
ATOM 1520  O OE1  . GLU A 1 93  ? 138.636 14.455  -1.276  1.00 0.00 ? 93  GLU A OE1  1  
ATOM 1521  O OE2  . GLU A 1 93  ? 139.674 14.457  0.650   1.00 0.00 ? 93  GLU A OE2  1  
ATOM 1522  H H    . GLU A 1 93  ? 134.485 14.218  -0.165  1.00 0.00 ? 93  GLU A H    1  
ATOM 1523  H HA   . GLU A 1 93  ? 135.336 14.930  2.500   1.00 0.00 ? 93  GLU A HA   1  
ATOM 1524  H HB2  . GLU A 1 93  ? 136.325 15.875  -0.206  1.00 0.00 ? 93  GLU A HB2  1  
ATOM 1525  H HB3  . GLU A 1 93  ? 137.102 16.216  1.336   1.00 0.00 ? 93  GLU A HB3  1  
ATOM 1526  H HG2  . GLU A 1 93  ? 137.487 13.822  1.675   1.00 0.00 ? 93  GLU A HG2  1  
ATOM 1527  H HG3  . GLU A 1 93  ? 136.708 13.478  0.132   1.00 0.00 ? 93  GLU A HG3  1  
ATOM 1528  N N    . GLU A 1 94  ? 133.309 16.793  0.941   1.00 0.00 ? 94  GLU A N    1  
ATOM 1529  C CA   . GLU A 1 94  ? 132.461 17.983  1.010   1.00 0.00 ? 94  GLU A CA   1  
ATOM 1530  C C    . GLU A 1 94  ? 130.995 17.591  0.771   1.00 0.00 ? 94  GLU A C    1  
ATOM 1531  O O    . GLU A 1 94  ? 130.346 18.086  -0.159  1.00 0.00 ? 94  GLU A O    1  
ATOM 1532  C CB   . GLU A 1 94  ? 132.925 19.029  -0.018  1.00 0.00 ? 94  GLU A CB   1  
ATOM 1533  C CG   . GLU A 1 94  ? 133.024 18.496  -1.446  1.00 0.00 ? 94  GLU A CG   1  
ATOM 1534  C CD   . GLU A 1 94  ? 133.375 19.578  -2.453  1.00 0.00 ? 94  GLU A CD   1  
ATOM 1535  O OE1  . GLU A 1 94  ? 132.448 20.243  -2.966  1.00 0.00 ? 94  GLU A OE1  1  
ATOM 1536  O OE2  . GLU A 1 94  ? 134.575 19.773  -2.733  1.00 0.00 ? 94  GLU A OE2  1  
ATOM 1537  H H    . GLU A 1 94  ? 133.030 16.053  0.361   1.00 0.00 ? 94  GLU A H    1  
ATOM 1538  H HA   . GLU A 1 94  ? 132.549 18.400  2.005   1.00 0.00 ? 94  GLU A HA   1  
ATOM 1539  H HB2  . GLU A 1 94  ? 132.228 19.856  -0.013  1.00 0.00 ? 94  GLU A HB2  1  
ATOM 1540  H HB3  . GLU A 1 94  ? 133.901 19.395  0.274   1.00 0.00 ? 94  GLU A HB3  1  
ATOM 1541  H HG2  . GLU A 1 94  ? 133.787 17.730  -1.479  1.00 0.00 ? 94  GLU A HG2  1  
ATOM 1542  H HG3  . GLU A 1 94  ? 132.072 18.061  -1.721  1.00 0.00 ? 94  GLU A HG3  1  
ATOM 1543  N N    . PRO A 1 95  ? 130.449 16.696  1.618   1.00 0.00 ? 95  PRO A N    1  
ATOM 1544  C CA   . PRO A 1 95  ? 129.119 16.129  1.417   1.00 0.00 ? 95  PRO A CA   1  
ATOM 1545  C C    . PRO A 1 95  ? 128.004 17.004  1.988   1.00 0.00 ? 95  PRO A C    1  
ATOM 1546  O O    . PRO A 1 95  ? 128.205 17.749  2.949   1.00 0.00 ? 95  PRO A O    1  
ATOM 1547  C CB   . PRO A 1 95  ? 129.208 14.801  2.167   1.00 0.00 ? 95  PRO A CB   1  
ATOM 1548  C CG   . PRO A 1 95  ? 130.143 15.070  3.304   1.00 0.00 ? 95  PRO A CG   1  
ATOM 1549  C CD   . PRO A 1 95  ? 131.072 16.181  2.858   1.00 0.00 ? 95  PRO A CD   1  
ATOM 1550  H HA   . PRO A 1 95  ? 128.925 15.940  0.370   1.00 0.00 ? 95  PRO A HA   1  
ATOM 1551  H HB2  . PRO A 1 95  ? 128.226 14.511  2.517   1.00 0.00 ? 95  PRO A HB2  1  
ATOM 1552  H HB3  . PRO A 1 95  ? 129.597 14.039  1.509   1.00 0.00 ? 95  PRO A HB3  1  
ATOM 1553  H HG2  . PRO A 1 95  ? 129.580 15.381  4.174   1.00 0.00 ? 95  PRO A HG2  1  
ATOM 1554  H HG3  . PRO A 1 95  ? 130.709 14.176  3.530   1.00 0.00 ? 95  PRO A HG3  1  
ATOM 1555  H HD2  . PRO A 1 95  ? 131.124 16.955  3.610   1.00 0.00 ? 95  PRO A HD2  1  
ATOM 1556  H HD3  . PRO A 1 95  ? 132.059 15.788  2.656   1.00 0.00 ? 95  PRO A HD3  1  
ATOM 1557  N N    . HIS A 1 96  ? 126.832 16.908  1.375   1.00 0.00 ? 96  HIS A N    1  
ATOM 1558  C CA   . HIS A 1 96  ? 125.646 17.636  1.820   1.00 0.00 ? 96  HIS A CA   1  
ATOM 1559  C C    . HIS A 1 96  ? 124.437 16.700  1.787   1.00 0.00 ? 96  HIS A C    1  
ATOM 1560  O O    . HIS A 1 96  ? 124.390 15.788  0.962   1.00 0.00 ? 96  HIS A O    1  
ATOM 1561  C CB   . HIS A 1 96  ? 125.404 18.866  0.929   1.00 0.00 ? 96  HIS A CB   1  
ATOM 1562  C CG   . HIS A 1 96  ? 126.523 19.865  0.967   1.00 0.00 ? 96  HIS A CG   1  
ATOM 1563  N ND1  . HIS A 1 96  ? 126.580 20.899  1.878   1.00 0.00 ? 96  HIS A ND1  1  
ATOM 1564  C CD2  . HIS A 1 96  ? 127.640 19.977  0.208   1.00 0.00 ? 96  HIS A CD2  1  
ATOM 1565  C CE1  . HIS A 1 96  ? 127.680 21.600  1.677   1.00 0.00 ? 96  HIS A CE1  1  
ATOM 1566  N NE2  . HIS A 1 96  ? 128.341 21.062  0.671   1.00 0.00 ? 96  HIS A NE2  1  
ATOM 1567  H H    . HIS A 1 96  ? 126.758 16.323  0.589   1.00 0.00 ? 96  HIS A H    1  
ATOM 1568  H HA   . HIS A 1 96  ? 125.811 17.960  2.840   1.00 0.00 ? 96  HIS A HA   1  
ATOM 1569  H HB2  . HIS A 1 96  ? 125.280 18.544  -0.095  1.00 0.00 ? 96  HIS A HB2  1  
ATOM 1570  H HB3  . HIS A 1 96  ? 124.502 19.365  1.254   1.00 0.00 ? 96  HIS A HB3  1  
ATOM 1571  H HD1  . HIS A 1 96  ? 125.912 21.090  2.572   1.00 0.00 ? 96  HIS A HD1  1  
ATOM 1572  H HD2  . HIS A 1 96  ? 127.927 19.330  -0.609  1.00 0.00 ? 96  HIS A HD2  1  
ATOM 1573  H HE1  . HIS A 1 96  ? 127.989 22.466  2.243   1.00 0.00 ? 96  HIS A HE1  1  
ATOM 1574  H HE2  . HIS A 1 96  ? 129.263 21.290  0.421   1.00 0.00 ? 96  HIS A HE2  1  
ATOM 1575  N N    . PRO A 1 97  ? 123.444 16.905  2.675   1.00 0.00 ? 97  PRO A N    1  
ATOM 1576  C CA   . PRO A 1 97  ? 122.299 15.991  2.804   1.00 0.00 ? 97  PRO A CA   1  
ATOM 1577  C C    . PRO A 1 97  ? 121.536 15.815  1.490   1.00 0.00 ? 97  PRO A C    1  
ATOM 1578  O O    . PRO A 1 97  ? 121.392 14.695  0.989   1.00 0.00 ? 97  PRO A O    1  
ATOM 1579  C CB   . PRO A 1 97  ? 121.410 16.654  3.875   1.00 0.00 ? 97  PRO A CB   1  
ATOM 1580  C CG   . PRO A 1 97  ? 121.881 18.070  3.955   1.00 0.00 ? 97  PRO A CG   1  
ATOM 1581  C CD   . PRO A 1 97  ? 123.346 18.037  3.614   1.00 0.00 ? 97  PRO A CD   1  
ATOM 1582  H HA   . PRO A 1 97  ? 122.619 15.020  3.154   1.00 0.00 ? 97  PRO A HA   1  
ATOM 1583  H HB2  . PRO A 1 97  ? 120.372 16.599  3.578   1.00 0.00 ? 97  PRO A HB2  1  
ATOM 1584  H HB3  . PRO A 1 97  ? 121.542 16.144  4.819   1.00 0.00 ? 97  PRO A HB3  1  
ATOM 1585  H HG2  . PRO A 1 97  ? 121.342 18.678  3.241   1.00 0.00 ? 97  PRO A HG2  1  
ATOM 1586  H HG3  . PRO A 1 97  ? 121.736 18.451  4.956   1.00 0.00 ? 97  PRO A HG3  1  
ATOM 1587  H HD2  . PRO A 1 97  ? 123.646 18.961  3.140   1.00 0.00 ? 97  PRO A HD2  1  
ATOM 1588  H HD3  . PRO A 1 97  ? 123.940 17.856  4.499   1.00 0.00 ? 97  PRO A HD3  1  
ATOM 1589  N N    . LEU A 1 98  ? 121.095 16.930  0.913   1.00 0.00 ? 98  LEU A N    1  
ATOM 1590  C CA   . LEU A 1 98  ? 120.227 16.904  -0.263  1.00 0.00 ? 98  LEU A CA   1  
ATOM 1591  C C    . LEU A 1 98  ? 120.925 16.284  -1.474  1.00 0.00 ? 98  LEU A C    1  
ATOM 1592  O O    . LEU A 1 98  ? 120.268 15.906  -2.446  1.00 0.00 ? 98  LEU A O    1  
ATOM 1593  C CB   . LEU A 1 98  ? 119.739 18.320  -0.599  1.00 0.00 ? 98  LEU A CB   1  
ATOM 1594  C CG   . LEU A 1 98  ? 118.938 19.015  0.516   1.00 0.00 ? 98  LEU A CG   1  
ATOM 1595  C CD1  . LEU A 1 98  ? 118.523 20.422  0.090   1.00 0.00 ? 98  LEU A CD1  1  
ATOM 1596  C CD2  . LEU A 1 98  ? 117.716 18.183  0.905   1.00 0.00 ? 98  LEU A CD2  1  
ATOM 1597  H H    . LEU A 1 98  ? 121.367 17.797  1.284   1.00 0.00 ? 98  LEU A H    1  
ATOM 1598  H HA   . LEU A 1 98  ? 119.369 16.295  -0.018  1.00 0.00 ? 98  LEU A HA   1  
ATOM 1599  H HB2  . LEU A 1 98  ? 120.603 18.929  -0.829  1.00 0.00 ? 98  LEU A HB2  1  
ATOM 1600  H HB3  . LEU A 1 98  ? 119.114 18.264  -1.480  1.00 0.00 ? 98  LEU A HB3  1  
ATOM 1601  H HG   . LEU A 1 98  ? 119.567 19.111  1.391   1.00 0.00 ? 98  LEU A HG   1  
ATOM 1602  H HD11 . LEU A 1 98  ? 117.975 20.895  0.892   1.00 0.00 ? 98  LEU A HD11 1  
ATOM 1603  H HD12 . LEU A 1 98  ? 117.896 20.364  -0.789  1.00 0.00 ? 98  LEU A HD12 1  
ATOM 1604  H HD13 . LEU A 1 98  ? 119.404 21.005  -0.135  1.00 0.00 ? 98  LEU A HD13 1  
ATOM 1605  H HD21 . LEU A 1 98  ? 118.037 17.214  1.262   1.00 0.00 ? 98  LEU A HD21 1  
ATOM 1606  H HD22 . LEU A 1 98  ? 117.075 18.054  0.045   1.00 0.00 ? 98  LEU A HD22 1  
ATOM 1607  H HD23 . LEU A 1 98  ? 117.169 18.689  1.688   1.00 0.00 ? 98  LEU A HD23 1  
ATOM 1608  N N    . MET A 1 99  ? 122.250 16.162  -1.411  1.00 0.00 ? 99  MET A N    1  
ATOM 1609  C CA   . MET A 1 99  ? 123.009 15.590  -2.522  1.00 0.00 ? 99  MET A CA   1  
ATOM 1610  C C    . MET A 1 99  ? 122.680 14.103  -2.661  1.00 0.00 ? 99  MET A C    1  
ATOM 1611  O O    . MET A 1 99  ? 122.735 13.542  -3.757  1.00 0.00 ? 99  MET A O    1  
ATOM 1612  C CB   . MET A 1 99  ? 124.526 15.831  -2.337  1.00 0.00 ? 99  MET A CB   1  
ATOM 1613  C CG   . MET A 1 99  ? 125.313 14.698  -1.675  1.00 0.00 ? 99  MET A CG   1  
ATOM 1614  S SD   . MET A 1 99  ? 125.624 13.317  -2.796  1.00 0.00 ? 99  MET A SD   1  
ATOM 1615  C CE   . MET A 1 99  ? 127.078 12.585  -2.044  1.00 0.00 ? 99  MET A CE   1  
ATOM 1616  H H    . MET A 1 99  ? 122.722 16.455  -0.604  1.00 0.00 ? 99  MET A H    1  
ATOM 1617  H HA   . MET A 1 99  ? 122.686 16.094  -3.424  1.00 0.00 ? 99  MET A HA   1  
ATOM 1618  H HB2  . MET A 1 99  ? 124.964 16.008  -3.308  1.00 0.00 ? 99  MET A HB2  1  
ATOM 1619  H HB3  . MET A 1 99  ? 124.658 16.722  -1.737  1.00 0.00 ? 99  MET A HB3  1  
ATOM 1620  H HG2  . MET A 1 99  ? 126.262 15.086  -1.334  1.00 0.00 ? 99  MET A HG2  1  
ATOM 1621  H HG3  . MET A 1 99  ? 124.754 14.334  -0.823  1.00 0.00 ? 99  MET A HG3  1  
ATOM 1622  H HE1  . MET A 1 99  ? 127.374 11.714  -2.607  1.00 0.00 ? 99  MET A HE1  1  
ATOM 1623  H HE2  . MET A 1 99  ? 126.853 12.297  -1.028  1.00 0.00 ? 99  MET A HE2  1  
ATOM 1624  H HE3  . MET A 1 99  ? 127.884 13.304  -2.045  1.00 0.00 ? 99  MET A HE3  1  
ATOM 1625  N N    . PHE A 1 100 ? 122.290 13.479  -1.547  1.00 0.00 ? 100 PHE A N    1  
ATOM 1626  C CA   . PHE A 1 100 ? 121.887 12.077  -1.554  1.00 0.00 ? 100 PHE A CA   1  
ATOM 1627  C C    . PHE A 1 100 ? 120.437 11.936  -1.992  1.00 0.00 ? 100 PHE A C    1  
ATOM 1628  O O    . PHE A 1 100 ? 120.051 10.909  -2.541  1.00 0.00 ? 100 PHE A O    1  
ATOM 1629  C CB   . PHE A 1 100 ? 122.087 11.439  -0.176  1.00 0.00 ? 100 PHE A CB   1  
ATOM 1630  C CG   . PHE A 1 100 ? 123.532 11.175  0.146   1.00 0.00 ? 100 PHE A CG   1  
ATOM 1631  C CD1  . PHE A 1 100 ? 124.144 10.002  -0.276  1.00 0.00 ? 100 PHE A CD1  1  
ATOM 1632  C CD2  . PHE A 1 100 ? 124.280 12.099  0.856   1.00 0.00 ? 100 PHE A CD2  1  
ATOM 1633  C CE1  . PHE A 1 100 ? 125.472 9.757   0.008   1.00 0.00 ? 100 PHE A CE1  1  
ATOM 1634  C CE2  . PHE A 1 100 ? 125.607 11.858  1.141   1.00 0.00 ? 100 PHE A CE2  1  
ATOM 1635  C CZ   . PHE A 1 100 ? 126.204 10.686  0.717   1.00 0.00 ? 100 PHE A CZ   1  
ATOM 1636  H H    . PHE A 1 100 ? 122.269 13.978  -0.701  1.00 0.00 ? 100 PHE A H    1  
ATOM 1637  H HA   . PHE A 1 100 ? 122.512 11.559  -2.271  1.00 0.00 ? 100 PHE A HA   1  
ATOM 1638  H HB2  . PHE A 1 100 ? 121.688 12.098  0.583   1.00 0.00 ? 100 PHE A HB2  1  
ATOM 1639  H HB3  . PHE A 1 100 ? 121.558 10.495  -0.139  1.00 0.00 ? 100 PHE A HB3  1  
ATOM 1640  H HD1  . PHE A 1 100 ? 123.571 9.274   -0.832  1.00 0.00 ? 100 PHE A HD1  1  
ATOM 1641  H HD2  . PHE A 1 100 ? 123.816 13.016  1.191   1.00 0.00 ? 100 PHE A HD2  1  
ATOM 1642  H HE1  . PHE A 1 100 ? 125.937 8.840   -0.324  1.00 0.00 ? 100 PHE A HE1  1  
ATOM 1643  H HE2  . PHE A 1 100 ? 126.181 12.587  1.695   1.00 0.00 ? 100 PHE A HE2  1  
ATOM 1644  H HZ   . PHE A 1 100 ? 127.245 10.498  0.940   1.00 0.00 ? 100 PHE A HZ   1  
ATOM 1645  N N    . GLN A 1 101 ? 119.639 12.977  -1.760  1.00 0.00 ? 101 GLN A N    1  
ATOM 1646  C CA   . GLN A 1 101 ? 118.238 12.975  -2.184  1.00 0.00 ? 101 GLN A CA   1  
ATOM 1647  C C    . GLN A 1 101 ? 118.132 12.894  -3.706  1.00 0.00 ? 101 GLN A C    1  
ATOM 1648  O O    . GLN A 1 101 ? 117.087 12.525  -4.245  1.00 0.00 ? 101 GLN A O    1  
ATOM 1649  C CB   . GLN A 1 101 ? 117.490 14.207  -1.651  1.00 0.00 ? 101 GLN A CB   1  
ATOM 1650  C CG   . GLN A 1 101 ? 117.002 14.061  -0.210  1.00 0.00 ? 101 GLN A CG   1  
ATOM 1651  C CD   . GLN A 1 101 ? 118.123 13.824  0.787   1.00 0.00 ? 101 GLN A CD   1  
ATOM 1652  O OE1  . GLN A 1 101 ? 118.687 14.767  1.330   1.00 0.00 ? 101 GLN A OE1  1  
ATOM 1653  N NE2  . GLN A 1 101 ? 118.441 12.564  1.048   1.00 0.00 ? 101 GLN A NE2  1  
ATOM 1654  H H    . GLN A 1 101 ? 119.998 13.760  -1.292  1.00 0.00 ? 101 GLN A H    1  
ATOM 1655  H HA   . GLN A 1 101 ? 117.780 12.087  -1.769  1.00 0.00 ? 101 GLN A HA   1  
ATOM 1656  H HB2  . GLN A 1 101 ? 118.149 15.062  -1.699  1.00 0.00 ? 101 GLN A HB2  1  
ATOM 1657  H HB3  . GLN A 1 101 ? 116.631 14.394  -2.280  1.00 0.00 ? 101 GLN A HB3  1  
ATOM 1658  H HG2  . GLN A 1 101 ? 116.482 14.965  0.071   1.00 0.00 ? 101 GLN A HG2  1  
ATOM 1659  H HG3  . GLN A 1 101 ? 116.314 13.227  -0.162  1.00 0.00 ? 101 GLN A HG3  1  
ATOM 1660  H HE21 . GLN A 1 101 ? 117.941 11.853  0.593   1.00 0.00 ? 101 GLN A HE21 1  
ATOM 1661  H HE22 . GLN A 1 101 ? 119.159 12.396  1.693   1.00 0.00 ? 101 GLN A HE22 1  
ATOM 1662  N N    . LYS A 1 102 ? 119.218 13.238  -4.393  1.00 0.00 ? 102 LYS A N    1  
ATOM 1663  C CA   . LYS A 1 102 ? 119.296 13.066  -5.841  1.00 0.00 ? 102 LYS A CA   1  
ATOM 1664  C C    . LYS A 1 102 ? 119.314 11.574  -6.168  1.00 0.00 ? 102 LYS A C    1  
ATOM 1665  O O    . LYS A 1 102 ? 118.551 11.093  -7.007  1.00 0.00 ? 102 LYS A O    1  
ATOM 1666  C CB   . LYS A 1 102 ? 120.554 13.754  -6.395  1.00 0.00 ? 102 LYS A CB   1  
ATOM 1667  C CG   . LYS A 1 102 ? 120.645 13.749  -7.921  1.00 0.00 ? 102 LYS A CG   1  
ATOM 1668  C CD   . LYS A 1 102 ? 121.904 14.459  -8.415  1.00 0.00 ? 102 LYS A CD   1  
ATOM 1669  C CE   . LYS A 1 102 ? 121.950 14.556  -9.938  1.00 0.00 ? 102 LYS A CE   1  
ATOM 1670  N NZ   . LYS A 1 102 ? 121.977 13.221  -10.596 1.00 0.00 ? 102 LYS A NZ   1  
ATOM 1671  H H    . LYS A 1 102 ? 119.985 13.619  -3.916  1.00 0.00 ? 102 LYS A H    1  
ATOM 1672  H HA   . LYS A 1 102 ? 118.416 13.516  -6.283  1.00 0.00 ? 102 LYS A HA   1  
ATOM 1673  H HB2  . LYS A 1 102 ? 120.563 14.782  -6.059  1.00 0.00 ? 102 LYS A HB2  1  
ATOM 1674  H HB3  . LYS A 1 102 ? 121.427 13.251  -6.002  1.00 0.00 ? 102 LYS A HB3  1  
ATOM 1675  H HG2  . LYS A 1 102 ? 120.661 12.726  -8.267  1.00 0.00 ? 102 LYS A HG2  1  
ATOM 1676  H HG3  . LYS A 1 102 ? 119.776 14.252  -8.324  1.00 0.00 ? 102 LYS A HG3  1  
ATOM 1677  H HD2  . LYS A 1 102 ? 121.926 15.458  -8.004  1.00 0.00 ? 102 LYS A HD2  1  
ATOM 1678  H HD3  . LYS A 1 102 ? 122.771 13.911  -8.073  1.00 0.00 ? 102 LYS A HD3  1  
ATOM 1679  H HE2  . LYS A 1 102 ? 121.077 15.094  -10.279 1.00 0.00 ? 102 LYS A HE2  1  
ATOM 1680  H HE3  . LYS A 1 102 ? 122.838 15.104  -10.222 1.00 0.00 ? 102 LYS A HE3  1  
ATOM 1681  H HZ1  . LYS A 1 102 ? 122.798 12.673  -10.267 1.00 0.00 ? 102 LYS A HZ1  1  
ATOM 1682  H HZ2  . LYS A 1 102 ? 122.044 13.333  -11.629 1.00 0.00 ? 102 LYS A HZ2  1  
ATOM 1683  H HZ3  . LYS A 1 102 ? 121.110 12.692  -10.376 1.00 0.00 ? 102 LYS A HZ3  1  
ATOM 1684  N N    . LEU A 1 103 ? 120.178 10.843  -5.464  1.00 0.00 ? 103 LEU A N    1  
ATOM 1685  C CA   . LEU A 1 103 ? 120.275 9.392   -5.614  1.00 0.00 ? 103 LEU A CA   1  
ATOM 1686  C C    . LEU A 1 103 ? 119.050 8.713   -5.007  1.00 0.00 ? 103 LEU A C    1  
ATOM 1687  O O    . LEU A 1 103 ? 118.668 7.621   -5.421  1.00 0.00 ? 103 LEU A O    1  
ATOM 1688  C CB   . LEU A 1 103 ? 121.556 8.850   -4.948  1.00 0.00 ? 103 LEU A CB   1  
ATOM 1689  C CG   . LEU A 1 103 ? 122.888 9.192   -5.647  1.00 0.00 ? 103 LEU A CG   1  
ATOM 1690  C CD1  . LEU A 1 103 ? 122.882 8.705   -7.096  1.00 0.00 ? 103 LEU A CD1  1  
ATOM 1691  C CD2  . LEU A 1 103 ? 123.185 10.690  -5.573  1.00 0.00 ? 103 LEU A CD2  1  
ATOM 1692  H H    . LEU A 1 103 ? 120.764 11.293  -4.820  1.00 0.00 ? 103 LEU A H    1  
ATOM 1693  H HA   . LEU A 1 103 ? 120.307 9.170   -6.672  1.00 0.00 ? 103 LEU A HA   1  
ATOM 1694  H HB2  . LEU A 1 103 ? 121.598 9.236   -3.939  1.00 0.00 ? 103 LEU A HB2  1  
ATOM 1695  H HB3  . LEU A 1 103 ? 121.476 7.773   -4.893  1.00 0.00 ? 103 LEU A HB3  1  
ATOM 1696  H HG   . LEU A 1 103 ? 123.688 8.673   -5.136  1.00 0.00 ? 103 LEU A HG   1  
ATOM 1697  H HD11 . LEU A 1 103 ? 122.099 9.208   -7.647  1.00 0.00 ? 103 LEU A HD11 1  
ATOM 1698  H HD12 . LEU A 1 103 ? 122.707 7.638   -7.117  1.00 0.00 ? 103 LEU A HD12 1  
ATOM 1699  H HD13 . LEU A 1 103 ? 123.838 8.919   -7.553  1.00 0.00 ? 103 LEU A HD13 1  
ATOM 1700  H HD21 . LEU A 1 103 ? 124.127 10.896  -6.061  1.00 0.00 ? 103 LEU A HD21 1  
ATOM 1701  H HD22 . LEU A 1 103 ? 123.245 10.995  -4.538  1.00 0.00 ? 103 LEU A HD22 1  
ATOM 1702  H HD23 . LEU A 1 103 ? 122.397 11.242  -6.066  1.00 0.00 ? 103 LEU A HD23 1  
ATOM 1703  N N    . GLN A 1 104 ? 118.443 9.371   -4.024  1.00 0.00 ? 104 GLN A N    1  
ATOM 1704  C CA   . GLN A 1 104 ? 117.267 8.852   -3.348  1.00 0.00 ? 104 GLN A CA   1  
ATOM 1705  C C    . GLN A 1 104 ? 116.075 8.831   -4.299  1.00 0.00 ? 104 GLN A C    1  
ATOM 1706  O O    . GLN A 1 104 ? 115.388 7.821   -4.428  1.00 0.00 ? 104 GLN A O    1  
ATOM 1707  C CB   . GLN A 1 104 ? 116.948 9.716   -2.127  1.00 0.00 ? 104 GLN A CB   1  
ATOM 1708  C CG   . GLN A 1 104 ? 115.934 9.091   -1.191  1.00 0.00 ? 104 GLN A CG   1  
ATOM 1709  C CD   . GLN A 1 104 ? 115.546 10.010  -0.050  1.00 0.00 ? 104 GLN A CD   1  
ATOM 1710  O OE1  . GLN A 1 104 ? 116.209 10.048  0.984   1.00 0.00 ? 104 GLN A OE1  1  
ATOM 1711  N NE2  . GLN A 1 104 ? 114.461 10.745  -0.224  1.00 0.00 ? 104 GLN A NE2  1  
ATOM 1712  H H    . GLN A 1 104 ? 118.805 10.229  -3.735  1.00 0.00 ? 104 GLN A H    1  
ATOM 1713  H HA   . GLN A 1 104 ? 117.482 7.842   -3.025  1.00 0.00 ? 104 GLN A HA   1  
ATOM 1714  H HB2  . GLN A 1 104 ? 117.861 9.886   -1.572  1.00 0.00 ? 104 GLN A HB2  1  
ATOM 1715  H HB3  . GLN A 1 104 ? 116.561 10.668  -2.463  1.00 0.00 ? 104 GLN A HB3  1  
ATOM 1716  H HG2  . GLN A 1 104 ? 115.048 8.845   -1.757  1.00 0.00 ? 104 GLN A HG2  1  
ATOM 1717  H HG3  . GLN A 1 104 ? 116.358 8.187   -0.781  1.00 0.00 ? 104 GLN A HG3  1  
ATOM 1718  H HE21 . GLN A 1 104 ? 113.974 10.660  -1.072  1.00 0.00 ? 104 GLN A HE21 1  
ATOM 1719  H HE22 . GLN A 1 104 ? 114.178 11.333  0.511   1.00 0.00 ? 104 GLN A HE22 1  
ATOM 1720  N N    . ASP A 1 105 ? 115.842 9.958   -4.966  1.00 0.00 ? 105 ASP A N    1  
ATOM 1721  C CA   . ASP A 1 105 ? 114.768 10.061  -5.953  1.00 0.00 ? 105 ASP A CA   1  
ATOM 1722  C C    . ASP A 1 105 ? 115.013 9.070   -7.087  1.00 0.00 ? 105 ASP A C    1  
ATOM 1723  O O    . ASP A 1 105 ? 114.079 8.468   -7.624  1.00 0.00 ? 105 ASP A O    1  
ATOM 1724  C CB   . ASP A 1 105 ? 114.681 11.492  -6.502  1.00 0.00 ? 105 ASP A CB   1  
ATOM 1725  C CG   . ASP A 1 105 ? 113.598 11.649  -7.560  1.00 0.00 ? 105 ASP A CG   1  
ATOM 1726  O OD1  . ASP A 1 105 ? 112.400 11.638  -7.199  1.00 0.00 ? 105 ASP A OD1  1  
ATOM 1727  O OD2  . ASP A 1 105 ? 113.934 11.784  -8.757  1.00 0.00 ? 105 ASP A OD2  1  
ATOM 1728  H H    . ASP A 1 105 ? 116.404 10.742  -4.790  1.00 0.00 ? 105 ASP A H    1  
ATOM 1729  H HA   . ASP A 1 105 ? 113.837 9.810   -5.462  1.00 0.00 ? 105 ASP A HA   1  
ATOM 1730  H HB2  . ASP A 1 105 ? 114.465 12.171  -5.689  1.00 0.00 ? 105 ASP A HB2  1  
ATOM 1731  H HB3  . ASP A 1 105 ? 115.633 11.761  -6.941  1.00 0.00 ? 105 ASP A HB3  1  
ATOM 1732  N N    . GLN A 1 106 ? 116.286 8.900   -7.427  1.00 0.00 ? 106 GLN A N    1  
ATOM 1733  C CA   . GLN A 1 106 ? 116.702 7.941   -8.443  1.00 0.00 ? 106 GLN A CA   1  
ATOM 1734  C C    . GLN A 1 106 ? 116.336 6.521   -8.005  1.00 0.00 ? 106 GLN A C    1  
ATOM 1735  O O    . GLN A 1 106 ? 115.620 5.810   -8.718  1.00 0.00 ? 106 GLN A O    1  
ATOM 1736  C CB   . GLN A 1 106 ? 118.218 8.082   -8.692  1.00 0.00 ? 106 GLN A CB   1  
ATOM 1737  C CG   . GLN A 1 106 ? 118.778 7.243   -9.844  1.00 0.00 ? 106 GLN A CG   1  
ATOM 1738  C CD   . GLN A 1 106 ? 118.991 5.780   -9.484  1.00 0.00 ? 106 GLN A CD   1  
ATOM 1739  O OE1  . GLN A 1 106 ? 118.121 4.939   -9.695  1.00 0.00 ? 106 GLN A OE1  1  
ATOM 1740  N NE2  . GLN A 1 106 ? 120.150 5.474   -8.923  1.00 0.00 ? 106 GLN A NE2  1  
ATOM 1741  H H    . GLN A 1 106 ? 116.970 9.446   -6.984  1.00 0.00 ? 106 GLN A H    1  
ATOM 1742  H HA   . GLN A 1 106 ? 116.173 8.171   -9.357  1.00 0.00 ? 106 GLN A HA   1  
ATOM 1743  H HB2  . GLN A 1 106 ? 118.432 9.120   -8.905  1.00 0.00 ? 106 GLN A HB2  1  
ATOM 1744  H HB3  . GLN A 1 106 ? 118.742 7.805   -7.787  1.00 0.00 ? 106 GLN A HB3  1  
ATOM 1745  H HG2  . GLN A 1 106 ? 118.090 7.292   -10.674 1.00 0.00 ? 106 GLN A HG2  1  
ATOM 1746  H HG3  . GLN A 1 106 ? 119.728 7.664   -10.145 1.00 0.00 ? 106 GLN A HG3  1  
ATOM 1747  H HE21 . GLN A 1 106 ? 120.799 6.193   -8.776  1.00 0.00 ? 106 GLN A HE21 1  
ATOM 1748  H HE22 . GLN A 1 106 ? 120.306 4.543   -8.671  1.00 0.00 ? 106 GLN A HE22 1  
ATOM 1749  N N    . ILE A 1 107 ? 116.802 6.121   -6.818  1.00 0.00 ? 107 ILE A N    1  
ATOM 1750  C CA   . ILE A 1 107 ? 116.562 4.767   -6.324  1.00 0.00 ? 107 ILE A CA   1  
ATOM 1751  C C    . ILE A 1 107 ? 115.079 4.561   -6.045  1.00 0.00 ? 107 ILE A C    1  
ATOM 1752  O O    . ILE A 1 107 ? 114.598 3.443   -6.080  1.00 0.00 ? 107 ILE A O    1  
ATOM 1753  C CB   . ILE A 1 107 ? 117.384 4.434   -5.042  1.00 0.00 ? 107 ILE A CB   1  
ATOM 1754  C CG1  . ILE A 1 107 ? 117.419 2.911   -4.801  1.00 0.00 ? 107 ILE A CG1  1  
ATOM 1755  C CG2  . ILE A 1 107 ? 116.807 5.140   -3.816  1.00 0.00 ? 107 ILE A CG2  1  
ATOM 1756  C CD1  . ILE A 1 107 ? 118.078 2.126   -5.919  1.00 0.00 ? 107 ILE A CD1  1  
ATOM 1757  H H    . ILE A 1 107 ? 117.312 6.748   -6.267  1.00 0.00 ? 107 ILE A H    1  
ATOM 1758  H HA   . ILE A 1 107 ? 116.863 4.080   -7.105  1.00 0.00 ? 107 ILE A HA   1  
ATOM 1759  H HB   . ILE A 1 107 ? 118.395 4.789   -5.188  1.00 0.00 ? 107 ILE A HB   1  
ATOM 1760  H HG12 . ILE A 1 107 ? 117.967 2.709   -3.892  1.00 0.00 ? 107 ILE A HG12 1  
ATOM 1761  H HG13 . ILE A 1 107 ? 116.405 2.546   -4.692  1.00 0.00 ? 107 ILE A HG13 1  
ATOM 1762  H HG21 . ILE A 1 107 ? 117.424 4.929   -2.954  1.00 0.00 ? 107 ILE A HG21 1  
ATOM 1763  H HG22 . ILE A 1 107 ? 115.802 4.780   -3.632  1.00 0.00 ? 107 ILE A HG22 1  
ATOM 1764  H HG23 . ILE A 1 107 ? 116.781 6.205   -3.989  1.00 0.00 ? 107 ILE A HG23 1  
ATOM 1765  H HD11 . ILE A 1 107 ? 119.096 2.463   -6.047  1.00 0.00 ? 107 ILE A HD11 1  
ATOM 1766  H HD12 . ILE A 1 107 ? 117.529 2.275   -6.838  1.00 0.00 ? 107 ILE A HD12 1  
ATOM 1767  H HD13 . ILE A 1 107 ? 118.077 1.075   -5.668  1.00 0.00 ? 107 ILE A HD13 1  
ATOM 1768  N N    . PHE A 1 108 ? 114.363 5.651   -5.772  1.00 0.00 ? 108 PHE A N    1  
ATOM 1769  C CA   . PHE A 1 108 ? 112.917 5.599   -5.561  1.00 0.00 ? 108 PHE A CA   1  
ATOM 1770  C C    . PHE A 1 108 ? 112.228 5.140   -6.846  1.00 0.00 ? 108 PHE A C    1  
ATOM 1771  O O    . PHE A 1 108 ? 111.314 4.311   -6.822  1.00 0.00 ? 108 PHE A O    1  
ATOM 1772  C CB   . PHE A 1 108 ? 112.394 6.981   -5.131  1.00 0.00 ? 108 PHE A CB   1  
ATOM 1773  C CG   . PHE A 1 108 ? 110.917 7.018   -4.809  1.00 0.00 ? 108 PHE A CG   1  
ATOM 1774  C CD1  . PHE A 1 108 ? 110.461 6.694   -3.537  1.00 0.00 ? 108 PHE A CD1  1  
ATOM 1775  C CD2  . PHE A 1 108 ? 109.986 7.380   -5.776  1.00 0.00 ? 108 PHE A CD2  1  
ATOM 1776  C CE1  . PHE A 1 108 ? 109.111 6.731   -3.238  1.00 0.00 ? 108 PHE A CE1  1  
ATOM 1777  C CE2  . PHE A 1 108 ? 108.635 7.416   -5.480  1.00 0.00 ? 108 PHE A CE2  1  
ATOM 1778  C CZ   . PHE A 1 108 ? 108.198 7.092   -4.210  1.00 0.00 ? 108 PHE A CZ   1  
ATOM 1779  H H    . PHE A 1 108 ? 114.822 6.514   -5.704  1.00 0.00 ? 108 PHE A H    1  
ATOM 1780  H HA   . PHE A 1 108 ? 112.717 4.881   -4.776  1.00 0.00 ? 108 PHE A HA   1  
ATOM 1781  H HB2  . PHE A 1 108 ? 112.932 7.299   -4.249  1.00 0.00 ? 108 PHE A HB2  1  
ATOM 1782  H HB3  . PHE A 1 108 ? 112.580 7.689   -5.927  1.00 0.00 ? 108 PHE A HB3  1  
ATOM 1783  H HD1  . PHE A 1 108 ? 111.172 6.411   -2.774  1.00 0.00 ? 108 PHE A HD1  1  
ATOM 1784  H HD2  . PHE A 1 108 ? 110.324 7.635   -6.770  1.00 0.00 ? 108 PHE A HD2  1  
ATOM 1785  H HE1  . PHE A 1 108 ? 108.770 6.476   -2.245  1.00 0.00 ? 108 PHE A HE1  1  
ATOM 1786  H HE2  . PHE A 1 108 ? 107.922 7.698   -6.241  1.00 0.00 ? 108 PHE A HE2  1  
ATOM 1787  H HZ   . PHE A 1 108 ? 107.143 7.120   -3.977  1.00 0.00 ? 108 PHE A HZ   1  
ATOM 1788  N N    . ASN A 1 109 ? 112.695 5.680   -7.968  1.00 0.00 ? 109 ASN A N    1  
ATOM 1789  C CA   . ASN A 1 109 ? 112.181 5.312   -9.284  1.00 0.00 ? 109 ASN A CA   1  
ATOM 1790  C C    . ASN A 1 109 ? 112.522 3.856   -9.594  1.00 0.00 ? 109 ASN A C    1  
ATOM 1791  O O    . ASN A 1 109 ? 111.650 3.062   -9.963  1.00 0.00 ? 109 ASN A O    1  
ATOM 1792  C CB   . ASN A 1 109 ? 112.768 6.242   -10.357 1.00 0.00 ? 109 ASN A CB   1  
ATOM 1793  C CG   . ASN A 1 109 ? 112.373 5.841   -11.770 1.00 0.00 ? 109 ASN A CG   1  
ATOM 1794  O OD1  . ASN A 1 109 ? 111.320 6.240   -12.271 1.00 0.00 ? 109 ASN A OD1  1  
ATOM 1795  N ND2  . ASN A 1 109 ? 113.225 5.072   -12.431 1.00 0.00 ? 109 ASN A ND2  1  
ATOM 1796  H H    . ASN A 1 109 ? 113.416 6.344   -7.908  1.00 0.00 ? 109 ASN A H    1  
ATOM 1797  H HA   . ASN A 1 109 ? 111.105 5.426   -9.266  1.00 0.00 ? 109 ASN A HA   1  
ATOM 1798  H HB2  . ASN A 1 109 ? 112.418 7.249   -10.180 1.00 0.00 ? 109 ASN A HB2  1  
ATOM 1799  H HB3  . ASN A 1 109 ? 113.847 6.226   -10.286 1.00 0.00 ? 109 ASN A HB3  1  
ATOM 1800  H HD21 . ASN A 1 109 ? 114.061 4.808   -11.983 1.00 0.00 ? 109 ASN A HD21 1  
ATOM 1801  H HD22 . ASN A 1 109 ? 112.986 4.793   -13.340 1.00 0.00 ? 109 ASN A HD22 1  
ATOM 1802  N N    . LEU A 1 110 ? 113.797 3.514   -9.421  1.00 0.00 ? 110 LEU A N    1  
ATOM 1803  C CA   . LEU A 1 110 ? 114.283 2.157   -9.645  1.00 0.00 ? 110 LEU A CA   1  
ATOM 1804  C C    . LEU A 1 110 ? 113.585 1.187   -8.690  1.00 0.00 ? 110 LEU A C    1  
ATOM 1805  O O    . LEU A 1 110 ? 113.311 0.043   -9.042  1.00 0.00 ? 110 LEU A O    1  
ATOM 1806  C CB   . LEU A 1 110 ? 115.814 2.130   -9.449  1.00 0.00 ? 110 LEU A CB   1  
ATOM 1807  C CG   . LEU A 1 110 ? 116.560 0.848   -9.881  1.00 0.00 ? 110 LEU A CG   1  
ATOM 1808  C CD1  . LEU A 1 110 ? 116.436 -0.264  -8.837  1.00 0.00 ? 110 LEU A CD1  1  
ATOM 1809  C CD2  . LEU A 1 110 ? 116.069 0.367   -11.248 1.00 0.00 ? 110 LEU A CD2  1  
ATOM 1810  H H    . LEU A 1 110 ? 114.438 4.201   -9.135  1.00 0.00 ? 110 LEU A H    1  
ATOM 1811  H HA   . LEU A 1 110 ? 114.049 1.881   -10.663 1.00 0.00 ? 110 LEU A HA   1  
ATOM 1812  H HB2  . LEU A 1 110 ? 116.232 2.958   -10.005 1.00 0.00 ? 110 LEU A HB2  1  
ATOM 1813  H HB3  . LEU A 1 110 ? 116.018 2.298   -8.400  1.00 0.00 ? 110 LEU A HB3  1  
ATOM 1814  H HG   . LEU A 1 110 ? 117.610 1.083   -9.977  1.00 0.00 ? 110 LEU A HG   1  
ATOM 1815  H HD11 . LEU A 1 110 ? 115.399 -0.548  -8.729  1.00 0.00 ? 110 LEU A HD11 1  
ATOM 1816  H HD12 . LEU A 1 110 ? 116.812 0.090   -7.888  1.00 0.00 ? 110 LEU A HD12 1  
ATOM 1817  H HD13 . LEU A 1 110 ? 117.013 -1.122  -9.153  1.00 0.00 ? 110 LEU A HD13 1  
ATOM 1818  H HD21 . LEU A 1 110 ? 116.630 -0.507  -11.546 1.00 0.00 ? 110 LEU A HD21 1  
ATOM 1819  H HD22 . LEU A 1 110 ? 116.214 1.150   -11.978 1.00 0.00 ? 110 LEU A HD22 1  
ATOM 1820  H HD23 . LEU A 1 110 ? 115.019 0.118   -11.191 1.00 0.00 ? 110 LEU A HD23 1  
ATOM 1821  N N    . MET A 1 111 ? 113.284 1.669   -7.491  1.00 0.00 ? 111 MET A N    1  
ATOM 1822  C CA   . MET A 1 111 ? 112.667 0.851   -6.455  1.00 0.00 ? 111 MET A CA   1  
ATOM 1823  C C    . MET A 1 111 ? 111.280 0.411   -6.895  1.00 0.00 ? 111 MET A C    1  
ATOM 1824  O O    . MET A 1 111 ? 110.947 -0.768  -6.832  1.00 0.00 ? 111 MET A O    1  
ATOM 1825  C CB   . MET A 1 111 ? 112.572 1.631   -5.135  1.00 0.00 ? 111 MET A CB   1  
ATOM 1826  C CG   . MET A 1 111 ? 112.358 0.757   -3.909  1.00 0.00 ? 111 MET A CG   1  
ATOM 1827  S SD   . MET A 1 111 ? 112.078 1.724   -2.415  1.00 0.00 ? 111 MET A SD   1  
ATOM 1828  C CE   . MET A 1 111 ? 113.600 2.667   -2.345  1.00 0.00 ? 111 MET A CE   1  
ATOM 1829  H H    . MET A 1 111 ? 113.486 2.606   -7.296  1.00 0.00 ? 111 MET A H    1  
ATOM 1830  H HA   . MET A 1 111 ? 113.285 -0.024  -6.307  1.00 0.00 ? 111 MET A HA   1  
ATOM 1831  H HB2  . MET A 1 111 ? 113.488 2.184   -4.994  1.00 0.00 ? 111 MET A HB2  1  
ATOM 1832  H HB3  . MET A 1 111 ? 111.751 2.330   -5.200  1.00 0.00 ? 111 MET A HB3  1  
ATOM 1833  H HG2  . MET A 1 111 ? 111.504 0.119   -4.075  1.00 0.00 ? 111 MET A HG2  1  
ATOM 1834  H HG3  . MET A 1 111 ? 113.242 0.151   -3.764  1.00 0.00 ? 111 MET A HG3  1  
ATOM 1835  H HE1  . MET A 1 111 ? 113.581 3.315   -1.482  1.00 0.00 ? 111 MET A HE1  1  
ATOM 1836  H HE2  . MET A 1 111 ? 113.697 3.263   -3.240  1.00 0.00 ? 111 MET A HE2  1  
ATOM 1837  H HE3  . MET A 1 111 ? 114.439 1.991   -2.268  1.00 0.00 ? 111 MET A HE3  1  
ATOM 1838  N N    . LYS A 1 112 ? 110.475 1.361   -7.357  1.00 0.00 ? 112 LYS A N    1  
ATOM 1839  C CA   . LYS A 1 112 ? 109.134 1.045   -7.830  1.00 0.00 ? 112 LYS A CA   1  
ATOM 1840  C C    . LYS A 1 112 ? 109.205 -0.019  -8.926  1.00 0.00 ? 112 LYS A C    1  
ATOM 1841  O O    . LYS A 1 112 ? 108.574 -1.070  -8.830  1.00 0.00 ? 112 LYS A O    1  
ATOM 1842  C CB   . LYS A 1 112 ? 108.423 2.300   -8.356  1.00 0.00 ? 112 LYS A CB   1  
ATOM 1843  C CG   . LYS A 1 112 ? 106.987 2.036   -8.805  1.00 0.00 ? 112 LYS A CG   1  
ATOM 1844  C CD   . LYS A 1 112 ? 106.320 3.280   -9.384  1.00 0.00 ? 112 LYS A CD   1  
ATOM 1845  C CE   . LYS A 1 112 ? 104.902 2.979   -9.860  1.00 0.00 ? 112 LYS A CE   1  
ATOM 1846  N NZ   . LYS A 1 112 ? 104.264 4.158   -10.501 1.00 0.00 ? 112 LYS A NZ   1  
ATOM 1847  H H    . LYS A 1 112 ? 110.789 2.292   -7.378  1.00 0.00 ? 112 LYS A H    1  
ATOM 1848  H HA   . LYS A 1 112 ? 108.575 0.648   -6.993  1.00 0.00 ? 112 LYS A HA   1  
ATOM 1849  H HB2  . LYS A 1 112 ? 108.404 3.047   -7.574  1.00 0.00 ? 112 LYS A HB2  1  
ATOM 1850  H HB3  . LYS A 1 112 ? 108.978 2.689   -9.199  1.00 0.00 ? 112 LYS A HB3  1  
ATOM 1851  H HG2  . LYS A 1 112 ? 106.997 1.265   -9.563  1.00 0.00 ? 112 LYS A HG2  1  
ATOM 1852  H HG3  . LYS A 1 112 ? 106.414 1.694   -7.954  1.00 0.00 ? 112 LYS A HG3  1  
ATOM 1853  H HD2  . LYS A 1 112 ? 106.279 4.045   -8.621  1.00 0.00 ? 112 LYS A HD2  1  
ATOM 1854  H HD3  . LYS A 1 112 ? 106.904 3.636   -10.221 1.00 0.00 ? 112 LYS A HD3  1  
ATOM 1855  H HE2  . LYS A 1 112 ? 104.938 2.171   -10.576 1.00 0.00 ? 112 LYS A HE2  1  
ATOM 1856  H HE3  . LYS A 1 112 ? 104.306 2.677   -9.010  1.00 0.00 ? 112 LYS A HE3  1  
ATOM 1857  H HZ1  . LYS A 1 112 ? 104.174 4.934   -9.818  1.00 0.00 ? 112 LYS A HZ1  1  
ATOM 1858  H HZ2  . LYS A 1 112 ? 103.317 3.908   -10.851 1.00 0.00 ? 112 LYS A HZ2  1  
ATOM 1859  H HZ3  . LYS A 1 112 ? 104.840 4.484   -11.303 1.00 0.00 ? 112 LYS A HZ3  1  
ATOM 1860  N N    . TYR A 1 113 ? 110.004 0.255   -9.949  1.00 0.00 ? 113 TYR A N    1  
ATOM 1861  C CA   . TYR A 1 113 ? 110.170 -0.660  -11.076 1.00 0.00 ? 113 TYR A CA   1  
ATOM 1862  C C    . TYR A 1 113 ? 110.665 -2.036  -10.605 1.00 0.00 ? 113 TYR A C    1  
ATOM 1863  O O    . TYR A 1 113 ? 109.955 -3.042  -10.711 1.00 0.00 ? 113 TYR A O    1  
ATOM 1864  C CB   . TYR A 1 113 ? 111.158 -0.048  -12.084 1.00 0.00 ? 113 TYR A CB   1  
ATOM 1865  C CG   . TYR A 1 113 ? 111.486 -0.938  -13.271 1.00 0.00 ? 113 TYR A CG   1  
ATOM 1866  C CD1  . TYR A 1 113 ? 110.594 -1.081  -14.329 1.00 0.00 ? 113 TYR A CD1  1  
ATOM 1867  C CD2  . TYR A 1 113 ? 112.695 -1.627  -13.338 1.00 0.00 ? 113 TYR A CD2  1  
ATOM 1868  C CE1  . TYR A 1 113 ? 110.897 -1.880  -15.415 1.00 0.00 ? 113 TYR A CE1  1  
ATOM 1869  C CE2  . TYR A 1 113 ? 113.002 -2.428  -14.420 1.00 0.00 ? 113 TYR A CE2  1  
ATOM 1870  C CZ   . TYR A 1 113 ? 112.100 -2.552  -15.455 1.00 0.00 ? 113 TYR A CZ   1  
ATOM 1871  O OH   . TYR A 1 113 ? 112.407 -3.346  -16.538 1.00 0.00 ? 113 TYR A OH   1  
ATOM 1872  H H    . TYR A 1 113 ? 110.502 1.102   -9.947  1.00 0.00 ? 113 TYR A H    1  
ATOM 1873  H HA   . TYR A 1 113 ? 109.208 -0.777  -11.554 1.00 0.00 ? 113 TYR A HA   1  
ATOM 1874  H HB2  . TYR A 1 113 ? 110.740 0.871   -12.469 1.00 0.00 ? 113 TYR A HB2  1  
ATOM 1875  H HB3  . TYR A 1 113 ? 112.084 0.178   -11.572 1.00 0.00 ? 113 TYR A HB3  1  
ATOM 1876  H HD1  . TYR A 1 113 ? 109.651 -0.556  -14.296 1.00 0.00 ? 113 TYR A HD1  1  
ATOM 1877  H HD2  . TYR A 1 113 ? 113.401 -1.529  -12.525 1.00 0.00 ? 113 TYR A HD2  1  
ATOM 1878  H HE1  . TYR A 1 113 ? 110.191 -1.978  -16.227 1.00 0.00 ? 113 TYR A HE1  1  
ATOM 1879  H HE2  . TYR A 1 113 ? 113.945 -2.955  -14.451 1.00 0.00 ? 113 TYR A HE2  1  
ATOM 1880  H HH   . TYR A 1 113 ? 112.282 -2.833  -17.350 1.00 0.00 ? 113 TYR A HH   1  
ATOM 1881  N N    . ASP A 1 114 ? 111.876 -2.056  -10.065 1.00 0.00 ? 114 ASP A N    1  
ATOM 1882  C CA   . ASP A 1 114 ? 112.550 -3.296  -9.675  1.00 0.00 ? 114 ASP A CA   1  
ATOM 1883  C C    . ASP A 1 114 ? 111.871 -3.974  -8.483  1.00 0.00 ? 114 ASP A C    1  
ATOM 1884  O O    . ASP A 1 114 ? 111.410 -5.113  -8.586  1.00 0.00 ? 114 ASP A O    1  
ATOM 1885  C CB   . ASP A 1 114 ? 114.022 -3.002  -9.344  1.00 0.00 ? 114 ASP A CB   1  
ATOM 1886  C CG   . ASP A 1 114 ? 114.736 -4.175  -8.688  1.00 0.00 ? 114 ASP A CG   1  
ATOM 1887  O OD1  . ASP A 1 114 ? 115.208 -5.081  -9.412  1.00 0.00 ? 114 ASP A OD1  1  
ATOM 1888  O OD2  . ASP A 1 114 ? 114.839 -4.192  -7.444  1.00 0.00 ? 114 ASP A OD2  1  
ATOM 1889  H H    . ASP A 1 114 ? 112.337 -1.206  -9.918  1.00 0.00 ? 114 ASP A H    1  
ATOM 1890  H HA   . ASP A 1 114 ? 112.515 -3.968  -10.521 1.00 0.00 ? 114 ASP A HA   1  
ATOM 1891  H HB2  . ASP A 1 114 ? 114.545 -2.755  -10.258 1.00 0.00 ? 114 ASP A HB2  1  
ATOM 1892  H HB3  . ASP A 1 114 ? 114.069 -2.153  -8.674  1.00 0.00 ? 114 ASP A HB3  1  
ATOM 1893  N N    . SER A 1 115 ? 111.794 -3.267  -7.360  1.00 0.00 ? 115 SER A N    1  
ATOM 1894  C CA   . SER A 1 115 ? 111.339 -3.861  -6.107  1.00 0.00 ? 115 SER A CA   1  
ATOM 1895  C C    . SER A 1 115 ? 109.894 -4.368  -6.200  1.00 0.00 ? 115 SER A C    1  
ATOM 1896  O O    . SER A 1 115 ? 109.546 -5.352  -5.544  1.00 0.00 ? 115 SER A O    1  
ATOM 1897  C CB   . SER A 1 115 ? 111.508 -2.866  -4.955  1.00 0.00 ? 115 SER A CB   1  
ATOM 1898  O OG   . SER A 1 115 ? 112.855 -2.414  -4.879  1.00 0.00 ? 115 SER A OG   1  
ATOM 1899  H H    . SER A 1 115 ? 112.044 -2.318  -7.376  1.00 0.00 ? 115 SER A H    1  
ATOM 1900  H HA   . SER A 1 115 ? 111.977 -4.713  -5.912  1.00 0.00 ? 115 SER A HA   1  
ATOM 1901  H HB2  . SER A 1 115 ? 110.864 -2.013  -5.115  1.00 0.00 ? 115 SER A HB2  1  
ATOM 1902  H HB3  . SER A 1 115 ? 111.249 -3.344  -4.022  1.00 0.00 ? 115 SER A HB3  1  
ATOM 1903  H HG   . SER A 1 115 ? 113.369 -2.817  -5.592  1.00 0.00 ? 115 SER A HG   1  
ATOM 1904  N N    . TYR A 1 116 ? 109.051 -3.723  -7.017  1.00 0.00 ? 116 TYR A N    1  
ATOM 1905  C CA   . TYR A 1 116 ? 107.710 -4.260  -7.272  1.00 0.00 ? 116 TYR A CA   1  
ATOM 1906  C C    . TYR A 1 116 ? 107.819 -5.570  -8.041  1.00 0.00 ? 116 TYR A C    1  
ATOM 1907  O O    . TYR A 1 116 ? 107.191 -6.563  -7.681  1.00 0.00 ? 116 TYR A O    1  
ATOM 1908  C CB   . TYR A 1 116 ? 106.832 -3.272  -8.054  1.00 0.00 ? 116 TYR A CB   1  
ATOM 1909  C CG   . TYR A 1 116 ? 106.092 -2.270  -7.187  1.00 0.00 ? 116 TYR A CG   1  
ATOM 1910  C CD1  . TYR A 1 116 ? 106.769 -1.273  -6.494  1.00 0.00 ? 116 TYR A CD1  1  
ATOM 1911  C CD2  . TYR A 1 116 ? 104.706 -2.322  -7.068  1.00 0.00 ? 116 TYR A CD2  1  
ATOM 1912  C CE1  . TYR A 1 116 ? 106.089 -0.361  -5.712  1.00 0.00 ? 116 TYR A CE1  1  
ATOM 1913  C CE2  . TYR A 1 116 ? 104.021 -1.412  -6.290  1.00 0.00 ? 116 TYR A CE2  1  
ATOM 1914  C CZ   . TYR A 1 116 ? 104.717 -0.435  -5.614  1.00 0.00 ? 116 TYR A CZ   1  
ATOM 1915  O OH   . TYR A 1 116 ? 104.036 0.478   -4.844  1.00 0.00 ? 116 TYR A OH   1  
ATOM 1916  H H    . TYR A 1 116 ? 109.331 -2.883  -7.451  1.00 0.00 ? 116 TYR A H    1  
ATOM 1917  H HA   . TYR A 1 116 ? 107.249 -4.460  -6.314  1.00 0.00 ? 116 TYR A HA   1  
ATOM 1918  H HB2  . TYR A 1 116 ? 107.454 -2.718  -8.740  1.00 0.00 ? 116 TYR A HB2  1  
ATOM 1919  H HB3  . TYR A 1 116 ? 106.096 -3.827  -8.621  1.00 0.00 ? 116 TYR A HB3  1  
ATOM 1920  H HD1  . TYR A 1 116 ? 107.845 -1.216  -6.573  1.00 0.00 ? 116 TYR A HD1  1  
ATOM 1921  H HD2  . TYR A 1 116 ? 104.162 -3.090  -7.600  1.00 0.00 ? 116 TYR A HD2  1  
ATOM 1922  H HE1  . TYR A 1 116 ? 106.634 0.407   -5.181  1.00 0.00 ? 116 TYR A HE1  1  
ATOM 1923  H HE2  . TYR A 1 116 ? 102.945 -1.471  -6.210  1.00 0.00 ? 116 TYR A HE2  1  
ATOM 1924  H HH   . TYR A 1 116 ? 103.490 0.009   -4.202  1.00 0.00 ? 116 TYR A HH   1  
ATOM 1925  N N    . SER A 1 117 ? 108.645 -5.571  -9.083  1.00 0.00 ? 117 SER A N    1  
ATOM 1926  C CA   . SER A 1 117 ? 108.852 -6.764  -9.897  1.00 0.00 ? 117 SER A CA   1  
ATOM 1927  C C    . SER A 1 117 ? 109.520 -7.877  -9.083  1.00 0.00 ? 117 SER A C    1  
ATOM 1928  O O    . SER A 1 117 ? 109.591 -9.023  -9.526  1.00 0.00 ? 117 SER A O    1  
ATOM 1929  C CB   . SER A 1 117 ? 109.693 -6.419  -11.129 1.00 0.00 ? 117 SER A CB   1  
ATOM 1930  O OG   . SER A 1 117 ? 109.083 -5.381  -11.883 1.00 0.00 ? 117 SER A OG   1  
ATOM 1931  H H    . SER A 1 117 ? 109.129 -4.746  -9.315  1.00 0.00 ? 117 SER A H    1  
ATOM 1932  H HA   . SER A 1 117 ? 107.880 -7.110  -10.223 1.00 0.00 ? 117 SER A HA   1  
ATOM 1933  H HB2  . SER A 1 117 ? 110.673 -6.090  -10.816 1.00 0.00 ? 117 SER A HB2  1  
ATOM 1934  H HB3  . SER A 1 117 ? 109.790 -7.293  -11.756 1.00 0.00 ? 117 SER A HB3  1  
ATOM 1935  H HG   . SER A 1 117 ? 109.602 -4.573  -11.787 1.00 0.00 ? 117 SER A HG   1  
ATOM 1936  N N    . ARG A 1 118 ? 110.023 -7.527  -7.897  1.00 0.00 ? 118 ARG A N    1  
ATOM 1937  C CA   . ARG A 1 118 ? 110.571 -8.512  -6.967  1.00 0.00 ? 118 ARG A CA   1  
ATOM 1938  C C    . ARG A 1 118 ? 109.485 -9.013  -6.012  1.00 0.00 ? 118 ARG A C    1  
ATOM 1939  O O    . ARG A 1 118 ? 109.229 -10.214 -5.916  1.00 0.00 ? 118 ARG A O    1  
ATOM 1940  C CB   . ARG A 1 118 ? 111.721 -7.919  -6.143  1.00 0.00 ? 118 ARG A CB   1  
ATOM 1941  C CG   . ARG A 1 118 ? 112.971 -7.557  -6.941  1.00 0.00 ? 118 ARG A CG   1  
ATOM 1942  C CD   . ARG A 1 118 ? 114.102 -7.151  -6.004  1.00 0.00 ? 118 ARG A CD   1  
ATOM 1943  N NE   . ARG A 1 118 ? 115.339 -6.813  -6.707  1.00 0.00 ? 118 ARG A NE   1  
ATOM 1944  C CZ   . ARG A 1 118 ? 116.524 -7.365  -6.436  1.00 0.00 ? 118 ARG A CZ   1  
ATOM 1945  N NH1  . ARG A 1 118 ? 116.602 -8.407  -5.615  1.00 0.00 ? 118 ARG A NH1  1  
ATOM 1946  N NH2  . ARG A 1 118 ? 117.622 -6.900  -7.019  1.00 0.00 ? 118 ARG A NH2  1  
ATOM 1947  H H    . ARG A 1 118 ? 110.036 -6.580  -7.650  1.00 0.00 ? 118 ARG A H    1  
ATOM 1948  H HA   . ARG A 1 118 ? 110.944 -9.349  -7.543  1.00 0.00 ? 118 ARG A HA   1  
ATOM 1949  H HB2  . ARG A 1 118 ? 111.366 -7.021  -5.656  1.00 0.00 ? 118 ARG A HB2  1  
ATOM 1950  H HB3  . ARG A 1 118 ? 112.003 -8.636  -5.383  1.00 0.00 ? 118 ARG A HB3  1  
ATOM 1951  H HG2  . ARG A 1 118 ? 113.283 -8.415  -7.521  1.00 0.00 ? 118 ARG A HG2  1  
ATOM 1952  H HG3  . ARG A 1 118 ? 112.745 -6.733  -7.603  1.00 0.00 ? 118 ARG A HG3  1  
ATOM 1953  H HD2  . ARG A 1 118 ? 113.785 -6.288  -5.437  1.00 0.00 ? 118 ARG A HD2  1  
ATOM 1954  H HD3  . ARG A 1 118 ? 114.296 -7.969  -5.325  1.00 0.00 ? 118 ARG A HD3  1  
ATOM 1955  H HE   . ARG A 1 118 ? 115.292 -6.091  -7.377  1.00 0.00 ? 118 ARG A HE   1  
ATOM 1956  H HH11 . ARG A 1 118 ? 115.770 -8.789  -5.198  1.00 0.00 ? 118 ARG A HH11 1  
ATOM 1957  H HH12 . ARG A 1 118 ? 117.493 -8.817  -5.404  1.00 0.00 ? 118 ARG A HH12 1  
ATOM 1958  H HH21 . ARG A 1 118 ? 117.563 -6.137  -7.668  1.00 0.00 ? 118 ARG A HH21 1  
ATOM 1959  H HH22 . ARG A 1 118 ? 118.519 -7.298  -6.801  1.00 0.00 ? 118 ARG A HH22 1  
ATOM 1960  N N    . PHE A 1 119 ? 108.850 -8.080  -5.308  1.00 0.00 ? 119 PHE A N    1  
ATOM 1961  C CA   . PHE A 1 119 ? 107.871 -8.415  -4.274  1.00 0.00 ? 119 PHE A CA   1  
ATOM 1962  C C    . PHE A 1 119 ? 106.658 -9.115  -4.891  1.00 0.00 ? 119 PHE A C    1  
ATOM 1963  O O    . PHE A 1 119 ? 106.109 -10.055 -4.316  1.00 0.00 ? 119 PHE A O    1  
ATOM 1964  C CB   . PHE A 1 119 ? 107.441 -7.140  -3.528  1.00 0.00 ? 119 PHE A CB   1  
ATOM 1965  C CG   . PHE A 1 119 ? 106.745 -7.399  -2.211  1.00 0.00 ? 119 PHE A CG   1  
ATOM 1966  C CD1  . PHE A 1 119 ? 105.370 -7.585  -2.155  1.00 0.00 ? 119 PHE A CD1  1  
ATOM 1967  C CD2  . PHE A 1 119 ? 107.472 -7.452  -1.026  1.00 0.00 ? 119 PHE A CD2  1  
ATOM 1968  C CE1  . PHE A 1 119 ? 104.737 -7.821  -0.949  1.00 0.00 ? 119 PHE A CE1  1  
ATOM 1969  C CE2  . PHE A 1 119 ? 106.841 -7.687  0.181   1.00 0.00 ? 119 PHE A CE2  1  
ATOM 1970  C CZ   . PHE A 1 119 ? 105.472 -7.872  0.219   1.00 0.00 ? 119 PHE A CZ   1  
ATOM 1971  H H    . PHE A 1 119 ? 109.042 -7.137  -5.491  1.00 0.00 ? 119 PHE A H    1  
ATOM 1972  H HA   . PHE A 1 119 ? 108.346 -9.090  -3.574  1.00 0.00 ? 119 PHE A HA   1  
ATOM 1973  H HB2  . PHE A 1 119 ? 108.317 -6.540  -3.326  1.00 0.00 ? 119 PHE A HB2  1  
ATOM 1974  H HB3  . PHE A 1 119 ? 106.767 -6.574  -4.157  1.00 0.00 ? 119 PHE A HB3  1  
ATOM 1975  H HD1  . PHE A 1 119 ? 104.792 -7.547  -3.068  1.00 0.00 ? 119 PHE A HD1  1  
ATOM 1976  H HD2  . PHE A 1 119 ? 108.545 -7.306  -1.052  1.00 0.00 ? 119 PHE A HD2  1  
ATOM 1977  H HE1  . PHE A 1 119 ? 103.666 -7.964  -0.920  1.00 0.00 ? 119 PHE A HE1  1  
ATOM 1978  H HE2  . PHE A 1 119 ? 107.418 -7.726  1.093   1.00 0.00 ? 119 PHE A HE2  1  
ATOM 1979  H HZ   . PHE A 1 119 ? 104.977 -8.056  1.161   1.00 0.00 ? 119 PHE A HZ   1  
ATOM 1980  N N    . LEU A 1 120 ? 106.260 -8.653  -6.073  1.00 0.00 ? 120 LEU A N    1  
ATOM 1981  C CA   . LEU A 1 120 ? 105.137 -9.237  -6.807  1.00 0.00 ? 120 LEU A CA   1  
ATOM 1982  C C    . LEU A 1 120 ? 105.606 -10.428 -7.652  1.00 0.00 ? 120 LEU A C    1  
ATOM 1983  O O    . LEU A 1 120 ? 104.833 -11.007 -8.419  1.00 0.00 ? 120 LEU A O    1  
ATOM 1984  C CB   . LEU A 1 120 ? 104.484 -8.166  -7.696  1.00 0.00 ? 120 LEU A CB   1  
ATOM 1985  C CG   . LEU A 1 120 ? 104.046 -6.884  -6.962  1.00 0.00 ? 120 LEU A CG   1  
ATOM 1986  C CD1  . LEU A 1 120 ? 103.505 -5.851  -7.946  1.00 0.00 ? 120 LEU A CD1  1  
ATOM 1987  C CD2  . LEU A 1 120 ? 103.012 -7.197  -5.881  1.00 0.00 ? 120 LEU A CD2  1  
ATOM 1988  H H    . LEU A 1 120 ? 106.730 -7.888  -6.463  1.00 0.00 ? 120 LEU A H    1  
ATOM 1989  H HA   . LEU A 1 120 ? 104.412 -9.586  -6.086  1.00 0.00 ? 120 LEU A HA   1  
ATOM 1990  H HB2  . LEU A 1 120 ? 105.190 -7.891  -8.469  1.00 0.00 ? 120 LEU A HB2  1  
ATOM 1991  H HB3  . LEU A 1 120 ? 103.613 -8.600  -8.168  1.00 0.00 ? 120 LEU A HB3  1  
ATOM 1992  H HG   . LEU A 1 120 ? 104.909 -6.449  -6.476  1.00 0.00 ? 120 LEU A HG   1  
ATOM 1993  H HD11 . LEU A 1 120 ? 102.651 -6.259  -8.466  1.00 0.00 ? 120 LEU A HD11 1  
ATOM 1994  H HD12 . LEU A 1 120 ? 104.276 -5.598  -8.662  1.00 0.00 ? 120 LEU A HD12 1  
ATOM 1995  H HD13 . LEU A 1 120 ? 103.209 -4.960  -7.408  1.00 0.00 ? 120 LEU A HD13 1  
ATOM 1996  H HD21 . LEU A 1 120 ? 102.141 -7.650  -6.333  1.00 0.00 ? 120 LEU A HD21 1  
ATOM 1997  H HD22 . LEU A 1 120 ? 102.723 -6.283  -5.382  1.00 0.00 ? 120 LEU A HD22 1  
ATOM 1998  H HD23 . LEU A 1 120 ? 103.438 -7.879  -5.159  1.00 0.00 ? 120 LEU A HD23 1  
ATOM 1999  N N    . LYS A 1 121 ? 106.887 -10.767 -7.525  1.00 0.00 ? 121 LYS A N    1  
ATOM 2000  C CA   . LYS A 1 121 ? 107.451 -11.960 -8.158  1.00 0.00 ? 121 LYS A CA   1  
ATOM 2001  C C    . LYS A 1 121 ? 107.258 -13.153 -7.238  1.00 0.00 ? 121 LYS A C    1  
ATOM 2002  O O    . LYS A 1 121 ? 106.747 -14.198 -7.646  1.00 0.00 ? 121 LYS A O    1  
ATOM 2003  C CB   . LYS A 1 121 ? 108.938 -11.751 -8.446  1.00 0.00 ? 121 LYS A CB   1  
ATOM 2004  C CG   . LYS A 1 121 ? 109.680 -13.000 -8.916  1.00 0.00 ? 121 LYS A CG   1  
ATOM 2005  C CD   . LYS A 1 121 ? 111.192 -12.788 -8.880  1.00 0.00 ? 121 LYS A CD   1  
ATOM 2006  C CE   . LYS A 1 121 ? 111.644 -12.323 -7.501  1.00 0.00 ? 121 LYS A CE   1  
ATOM 2007  N NZ   . LYS A 1 121 ? 113.118 -12.155 -7.410  1.00 0.00 ? 121 LYS A NZ   1  
ATOM 2008  H H    . LYS A 1 121 ? 107.472 -10.201 -6.982  1.00 0.00 ? 121 LYS A H    1  
ATOM 2009  H HA   . LYS A 1 121 ? 106.933 -12.138 -9.081  1.00 0.00 ? 121 LYS A HA   1  
ATOM 2010  H HB2  . LYS A 1 121 ? 109.037 -10.995 -9.211  1.00 0.00 ? 121 LYS A HB2  1  
ATOM 2011  H HB3  . LYS A 1 121 ? 109.410 -11.395 -7.544  1.00 0.00 ? 121 LYS A HB3  1  
ATOM 2012  H HG2  . LYS A 1 121 ? 109.427 -13.828 -8.268  1.00 0.00 ? 121 LYS A HG2  1  
ATOM 2013  H HG3  . LYS A 1 121 ? 109.381 -13.229 -9.930  1.00 0.00 ? 121 LYS A HG3  1  
ATOM 2014  H HD2  . LYS A 1 121 ? 111.685 -13.720 -9.117  1.00 0.00 ? 121 LYS A HD2  1  
ATOM 2015  H HD3  . LYS A 1 121 ? 111.461 -12.038 -9.611  1.00 0.00 ? 121 LYS A HD3  1  
ATOM 2016  H HE2  . LYS A 1 121 ? 111.172 -11.375 -7.286  1.00 0.00 ? 121 LYS A HE2  1  
ATOM 2017  H HE3  . LYS A 1 121 ? 111.324 -13.051 -6.769  1.00 0.00 ? 121 LYS A HE3  1  
ATOM 2018  H HZ1  . LYS A 1 121 ? 113.379 -11.794 -6.468  1.00 0.00 ? 121 LYS A HZ1  1  
ATOM 2019  H HZ2  . LYS A 1 121 ? 113.448 -11.482 -8.129  1.00 0.00 ? 121 LYS A HZ2  1  
ATOM 2020  H HZ3  . LYS A 1 121 ? 113.594 -13.068 -7.560  1.00 0.00 ? 121 LYS A HZ3  1  
ATOM 2021  N N    . SER A 1 122 ? 107.668 -12.985 -5.989  1.00 0.00 ? 122 SER A N    1  
ATOM 2022  C CA   . SER A 1 122 ? 107.456 -13.993 -4.965  1.00 0.00 ? 122 SER A CA   1  
ATOM 2023  C C    . SER A 1 122 ? 106.490 -13.440 -3.915  1.00 0.00 ? 122 SER A C    1  
ATOM 2024  O O    . SER A 1 122 ? 106.895 -13.051 -2.817  1.00 0.00 ? 122 SER A O    1  
ATOM 2025  C CB   . SER A 1 122 ? 108.795 -14.400 -4.336  1.00 0.00 ? 122 SER A CB   1  
ATOM 2026  O OG   . SER A 1 122 ? 109.746 -14.736 -5.338  1.00 0.00 ? 122 SER A OG   1  
ATOM 2027  H H    . SER A 1 122 ? 108.126 -12.151 -5.746  1.00 0.00 ? 122 SER A H    1  
ATOM 2028  H HA   . SER A 1 122 ? 107.005 -14.858 -5.434  1.00 0.00 ? 122 SER A HA   1  
ATOM 2029  H HB2  . SER A 1 122 ? 109.184 -13.580 -3.752  1.00 0.00 ? 122 SER A HB2  1  
ATOM 2030  H HB3  . SER A 1 122 ? 108.646 -15.258 -3.696  1.00 0.00 ? 122 SER A HB3  1  
ATOM 2031  H HG   . SER A 1 122 ? 109.322 -15.282 -6.014  1.00 0.00 ? 122 SER A HG   1  
ATOM 2032  N N    . ASP A 1 123 ? 105.213 -13.379 -4.297  1.00 0.00 ? 123 ASP A N    1  
ATOM 2033  C CA   . ASP A 1 123 ? 104.161 -12.766 -3.482  1.00 0.00 ? 123 ASP A CA   1  
ATOM 2034  C C    . ASP A 1 123 ? 104.161 -13.303 -2.051  1.00 0.00 ? 123 ASP A C    1  
ATOM 2035  O O    . ASP A 1 123 ? 103.835 -14.466 -1.816  1.00 0.00 ? 123 ASP A O    1  
ATOM 2036  C CB   . ASP A 1 123 ? 102.781 -13.020 -4.113  1.00 0.00 ? 123 ASP A CB   1  
ATOM 2037  C CG   . ASP A 1 123 ? 102.662 -12.489 -5.534  1.00 0.00 ? 123 ASP A CG   1  
ATOM 2038  O OD1  . ASP A 1 123 ? 103.275 -13.085 -6.447  1.00 0.00 ? 123 ASP A OD1  1  
ATOM 2039  O OD2  . ASP A 1 123 ? 101.950 -11.485 -5.749  1.00 0.00 ? 123 ASP A OD2  1  
ATOM 2040  H H    . ASP A 1 123 ? 104.968 -13.752 -5.171  1.00 0.00 ? 123 ASP A H    1  
ATOM 2041  H HA   . ASP A 1 123 ? 104.342 -11.701 -3.456  1.00 0.00 ? 123 ASP A HA   1  
ATOM 2042  H HB2  . ASP A 1 123 ? 102.595 -14.085 -4.134  1.00 0.00 ? 123 ASP A HB2  1  
ATOM 2043  H HB3  . ASP A 1 123 ? 102.024 -12.544 -3.505  1.00 0.00 ? 123 ASP A HB3  1  
ATOM 2044  N N    . LEU A 1 124 ? 104.497 -12.442 -1.094  1.00 0.00 ? 124 LEU A N    1  
ATOM 2045  C CA   . LEU A 1 124 ? 104.459 -12.805 0.326   1.00 0.00 ? 124 LEU A CA   1  
ATOM 2046  C C    . LEU A 1 124 ? 103.029 -12.750 0.865   1.00 0.00 ? 124 LEU A C    1  
ATOM 2047  O O    . LEU A 1 124 ? 102.811 -12.722 2.077   1.00 0.00 ? 124 LEU A O    1  
ATOM 2048  C CB   . LEU A 1 124 ? 105.354 -11.869 1.153   1.00 0.00 ? 124 LEU A CB   1  
ATOM 2049  C CG   . LEU A 1 124 ? 106.856 -11.919 0.836   1.00 0.00 ? 124 LEU A CG   1  
ATOM 2050  C CD1  . LEU A 1 124 ? 107.631 -11.018 1.794   1.00 0.00 ? 124 LEU A CD1  1  
ATOM 2051  C CD2  . LEU A 1 124 ? 107.380 -13.353 0.897   1.00 0.00 ? 124 LEU A CD2  1  
ATOM 2052  H H    . LEU A 1 124 ? 104.787 -11.541 -1.348  1.00 0.00 ? 124 LEU A H    1  
ATOM 2053  H HA   . LEU A 1 124 ? 104.822 -13.821 0.422   1.00 0.00 ? 124 LEU A HA   1  
ATOM 2054  H HB2  . LEU A 1 124 ? 105.011 -10.855 0.999   1.00 0.00 ? 124 LEU A HB2  1  
ATOM 2055  H HB3  . LEU A 1 124 ? 105.223 -12.115 2.198   1.00 0.00 ? 124 LEU A HB3  1  
ATOM 2056  H HG   . LEU A 1 124 ? 107.016 -11.548 -0.166  1.00 0.00 ? 124 LEU A HG   1  
ATOM 2057  H HD11 . LEU A 1 124 ? 107.302 -9.995  1.672   1.00 0.00 ? 124 LEU A HD11 1  
ATOM 2058  H HD12 . LEU A 1 124 ? 108.686 -11.083 1.578   1.00 0.00 ? 124 LEU A HD12 1  
ATOM 2059  H HD13 . LEU A 1 124 ? 107.453 -11.333 2.814   1.00 0.00 ? 124 LEU A HD13 1  
ATOM 2060  H HD21 . LEU A 1 124 ? 108.440 -13.359 0.687   1.00 0.00 ? 124 LEU A HD21 1  
ATOM 2061  H HD22 . LEU A 1 124 ? 106.866 -13.956 0.163   1.00 0.00 ? 124 LEU A HD22 1  
ATOM 2062  H HD23 . LEU A 1 124 ? 107.207 -13.761 1.883   1.00 0.00 ? 124 LEU A HD23 1  
ATOM 2063  N N    . PHE A 1 125 ? 102.060 -12.746 -0.045  1.00 0.00 ? 125 PHE A N    1  
ATOM 2064  C CA   . PHE A 1 125 ? 100.648 -12.721 0.322   1.00 0.00 ? 125 PHE A CA   1  
ATOM 2065  C C    . PHE A 1 125 ? 100.258 -14.058 0.955   1.00 0.00 ? 125 PHE A C    1  
ATOM 2066  O O    . PHE A 1 125 ? 99.196  -14.192 1.567   1.00 0.00 ? 125 PHE A O    1  
ATOM 2067  C CB   . PHE A 1 125 ? 99.776  -12.449 -0.921  1.00 0.00 ? 125 PHE A CB   1  
ATOM 2068  C CG   . PHE A 1 125 ? 100.174 -11.230 -1.737  1.00 0.00 ? 125 PHE A CG   1  
ATOM 2069  C CD1  . PHE A 1 125 ? 101.216 -10.395 -1.342  1.00 0.00 ? 125 PHE A CD1  1  
ATOM 2070  C CD2  . PHE A 1 125 ? 99.502  -10.928 -2.914  1.00 0.00 ? 125 PHE A CD2  1  
ATOM 2071  C CE1  . PHE A 1 125 ? 101.572 -9.296  -2.099  1.00 0.00 ? 125 PHE A CE1  1  
ATOM 2072  C CE2  . PHE A 1 125 ? 99.859  -9.828  -3.674  1.00 0.00 ? 125 PHE A CE2  1  
ATOM 2073  C CZ   . PHE A 1 125 ? 100.895 -9.013  -3.266  1.00 0.00 ? 125 PHE A CZ   1  
ATOM 2074  H H    . PHE A 1 125 ? 102.300 -12.760 -0.991  1.00 0.00 ? 125 PHE A H    1  
ATOM 2075  H HA   . PHE A 1 125 ? 100.499 -11.930 1.044   1.00 0.00 ? 125 PHE A HA   1  
ATOM 2076  H HB2  . PHE A 1 125 ? 99.826  -13.307 -1.575  1.00 0.00 ? 125 PHE A HB2  1  
ATOM 2077  H HB3  . PHE A 1 125 ? 98.751  -12.313 -0.602  1.00 0.00 ? 125 PHE A HB3  1  
ATOM 2078  H HD1  . PHE A 1 125 ? 101.751 -10.610 -0.428  1.00 0.00 ? 125 PHE A HD1  1  
ATOM 2079  H HD2  . PHE A 1 125 ? 98.689  -11.563 -3.238  1.00 0.00 ? 125 PHE A HD2  1  
ATOM 2080  H HE1  . PHE A 1 125 ? 102.384 -8.659  -1.778  1.00 0.00 ? 125 PHE A HE1  1  
ATOM 2081  H HE2  . PHE A 1 125 ? 99.326  -9.608  -4.588  1.00 0.00 ? 125 PHE A HE2  1  
ATOM 2082  H HZ   . PHE A 1 125 ? 101.176 -8.154  -3.860  1.00 0.00 ? 125 PHE A HZ   1  
ATOM 2083  N N    . LEU A 1 126 ? 101.146 -15.039 0.799   1.00 0.00 ? 126 LEU A N    1  
ATOM 2084  C CA   . LEU A 1 126 ? 100.945 -16.387 1.310   1.00 0.00 ? 126 LEU A CA   1  
ATOM 2085  C C    . LEU A 1 126 ? 101.791 -16.586 2.563   1.00 0.00 ? 126 LEU A C    1  
ATOM 2086  O O    . LEU A 1 126 ? 102.922 -16.097 2.632   1.00 0.00 ? 126 LEU A O    1  
ATOM 2087  C CB   . LEU A 1 126 ? 101.352 -17.425 0.247   1.00 0.00 ? 126 LEU A CB   1  
ATOM 2088  C CG   . LEU A 1 126 ? 100.558 -17.398 -1.078  1.00 0.00 ? 126 LEU A CG   1  
ATOM 2089  C CD1  . LEU A 1 126 ? 99.053  -17.394 -0.818  1.00 0.00 ? 126 LEU A CD1  1  
ATOM 2090  C CD2  . LEU A 1 126 ? 100.967 -16.207 -1.947  1.00 0.00 ? 126 LEU A CD2  1  
ATOM 2091  H H    . LEU A 1 126 ? 101.983 -14.841 0.334   1.00 0.00 ? 126 LEU A H    1  
ATOM 2092  H HA   . LEU A 1 126 ? 99.900  -16.513 1.558   1.00 0.00 ? 126 LEU A HA   1  
ATOM 2093  H HB2  . LEU A 1 126 ? 102.399 -17.268 0.013   1.00 0.00 ? 126 LEU A HB2  1  
ATOM 2094  H HB3  . LEU A 1 126 ? 101.247 -18.410 0.681   1.00 0.00 ? 126 LEU A HB3  1  
ATOM 2095  H HG   . LEU A 1 126 ? 100.785 -18.299 -1.633  1.00 0.00 ? 126 LEU A HG   1  
ATOM 2096  H HD11 . LEU A 1 126 ? 98.525  -17.413 -1.760  1.00 0.00 ? 126 LEU A HD11 1  
ATOM 2097  H HD12 . LEU A 1 126 ? 98.781  -16.501 -0.273  1.00 0.00 ? 126 LEU A HD12 1  
ATOM 2098  H HD13 . LEU A 1 126 ? 98.785  -18.266 -0.238  1.00 0.00 ? 126 LEU A HD13 1  
ATOM 2099  H HD21 . LEU A 1 126 ? 100.420 -16.234 -2.878  1.00 0.00 ? 126 LEU A HD21 1  
ATOM 2100  H HD22 . LEU A 1 126 ? 102.027 -16.256 -2.153  1.00 0.00 ? 126 LEU A HD22 1  
ATOM 2101  H HD23 . LEU A 1 126 ? 100.745 -15.286 -1.426  1.00 0.00 ? 126 LEU A HD23 1  
ATOM 2102  N N    . LYS A 1 127 ? 101.266 -17.322 3.540   1.00 0.00 ? 127 LYS A N    1  
ATOM 2103  C CA   . LYS A 1 127 ? 102.001 -17.574 4.773   1.00 0.00 ? 127 LYS A CA   1  
ATOM 2104  C C    . LYS A 1 127 ? 103.078 -18.623 4.530   1.00 0.00 ? 127 LYS A C    1  
ATOM 2105  O O    . LYS A 1 127 ? 103.990 -18.792 5.337   1.00 0.00 ? 127 LYS A O    1  
ATOM 2106  C CB   . LYS A 1 127 ? 101.067 -18.037 5.900   1.00 0.00 ? 127 LYS A CB   1  
ATOM 2107  C CG   . LYS A 1 127 ? 100.020 -17.006 6.311   1.00 0.00 ? 127 LYS A CG   1  
ATOM 2108  C CD   . LYS A 1 127 ? 99.259  -17.447 7.560   1.00 0.00 ? 127 LYS A CD   1  
ATOM 2109  C CE   . LYS A 1 127 ? 98.187  -16.441 7.965   1.00 0.00 ? 127 LYS A CE   1  
ATOM 2110  N NZ   . LYS A 1 127 ? 97.568  -16.794 9.271   1.00 0.00 ? 127 LYS A NZ   1  
ATOM 2111  H H    . LYS A 1 127 ? 100.380 -17.724 3.420   1.00 0.00 ? 127 LYS A H    1  
ATOM 2112  H HA   . LYS A 1 127 ? 102.478 -16.647 5.065   1.00 0.00 ? 127 LYS A HA   1  
ATOM 2113  H HB2  . LYS A 1 127 ? 100.551 -18.931 5.577   1.00 0.00 ? 127 LYS A HB2  1  
ATOM 2114  H HB3  . LYS A 1 127 ? 101.665 -18.276 6.770   1.00 0.00 ? 127 LYS A HB3  1  
ATOM 2115  H HG2  . LYS A 1 127 ? 100.514 -16.066 6.516   1.00 0.00 ? 127 LYS A HG2  1  
ATOM 2116  H HG3  . LYS A 1 127 ? 99.318  -16.875 5.498   1.00 0.00 ? 127 LYS A HG3  1  
ATOM 2117  H HD2  . LYS A 1 127 ? 98.785  -18.398 7.363   1.00 0.00 ? 127 LYS A HD2  1  
ATOM 2118  H HD3  . LYS A 1 127 ? 99.961  -17.558 8.375   1.00 0.00 ? 127 LYS A HD3  1  
ATOM 2119  H HE2  . LYS A 1 127 ? 98.637  -15.462 8.045   1.00 0.00 ? 127 LYS A HE2  1  
ATOM 2120  H HE3  . LYS A 1 127 ? 97.418  -16.422 7.205   1.00 0.00 ? 127 LYS A HE3  1  
ATOM 2121  H HZ1  . LYS A 1 127 ? 97.192  -17.762 9.239   1.00 0.00 ? 127 LYS A HZ1  1  
ATOM 2122  H HZ2  . LYS A 1 127 ? 96.789  -16.141 9.489   1.00 0.00 ? 127 LYS A HZ2  1  
ATOM 2123  H HZ3  . LYS A 1 127 ? 98.279  -16.734 10.031  1.00 0.00 ? 127 LYS A HZ3  1  
ATOM 2124  N N    . HIS A 1 128 ? 102.955 -19.331 3.409   1.00 0.00 ? 128 HIS A N    1  
ATOM 2125  C CA   . HIS A 1 128 ? 103.941 -20.332 3.016   1.00 0.00 ? 128 HIS A CA   1  
ATOM 2126  C C    . HIS A 1 128 ? 105.180 -19.665 2.420   1.00 0.00 ? 128 HIS A C    1  
ATOM 2127  O O    . HIS A 1 128 ? 106.191 -20.323 2.162   1.00 0.00 ? 128 HIS A O    1  
ATOM 2128  C CB   . HIS A 1 128 ? 103.337 -21.330 2.014   1.00 0.00 ? 128 HIS A CB   1  
ATOM 2129  C CG   . HIS A 1 128 ? 102.343 -22.277 2.622   1.00 0.00 ? 128 HIS A CG   1  
ATOM 2130  N ND1  . HIS A 1 128 ? 102.007 -23.485 2.050   1.00 0.00 ? 128 HIS A ND1  1  
ATOM 2131  C CD2  . HIS A 1 128 ? 101.610 -22.190 3.759   1.00 0.00 ? 128 HIS A CD2  1  
ATOM 2132  C CE1  . HIS A 1 128 ? 101.115 -24.097 2.807   1.00 0.00 ? 128 HIS A CE1  1  
ATOM 2133  N NE2  . HIS A 1 128 ? 100.859 -23.333 3.850   1.00 0.00 ? 128 HIS A NE2  1  
ATOM 2134  H H    . HIS A 1 128 ? 102.173 -19.179 2.835   1.00 0.00 ? 128 HIS A H    1  
ATOM 2135  H HA   . HIS A 1 128 ? 104.230 -20.865 3.908   1.00 0.00 ? 128 HIS A HA   1  
ATOM 2136  H HB2  . HIS A 1 128 ? 102.834 -20.784 1.229   1.00 0.00 ? 128 HIS A HB2  1  
ATOM 2137  H HB3  . HIS A 1 128 ? 104.133 -21.920 1.579   1.00 0.00 ? 128 HIS A HB3  1  
ATOM 2138  H HD1  . HIS A 1 128 ? 102.368 -23.840 1.208   1.00 0.00 ? 128 HIS A HD1  1  
ATOM 2139  H HD2  . HIS A 1 128 ? 101.614 -21.368 4.462   1.00 0.00 ? 128 HIS A HD2  1  
ATOM 2140  H HE1  . HIS A 1 128 ? 100.670 -25.061 2.605   1.00 0.00 ? 128 HIS A HE1  1  
ATOM 2141  H HE2  . HIS A 1 128 ? 100.340 -23.610 4.638   1.00 0.00 ? 128 HIS A HE2  1  
ATOM 2142  N N    . LYS A 1 129 ? 105.086 -18.355 2.193   1.00 0.00 ? 129 LYS A N    1  
ATOM 2143  C CA   . LYS A 1 129 ? 106.211 -17.565 1.697   1.00 0.00 ? 129 LYS A CA   1  
ATOM 2144  C C    . LYS A 1 129 ? 106.645 -16.562 2.762   1.00 0.00 ? 129 LYS A C    1  
ATOM 2145  O O    . LYS A 1 129 ? 107.819 -16.498 3.127   1.00 0.00 ? 129 LYS A O    1  
ATOM 2146  C CB   . LYS A 1 129 ? 105.836 -16.854 0.389   1.00 0.00 ? 129 LYS A CB   1  
ATOM 2147  C CG   . LYS A 1 129 ? 105.547 -17.820 -0.756  1.00 0.00 ? 129 LYS A CG   1  
ATOM 2148  C CD   . LYS A 1 129 ? 105.324 -17.096 -2.080  1.00 0.00 ? 129 LYS A CD   1  
ATOM 2149  C CE   . LYS A 1 129 ? 105.165 -18.075 -3.236  1.00 0.00 ? 129 LYS A CE   1  
ATOM 2150  N NZ   . LYS A 1 129 ? 106.379 -18.915 -3.425  1.00 0.00 ? 129 LYS A NZ   1  
ATOM 2151  H H    . LYS A 1 129 ? 104.236 -17.904 2.374   1.00 0.00 ? 129 LYS A H    1  
ATOM 2152  H HA   . LYS A 1 129 ? 107.035 -18.241 1.506   1.00 0.00 ? 129 LYS A HA   1  
ATOM 2153  H HB2  . LYS A 1 129 ? 104.955 -16.250 0.558   1.00 0.00 ? 129 LYS A HB2  1  
ATOM 2154  H HB3  . LYS A 1 129 ? 106.652 -16.210 0.093   1.00 0.00 ? 129 LYS A HB3  1  
ATOM 2155  H HG2  . LYS A 1 129 ? 106.387 -18.492 -0.866  1.00 0.00 ? 129 LYS A HG2  1  
ATOM 2156  H HG3  . LYS A 1 129 ? 104.661 -18.392 -0.515  1.00 0.00 ? 129 LYS A HG3  1  
ATOM 2157  H HD2  . LYS A 1 129 ? 104.428 -16.496 -2.005  1.00 0.00 ? 129 LYS A HD2  1  
ATOM 2158  H HD3  . LYS A 1 129 ? 106.172 -16.454 -2.277  1.00 0.00 ? 129 LYS A HD3  1  
ATOM 2159  H HE2  . LYS A 1 129 ? 104.322 -18.720 -3.036  1.00 0.00 ? 129 LYS A HE2  1  
ATOM 2160  H HE3  . LYS A 1 129 ? 104.982 -17.517 -4.143  1.00 0.00 ? 129 LYS A HE3  1  
ATOM 2161  H HZ1  . LYS A 1 129 ? 106.599 -19.435 -2.548  1.00 0.00 ? 129 LYS A HZ1  1  
ATOM 2162  H HZ2  . LYS A 1 129 ? 107.195 -18.321 -3.674  1.00 0.00 ? 129 LYS A HZ2  1  
ATOM 2163  H HZ3  . LYS A 1 129 ? 106.222 -19.603 -4.188  1.00 0.00 ? 129 LYS A HZ3  1  
ATOM 2164  N N    . ARG A 1 130 ? 105.691 -15.779 3.257   1.00 0.00 ? 130 ARG A N    1  
ATOM 2165  C CA   . ARG A 1 130 ? 105.926 -14.927 4.417   1.00 0.00 ? 130 ARG A CA   1  
ATOM 2166  C C    . ARG A 1 130 ? 105.735 -15.765 5.681   1.00 0.00 ? 130 ARG A C    1  
ATOM 2167  O O    . ARG A 1 130 ? 104.623 -16.196 5.994   1.00 0.00 ? 130 ARG A O    1  
ATOM 2168  C CB   . ARG A 1 130 ? 104.992 -13.702 4.391   1.00 0.00 ? 130 ARG A CB   1  
ATOM 2169  C CG   . ARG A 1 130 ? 104.993 -12.873 5.680   1.00 0.00 ? 130 ARG A CG   1  
ATOM 2170  C CD   . ARG A 1 130 ? 103.832 -13.257 6.590   1.00 0.00 ? 130 ARG A CD   1  
ATOM 2171  N NE   . ARG A 1 130 ? 103.976 -12.733 7.945   1.00 0.00 ? 130 ARG A NE   1  
ATOM 2172  C CZ   . ARG A 1 130 ? 102.993 -12.734 8.842   1.00 0.00 ? 130 ARG A CZ   1  
ATOM 2173  N NH1  . ARG A 1 130 ? 101.761 -13.082 8.482   1.00 0.00 ? 130 ARG A NH1  1  
ATOM 2174  N NH2  . ARG A 1 130 ? 103.231 -12.375 10.094  1.00 0.00 ? 130 ARG A NH2  1  
ATOM 2175  H H    . ARG A 1 130 ? 104.806 -15.778 2.838   1.00 0.00 ? 130 ARG A H    1  
ATOM 2176  H HA   . ARG A 1 130 ? 106.954 -14.588 4.377   1.00 0.00 ? 130 ARG A HA   1  
ATOM 2177  H HB2  . ARG A 1 130 ? 105.296 -13.058 3.578   1.00 0.00 ? 130 ARG A HB2  1  
ATOM 2178  H HB3  . ARG A 1 130 ? 103.982 -14.040 4.203   1.00 0.00 ? 130 ARG A HB3  1  
ATOM 2179  H HG2  . ARG A 1 130 ? 105.921 -13.040 6.208   1.00 0.00 ? 130 ARG A HG2  1  
ATOM 2180  H HG3  . ARG A 1 130 ? 104.907 -11.825 5.426   1.00 0.00 ? 130 ARG A HG3  1  
ATOM 2181  H HD2  . ARG A 1 130 ? 102.917 -12.871 6.165   1.00 0.00 ? 130 ARG A HD2  1  
ATOM 2182  H HD3  . ARG A 1 130 ? 103.772 -14.336 6.640   1.00 0.00 ? 130 ARG A HD3  1  
ATOM 2183  H HE   . ARG A 1 130 ? 104.870 -12.417 8.218   1.00 0.00 ? 130 ARG A HE   1  
ATOM 2184  H HH11 . ARG A 1 130 ? 101.562 -13.340 7.531   1.00 0.00 ? 130 ARG A HH11 1  
ATOM 2185  H HH12 . ARG A 1 130 ? 101.026 -13.108 9.168   1.00 0.00 ? 130 ARG A HH12 1  
ATOM 2186  H HH21 . ARG A 1 130 ? 104.158 -12.098 10.376  1.00 0.00 ? 130 ARG A HH21 1  
ATOM 2187  H HH22 . ARG A 1 130 ? 102.494 -12.401 10.774  1.00 0.00 ? 130 ARG A HH22 1  
ATOM 2188  N N    . THR A 1 131 ? 106.827 -15.999 6.391   1.00 0.00 ? 131 THR A N    1  
ATOM 2189  C CA   . THR A 1 131 ? 106.853 -16.977 7.467   1.00 0.00 ? 131 THR A CA   1  
ATOM 2190  C C    . THR A 1 131 ? 106.060 -16.527 8.701   1.00 0.00 ? 131 THR A C    1  
ATOM 2191  O O    . THR A 1 131 ? 106.578 -15.815 9.566   1.00 0.00 ? 131 THR A O    1  
ATOM 2192  C CB   . THR A 1 131 ? 108.311 -17.303 7.864   1.00 0.00 ? 131 THR A CB   1  
ATOM 2193  O OG1  . THR A 1 131 ? 109.055 -17.674 6.691   1.00 0.00 ? 131 THR A OG1  1  
ATOM 2194  C CG2  . THR A 1 131 ? 108.370 -18.439 8.883   1.00 0.00 ? 131 THR A CG2  1  
ATOM 2195  H H    . THR A 1 131 ? 107.645 -15.492 6.191   1.00 0.00 ? 131 THR A H    1  
ATOM 2196  H HA   . THR A 1 131 ? 106.407 -17.887 7.086   1.00 0.00 ? 131 THR A HA   1  
ATOM 2197  H HB   . THR A 1 131 ? 108.759 -16.420 8.300   1.00 0.00 ? 131 THR A HB   1  
ATOM 2198  H HG1  . THR A 1 131 ? 108.844 -18.586 6.452   1.00 0.00 ? 131 THR A HG1  1  
ATOM 2199  H HG21 . THR A 1 131 ? 107.921 -19.326 8.461   1.00 0.00 ? 131 THR A HG21 1  
ATOM 2200  H HG22 . THR A 1 131 ? 107.832 -18.153 9.775   1.00 0.00 ? 131 THR A HG22 1  
ATOM 2201  H HG23 . THR A 1 131 ? 109.401 -18.643 9.136   1.00 0.00 ? 131 THR A HG23 1  
ATOM 2202  N N    . GLU A 1 132 ? 104.785 -16.911 8.742   1.00 0.00 ? 132 GLU A N    1  
ATOM 2203  C CA   . GLU A 1 132 ? 103.990 -16.846 9.968   1.00 0.00 ? 132 GLU A CA   1  
ATOM 2204  C C    . GLU A 1 132 ? 103.695 -18.276 10.409  1.00 0.00 ? 132 GLU A C    1  
ATOM 2205  O O    . GLU A 1 132 ? 104.056 -18.687 11.513  1.00 0.00 ? 132 GLU A O    1  
ATOM 2206  C CB   . GLU A 1 132 ? 102.681 -16.064 9.757   1.00 0.00 ? 132 GLU A CB   1  
ATOM 2207  C CG   . GLU A 1 132 ? 101.896 -15.825 11.049  1.00 0.00 ? 132 GLU A CG   1  
ATOM 2208  C CD   . GLU A 1 132 ? 100.639 -14.985 10.845  1.00 0.00 ? 132 GLU A CD   1  
ATOM 2209  O OE1  . GLU A 1 132 ? 100.741 -13.735 10.842  1.00 0.00 ? 132 GLU A OE1  1  
ATOM 2210  O OE2  . GLU A 1 132 ? 99.545  -15.568 10.690  1.00 0.00 ? 132 GLU A OE2  1  
ATOM 2211  H H    . GLU A 1 132 ? 104.365 -17.238 7.919   1.00 0.00 ? 132 GLU A H    1  
ATOM 2212  H HA   . GLU A 1 132 ? 104.582 -16.358 10.733  1.00 0.00 ? 132 GLU A HA   1  
ATOM 2213  H HB2  . GLU A 1 132 ? 102.917 -15.104 9.321   1.00 0.00 ? 132 GLU A HB2  1  
ATOM 2214  H HB3  . GLU A 1 132 ? 102.050 -16.614 9.072   1.00 0.00 ? 132 GLU A HB3  1  
ATOM 2215  H HG2  . GLU A 1 132 ? 101.607 -16.783 11.459  1.00 0.00 ? 132 GLU A HG2  1  
ATOM 2216  H HG3  . GLU A 1 132 ? 102.539 -15.318 11.756  1.00 0.00 ? 132 GLU A HG3  1  
ATOM 2217  N N    . GLU A 1 133 ? 103.056 -19.026 9.507   1.00 0.00 ? 133 GLU A N    1  
ATOM 2218  C CA   . GLU A 1 133 ? 102.843 -20.468 9.661   1.00 0.00 ? 133 GLU A CA   1  
ATOM 2219  C C    . GLU A 1 133 ? 101.957 -20.804 10.866  1.00 0.00 ? 133 GLU A C    1  
ATOM 2220  O O    . GLU A 1 133 ? 100.783 -21.140 10.701  1.00 0.00 ? 133 GLU A O    1  
ATOM 2221  C CB   . GLU A 1 133 ? 104.193 -21.204 9.751   1.00 0.00 ? 133 GLU A CB   1  
ATOM 2222  C CG   . GLU A 1 133 ? 104.067 -22.711 9.965   1.00 0.00 ? 133 GLU A CG   1  
ATOM 2223  C CD   . GLU A 1 133 ? 105.404 -23.438 9.928   1.00 0.00 ? 133 GLU A CD   1  
ATOM 2224  O OE1  . GLU A 1 133 ? 106.416 -22.878 10.402  1.00 0.00 ? 133 GLU A OE1  1  
ATOM 2225  O OE2  . GLU A 1 133 ? 105.446 -24.586 9.435   1.00 0.00 ? 133 GLU A OE2  1  
ATOM 2226  H H    . GLU A 1 133 ? 102.705 -18.589 8.706   1.00 0.00 ? 133 GLU A H    1  
ATOM 2227  H HA   . GLU A 1 133 ? 102.334 -20.806 8.769   1.00 0.00 ? 133 GLU A HA   1  
ATOM 2228  H HB2  . GLU A 1 133 ? 104.742 -21.037 8.835   1.00 0.00 ? 133 GLU A HB2  1  
ATOM 2229  H HB3  . GLU A 1 133 ? 104.758 -20.791 10.576  1.00 0.00 ? 133 GLU A HB3  1  
ATOM 2230  H HG2  . GLU A 1 133 ? 103.611 -22.887 10.929  1.00 0.00 ? 133 GLU A HG2  1  
ATOM 2231  H HG3  . GLU A 1 133 ? 103.429 -23.116 9.191   1.00 0.00 ? 133 GLU A HG3  1  
ATOM 2232  N N    . GLU A 1 134 ? 102.525 -20.710 12.065  1.00 0.00 ? 134 GLU A N    1  
ATOM 2233  C CA   . GLU A 1 134 ? 101.840 -21.107 13.294  1.00 0.00 ? 134 GLU A CA   1  
ATOM 2234  C C    . GLU A 1 134 ? 100.593 -20.259 13.547  1.00 0.00 ? 134 GLU A C    1  
ATOM 2235  O O    . GLU A 1 134 ? 100.500 -19.114 13.096  1.00 0.00 ? 134 GLU A O    1  
ATOM 2236  C CB   . GLU A 1 134 ? 102.792 -20.979 14.491  1.00 0.00 ? 134 GLU A CB   1  
ATOM 2237  C CG   . GLU A 1 134 ? 104.078 -21.788 14.355  1.00 0.00 ? 134 GLU A CG   1  
ATOM 2238  C CD   . GLU A 1 134 ? 103.836 -23.288 14.254  1.00 0.00 ? 134 GLU A CD   1  
ATOM 2239  O OE1  . GLU A 1 134 ? 103.418 -23.896 15.261  1.00 0.00 ? 134 GLU A OE1  1  
ATOM 2240  O OE2  . GLU A 1 134 ? 104.091 -23.870 13.179  1.00 0.00 ? 134 GLU A OE2  1  
ATOM 2241  H H    . GLU A 1 134 ? 103.435 -20.355 12.128  1.00 0.00 ? 134 GLU A H    1  
ATOM 2242  H HA   . GLU A 1 134 ? 101.545 -22.141 13.191  1.00 0.00 ? 134 GLU A HA   1  
ATOM 2243  H HB2  . GLU A 1 134 ? 103.061 -19.939 14.613  1.00 0.00 ? 134 GLU A HB2  1  
ATOM 2244  H HB3  . GLU A 1 134 ? 102.278 -21.312 15.383  1.00 0.00 ? 134 GLU A HB3  1  
ATOM 2245  H HG2  . GLU A 1 134 ? 104.597 -21.460 13.465  1.00 0.00 ? 134 GLU A HG2  1  
ATOM 2246  H HG3  . GLU A 1 134 ? 104.700 -21.597 15.219  1.00 0.00 ? 134 GLU A HG3  1  
ATOM 2247  N N    . GLU A 1 135 ? 99.635  -20.840 14.262  1.00 0.00 ? 135 GLU A N    1  
ATOM 2248  C CA   . GLU A 1 135 ? 98.463  -20.107 14.731  1.00 0.00 ? 135 GLU A CA   1  
ATOM 2249  C C    . GLU A 1 135 ? 98.759  -19.476 16.088  1.00 0.00 ? 135 GLU A C    1  
ATOM 2250  O O    . GLU A 1 135 ? 99.689  -19.892 16.790  1.00 0.00 ? 135 GLU A O    1  
ATOM 2251  C CB   . GLU A 1 135 ? 97.238  -21.034 14.843  1.00 0.00 ? 135 GLU A CB   1  
ATOM 2252  C CG   . GLU A 1 135 ? 96.503  -21.283 13.527  1.00 0.00 ? 135 GLU A CG   1  
ATOM 2253  C CD   . GLU A 1 135 ? 97.362  -21.946 12.463  1.00 0.00 ? 135 GLU A CD   1  
ATOM 2254  O OE1  . GLU A 1 135 ? 97.695  -23.139 12.621  1.00 0.00 ? 135 GLU A OE1  1  
ATOM 2255  O OE2  . GLU A 1 135 ? 97.678  -21.286 11.449  1.00 0.00 ? 135 GLU A OE2  1  
ATOM 2256  H H    . GLU A 1 135 ? 99.720  -21.792 14.486  1.00 0.00 ? 135 GLU A H    1  
ATOM 2257  H HA   . GLU A 1 135 ? 98.250  -19.321 14.018  1.00 0.00 ? 135 GLU A HA   1  
ATOM 2258  H HB2  . GLU A 1 135 ? 97.561  -21.989 15.232  1.00 0.00 ? 135 GLU A HB2  1  
ATOM 2259  H HB3  . GLU A 1 135 ? 96.536  -20.598 15.541  1.00 0.00 ? 135 GLU A HB3  1  
ATOM 2260  H HG2  . GLU A 1 135 ? 95.653  -21.921 13.724  1.00 0.00 ? 135 GLU A HG2  1  
ATOM 2261  H HG3  . GLU A 1 135 ? 96.149  -20.333 13.147  1.00 0.00 ? 135 GLU A HG3  1  
ATOM 2262  N N    . GLU A 1 136 ? 97.967  -18.477 16.457  1.00 0.00 ? 136 GLU A N    1  
ATOM 2263  C CA   . GLU A 1 136 ? 98.117  -17.817 17.748  1.00 0.00 ? 136 GLU A CA   1  
ATOM 2264  C C    . GLU A 1 136 ? 97.644  -18.748 18.862  1.00 0.00 ? 136 GLU A C    1  
ATOM 2265  O O    . GLU A 1 136 ? 98.269  -18.824 19.918  1.00 0.00 ? 136 GLU A O    1  
ATOM 2266  C CB   . GLU A 1 136 ? 97.338  -16.496 17.755  1.00 0.00 ? 136 GLU A CB   1  
ATOM 2267  C CG   . GLU A 1 136 ? 97.818  -15.513 16.690  1.00 0.00 ? 136 GLU A CG   1  
ATOM 2268  C CD   . GLU A 1 136 ? 97.007  -14.230 16.656  1.00 0.00 ? 136 GLU A CD   1  
ATOM 2269  O OE1  . GLU A 1 136 ? 97.365  -13.273 17.370  1.00 0.00 ? 136 GLU A OE1  1  
ATOM 2270  O OE2  . GLU A 1 136 ? 96.004  -14.172 15.914  1.00 0.00 ? 136 GLU A OE2  1  
ATOM 2271  H H    . GLU A 1 136 ? 97.258  -18.180 15.848  1.00 0.00 ? 136 GLU A H    1  
ATOM 2272  H HA   . GLU A 1 136 ? 99.169  -17.607 17.893  1.00 0.00 ? 136 GLU A HA   1  
ATOM 2273  H HB2  . GLU A 1 136 ? 96.291  -16.704 17.581  1.00 0.00 ? 136 GLU A HB2  1  
ATOM 2274  H HB3  . GLU A 1 136 ? 97.448  -16.028 18.724  1.00 0.00 ? 136 GLU A HB3  1  
ATOM 2275  H HG2  . GLU A 1 136 ? 98.851  -15.262 16.888  1.00 0.00 ? 136 GLU A HG2  1  
ATOM 2276  H HG3  . GLU A 1 136 ? 97.750  -15.991 15.722  1.00 0.00 ? 136 GLU A HG3  1  
ATOM 2277  N N    . ASP A 1 137 ? 96.530  -19.442 18.592  1.00 0.00 ? 137 ASP A N    1  
ATOM 2278  C CA   . ASP A 1 137 ? 96.004  -20.522 19.444  1.00 0.00 ? 137 ASP A CA   1  
ATOM 2279  C C    . ASP A 1 137 ? 96.157  -20.239 20.945  1.00 0.00 ? 137 ASP A C    1  
ATOM 2280  O O    . ASP A 1 137 ? 95.251  -19.692 21.579  1.00 0.00 ? 137 ASP A O    1  
ATOM 2281  C CB   . ASP A 1 137 ? 96.674  -21.856 19.068  1.00 0.00 ? 137 ASP A CB   1  
ATOM 2282  C CG   . ASP A 1 137 ? 96.253  -23.012 19.966  1.00 0.00 ? 137 ASP A CG   1  
ATOM 2283  O OD1  . ASP A 1 137 ? 95.043  -23.306 20.038  1.00 0.00 ? 137 ASP A OD1  1  
ATOM 2284  O OD2  . ASP A 1 137 ? 97.136  -23.642 20.589  1.00 0.00 ? 137 ASP A OD2  1  
ATOM 2285  H H    . ASP A 1 137 ? 96.035  -19.217 17.777  1.00 0.00 ? 137 ASP A H    1  
ATOM 2286  H HA   . ASP A 1 137 ? 94.949  -20.605 19.228  1.00 0.00 ? 137 ASP A HA   1  
ATOM 2287  H HB2  . ASP A 1 137 ? 96.412  -22.106 18.049  1.00 0.00 ? 137 ASP A HB2  1  
ATOM 2288  H HB3  . ASP A 1 137 ? 97.747  -21.740 19.136  1.00 0.00 ? 137 ASP A HB3  1  
ATOM 2289  N N    . LEU A 1 138 ? 97.305  -20.609 21.504  1.00 0.00 ? 138 LEU A N    1  
ATOM 2290  C CA   . LEU A 1 138 ? 97.581  -20.422 22.923  1.00 0.00 ? 138 LEU A CA   1  
ATOM 2291  C C    . LEU A 1 138 ? 98.858  -19.604 23.092  1.00 0.00 ? 138 LEU A C    1  
ATOM 2292  O O    . LEU A 1 138 ? 98.757  -18.407 23.434  1.00 0.00 ? 138 LEU A O    1  
ATOM 2293  C CB   . LEU A 1 138 ? 97.701  -21.778 23.639  1.00 0.00 ? 138 LEU A CB   1  
ATOM 2294  C CG   . LEU A 1 138 ? 96.408  -22.614 23.680  1.00 0.00 ? 138 LEU A CG   1  
ATOM 2295  C CD1  . LEU A 1 138 ? 96.656  -23.972 24.334  1.00 0.00 ? 138 LEU A CD1  1  
ATOM 2296  C CD2  . LEU A 1 138 ? 95.299  -21.859 24.411  1.00 0.00 ? 138 LEU A CD2  1  
ATOM 2297  O OXT  . LEU A 1 138 ? 99.955  -20.145 22.841  1.00 0.00 ? 138 LEU A OXT  1  
ATOM 2298  H H    . LEU A 1 138 ? 98.001  -21.007 20.939  1.00 0.00 ? 138 LEU A H    1  
ATOM 2299  H HA   . LEU A 1 138 ? 96.755  -19.869 23.353  1.00 0.00 ? 138 LEU A HA   1  
ATOM 2300  H HB2  . LEU A 1 138 ? 98.465  -22.357 23.138  1.00 0.00 ? 138 LEU A HB2  1  
ATOM 2301  H HB3  . LEU A 1 138 ? 98.020  -21.598 24.656  1.00 0.00 ? 138 LEU A HB3  1  
ATOM 2302  H HG   . LEU A 1 138 ? 96.075  -22.794 22.667  1.00 0.00 ? 138 LEU A HG   1  
ATOM 2303  H HD11 . LEU A 1 138 ? 97.406  -24.511 23.774  1.00 0.00 ? 138 LEU A HD11 1  
ATOM 2304  H HD12 . LEU A 1 138 ? 95.738  -24.542 24.341  1.00 0.00 ? 138 LEU A HD12 1  
ATOM 2305  H HD13 . LEU A 1 138 ? 96.998  -23.830 25.350  1.00 0.00 ? 138 LEU A HD13 1  
ATOM 2306  H HD21 . LEU A 1 138 ? 95.094  -20.931 23.895  1.00 0.00 ? 138 LEU A HD21 1  
ATOM 2307  H HD22 . LEU A 1 138 ? 95.611  -21.646 25.424  1.00 0.00 ? 138 LEU A HD22 1  
ATOM 2308  H HD23 . LEU A 1 138 ? 94.404  -22.463 24.431  1.00 0.00 ? 138 LEU A HD23 1  
ATOM 2309  N N    . SER A 1 1   ? 93.779  -8.816  11.081  1.00 0.00 ? 1   SER A N    2  
ATOM 2310  C CA   . SER A 1 1   ? 95.240  -8.622  10.955  1.00 0.00 ? 1   SER A CA   2  
ATOM 2311  C C    . SER A 1 1   ? 95.539  -7.361  10.142  1.00 0.00 ? 1   SER A C    2  
ATOM 2312  O O    . SER A 1 1   ? 94.978  -7.170  9.063   1.00 0.00 ? 1   SER A O    2  
ATOM 2313  C CB   . SER A 1 1   ? 95.862  -9.846  10.271  1.00 0.00 ? 1   SER A CB   2  
ATOM 2314  O OG   . SER A 1 1   ? 95.374  -11.051 10.842  1.00 0.00 ? 1   SER A OG   2  
ATOM 2315  H H1   . SER A 1 1   ? 93.349  -8.896  10.139  1.00 0.00 ? 1   SER A H1   2  
ATOM 2316  H H2   . SER A 1 1   ? 93.353  -8.011  11.577  1.00 0.00 ? 1   SER A H2   2  
ATOM 2317  H H3   . SER A 1 1   ? 93.579  -9.685  11.617  1.00 0.00 ? 1   SER A H3   2  
ATOM 2318  H HA   . SER A 1 1   ? 95.658  -8.514  11.947  1.00 0.00 ? 1   SER A HA   2  
ATOM 2319  H HB2  . SER A 1 1   ? 95.613  -9.836  9.220   1.00 0.00 ? 1   SER A HB2  2  
ATOM 2320  H HB3  . SER A 1 1   ? 96.936  -9.816  10.387  1.00 0.00 ? 1   SER A HB3  2  
ATOM 2321  H HG   . SER A 1 1   ? 95.970  -11.340 11.548  1.00 0.00 ? 1   SER A HG   2  
ATOM 2322  N N    . MET A 1 2   ? 96.408  -6.497  10.667  1.00 0.00 ? 2   MET A N    2  
ATOM 2323  C CA   . MET A 1 2   ? 96.812  -5.284  9.952   1.00 0.00 ? 2   MET A CA   2  
ATOM 2324  C C    . MET A 1 2   ? 97.626  -5.646  8.713   1.00 0.00 ? 2   MET A C    2  
ATOM 2325  O O    . MET A 1 2   ? 97.410  -5.102  7.628   1.00 0.00 ? 2   MET A O    2  
ATOM 2326  C CB   . MET A 1 2   ? 97.639  -4.365  10.867  1.00 0.00 ? 2   MET A CB   2  
ATOM 2327  C CG   . MET A 1 2   ? 98.159  -3.112  10.169  1.00 0.00 ? 2   MET A CG   2  
ATOM 2328  S SD   . MET A 1 2   ? 99.211  -2.104  11.237  1.00 0.00 ? 2   MET A SD   2  
ATOM 2329  C CE   . MET A 1 2   ? 99.678  -0.786  10.112  1.00 0.00 ? 2   MET A CE   2  
ATOM 2330  H H    . MET A 1 2   ? 96.782  -6.674  11.554  1.00 0.00 ? 2   MET A H    2  
ATOM 2331  H HA   . MET A 1 2   ? 95.915  -4.763  9.644   1.00 0.00 ? 2   MET A HA   2  
ATOM 2332  H HB2  . MET A 1 2   ? 97.023  -4.058  11.700  1.00 0.00 ? 2   MET A HB2  2  
ATOM 2333  H HB3  . MET A 1 2   ? 98.487  -4.919  11.244  1.00 0.00 ? 2   MET A HB3  2  
ATOM 2334  H HG2  . MET A 1 2   ? 98.733  -3.409  9.304   1.00 0.00 ? 2   MET A HG2  2  
ATOM 2335  H HG3  . MET A 1 2   ? 97.315  -2.515  9.852   1.00 0.00 ? 2   MET A HG3  2  
ATOM 2336  H HE1  . MET A 1 2   ? 100.327 -0.090  10.624  1.00 0.00 ? 2   MET A HE1  2  
ATOM 2337  H HE2  . MET A 1 2   ? 98.793  -0.269  9.774   1.00 0.00 ? 2   MET A HE2  2  
ATOM 2338  H HE3  . MET A 1 2   ? 100.199 -1.204  9.262   1.00 0.00 ? 2   MET A HE3  2  
ATOM 2339  N N    . GLN A 1 3   ? 98.564  -6.570  8.891   1.00 0.00 ? 3   GLN A N    2  
ATOM 2340  C CA   . GLN A 1 3   ? 99.426  -7.016  7.801   1.00 0.00 ? 3   GLN A CA   2  
ATOM 2341  C C    . GLN A 1 3   ? 98.638  -7.818  6.769   1.00 0.00 ? 3   GLN A C    2  
ATOM 2342  O O    . GLN A 1 3   ? 97.737  -8.589  7.118   1.00 0.00 ? 3   GLN A O    2  
ATOM 2343  C CB   . GLN A 1 3   ? 100.608 -7.852  8.320   1.00 0.00 ? 3   GLN A CB   2  
ATOM 2344  C CG   . GLN A 1 3   ? 100.218 -9.083  9.140   1.00 0.00 ? 3   GLN A CG   2  
ATOM 2345  C CD   . GLN A 1 3   ? 99.759  -8.749  10.553  1.00 0.00 ? 3   GLN A CD   2  
ATOM 2346  O OE1  . GLN A 1 3   ? 98.918  -9.440  11.121  1.00 0.00 ? 3   GLN A OE1  2  
ATOM 2347  N NE2  . GLN A 1 3   ? 100.310 -7.691  11.136  1.00 0.00 ? 3   GLN A NE2  2  
ATOM 2348  H H    . GLN A 1 3   ? 98.677  -6.960  9.777   1.00 0.00 ? 3   GLN A H    2  
ATOM 2349  H HA   . GLN A 1 3   ? 99.818  -6.130  7.318   1.00 0.00 ? 3   GLN A HA   2  
ATOM 2350  H HB2  . GLN A 1 3   ? 101.190 -8.187  7.473   1.00 0.00 ? 3   GLN A HB2  2  
ATOM 2351  H HB3  . GLN A 1 3   ? 101.231 -7.220  8.937   1.00 0.00 ? 3   GLN A HB3  2  
ATOM 2352  H HG2  . GLN A 1 3   ? 99.415  -9.597  8.632   1.00 0.00 ? 3   GLN A HG2  2  
ATOM 2353  H HG3  . GLN A 1 3   ? 101.075 -9.740  9.204   1.00 0.00 ? 3   GLN A HG3  2  
ATOM 2354  H HE21 . GLN A 1 3   ? 100.981 -7.173  10.634  1.00 0.00 ? 3   GLN A HE21 2  
ATOM 2355  H HE22 . GLN A 1 3   ? 100.037 -7.475  12.053  1.00 0.00 ? 3   GLN A HE22 2  
ATOM 2356  N N    . SER A 1 4   ? 98.997  -7.611  5.505   1.00 0.00 ? 4   SER A N    2  
ATOM 2357  C CA   . SER A 1 4   ? 98.379  -8.286  4.370   1.00 0.00 ? 4   SER A CA   2  
ATOM 2358  C C    . SER A 1 4   ? 96.953  -7.767  4.120   1.00 0.00 ? 4   SER A C    2  
ATOM 2359  O O    . SER A 1 4   ? 96.478  -6.867  4.822   1.00 0.00 ? 4   SER A O    2  
ATOM 2360  C CB   . SER A 1 4   ? 98.381  -9.808  4.569   1.00 0.00 ? 4   SER A CB   2  
ATOM 2361  O OG   . SER A 1 4   ? 99.700  -10.287 4.765   1.00 0.00 ? 4   SER A OG   2  
ATOM 2362  H H    . SER A 1 4   ? 99.700  -6.953  5.323   1.00 0.00 ? 4   SER A H    2  
ATOM 2363  H HA   . SER A 1 4   ? 98.989  -8.052  3.509   1.00 0.00 ? 4   SER A HA   2  
ATOM 2364  H HB2  . SER A 1 4   ? 97.787  -10.060 5.435   1.00 0.00 ? 4   SER A HB2  2  
ATOM 2365  H HB3  . SER A 1 4   ? 97.964  -10.285 3.695   1.00 0.00 ? 4   SER A HB3  2  
ATOM 2366  H HG   . SER A 1 4   ? 100.298 -9.832  4.160   1.00 0.00 ? 4   SER A HG   2  
ATOM 2367  N N    . LEU A 1 5   ? 96.295  -8.326  3.099   1.00 0.00 ? 5   LEU A N    2  
ATOM 2368  C CA   . LEU A 1 5   ? 94.918  -7.971  2.740   1.00 0.00 ? 5   LEU A CA   2  
ATOM 2369  C C    . LEU A 1 5   ? 94.778  -6.473  2.482   1.00 0.00 ? 5   LEU A C    2  
ATOM 2370  O O    . LEU A 1 5   ? 94.999  -5.991  1.365   1.00 0.00 ? 5   LEU A O    2  
ATOM 2371  C CB   . LEU A 1 5   ? 93.927  -8.440  3.825   1.00 0.00 ? 5   LEU A CB   2  
ATOM 2372  C CG   . LEU A 1 5   ? 92.436  -8.259  3.487   1.00 0.00 ? 5   LEU A CG   2  
ATOM 2373  C CD1  . LEU A 1 5   ? 92.053  -9.071  2.252   1.00 0.00 ? 5   LEU A CD1  2  
ATOM 2374  C CD2  . LEU A 1 5   ? 91.566  -8.646  4.681   1.00 0.00 ? 5   LEU A CD2  2  
ATOM 2375  H H    . LEU A 1 5   ? 96.757  -9.003  2.557   1.00 0.00 ? 5   LEU A H    2  
ATOM 2376  H HA   . LEU A 1 5   ? 94.684  -8.476  1.833   1.00 0.00 ? 5   LEU A HA   2  
ATOM 2377  H HB2  . LEU A 1 5   ? 94.108  -9.488  4.017   1.00 0.00 ? 5   LEU A HB2  2  
ATOM 2378  H HB3  . LEU A 1 5   ? 94.135  -7.887  4.730   1.00 0.00 ? 5   LEU A HB3  2  
ATOM 2379  H HG   . LEU A 1 5   ? 92.249  -7.217  3.265   1.00 0.00 ? 5   LEU A HG   2  
ATOM 2380  H HD11 . LEU A 1 5   ? 92.241  -10.120 2.434   1.00 0.00 ? 5   LEU A HD11 2  
ATOM 2381  H HD12 . LEU A 1 5   ? 92.639  -8.742  1.407   1.00 0.00 ? 5   LEU A HD12 2  
ATOM 2382  H HD13 . LEU A 1 5   ? 91.003  -8.928  2.036   1.00 0.00 ? 5   LEU A HD13 2  
ATOM 2383  H HD21 . LEU A 1 5   ? 90.524  -8.508  4.429   1.00 0.00 ? 5   LEU A HD21 2  
ATOM 2384  H HD22 . LEU A 1 5   ? 91.816  -8.021  5.526   1.00 0.00 ? 5   LEU A HD22 2  
ATOM 2385  H HD23 . LEU A 1 5   ? 91.740  -9.682  4.935   1.00 0.00 ? 5   LEU A HD23 2  
ATOM 2386  N N    . LYS A 1 6   ? 94.442  -5.751  3.529   1.00 0.00 ? 6   LYS A N    2  
ATOM 2387  C CA   . LYS A 1 6   ? 94.256  -4.311  3.460   1.00 0.00 ? 6   LYS A CA   2  
ATOM 2388  C C    . LYS A 1 6   ? 95.565  -3.633  3.085   1.00 0.00 ? 6   LYS A C    2  
ATOM 2389  O O    . LYS A 1 6   ? 95.622  -2.800  2.177   1.00 0.00 ? 6   LYS A O    2  
ATOM 2390  C CB   . LYS A 1 6   ? 93.772  -3.774  4.813   1.00 0.00 ? 6   LYS A CB   2  
ATOM 2391  C CG   . LYS A 1 6   ? 93.560  -2.260  4.843   1.00 0.00 ? 6   LYS A CG   2  
ATOM 2392  C CD   . LYS A 1 6   ? 93.395  -1.739  6.267   1.00 0.00 ? 6   LYS A CD   2  
ATOM 2393  C CE   . LYS A 1 6   ? 92.227  -2.400  6.990   1.00 0.00 ? 6   LYS A CE   2  
ATOM 2394  N NZ   . LYS A 1 6   ? 92.185  -2.021  8.426   1.00 0.00 ? 6   LYS A NZ   2  
ATOM 2395  H H    . LYS A 1 6   ? 94.324  -6.207  4.379   1.00 0.00 ? 6   LYS A H    2  
ATOM 2396  H HA   . LYS A 1 6   ? 93.515  -4.105  2.706   1.00 0.00 ? 6   LYS A HA   2  
ATOM 2397  H HB2  . LYS A 1 6   ? 92.834  -4.252  5.060   1.00 0.00 ? 6   LYS A HB2  2  
ATOM 2398  H HB3  . LYS A 1 6   ? 94.503  -4.029  5.568   1.00 0.00 ? 6   LYS A HB3  2  
ATOM 2399  H HG2  . LYS A 1 6   ? 94.416  -1.777  4.394   1.00 0.00 ? 6   LYS A HG2  2  
ATOM 2400  H HG3  . LYS A 1 6   ? 92.672  -2.019  4.274   1.00 0.00 ? 6   LYS A HG3  2  
ATOM 2401  H HD2  . LYS A 1 6   ? 94.302  -1.938  6.820   1.00 0.00 ? 6   LYS A HD2  2  
ATOM 2402  H HD3  . LYS A 1 6   ? 93.226  -0.671  6.231   1.00 0.00 ? 6   LYS A HD3  2  
ATOM 2403  H HE2  . LYS A 1 6   ? 91.305  -2.092  6.519   1.00 0.00 ? 6   LYS A HE2  2  
ATOM 2404  H HE3  . LYS A 1 6   ? 92.329  -3.472  6.913   1.00 0.00 ? 6   LYS A HE3  2  
ATOM 2405  H HZ1  . LYS A 1 6   ? 91.385  -2.493  8.897   1.00 0.00 ? 6   LYS A HZ1  2  
ATOM 2406  H HZ2  . LYS A 1 6   ? 92.072  -0.994  8.525   1.00 0.00 ? 6   LYS A HZ2  2  
ATOM 2407  H HZ3  . LYS A 1 6   ? 93.067  -2.309  8.897   1.00 0.00 ? 6   LYS A HZ3  2  
ATOM 2408  N N    . SER A 1 7   ? 96.620  -4.022  3.783   1.00 0.00 ? 7   SER A N    2  
ATOM 2409  C CA   . SER A 1 7   ? 97.918  -3.403  3.612   1.00 0.00 ? 7   SER A CA   2  
ATOM 2410  C C    . SER A 1 7   ? 98.566  -3.827  2.290   1.00 0.00 ? 7   SER A C    2  
ATOM 2411  O O    . SER A 1 7   ? 99.298  -3.050  1.682   1.00 0.00 ? 7   SER A O    2  
ATOM 2412  C CB   . SER A 1 7   ? 98.805  -3.727  4.815   1.00 0.00 ? 7   SER A CB   2  
ATOM 2413  O OG   . SER A 1 7   ? 98.772  -5.109  5.111   1.00 0.00 ? 7   SER A OG   2  
ATOM 2414  H H    . SER A 1 7   ? 96.524  -4.756  4.428   1.00 0.00 ? 7   SER A H    2  
ATOM 2415  H HA   . SER A 1 7   ? 97.761  -2.333  3.583   1.00 0.00 ? 7   SER A HA   2  
ATOM 2416  H HB2  . SER A 1 7   ? 99.822  -3.440  4.601   1.00 0.00 ? 7   SER A HB2  2  
ATOM 2417  H HB3  . SER A 1 7   ? 98.452  -3.179  5.677   1.00 0.00 ? 7   SER A HB3  2  
ATOM 2418  H HG   . SER A 1 7   ? 98.119  -5.271  5.803   1.00 0.00 ? 7   SER A HG   2  
ATOM 2419  N N    . THR A 1 8   ? 98.277  -5.041  1.819   1.00 0.00 ? 8   THR A N    2  
ATOM 2420  C CA   . THR A 1 8   ? 98.782  -5.469  0.514   1.00 0.00 ? 8   THR A CA   2  
ATOM 2421  C C    . THR A 1 8   ? 98.170  -4.610  -0.592  1.00 0.00 ? 8   THR A C    2  
ATOM 2422  O O    . THR A 1 8   ? 98.814  -4.331  -1.605  1.00 0.00 ? 8   THR A O    2  
ATOM 2423  C CB   . THR A 1 8   ? 98.516  -6.970  0.243   1.00 0.00 ? 8   THR A CB   2  
ATOM 2424  O OG1  . THR A 1 8   ? 97.155  -7.303  0.551   1.00 0.00 ? 8   THR A OG1  2  
ATOM 2425  C CG2  . THR A 1 8   ? 99.451  -7.844  1.069   1.00 0.00 ? 8   THR A CG2  2  
ATOM 2426  H H    . THR A 1 8   ? 97.727  -5.651  2.351   1.00 0.00 ? 8   THR A H    2  
ATOM 2427  H HA   . THR A 1 8   ? 99.853  -5.311  0.513   1.00 0.00 ? 8   THR A HA   2  
ATOM 2428  H HB   . THR A 1 8   ? 98.700  -7.172  -0.807  1.00 0.00 ? 8   THR A HB   2  
ATOM 2429  H HG1  . THR A 1 8   ? 96.574  -6.586  0.274   1.00 0.00 ? 8   THR A HG1  2  
ATOM 2430  H HG21 . THR A 1 8   ? 99.336  -7.607  2.115   1.00 0.00 ? 8   THR A HG21 2  
ATOM 2431  H HG22 . THR A 1 8   ? 100.474 -7.665  0.770   1.00 0.00 ? 8   THR A HG22 2  
ATOM 2432  H HG23 . THR A 1 8   ? 99.208  -8.885  0.908   1.00 0.00 ? 8   THR A HG23 2  
ATOM 2433  N N    . ALA A 1 9   ? 96.930  -4.171  -0.369  1.00 0.00 ? 9   ALA A N    2  
ATOM 2434  C CA   . ALA A 1 9   ? 96.266  -3.242  -1.279  1.00 0.00 ? 9   ALA A CA   2  
ATOM 2435  C C    . ALA A 1 9   ? 96.925  -1.869  -1.182  1.00 0.00 ? 9   ALA A C    2  
ATOM 2436  O O    . ALA A 1 9   ? 97.082  -1.169  -2.182  1.00 0.00 ? 9   ALA A O    2  
ATOM 2437  C CB   . ALA A 1 9   ? 94.778  -3.150  -0.957  1.00 0.00 ? 9   ALA A CB   2  
ATOM 2438  H H    . ALA A 1 9   ? 96.453  -4.475  0.431   1.00 0.00 ? 9   ALA A H    2  
ATOM 2439  H HA   . ALA A 1 9   ? 96.376  -3.619  -2.288  1.00 0.00 ? 9   ALA A HA   2  
ATOM 2440  H HB1  . ALA A 1 9   ? 94.333  -4.133  -1.023  1.00 0.00 ? 9   ALA A HB1  2  
ATOM 2441  H HB2  . ALA A 1 9   ? 94.295  -2.490  -1.663  1.00 0.00 ? 9   ALA A HB2  2  
ATOM 2442  H HB3  . ALA A 1 9   ? 94.647  -2.763  0.044   1.00 0.00 ? 9   ALA A HB3  2  
ATOM 2443  N N    . LYS A 1 10  ? 97.307  -1.506  0.043   1.00 0.00 ? 10  LYS A N    2  
ATOM 2444  C CA   . LYS A 1 10  ? 98.039  -0.269  0.317   1.00 0.00 ? 10  LYS A CA   2  
ATOM 2445  C C    . LYS A 1 10  ? 99.282  -0.161  -0.557  1.00 0.00 ? 10  LYS A C    2  
ATOM 2446  O O    . LYS A 1 10  ? 99.368  0.687   -1.453  1.00 0.00 ? 10  LYS A O    2  
ATOM 2447  C CB   . LYS A 1 10  ? 98.468  -0.231  1.796   1.00 0.00 ? 10  LYS A CB   2  
ATOM 2448  C CG   . LYS A 1 10  ? 97.350  0.152   2.767   1.00 0.00 ? 10  LYS A CG   2  
ATOM 2449  C CD   . LYS A 1 10  ? 97.018  1.644   2.691   1.00 0.00 ? 10  LYS A CD   2  
ATOM 2450  C CE   . LYS A 1 10  ? 98.194  2.513   3.143   1.00 0.00 ? 10  LYS A CE   2  
ATOM 2451  N NZ   . LYS A 1 10  ? 97.898  3.968   3.026   1.00 0.00 ? 10  LYS A NZ   2  
ATOM 2452  H H    . LYS A 1 10  ? 97.080  -2.093  0.796   1.00 0.00 ? 10  LYS A H    2  
ATOM 2453  H HA   . LYS A 1 10  ? 97.385  0.566   0.113   1.00 0.00 ? 10  LYS A HA   2  
ATOM 2454  H HB2  . LYS A 1 10  ? 98.838  -1.216  2.069   1.00 0.00 ? 10  LYS A HB2  2  
ATOM 2455  H HB3  . LYS A 1 10  ? 99.277  0.478   1.910   1.00 0.00 ? 10  LYS A HB3  2  
ATOM 2456  H HG2  . LYS A 1 10  ? 96.463  -0.417  2.523   1.00 0.00 ? 10  LYS A HG2  2  
ATOM 2457  H HG3  . LYS A 1 10  ? 97.664  -0.088  3.774   1.00 0.00 ? 10  LYS A HG3  2  
ATOM 2458  H HD2  . LYS A 1 10  ? 96.768  1.897   1.671   1.00 0.00 ? 10  LYS A HD2  2  
ATOM 2459  H HD3  . LYS A 1 10  ? 96.168  1.846   3.330   1.00 0.00 ? 10  LYS A HD3  2  
ATOM 2460  H HE2  . LYS A 1 10  ? 98.419  2.286   4.175   1.00 0.00 ? 10  LYS A HE2  2  
ATOM 2461  H HE3  . LYS A 1 10  ? 99.054  2.281   2.530   1.00 0.00 ? 10  LYS A HE3  2  
ATOM 2462  H HZ1  . LYS A 1 10  ? 97.074  4.214   3.611   1.00 0.00 ? 10  LYS A HZ1  2  
ATOM 2463  H HZ2  . LYS A 1 10  ? 97.691  4.216   2.037   1.00 0.00 ? 10  LYS A HZ2  2  
ATOM 2464  H HZ3  . LYS A 1 10  ? 98.715  4.528   3.346   1.00 0.00 ? 10  LYS A HZ3  2  
ATOM 2465  N N    . TRP A 1 11  ? 100.238 -1.037  -0.288  1.00 0.00 ? 11  TRP A N    2  
ATOM 2466  C CA   . TRP A 1 11  ? 101.543 -0.977  -0.924  1.00 0.00 ? 11  TRP A CA   2  
ATOM 2467  C C    . TRP A 1 11  ? 101.415 -1.140  -2.432  1.00 0.00 ? 11  TRP A C    2  
ATOM 2468  O O    . TRP A 1 11  ? 102.095 -0.458  -3.194  1.00 0.00 ? 11  TRP A O    2  
ATOM 2469  C CB   . TRP A 1 11  ? 102.457 -2.059  -0.347  1.00 0.00 ? 11  TRP A CB   2  
ATOM 2470  C CG   . TRP A 1 11  ? 102.398 -2.158  1.151   1.00 0.00 ? 11  TRP A CG   2  
ATOM 2471  C CD1  . TRP A 1 11  ? 102.532 -1.147  2.059   1.00 0.00 ? 11  TRP A CD1  2  
ATOM 2472  C CD2  . TRP A 1 11  ? 102.194 -3.348  1.911   1.00 0.00 ? 11  TRP A CD2  2  
ATOM 2473  N NE1  . TRP A 1 11  ? 102.425 -1.646  3.334   1.00 0.00 ? 11  TRP A NE1  2  
ATOM 2474  C CE2  . TRP A 1 11  ? 102.223 -2.997  3.266   1.00 0.00 ? 11  TRP A CE2  2  
ATOM 2475  C CE3  . TRP A 1 11  ? 101.993 -4.676  1.566   1.00 0.00 ? 11  TRP A CE3  2  
ATOM 2476  C CZ2  . TRP A 1 11  ? 102.061 -3.934  4.281   1.00 0.00 ? 11  TRP A CZ2  2  
ATOM 2477  C CZ3  . TRP A 1 11  ? 101.829 -5.612  2.568   1.00 0.00 ? 11  TRP A CZ3  2  
ATOM 2478  C CH2  . TRP A 1 11  ? 101.867 -5.238  3.915   1.00 0.00 ? 11  TRP A CH2  2  
ATOM 2479  H H    . TRP A 1 11  ? 100.059 -1.753  0.362   1.00 0.00 ? 11  TRP A H    2  
ATOM 2480  H HA   . TRP A 1 11  ? 101.971 -0.006  -0.711  1.00 0.00 ? 11  TRP A HA   2  
ATOM 2481  H HB2  . TRP A 1 11  ? 102.173 -3.019  -0.756  1.00 0.00 ? 11  TRP A HB2  2  
ATOM 2482  H HB3  . TRP A 1 11  ? 103.479 -1.844  -0.628  1.00 0.00 ? 11  TRP A HB3  2  
ATOM 2483  H HD1  . TRP A 1 11  ? 102.695 -0.111  1.800   1.00 0.00 ? 11  TRP A HD1  2  
ATOM 2484  H HE1  . TRP A 1 11  ? 102.488 -1.122  4.162   1.00 0.00 ? 11  TRP A HE1  2  
ATOM 2485  H HE3  . TRP A 1 11  ? 101.945 -4.969  0.535   1.00 0.00 ? 11  TRP A HE3  2  
ATOM 2486  H HZ2  . TRP A 1 11  ? 102.085 -3.654  5.323   1.00 0.00 ? 11  TRP A HZ2  2  
ATOM 2487  H HZ3  . TRP A 1 11  ? 101.675 -6.650  2.315   1.00 0.00 ? 11  TRP A HZ3  2  
ATOM 2488  H HH2  . TRP A 1 11  ? 101.736 -6.001  4.670   1.00 0.00 ? 11  TRP A HH2  2  
ATOM 2489  N N    . ALA A 1 12  ? 100.518 -2.029  -2.857  1.00 0.00 ? 12  ALA A N    2  
ATOM 2490  C CA   . ALA A 1 12  ? 100.317 -2.286  -4.279  1.00 0.00 ? 12  ALA A CA   2  
ATOM 2491  C C    . ALA A 1 12  ? 99.383  -1.247  -4.910  1.00 0.00 ? 12  ALA A C    2  
ATOM 2492  O O    . ALA A 1 12  ? 99.085  -1.323  -6.106  1.00 0.00 ? 12  ALA A O    2  
ATOM 2493  C CB   . ALA A 1 12  ? 99.823  -3.721  -4.511  1.00 0.00 ? 12  ALA A CB   2  
ATOM 2494  H H    . ALA A 1 12  ? 99.985  -2.526  -2.200  1.00 0.00 ? 12  ALA A H    2  
ATOM 2495  H HA   . ALA A 1 12  ? 101.283 -2.194  -4.759  1.00 0.00 ? 12  ALA A HA   2  
ATOM 2496  H HB1  . ALA A 1 12  ? 100.538 -4.417  -4.091  1.00 0.00 ? 12  ALA A HB1  2  
ATOM 2497  H HB2  . ALA A 1 12  ? 99.731  -3.908  -5.572  1.00 0.00 ? 12  ALA A HB2  2  
ATOM 2498  H HB3  . ALA A 1 12  ? 98.865  -3.868  -4.036  1.00 0.00 ? 12  ALA A HB3  2  
ATOM 2499  N N    . ALA A 1 13  ? 98.914  -0.281  -4.105  1.00 0.00 ? 13  ALA A N    2  
ATOM 2500  C CA   . ALA A 1 13  ? 98.221  0.898   -4.639  1.00 0.00 ? 13  ALA A CA   2  
ATOM 2501  C C    . ALA A 1 13  ? 99.249  1.928   -5.080  1.00 0.00 ? 13  ALA A C    2  
ATOM 2502  O O    . ALA A 1 13  ? 99.124  2.532   -6.149  1.00 0.00 ? 13  ALA A O    2  
ATOM 2503  C CB   . ALA A 1 13  ? 97.275  1.539   -3.614  1.00 0.00 ? 13  ALA A CB   2  
ATOM 2504  H H    . ALA A 1 13  ? 99.033  -0.369  -3.138  1.00 0.00 ? 13  ALA A H    2  
ATOM 2505  H HA   . ALA A 1 13  ? 97.637  0.589   -5.498  1.00 0.00 ? 13  ALA A HA   2  
ATOM 2506  H HB1  . ALA A 1 13  ? 96.844  2.438   -4.038  1.00 0.00 ? 13  ALA A HB1  2  
ATOM 2507  H HB2  . ALA A 1 13  ? 97.826  1.800   -2.721  1.00 0.00 ? 13  ALA A HB2  2  
ATOM 2508  H HB3  . ALA A 1 13  ? 96.482  0.853   -3.358  1.00 0.00 ? 13  ALA A HB3  2  
ATOM 2509  N N    . SER A 1 14  ? 100.269 2.129   -4.245  1.00 0.00 ? 14  SER A N    2  
ATOM 2510  C CA   . SER A 1 14  ? 101.293 3.131   -4.508  1.00 0.00 ? 14  SER A CA   2  
ATOM 2511  C C    . SER A 1 14  ? 102.579 2.809   -3.750  1.00 0.00 ? 14  SER A C    2  
ATOM 2512  O O    . SER A 1 14  ? 102.534 2.393   -2.586  1.00 0.00 ? 14  SER A O    2  
ATOM 2513  C CB   . SER A 1 14  ? 100.786 4.520   -4.089  1.00 0.00 ? 14  SER A CB   2  
ATOM 2514  O OG   . SER A 1 14  ? 99.537  4.821   -4.692  1.00 0.00 ? 14  SER A OG   2  
ATOM 2515  H H    . SER A 1 14  ? 100.341 1.580   -3.430  1.00 0.00 ? 14  SER A H    2  
ATOM 2516  H HA   . SER A 1 14  ? 101.499 3.132   -5.568  1.00 0.00 ? 14  SER A HA   2  
ATOM 2517  H HB2  . SER A 1 14  ? 100.666 4.551   -3.015  1.00 0.00 ? 14  SER A HB2  2  
ATOM 2518  H HB3  . SER A 1 14  ? 101.505 5.269   -4.391  1.00 0.00 ? 14  SER A HB3  2  
ATOM 2519  H HG   . SER A 1 14  ? 99.492  4.400   -5.558  1.00 0.00 ? 14  SER A HG   2  
ATOM 2520  N N    . LEU A 1 15  ? 103.721 3.018   -4.408  1.00 0.00 ? 15  LEU A N    2  
ATOM 2521  C CA   . LEU A 1 15  ? 105.027 2.874   -3.764  1.00 0.00 ? 15  LEU A CA   2  
ATOM 2522  C C    . LEU A 1 15  ? 105.095 3.784   -2.537  1.00 0.00 ? 15  LEU A C    2  
ATOM 2523  O O    . LEU A 1 15  ? 105.759 3.475   -1.547  1.00 0.00 ? 15  LEU A O    2  
ATOM 2524  C CB   . LEU A 1 15  ? 106.149 3.224   -4.756  1.00 0.00 ? 15  LEU A CB   2  
ATOM 2525  C CG   . LEU A 1 15  ? 107.587 3.107   -4.215  1.00 0.00 ? 15  LEU A CG   2  
ATOM 2526  C CD1  . LEU A 1 15  ? 107.902 1.669   -3.811  1.00 0.00 ? 15  LEU A CD1  2  
ATOM 2527  C CD2  . LEU A 1 15  ? 108.593 3.610   -5.247  1.00 0.00 ? 15  LEU A CD2  2  
ATOM 2528  H H    . LEU A 1 15  ? 103.685 3.275   -5.355  1.00 0.00 ? 15  LEU A H    2  
ATOM 2529  H HA   . LEU A 1 15  ? 105.135 1.845   -3.449  1.00 0.00 ? 15  LEU A HA   2  
ATOM 2530  H HB2  . LEU A 1 15  ? 106.057 2.570   -5.612  1.00 0.00 ? 15  LEU A HB2  2  
ATOM 2531  H HB3  . LEU A 1 15  ? 105.997 4.241   -5.089  1.00 0.00 ? 15  LEU A HB3  2  
ATOM 2532  H HG   . LEU A 1 15  ? 107.682 3.724   -3.331  1.00 0.00 ? 15  LEU A HG   2  
ATOM 2533  H HD11 . LEU A 1 15  ? 108.913 1.614   -3.433  1.00 0.00 ? 15  LEU A HD11 2  
ATOM 2534  H HD12 . LEU A 1 15  ? 107.804 1.021   -4.671  1.00 0.00 ? 15  LEU A HD12 2  
ATOM 2535  H HD13 . LEU A 1 15  ? 107.214 1.351   -3.041  1.00 0.00 ? 15  LEU A HD13 2  
ATOM 2536  H HD21 . LEU A 1 15  ? 109.594 3.522   -4.849  1.00 0.00 ? 15  LEU A HD21 2  
ATOM 2537  H HD22 . LEU A 1 15  ? 108.389 4.646   -5.475  1.00 0.00 ? 15  LEU A HD22 2  
ATOM 2538  H HD23 . LEU A 1 15  ? 108.512 3.021   -6.150  1.00 0.00 ? 15  LEU A HD23 2  
ATOM 2539  N N    . GLU A 1 16  ? 104.370 4.899   -2.615  1.00 0.00 ? 16  GLU A N    2  
ATOM 2540  C CA   . GLU A 1 16  ? 104.276 5.850   -1.511  1.00 0.00 ? 16  GLU A CA   2  
ATOM 2541  C C    . GLU A 1 16  ? 103.727 5.154   -0.266  1.00 0.00 ? 16  GLU A C    2  
ATOM 2542  O O    . GLU A 1 16  ? 104.263 5.303   0.835   1.00 0.00 ? 16  GLU A O    2  
ATOM 2543  C CB   . GLU A 1 16  ? 103.365 7.030   -1.892  1.00 0.00 ? 16  GLU A CB   2  
ATOM 2544  C CG   . GLU A 1 16  ? 103.918 7.935   -2.993  1.00 0.00 ? 16  GLU A CG   2  
ATOM 2545  C CD   . GLU A 1 16  ? 104.112 7.229   -4.328  1.00 0.00 ? 16  GLU A CD   2  
ATOM 2546  O OE1  . GLU A 1 16  ? 103.117 6.722   -4.891  1.00 0.00 ? 16  GLU A OE1  2  
ATOM 2547  O OE2  . GLU A 1 16  ? 105.255 7.192   -4.829  1.00 0.00 ? 16  GLU A OE2  2  
ATOM 2548  H H    . GLU A 1 16  ? 103.878 5.083   -3.443  1.00 0.00 ? 16  GLU A H    2  
ATOM 2549  H HA   . GLU A 1 16  ? 105.270 6.220   -1.299  1.00 0.00 ? 16  GLU A HA   2  
ATOM 2550  H HB2  . GLU A 1 16  ? 102.413 6.640   -2.225  1.00 0.00 ? 16  GLU A HB2  2  
ATOM 2551  H HB3  . GLU A 1 16  ? 103.199 7.637   -1.011  1.00 0.00 ? 16  GLU A HB3  2  
ATOM 2552  H HG2  . GLU A 1 16  ? 103.230 8.755   -3.141  1.00 0.00 ? 16  GLU A HG2  2  
ATOM 2553  H HG3  . GLU A 1 16  ? 104.870 8.329   -2.665  1.00 0.00 ? 16  GLU A HG3  2  
ATOM 2554  N N    . ASN A 1 17  ? 102.665 4.377   -0.463  1.00 0.00 ? 17  ASN A N    2  
ATOM 2555  C CA   . ASN A 1 17  ? 102.036 3.631   0.618   1.00 0.00 ? 17  ASN A CA   2  
ATOM 2556  C C    . ASN A 1 17  ? 103.020 2.642   1.223   1.00 0.00 ? 17  ASN A C    2  
ATOM 2557  O O    . ASN A 1 17  ? 103.059 2.457   2.437   1.00 0.00 ? 17  ASN A O    2  
ATOM 2558  C CB   . ASN A 1 17  ? 100.798 2.889   0.107   1.00 0.00 ? 17  ASN A CB   2  
ATOM 2559  C CG   . ASN A 1 17  ? 99.586  3.790   -0.066  1.00 0.00 ? 17  ASN A CG   2  
ATOM 2560  O OD1  . ASN A 1 17  ? 99.418  4.773   0.658   1.00 0.00 ? 17  ASN A OD1  2  
ATOM 2561  N ND2  . ASN A 1 17  ? 98.724  3.448   -1.012  1.00 0.00 ? 17  ASN A ND2  2  
ATOM 2562  H H    . ASN A 1 17  ? 102.300 4.293   -1.366  1.00 0.00 ? 17  ASN A H    2  
ATOM 2563  H HA   . ASN A 1 17  ? 101.736 4.336   1.381   1.00 0.00 ? 17  ASN A HA   2  
ATOM 2564  H HB2  . ASN A 1 17  ? 101.027 2.444   -0.851  1.00 0.00 ? 17  ASN A HB2  2  
ATOM 2565  H HB3  . ASN A 1 17  ? 100.546 2.107   0.802   1.00 0.00 ? 17  ASN A HB3  2  
ATOM 2566  H HD21 . ASN A 1 17  ? 98.911  2.643   -1.540  1.00 0.00 ? 17  ASN A HD21 2  
ATOM 2567  H HD22 . ASN A 1 17  ? 97.932  4.014   -1.147  1.00 0.00 ? 17  ASN A HD22 2  
ATOM 2568  N N    . LEU A 1 18  ? 103.808 2.008   0.363   1.00 0.00 ? 18  LEU A N    2  
ATOM 2569  C CA   . LEU A 1 18  ? 104.859 1.096   0.810   1.00 0.00 ? 18  LEU A CA   2  
ATOM 2570  C C    . LEU A 1 18  ? 105.837 1.813   1.742   1.00 0.00 ? 18  LEU A C    2  
ATOM 2571  O O    . LEU A 1 18  ? 106.207 1.285   2.788   1.00 0.00 ? 18  LEU A O    2  
ATOM 2572  C CB   . LEU A 1 18  ? 105.599 0.496   -0.397  1.00 0.00 ? 18  LEU A CB   2  
ATOM 2573  C CG   . LEU A 1 18  ? 106.869 -0.315  -0.070  1.00 0.00 ? 18  LEU A CG   2  
ATOM 2574  C CD1  . LEU A 1 18  ? 106.598 -1.361  1.007   1.00 0.00 ? 18  LEU A CD1  2  
ATOM 2575  C CD2  . LEU A 1 18  ? 107.426 -0.975  -1.330  1.00 0.00 ? 18  LEU A CD2  2  
ATOM 2576  H H    . LEU A 1 18  ? 103.674 2.152   -0.600  1.00 0.00 ? 18  LEU A H    2  
ATOM 2577  H HA   . LEU A 1 18  ? 104.384 0.296   1.359   1.00 0.00 ? 18  LEU A HA   2  
ATOM 2578  H HB2  . LEU A 1 18  ? 104.910 -0.150  -0.926  1.00 0.00 ? 18  LEU A HB2  2  
ATOM 2579  H HB3  . LEU A 1 18  ? 105.877 1.306   -1.056  1.00 0.00 ? 18  LEU A HB3  2  
ATOM 2580  H HG   . LEU A 1 18  ? 107.624 0.359   0.311   1.00 0.00 ? 18  LEU A HG   2  
ATOM 2581  H HD11 . LEU A 1 18  ? 106.356 -0.864  1.938   1.00 0.00 ? 18  LEU A HD11 2  
ATOM 2582  H HD12 . LEU A 1 18  ? 107.481 -1.968  1.147   1.00 0.00 ? 18  LEU A HD12 2  
ATOM 2583  H HD13 . LEU A 1 18  ? 105.772 -1.989  0.707   1.00 0.00 ? 18  LEU A HD13 2  
ATOM 2584  H HD21 . LEU A 1 18  ? 108.324 -1.523  -1.082  1.00 0.00 ? 18  LEU A HD21 2  
ATOM 2585  H HD22 . LEU A 1 18  ? 107.660 -0.216  -2.061  1.00 0.00 ? 18  LEU A HD22 2  
ATOM 2586  H HD23 . LEU A 1 18  ? 106.692 -1.654  -1.738  1.00 0.00 ? 18  LEU A HD23 2  
ATOM 2587  N N    . LEU A 1 19  ? 106.226 3.025   1.366   1.00 0.00 ? 19  LEU A N    2  
ATOM 2588  C CA   . LEU A 1 19  ? 107.178 3.812   2.151   1.00 0.00 ? 19  LEU A CA   2  
ATOM 2589  C C    . LEU A 1 19  ? 106.473 4.554   3.293   1.00 0.00 ? 19  LEU A C    2  
ATOM 2590  O O    . LEU A 1 19  ? 107.114 5.236   4.097   1.00 0.00 ? 19  LEU A O    2  
ATOM 2591  C CB   . LEU A 1 19  ? 107.906 4.802   1.231   1.00 0.00 ? 19  LEU A CB   2  
ATOM 2592  C CG   . LEU A 1 19  ? 108.661 4.159   0.052   1.00 0.00 ? 19  LEU A CG   2  
ATOM 2593  C CD1  . LEU A 1 19  ? 109.251 5.226   -0.864  1.00 0.00 ? 19  LEU A CD1  2  
ATOM 2594  C CD2  . LEU A 1 19  ? 109.753 3.216   0.557   1.00 0.00 ? 19  LEU A CD2  2  
ATOM 2595  H H    . LEU A 1 19  ? 105.869 3.403   0.534   1.00 0.00 ? 19  LEU A H    2  
ATOM 2596  H HA   . LEU A 1 19  ? 107.903 3.131   2.575   1.00 0.00 ? 19  LEU A HA   2  
ATOM 2597  H HB2  . LEU A 1 19  ? 107.176 5.493   0.831   1.00 0.00 ? 19  LEU A HB2  2  
ATOM 2598  H HB3  . LEU A 1 19  ? 108.617 5.361   1.824   1.00 0.00 ? 19  LEU A HB3  2  
ATOM 2599  H HG   . LEU A 1 19  ? 107.963 3.575   -0.532  1.00 0.00 ? 19  LEU A HG   2  
ATOM 2600  H HD11 . LEU A 1 19  ? 108.457 5.851   -1.247  1.00 0.00 ? 19  LEU A HD11 2  
ATOM 2601  H HD12 . LEU A 1 19  ? 109.762 4.751   -1.689  1.00 0.00 ? 19  LEU A HD12 2  
ATOM 2602  H HD13 . LEU A 1 19  ? 109.952 5.834   -0.309  1.00 0.00 ? 19  LEU A HD13 2  
ATOM 2603  H HD21 . LEU A 1 19  ? 109.306 2.430   1.149   1.00 0.00 ? 19  LEU A HD21 2  
ATOM 2604  H HD22 . LEU A 1 19  ? 110.457 3.767   1.165   1.00 0.00 ? 19  LEU A HD22 2  
ATOM 2605  H HD23 . LEU A 1 19  ? 110.270 2.779   -0.285  1.00 0.00 ? 19  LEU A HD23 2  
ATOM 2606  N N    . GLU A 1 20  ? 105.152 4.414   3.356   1.00 0.00 ? 20  GLU A N    2  
ATOM 2607  C CA   . GLU A 1 20  ? 104.336 5.074   4.378   1.00 0.00 ? 20  GLU A CA   2  
ATOM 2608  C C    . GLU A 1 20  ? 103.962 4.113   5.509   1.00 0.00 ? 20  GLU A C    2  
ATOM 2609  O O    . GLU A 1 20  ? 104.037 4.463   6.691   1.00 0.00 ? 20  GLU A O    2  
ATOM 2610  C CB   . GLU A 1 20  ? 103.057 5.629   3.736   1.00 0.00 ? 20  GLU A CB   2  
ATOM 2611  C CG   . GLU A 1 20  ? 102.053 6.201   4.732   1.00 0.00 ? 20  GLU A CG   2  
ATOM 2612  C CD   . GLU A 1 20  ? 100.755 6.623   4.068   1.00 0.00 ? 20  GLU A CD   2  
ATOM 2613  O OE1  . GLU A 1 20  ? 100.678 7.772   3.582   1.00 0.00 ? 20  GLU A OE1  2  
ATOM 2614  O OE2  . GLU A 1 20  ? 99.805  5.806   4.019   1.00 0.00 ? 20  GLU A OE2  2  
ATOM 2615  H H    . GLU A 1 20  ? 104.707 3.856   2.684   1.00 0.00 ? 20  GLU A H    2  
ATOM 2616  H HA   . GLU A 1 20  ? 104.906 5.895   4.789   1.00 0.00 ? 20  GLU A HA   2  
ATOM 2617  H HB2  . GLU A 1 20  ? 103.330 6.415   3.045   1.00 0.00 ? 20  GLU A HB2  2  
ATOM 2618  H HB3  . GLU A 1 20  ? 102.573 4.835   3.185   1.00 0.00 ? 20  GLU A HB3  2  
ATOM 2619  H HG2  . GLU A 1 20  ? 101.834 5.448   5.477   1.00 0.00 ? 20  GLU A HG2  2  
ATOM 2620  H HG3  . GLU A 1 20  ? 102.494 7.063   5.215   1.00 0.00 ? 20  GLU A HG3  2  
ATOM 2621  N N    . ASP A 1 21  ? 103.551 2.907   5.139   1.00 0.00 ? 21  ASP A N    2  
ATOM 2622  C CA   . ASP A 1 21  ? 102.992 1.946   6.090   1.00 0.00 ? 21  ASP A CA   2  
ATOM 2623  C C    . ASP A 1 21  ? 104.101 1.170   6.811   1.00 0.00 ? 21  ASP A C    2  
ATOM 2624  O O    . ASP A 1 21  ? 105.021 0.660   6.169   1.00 0.00 ? 21  ASP A O    2  
ATOM 2625  C CB   . ASP A 1 21  ? 102.051 0.983   5.353   1.00 0.00 ? 21  ASP A CB   2  
ATOM 2626  C CG   . ASP A 1 21  ? 101.409 -0.039  6.278   1.00 0.00 ? 21  ASP A CG   2  
ATOM 2627  O OD1  . ASP A 1 21  ? 100.339 0.262   6.854   1.00 0.00 ? 21  ASP A OD1  2  
ATOM 2628  O OD2  . ASP A 1 21  ? 101.970 -1.142  6.425   1.00 0.00 ? 21  ASP A OD2  2  
ATOM 2629  H H    . ASP A 1 21  ? 103.641 2.643   4.200   1.00 0.00 ? 21  ASP A H    2  
ATOM 2630  H HA   . ASP A 1 21  ? 102.420 2.501   6.820   1.00 0.00 ? 21  ASP A HA   2  
ATOM 2631  H HB2  . ASP A 1 21  ? 101.266 1.553   4.877   1.00 0.00 ? 21  ASP A HB2  2  
ATOM 2632  H HB3  . ASP A 1 21  ? 102.611 0.454   4.593   1.00 0.00 ? 21  ASP A HB3  2  
ATOM 2633  N N    . PRO A 1 22  ? 104.022 1.075   8.160   1.00 0.00 ? 22  PRO A N    2  
ATOM 2634  C CA   . PRO A 1 22  ? 105.036 0.384   8.979   1.00 0.00 ? 22  PRO A CA   2  
ATOM 2635  C C    . PRO A 1 22  ? 105.253 -1.065  8.542   1.00 0.00 ? 22  PRO A C    2  
ATOM 2636  O O    . PRO A 1 22  ? 106.381 -1.482  8.271   1.00 0.00 ? 22  PRO A O    2  
ATOM 2637  C CB   . PRO A 1 22  ? 104.450 0.438   10.400  1.00 0.00 ? 22  PRO A CB   2  
ATOM 2638  C CG   . PRO A 1 22  ? 103.515 1.599   10.382  1.00 0.00 ? 22  PRO A CG   2  
ATOM 2639  C CD   . PRO A 1 22  ? 102.939 1.637   8.993   1.00 0.00 ? 22  PRO A CD   2  
ATOM 2640  H HA   . PRO A 1 22  ? 105.982 0.909   8.956   1.00 0.00 ? 22  PRO A HA   2  
ATOM 2641  H HB2  . PRO A 1 22  ? 103.929 -0.485  10.618  1.00 0.00 ? 22  PRO A HB2  2  
ATOM 2642  H HB3  . PRO A 1 22  ? 105.246 0.583   11.118  1.00 0.00 ? 22  PRO A HB3  2  
ATOM 2643  H HG2  . PRO A 1 22  ? 102.731 1.453   11.113  1.00 0.00 ? 22  PRO A HG2  2  
ATOM 2644  H HG3  . PRO A 1 22  ? 104.055 2.512   10.590  1.00 0.00 ? 22  PRO A HG3  2  
ATOM 2645  H HD2  . PRO A 1 22  ? 102.049 1.024   8.935   1.00 0.00 ? 22  PRO A HD2  2  
ATOM 2646  H HD3  . PRO A 1 22  ? 102.717 2.654   8.703   1.00 0.00 ? 22  PRO A HD3  2  
ATOM 2647  N N    . GLU A 1 23  ? 104.160 -1.819  8.454   1.00 0.00 ? 23  GLU A N    2  
ATOM 2648  C CA   . GLU A 1 23  ? 104.218 -3.221  8.061   1.00 0.00 ? 23  GLU A CA   2  
ATOM 2649  C C    . GLU A 1 23  ? 104.880 -3.328  6.698   1.00 0.00 ? 23  GLU A C    2  
ATOM 2650  O O    . GLU A 1 23  ? 105.704 -4.207  6.463   1.00 0.00 ? 23  GLU A O    2  
ATOM 2651  C CB   . GLU A 1 23  ? 102.809 -3.834  8.013   1.00 0.00 ? 23  GLU A CB   2  
ATOM 2652  C CG   . GLU A 1 23  ? 102.087 -3.863  9.358   1.00 0.00 ? 23  GLU A CG   2  
ATOM 2653  C CD   . GLU A 1 23  ? 102.733 -4.809  10.361  1.00 0.00 ? 23  GLU A CD   2  
ATOM 2654  O OE1  . GLU A 1 23  ? 102.574 -6.041  10.206  1.00 0.00 ? 23  GLU A OE1  2  
ATOM 2655  O OE2  . GLU A 1 23  ? 103.384 -4.327  11.313  1.00 0.00 ? 23  GLU A OE2  2  
ATOM 2656  H H    . GLU A 1 23  ? 103.296 -1.412  8.623   1.00 0.00 ? 23  GLU A H    2  
ATOM 2657  H HA   . GLU A 1 23  ? 104.817 -3.752  8.790   1.00 0.00 ? 23  GLU A HA   2  
ATOM 2658  H HB2  . GLU A 1 23  ? 102.206 -3.262  7.322   1.00 0.00 ? 23  GLU A HB2  2  
ATOM 2659  H HB3  . GLU A 1 23  ? 102.883 -4.850  7.649   1.00 0.00 ? 23  GLU A HB3  2  
ATOM 2660  H HG2  . GLU A 1 23  ? 102.087 -2.864  9.773   1.00 0.00 ? 23  GLU A HG2  2  
ATOM 2661  H HG3  . GLU A 1 23  ? 101.064 -4.177  9.196   1.00 0.00 ? 23  GLU A HG3  2  
ATOM 2662  N N    . GLY A 1 24  ? 104.528 -2.400  5.818   1.00 0.00 ? 24  GLY A N    2  
ATOM 2663  C CA   . GLY A 1 24  ? 105.112 -2.356  4.496   1.00 0.00 ? 24  GLY A CA   2  
ATOM 2664  C C    . GLY A 1 24  ? 106.612 -2.225  4.536   1.00 0.00 ? 24  GLY A C    2  
ATOM 2665  O O    . GLY A 1 24  ? 107.323 -3.127  4.115   1.00 0.00 ? 24  GLY A O    2  
ATOM 2666  H H    . GLY A 1 24  ? 103.853 -1.734  6.073   1.00 0.00 ? 24  GLY A H    2  
ATOM 2667  H HA2  . GLY A 1 24  ? 104.851 -3.261  3.967   1.00 0.00 ? 24  GLY A HA2  2  
ATOM 2668  H HA3  . GLY A 1 24  ? 104.702 -1.511  3.963   1.00 0.00 ? 24  GLY A HA3  2  
ATOM 2669  N N    . VAL A 1 25  ? 107.092 -1.112  5.073   1.00 0.00 ? 25  VAL A N    2  
ATOM 2670  C CA   . VAL A 1 25  ? 108.523 -0.834  5.122   1.00 0.00 ? 25  VAL A CA   2  
ATOM 2671  C C    . VAL A 1 25  ? 109.304 -1.972  5.787   1.00 0.00 ? 25  VAL A C    2  
ATOM 2672  O O    . VAL A 1 25  ? 110.401 -2.319  5.343   1.00 0.00 ? 25  VAL A O    2  
ATOM 2673  C CB   . VAL A 1 25  ? 108.811 0.498   5.856   1.00 0.00 ? 25  VAL A CB   2  
ATOM 2674  C CG1  . VAL A 1 25  ? 110.310 0.798   5.875   1.00 0.00 ? 25  VAL A CG1  2  
ATOM 2675  C CG2  . VAL A 1 25  ? 108.038 1.638   5.198   1.00 0.00 ? 25  VAL A CG2  2  
ATOM 2676  H H    . VAL A 1 25  ? 106.464 -0.449  5.438   1.00 0.00 ? 25  VAL A H    2  
ATOM 2677  H HA   . VAL A 1 25  ? 108.871 -0.731  4.107   1.00 0.00 ? 25  VAL A HA   2  
ATOM 2678  H HB   . VAL A 1 25  ? 108.471 0.405   6.879   1.00 0.00 ? 25  VAL A HB   2  
ATOM 2679  H HG11 . VAL A 1 25  ? 110.683 0.844   4.861   1.00 0.00 ? 25  VAL A HG11 2  
ATOM 2680  H HG12 . VAL A 1 25  ? 110.828 0.017   6.413   1.00 0.00 ? 25  VAL A HG12 2  
ATOM 2681  H HG13 . VAL A 1 25  ? 110.483 1.746   6.365   1.00 0.00 ? 25  VAL A HG13 2  
ATOM 2682  H HG21 . VAL A 1 25  ? 106.978 1.438   5.261   1.00 0.00 ? 25  VAL A HG21 2  
ATOM 2683  H HG22 . VAL A 1 25  ? 108.324 1.714   4.157   1.00 0.00 ? 25  VAL A HG22 2  
ATOM 2684  H HG23 . VAL A 1 25  ? 108.260 2.567   5.702   1.00 0.00 ? 25  VAL A HG23 2  
ATOM 2685  N N    . LYS A 1 26  ? 108.735 -2.575  6.829   1.00 0.00 ? 26  LYS A N    2  
ATOM 2686  C CA   . LYS A 1 26  ? 109.468 -3.583  7.603   1.00 0.00 ? 26  LYS A CA   2  
ATOM 2687  C C    . LYS A 1 26  ? 109.376 -4.980  6.976   1.00 0.00 ? 26  LYS A C    2  
ATOM 2688  O O    . LYS A 1 26  ? 110.314 -5.773  7.087   1.00 0.00 ? 26  LYS A O    2  
ATOM 2689  C CB   . LYS A 1 26  ? 109.010 -3.590  9.073   1.00 0.00 ? 26  LYS A CB   2  
ATOM 2690  C CG   . LYS A 1 26  ? 109.563 -2.406  9.878   1.00 0.00 ? 26  LYS A CG   2  
ATOM 2691  C CD   . LYS A 1 26  ? 109.038 -1.063  9.364   1.00 0.00 ? 26  LYS A CD   2  
ATOM 2692  C CE   . LYS A 1 26  ? 109.959 0.100   9.709   1.00 0.00 ? 26  LYS A CE   2  
ATOM 2693  N NZ   . LYS A 1 26  ? 110.140 0.270   11.175  1.00 0.00 ? 26  LYS A NZ   2  
ATOM 2694  H H    . LYS A 1 26  ? 107.804 -2.340  7.084   1.00 0.00 ? 26  LYS A H    2  
ATOM 2695  H HA   . LYS A 1 26  ? 110.511 -3.290  7.583   1.00 0.00 ? 26  LYS A HA   2  
ATOM 2696  H HB2  . LYS A 1 26  ? 107.930 -3.552  9.106   1.00 0.00 ? 26  LYS A HB2  2  
ATOM 2697  H HB3  . LYS A 1 26  ? 109.345 -4.504  9.542   1.00 0.00 ? 26  LYS A HB3  2  
ATOM 2698  H HG2  . LYS A 1 26  ? 109.272 -2.522  10.913  1.00 0.00 ? 26  LYS A HG2  2  
ATOM 2699  H HG3  . LYS A 1 26  ? 110.642 -2.413  9.807   1.00 0.00 ? 26  LYS A HG3  2  
ATOM 2700  H HD2  . LYS A 1 26  ? 108.940 -1.113  8.290   1.00 0.00 ? 26  LYS A HD2  2  
ATOM 2701  H HD3  . LYS A 1 26  ? 108.066 -0.880  9.802   1.00 0.00 ? 26  LYS A HD3  2  
ATOM 2702  H HE2  . LYS A 1 26  ? 110.923 -0.079  9.255   1.00 0.00 ? 26  LYS A HE2  2  
ATOM 2703  H HE3  . LYS A 1 26  ? 109.537 1.005   9.297   1.00 0.00 ? 26  LYS A HE3  2  
ATOM 2704  H HZ1  . LYS A 1 26  ? 110.619 -0.561  11.577  1.00 0.00 ? 26  LYS A HZ1  2  
ATOM 2705  H HZ2  . LYS A 1 26  ? 109.219 0.381   11.641  1.00 0.00 ? 26  LYS A HZ2  2  
ATOM 2706  H HZ3  . LYS A 1 26  ? 110.717 1.112   11.367  1.00 0.00 ? 26  LYS A HZ3  2  
ATOM 2707  N N    . ARG A 1 27  ? 108.266 -5.280  6.307   1.00 0.00 ? 27  ARG A N    2  
ATOM 2708  C CA   . ARG A 1 27  ? 108.117 -6.567  5.616   1.00 0.00 ? 27  ARG A CA   2  
ATOM 2709  C C    . ARG A 1 27  ? 108.806 -6.508  4.254   1.00 0.00 ? 27  ARG A C    2  
ATOM 2710  O O    . ARG A 1 27  ? 109.298 -7.514  3.743   1.00 0.00 ? 27  ARG A O    2  
ATOM 2711  C CB   . ARG A 1 27  ? 106.632 -6.943  5.481   1.00 0.00 ? 27  ARG A CB   2  
ATOM 2712  C CG   . ARG A 1 27  ? 105.958 -7.145  6.835   1.00 0.00 ? 27  ARG A CG   2  
ATOM 2713  C CD   . ARG A 1 27  ? 104.482 -7.523  6.732   1.00 0.00 ? 27  ARG A CD   2  
ATOM 2714  N NE   . ARG A 1 27  ? 103.885 -7.605  8.069   1.00 0.00 ? 27  ARG A NE   2  
ATOM 2715  C CZ   . ARG A 1 27  ? 103.947 -8.680  8.860   1.00 0.00 ? 27  ARG A CZ   2  
ATOM 2716  N NH1  . ARG A 1 27  ? 104.508 -9.803  8.435   1.00 0.00 ? 27  ARG A NH1  2  
ATOM 2717  N NH2  . ARG A 1 27  ? 103.457 -8.622  10.089  1.00 0.00 ? 27  ARG A NH2  2  
ATOM 2718  H H    . ARG A 1 27  ? 107.533 -4.628  6.271   1.00 0.00 ? 27  ARG A H    2  
ATOM 2719  H HA   . ARG A 1 27  ? 108.614 -7.319  6.216   1.00 0.00 ? 27  ARG A HA   2  
ATOM 2720  H HB2  . ARG A 1 27  ? 106.114 -6.154  4.953   1.00 0.00 ? 27  ARG A HB2  2  
ATOM 2721  H HB3  . ARG A 1 27  ? 106.548 -7.861  4.918   1.00 0.00 ? 27  ARG A HB3  2  
ATOM 2722  H HG2  . ARG A 1 27  ? 106.476 -7.933  7.363   1.00 0.00 ? 27  ARG A HG2  2  
ATOM 2723  H HG3  . ARG A 1 27  ? 106.043 -6.227  7.401   1.00 0.00 ? 27  ARG A HG3  2  
ATOM 2724  H HD2  . ARG A 1 27  ? 103.956 -6.772  6.154   1.00 0.00 ? 27  ARG A HD2  2  
ATOM 2725  H HD3  . ARG A 1 27  ? 104.390 -8.483  6.242   1.00 0.00 ? 27  ARG A HD3  2  
ATOM 2726  H HE   . ARG A 1 27  ? 103.443 -6.794  8.414   1.00 0.00 ? 27  ARG A HE   2  
ATOM 2727  H HH11 . ARG A 1 27  ? 104.899 -9.859  7.513   1.00 0.00 ? 27  ARG A HH11 2  
ATOM 2728  H HH12 . ARG A 1 27  ? 104.550 -10.601 9.042   1.00 0.00 ? 27  ARG A HH12 2  
ATOM 2729  H HH21 . ARG A 1 27  ? 103.044 -7.767  10.427  1.00 0.00 ? 27  ARG A HH21 2  
ATOM 2730  H HH22 . ARG A 1 27  ? 103.505 -9.426  10.689  1.00 0.00 ? 27  ARG A HH22 2  
ATOM 2731  N N    . PHE A 1 28  ? 108.857 -5.306  3.699   1.00 0.00 ? 28  PHE A N    2  
ATOM 2732  C CA   . PHE A 1 28  ? 109.588 -5.027  2.468   1.00 0.00 ? 28  PHE A CA   2  
ATOM 2733  C C    . PHE A 1 28  ? 111.084 -5.137  2.734   1.00 0.00 ? 28  PHE A C    2  
ATOM 2734  O O    . PHE A 1 28  ? 111.843 -5.666  1.915   1.00 0.00 ? 28  PHE A O    2  
ATOM 2735  C CB   . PHE A 1 28  ? 109.218 -3.618  1.981   1.00 0.00 ? 28  PHE A CB   2  
ATOM 2736  C CG   . PHE A 1 28  ? 109.977 -3.117  0.777   1.00 0.00 ? 28  PHE A CG   2  
ATOM 2737  C CD1  . PHE A 1 28  ? 109.923 -3.792  -0.433  1.00 0.00 ? 28  PHE A CD1  2  
ATOM 2738  C CD2  . PHE A 1 28  ? 110.717 -1.946  0.853   1.00 0.00 ? 28  PHE A CD2  2  
ATOM 2739  C CE1  . PHE A 1 28  ? 110.594 -3.311  -1.540  1.00 0.00 ? 28  PHE A CE1  2  
ATOM 2740  C CE2  . PHE A 1 28  ? 111.393 -1.464  -0.250  1.00 0.00 ? 28  PHE A CE2  2  
ATOM 2741  C CZ   . PHE A 1 28  ? 111.330 -2.145  -1.448  1.00 0.00 ? 28  PHE A CZ   2  
ATOM 2742  H H    . PHE A 1 28  ? 108.382 -4.573  4.135   1.00 0.00 ? 28  PHE A H    2  
ATOM 2743  H HA   . PHE A 1 28  ? 109.299 -5.756  1.724   1.00 0.00 ? 28  PHE A HA   2  
ATOM 2744  H HB2  . PHE A 1 28  ? 108.168 -3.607  1.726   1.00 0.00 ? 28  PHE A HB2  2  
ATOM 2745  H HB3  . PHE A 1 28  ? 109.383 -2.920  2.791   1.00 0.00 ? 28  PHE A HB3  2  
ATOM 2746  H HD1  . PHE A 1 28  ? 109.351 -4.704  -0.506  1.00 0.00 ? 28  PHE A HD1  2  
ATOM 2747  H HD2  . PHE A 1 28  ? 110.767 -1.411  1.791   1.00 0.00 ? 28  PHE A HD2  2  
ATOM 2748  H HE1  . PHE A 1 28  ? 110.543 -3.846  -2.477  1.00 0.00 ? 28  PHE A HE1  2  
ATOM 2749  H HE2  . PHE A 1 28  ? 111.967 -0.552  -0.174  1.00 0.00 ? 28  PHE A HE2  2  
ATOM 2750  H HZ   . PHE A 1 28  ? 111.856 -1.767  -2.313  1.00 0.00 ? 28  PHE A HZ   2  
ATOM 2751  N N    . ARG A 1 29  ? 111.493 -4.641  3.902   1.00 0.00 ? 29  ARG A N    2  
ATOM 2752  C CA   . ARG A 1 29  ? 112.877 -4.737  4.340   1.00 0.00 ? 29  ARG A CA   2  
ATOM 2753  C C    . ARG A 1 29  ? 113.308 -6.195  4.430   1.00 0.00 ? 29  ARG A C    2  
ATOM 2754  O O    . ARG A 1 29  ? 114.297 -6.588  3.813   1.00 0.00 ? 29  ARG A O    2  
ATOM 2755  C CB   . ARG A 1 29  ? 113.070 -4.048  5.700   1.00 0.00 ? 29  ARG A CB   2  
ATOM 2756  C CG   . ARG A 1 29  ? 114.472 -4.225  6.281   1.00 0.00 ? 29  ARG A CG   2  
ATOM 2757  C CD   . ARG A 1 29  ? 114.637 -3.511  7.617   1.00 0.00 ? 29  ARG A CD   2  
ATOM 2758  N NE   . ARG A 1 29  ? 115.910 -3.850  8.256   1.00 0.00 ? 29  ARG A NE   2  
ATOM 2759  C CZ   . ARG A 1 29  ? 116.544 -3.077  9.137   1.00 0.00 ? 29  ARG A CZ   2  
ATOM 2760  N NH1  . ARG A 1 29  ? 116.072 -1.873  9.435   1.00 0.00 ? 29  ARG A NH1  2  
ATOM 2761  N NH2  . ARG A 1 29  ? 117.662 -3.510  9.705   1.00 0.00 ? 29  ARG A NH2  2  
ATOM 2762  H H    . ARG A 1 29  ? 110.842 -4.188  4.479   1.00 0.00 ? 29  ARG A H    2  
ATOM 2763  H HA   . ARG A 1 29  ? 113.492 -4.237  3.604   1.00 0.00 ? 29  ARG A HA   2  
ATOM 2764  H HB2  . ARG A 1 29  ? 112.881 -2.991  5.583   1.00 0.00 ? 29  ARG A HB2  2  
ATOM 2765  H HB3  . ARG A 1 29  ? 112.356 -4.456  6.402   1.00 0.00 ? 29  ARG A HB3  2  
ATOM 2766  H HG2  . ARG A 1 29  ? 114.660 -5.279  6.428   1.00 0.00 ? 29  ARG A HG2  2  
ATOM 2767  H HG3  . ARG A 1 29  ? 115.193 -3.827  5.580   1.00 0.00 ? 29  ARG A HG3  2  
ATOM 2768  H HD2  . ARG A 1 29  ? 114.598 -2.443  7.450   1.00 0.00 ? 29  ARG A HD2  2  
ATOM 2769  H HD3  . ARG A 1 29  ? 113.828 -3.802  8.272   1.00 0.00 ? 29  ARG A HD3  2  
ATOM 2770  H HE   . ARG A 1 29  ? 116.307 -4.723  8.027   1.00 0.00 ? 29  ARG A HE   2  
ATOM 2771  H HH11 . ARG A 1 29  ? 115.235 -1.532  8.995   1.00 0.00 ? 29  ARG A HH11 2  
ATOM 2772  H HH12 . ARG A 1 29  ? 116.548 -1.297  10.107  1.00 0.00 ? 29  ARG A HH12 2  
ATOM 2773  H HH21 . ARG A 1 29  ? 118.027 -4.416  9.467   1.00 0.00 ? 29  ARG A HH21 2  
ATOM 2774  H HH22 . ARG A 1 29  ? 118.148 -2.938  10.375  1.00 0.00 ? 29  ARG A HH22 2  
ATOM 2775  N N    . GLU A 1 30  ? 112.555 -7.001  5.184   1.00 0.00 ? 30  GLU A N    2  
ATOM 2776  C CA   . GLU A 1 30  ? 112.918 -8.404  5.384   1.00 0.00 ? 30  GLU A CA   2  
ATOM 2777  C C    . GLU A 1 30  ? 112.835 -9.173  4.067   1.00 0.00 ? 30  GLU A C    2  
ATOM 2778  O O    . GLU A 1 30  ? 113.635 -10.072 3.821   1.00 0.00 ? 30  GLU A O    2  
ATOM 2779  C CB   . GLU A 1 30  ? 112.041 -9.081  6.447   1.00 0.00 ? 30  GLU A CB   2  
ATOM 2780  C CG   . GLU A 1 30  ? 110.590 -9.281  6.023   1.00 0.00 ? 30  GLU A CG   2  
ATOM 2781  C CD   . GLU A 1 30  ? 109.815 -10.181 6.971   1.00 0.00 ? 30  GLU A CD   2  
ATOM 2782  O OE1  . GLU A 1 30  ? 109.229 -9.666  7.946   1.00 0.00 ? 30  GLU A OE1  2  
ATOM 2783  O OE2  . GLU A 1 30  ? 109.780 -11.409 6.743   1.00 0.00 ? 30  GLU A OE2  2  
ATOM 2784  H H    . GLU A 1 30  ? 111.745 -6.644  5.610   1.00 0.00 ? 30  GLU A H    2  
ATOM 2785  H HA   . GLU A 1 30  ? 113.946 -8.423  5.723   1.00 0.00 ? 30  GLU A HA   2  
ATOM 2786  H HB2  . GLU A 1 30  ? 112.465 -10.050 6.679   1.00 0.00 ? 30  GLU A HB2  2  
ATOM 2787  H HB3  . GLU A 1 30  ? 112.053 -8.475  7.343   1.00 0.00 ? 30  GLU A HB3  2  
ATOM 2788  H HG2  . GLU A 1 30  ? 110.103 -8.317  5.988   1.00 0.00 ? 30  GLU A HG2  2  
ATOM 2789  H HG3  . GLU A 1 30  ? 110.574 -9.723  5.036   1.00 0.00 ? 30  GLU A HG3  2  
ATOM 2790  N N    . PHE A 1 31  ? 111.868 -8.813  3.222   1.00 0.00 ? 31  PHE A N    2  
ATOM 2791  C CA   . PHE A 1 31  ? 111.733 -9.433  1.905   1.00 0.00 ? 31  PHE A CA   2  
ATOM 2792  C C    . PHE A 1 31  ? 113.032 -9.293  1.116   1.00 0.00 ? 31  PHE A C    2  
ATOM 2793  O O    . PHE A 1 31  ? 113.675 -10.288 0.776   1.00 0.00 ? 31  PHE A O    2  
ATOM 2794  C CB   . PHE A 1 31  ? 110.567 -8.809  1.122   1.00 0.00 ? 31  PHE A CB   2  
ATOM 2795  C CG   . PHE A 1 31  ? 110.566 -9.171  -0.345  1.00 0.00 ? 31  PHE A CG   2  
ATOM 2796  C CD1  . PHE A 1 31  ? 110.484 -10.497 -0.747  1.00 0.00 ? 31  PHE A CD1  2  
ATOM 2797  C CD2  . PHE A 1 31  ? 110.671 -8.187  -1.319  1.00 0.00 ? 31  PHE A CD2  2  
ATOM 2798  C CE1  . PHE A 1 31  ? 110.502 -10.831 -2.087  1.00 0.00 ? 31  PHE A CE1  2  
ATOM 2799  C CE2  . PHE A 1 31  ? 110.692 -8.519  -2.660  1.00 0.00 ? 31  PHE A CE2  2  
ATOM 2800  C CZ   . PHE A 1 31  ? 110.606 -9.842  -3.045  1.00 0.00 ? 31  PHE A CZ   2  
ATOM 2801  H H    . PHE A 1 31  ? 111.226 -8.122  3.493   1.00 0.00 ? 31  PHE A H    2  
ATOM 2802  H HA   . PHE A 1 31  ? 111.530 -10.484 2.057   1.00 0.00 ? 31  PHE A HA   2  
ATOM 2803  H HB2  . PHE A 1 31  ? 109.633 -9.147  1.548   1.00 0.00 ? 31  PHE A HB2  2  
ATOM 2804  H HB3  . PHE A 1 31  ? 110.623 -7.732  1.202   1.00 0.00 ? 31  PHE A HB3  2  
ATOM 2805  H HD1  . PHE A 1 31  ? 110.402 -11.275 -0.001  1.00 0.00 ? 31  PHE A HD1  2  
ATOM 2806  H HD2  . PHE A 1 31  ? 110.737 -7.150  -1.022  1.00 0.00 ? 31  PHE A HD2  2  
ATOM 2807  H HE1  . PHE A 1 31  ? 110.434 -11.867 -2.387  1.00 0.00 ? 31  PHE A HE1  2  
ATOM 2808  H HE2  . PHE A 1 31  ? 110.773 -7.743  -3.408  1.00 0.00 ? 31  PHE A HE2  2  
ATOM 2809  H HZ   . PHE A 1 31  ? 110.622 -10.102 -4.094  1.00 0.00 ? 31  PHE A HZ   2  
ATOM 2810  N N    . LEU A 1 32  ? 113.423 -8.052  0.846   1.00 0.00 ? 32  LEU A N    2  
ATOM 2811  C CA   . LEU A 1 32  ? 114.651 -7.783  0.108   1.00 0.00 ? 32  LEU A CA   2  
ATOM 2812  C C    . LEU A 1 32  ? 115.861 -8.315  0.874   1.00 0.00 ? 32  LEU A C    2  
ATOM 2813  O O    . LEU A 1 32  ? 116.823 -8.784  0.277   1.00 0.00 ? 32  LEU A O    2  
ATOM 2814  C CB   . LEU A 1 32  ? 114.799 -6.282  -0.168  1.00 0.00 ? 32  LEU A CB   2  
ATOM 2815  C CG   . LEU A 1 32  ? 113.786 -5.695  -1.165  1.00 0.00 ? 32  LEU A CG   2  
ATOM 2816  C CD1  . LEU A 1 32  ? 114.086 -4.224  -1.429  1.00 0.00 ? 32  LEU A CD1  2  
ATOM 2817  C CD2  . LEU A 1 32  ? 113.781 -6.485  -2.474  1.00 0.00 ? 32  LEU A CD2  2  
ATOM 2818  H H    . LEU A 1 32  ? 112.872 -7.298  1.151   1.00 0.00 ? 32  LEU A H    2  
ATOM 2819  H HA   . LEU A 1 32  ? 114.587 -8.307  -0.836  1.00 0.00 ? 32  LEU A HA   2  
ATOM 2820  H HB2  . LEU A 1 32  ? 114.691 -5.755  0.771   1.00 0.00 ? 32  LEU A HB2  2  
ATOM 2821  H HB3  . LEU A 1 32  ? 115.793 -6.102  -0.551  1.00 0.00 ? 32  LEU A HB3  2  
ATOM 2822  H HG   . LEU A 1 32  ? 112.795 -5.756  -0.736  1.00 0.00 ? 32  LEU A HG   2  
ATOM 2823  H HD11 . LEU A 1 32  ? 115.096 -4.120  -1.800  1.00 0.00 ? 32  LEU A HD11 2  
ATOM 2824  H HD12 . LEU A 1 32  ? 113.980 -3.666  -0.511  1.00 0.00 ? 32  LEU A HD12 2  
ATOM 2825  H HD13 . LEU A 1 32  ? 113.393 -3.840  -2.162  1.00 0.00 ? 32  LEU A HD13 2  
ATOM 2826  H HD21 . LEU A 1 32  ? 113.063 -6.051  -3.156  1.00 0.00 ? 32  LEU A HD21 2  
ATOM 2827  H HD22 . LEU A 1 32  ? 113.508 -7.512  -2.276  1.00 0.00 ? 32  LEU A HD22 2  
ATOM 2828  H HD23 . LEU A 1 32  ? 114.765 -6.455  -2.921  1.00 0.00 ? 32  LEU A HD23 2  
ATOM 2829  N N    . LYS A 1 33  ? 115.792 -8.255  2.197   1.00 0.00 ? 33  LYS A N    2  
ATOM 2830  C CA   . LYS A 1 33  ? 116.838 -8.803  3.062   1.00 0.00 ? 33  LYS A CA   2  
ATOM 2831  C C    . LYS A 1 33  ? 117.060 -10.286 2.756   1.00 0.00 ? 33  LYS A C    2  
ATOM 2832  O O    . LYS A 1 33  ? 118.197 -10.758 2.675   1.00 0.00 ? 33  LYS A O    2  
ATOM 2833  C CB   . LYS A 1 33  ? 116.434 -8.618  4.531   1.00 0.00 ? 33  LYS A CB   2  
ATOM 2834  C CG   . LYS A 1 33  ? 117.370 -9.267  5.543   1.00 0.00 ? 33  LYS A CG   2  
ATOM 2835  C CD   . LYS A 1 33  ? 116.775 -9.218  6.948   1.00 0.00 ? 33  LYS A CD   2  
ATOM 2836  C CE   . LYS A 1 33  ? 117.666 -9.898  7.977   1.00 0.00 ? 33  LYS A CE   2  
ATOM 2837  N NZ   . LYS A 1 33  ? 117.970 -11.309 7.616   1.00 0.00 ? 33  LYS A NZ   2  
ATOM 2838  H H    . LYS A 1 33  ? 115.012 -7.829  2.611   1.00 0.00 ? 33  LYS A H    2  
ATOM 2839  H HA   . LYS A 1 33  ? 117.753 -8.261  2.872   1.00 0.00 ? 33  LYS A HA   2  
ATOM 2840  H HB2  . LYS A 1 33  ? 116.394 -7.559  4.746   1.00 0.00 ? 33  LYS A HB2  2  
ATOM 2841  H HB3  . LYS A 1 33  ? 115.446 -9.036  4.671   1.00 0.00 ? 33  LYS A HB3  2  
ATOM 2842  H HG2  . LYS A 1 33  ? 117.531 -10.300 5.264   1.00 0.00 ? 33  LYS A HG2  2  
ATOM 2843  H HG3  . LYS A 1 33  ? 118.314 -8.739  5.539   1.00 0.00 ? 33  LYS A HG3  2  
ATOM 2844  H HD2  . LYS A 1 33  ? 116.641 -8.184  7.234   1.00 0.00 ? 33  LYS A HD2  2  
ATOM 2845  H HD3  . LYS A 1 33  ? 115.813 -9.713  6.937   1.00 0.00 ? 33  LYS A HD3  2  
ATOM 2846  H HE2  . LYS A 1 33  ? 118.593 -9.349  8.055   1.00 0.00 ? 33  LYS A HE2  2  
ATOM 2847  H HE3  . LYS A 1 33  ? 117.159 -9.883  8.932   1.00 0.00 ? 33  LYS A HE3  2  
ATOM 2848  H HZ1  . LYS A 1 33  ? 118.541 -11.756 8.362   1.00 0.00 ? 33  LYS A HZ1  2  
ATOM 2849  H HZ2  . LYS A 1 33  ? 118.502 -11.349 6.722   1.00 0.00 ? 33  LYS A HZ2  2  
ATOM 2850  H HZ3  . LYS A 1 33  ? 117.089 -11.849 7.502   1.00 0.00 ? 33  LYS A HZ3  2  
ATOM 2851  N N    . LYS A 1 34  ? 115.958 -11.005 2.567   1.00 0.00 ? 34  LYS A N    2  
ATOM 2852  C CA   . LYS A 1 34  ? 115.999 -12.435 2.277   1.00 0.00 ? 34  LYS A CA   2  
ATOM 2853  C C    . LYS A 1 34  ? 116.362 -12.682 0.814   1.00 0.00 ? 34  LYS A C    2  
ATOM 2854  O O    . LYS A 1 34  ? 117.035 -13.660 0.490   1.00 0.00 ? 34  LYS A O    2  
ATOM 2855  C CB   . LYS A 1 34  ? 114.640 -13.074 2.609   1.00 0.00 ? 34  LYS A CB   2  
ATOM 2856  C CG   . LYS A 1 34  ? 114.285 -13.014 4.095   1.00 0.00 ? 34  LYS A CG   2  
ATOM 2857  C CD   . LYS A 1 34  ? 112.835 -13.417 4.362   1.00 0.00 ? 34  LYS A CD   2  
ATOM 2858  C CE   . LYS A 1 34  ? 112.499 -13.334 5.848   1.00 0.00 ? 34  LYS A CE   2  
ATOM 2859  N NZ   . LYS A 1 34  ? 111.065 -13.628 6.125   1.00 0.00 ? 34  LYS A NZ   2  
ATOM 2860  H H    . LYS A 1 34  ? 115.086 -10.557 2.624   1.00 0.00 ? 34  LYS A H    2  
ATOM 2861  H HA   . LYS A 1 34  ? 116.759 -12.881 2.905   1.00 0.00 ? 34  LYS A HA   2  
ATOM 2862  H HB2  . LYS A 1 34  ? 113.868 -12.559 2.053   1.00 0.00 ? 34  LYS A HB2  2  
ATOM 2863  H HB3  . LYS A 1 34  ? 114.658 -14.112 2.306   1.00 0.00 ? 34  LYS A HB3  2  
ATOM 2864  H HG2  . LYS A 1 34  ? 114.937 -13.685 4.636   1.00 0.00 ? 34  LYS A HG2  2  
ATOM 2865  H HG3  . LYS A 1 34  ? 114.439 -12.003 4.449   1.00 0.00 ? 34  LYS A HG3  2  
ATOM 2866  H HD2  . LYS A 1 34  ? 112.180 -12.751 3.818   1.00 0.00 ? 34  LYS A HD2  2  
ATOM 2867  H HD3  . LYS A 1 34  ? 112.682 -14.432 4.022   1.00 0.00 ? 34  LYS A HD3  2  
ATOM 2868  H HE2  . LYS A 1 34  ? 113.108 -14.047 6.384   1.00 0.00 ? 34  LYS A HE2  2  
ATOM 2869  H HE3  . LYS A 1 34  ? 112.724 -12.337 6.200   1.00 0.00 ? 34  LYS A HE3  2  
ATOM 2870  H HZ1  . LYS A 1 34  ? 110.773 -14.504 5.648   1.00 0.00 ? 34  LYS A HZ1  2  
ATOM 2871  H HZ2  . LYS A 1 34  ? 110.467 -12.845 5.793   1.00 0.00 ? 34  LYS A HZ2  2  
ATOM 2872  H HZ3  . LYS A 1 34  ? 110.919 -13.741 7.149   1.00 0.00 ? 34  LYS A HZ3  2  
ATOM 2873  N N    . GLU A 1 35  ? 115.922 -11.783 -0.066  1.00 0.00 ? 35  GLU A N    2  
ATOM 2874  C CA   . GLU A 1 35  ? 116.168 -11.922 -1.503  1.00 0.00 ? 35  GLU A CA   2  
ATOM 2875  C C    . GLU A 1 35  ? 117.460 -11.195 -1.906  1.00 0.00 ? 35  GLU A C    2  
ATOM 2876  O O    . GLU A 1 35  ? 117.791 -11.099 -3.090  1.00 0.00 ? 35  GLU A O    2  
ATOM 2877  C CB   . GLU A 1 35  ? 114.964 -11.388 -2.300  1.00 0.00 ? 35  GLU A CB   2  
ATOM 2878  C CG   . GLU A 1 35  ? 114.904 -11.907 -3.736  1.00 0.00 ? 35  GLU A CG   2  
ATOM 2879  C CD   . GLU A 1 35  ? 113.622 -11.528 -4.463  1.00 0.00 ? 35  GLU A CD   2  
ATOM 2880  O OE1  . GLU A 1 35  ? 112.626 -12.277 -4.363  1.00 0.00 ? 35  GLU A OE1  2  
ATOM 2881  O OE2  . GLU A 1 35  ? 113.610 -10.494 -5.156  1.00 0.00 ? 35  GLU A OE2  2  
ATOM 2882  H H    . GLU A 1 35  ? 115.413 -11.010 0.258   1.00 0.00 ? 35  GLU A H    2  
ATOM 2883  H HA   . GLU A 1 35  ? 116.288 -12.975 -1.717  1.00 0.00 ? 35  GLU A HA   2  
ATOM 2884  H HB2  . GLU A 1 35  ? 114.054 -11.680 -1.795  1.00 0.00 ? 35  GLU A HB2  2  
ATOM 2885  H HB3  . GLU A 1 35  ? 115.018 -10.306 -2.329  1.00 0.00 ? 35  GLU A HB3  2  
ATOM 2886  H HG2  . GLU A 1 35  ? 115.743 -11.503 -4.284  1.00 0.00 ? 35  GLU A HG2  2  
ATOM 2887  H HG3  . GLU A 1 35  ? 114.983 -12.986 -3.715  1.00 0.00 ? 35  GLU A HG3  2  
ATOM 2888  N N    . PHE A 1 36  ? 118.179 -10.696 -0.900  1.00 0.00 ? 36  PHE A N    2  
ATOM 2889  C CA   . PHE A 1 36  ? 119.483 -10.049 -1.083  1.00 0.00 ? 36  PHE A CA   2  
ATOM 2890  C C    . PHE A 1 36  ? 119.367 -8.743  -1.875  1.00 0.00 ? 36  PHE A C    2  
ATOM 2891  O O    . PHE A 1 36  ? 119.777 -8.653  -3.035  1.00 0.00 ? 36  PHE A O    2  
ATOM 2892  C CB   . PHE A 1 36  ? 120.488 -11.007 -1.739  1.00 0.00 ? 36  PHE A CB   2  
ATOM 2893  C CG   . PHE A 1 36  ? 120.705 -12.267 -0.938  1.00 0.00 ? 36  PHE A CG   2  
ATOM 2894  C CD1  . PHE A 1 36  ? 121.518 -12.257 0.187   1.00 0.00 ? 36  PHE A CD1  2  
ATOM 2895  C CD2  . PHE A 1 36  ? 120.086 -13.456 -1.300  1.00 0.00 ? 36  PHE A CD2  2  
ATOM 2896  C CE1  . PHE A 1 36  ? 121.709 -13.405 0.931   1.00 0.00 ? 36  PHE A CE1  2  
ATOM 2897  C CE2  . PHE A 1 36  ? 120.277 -14.606 -0.558  1.00 0.00 ? 36  PHE A CE2  2  
ATOM 2898  C CZ   . PHE A 1 36  ? 121.088 -14.580 0.559   1.00 0.00 ? 36  PHE A CZ   2  
ATOM 2899  H H    . PHE A 1 36  ? 117.814 -10.756 0.006   1.00 0.00 ? 36  PHE A H    2  
ATOM 2900  H HA   . PHE A 1 36  ? 119.849 -9.803  -0.095  1.00 0.00 ? 36  PHE A HA   2  
ATOM 2901  H HB2  . PHE A 1 36  ? 120.123 -11.286 -2.717  1.00 0.00 ? 36  PHE A HB2  2  
ATOM 2902  H HB3  . PHE A 1 36  ? 121.441 -10.508 -1.844  1.00 0.00 ? 36  PHE A HB3  2  
ATOM 2903  H HD1  . PHE A 1 36  ? 122.006 -11.339 0.481   1.00 0.00 ? 36  PHE A HD1  2  
ATOM 2904  H HD2  . PHE A 1 36  ? 119.450 -13.479 -2.173  1.00 0.00 ? 36  PHE A HD2  2  
ATOM 2905  H HE1  . PHE A 1 36  ? 122.344 -13.383 1.805   1.00 0.00 ? 36  PHE A HE1  2  
ATOM 2906  H HE2  . PHE A 1 36  ? 119.790 -15.524 -0.851  1.00 0.00 ? 36  PHE A HE2  2  
ATOM 2907  H HZ   . PHE A 1 36  ? 121.237 -15.479 1.140   1.00 0.00 ? 36  PHE A HZ   2  
ATOM 2908  N N    . SER A 1 37  ? 118.756 -7.752  -1.235  1.00 0.00 ? 37  SER A N    2  
ATOM 2909  C CA   . SER A 1 37  ? 118.664 -6.386  -1.753  1.00 0.00 ? 37  SER A CA   2  
ATOM 2910  C C    . SER A 1 37  ? 118.483 -5.406  -0.585  1.00 0.00 ? 37  SER A C    2  
ATOM 2911  O O    . SER A 1 37  ? 117.963 -4.286  -0.736  1.00 0.00 ? 37  SER A O    2  
ATOM 2912  C CB   . SER A 1 37  ? 117.504 -6.270  -2.749  1.00 0.00 ? 37  SER A CB   2  
ATOM 2913  O OG   . SER A 1 37  ? 117.697 -7.135  -3.858  1.00 0.00 ? 37  SER A OG   2  
ATOM 2914  H H    . SER A 1 37  ? 118.330 -7.955  -0.379  1.00 0.00 ? 37  SER A H    2  
ATOM 2915  H HA   . SER A 1 37  ? 119.592 -6.155  -2.259  1.00 0.00 ? 37  SER A HA   2  
ATOM 2916  H HB2  . SER A 1 37  ? 116.579 -6.537  -2.258  1.00 0.00 ? 37  SER A HB2  2  
ATOM 2917  H HB3  . SER A 1 37  ? 117.438 -5.254  -3.110  1.00 0.00 ? 37  SER A HB3  2  
ATOM 2918  H HG   . SER A 1 37  ? 118.616 -7.435  -3.872  1.00 0.00 ? 37  SER A HG   2  
ATOM 2919  N N    . GLU A 1 38  ? 118.951 -5.836  0.586   1.00 0.00 ? 38  GLU A N    2  
ATOM 2920  C CA   . GLU A 1 38  ? 118.863 -5.039  1.804   1.00 0.00 ? 38  GLU A CA   2  
ATOM 2921  C C    . GLU A 1 38  ? 119.564 -3.696  1.603   1.00 0.00 ? 38  GLU A C    2  
ATOM 2922  O O    . GLU A 1 38  ? 119.218 -2.691  2.229   1.00 0.00 ? 38  GLU A O    2  
ATOM 2923  C CB   . GLU A 1 38  ? 119.501 -5.798  2.975   1.00 0.00 ? 38  GLU A CB   2  
ATOM 2924  C CG   . GLU A 1 38  ? 119.399 -5.076  4.312   1.00 0.00 ? 38  GLU A CG   2  
ATOM 2925  C CD   . GLU A 1 38  ? 120.208 -5.753  5.405   1.00 0.00 ? 38  GLU A CD   2  
ATOM 2926  O OE1  . GLU A 1 38  ? 121.434 -5.529  5.467   1.00 0.00 ? 38  GLU A OE1  2  
ATOM 2927  O OE2  . GLU A 1 38  ? 119.625 -6.517  6.207   1.00 0.00 ? 38  GLU A OE2  2  
ATOM 2928  H H    . GLU A 1 38  ? 119.393 -6.712  0.625   1.00 0.00 ? 38  GLU A H    2  
ATOM 2929  H HA   . GLU A 1 38  ? 117.819 -4.865  2.019   1.00 0.00 ? 38  GLU A HA   2  
ATOM 2930  H HB2  . GLU A 1 38  ? 119.014 -6.759  3.072   1.00 0.00 ? 38  GLU A HB2  2  
ATOM 2931  H HB3  . GLU A 1 38  ? 120.549 -5.959  2.756   1.00 0.00 ? 38  GLU A HB3  2  
ATOM 2932  H HG2  . GLU A 1 38  ? 119.760 -4.064  4.191   1.00 0.00 ? 38  GLU A HG2  2  
ATOM 2933  H HG3  . GLU A 1 38  ? 118.360 -5.049  4.613   1.00 0.00 ? 38  GLU A HG3  2  
ATOM 2934  N N    . GLU A 1 39  ? 120.529 -3.695  0.693   1.00 0.00 ? 39  GLU A N    2  
ATOM 2935  C CA   . GLU A 1 39  ? 121.335 -2.519  0.402   1.00 0.00 ? 39  GLU A CA   2  
ATOM 2936  C C    . GLU A 1 39  ? 120.465 -1.353  -0.062  1.00 0.00 ? 39  GLU A C    2  
ATOM 2937  O O    . GLU A 1 39  ? 120.580 -0.242  0.456   1.00 0.00 ? 39  GLU A O    2  
ATOM 2938  C CB   . GLU A 1 39  ? 122.395 -2.842  -0.667  1.00 0.00 ? 39  GLU A CB   2  
ATOM 2939  C CG   . GLU A 1 39  ? 123.448 -3.862  -0.228  1.00 0.00 ? 39  GLU A CG   2  
ATOM 2940  C CD   . GLU A 1 39  ? 122.856 -5.216  0.132   1.00 0.00 ? 39  GLU A CD   2  
ATOM 2941  O OE1  . GLU A 1 39  ? 122.274 -5.870  -0.762  1.00 0.00 ? 39  GLU A OE1  2  
ATOM 2942  O OE2  . GLU A 1 39  ? 122.938 -5.617  1.311   1.00 0.00 ? 39  GLU A OE2  2  
ATOM 2943  H H    . GLU A 1 39  ? 120.710 -4.525  0.202   1.00 0.00 ? 39  GLU A H    2  
ATOM 2944  H HA   . GLU A 1 39  ? 121.838 -2.234  1.314   1.00 0.00 ? 39  GLU A HA   2  
ATOM 2945  H HB2  . GLU A 1 39  ? 121.896 -3.230  -1.545  1.00 0.00 ? 39  GLU A HB2  2  
ATOM 2946  H HB3  . GLU A 1 39  ? 122.906 -1.927  -0.936  1.00 0.00 ? 39  GLU A HB3  2  
ATOM 2947  H HG2  . GLU A 1 39  ? 124.152 -4.000  -1.036  1.00 0.00 ? 39  GLU A HG2  2  
ATOM 2948  H HG3  . GLU A 1 39  ? 123.970 -3.468  0.635   1.00 0.00 ? 39  GLU A HG3  2  
ATOM 2949  N N    . ASN A 1 40  ? 119.578 -1.608  -1.024  1.00 0.00 ? 40  ASN A N    2  
ATOM 2950  C CA   . ASN A 1 40  ? 118.788 -0.532  -1.619  1.00 0.00 ? 40  ASN A CA   2  
ATOM 2951  C C    . ASN A 1 40  ? 117.648 -0.117  -0.697  1.00 0.00 ? 40  ASN A C    2  
ATOM 2952  O O    . ASN A 1 40  ? 117.333 1.074   -0.600  1.00 0.00 ? 40  ASN A O    2  
ATOM 2953  C CB   . ASN A 1 40  ? 118.249 -0.912  -3.012  1.00 0.00 ? 40  ASN A CB   2  
ATOM 2954  C CG   . ASN A 1 40  ? 117.160 -1.970  -2.991  1.00 0.00 ? 40  ASN A CG   2  
ATOM 2955  O OD1  . ASN A 1 40  ? 117.441 -3.162  -3.052  1.00 0.00 ? 40  ASN A OD1  2  
ATOM 2956  N ND2  . ASN A 1 40  ? 115.908 -1.538  -2.923  1.00 0.00 ? 40  ASN A ND2  2  
ATOM 2957  H H    . ASN A 1 40  ? 119.442 -2.532  -1.323  1.00 0.00 ? 40  ASN A H    2  
ATOM 2958  H HA   . ASN A 1 40  ? 119.448 0.319   -1.734  1.00 0.00 ? 40  ASN A HA   2  
ATOM 2959  H HB2  . ASN A 1 40  ? 117.846 -0.027  -3.483  1.00 0.00 ? 40  ASN A HB2  2  
ATOM 2960  H HB3  . ASN A 1 40  ? 119.069 -1.282  -3.612  1.00 0.00 ? 40  ASN A HB3  2  
ATOM 2961  H HD21 . ASN A 1 40  ? 115.752 -0.572  -2.885  1.00 0.00 ? 40  ASN A HD21 2  
ATOM 2962  H HD22 . ASN A 1 40  ? 115.186 -2.204  -2.941  1.00 0.00 ? 40  ASN A HD22 2  
ATOM 2963  N N    . VAL A 1 41  ? 117.034 -1.083  -0.005  1.00 0.00 ? 41  VAL A N    2  
ATOM 2964  C CA   . VAL A 1 41  ? 115.943 -0.747  0.915   1.00 0.00 ? 41  VAL A CA   2  
ATOM 2965  C C    . VAL A 1 41  ? 116.464 0.112   2.073   1.00 0.00 ? 41  VAL A C    2  
ATOM 2966  O O    . VAL A 1 41  ? 115.905 1.171   2.372   1.00 0.00 ? 41  VAL A O    2  
ATOM 2967  C CB   . VAL A 1 41  ? 115.198 -1.999  1.461   1.00 0.00 ? 41  VAL A CB   2  
ATOM 2968  C CG1  . VAL A 1 41  ? 116.134 -2.935  2.217   1.00 0.00 ? 41  VAL A CG1  2  
ATOM 2969  C CG2  . VAL A 1 41  ? 114.020 -1.582  2.344   1.00 0.00 ? 41  VAL A CG2  2  
ATOM 2970  H H    . VAL A 1 41  ? 117.315 -2.023  -0.118  1.00 0.00 ? 41  VAL A H    2  
ATOM 2971  H HA   . VAL A 1 41  ? 115.228 -0.156  0.354   1.00 0.00 ? 41  VAL A HA   2  
ATOM 2972  H HB   . VAL A 1 41  ? 114.800 -2.543  0.617   1.00 0.00 ? 41  VAL A HB   2  
ATOM 2973  H HG11 . VAL A 1 41  ? 116.575 -2.410  3.053   1.00 0.00 ? 41  VAL A HG11 2  
ATOM 2974  H HG12 . VAL A 1 41  ? 116.915 -3.275  1.554   1.00 0.00 ? 41  VAL A HG12 2  
ATOM 2975  H HG13 . VAL A 1 41  ? 115.577 -3.786  2.582   1.00 0.00 ? 41  VAL A HG13 2  
ATOM 2976  H HG21 . VAL A 1 41  ? 114.385 -1.025  3.196   1.00 0.00 ? 41  VAL A HG21 2  
ATOM 2977  H HG22 . VAL A 1 41  ? 113.495 -2.461  2.688   1.00 0.00 ? 41  VAL A HG22 2  
ATOM 2978  H HG23 . VAL A 1 41  ? 113.344 -0.961  1.774   1.00 0.00 ? 41  VAL A HG23 2  
ATOM 2979  N N    . LEU A 1 42  ? 117.562 -0.320  2.694   1.00 0.00 ? 42  LEU A N    2  
ATOM 2980  C CA   . LEU A 1 42  ? 118.139 0.419   3.814   1.00 0.00 ? 42  LEU A CA   2  
ATOM 2981  C C    . LEU A 1 42  ? 118.693 1.758   3.355   1.00 0.00 ? 42  LEU A C    2  
ATOM 2982  O O    . LEU A 1 42  ? 118.650 2.731   4.100   1.00 0.00 ? 42  LEU A O    2  
ATOM 2983  C CB   . LEU A 1 42  ? 119.238 -0.392  4.519   1.00 0.00 ? 42  LEU A CB   2  
ATOM 2984  C CG   . LEU A 1 42  ? 118.739 -1.459  5.505   1.00 0.00 ? 42  LEU A CG   2  
ATOM 2985  C CD1  . LEU A 1 42  ? 119.914 -2.134  6.209   1.00 0.00 ? 42  LEU A CD1  2  
ATOM 2986  C CD2  . LEU A 1 42  ? 117.782 -0.837  6.523   1.00 0.00 ? 42  LEU A CD2  2  
ATOM 2987  H H    . LEU A 1 42  ? 117.998 -1.146  2.387   1.00 0.00 ? 42  LEU A H    2  
ATOM 2988  H HA   . LEU A 1 42  ? 117.342 0.607   4.521   1.00 0.00 ? 42  LEU A HA   2  
ATOM 2989  H HB2  . LEU A 1 42  ? 119.835 -0.883  3.761   1.00 0.00 ? 42  LEU A HB2  2  
ATOM 2990  H HB3  . LEU A 1 42  ? 119.875 0.294   5.060   1.00 0.00 ? 42  LEU A HB3  2  
ATOM 2991  H HG   . LEU A 1 42  ? 118.198 -2.220  4.960   1.00 0.00 ? 42  LEU A HG   2  
ATOM 2992  H HD11 . LEU A 1 42  ? 120.557 -2.596  5.474   1.00 0.00 ? 42  LEU A HD11 2  
ATOM 2993  H HD12 . LEU A 1 42  ? 119.544 -2.890  6.887   1.00 0.00 ? 42  LEU A HD12 2  
ATOM 2994  H HD13 . LEU A 1 42  ? 120.477 -1.396  6.765   1.00 0.00 ? 42  LEU A HD13 2  
ATOM 2995  H HD21 . LEU A 1 42  ? 117.479 -1.586  7.240   1.00 0.00 ? 42  LEU A HD21 2  
ATOM 2996  H HD22 . LEU A 1 42  ? 116.909 -0.457  6.013   1.00 0.00 ? 42  LEU A HD22 2  
ATOM 2997  H HD23 . LEU A 1 42  ? 118.278 -0.025  7.038   1.00 0.00 ? 42  LEU A HD23 2  
ATOM 2998  N N    . PHE A 1 43  ? 119.205 1.807   2.128   1.00 0.00 ? 43  PHE A N    2  
ATOM 2999  C CA   . PHE A 1 43  ? 119.779 3.037   1.593   1.00 0.00 ? 43  PHE A CA   2  
ATOM 3000  C C    . PHE A 1 43  ? 118.750 4.168   1.598   1.00 0.00 ? 43  PHE A C    2  
ATOM 3001  O O    . PHE A 1 43  ? 119.038 5.272   2.066   1.00 0.00 ? 43  PHE A O    2  
ATOM 3002  C CB   . PHE A 1 43  ? 120.323 2.825   0.175   1.00 0.00 ? 43  PHE A CB   2  
ATOM 3003  C CG   . PHE A 1 43  ? 120.916 4.075   -0.429  1.00 0.00 ? 43  PHE A CG   2  
ATOM 3004  C CD1  . PHE A 1 43  ? 121.953 4.743   0.210   1.00 0.00 ? 43  PHE A CD1  2  
ATOM 3005  C CD2  . PHE A 1 43  ? 120.437 4.584   -1.629  1.00 0.00 ? 43  PHE A CD2  2  
ATOM 3006  C CE1  . PHE A 1 43  ? 122.498 5.889   -0.336  1.00 0.00 ? 43  PHE A CE1  2  
ATOM 3007  C CE2  . PHE A 1 43  ? 120.982 5.730   -2.178  1.00 0.00 ? 43  PHE A CE2  2  
ATOM 3008  C CZ   . PHE A 1 43  ? 122.012 6.383   -1.530  1.00 0.00 ? 43  PHE A CZ   2  
ATOM 3009  H H    . PHE A 1 43  ? 119.205 0.997   1.575   1.00 0.00 ? 43  PHE A H    2  
ATOM 3010  H HA   . PHE A 1 43  ? 120.599 3.319   2.239   1.00 0.00 ? 43  PHE A HA   2  
ATOM 3011  H HB2  . PHE A 1 43  ? 121.095 2.069   0.202   1.00 0.00 ? 43  PHE A HB2  2  
ATOM 3012  H HB3  . PHE A 1 43  ? 119.520 2.489   -0.466  1.00 0.00 ? 43  PHE A HB3  2  
ATOM 3013  H HD1  . PHE A 1 43  ? 122.336 4.359   1.144   1.00 0.00 ? 43  PHE A HD1  2  
ATOM 3014  H HD2  . PHE A 1 43  ? 119.631 4.075   -2.137  1.00 0.00 ? 43  PHE A HD2  2  
ATOM 3015  H HE1  . PHE A 1 43  ? 123.303 6.400   0.173   1.00 0.00 ? 43  PHE A HE1  2  
ATOM 3016  H HE2  . PHE A 1 43  ? 120.601 6.115   -3.112  1.00 0.00 ? 43  PHE A HE2  2  
ATOM 3017  H HZ   . PHE A 1 43  ? 122.437 7.280   -1.957  1.00 0.00 ? 43  PHE A HZ   2  
ATOM 3018  N N    . TRP A 1 44  ? 117.550 3.889   1.090   1.00 0.00 ? 44  TRP A N    2  
ATOM 3019  C CA   . TRP A 1 44  ? 116.502 4.907   1.029   1.00 0.00 ? 44  TRP A CA   2  
ATOM 3020  C C    . TRP A 1 44  ? 116.104 5.341   2.438   1.00 0.00 ? 44  TRP A C    2  
ATOM 3021  O O    . TRP A 1 44  ? 116.095 6.532   2.748   1.00 0.00 ? 44  TRP A O    2  
ATOM 3022  C CB   . TRP A 1 44  ? 115.272 4.396   0.268   1.00 0.00 ? 44  TRP A CB   2  
ATOM 3023  C CG   . TRP A 1 44  ? 114.305 5.493   -0.099  1.00 0.00 ? 44  TRP A CG   2  
ATOM 3024  C CD1  . TRP A 1 44  ? 114.289 6.210   -1.263  1.00 0.00 ? 44  TRP A CD1  2  
ATOM 3025  C CD2  . TRP A 1 44  ? 113.224 6.003   0.698   1.00 0.00 ? 44  TRP A CD2  2  
ATOM 3026  N NE1  . TRP A 1 44  ? 113.268 7.126   -1.241  1.00 0.00 ? 44  TRP A NE1  2  
ATOM 3027  C CE2  . TRP A 1 44  ? 112.601 7.021   -0.049  1.00 0.00 ? 44  TRP A CE2  2  
ATOM 3028  C CE3  . TRP A 1 44  ? 112.722 5.697   1.967   1.00 0.00 ? 44  TRP A CE3  2  
ATOM 3029  C CZ2  . TRP A 1 44  ? 111.504 7.733   0.430   1.00 0.00 ? 44  TRP A CZ2  2  
ATOM 3030  C CZ3  . TRP A 1 44  ? 111.633 6.405   2.442   1.00 0.00 ? 44  TRP A CZ3  2  
ATOM 3031  C CH2  . TRP A 1 44  ? 111.035 7.412   1.675   1.00 0.00 ? 44  TRP A CH2  2  
ATOM 3032  H H    . TRP A 1 44  ? 117.368 2.984   0.751   1.00 0.00 ? 44  TRP A H    2  
ATOM 3033  H HA   . TRP A 1 44  ? 116.908 5.763   0.505   1.00 0.00 ? 44  TRP A HA   2  
ATOM 3034  H HB2  . TRP A 1 44  ? 115.594 3.916   -0.646  1.00 0.00 ? 44  TRP A HB2  2  
ATOM 3035  H HB3  . TRP A 1 44  ? 114.747 3.676   0.880   1.00 0.00 ? 44  TRP A HB3  2  
ATOM 3036  H HD1  . TRP A 1 44  ? 114.983 6.064   -2.076  1.00 0.00 ? 44  TRP A HD1  2  
ATOM 3037  H HE1  . TRP A 1 44  ? 113.054 7.755   -1.961  1.00 0.00 ? 44  TRP A HE1  2  
ATOM 3038  H HE3  . TRP A 1 44  ? 113.172 4.925   2.574   1.00 0.00 ? 44  TRP A HE3  2  
ATOM 3039  H HZ2  . TRP A 1 44  ? 111.032 8.512   -0.149  1.00 0.00 ? 44  TRP A HZ2  2  
ATOM 3040  H HZ3  . TRP A 1 44  ? 111.233 6.182   3.421   1.00 0.00 ? 44  TRP A HZ3  2  
ATOM 3041  H HH2  . TRP A 1 44  ? 110.186 7.940   2.086   1.00 0.00 ? 44  TRP A HH2  2  
ATOM 3042  N N    . LEU A 1 45  ? 115.795 4.364   3.293   1.00 0.00 ? 45  LEU A N    2  
ATOM 3043  C CA   . LEU A 1 45  ? 115.415 4.649   4.679   1.00 0.00 ? 45  LEU A CA   2  
ATOM 3044  C C    . LEU A 1 45  ? 116.547 5.371   5.414   1.00 0.00 ? 45  LEU A C    2  
ATOM 3045  O O    . LEU A 1 45  ? 116.307 6.142   6.348   1.00 0.00 ? 45  LEU A O    2  
ATOM 3046  C CB   . LEU A 1 45  ? 115.031 3.356   5.426   1.00 0.00 ? 45  LEU A CB   2  
ATOM 3047  C CG   . LEU A 1 45  ? 113.610 2.820   5.157   1.00 0.00 ? 45  LEU A CG   2  
ATOM 3048  C CD1  . LEU A 1 45  ? 112.558 3.865   5.527   1.00 0.00 ? 45  LEU A CD1  2  
ATOM 3049  C CD2  . LEU A 1 45  ? 113.445 2.377   3.704   1.00 0.00 ? 45  LEU A CD2  2  
ATOM 3050  H H    . LEU A 1 45  ? 115.826 3.429   2.987   1.00 0.00 ? 45  LEU A H    2  
ATOM 3051  H HA   . LEU A 1 45  ? 114.555 5.304   4.652   1.00 0.00 ? 45  LEU A HA   2  
ATOM 3052  H HB2  . LEU A 1 45  ? 115.739 2.585   5.153   1.00 0.00 ? 45  LEU A HB2  2  
ATOM 3053  H HB3  . LEU A 1 45  ? 115.123 3.537   6.488   1.00 0.00 ? 45  LEU A HB3  2  
ATOM 3054  H HG   . LEU A 1 45  ? 113.442 1.956   5.785   1.00 0.00 ? 45  LEU A HG   2  
ATOM 3055  H HD11 . LEU A 1 45  ? 112.653 4.116   6.574   1.00 0.00 ? 45  LEU A HD11 2  
ATOM 3056  H HD12 . LEU A 1 45  ? 111.571 3.465   5.344   1.00 0.00 ? 45  LEU A HD12 2  
ATOM 3057  H HD13 . LEU A 1 45  ? 112.702 4.753   4.929   1.00 0.00 ? 45  LEU A HD13 2  
ATOM 3058  H HD21 . LEU A 1 45  ? 113.655 3.207   3.045   1.00 0.00 ? 45  LEU A HD21 2  
ATOM 3059  H HD22 . LEU A 1 45  ? 112.432 2.037   3.542   1.00 0.00 ? 45  LEU A HD22 2  
ATOM 3060  H HD23 . LEU A 1 45  ? 114.131 1.569   3.494   1.00 0.00 ? 45  LEU A HD23 2  
ATOM 3061  N N    . ALA A 1 46  ? 117.779 5.121   4.981   1.00 0.00 ? 46  ALA A N    2  
ATOM 3062  C CA   . ALA A 1 46  ? 118.945 5.778   5.557   1.00 0.00 ? 46  ALA A CA   2  
ATOM 3063  C C    . ALA A 1 46  ? 118.993 7.243   5.133   1.00 0.00 ? 46  ALA A C    2  
ATOM 3064  O O    . ALA A 1 46  ? 119.277 8.116   5.947   1.00 0.00 ? 46  ALA A O    2  
ATOM 3065  C CB   . ALA A 1 46  ? 120.229 5.055   5.157   1.00 0.00 ? 46  ALA A CB   2  
ATOM 3066  H H    . ALA A 1 46  ? 117.907 4.472   4.257   1.00 0.00 ? 46  ALA A H    2  
ATOM 3067  H HA   . ALA A 1 46  ? 118.854 5.730   6.635   1.00 0.00 ? 46  ALA A HA   2  
ATOM 3068  H HB1  . ALA A 1 46  ? 120.356 5.109   4.085   1.00 0.00 ? 46  ALA A HB1  2  
ATOM 3069  H HB2  . ALA A 1 46  ? 120.166 4.017   5.458   1.00 0.00 ? 46  ALA A HB2  2  
ATOM 3070  H HB3  . ALA A 1 46  ? 121.074 5.519   5.644   1.00 0.00 ? 46  ALA A HB3  2  
ATOM 3071  N N    . CYS A 1 47  ? 118.699 7.503   3.858   1.00 0.00 ? 47  CYS A N    2  
ATOM 3072  C CA   . CYS A 1 47  ? 118.671 8.870   3.331   1.00 0.00 ? 47  CYS A CA   2  
ATOM 3073  C C    . CYS A 1 47  ? 117.509 9.655   3.942   1.00 0.00 ? 47  CYS A C    2  
ATOM 3074  O O    . CYS A 1 47  ? 117.617 10.856  4.203   1.00 0.00 ? 47  CYS A O    2  
ATOM 3075  C CB   . CYS A 1 47  ? 118.553 8.853   1.803   1.00 0.00 ? 47  CYS A CB   2  
ATOM 3076  S SG   . CYS A 1 47  ? 119.935 8.040   0.965   1.00 0.00 ? 47  CYS A SG   2  
ATOM 3077  H H    . CYS A 1 47  ? 118.491 6.757   3.256   1.00 0.00 ? 47  CYS A H    2  
ATOM 3078  H HA   . CYS A 1 47  ? 119.600 9.350   3.607   1.00 0.00 ? 47  CYS A HA   2  
ATOM 3079  H HB2  . CYS A 1 47  ? 117.650 8.331   1.523   1.00 0.00 ? 47  CYS A HB2  2  
ATOM 3080  H HB3  . CYS A 1 47  ? 118.502 9.870   1.440   1.00 0.00 ? 47  CYS A HB3  2  
ATOM 3081  H HG   . CYS A 1 47  ? 119.994 6.789   1.394   1.00 0.00 ? 47  CYS A HG   2  
ATOM 3082  N N    . GLU A 1 48  ? 116.406 8.955   4.172   1.00 0.00 ? 48  GLU A N    2  
ATOM 3083  C CA   . GLU A 1 48  ? 115.221 9.532   4.796   1.00 0.00 ? 48  GLU A CA   2  
ATOM 3084  C C    . GLU A 1 48  ? 115.595 10.078  6.182   1.00 0.00 ? 48  GLU A C    2  
ATOM 3085  O O    . GLU A 1 48  ? 115.418 11.268  6.478   1.00 0.00 ? 48  GLU A O    2  
ATOM 3086  C CB   . GLU A 1 48  ? 114.136 8.437   4.887   1.00 0.00 ? 48  GLU A CB   2  
ATOM 3087  C CG   . GLU A 1 48  ? 112.698 8.941   4.990   1.00 0.00 ? 48  GLU A CG   2  
ATOM 3088  C CD   . GLU A 1 48  ? 112.350 9.512   6.352   1.00 0.00 ? 48  GLU A CD   2  
ATOM 3089  O OE1  . GLU A 1 48  ? 112.315 8.737   7.331   1.00 0.00 ? 48  GLU A OE1  2  
ATOM 3090  O OE2  . GLU A 1 48  ? 112.101 10.730  6.446   1.00 0.00 ? 48  GLU A OE2  2  
ATOM 3091  H H    . GLU A 1 48  ? 116.384 8.012   3.906   1.00 0.00 ? 48  GLU A H    2  
ATOM 3092  H HA   . GLU A 1 48  ? 114.868 10.342  4.173   1.00 0.00 ? 48  GLU A HA   2  
ATOM 3093  H HB2  . GLU A 1 48  ? 114.204 7.816   4.005   1.00 0.00 ? 48  GLU A HB2  2  
ATOM 3094  H HB3  . GLU A 1 48  ? 114.340 7.823   5.754   1.00 0.00 ? 48  GLU A HB3  2  
ATOM 3095  H HG2  . GLU A 1 48  ? 112.547 9.710   4.244   1.00 0.00 ? 48  GLU A HG2  2  
ATOM 3096  H HG3  . GLU A 1 48  ? 112.030 8.115   4.783   1.00 0.00 ? 48  GLU A HG3  2  
ATOM 3097  N N    . ASP A 1 49  ? 116.161 9.201   7.006   1.00 0.00 ? 49  ASP A N    2  
ATOM 3098  C CA   . ASP A 1 49  ? 116.630 9.567   8.343   1.00 0.00 ? 49  ASP A CA   2  
ATOM 3099  C C    . ASP A 1 49  ? 117.766 10.588  8.258   1.00 0.00 ? 49  ASP A C    2  
ATOM 3100  O O    . ASP A 1 49  ? 117.865 11.502  9.082   1.00 0.00 ? 49  ASP A O    2  
ATOM 3101  C CB   . ASP A 1 49  ? 117.102 8.312   9.086   1.00 0.00 ? 49  ASP A CB   2  
ATOM 3102  C CG   . ASP A 1 49  ? 117.653 8.614   10.472  1.00 0.00 ? 49  ASP A CG   2  
ATOM 3103  O OD1  . ASP A 1 49  ? 118.869 8.871   10.589  1.00 0.00 ? 49  ASP A OD1  2  
ATOM 3104  O OD2  . ASP A 1 49  ? 116.871 8.577   11.450  1.00 0.00 ? 49  ASP A OD2  2  
ATOM 3105  H H    . ASP A 1 49  ? 116.269 8.272   6.706   1.00 0.00 ? 49  ASP A H    2  
ATOM 3106  H HA   . ASP A 1 49  ? 115.801 10.006  8.881   1.00 0.00 ? 49  ASP A HA   2  
ATOM 3107  H HB2  . ASP A 1 49  ? 116.270 7.630   9.190   1.00 0.00 ? 49  ASP A HB2  2  
ATOM 3108  H HB3  . ASP A 1 49  ? 117.879 7.831   8.506   1.00 0.00 ? 49  ASP A HB3  2  
ATOM 3109  N N    . PHE A 1 50  ? 118.602 10.421  7.237   1.00 0.00 ? 50  PHE A N    2  
ATOM 3110  C CA   . PHE A 1 50  ? 119.758 11.288  6.992   1.00 0.00 ? 50  PHE A CA   2  
ATOM 3111  C C    . PHE A 1 50  ? 119.326 12.747  6.877   1.00 0.00 ? 50  PHE A C    2  
ATOM 3112  O O    . PHE A 1 50  ? 120.027 13.654  7.326   1.00 0.00 ? 50  PHE A O    2  
ATOM 3113  C CB   . PHE A 1 50  ? 120.443 10.842  5.693   1.00 0.00 ? 50  PHE A CB   2  
ATOM 3114  C CG   . PHE A 1 50  ? 121.791 11.459  5.423   1.00 0.00 ? 50  PHE A CG   2  
ATOM 3115  C CD1  . PHE A 1 50  ? 121.906 12.676  4.764   1.00 0.00 ? 50  PHE A CD1  2  
ATOM 3116  C CD2  . PHE A 1 50  ? 122.945 10.796  5.800   1.00 0.00 ? 50  PHE A CD2  2  
ATOM 3117  C CE1  . PHE A 1 50  ? 123.148 13.215  4.490   1.00 0.00 ? 50  PHE A CE1  2  
ATOM 3118  C CE2  . PHE A 1 50  ? 124.188 11.333  5.533   1.00 0.00 ? 50  PHE A CE2  2  
ATOM 3119  C CZ   . PHE A 1 50  ? 124.291 12.542  4.875   1.00 0.00 ? 50  PHE A CZ   2  
ATOM 3120  H H    . PHE A 1 50  ? 118.437 9.681   6.619   1.00 0.00 ? 50  PHE A H    2  
ATOM 3121  H HA   . PHE A 1 50  ? 120.448 11.179  7.818   1.00 0.00 ? 50  PHE A HA   2  
ATOM 3122  H HB2  . PHE A 1 50  ? 120.577 9.771   5.723   1.00 0.00 ? 50  PHE A HB2  2  
ATOM 3123  H HB3  . PHE A 1 50  ? 119.796 11.083  4.860   1.00 0.00 ? 50  PHE A HB3  2  
ATOM 3124  H HD1  . PHE A 1 50  ? 121.013 13.207  4.468   1.00 0.00 ? 50  PHE A HD1  2  
ATOM 3125  H HD2  . PHE A 1 50  ? 122.866 9.850   6.318   1.00 0.00 ? 50  PHE A HD2  2  
ATOM 3126  H HE1  . PHE A 1 50  ? 123.225 14.163  3.976   1.00 0.00 ? 50  PHE A HE1  2  
ATOM 3127  H HE2  . PHE A 1 50  ? 125.081 10.806  5.836   1.00 0.00 ? 50  PHE A HE2  2  
ATOM 3128  H HZ   . PHE A 1 50  ? 125.264 12.960  4.662   1.00 0.00 ? 50  PHE A HZ   2  
ATOM 3129  N N    . LYS A 1 51  ? 118.172 12.958  6.256   1.00 0.00 ? 51  LYS A N    2  
ATOM 3130  C CA   . LYS A 1 51  ? 117.622 14.293  6.073   1.00 0.00 ? 51  LYS A CA   2  
ATOM 3131  C C    . LYS A 1 51  ? 116.993 14.797  7.373   1.00 0.00 ? 51  LYS A C    2  
ATOM 3132  O O    . LYS A 1 51  ? 117.033 15.993  7.671   1.00 0.00 ? 51  LYS A O    2  
ATOM 3133  C CB   . LYS A 1 51  ? 116.594 14.267  4.925   1.00 0.00 ? 51  LYS A CB   2  
ATOM 3134  C CG   . LYS A 1 51  ? 115.958 15.620  4.590   1.00 0.00 ? 51  LYS A CG   2  
ATOM 3135  C CD   . LYS A 1 51  ? 114.685 15.886  5.396   1.00 0.00 ? 51  LYS A CD   2  
ATOM 3136  C CE   . LYS A 1 51  ? 114.074 17.241  5.057   1.00 0.00 ? 51  LYS A CE   2  
ATOM 3137  N NZ   . LYS A 1 51  ? 114.960 18.366  5.459   1.00 0.00 ? 51  LYS A NZ   2  
ATOM 3138  H H    . LYS A 1 51  ? 117.678 12.190  5.898   1.00 0.00 ? 51  LYS A H    2  
ATOM 3139  H HA   . LYS A 1 51  ? 118.435 14.953  5.801   1.00 0.00 ? 51  LYS A HA   2  
ATOM 3140  H HB2  . LYS A 1 51  ? 117.087 13.903  4.034   1.00 0.00 ? 51  LYS A HB2  2  
ATOM 3141  H HB3  . LYS A 1 51  ? 115.803 13.577  5.186   1.00 0.00 ? 51  LYS A HB3  2  
ATOM 3142  H HG2  . LYS A 1 51  ? 116.673 16.401  4.802   1.00 0.00 ? 51  LYS A HG2  2  
ATOM 3143  H HG3  . LYS A 1 51  ? 115.715 15.636  3.537   1.00 0.00 ? 51  LYS A HG3  2  
ATOM 3144  H HD2  . LYS A 1 51  ? 113.963 15.113  5.175   1.00 0.00 ? 51  LYS A HD2  2  
ATOM 3145  H HD3  . LYS A 1 51  ? 114.925 15.863  6.450   1.00 0.00 ? 51  LYS A HD3  2  
ATOM 3146  H HE2  . LYS A 1 51  ? 113.905 17.292  3.991   1.00 0.00 ? 51  LYS A HE2  2  
ATOM 3147  H HE3  . LYS A 1 51  ? 113.130 17.336  5.575   1.00 0.00 ? 51  LYS A HE3  2  
ATOM 3148  H HZ1  . LYS A 1 51  ? 114.586 19.266  5.094   1.00 0.00 ? 51  LYS A HZ1  2  
ATOM 3149  H HZ2  . LYS A 1 51  ? 115.919 18.225  5.084   1.00 0.00 ? 51  LYS A HZ2  2  
ATOM 3150  H HZ3  . LYS A 1 51  ? 115.014 18.425  6.495   1.00 0.00 ? 51  LYS A HZ3  2  
ATOM 3151  N N    . LYS A 1 52  ? 116.420 13.880  8.149   1.00 0.00 ? 52  LYS A N    2  
ATOM 3152  C CA   . LYS A 1 52  ? 115.712 14.248  9.377   1.00 0.00 ? 52  LYS A CA   2  
ATOM 3153  C C    . LYS A 1 52  ? 116.656 14.656  10.509  1.00 0.00 ? 52  LYS A C    2  
ATOM 3154  O O    . LYS A 1 52  ? 116.585 15.787  10.995  1.00 0.00 ? 52  LYS A O    2  
ATOM 3155  C CB   . LYS A 1 52  ? 114.794 13.108  9.837   1.00 0.00 ? 52  LYS A CB   2  
ATOM 3156  C CG   . LYS A 1 52  ? 113.678 12.791  8.846   1.00 0.00 ? 52  LYS A CG   2  
ATOM 3157  C CD   . LYS A 1 52  ? 112.681 11.773  9.396   1.00 0.00 ? 52  LYS A CD   2  
ATOM 3158  C CE   . LYS A 1 52  ? 113.336 10.439  9.731   1.00 0.00 ? 52  LYS A CE   2  
ATOM 3159  N NZ   . LYS A 1 52  ? 112.327 9.396   10.055  1.00 0.00 ? 52  LYS A NZ   2  
ATOM 3160  H H    . LYS A 1 52  ? 116.463 12.932  7.883   1.00 0.00 ? 52  LYS A H    2  
ATOM 3161  H HA   . LYS A 1 52  ? 115.096 15.102  9.147   1.00 0.00 ? 52  LYS A HA   2  
ATOM 3162  H HB2  . LYS A 1 52  ? 115.388 12.216  9.979   1.00 0.00 ? 52  LYS A HB2  2  
ATOM 3163  H HB3  . LYS A 1 52  ? 114.341 13.381  10.781  1.00 0.00 ? 52  LYS A HB3  2  
ATOM 3164  H HG2  . LYS A 1 52  ? 113.149 13.704  8.614   1.00 0.00 ? 52  LYS A HG2  2  
ATOM 3165  H HG3  . LYS A 1 52  ? 114.119 12.394  7.941   1.00 0.00 ? 52  LYS A HG3  2  
ATOM 3166  H HD2  . LYS A 1 52  ? 112.232 12.174  10.294  1.00 0.00 ? 52  LYS A HD2  2  
ATOM 3167  H HD3  . LYS A 1 52  ? 111.910 11.608  8.655   1.00 0.00 ? 52  LYS A HD3  2  
ATOM 3168  H HE2  . LYS A 1 52  ? 113.918 10.111  8.882   1.00 0.00 ? 52  LYS A HE2  2  
ATOM 3169  H HE3  . LYS A 1 52  ? 113.987 10.573  10.583  1.00 0.00 ? 52  LYS A HE3  2  
ATOM 3170  H HZ1  . LYS A 1 52  ? 111.717 9.224   9.227   1.00 0.00 ? 52  LYS A HZ1  2  
ATOM 3171  H HZ2  . LYS A 1 52  ? 111.732 9.704   10.849  1.00 0.00 ? 52  LYS A HZ2  2  
ATOM 3172  H HZ3  . LYS A 1 52  ? 112.796 8.504   10.314  1.00 0.00 ? 52  LYS A HZ3  2  
ATOM 3173  N N    . MET A 1 53  ? 117.536 13.755  10.935  1.00 0.00 ? 53  MET A N    2  
ATOM 3174  C CA   . MET A 1 53  ? 118.335 13.998  12.141  1.00 0.00 ? 53  MET A CA   2  
ATOM 3175  C C    . MET A 1 53  ? 119.836 14.056  11.831  1.00 0.00 ? 53  MET A C    2  
ATOM 3176  O O    . MET A 1 53  ? 120.229 14.199  10.673  1.00 0.00 ? 53  MET A O    2  
ATOM 3177  C CB   . MET A 1 53  ? 118.062 12.903  13.190  1.00 0.00 ? 53  MET A CB   2  
ATOM 3178  C CG   . MET A 1 53  ? 118.685 11.550  12.855  1.00 0.00 ? 53  MET A CG   2  
ATOM 3179  S SD   . MET A 1 53  ? 118.548 10.363  14.208  1.00 0.00 ? 53  MET A SD   2  
ATOM 3180  C CE   . MET A 1 53  ? 119.676 9.080   13.656  1.00 0.00 ? 53  MET A CE   2  
ATOM 3181  H H    . MET A 1 53  ? 117.664 12.924  10.428  1.00 0.00 ? 53  MET A H    2  
ATOM 3182  H HA   . MET A 1 53  ? 118.029 14.952  12.546  1.00 0.00 ? 53  MET A HA   2  
ATOM 3183  H HB2  . MET A 1 53  ? 118.456 13.228  14.143  1.00 0.00 ? 53  MET A HB2  2  
ATOM 3184  H HB3  . MET A 1 53  ? 116.993 12.769  13.283  1.00 0.00 ? 53  MET A HB3  2  
ATOM 3185  H HG2  . MET A 1 53  ? 118.184 11.143  11.988  1.00 0.00 ? 53  MET A HG2  2  
ATOM 3186  H HG3  . MET A 1 53  ? 119.730 11.697  12.627  1.00 0.00 ? 53  MET A HG3  2  
ATOM 3187  H HE1  . MET A 1 53  ? 119.338 8.685   12.708  1.00 0.00 ? 53  MET A HE1  2  
ATOM 3188  H HE2  . MET A 1 53  ? 119.704 8.286   14.387  1.00 0.00 ? 53  MET A HE2  2  
ATOM 3189  H HE3  . MET A 1 53  ? 120.666 9.496   13.539  1.00 0.00 ? 53  MET A HE3  2  
ATOM 3190  N N    . GLN A 1 54  ? 120.650 13.968  12.898  1.00 0.00 ? 54  GLN A N    2  
ATOM 3191  C CA   . GLN A 1 54  ? 122.116 13.869  12.816  1.00 0.00 ? 54  GLN A CA   2  
ATOM 3192  C C    . GLN A 1 54  ? 122.786 15.237  12.665  1.00 0.00 ? 54  GLN A C    2  
ATOM 3193  O O    . GLN A 1 54  ? 122.438 16.023  11.782  1.00 0.00 ? 54  GLN A O    2  
ATOM 3194  C CB   . GLN A 1 54  ? 122.561 12.927  11.681  1.00 0.00 ? 54  GLN A CB   2  
ATOM 3195  C CG   . GLN A 1 54  ? 122.221 11.461  11.927  1.00 0.00 ? 54  GLN A CG   2  
ATOM 3196  C CD   . GLN A 1 54  ? 122.555 10.574  10.741  1.00 0.00 ? 54  GLN A CD   2  
ATOM 3197  O OE1  . GLN A 1 54  ? 123.673 10.077  10.620  1.00 0.00 ? 54  GLN A OE1  2  
ATOM 3198  N NE2  . GLN A 1 54  ? 121.583 10.358  9.867   1.00 0.00 ? 54  GLN A NE2  2  
ATOM 3199  H H    . GLN A 1 54  ? 120.242 13.987  13.791  1.00 0.00 ? 54  GLN A H    2  
ATOM 3200  H HA   . GLN A 1 54  ? 122.447 13.442  13.754  1.00 0.00 ? 54  GLN A HA   2  
ATOM 3201  H HB2  . GLN A 1 54  ? 122.082 13.237  10.763  1.00 0.00 ? 54  GLN A HB2  2  
ATOM 3202  H HB3  . GLN A 1 54  ? 123.633 13.010  11.559  1.00 0.00 ? 54  GLN A HB3  2  
ATOM 3203  H HG2  . GLN A 1 54  ? 122.779 11.113  12.785  1.00 0.00 ? 54  GLN A HG2  2  
ATOM 3204  H HG3  . GLN A 1 54  ? 121.163 11.380  12.133  1.00 0.00 ? 54  GLN A HG3  2  
ATOM 3205  H HE21 . GLN A 1 54  ? 120.708 10.773  10.032  1.00 0.00 ? 54  GLN A HE21 2  
ATOM 3206  H HE22 . GLN A 1 54  ? 121.773 9.787   9.097   1.00 0.00 ? 54  GLN A HE22 2  
ATOM 3207  N N    . ASP A 1 55  ? 123.746 15.510  13.553  1.00 0.00 ? 55  ASP A N    2  
ATOM 3208  C CA   . ASP A 1 55  ? 124.593 16.704  13.459  1.00 0.00 ? 55  ASP A CA   2  
ATOM 3209  C C    . ASP A 1 55  ? 125.525 16.576  12.257  1.00 0.00 ? 55  ASP A C    2  
ATOM 3210  O O    . ASP A 1 55  ? 125.786 15.465  11.804  1.00 0.00 ? 55  ASP A O    2  
ATOM 3211  C CB   . ASP A 1 55  ? 125.415 16.873  14.750  1.00 0.00 ? 55  ASP A CB   2  
ATOM 3212  C CG   . ASP A 1 55  ? 126.390 18.045  14.689  1.00 0.00 ? 55  ASP A CG   2  
ATOM 3213  O OD1  . ASP A 1 55  ? 125.996 19.175  15.047  1.00 0.00 ? 55  ASP A OD1  2  
ATOM 3214  O OD2  . ASP A 1 55  ? 127.558 17.842  14.285  1.00 0.00 ? 55  ASP A OD2  2  
ATOM 3215  H H    . ASP A 1 55  ? 123.890 14.886  14.296  1.00 0.00 ? 55  ASP A H    2  
ATOM 3216  H HA   . ASP A 1 55  ? 123.953 17.565  13.324  1.00 0.00 ? 55  ASP A HA   2  
ATOM 3217  H HB2  . ASP A 1 55  ? 124.739 17.035  15.577  1.00 0.00 ? 55  ASP A HB2  2  
ATOM 3218  H HB3  . ASP A 1 55  ? 125.978 15.967  14.930  1.00 0.00 ? 55  ASP A HB3  2  
ATOM 3219  N N    . LYS A 1 56  ? 126.035 17.705  11.757  1.00 0.00 ? 56  LYS A N    2  
ATOM 3220  C CA   . LYS A 1 56  ? 126.903 17.717  10.575  1.00 0.00 ? 56  LYS A CA   2  
ATOM 3221  C C    . LYS A 1 56  ? 127.980 16.632  10.645  1.00 0.00 ? 56  LYS A C    2  
ATOM 3222  O O    . LYS A 1 56  ? 128.250 15.953  9.654   1.00 0.00 ? 56  LYS A O    2  
ATOM 3223  C CB   . LYS A 1 56  ? 127.570 19.083  10.399  1.00 0.00 ? 56  LYS A CB   2  
ATOM 3224  C CG   . LYS A 1 56  ? 128.361 19.196  9.099   1.00 0.00 ? 56  LYS A CG   2  
ATOM 3225  C CD   . LYS A 1 56  ? 129.055 20.542  8.973   1.00 0.00 ? 56  LYS A CD   2  
ATOM 3226  C CE   . LYS A 1 56  ? 129.872 20.641  7.688   1.00 0.00 ? 56  LYS A CE   2  
ATOM 3227  N NZ   . LYS A 1 56  ? 130.642 21.911  7.608   1.00 0.00 ? 56  LYS A NZ   2  
ATOM 3228  H H    . LYS A 1 56  ? 125.810 18.557  12.187  1.00 0.00 ? 56  LYS A H    2  
ATOM 3229  H HA   . LYS A 1 56  ? 126.283 17.532  9.711   1.00 0.00 ? 56  LYS A HA   2  
ATOM 3230  H HB2  . LYS A 1 56  ? 126.807 19.849  10.404  1.00 0.00 ? 56  LYS A HB2  2  
ATOM 3231  H HB3  . LYS A 1 56  ? 128.245 19.253  11.226  1.00 0.00 ? 56  LYS A HB3  2  
ATOM 3232  H HG2  . LYS A 1 56  ? 129.109 18.415  9.075   1.00 0.00 ? 56  LYS A HG2  2  
ATOM 3233  H HG3  . LYS A 1 56  ? 127.683 19.070  8.265   1.00 0.00 ? 56  LYS A HG3  2  
ATOM 3234  H HD2  . LYS A 1 56  ? 128.304 21.319  8.974   1.00 0.00 ? 56  LYS A HD2  2  
ATOM 3235  H HD3  . LYS A 1 56  ? 129.710 20.673  9.820   1.00 0.00 ? 56  LYS A HD3  2  
ATOM 3236  H HE2  . LYS A 1 56  ? 130.563 19.812  7.651   1.00 0.00 ? 56  LYS A HE2  2  
ATOM 3237  H HE3  . LYS A 1 56  ? 129.200 20.585  6.843   1.00 0.00 ? 56  LYS A HE3  2  
ATOM 3238  H HZ1  . LYS A 1 56  ? 131.148 21.969  6.700   1.00 0.00 ? 56  LYS A HZ1  2  
ATOM 3239  H HZ2  . LYS A 1 56  ? 131.337 21.959  8.381   1.00 0.00 ? 56  LYS A HZ2  2  
ATOM 3240  H HZ3  . LYS A 1 56  ? 130.001 22.727  7.687   1.00 0.00 ? 56  LYS A HZ3  2  
ATOM 3241  N N    . THR A 1 57  ? 128.591 16.473  11.815  1.00 0.00 ? 57  THR A N    2  
ATOM 3242  C CA   . THR A 1 57  ? 129.651 15.484  11.999  1.00 0.00 ? 57  THR A CA   2  
ATOM 3243  C C    . THR A 1 57  ? 129.129 14.072  11.728  1.00 0.00 ? 57  THR A C    2  
ATOM 3244  O O    . THR A 1 57  ? 129.661 13.354  10.876  1.00 0.00 ? 57  THR A O    2  
ATOM 3245  C CB   . THR A 1 57  ? 130.247 15.558  13.423  1.00 0.00 ? 57  THR A CB   2  
ATOM 3246  O OG1  . THR A 1 57  ? 129.203 15.425  14.404  1.00 0.00 ? 57  THR A OG1  2  
ATOM 3247  C CG2  . THR A 1 57  ? 130.985 16.876  13.636  1.00 0.00 ? 57  THR A CG2  2  
ATOM 3248  H H    . THR A 1 57  ? 128.318 17.030  12.576  1.00 0.00 ? 57  THR A H    2  
ATOM 3249  H HA   . THR A 1 57  ? 130.438 15.706  11.290  1.00 0.00 ? 57  THR A HA   2  
ATOM 3250  H HB   . THR A 1 57  ? 130.951 14.746  13.547  1.00 0.00 ? 57  THR A HB   2  
ATOM 3251  H HG1  . THR A 1 57  ? 128.777 16.284  14.537  1.00 0.00 ? 57  THR A HG1  2  
ATOM 3252  H HG21 . THR A 1 57  ? 130.298 17.700  13.504  1.00 0.00 ? 57  THR A HG21 2  
ATOM 3253  H HG22 . THR A 1 57  ? 131.788 16.960  12.918  1.00 0.00 ? 57  THR A HG22 2  
ATOM 3254  H HG23 . THR A 1 57  ? 131.393 16.904  14.636  1.00 0.00 ? 57  THR A HG23 2  
ATOM 3255  N N    . GLN A 1 58  ? 128.072 13.699  12.443  1.00 0.00 ? 58  GLN A N    2  
ATOM 3256  C CA   . GLN A 1 58  ? 127.432 12.393  12.283  1.00 0.00 ? 58  GLN A CA   2  
ATOM 3257  C C    . GLN A 1 58  ? 126.967 12.192  10.845  1.00 0.00 ? 58  GLN A C    2  
ATOM 3258  O O    . GLN A 1 58  ? 127.199 11.148  10.243  1.00 0.00 ? 58  GLN A O    2  
ATOM 3259  C CB   . GLN A 1 58  ? 126.234 12.285  13.229  1.00 0.00 ? 58  GLN A CB   2  
ATOM 3260  C CG   . GLN A 1 58  ? 126.613 12.224  14.705  1.00 0.00 ? 58  GLN A CG   2  
ATOM 3261  C CD   . GLN A 1 58  ? 125.406 12.293  15.623  1.00 0.00 ? 58  GLN A CD   2  
ATOM 3262  O OE1  . GLN A 1 58  ? 124.405 12.937  15.304  1.00 0.00 ? 58  GLN A OE1  2  
ATOM 3263  N NE2  . GLN A 1 58  ? 125.485 11.625  16.764  1.00 0.00 ? 58  GLN A NE2  2  
ATOM 3264  H H    . GLN A 1 58  ? 127.704 14.327  13.101  1.00 0.00 ? 58  GLN A H    2  
ATOM 3265  H HA   . GLN A 1 58  ? 128.155 11.629  12.533  1.00 0.00 ? 58  GLN A HA   2  
ATOM 3266  H HB2  . GLN A 1 58  ? 125.595 13.145  13.080  1.00 0.00 ? 58  GLN A HB2  2  
ATOM 3267  H HB3  . GLN A 1 58  ? 125.677 11.393  12.983  1.00 0.00 ? 58  GLN A HB3  2  
ATOM 3268  H HG2  . GLN A 1 58  ? 127.137 11.297  14.892  1.00 0.00 ? 58  GLN A HG2  2  
ATOM 3269  H HG3  . GLN A 1 58  ? 127.266 13.056  14.931  1.00 0.00 ? 58  GLN A HG3  2  
ATOM 3270  H HE21 . GLN A 1 58  ? 126.308 11.126  16.953  1.00 0.00 ? 58  GLN A HE21 2  
ATOM 3271  H HE22 . GLN A 1 58  ? 124.716 11.655  17.374  1.00 0.00 ? 58  GLN A HE22 2  
ATOM 3272  N N    . MET A 1 59  ? 126.312 13.213  10.319  1.00 0.00 ? 59  MET A N    2  
ATOM 3273  C CA   . MET A 1 59  ? 125.782 13.213  8.959   1.00 0.00 ? 59  MET A CA   2  
ATOM 3274  C C    . MET A 1 59  ? 126.857 12.840  7.942   1.00 0.00 ? 59  MET A C    2  
ATOM 3275  O O    . MET A 1 59  ? 126.667 11.958  7.105   1.00 0.00 ? 59  MET A O    2  
ATOM 3276  C CB   . MET A 1 59  ? 125.205 14.599  8.647   1.00 0.00 ? 59  MET A CB   2  
ATOM 3277  C CG   . MET A 1 59  ? 124.586 14.727  7.265   1.00 0.00 ? 59  MET A CG   2  
ATOM 3278  S SD   . MET A 1 59  ? 124.013 16.400  6.922   1.00 0.00 ? 59  MET A SD   2  
ATOM 3279  C CE   . MET A 1 59  ? 125.538 17.330  7.078   1.00 0.00 ? 59  MET A CE   2  
ATOM 3280  H H    . MET A 1 59  ? 126.168 14.000  10.874  1.00 0.00 ? 59  MET A H    2  
ATOM 3281  H HA   . MET A 1 59  ? 124.998 12.488  8.912   1.00 0.00 ? 59  MET A HA   2  
ATOM 3282  H HB2  . MET A 1 59  ? 124.442 14.829  9.378   1.00 0.00 ? 59  MET A HB2  2  
ATOM 3283  H HB3  . MET A 1 59  ? 125.996 15.330  8.732   1.00 0.00 ? 59  MET A HB3  2  
ATOM 3284  H HG2  . MET A 1 59  ? 125.324 14.456  6.524   1.00 0.00 ? 59  MET A HG2  2  
ATOM 3285  H HG3  . MET A 1 59  ? 123.743 14.052  7.195   1.00 0.00 ? 59  MET A HG3  2  
ATOM 3286  H HE1  . MET A 1 59  ? 125.925 17.224  8.080   1.00 0.00 ? 59  MET A HE1  2  
ATOM 3287  H HE2  . MET A 1 59  ? 125.345 18.373  6.875   1.00 0.00 ? 59  MET A HE2  2  
ATOM 3288  H HE3  . MET A 1 59  ? 126.262 16.954  6.371   1.00 0.00 ? 59  MET A HE3  2  
ATOM 3289  N N    . GLN A 1 60  ? 127.989 13.509  8.040   1.00 0.00 ? 60  GLN A N    2  
ATOM 3290  C CA   . GLN A 1 60  ? 129.122 13.254  7.150   1.00 0.00 ? 60  GLN A CA   2  
ATOM 3291  C C    . GLN A 1 60  ? 129.605 11.815  7.305   1.00 0.00 ? 60  GLN A C    2  
ATOM 3292  O O    . GLN A 1 60  ? 129.853 11.115  6.318   1.00 0.00 ? 60  GLN A O    2  
ATOM 3293  C CB   . GLN A 1 60  ? 130.263 14.230  7.449   1.00 0.00 ? 60  GLN A CB   2  
ATOM 3294  C CG   . GLN A 1 60  ? 129.924 15.681  7.127   1.00 0.00 ? 60  GLN A CG   2  
ATOM 3295  C CD   . GLN A 1 60  ? 130.998 16.648  7.589   1.00 0.00 ? 60  GLN A CD   2  
ATOM 3296  O OE1  . GLN A 1 60  ? 131.919 16.984  6.843   1.00 0.00 ? 60  GLN A OE1  2  
ATOM 3297  N NE2  . GLN A 1 60  ? 130.890 17.093  8.829   1.00 0.00 ? 60  GLN A NE2  2  
ATOM 3298  H H    . GLN A 1 60  ? 128.066 14.190  8.737   1.00 0.00 ? 60  GLN A H    2  
ATOM 3299  H HA   . GLN A 1 60  ? 128.786 13.403  6.132   1.00 0.00 ? 60  GLN A HA   2  
ATOM 3300  H HB2  . GLN A 1 60  ? 130.508 14.165  8.500   1.00 0.00 ? 60  GLN A HB2  2  
ATOM 3301  H HB3  . GLN A 1 60  ? 131.128 13.944  6.871   1.00 0.00 ? 60  GLN A HB3  2  
ATOM 3302  H HG2  . GLN A 1 60  ? 129.807 15.781  6.057   1.00 0.00 ? 60  GLN A HG2  2  
ATOM 3303  H HG3  . GLN A 1 60  ? 128.994 15.937  7.613   1.00 0.00 ? 60  GLN A HG3  2  
ATOM 3304  H HE21 . GLN A 1 60  ? 130.135 16.777  9.368   1.00 0.00 ? 60  GLN A HE21 2  
ATOM 3305  H HE22 . GLN A 1 60  ? 131.573 17.713  9.162   1.00 0.00 ? 60  GLN A HE22 2  
ATOM 3306  N N    . GLU A 1 61  ? 129.719 11.380  8.554   1.00 0.00 ? 61  GLU A N    2  
ATOM 3307  C CA   . GLU A 1 61  ? 130.112 10.008  8.867   1.00 0.00 ? 61  GLU A CA   2  
ATOM 3308  C C    . GLU A 1 61  ? 129.105 9.014   8.294   1.00 0.00 ? 61  GLU A C    2  
ATOM 3309  O O    . GLU A 1 61  ? 129.469 7.922   7.858   1.00 0.00 ? 61  GLU A O    2  
ATOM 3310  C CB   . GLU A 1 61  ? 130.227 9.818   10.384  1.00 0.00 ? 61  GLU A CB   2  
ATOM 3311  C CG   . GLU A 1 61  ? 131.315 10.664  11.029  1.00 0.00 ? 61  GLU A CG   2  
ATOM 3312  C CD   . GLU A 1 61  ? 132.694 10.377  10.459  1.00 0.00 ? 61  GLU A CD   2  
ATOM 3313  O OE1  . GLU A 1 61  ? 133.226 9.275   10.714  1.00 0.00 ? 61  GLU A OE1  2  
ATOM 3314  O OE2  . GLU A 1 61  ? 133.249 11.247  9.755   1.00 0.00 ? 61  GLU A OE2  2  
ATOM 3315  H H    . GLU A 1 61  ? 129.536 12.002  9.290   1.00 0.00 ? 61  GLU A H    2  
ATOM 3316  H HA   . GLU A 1 61  ? 131.077 9.827   8.416   1.00 0.00 ? 61  GLU A HA   2  
ATOM 3317  H HB2  . GLU A 1 61  ? 129.281 10.078  10.840  1.00 0.00 ? 61  GLU A HB2  2  
ATOM 3318  H HB3  . GLU A 1 61  ? 130.439 8.778   10.590  1.00 0.00 ? 61  GLU A HB3  2  
ATOM 3319  H HG2  . GLU A 1 61  ? 131.083 11.708  10.872  1.00 0.00 ? 61  GLU A HG2  2  
ATOM 3320  H HG3  . GLU A 1 61  ? 131.330 10.459  12.091  1.00 0.00 ? 61  GLU A HG3  2  
ATOM 3321  N N    . LYS A 1 62  ? 127.840 9.412   8.285   1.00 0.00 ? 62  LYS A N    2  
ATOM 3322  C CA   . LYS A 1 62  ? 126.769 8.571   7.772   1.00 0.00 ? 62  LYS A CA   2  
ATOM 3323  C C    . LYS A 1 62  ? 126.861 8.478   6.252   1.00 0.00 ? 62  LYS A C    2  
ATOM 3324  O O    . LYS A 1 62  ? 126.486 7.465   5.659   1.00 0.00 ? 62  LYS A O    2  
ATOM 3325  C CB   . LYS A 1 62  ? 125.408 9.146   8.189   1.00 0.00 ? 62  LYS A CB   2  
ATOM 3326  C CG   . LYS A 1 62  ? 124.227 8.206   7.957   1.00 0.00 ? 62  LYS A CG   2  
ATOM 3327  C CD   . LYS A 1 62  ? 124.314 6.965   8.843   1.00 0.00 ? 62  LYS A CD   2  
ATOM 3328  C CE   . LYS A 1 62  ? 123.110 6.049   8.665   1.00 0.00 ? 62  LYS A CE   2  
ATOM 3329  N NZ   . LYS A 1 62  ? 123.214 4.836   9.518   1.00 0.00 ? 62  LYS A NZ   2  
ATOM 3330  H H    . LYS A 1 62  ? 127.620 10.299  8.638   1.00 0.00 ? 62  LYS A H    2  
ATOM 3331  H HA   . LYS A 1 62  ? 126.884 7.581   8.196   1.00 0.00 ? 62  LYS A HA   2  
ATOM 3332  H HB2  . LYS A 1 62  ? 125.443 9.387   9.242   1.00 0.00 ? 62  LYS A HB2  2  
ATOM 3333  H HB3  . LYS A 1 62  ? 125.230 10.055  7.631   1.00 0.00 ? 62  LYS A HB3  2  
ATOM 3334  H HG2  . LYS A 1 62  ? 123.310 8.733   8.182   1.00 0.00 ? 62  LYS A HG2  2  
ATOM 3335  H HG3  . LYS A 1 62  ? 124.221 7.899   6.920   1.00 0.00 ? 62  LYS A HG3  2  
ATOM 3336  H HD2  . LYS A 1 62  ? 125.209 6.415   8.589   1.00 0.00 ? 62  LYS A HD2  2  
ATOM 3337  H HD3  . LYS A 1 62  ? 124.367 7.278   9.877   1.00 0.00 ? 62  LYS A HD3  2  
ATOM 3338  H HE2  . LYS A 1 62  ? 122.214 6.591   8.935   1.00 0.00 ? 62  LYS A HE2  2  
ATOM 3339  H HE3  . LYS A 1 62  ? 123.049 5.747   7.629   1.00 0.00 ? 62  LYS A HE3  2  
ATOM 3340  H HZ1  . LYS A 1 62  ? 122.416 4.194   9.336   1.00 0.00 ? 62  LYS A HZ1  2  
ATOM 3341  H HZ2  . LYS A 1 62  ? 123.205 5.102   10.524  1.00 0.00 ? 62  LYS A HZ2  2  
ATOM 3342  H HZ3  . LYS A 1 62  ? 124.100 4.332   9.314   1.00 0.00 ? 62  LYS A HZ3  2  
ATOM 3343  N N    . ALA A 1 63  ? 127.391 9.534   5.633   1.00 0.00 ? 63  ALA A N    2  
ATOM 3344  C CA   . ALA A 1 63  ? 127.517 9.593   4.180   1.00 0.00 ? 63  ALA A CA   2  
ATOM 3345  C C    . ALA A 1 63  ? 128.518 8.552   3.708   1.00 0.00 ? 63  ALA A C    2  
ATOM 3346  O O    . ALA A 1 63  ? 128.195 7.677   2.902   1.00 0.00 ? 63  ALA A O    2  
ATOM 3347  C CB   . ALA A 1 63  ? 127.949 10.986  3.728   1.00 0.00 ? 63  ALA A CB   2  
ATOM 3348  H H    . ALA A 1 63  ? 127.727 10.284  6.173   1.00 0.00 ? 63  ALA A H    2  
ATOM 3349  H HA   . ALA A 1 63  ? 126.548 9.378   3.748   1.00 0.00 ? 63  ALA A HA   2  
ATOM 3350  H HB1  . ALA A 1 63  ? 128.935 11.203  4.116   1.00 0.00 ? 63  ALA A HB1  2  
ATOM 3351  H HB2  . ALA A 1 63  ? 127.251 11.723  4.095   1.00 0.00 ? 63  ALA A HB2  2  
ATOM 3352  H HB3  . ALA A 1 63  ? 127.974 11.026  2.647   1.00 0.00 ? 63  ALA A HB3  2  
ATOM 3353  N N    . LYS A 1 64  ? 129.731 8.650   4.241   1.00 0.00 ? 64  LYS A N    2  
ATOM 3354  C CA   . LYS A 1 64  ? 130.801 7.711   3.923   1.00 0.00 ? 64  LYS A CA   2  
ATOM 3355  C C    . LYS A 1 64  ? 130.395 6.291   4.315   1.00 0.00 ? 64  LYS A C    2  
ATOM 3356  O O    . LYS A 1 64  ? 130.730 5.326   3.625   1.00 0.00 ? 64  LYS A O    2  
ATOM 3357  C CB   . LYS A 1 64  ? 132.092 8.128   4.646   1.00 0.00 ? 64  LYS A CB   2  
ATOM 3358  C CG   . LYS A 1 64  ? 131.938 8.227   6.162   1.00 0.00 ? 64  LYS A CG   2  
ATOM 3359  C CD   . LYS A 1 64  ? 133.139 8.889   6.830   1.00 0.00 ? 64  LYS A CD   2  
ATOM 3360  C CE   . LYS A 1 64  ? 134.420 8.086   6.630   1.00 0.00 ? 64  LYS A CE   2  
ATOM 3361  N NZ   . LYS A 1 64  ? 135.596 8.740   7.265   1.00 0.00 ? 64  LYS A NZ   2  
ATOM 3362  H H    . LYS A 1 64  ? 129.910 9.378   4.876   1.00 0.00 ? 64  LYS A H    2  
ATOM 3363  H HA   . LYS A 1 64  ? 130.968 7.746   2.854   1.00 0.00 ? 64  LYS A HA   2  
ATOM 3364  H HB2  . LYS A 1 64  ? 132.864 7.404   4.428   1.00 0.00 ? 64  LYS A HB2  2  
ATOM 3365  H HB3  . LYS A 1 64  ? 132.403 9.094   4.273   1.00 0.00 ? 64  LYS A HB3  2  
ATOM 3366  H HG2  . LYS A 1 64  ? 131.054 8.809   6.385   1.00 0.00 ? 64  LYS A HG2  2  
ATOM 3367  H HG3  . LYS A 1 64  ? 131.818 7.230   6.565   1.00 0.00 ? 64  LYS A HG3  2  
ATOM 3368  H HD2  . LYS A 1 64  ? 133.271 9.874   6.406   1.00 0.00 ? 64  LYS A HD2  2  
ATOM 3369  H HD3  . LYS A 1 64  ? 132.940 8.979   7.889   1.00 0.00 ? 64  LYS A HD3  2  
ATOM 3370  H HE2  . LYS A 1 64  ? 134.288 7.107   7.065   1.00 0.00 ? 64  LYS A HE2  2  
ATOM 3371  H HE3  . LYS A 1 64  ? 134.606 7.985   5.570   1.00 0.00 ? 64  LYS A HE3  2  
ATOM 3372  H HZ1  . LYS A 1 64  ? 135.509 8.713   8.300   1.00 0.00 ? 64  LYS A HZ1  2  
ATOM 3373  H HZ2  . LYS A 1 64  ? 135.659 9.732   6.962   1.00 0.00 ? 64  LYS A HZ2  2  
ATOM 3374  H HZ3  . LYS A 1 64  ? 136.473 8.253   6.987   1.00 0.00 ? 64  LYS A HZ3  2  
ATOM 3375  N N    . GLU A 1 65  ? 129.649 6.180   5.416   1.00 0.00 ? 65  GLU A N    2  
ATOM 3376  C CA   . GLU A 1 65  ? 129.165 4.892   5.901   1.00 0.00 ? 65  GLU A CA   2  
ATOM 3377  C C    . GLU A 1 65  ? 128.292 4.212   4.847   1.00 0.00 ? 65  GLU A C    2  
ATOM 3378  O O    . GLU A 1 65  ? 128.710 3.234   4.223   1.00 0.00 ? 65  GLU A O    2  
ATOM 3379  C CB   . GLU A 1 65  ? 128.373 5.070   7.205   1.00 0.00 ? 65  GLU A CB   2  
ATOM 3380  C CG   . GLU A 1 65  ? 127.855 3.762   7.797   1.00 0.00 ? 65  GLU A CG   2  
ATOM 3381  C CD   . GLU A 1 65  ? 126.988 3.974   9.028   1.00 0.00 ? 65  GLU A CD   2  
ATOM 3382  O OE1  . GLU A 1 65  ? 127.545 4.195   10.125  1.00 0.00 ? 65  GLU A OE1  2  
ATOM 3383  O OE2  . GLU A 1 65  ? 125.747 3.913   8.909   1.00 0.00 ? 65  GLU A OE2  2  
ATOM 3384  H H    . GLU A 1 65  ? 129.424 6.991   5.920   1.00 0.00 ? 65  GLU A H    2  
ATOM 3385  H HA   . GLU A 1 65  ? 130.026 4.268   6.097   1.00 0.00 ? 65  GLU A HA   2  
ATOM 3386  H HB2  . GLU A 1 65  ? 129.011 5.544   7.938   1.00 0.00 ? 65  GLU A HB2  2  
ATOM 3387  H HB3  . GLU A 1 65  ? 127.525 5.715   7.013   1.00 0.00 ? 65  GLU A HB3  2  
ATOM 3388  H HG2  . GLU A 1 65  ? 127.270 3.250   7.046   1.00 0.00 ? 65  GLU A HG2  2  
ATOM 3389  H HG3  . GLU A 1 65  ? 128.701 3.147   8.070   1.00 0.00 ? 65  GLU A HG3  2  
ATOM 3390  N N    . ILE A 1 66  ? 127.093 4.753   4.624   1.00 0.00 ? 66  ILE A N    2  
ATOM 3391  C CA   . ILE A 1 66  ? 126.129 4.131   3.717   1.00 0.00 ? 66  ILE A CA   2  
ATOM 3392  C C    . ILE A 1 66  ? 126.700 4.012   2.304   1.00 0.00 ? 66  ILE A C    2  
ATOM 3393  O O    . ILE A 1 66  ? 126.390 3.065   1.577   1.00 0.00 ? 66  ILE A O    2  
ATOM 3394  C CB   . ILE A 1 66  ? 124.780 4.899   3.679   1.00 0.00 ? 66  ILE A CB   2  
ATOM 3395  C CG1  . ILE A 1 66  ? 124.973 6.346   3.191   1.00 0.00 ? 66  ILE A CG1  2  
ATOM 3396  C CG2  . ILE A 1 66  ? 124.118 4.877   5.056   1.00 0.00 ? 66  ILE A CG2  2  
ATOM 3397  C CD1  . ILE A 1 66  ? 123.696 7.166   3.187   1.00 0.00 ? 66  ILE A CD1  2  
ATOM 3398  H H    . ILE A 1 66  ? 126.854 5.592   5.077   1.00 0.00 ? 66  ILE A H    2  
ATOM 3399  H HA   . ILE A 1 66  ? 125.933 3.134   4.089   1.00 0.00 ? 66  ILE A HA   2  
ATOM 3400  H HB   . ILE A 1 66  ? 124.127 4.383   2.990   1.00 0.00 ? 66  ILE A HB   2  
ATOM 3401  H HG12 . ILE A 1 66  ? 125.682 6.845   3.832   1.00 0.00 ? 66  ILE A HG12 2  
ATOM 3402  H HG13 . ILE A 1 66  ? 125.358 6.331   2.181   1.00 0.00 ? 66  ILE A HG13 2  
ATOM 3403  H HG21 . ILE A 1 66  ? 123.176 5.406   5.014   1.00 0.00 ? 66  ILE A HG21 2  
ATOM 3404  H HG22 . ILE A 1 66  ? 124.765 5.354   5.778   1.00 0.00 ? 66  ILE A HG22 2  
ATOM 3405  H HG23 . ILE A 1 66  ? 123.940 3.853   5.355   1.00 0.00 ? 66  ILE A HG23 2  
ATOM 3406  H HD11 . ILE A 1 66  ? 122.957 6.682   2.565   1.00 0.00 ? 66  ILE A HD11 2  
ATOM 3407  H HD12 . ILE A 1 66  ? 123.904 8.150   2.797   1.00 0.00 ? 66  ILE A HD12 2  
ATOM 3408  H HD13 . ILE A 1 66  ? 123.319 7.252   4.196   1.00 0.00 ? 66  ILE A HD13 2  
ATOM 3409  N N    . TYR A 1 67  ? 127.552 4.962   1.930   1.00 0.00 ? 67  TYR A N    2  
ATOM 3410  C CA   . TYR A 1 67  ? 128.215 4.929   0.631   1.00 0.00 ? 67  TYR A CA   2  
ATOM 3411  C C    . TYR A 1 67  ? 129.084 3.678   0.508   1.00 0.00 ? 67  TYR A C    2  
ATOM 3412  O O    . TYR A 1 67  ? 128.995 2.951   -0.476  1.00 0.00 ? 67  TYR A O    2  
ATOM 3413  C CB   . TYR A 1 67  ? 129.066 6.191   0.420   1.00 0.00 ? 67  TYR A CB   2  
ATOM 3414  C CG   . TYR A 1 67  ? 129.741 6.262   -0.942  1.00 0.00 ? 67  TYR A CG   2  
ATOM 3415  C CD1  . TYR A 1 67  ? 128.995 6.470   -2.098  1.00 0.00 ? 67  TYR A CD1  2  
ATOM 3416  C CD2  . TYR A 1 67  ? 131.121 6.120   -1.073  1.00 0.00 ? 67  TYR A CD2  2  
ATOM 3417  C CE1  . TYR A 1 67  ? 129.599 6.531   -3.338  1.00 0.00 ? 67  TYR A CE1  2  
ATOM 3418  C CE2  . TYR A 1 67  ? 131.731 6.182   -2.313  1.00 0.00 ? 67  TYR A CE2  2  
ATOM 3419  C CZ   . TYR A 1 67  ? 130.965 6.388   -3.441  1.00 0.00 ? 67  TYR A CZ   2  
ATOM 3420  O OH   . TYR A 1 67  ? 131.562 6.452   -4.679  1.00 0.00 ? 67  TYR A OH   2  
ATOM 3421  H H    . TYR A 1 67  ? 127.732 5.709   2.542   1.00 0.00 ? 67  TYR A H    2  
ATOM 3422  H HA   . TYR A 1 67  ? 127.446 4.893   -0.129  1.00 0.00 ? 67  TYR A HA   2  
ATOM 3423  H HB2  . TYR A 1 67  ? 128.433 7.062   0.520   1.00 0.00 ? 67  TYR A HB2  2  
ATOM 3424  H HB3  . TYR A 1 67  ? 129.836 6.228   1.179   1.00 0.00 ? 67  TYR A HB3  2  
ATOM 3425  H HD1  . TYR A 1 67  ? 127.924 6.588   -2.020  1.00 0.00 ? 67  TYR A HD1  2  
ATOM 3426  H HD2  . TYR A 1 67  ? 131.720 5.958   -0.188  1.00 0.00 ? 67  TYR A HD2  2  
ATOM 3427  H HE1  . TYR A 1 67  ? 128.998 6.691   -4.222  1.00 0.00 ? 67  TYR A HE1  2  
ATOM 3428  H HE2  . TYR A 1 67  ? 132.803 6.069   -2.394  1.00 0.00 ? 67  TYR A HE2  2  
ATOM 3429  H HH   . TYR A 1 67  ? 132.361 5.915   -4.681  1.00 0.00 ? 67  TYR A HH   2  
ATOM 3430  N N    . MET A 1 68  ? 129.903 3.417   1.525   1.00 0.00 ? 68  MET A N    2  
ATOM 3431  C CA   . MET A 1 68  ? 130.842 2.292   1.492   1.00 0.00 ? 68  MET A CA   2  
ATOM 3432  C C    . MET A 1 68  ? 130.187 0.996   1.966   1.00 0.00 ? 68  MET A C    2  
ATOM 3433  O O    . MET A 1 68  ? 130.795 -0.075  1.900   1.00 0.00 ? 68  MET A O    2  
ATOM 3434  C CB   . MET A 1 68  ? 132.077 2.599   2.348   1.00 0.00 ? 68  MET A CB   2  
ATOM 3435  C CG   . MET A 1 68  ? 132.895 3.777   1.835   1.00 0.00 ? 68  MET A CG   2  
ATOM 3436  S SD   . MET A 1 68  ? 133.532 3.514   0.166   1.00 0.00 ? 68  MET A SD   2  
ATOM 3437  C CE   . MET A 1 68  ? 134.567 2.071   0.414   1.00 0.00 ? 68  MET A CE   2  
ATOM 3438  H H    . MET A 1 68  ? 129.877 3.996   2.321   1.00 0.00 ? 68  MET A H    2  
ATOM 3439  H HA   . MET A 1 68  ? 131.158 2.158   0.466   1.00 0.00 ? 68  MET A HA   2  
ATOM 3440  H HB2  . MET A 1 68  ? 131.758 2.821   3.357   1.00 0.00 ? 68  MET A HB2  2  
ATOM 3441  H HB3  . MET A 1 68  ? 132.716 1.727   2.368   1.00 0.00 ? 68  MET A HB3  2  
ATOM 3442  H HG2  . MET A 1 68  ? 132.269 4.658   1.829   1.00 0.00 ? 68  MET A HG2  2  
ATOM 3443  H HG3  . MET A 1 68  ? 133.730 3.937   2.502   1.00 0.00 ? 68  MET A HG3  2  
ATOM 3444  H HE1  . MET A 1 68  ? 135.332 2.297   1.143   1.00 0.00 ? 68  MET A HE1  2  
ATOM 3445  H HE2  . MET A 1 68  ? 135.032 1.797   -0.522  1.00 0.00 ? 68  MET A HE2  2  
ATOM 3446  H HE3  . MET A 1 68  ? 133.962 1.250   0.769   1.00 0.00 ? 68  MET A HE3  2  
ATOM 3447  N N    . THR A 1 69  ? 128.954 1.092   2.451   1.00 0.00 ? 69  THR A N    2  
ATOM 3448  C CA   . THR A 1 69  ? 128.222 -0.083  2.919   1.00 0.00 ? 69  THR A CA   2  
ATOM 3449  C C    . THR A 1 69  ? 127.279 -0.614  1.838   1.00 0.00 ? 69  THR A C    2  
ATOM 3450  O O    . THR A 1 69  ? 127.103 -1.828  1.699   1.00 0.00 ? 69  THR A O    2  
ATOM 3451  C CB   . THR A 1 69  ? 127.412 0.238   4.198   1.00 0.00 ? 69  THR A CB   2  
ATOM 3452  O OG1  . THR A 1 69  ? 128.291 0.747   5.209   1.00 0.00 ? 69  THR A OG1  2  
ATOM 3453  C CG2  . THR A 1 69  ? 126.691 -0.998  4.730   1.00 0.00 ? 69  THR A CG2  2  
ATOM 3454  H H    . THR A 1 69  ? 128.531 1.974   2.507   1.00 0.00 ? 69  THR A H    2  
ATOM 3455  H HA   . THR A 1 69  ? 128.943 -0.853  3.161   1.00 0.00 ? 69  THR A HA   2  
ATOM 3456  H HB   . THR A 1 69  ? 126.675 0.994   3.961   1.00 0.00 ? 69  THR A HB   2  
ATOM 3457  H HG1  . THR A 1 69  ? 128.750 1.522   4.870   1.00 0.00 ? 69  THR A HG1  2  
ATOM 3458  H HG21 . THR A 1 69  ? 127.413 -1.769  4.956   1.00 0.00 ? 69  THR A HG21 2  
ATOM 3459  H HG22 . THR A 1 69  ? 125.998 -1.362  3.986   1.00 0.00 ? 69  THR A HG22 2  
ATOM 3460  H HG23 . THR A 1 69  ? 126.149 -0.739  5.629   1.00 0.00 ? 69  THR A HG23 2  
ATOM 3461  N N    . PHE A 1 70  ? 126.686 0.296   1.066   1.00 0.00 ? 70  PHE A N    2  
ATOM 3462  C CA   . PHE A 1 70  ? 125.671 -0.080  0.081   1.00 0.00 ? 70  PHE A CA   2  
ATOM 3463  C C    . PHE A 1 70  ? 126.124 0.246   -1.344  1.00 0.00 ? 70  PHE A C    2  
ATOM 3464  O O    . PHE A 1 70  ? 125.926 -0.551  -2.261  1.00 0.00 ? 70  PHE A O    2  
ATOM 3465  C CB   . PHE A 1 70  ? 124.344 0.634   0.382   1.00 0.00 ? 70  PHE A CB   2  
ATOM 3466  C CG   . PHE A 1 70  ? 123.841 0.432   1.795   1.00 0.00 ? 70  PHE A CG   2  
ATOM 3467  C CD1  . PHE A 1 70  ? 123.660 -0.844  2.310   1.00 0.00 ? 70  PHE A CD1  2  
ATOM 3468  C CD2  . PHE A 1 70  ? 123.553 1.522   2.607   1.00 0.00 ? 70  PHE A CD2  2  
ATOM 3469  C CE1  . PHE A 1 70  ? 123.202 -1.028  3.603   1.00 0.00 ? 70  PHE A CE1  2  
ATOM 3470  C CE2  . PHE A 1 70  ? 123.096 1.342   3.898   1.00 0.00 ? 70  PHE A CE2  2  
ATOM 3471  C CZ   . PHE A 1 70  ? 122.920 0.066   4.397   1.00 0.00 ? 70  PHE A CZ   2  
ATOM 3472  H H    . PHE A 1 70  ? 126.939 1.237   1.155   1.00 0.00 ? 70  PHE A H    2  
ATOM 3473  H HA   . PHE A 1 70  ? 125.514 -1.148  0.155   1.00 0.00 ? 70  PHE A HA   2  
ATOM 3474  H HB2  . PHE A 1 70  ? 124.472 1.696   0.224   1.00 0.00 ? 70  PHE A HB2  2  
ATOM 3475  H HB3  . PHE A 1 70  ? 123.584 0.268   -0.296  1.00 0.00 ? 70  PHE A HB3  2  
ATOM 3476  H HD1  . PHE A 1 70  ? 123.879 -1.703  1.691   1.00 0.00 ? 70  PHE A HD1  2  
ATOM 3477  H HD2  . PHE A 1 70  ? 123.688 2.522   2.220   1.00 0.00 ? 70  PHE A HD2  2  
ATOM 3478  H HE1  . PHE A 1 70  ? 123.066 -2.027  3.991   1.00 0.00 ? 70  PHE A HE1  2  
ATOM 3479  H HE2  . PHE A 1 70  ? 122.877 2.199   4.518   1.00 0.00 ? 70  PHE A HE2  2  
ATOM 3480  H HZ   . PHE A 1 70  ? 122.563 -0.077  5.407   1.00 0.00 ? 70  PHE A HZ   2  
ATOM 3481  N N    . LEU A 1 71  ? 126.722 1.421   -1.535  1.00 0.00 ? 71  LEU A N    2  
ATOM 3482  C CA   . LEU A 1 71  ? 127.124 1.863   -2.872  1.00 0.00 ? 71  LEU A CA   2  
ATOM 3483  C C    . LEU A 1 71  ? 128.569 1.456   -3.173  1.00 0.00 ? 71  LEU A C    2  
ATOM 3484  O O    . LEU A 1 71  ? 128.824 0.317   -3.571  1.00 0.00 ? 71  LEU A O    2  
ATOM 3485  C CB   . LEU A 1 71  ? 126.946 3.385   -3.040  1.00 0.00 ? 71  LEU A CB   2  
ATOM 3486  C CG   . LEU A 1 71  ? 125.493 3.901   -3.050  1.00 0.00 ? 71  LEU A CG   2  
ATOM 3487  C CD1  . LEU A 1 71  ? 124.825 3.700   -1.692  1.00 0.00 ? 71  LEU A CD1  2  
ATOM 3488  C CD2  . LEU A 1 71  ? 125.449 5.372   -3.460  1.00 0.00 ? 71  LEU A CD2  2  
ATOM 3489  H H    . LEU A 1 71  ? 126.907 1.997   -0.765  1.00 0.00 ? 71  LEU A H    2  
ATOM 3490  H HA   . LEU A 1 71  ? 126.480 1.363   -3.585  1.00 0.00 ? 71  LEU A HA   2  
ATOM 3491  H HB2  . LEU A 1 71  ? 127.472 3.876   -2.233  1.00 0.00 ? 71  LEU A HB2  2  
ATOM 3492  H HB3  . LEU A 1 71  ? 127.410 3.676   -3.973  1.00 0.00 ? 71  LEU A HB3  2  
ATOM 3493  H HG   . LEU A 1 71  ? 124.927 3.338   -3.779  1.00 0.00 ? 71  LEU A HG   2  
ATOM 3494  H HD11 . LEU A 1 71  ? 124.814 2.648   -1.448  1.00 0.00 ? 71  LEU A HD11 2  
ATOM 3495  H HD12 . LEU A 1 71  ? 123.810 4.069   -1.731  1.00 0.00 ? 71  LEU A HD12 2  
ATOM 3496  H HD13 . LEU A 1 71  ? 125.375 4.240   -0.934  1.00 0.00 ? 71  LEU A HD13 2  
ATOM 3497  H HD21 . LEU A 1 71  ? 125.878 5.485   -4.445  1.00 0.00 ? 71  LEU A HD21 2  
ATOM 3498  H HD22 . LEU A 1 71  ? 126.012 5.963   -2.752  1.00 0.00 ? 71  LEU A HD22 2  
ATOM 3499  H HD23 . LEU A 1 71  ? 124.423 5.712   -3.475  1.00 0.00 ? 71  LEU A HD23 2  
ATOM 3500  N N    . SER A 1 72  ? 129.511 2.379   -2.946  1.00 0.00 ? 72  SER A N    2  
ATOM 3501  C CA   . SER A 1 72  ? 130.916 2.158   -3.282  1.00 0.00 ? 72  SER A CA   2  
ATOM 3502  C C    . SER A 1 72  ? 131.047 1.685   -4.739  1.00 0.00 ? 72  SER A C    2  
ATOM 3503  O O    . SER A 1 72  ? 130.139 1.893   -5.546  1.00 0.00 ? 72  SER A O    2  
ATOM 3504  C CB   . SER A 1 72  ? 131.521 1.141   -2.302  1.00 0.00 ? 72  SER A CB   2  
ATOM 3505  O OG   . SER A 1 72  ? 132.905 0.937   -2.534  1.00 0.00 ? 72  SER A OG   2  
ATOM 3506  H H    . SER A 1 72  ? 129.255 3.218   -2.517  1.00 0.00 ? 72  SER A H    2  
ATOM 3507  H HA   . SER A 1 72  ? 131.433 3.102   -3.177  1.00 0.00 ? 72  SER A HA   2  
ATOM 3508  H HB2  . SER A 1 72  ? 131.393 1.502   -1.292  1.00 0.00 ? 72  SER A HB2  2  
ATOM 3509  H HB3  . SER A 1 72  ? 131.008 0.195   -2.409  1.00 0.00 ? 72  SER A HB3  2  
ATOM 3510  H HG   . SER A 1 72  ? 133.385 1.759   -2.373  1.00 0.00 ? 72  SER A HG   2  
ATOM 3511  N N    . SER A 1 73  ? 132.176 1.082   -5.083  1.00 0.00 ? 73  SER A N    2  
ATOM 3512  C CA   . SER A 1 73  ? 132.369 0.514   -6.414  1.00 0.00 ? 73  SER A CA   2  
ATOM 3513  C C    . SER A 1 73  ? 132.390 -1.014  -6.335  1.00 0.00 ? 73  SER A C    2  
ATOM 3514  O O    . SER A 1 73  ? 132.634 -1.695  -7.336  1.00 0.00 ? 73  SER A O    2  
ATOM 3515  C CB   . SER A 1 73  ? 133.674 1.042   -7.021  1.00 0.00 ? 73  SER A CB   2  
ATOM 3516  O OG   . SER A 1 73  ? 133.720 2.462   -6.972  1.00 0.00 ? 73  SER A OG   2  
ATOM 3517  H H    . SER A 1 73  ? 132.906 1.018   -4.429  1.00 0.00 ? 73  SER A H    2  
ATOM 3518  H HA   . SER A 1 73  ? 131.539 0.820   -7.038  1.00 0.00 ? 73  SER A HA   2  
ATOM 3519  H HB2  . SER A 1 73  ? 134.514 0.650   -6.467  1.00 0.00 ? 73  SER A HB2  2  
ATOM 3520  H HB3  . SER A 1 73  ? 133.746 0.727   -8.052  1.00 0.00 ? 73  SER A HB3  2  
ATOM 3521  H HG   . SER A 1 73  ? 133.913 2.740   -6.066  1.00 0.00 ? 73  SER A HG   2  
ATOM 3522  N N    . LYS A 1 74  ? 132.104 -1.538  -5.138  1.00 0.00 ? 74  LYS A N    2  
ATOM 3523  C CA   . LYS A 1 74  ? 132.168 -2.964  -4.855  1.00 0.00 ? 74  LYS A CA   2  
ATOM 3524  C C    . LYS A 1 74  ? 131.898 -3.162  -3.372  1.00 0.00 ? 74  LYS A C    2  
ATOM 3525  O O    . LYS A 1 74  ? 130.862 -3.707  -2.991  1.00 0.00 ? 74  LYS A O    2  
ATOM 3526  C CB   . LYS A 1 74  ? 133.548 -3.540  -5.221  1.00 0.00 ? 74  LYS A CB   2  
ATOM 3527  C CG   . LYS A 1 74  ? 133.685 -5.040  -4.973  1.00 0.00 ? 74  LYS A CG   2  
ATOM 3528  C CD   . LYS A 1 74  ? 135.098 -5.531  -5.276  1.00 0.00 ? 74  LYS A CD   2  
ATOM 3529  C CE   . LYS A 1 74  ? 135.240 -7.028  -5.041  1.00 0.00 ? 74  LYS A CE   2  
ATOM 3530  N NZ   . LYS A 1 74  ? 136.632 -7.493  -5.274  1.00 0.00 ? 74  LYS A NZ   2  
ATOM 3531  H H    . LYS A 1 74  ? 131.813 -0.941  -4.413  1.00 0.00 ? 74  LYS A H    2  
ATOM 3532  H HA   . LYS A 1 74  ? 131.399 -3.461  -5.431  1.00 0.00 ? 74  LYS A HA   2  
ATOM 3533  H HB2  . LYS A 1 74  ? 133.733 -3.353  -6.270  1.00 0.00 ? 74  LYS A HB2  2  
ATOM 3534  H HB3  . LYS A 1 74  ? 134.302 -3.029  -4.639  1.00 0.00 ? 74  LYS A HB3  2  
ATOM 3535  H HG2  . LYS A 1 74  ? 133.458 -5.247  -3.937  1.00 0.00 ? 74  LYS A HG2  2  
ATOM 3536  H HG3  . LYS A 1 74  ? 132.986 -5.566  -5.608  1.00 0.00 ? 74  LYS A HG3  2  
ATOM 3537  H HD2  . LYS A 1 74  ? 135.331 -5.317  -6.310  1.00 0.00 ? 74  LYS A HD2  2  
ATOM 3538  H HD3  . LYS A 1 74  ? 135.795 -5.008  -4.635  1.00 0.00 ? 74  LYS A HD3  2  
ATOM 3539  H HE2  . LYS A 1 74  ? 134.964 -7.250  -4.021  1.00 0.00 ? 74  LYS A HE2  2  
ATOM 3540  H HE3  . LYS A 1 74  ? 134.577 -7.553  -5.716  1.00 0.00 ? 74  LYS A HE3  2  
ATOM 3541  H HZ1  . LYS A 1 74  ? 137.282 -7.021  -4.615  1.00 0.00 ? 74  LYS A HZ1  2  
ATOM 3542  H HZ2  . LYS A 1 74  ? 136.926 -7.274  -6.248  1.00 0.00 ? 74  LYS A HZ2  2  
ATOM 3543  H HZ3  . LYS A 1 74  ? 136.695 -8.520  -5.130  1.00 0.00 ? 74  LYS A HZ3  2  
ATOM 3544  N N    . ALA A 1 75  ? 132.838 -2.670  -2.553  1.00 0.00 ? 75  ALA A N    2  
ATOM 3545  C CA   . ALA A 1 75  ? 132.726 -2.684  -1.092  1.00 0.00 ? 75  ALA A CA   2  
ATOM 3546  C C    . ALA A 1 75  ? 132.641 -4.104  -0.539  1.00 0.00 ? 75  ALA A C    2  
ATOM 3547  O O    . ALA A 1 75  ? 133.601 -4.629  0.028   1.00 0.00 ? 75  ALA A O    2  
ATOM 3548  C CB   . ALA A 1 75  ? 131.512 -1.871  -0.643  1.00 0.00 ? 75  ALA A CB   2  
ATOM 3549  H H    . ALA A 1 75  ? 133.644 -2.278  -2.951  1.00 0.00 ? 75  ALA A H    2  
ATOM 3550  H HA   . ALA A 1 75  ? 133.610 -2.207  -0.691  1.00 0.00 ? 75  ALA A HA   2  
ATOM 3551  H HB1  . ALA A 1 75  ? 131.431 -1.905  0.434   1.00 0.00 ? 75  ALA A HB1  2  
ATOM 3552  H HB2  . ALA A 1 75  ? 130.614 -2.283  -1.085  1.00 0.00 ? 75  ALA A HB2  2  
ATOM 3553  H HB3  . ALA A 1 75  ? 131.628 -0.846  -0.960  1.00 0.00 ? 75  ALA A HB3  2  
ATOM 3554  N N    . SER A 1 76  ? 131.487 -4.708  -0.736  1.00 0.00 ? 76  SER A N    2  
ATOM 3555  C CA   . SER A 1 76  ? 131.154 -6.010  -0.182  1.00 0.00 ? 76  SER A CA   2  
ATOM 3556  C C    . SER A 1 76  ? 129.806 -6.463  -0.732  1.00 0.00 ? 76  SER A C    2  
ATOM 3557  O O    . SER A 1 76  ? 129.554 -7.658  -0.895  1.00 0.00 ? 76  SER A O    2  
ATOM 3558  C CB   . SER A 1 76  ? 131.123 -5.932  1.353   1.00 0.00 ? 76  SER A CB   2  
ATOM 3559  O OG   . SER A 1 76  ? 130.451 -4.757  1.790   1.00 0.00 ? 76  SER A OG   2  
ATOM 3560  H H    . SER A 1 76  ? 130.827 -4.260  -1.292  1.00 0.00 ? 76  SER A H    2  
ATOM 3561  H HA   . SER A 1 76  ? 131.912 -6.713  -0.493  1.00 0.00 ? 76  SER A HA   2  
ATOM 3562  H HB2  . SER A 1 76  ? 130.609 -6.796  1.750   1.00 0.00 ? 76  SER A HB2  2  
ATOM 3563  H HB3  . SER A 1 76  ? 132.135 -5.912  1.731   1.00 0.00 ? 76  SER A HB3  2  
ATOM 3564  H HG   . SER A 1 76  ? 129.691 -5.003  2.332   1.00 0.00 ? 76  SER A HG   2  
ATOM 3565  N N    . SER A 1 77  ? 128.958 -5.489  -1.051  1.00 0.00 ? 77  SER A N    2  
ATOM 3566  C CA   . SER A 1 77  ? 127.639 -5.757  -1.594  1.00 0.00 ? 77  SER A CA   2  
ATOM 3567  C C    . SER A 1 77  ? 127.077 -4.472  -2.187  1.00 0.00 ? 77  SER A C    2  
ATOM 3568  O O    . SER A 1 77  ? 126.405 -3.701  -1.501  1.00 0.00 ? 77  SER A O    2  
ATOM 3569  C CB   . SER A 1 77  ? 126.705 -6.311  -0.506  1.00 0.00 ? 77  SER A CB   2  
ATOM 3570  O OG   . SER A 1 77  ? 126.640 -5.433  0.608   1.00 0.00 ? 77  SER A OG   2  
ATOM 3571  H H    . SER A 1 77  ? 129.230 -4.552  -0.926  1.00 0.00 ? 77  SER A H    2  
ATOM 3572  H HA   . SER A 1 77  ? 127.748 -6.491  -2.381  1.00 0.00 ? 77  SER A HA   2  
ATOM 3573  H HB2  . SER A 1 77  ? 125.711 -6.430  -0.911  1.00 0.00 ? 77  SER A HB2  2  
ATOM 3574  H HB3  . SER A 1 77  ? 127.074 -7.269  -0.171  1.00 0.00 ? 77  SER A HB3  2  
ATOM 3575  H HG   . SER A 1 77  ? 126.366 -4.555  0.305   1.00 0.00 ? 77  SER A HG   2  
ATOM 3576  N N    . GLN A 1 78  ? 127.402 -4.220  -3.447  1.00 0.00 ? 78  GLN A N    2  
ATOM 3577  C CA   . GLN A 1 78  ? 126.998 -2.994  -4.104  1.00 0.00 ? 78  GLN A CA   2  
ATOM 3578  C C    . GLN A 1 78  ? 125.528 -3.065  -4.491  1.00 0.00 ? 78  GLN A C    2  
ATOM 3579  O O    . GLN A 1 78  ? 125.015 -4.127  -4.856  1.00 0.00 ? 78  GLN A O    2  
ATOM 3580  C CB   . GLN A 1 78  ? 127.857 -2.733  -5.345  1.00 0.00 ? 78  GLN A CB   2  
ATOM 3581  C CG   . GLN A 1 78  ? 127.598 -1.378  -5.994  1.00 0.00 ? 78  GLN A CG   2  
ATOM 3582  C CD   . GLN A 1 78  ? 128.531 -1.085  -7.155  1.00 0.00 ? 78  GLN A CD   2  
ATOM 3583  O OE1  . GLN A 1 78  ? 128.962 -1.985  -7.876  1.00 0.00 ? 78  GLN A OE1  2  
ATOM 3584  N NE2  . GLN A 1 78  ? 128.870 0.181   -7.326  1.00 0.00 ? 78  GLN A NE2  2  
ATOM 3585  H H    . GLN A 1 78  ? 127.918 -4.877  -3.948  1.00 0.00 ? 78  GLN A H    2  
ATOM 3586  H HA   . GLN A 1 78  ? 127.141 -2.180  -3.402  1.00 0.00 ? 78  GLN A HA   2  
ATOM 3587  H HB2  . GLN A 1 78  ? 128.898 -2.780  -5.064  1.00 0.00 ? 78  GLN A HB2  2  
ATOM 3588  H HB3  . GLN A 1 78  ? 127.654 -3.502  -6.075  1.00 0.00 ? 78  GLN A HB3  2  
ATOM 3589  H HG2  . GLN A 1 78  ? 126.581 -1.359  -6.360  1.00 0.00 ? 78  GLN A HG2  2  
ATOM 3590  H HG3  . GLN A 1 78  ? 127.722 -0.607  -5.247  1.00 0.00 ? 78  GLN A HG3  2  
ATOM 3591  H HE21 . GLN A 1 78  ? 128.507 0.846   -6.705  1.00 0.00 ? 78  GLN A HE21 2  
ATOM 3592  H HE22 . GLN A 1 78  ? 129.470 0.403   -8.065  1.00 0.00 ? 78  GLN A HE22 2  
ATOM 3593  N N    . VAL A 1 79  ? 124.862 -1.933  -4.399  1.00 0.00 ? 79  VAL A N    2  
ATOM 3594  C CA   . VAL A 1 79  ? 123.455 -1.828  -4.757  1.00 0.00 ? 79  VAL A CA   2  
ATOM 3595  C C    . VAL A 1 79  ? 123.298 -1.695  -6.268  1.00 0.00 ? 79  VAL A C    2  
ATOM 3596  O O    . VAL A 1 79  ? 124.110 -1.051  -6.937  1.00 0.00 ? 79  VAL A O    2  
ATOM 3597  C CB   . VAL A 1 79  ? 122.768 -0.634  -4.040  1.00 0.00 ? 79  VAL A CB   2  
ATOM 3598  C CG1  . VAL A 1 79  ? 123.603 0.640   -4.166  1.00 0.00 ? 79  VAL A CG1  2  
ATOM 3599  C CG2  . VAL A 1 79  ? 121.352 -0.408  -4.574  1.00 0.00 ? 79  VAL A CG2  2  
ATOM 3600  H H    . VAL A 1 79  ? 125.339 -1.140  -4.088  1.00 0.00 ? 79  VAL A H    2  
ATOM 3601  H HA   . VAL A 1 79  ? 122.964 -2.740  -4.438  1.00 0.00 ? 79  VAL A HA   2  
ATOM 3602  H HB   . VAL A 1 79  ? 122.690 -0.881  -2.993  1.00 0.00 ? 79  VAL A HB   2  
ATOM 3603  H HG11 . VAL A 1 79  ? 124.554 0.498   -3.672  1.00 0.00 ? 79  VAL A HG11 2  
ATOM 3604  H HG12 . VAL A 1 79  ? 123.079 1.465   -3.704  1.00 0.00 ? 79  VAL A HG12 2  
ATOM 3605  H HG13 . VAL A 1 79  ? 123.771 0.860   -5.209  1.00 0.00 ? 79  VAL A HG13 2  
ATOM 3606  H HG21 . VAL A 1 79  ? 120.763 -1.302  -4.424  1.00 0.00 ? 79  VAL A HG21 2  
ATOM 3607  H HG22 . VAL A 1 79  ? 121.393 -0.178  -5.629  1.00 0.00 ? 79  VAL A HG22 2  
ATOM 3608  H HG23 . VAL A 1 79  ? 120.893 0.416   -4.045  1.00 0.00 ? 79  VAL A HG23 2  
ATOM 3609  N N    . ASN A 1 80  ? 122.252 -2.320  -6.796  1.00 0.00 ? 80  ASN A N    2  
ATOM 3610  C CA   . ASN A 1 80  ? 121.979 -2.302  -8.230  1.00 0.00 ? 80  ASN A CA   2  
ATOM 3611  C C    . ASN A 1 80  ? 121.503 -0.920  -8.663  1.00 0.00 ? 80  ASN A C    2  
ATOM 3612  O O    . ASN A 1 80  ? 120.305 -0.652  -8.714  1.00 0.00 ? 80  ASN A O    2  
ATOM 3613  C CB   . ASN A 1 80  ? 120.936 -3.370  -8.608  1.00 0.00 ? 80  ASN A CB   2  
ATOM 3614  C CG   . ASN A 1 80  ? 121.474 -4.787  -8.488  1.00 0.00 ? 80  ASN A CG   2  
ATOM 3615  O OD1  . ASN A 1 80  ? 122.027 -5.333  -9.443  1.00 0.00 ? 80  ASN A OD1  2  
ATOM 3616  N ND2  . ASN A 1 80  ? 121.300 -5.401  -7.328  1.00 0.00 ? 80  ASN A ND2  2  
ATOM 3617  H H    . ASN A 1 80  ? 121.639 -2.793  -6.199  1.00 0.00 ? 80  ASN A H    2  
ATOM 3618  H HA   . ASN A 1 80  ? 122.905 -2.522  -8.744  1.00 0.00 ? 80  ASN A HA   2  
ATOM 3619  H HB2  . ASN A 1 80  ? 120.080 -3.275  -7.955  1.00 0.00 ? 80  ASN A HB2  2  
ATOM 3620  H HB3  . ASN A 1 80  ? 120.619 -3.211  -9.630  1.00 0.00 ? 80  ASN A HB3  2  
ATOM 3621  H HD21 . ASN A 1 80  ? 120.834 -4.923  -6.614  1.00 0.00 ? 80  ASN A HD21 2  
ATOM 3622  H HD22 . ASN A 1 80  ? 121.653 -6.312  -7.231  1.00 0.00 ? 80  ASN A HD22 2  
ATOM 3623  N N    . VAL A 1 81  ? 122.455 -0.032  -8.925  1.00 0.00 ? 81  VAL A N    2  
ATOM 3624  C CA   . VAL A 1 81  ? 122.153 1.310   -9.392  1.00 0.00 ? 81  VAL A CA   2  
ATOM 3625  C C    . VAL A 1 81  ? 122.360 1.416   -10.899 1.00 0.00 ? 81  VAL A C    2  
ATOM 3626  O O    . VAL A 1 81  ? 122.750 0.447   -11.562 1.00 0.00 ? 81  VAL A O    2  
ATOM 3627  C CB   . VAL A 1 81  ? 123.032 2.369   -8.677  1.00 0.00 ? 81  VAL A CB   2  
ATOM 3628  C CG1  . VAL A 1 81  ? 122.717 2.412   -7.185  1.00 0.00 ? 81  VAL A CG1  2  
ATOM 3629  C CG2  . VAL A 1 81  ? 124.519 2.092   -8.912  1.00 0.00 ? 81  VAL A CG2  2  
ATOM 3630  H H    . VAL A 1 81  ? 123.390 -0.285  -8.794  1.00 0.00 ? 81  VAL A H    2  
ATOM 3631  H HA   . VAL A 1 81  ? 121.116 1.522   -9.168  1.00 0.00 ? 81  VAL A HA   2  
ATOM 3632  H HB   . VAL A 1 81  ? 122.800 3.341   -9.095  1.00 0.00 ? 81  VAL A HB   2  
ATOM 3633  H HG11 . VAL A 1 81  ? 121.682 2.691   -7.041  1.00 0.00 ? 81  VAL A HG11 2  
ATOM 3634  H HG12 . VAL A 1 81  ? 123.355 3.137   -6.700  1.00 0.00 ? 81  VAL A HG12 2  
ATOM 3635  H HG13 . VAL A 1 81  ? 122.888 1.437   -6.753  1.00 0.00 ? 81  VAL A HG13 2  
ATOM 3636  H HG21 . VAL A 1 81  ? 124.732 2.128   -9.971  1.00 0.00 ? 81  VAL A HG21 2  
ATOM 3637  H HG22 . VAL A 1 81  ? 124.769 1.112   -8.529  1.00 0.00 ? 81  VAL A HG22 2  
ATOM 3638  H HG23 . VAL A 1 81  ? 125.111 2.838   -8.401  1.00 0.00 ? 81  VAL A HG23 2  
ATOM 3639  N N    . GLU A 1 82  ? 122.096 2.602   -11.423 1.00 0.00 ? 82  GLU A N    2  
ATOM 3640  C CA   . GLU A 1 82  ? 122.249 2.878   -12.844 1.00 0.00 ? 82  GLU A CA   2  
ATOM 3641  C C    . GLU A 1 82  ? 123.731 2.951   -13.212 1.00 0.00 ? 82  GLU A C    2  
ATOM 3642  O O    . GLU A 1 82  ? 124.383 3.979   -13.016 1.00 0.00 ? 82  GLU A O    2  
ATOM 3643  C CB   . GLU A 1 82  ? 121.539 4.190   -13.207 1.00 0.00 ? 82  GLU A CB   2  
ATOM 3644  C CG   . GLU A 1 82  ? 120.070 4.225   -12.799 1.00 0.00 ? 82  GLU A CG   2  
ATOM 3645  C CD   . GLU A 1 82  ? 119.377 5.507   -13.228 1.00 0.00 ? 82  GLU A CD   2  
ATOM 3646  O OE1  . GLU A 1 82  ? 118.856 5.554   -14.364 1.00 0.00 ? 82  GLU A OE1  2  
ATOM 3647  O OE2  . GLU A 1 82  ? 119.359 6.478   -12.444 1.00 0.00 ? 82  GLU A OE2  2  
ATOM 3648  H H    . GLU A 1 82  ? 121.792 3.316   -10.831 1.00 0.00 ? 82  GLU A H    2  
ATOM 3649  H HA   . GLU A 1 82  ? 121.791 2.066   -13.392 1.00 0.00 ? 82  GLU A HA   2  
ATOM 3650  H HB2  . GLU A 1 82  ? 122.047 5.009   -12.715 1.00 0.00 ? 82  GLU A HB2  2  
ATOM 3651  H HB3  . GLU A 1 82  ? 121.598 4.334   -14.277 1.00 0.00 ? 82  GLU A HB3  2  
ATOM 3652  H HG2  . GLU A 1 82  ? 119.561 3.386   -13.254 1.00 0.00 ? 82  GLU A HG2  2  
ATOM 3653  H HG3  . GLU A 1 82  ? 120.006 4.139   -11.722 1.00 0.00 ? 82  GLU A HG3  2  
ATOM 3654  N N    . GLY A 1 83  ? 124.261 1.840   -13.709 1.00 0.00 ? 83  GLY A N    2  
ATOM 3655  C CA   . GLY A 1 83  ? 125.659 1.780   -14.089 1.00 0.00 ? 83  GLY A CA   2  
ATOM 3656  C C    . GLY A 1 83  ? 126.568 1.616   -12.888 1.00 0.00 ? 83  GLY A C    2  
ATOM 3657  O O    . GLY A 1 83  ? 126.927 0.493   -12.524 1.00 0.00 ? 83  GLY A O    2  
ATOM 3658  H H    . GLY A 1 83  ? 123.698 1.045   -13.805 1.00 0.00 ? 83  GLY A H    2  
ATOM 3659  H HA2  . GLY A 1 83  ? 125.803 0.942   -14.757 1.00 0.00 ? 83  GLY A HA2  2  
ATOM 3660  H HA3  . GLY A 1 83  ? 125.924 2.690   -14.610 1.00 0.00 ? 83  GLY A HA3  2  
ATOM 3661  N N    . GLN A 1 84  ? 126.922 2.735   -12.259 1.00 0.00 ? 84  GLN A N    2  
ATOM 3662  C CA   . GLN A 1 84  ? 127.823 2.740   -11.105 1.00 0.00 ? 84  GLN A CA   2  
ATOM 3663  C C    . GLN A 1 84  ? 127.544 3.942   -10.207 1.00 0.00 ? 84  GLN A C    2  
ATOM 3664  O O    . GLN A 1 84  ? 126.733 4.810   -10.544 1.00 0.00 ? 84  GLN A O    2  
ATOM 3665  C CB   . GLN A 1 84  ? 129.296 2.749   -11.564 1.00 0.00 ? 84  GLN A CB   2  
ATOM 3666  C CG   . GLN A 1 84  ? 129.837 1.368   -11.914 1.00 0.00 ? 84  GLN A CG   2  
ATOM 3667  C CD   . GLN A 1 84  ? 129.976 0.480   -10.690 1.00 0.00 ? 84  GLN A CD   2  
ATOM 3668  O OE1  . GLN A 1 84  ? 130.281 0.956   -9.597  1.00 0.00 ? 84  GLN A OE1  2  
ATOM 3669  N NE2  . GLN A 1 84  ? 129.739 -0.810  -10.853 1.00 0.00 ? 84  GLN A NE2  2  
ATOM 3670  H H    . GLN A 1 84  ? 126.555 3.591   -12.575 1.00 0.00 ? 84  GLN A H    2  
ATOM 3671  H HA   . GLN A 1 84  ? 127.638 1.838   -10.536 1.00 0.00 ? 84  GLN A HA   2  
ATOM 3672  H HB2  . GLN A 1 84  ? 129.384 3.380   -12.438 1.00 0.00 ? 84  GLN A HB2  2  
ATOM 3673  H HB3  . GLN A 1 84  ? 129.908 3.162   -10.774 1.00 0.00 ? 84  GLN A HB3  2  
ATOM 3674  H HG2  . GLN A 1 84  ? 129.164 0.894   -12.615 1.00 0.00 ? 84  GLN A HG2  2  
ATOM 3675  H HG3  . GLN A 1 84  ? 130.810 1.481   -12.371 1.00 0.00 ? 84  GLN A HG3  2  
ATOM 3676  H HE21 . GLN A 1 84  ? 129.491 -1.126  -11.747 1.00 0.00 ? 84  GLN A HE21 2  
ATOM 3677  H HE22 . GLN A 1 84  ? 129.808 -1.397  -10.069 1.00 0.00 ? 84  GLN A HE22 2  
ATOM 3678  N N    . SER A 1 85  ? 128.218 3.986   -9.060  1.00 0.00 ? 85  SER A N    2  
ATOM 3679  C CA   . SER A 1 85  ? 128.060 5.086   -8.120  1.00 0.00 ? 85  SER A CA   2  
ATOM 3680  C C    . SER A 1 85  ? 128.650 6.370   -8.698  1.00 0.00 ? 85  SER A C    2  
ATOM 3681  O O    . SER A 1 85  ? 129.856 6.607   -8.634  1.00 0.00 ? 85  SER A O    2  
ATOM 3682  C CB   . SER A 1 85  ? 128.709 4.741   -6.779  1.00 0.00 ? 85  SER A CB   2  
ATOM 3683  O OG   . SER A 1 85  ? 128.086 3.607   -6.201  1.00 0.00 ? 85  SER A OG   2  
ATOM 3684  H H    . SER A 1 85  ? 128.844 3.263   -8.845  1.00 0.00 ? 85  SER A H    2  
ATOM 3685  H HA   . SER A 1 85  ? 126.999 5.234   -7.964  1.00 0.00 ? 85  SER A HA   2  
ATOM 3686  H HB2  . SER A 1 85  ? 129.757 4.524   -6.929  1.00 0.00 ? 85  SER A HB2  2  
ATOM 3687  H HB3  . SER A 1 85  ? 128.607 5.576   -6.101  1.00 0.00 ? 85  SER A HB3  2  
ATOM 3688  H HG   . SER A 1 85  ? 128.761 2.984   -5.919  1.00 0.00 ? 85  SER A HG   2  
ATOM 3689  N N    . ARG A 1 86  ? 127.777 7.187   -9.275  1.00 0.00 ? 86  ARG A N    2  
ATOM 3690  C CA   . ARG A 1 86  ? 128.172 8.438   -9.919  1.00 0.00 ? 86  ARG A CA   2  
ATOM 3691  C C    . ARG A 1 86  ? 128.645 9.476   -8.901  1.00 0.00 ? 86  ARG A C    2  
ATOM 3692  O O    . ARG A 1 86  ? 129.041 10.584  -9.261  1.00 0.00 ? 86  ARG A O    2  
ATOM 3693  C CB   . ARG A 1 86  ? 127.000 8.964   -10.751 1.00 0.00 ? 86  ARG A CB   2  
ATOM 3694  C CG   . ARG A 1 86  ? 126.634 8.033   -11.909 1.00 0.00 ? 86  ARG A CG   2  
ATOM 3695  C CD   . ARG A 1 86  ? 125.393 8.485   -12.672 1.00 0.00 ? 86  ARG A CD   2  
ATOM 3696  N NE   . ARG A 1 86  ? 125.133 7.610   -13.819 1.00 0.00 ? 86  ARG A NE   2  
ATOM 3697  C CZ   . ARG A 1 86  ? 123.925 7.327   -14.313 1.00 0.00 ? 86  ARG A CZ   2  
ATOM 3698  N NH1  . ARG A 1 86  ? 122.827 7.849   -13.780 1.00 0.00 ? 86  ARG A NH1  2  
ATOM 3699  N NH2  . ARG A 1 86  ? 123.816 6.505   -15.346 1.00 0.00 ? 86  ARG A NH2  2  
ATOM 3700  H H    . ARG A 1 86  ? 126.832 6.928   -9.287  1.00 0.00 ? 86  ARG A H    2  
ATOM 3701  H HA   . ARG A 1 86  ? 128.994 8.216   -10.578 1.00 0.00 ? 86  ARG A HA   2  
ATOM 3702  H HB2  . ARG A 1 86  ? 126.139 9.070   -10.105 1.00 0.00 ? 86  ARG A HB2  2  
ATOM 3703  H HB3  . ARG A 1 86  ? 127.259 9.931   -11.157 1.00 0.00 ? 86  ARG A HB3  2  
ATOM 3704  H HG2  . ARG A 1 86  ? 127.465 7.995   -12.598 1.00 0.00 ? 86  ARG A HG2  2  
ATOM 3705  H HG3  . ARG A 1 86  ? 126.457 7.042   -11.513 1.00 0.00 ? 86  ARG A HG3  2  
ATOM 3706  H HD2  . ARG A 1 86  ? 124.542 8.461   -12.004 1.00 0.00 ? 86  ARG A HD2  2  
ATOM 3707  H HD3  . ARG A 1 86  ? 125.546 9.494   -13.026 1.00 0.00 ? 86  ARG A HD3  2  
ATOM 3708  H HE   . ARG A 1 86  ? 125.917 7.198   -14.248 1.00 0.00 ? 86  ARG A HE   2  
ATOM 3709  H HH11 . ARG A 1 86  ? 122.885 8.466   -12.993 1.00 0.00 ? 86  ARG A HH11 2  
ATOM 3710  H HH12 . ARG A 1 86  ? 121.927 7.625   -14.166 1.00 0.00 ? 86  ARG A HH12 2  
ATOM 3711  H HH21 . ARG A 1 86  ? 124.640 6.095   -15.751 1.00 0.00 ? 86  ARG A HH21 2  
ATOM 3712  H HH22 . ARG A 1 86  ? 122.910 6.290   -15.725 1.00 0.00 ? 86  ARG A HH22 2  
ATOM 3713  N N    . LEU A 1 87  ? 128.599 9.099   -7.634  1.00 0.00 ? 87  LEU A N    2  
ATOM 3714  C CA   . LEU A 1 87  ? 129.159 9.914   -6.556  1.00 0.00 ? 87  LEU A CA   2  
ATOM 3715  C C    . LEU A 1 87  ? 130.679 9.950   -6.689  1.00 0.00 ? 87  LEU A C    2  
ATOM 3716  O O    . LEU A 1 87  ? 131.320 10.978  -6.460  1.00 0.00 ? 87  LEU A O    2  
ATOM 3717  C CB   . LEU A 1 87  ? 128.755 9.357   -5.174  1.00 0.00 ? 87  LEU A CB   2  
ATOM 3718  C CG   . LEU A 1 87  ? 127.247 9.378   -4.853  1.00 0.00 ? 87  LEU A CG   2  
ATOM 3719  C CD1  . LEU A 1 87  ? 126.505 8.278   -5.611  1.00 0.00 ? 87  LEU A CD1  2  
ATOM 3720  C CD2  . LEU A 1 87  ? 127.010 9.251   -3.348  1.00 0.00 ? 87  LEU A CD2  2  
ATOM 3721  H H    . LEU A 1 87  ? 128.181 8.249   -7.424  1.00 0.00 ? 87  LEU A H    2  
ATOM 3722  H HA   . LEU A 1 87  ? 128.777 10.914  -6.663  1.00 0.00 ? 87  LEU A HA   2  
ATOM 3723  H HB2  . LEU A 1 87  ? 129.098 8.333   -5.115  1.00 0.00 ? 87  LEU A HB2  2  
ATOM 3724  H HB3  . LEU A 1 87  ? 129.269 9.928   -4.414  1.00 0.00 ? 87  LEU A HB3  2  
ATOM 3725  H HG   . LEU A 1 87  ? 126.836 10.326  -5.172  1.00 0.00 ? 87  LEU A HG   2  
ATOM 3726  H HD11 . LEU A 1 87  ? 125.470 8.262   -5.303  1.00 0.00 ? 87  LEU A HD11 2  
ATOM 3727  H HD12 . LEU A 1 87  ? 126.958 7.320   -5.398  1.00 0.00 ? 87  LEU A HD12 2  
ATOM 3728  H HD13 . LEU A 1 87  ? 126.559 8.473   -6.672  1.00 0.00 ? 87  LEU A HD13 2  
ATOM 3729  H HD21 . LEU A 1 87  ? 127.422 8.317   -2.993  1.00 0.00 ? 87  LEU A HD21 2  
ATOM 3730  H HD22 . LEU A 1 87  ? 125.949 9.276   -3.145  1.00 0.00 ? 87  LEU A HD22 2  
ATOM 3731  H HD23 . LEU A 1 87  ? 127.492 10.073  -2.837  1.00 0.00 ? 87  LEU A HD23 2  
ATOM 3732  N N    . ASN A 1 88  ? 131.225 8.804   -7.077  1.00 0.00 ? 88  ASN A N    2  
ATOM 3733  C CA   . ASN A 1 88  ? 132.650 8.636   -7.367  1.00 0.00 ? 88  ASN A CA   2  
ATOM 3734  C C    . ASN A 1 88  ? 133.538 8.984   -6.167  1.00 0.00 ? 88  ASN A C    2  
ATOM 3735  O O    . ASN A 1 88  ? 133.849 8.118   -5.350  1.00 0.00 ? 88  ASN A O    2  
ATOM 3736  C CB   . ASN A 1 88  ? 133.054 9.459   -8.603  1.00 0.00 ? 88  ASN A CB   2  
ATOM 3737  C CG   . ASN A 1 88  ? 134.488 9.207   -9.052  1.00 0.00 ? 88  ASN A CG   2  
ATOM 3738  O OD1  . ASN A 1 88  ? 135.169 10.122  -9.515  1.00 0.00 ? 88  ASN A OD1  2  
ATOM 3739  N ND2  . ASN A 1 88  ? 134.951 7.968   -8.947  1.00 0.00 ? 88  ASN A ND2  2  
ATOM 3740  H H    . ASN A 1 88  ? 130.638 8.030   -7.178  1.00 0.00 ? 88  ASN A H    2  
ATOM 3741  H HA   . ASN A 1 88  ? 132.801 7.596   -7.595  1.00 0.00 ? 88  ASN A HA   2  
ATOM 3742  H HB2  . ASN A 1 88  ? 132.396 9.207   -9.423  1.00 0.00 ? 88  ASN A HB2  2  
ATOM 3743  H HB3  . ASN A 1 88  ? 132.946 10.511  -8.377  1.00 0.00 ? 88  ASN A HB3  2  
ATOM 3744  H HD21 . ASN A 1 88  ? 134.356 7.275   -8.592  1.00 0.00 ? 88  ASN A HD21 2  
ATOM 3745  H HD22 . ASN A 1 88  ? 135.871 7.792   -9.236  1.00 0.00 ? 88  ASN A HD22 2  
ATOM 3746  N N    . GLU A 1 89  ? 133.932 10.253  -6.060  1.00 0.00 ? 89  GLU A N    2  
ATOM 3747  C CA   . GLU A 1 89  ? 134.882 10.691  -5.029  1.00 0.00 ? 89  GLU A CA   2  
ATOM 3748  C C    . GLU A 1 89  ? 134.525 12.085  -4.504  1.00 0.00 ? 89  GLU A C    2  
ATOM 3749  O O    . GLU A 1 89  ? 134.225 12.262  -3.319  1.00 0.00 ? 89  GLU A O    2  
ATOM 3750  C CB   . GLU A 1 89  ? 136.317 10.722  -5.592  1.00 0.00 ? 89  GLU A CB   2  
ATOM 3751  C CG   . GLU A 1 89  ? 136.817 9.389   -6.142  1.00 0.00 ? 89  GLU A CG   2  
ATOM 3752  C CD   . GLU A 1 89  ? 138.228 9.481   -6.706  1.00 0.00 ? 89  GLU A CD   2  
ATOM 3753  O OE1  . GLU A 1 89  ? 138.419 10.161  -7.737  1.00 0.00 ? 89  GLU A OE1  2  
ATOM 3754  O OE2  . GLU A 1 89  ? 139.153 8.867   -6.130  1.00 0.00 ? 89  GLU A OE2  2  
ATOM 3755  H H    . GLU A 1 89  ? 133.567 10.912  -6.683  1.00 0.00 ? 89  GLU A H    2  
ATOM 3756  H HA   . GLU A 1 89  ? 134.840 9.988   -4.209  1.00 0.00 ? 89  GLU A HA   2  
ATOM 3757  H HB2  . GLU A 1 89  ? 136.359 11.449  -6.392  1.00 0.00 ? 89  GLU A HB2  2  
ATOM 3758  H HB3  . GLU A 1 89  ? 136.990 11.034  -4.806  1.00 0.00 ? 89  GLU A HB3  2  
ATOM 3759  H HG2  . GLU A 1 89  ? 136.808 8.659   -5.344  1.00 0.00 ? 89  GLU A HG2  2  
ATOM 3760  H HG3  . GLU A 1 89  ? 136.150 9.065   -6.929  1.00 0.00 ? 89  GLU A HG3  2  
ATOM 3761  N N    . LYS A 1 90  ? 134.546 13.065  -5.408  1.00 0.00 ? 90  LYS A N    2  
ATOM 3762  C CA   . LYS A 1 90  ? 134.401 14.474  -5.052  1.00 0.00 ? 90  LYS A CA   2  
ATOM 3763  C C    . LYS A 1 90  ? 132.954 14.818  -4.716  1.00 0.00 ? 90  LYS A C    2  
ATOM 3764  O O    . LYS A 1 90  ? 132.252 15.484  -5.481  1.00 0.00 ? 90  LYS A O    2  
ATOM 3765  C CB   . LYS A 1 90  ? 134.929 15.370  -6.183  1.00 0.00 ? 90  LYS A CB   2  
ATOM 3766  C CG   . LYS A 1 90  ? 136.431 15.227  -6.424  1.00 0.00 ? 90  LYS A CG   2  
ATOM 3767  C CD   . LYS A 1 90  ? 136.919 16.111  -7.571  1.00 0.00 ? 90  LYS A CD   2  
ATOM 3768  C CE   . LYS A 1 90  ? 136.340 15.679  -8.916  1.00 0.00 ? 90  LYS A CE   2  
ATOM 3769  N NZ   . LYS A 1 90  ? 136.737 14.289  -9.279  1.00 0.00 ? 90  LYS A NZ   2  
ATOM 3770  H H    . LYS A 1 90  ? 134.648 12.831  -6.346  1.00 0.00 ? 90  LYS A H    2  
ATOM 3771  H HA   . LYS A 1 90  ? 135.002 14.648  -4.169  1.00 0.00 ? 90  LYS A HA   2  
ATOM 3772  H HB2  . LYS A 1 90  ? 134.411 15.118  -7.098  1.00 0.00 ? 90  LYS A HB2  2  
ATOM 3773  H HB3  . LYS A 1 90  ? 134.722 16.403  -5.936  1.00 0.00 ? 90  LYS A HB3  2  
ATOM 3774  H HG2  . LYS A 1 90  ? 136.957 15.507  -5.523  1.00 0.00 ? 90  LYS A HG2  2  
ATOM 3775  H HG3  . LYS A 1 90  ? 136.649 14.194  -6.660  1.00 0.00 ? 90  LYS A HG3  2  
ATOM 3776  H HD2  . LYS A 1 90  ? 136.623 17.132  -7.377  1.00 0.00 ? 90  LYS A HD2  2  
ATOM 3777  H HD3  . LYS A 1 90  ? 137.998 16.054  -7.620  1.00 0.00 ? 90  LYS A HD3  2  
ATOM 3778  H HE2  . LYS A 1 90  ? 135.262 15.732  -8.866  1.00 0.00 ? 90  LYS A HE2  2  
ATOM 3779  H HE3  . LYS A 1 90  ? 136.696 16.355  -9.681  1.00 0.00 ? 90  LYS A HE3  2  
ATOM 3780  H HZ1  . LYS A 1 90  ? 136.393 13.618  -8.563  1.00 0.00 ? 90  LYS A HZ1  2  
ATOM 3781  H HZ2  . LYS A 1 90  ? 137.772 14.211  -9.337  1.00 0.00 ? 90  LYS A HZ2  2  
ATOM 3782  H HZ3  . LYS A 1 90  ? 136.333 14.030  -10.202 1.00 0.00 ? 90  LYS A HZ3  2  
ATOM 3783  N N    . ILE A 1 91  ? 132.520 14.316  -3.577  1.00 0.00 ? 91  ILE A N    2  
ATOM 3784  C CA   . ILE A 1 91  ? 131.217 14.634  -3.013  1.00 0.00 ? 91  ILE A CA   2  
ATOM 3785  C C    . ILE A 1 91  ? 131.201 14.287  -1.519  1.00 0.00 ? 91  ILE A C    2  
ATOM 3786  O O    . ILE A 1 91  ? 130.530 14.946  -0.723  1.00 0.00 ? 91  ILE A O    2  
ATOM 3787  C CB   . ILE A 1 91  ? 130.071 13.901  -3.759  1.00 0.00 ? 91  ILE A CB   2  
ATOM 3788  C CG1  . ILE A 1 91  ? 128.707 14.328  -3.198  1.00 0.00 ? 91  ILE A CG1  2  
ATOM 3789  C CG2  . ILE A 1 91  ? 130.243 12.387  -3.676  1.00 0.00 ? 91  ILE A CG2  2  
ATOM 3790  C CD1  . ILE A 1 91  ? 127.524 13.744  -3.945  1.00 0.00 ? 91  ILE A CD1  2  
ATOM 3791  H H    . ILE A 1 91  ? 133.097 13.692  -3.105  1.00 0.00 ? 91  ILE A H    2  
ATOM 3792  H HA   . ILE A 1 91  ? 131.065 15.702  -3.118  1.00 0.00 ? 91  ILE A HA   2  
ATOM 3793  H HB   . ILE A 1 91  ? 130.121 14.182  -4.802  1.00 0.00 ? 91  ILE A HB   2  
ATOM 3794  H HG12 . ILE A 1 91  ? 128.636 14.013  -2.168  1.00 0.00 ? 91  ILE A HG12 2  
ATOM 3795  H HG13 . ILE A 1 91  ? 128.630 15.405  -3.244  1.00 0.00 ? 91  ILE A HG13 2  
ATOM 3796  H HG21 . ILE A 1 91  ? 129.460 11.902  -4.241  1.00 0.00 ? 91  ILE A HG21 2  
ATOM 3797  H HG22 . ILE A 1 91  ? 130.187 12.073  -2.644  1.00 0.00 ? 91  ILE A HG22 2  
ATOM 3798  H HG23 . ILE A 1 91  ? 131.205 12.109  -4.083  1.00 0.00 ? 91  ILE A HG23 2  
ATOM 3799  H HD11 . ILE A 1 91  ? 127.566 14.046  -4.982  1.00 0.00 ? 91  ILE A HD11 2  
ATOM 3800  H HD12 . ILE A 1 91  ? 126.607 14.104  -3.503  1.00 0.00 ? 91  ILE A HD12 2  
ATOM 3801  H HD13 . ILE A 1 91  ? 127.554 12.666  -3.883  1.00 0.00 ? 91  ILE A HD13 2  
ATOM 3802  N N    . LEU A 1 92  ? 131.982 13.265  -1.145  1.00 0.00 ? 92  LEU A N    2  
ATOM 3803  C CA   . LEU A 1 92  ? 132.159 12.881  0.260   1.00 0.00 ? 92  LEU A CA   2  
ATOM 3804  C C    . LEU A 1 92  ? 132.879 13.981  1.045   1.00 0.00 ? 92  LEU A C    2  
ATOM 3805  O O    . LEU A 1 92  ? 132.908 13.962  2.277   1.00 0.00 ? 92  LEU A O    2  
ATOM 3806  C CB   . LEU A 1 92  ? 132.972 11.578  0.365   1.00 0.00 ? 92  LEU A CB   2  
ATOM 3807  C CG   . LEU A 1 92  ? 132.277 10.287  -0.121  1.00 0.00 ? 92  LEU A CG   2  
ATOM 3808  C CD1  . LEU A 1 92  ? 130.880 10.158  0.483   1.00 0.00 ? 92  LEU A CD1  2  
ATOM 3809  C CD2  . LEU A 1 92  ? 132.229 10.221  -1.647  1.00 0.00 ? 92  LEU A CD2  2  
ATOM 3810  H H    . LEU A 1 92  ? 132.441 12.743  -1.834  1.00 0.00 ? 92  LEU A H    2  
ATOM 3811  H HA   . LEU A 1 92  ? 131.181 12.724  0.691   1.00 0.00 ? 92  LEU A HA   2  
ATOM 3812  H HB2  . LEU A 1 92  ? 133.880 11.712  -0.213  1.00 0.00 ? 92  LEU A HB2  2  
ATOM 3813  H HB3  . LEU A 1 92  ? 133.250 11.439  1.400   1.00 0.00 ? 92  LEU A HB3  2  
ATOM 3814  H HG   . LEU A 1 92  ? 132.853 9.438   0.223   1.00 0.00 ? 92  LEU A HG   2  
ATOM 3815  H HD11 . LEU A 1 92  ? 130.269 10.992  0.169   1.00 0.00 ? 92  LEU A HD11 2  
ATOM 3816  H HD12 . LEU A 1 92  ? 130.953 10.152  1.561   1.00 0.00 ? 92  LEU A HD12 2  
ATOM 3817  H HD13 . LEU A 1 92  ? 130.426 9.235   0.150   1.00 0.00 ? 92  LEU A HD13 2  
ATOM 3818  H HD21 . LEU A 1 92  ? 133.236 10.220  -2.039  1.00 0.00 ? 92  LEU A HD21 2  
ATOM 3819  H HD22 . LEU A 1 92  ? 131.695 11.077  -2.030  1.00 0.00 ? 92  LEU A HD22 2  
ATOM 3820  H HD23 . LEU A 1 92  ? 131.724 9.316   -1.954  1.00 0.00 ? 92  LEU A HD23 2  
ATOM 3821  N N    . GLU A 1 93  ? 133.464 14.925  0.310   1.00 0.00 ? 93  GLU A N    2  
ATOM 3822  C CA   . GLU A 1 93  ? 134.247 16.017  0.888   1.00 0.00 ? 93  GLU A CA   2  
ATOM 3823  C C    . GLU A 1 93  ? 133.467 16.716  2.005   1.00 0.00 ? 93  GLU A C    2  
ATOM 3824  O O    . GLU A 1 93  ? 133.903 16.752  3.157   1.00 0.00 ? 93  GLU A O    2  
ATOM 3825  C CB   . GLU A 1 93  ? 134.617 17.006  -0.220  1.00 0.00 ? 93  GLU A CB   2  
ATOM 3826  C CG   . GLU A 1 93  ? 135.246 16.333  -1.439  1.00 0.00 ? 93  GLU A CG   2  
ATOM 3827  C CD   . GLU A 1 93  ? 135.511 17.309  -2.574  1.00 0.00 ? 93  GLU A CD   2  
ATOM 3828  O OE1  . GLU A 1 93  ? 134.560 17.644  -3.313  1.00 0.00 ? 93  GLU A OE1  2  
ATOM 3829  O OE2  . GLU A 1 93  ? 136.666 17.761  -2.721  1.00 0.00 ? 93  GLU A OE2  2  
ATOM 3830  H H    . GLU A 1 93  ? 133.366 14.885  -0.660  1.00 0.00 ? 93  GLU A H    2  
ATOM 3831  H HA   . GLU A 1 93  ? 135.152 15.596  1.303   1.00 0.00 ? 93  GLU A HA   2  
ATOM 3832  H HB2  . GLU A 1 93  ? 133.724 17.526  -0.539  1.00 0.00 ? 93  GLU A HB2  2  
ATOM 3833  H HB3  . GLU A 1 93  ? 135.322 17.726  0.172   1.00 0.00 ? 93  GLU A HB3  2  
ATOM 3834  H HG2  . GLU A 1 93  ? 136.182 15.880  -1.141  1.00 0.00 ? 93  GLU A HG2  2  
ATOM 3835  H HG3  . GLU A 1 93  ? 134.576 15.557  -1.793  1.00 0.00 ? 93  GLU A HG3  2  
ATOM 3836  N N    . GLU A 1 94  ? 132.309 17.261  1.657   1.00 0.00 ? 94  GLU A N    2  
ATOM 3837  C CA   . GLU A 1 94  ? 131.379 17.790  2.645   1.00 0.00 ? 94  GLU A CA   2  
ATOM 3838  C C    . GLU A 1 94  ? 129.949 17.504  2.198   1.00 0.00 ? 94  GLU A C    2  
ATOM 3839  O O    . GLU A 1 94  ? 129.356 18.282  1.445   1.00 0.00 ? 94  GLU A O    2  
ATOM 3840  C CB   . GLU A 1 94  ? 131.579 19.296  2.868   1.00 0.00 ? 94  GLU A CB   2  
ATOM 3841  C CG   . GLU A 1 94  ? 130.664 19.868  3.948   1.00 0.00 ? 94  GLU A CG   2  
ATOM 3842  C CD   . GLU A 1 94  ? 130.841 21.362  4.152   1.00 0.00 ? 94  GLU A CD   2  
ATOM 3843  O OE1  . GLU A 1 94  ? 131.692 21.760  4.975   1.00 0.00 ? 94  GLU A OE1  2  
ATOM 3844  O OE2  . GLU A 1 94  ? 130.118 22.148  3.504   1.00 0.00 ? 94  GLU A OE2  2  
ATOM 3845  H H    . GLU A 1 94  ? 132.073 17.313  0.707   1.00 0.00 ? 94  GLU A H    2  
ATOM 3846  H HA   . GLU A 1 94  ? 131.557 17.271  3.579   1.00 0.00 ? 94  GLU A HA   2  
ATOM 3847  H HB2  . GLU A 1 94  ? 132.605 19.474  3.159   1.00 0.00 ? 94  GLU A HB2  2  
ATOM 3848  H HB3  . GLU A 1 94  ? 131.381 19.818  1.942   1.00 0.00 ? 94  GLU A HB3  2  
ATOM 3849  H HG2  . GLU A 1 94  ? 129.637 19.679  3.666   1.00 0.00 ? 94  GLU A HG2  2  
ATOM 3850  H HG3  . GLU A 1 94  ? 130.873 19.363  4.882   1.00 0.00 ? 94  GLU A HG3  2  
ATOM 3851  N N    . PRO A 1 95  ? 129.398 16.349  2.610   1.00 0.00 ? 95  PRO A N    2  
ATOM 3852  C CA   . PRO A 1 95  ? 128.026 15.966  2.292   1.00 0.00 ? 95  PRO A CA   2  
ATOM 3853  C C    . PRO A 1 95  ? 127.011 16.727  3.144   1.00 0.00 ? 95  PRO A C    2  
ATOM 3854  O O    . PRO A 1 95  ? 127.154 16.823  4.364   1.00 0.00 ? 95  PRO A O    2  
ATOM 3855  C CB   . PRO A 1 95  ? 127.975 14.456  2.602   1.00 0.00 ? 95  PRO A CB   2  
ATOM 3856  C CG   . PRO A 1 95  ? 129.382 14.061  2.937   1.00 0.00 ? 95  PRO A CG   2  
ATOM 3857  C CD   . PRO A 1 95  ? 130.069 15.312  3.401   1.00 0.00 ? 95  PRO A CD   2  
ATOM 3858  H HA   . PRO A 1 95  ? 127.806 16.128  1.244   1.00 0.00 ? 95  PRO A HA   2  
ATOM 3859  H HB2  . PRO A 1 95  ? 127.309 14.279  3.435   1.00 0.00 ? 95  PRO A HB2  2  
ATOM 3860  H HB3  . PRO A 1 95  ? 127.613 13.922  1.734   1.00 0.00 ? 95  PRO A HB3  2  
ATOM 3861  H HG2  . PRO A 1 95  ? 129.378 13.321  3.725   1.00 0.00 ? 95  PRO A HG2  2  
ATOM 3862  H HG3  . PRO A 1 95  ? 129.873 13.667  2.057   1.00 0.00 ? 95  PRO A HG3  2  
ATOM 3863  H HD2  . PRO A 1 95  ? 129.908 15.465  4.459   1.00 0.00 ? 95  PRO A HD2  2  
ATOM 3864  H HD3  . PRO A 1 95  ? 131.125 15.272  3.177   1.00 0.00 ? 95  PRO A HD3  2  
ATOM 3865  N N    . HIS A 1 96  ? 126.001 17.272  2.485   1.00 0.00 ? 96  HIS A N    2  
ATOM 3866  C CA   . HIS A 1 96  ? 124.914 17.983  3.154   1.00 0.00 ? 96  HIS A CA   2  
ATOM 3867  C C    . HIS A 1 96  ? 123.672 17.091  3.194   1.00 0.00 ? 96  HIS A C    2  
ATOM 3868  O O    . HIS A 1 96  ? 123.547 16.176  2.377   1.00 0.00 ? 96  HIS A O    2  
ATOM 3869  C CB   . HIS A 1 96  ? 124.618 19.305  2.425   1.00 0.00 ? 96  HIS A CB   2  
ATOM 3870  C CG   . HIS A 1 96  ? 125.708 20.327  2.573   1.00 0.00 ? 96  HIS A CG   2  
ATOM 3871  N ND1  . HIS A 1 96  ? 125.554 21.493  3.294   1.00 0.00 ? 96  HIS A ND1  2  
ATOM 3872  C CD2  . HIS A 1 96  ? 126.974 20.355  2.091   1.00 0.00 ? 96  HIS A CD2  2  
ATOM 3873  C CE1  . HIS A 1 96  ? 126.674 22.188  3.251   1.00 0.00 ? 96  HIS A CE1  2  
ATOM 3874  N NE2  . HIS A 1 96  ? 127.551 21.520  2.529   1.00 0.00 ? 96  HIS A NE2  2  
ATOM 3875  H H    . HIS A 1 96  ? 125.978 17.186  1.508   1.00 0.00 ? 96  HIS A H    2  
ATOM 3876  H HA   . HIS A 1 96  ? 125.223 18.198  4.169   1.00 0.00 ? 96  HIS A HA   2  
ATOM 3877  H HB2  . HIS A 1 96  ? 124.490 19.107  1.370   1.00 0.00 ? 96  HIS A HB2  2  
ATOM 3878  H HB3  . HIS A 1 96  ? 123.706 19.731  2.818   1.00 0.00 ? 96  HIS A HB3  2  
ATOM 3879  H HD1  . HIS A 1 96  ? 124.736 21.774  3.764   1.00 0.00 ? 96  HIS A HD1  2  
ATOM 3880  H HD2  . HIS A 1 96  ? 127.443 19.599  1.477   1.00 0.00 ? 96  HIS A HD2  2  
ATOM 3881  H HE1  . HIS A 1 96  ? 126.844 23.143  3.726   1.00 0.00 ? 96  HIS A HE1  2  
ATOM 3882  H HE2  . HIS A 1 96  ? 128.500 21.761  2.427   1.00 0.00 ? 96  HIS A HE2  2  
ATOM 3883  N N    . PRO A 1 97  ? 122.726 17.347  4.124   1.00 0.00 ? 97  PRO A N    2  
ATOM 3884  C CA   . PRO A 1 97  ? 121.556 16.475  4.318   1.00 0.00 ? 97  PRO A CA   2  
ATOM 3885  C C    . PRO A 1 97  ? 120.692 16.388  3.061   1.00 0.00 ? 97  PRO A C    2  
ATOM 3886  O O    . PRO A 1 97  ? 119.988 15.402  2.840   1.00 0.00 ? 97  PRO A O    2  
ATOM 3887  C CB   . PRO A 1 97  ? 120.784 17.143  5.470   1.00 0.00 ? 97  PRO A CB   2  
ATOM 3888  C CG   . PRO A 1 97  ? 121.267 18.555  5.491   1.00 0.00 ? 97  PRO A CG   2  
ATOM 3889  C CD   . PRO A 1 97  ? 122.702 18.504  5.043   1.00 0.00 ? 97  PRO A CD   2  
ATOM 3890  H HA   . PRO A 1 97  ? 121.855 15.477  4.612   1.00 0.00 ? 97  PRO A HA   2  
ATOM 3891  H HB2  . PRO A 1 97  ? 119.720 17.090  5.281   1.00 0.00 ? 97  PRO A HB2  2  
ATOM 3892  H HB3  . PRO A 1 97  ? 121.011 16.637  6.399   1.00 0.00 ? 97  PRO A HB3  2  
ATOM 3893  H HG2  . PRO A 1 97  ? 120.680 19.156  4.808   1.00 0.00 ? 97  PRO A HG2  2  
ATOM 3894  H HG3  . PRO A 1 97  ? 121.200 18.954  6.493   1.00 0.00 ? 97  PRO A HG3  2  
ATOM 3895  H HD2  . PRO A 1 97  ? 122.970 19.415  4.526   1.00 0.00 ? 97  PRO A HD2  2  
ATOM 3896  H HD3  . PRO A 1 97  ? 123.358 18.339  5.885   1.00 0.00 ? 97  PRO A HD3  2  
ATOM 3897  N N    . LEU A 1 98  ? 120.774 17.423  2.232   1.00 0.00 ? 98  LEU A N    2  
ATOM 3898  C CA   . LEU A 1 98  ? 119.966 17.510  1.021   1.00 0.00 ? 98  LEU A CA   2  
ATOM 3899  C C    . LEU A 1 98  ? 120.657 16.834  -0.161  1.00 0.00 ? 98  LEU A C    2  
ATOM 3900  O O    . LEU A 1 98  ? 120.010 16.497  -1.152  1.00 0.00 ? 98  LEU A O    2  
ATOM 3901  C CB   . LEU A 1 98  ? 119.676 18.980  0.684   1.00 0.00 ? 98  LEU A CB   2  
ATOM 3902  C CG   . LEU A 1 98  ? 119.017 19.797  1.809   1.00 0.00 ? 98  LEU A CG   2  
ATOM 3903  C CD1  . LEU A 1 98  ? 118.764 21.231  1.353   1.00 0.00 ? 98  LEU A CD1  2  
ATOM 3904  C CD2  . LEU A 1 98  ? 117.720 19.137  2.273   1.00 0.00 ? 98  LEU A CD2  2  
ATOM 3905  H H    . LEU A 1 98  ? 121.394 18.151  2.443   1.00 0.00 ? 98  LEU A H    2  
ATOM 3906  H HA   . LEU A 1 98  ? 119.028 17.006  1.209   1.00 0.00 ? 98  LEU A HA   2  
ATOM 3907  H HB2  . LEU A 1 98  ? 120.611 19.457  0.422   1.00 0.00 ? 98  LEU A HB2  2  
ATOM 3908  H HB3  . LEU A 1 98  ? 119.026 19.008  -0.179  1.00 0.00 ? 98  LEU A HB3  2  
ATOM 3909  H HG   . LEU A 1 98  ? 119.691 19.836  2.654   1.00 0.00 ? 98  LEU A HG   2  
ATOM 3910  H HD11 . LEU A 1 98  ? 119.701 21.692  1.075   1.00 0.00 ? 98  LEU A HD11 2  
ATOM 3911  H HD12 . LEU A 1 98  ? 118.315 21.793  2.160   1.00 0.00 ? 98  LEU A HD12 2  
ATOM 3912  H HD13 . LEU A 1 98  ? 118.097 21.230  0.502   1.00 0.00 ? 98  LEU A HD13 2  
ATOM 3913  H HD21 . LEU A 1 98  ? 117.031 19.068  1.444   1.00 0.00 ? 98  LEU A HD21 2  
ATOM 3914  H HD22 . LEU A 1 98  ? 117.276 19.729  3.060   1.00 0.00 ? 98  LEU A HD22 2  
ATOM 3915  H HD23 . LEU A 1 98  ? 117.932 18.146  2.648   1.00 0.00 ? 98  LEU A HD23 2  
ATOM 3916  N N    . MET A 1 99  ? 121.965 16.611  -0.053  1.00 0.00 ? 99  MET A N    2  
ATOM 3917  C CA   . MET A 1 99  ? 122.737 16.086  -1.181  1.00 0.00 ? 99  MET A CA   2  
ATOM 3918  C C    . MET A 1 99  ? 122.286 14.664  -1.522  1.00 0.00 ? 99  MET A C    2  
ATOM 3919  O O    . MET A 1 99  ? 122.253 14.276  -2.692  1.00 0.00 ? 99  MET A O    2  
ATOM 3920  C CB   . MET A 1 99  ? 124.255 16.154  -0.893  1.00 0.00 ? 99  MET A CB   2  
ATOM 3921  C CG   . MET A 1 99  ? 124.878 14.905  -0.266  1.00 0.00 ? 99  MET A CG   2  
ATOM 3922  S SD   . MET A 1 99  ? 125.081 13.560  -1.454  1.00 0.00 ? 99  MET A SD   2  
ATOM 3923  C CE   . MET A 1 99  ? 126.307 12.551  -0.626  1.00 0.00 ? 99  MET A CE   2  
ATOM 3924  H H    . MET A 1 99  ? 122.417 16.798  0.796   1.00 0.00 ? 99  MET A H    2  
ATOM 3925  H HA   . MET A 1 99  ? 122.522 16.718  -2.033  1.00 0.00 ? 99  MET A HA   2  
ATOM 3926  H HB2  . MET A 1 99  ? 124.770 16.344  -1.823  1.00 0.00 ? 99  MET A HB2  2  
ATOM 3927  H HB3  . MET A 1 99  ? 124.438 16.988  -0.227  1.00 0.00 ? 99  MET A HB3  2  
ATOM 3928  H HG2  . MET A 1 99  ? 125.850 15.162  0.134   1.00 0.00 ? 99  MET A HG2  2  
ATOM 3929  H HG3  . MET A 1 99  ? 124.242 14.563  0.539   1.00 0.00 ? 99  MET A HG3  2  
ATOM 3930  H HE1  . MET A 1 99  ? 126.512 11.674  -1.222  1.00 0.00 ? 99  MET A HE1  2  
ATOM 3931  H HE2  . MET A 1 99  ? 125.933 12.250  0.340   1.00 0.00 ? 99  MET A HE2  2  
ATOM 3932  H HE3  . MET A 1 99  ? 127.216 13.120  -0.499  1.00 0.00 ? 99  MET A HE3  2  
ATOM 3933  N N    . PHE A 1 100 ? 121.888 13.905  -0.500  1.00 0.00 ? 100 PHE A N    2  
ATOM 3934  C CA   . PHE A 1 100 ? 121.431 12.531  -0.700  1.00 0.00 ? 100 PHE A CA   2  
ATOM 3935  C C    . PHE A 1 100 ? 120.013 12.481  -1.264  1.00 0.00 ? 100 PHE A C    2  
ATOM 3936  O O    . PHE A 1 100 ? 119.526 11.407  -1.598  1.00 0.00 ? 100 PHE A O    2  
ATOM 3937  C CB   . PHE A 1 100 ? 121.515 11.715  0.601   1.00 0.00 ? 100 PHE A CB   2  
ATOM 3938  C CG   . PHE A 1 100 ? 122.803 10.940  0.741   1.00 0.00 ? 100 PHE A CG   2  
ATOM 3939  C CD1  . PHE A 1 100 ? 123.063 9.853   -0.084  1.00 0.00 ? 100 PHE A CD1  2  
ATOM 3940  C CD2  . PHE A 1 100 ? 123.749 11.292  1.689   1.00 0.00 ? 100 PHE A CD2  2  
ATOM 3941  C CE1  . PHE A 1 100 ? 124.238 9.136   0.037   1.00 0.00 ? 100 PHE A CE1  2  
ATOM 3942  C CE2  . PHE A 1 100 ? 124.925 10.578  1.814   1.00 0.00 ? 100 PHE A CE2  2  
ATOM 3943  C CZ   . PHE A 1 100 ? 125.171 9.500   0.987   1.00 0.00 ? 100 PHE A CZ   2  
ATOM 3944  H H    . PHE A 1 100 ? 121.907 14.277  0.407   1.00 0.00 ? 100 PHE A H    2  
ATOM 3945  H HA   . PHE A 1 100 ? 122.091 12.080  -1.429  1.00 0.00 ? 100 PHE A HA   2  
ATOM 3946  H HB2  . PHE A 1 100 ? 121.433 12.384  1.445   1.00 0.00 ? 100 PHE A HB2  2  
ATOM 3947  H HB3  . PHE A 1 100 ? 120.698 11.006  0.634   1.00 0.00 ? 100 PHE A HB3  2  
ATOM 3948  H HD1  . PHE A 1 100 ? 122.334 9.566   -0.829  1.00 0.00 ? 100 PHE A HD1  2  
ATOM 3949  H HD2  . PHE A 1 100 ? 123.562 12.135  2.337   1.00 0.00 ? 100 PHE A HD2  2  
ATOM 3950  H HE1  . PHE A 1 100 ? 124.427 8.292   -0.612  1.00 0.00 ? 100 PHE A HE1  2  
ATOM 3951  H HE2  . PHE A 1 100 ? 125.653 10.864  2.558   1.00 0.00 ? 100 PHE A HE2  2  
ATOM 3952  H HZ   . PHE A 1 100 ? 126.091 8.942   1.084   1.00 0.00 ? 100 PHE A HZ   2  
ATOM 3953  N N    . GLN A 1 101 ? 119.351 13.635  -1.379  1.00 0.00 ? 101 GLN A N    2  
ATOM 3954  C CA   . GLN A 1 101 ? 118.020 13.683  -1.993  1.00 0.00 ? 101 GLN A CA   2  
ATOM 3955  C C    . GLN A 1 101 ? 118.113 13.273  -3.460  1.00 0.00 ? 101 GLN A C    2  
ATOM 3956  O O    . GLN A 1 101 ? 117.171 12.711  -4.022  1.00 0.00 ? 101 GLN A O    2  
ATOM 3957  C CB   . GLN A 1 101 ? 117.387 15.084  -1.872  1.00 0.00 ? 101 GLN A CB   2  
ATOM 3958  C CG   . GLN A 1 101 ? 116.401 15.259  -0.709  1.00 0.00 ? 101 GLN A CG   2  
ATOM 3959  C CD   . GLN A 1 101 ? 117.046 15.397  0.669   1.00 0.00 ? 101 GLN A CD   2  
ATOM 3960  O OE1  . GLN A 1 101 ? 116.555 16.149  1.508   1.00 0.00 ? 101 GLN A OE1  2  
ATOM 3961  N NE2  . GLN A 1 101 ? 118.103 14.646  0.940   1.00 0.00 ? 101 GLN A NE2  2  
ATOM 3962  H H    . GLN A 1 101 ? 119.767 14.466  -1.061  1.00 0.00 ? 101 GLN A H    2  
ATOM 3963  H HA   . GLN A 1 101 ? 117.394 12.968  -1.476  1.00 0.00 ? 101 GLN A HA   2  
ATOM 3964  H HB2  . GLN A 1 101 ? 118.177 15.810  -1.748  1.00 0.00 ? 101 GLN A HB2  2  
ATOM 3965  H HB3  . GLN A 1 101 ? 116.860 15.307  -2.790  1.00 0.00 ? 101 GLN A HB3  2  
ATOM 3966  H HG2  . GLN A 1 101 ? 115.813 16.147  -0.893  1.00 0.00 ? 101 GLN A HG2  2  
ATOM 3967  H HG3  . GLN A 1 101 ? 115.742 14.402  -0.692  1.00 0.00 ? 101 GLN A HG3  2  
ATOM 3968  H HE21 . GLN A 1 101 ? 118.426 14.034  0.258   1.00 0.00 ? 101 GLN A HE21 2  
ATOM 3969  H HE22 . GLN A 1 101 ? 118.518 14.739  1.826   1.00 0.00 ? 101 GLN A HE22 2  
ATOM 3970  N N    . LYS A 1 102 ? 119.265 13.554  -4.065  1.00 0.00 ? 102 LYS A N    2  
ATOM 3971  C CA   . LYS A 1 102 ? 119.527 13.170  -5.447  1.00 0.00 ? 102 LYS A CA   2  
ATOM 3972  C C    . LYS A 1 102 ? 119.553 11.648  -5.565  1.00 0.00 ? 102 LYS A C    2  
ATOM 3973  O O    . LYS A 1 102 ? 118.917 11.063  -6.443  1.00 0.00 ? 102 LYS A O    2  
ATOM 3974  C CB   . LYS A 1 102 ? 120.868 13.757  -5.911  1.00 0.00 ? 102 LYS A CB   2  
ATOM 3975  C CG   . LYS A 1 102 ? 120.969 15.271  -5.743  1.00 0.00 ? 102 LYS A CG   2  
ATOM 3976  C CD   . LYS A 1 102 ? 122.335 15.800  -6.173  1.00 0.00 ? 102 LYS A CD   2  
ATOM 3977  C CE   . LYS A 1 102 ? 122.441 17.311  -5.990  1.00 0.00 ? 102 LYS A CE   2  
ATOM 3978  N NZ   . LYS A 1 102 ? 123.755 17.837  -6.447  1.00 0.00 ? 102 LYS A NZ   2  
ATOM 3979  H H    . LYS A 1 102 ? 119.959 14.035  -3.566  1.00 0.00 ? 102 LYS A H    2  
ATOM 3980  H HA   . LYS A 1 102 ? 118.732 13.563  -6.065  1.00 0.00 ? 102 LYS A HA   2  
ATOM 3981  H HB2  . LYS A 1 102 ? 121.665 13.299  -5.340  1.00 0.00 ? 102 LYS A HB2  2  
ATOM 3982  H HB3  . LYS A 1 102 ? 121.008 13.521  -6.957  1.00 0.00 ? 102 LYS A HB3  2  
ATOM 3983  H HG2  . LYS A 1 102 ? 120.206 15.741  -6.348  1.00 0.00 ? 102 LYS A HG2  2  
ATOM 3984  H HG3  . LYS A 1 102 ? 120.807 15.519  -4.703  1.00 0.00 ? 102 LYS A HG3  2  
ATOM 3985  H HD2  . LYS A 1 102 ? 123.100 15.323  -5.576  1.00 0.00 ? 102 LYS A HD2  2  
ATOM 3986  H HD3  . LYS A 1 102 ? 122.491 15.561  -7.216  1.00 0.00 ? 102 LYS A HD3  2  
ATOM 3987  H HE2  . LYS A 1 102 ? 121.657 17.788  -6.561  1.00 0.00 ? 102 LYS A HE2  2  
ATOM 3988  H HE3  . LYS A 1 102 ? 122.315 17.546  -4.942  1.00 0.00 ? 102 LYS A HE3  2  
ATOM 3989  H HZ1  . LYS A 1 102 ? 124.528 17.355  -5.946  1.00 0.00 ? 102 LYS A HZ1  2  
ATOM 3990  H HZ2  . LYS A 1 102 ? 123.818 18.857  -6.255  1.00 0.00 ? 102 LYS A HZ2  2  
ATOM 3991  H HZ3  . LYS A 1 102 ? 123.868 17.682  -7.468  1.00 0.00 ? 102 LYS A HZ3  2  
ATOM 3992  N N    . LEU A 1 103 ? 120.276 11.015  -4.646  1.00 0.00 ? 103 LEU A N    2  
ATOM 3993  C CA   . LEU A 1 103 ? 120.410 9.562   -4.634  1.00 0.00 ? 103 LEU A CA   2  
ATOM 3994  C C    . LEU A 1 103 ? 119.121 8.914   -4.140  1.00 0.00 ? 103 LEU A C    2  
ATOM 3995  O O    . LEU A 1 103 ? 118.786 7.798   -4.534  1.00 0.00 ? 103 LEU A O    2  
ATOM 3996  C CB   . LEU A 1 103 ? 121.599 9.129   -3.759  1.00 0.00 ? 103 LEU A CB   2  
ATOM 3997  C CG   . LEU A 1 103 ? 122.989 9.593   -4.242  1.00 0.00 ? 103 LEU A CG   2  
ATOM 3998  C CD1  . LEU A 1 103 ? 123.166 9.311   -5.733  1.00 0.00 ? 103 LEU A CD1  2  
ATOM 3999  C CD2  . LEU A 1 103 ? 123.223 11.073  -3.931  1.00 0.00 ? 103 LEU A CD2  2  
ATOM 4000  H H    . LEU A 1 103 ? 120.726 11.539  -3.953  1.00 0.00 ? 103 LEU A H    2  
ATOM 4001  H HA   . LEU A 1 103 ? 120.589 9.239   -5.651  1.00 0.00 ? 103 LEU A HA   2  
ATOM 4002  H HB2  . LEU A 1 103 ? 121.441 9.512   -2.760  1.00 0.00 ? 103 LEU A HB2  2  
ATOM 4003  H HB3  . LEU A 1 103 ? 121.605 8.049   -3.710  1.00 0.00 ? 103 LEU A HB3  2  
ATOM 4004  H HG   . LEU A 1 103 ? 123.744 9.024   -3.715  1.00 0.00 ? 103 LEU A HG   2  
ATOM 4005  H HD11 . LEU A 1 103 ? 122.432 9.868   -6.298  1.00 0.00 ? 103 LEU A HD11 2  
ATOM 4006  H HD12 . LEU A 1 103 ? 123.035 8.254   -5.918  1.00 0.00 ? 103 LEU A HD12 2  
ATOM 4007  H HD13 . LEU A 1 103 ? 124.158 9.608   -6.040  1.00 0.00 ? 103 LEU A HD13 2  
ATOM 4008  H HD21 . LEU A 1 103 ? 123.129 11.238  -2.867  1.00 0.00 ? 103 LEU A HD21 2  
ATOM 4009  H HD22 . LEU A 1 103 ? 122.493 11.676  -4.453  1.00 0.00 ? 103 LEU A HD22 2  
ATOM 4010  H HD23 . LEU A 1 103 ? 124.216 11.356  -4.250  1.00 0.00 ? 103 LEU A HD23 2  
ATOM 4011  N N    . GLN A 1 104 ? 118.403 9.630   -3.280  1.00 0.00 ? 104 GLN A N    2  
ATOM 4012  C CA   . GLN A 1 104 ? 117.106 9.195   -2.795  1.00 0.00 ? 104 GLN A CA   2  
ATOM 4013  C C    . GLN A 1 104 ? 116.130 9.112   -3.963  1.00 0.00 ? 104 GLN A C    2  
ATOM 4014  O O    . GLN A 1 104 ? 115.345 8.172   -4.070  1.00 0.00 ? 104 GLN A O    2  
ATOM 4015  C CB   . GLN A 1 104 ? 116.601 10.183  -1.736  1.00 0.00 ? 104 GLN A CB   2  
ATOM 4016  C CG   . GLN A 1 104 ? 115.224 9.857   -1.187  1.00 0.00 ? 104 GLN A CG   2  
ATOM 4017  C CD   . GLN A 1 104 ? 114.748 10.871  -0.160  1.00 0.00 ? 104 GLN A CD   2  
ATOM 4018  O OE1  . GLN A 1 104 ? 114.984 10.720  1.038   1.00 0.00 ? 104 GLN A OE1  2  
ATOM 4019  N NE2  . GLN A 1 104 ? 114.083 11.919  -0.624  1.00 0.00 ? 104 GLN A NE2  2  
ATOM 4020  H H    . GLN A 1 104 ? 118.757 10.479  -2.959  1.00 0.00 ? 104 GLN A H    2  
ATOM 4021  H HA   . GLN A 1 104 ? 117.219 8.216   -2.350  1.00 0.00 ? 104 GLN A HA   2  
ATOM 4022  H HB2  . GLN A 1 104 ? 117.299 10.194  -0.911  1.00 0.00 ? 104 GLN A HB2  2  
ATOM 4023  H HB3  . GLN A 1 104 ? 116.566 11.172  -2.173  1.00 0.00 ? 104 GLN A HB3  2  
ATOM 4024  H HG2  . GLN A 1 104 ? 114.523 9.837   -2.008  1.00 0.00 ? 104 GLN A HG2  2  
ATOM 4025  H HG3  . GLN A 1 104 ? 115.261 8.883   -0.724  1.00 0.00 ? 104 GLN A HG3  2  
ATOM 4026  H HE21 . GLN A 1 104 ? 113.935 11.986  -1.589  1.00 0.00 ? 104 GLN A HE21 2  
ATOM 4027  H HE22 . GLN A 1 104 ? 113.763 12.588  0.022   1.00 0.00 ? 104 GLN A HE22 2  
ATOM 4028  N N    . ASP A 1 105 ? 116.205 10.107  -4.844  1.00 0.00 ? 105 ASP A N    2  
ATOM 4029  C CA   . ASP A 1 105 ? 115.390 10.142  -6.056  1.00 0.00 ? 105 ASP A CA   2  
ATOM 4030  C C    . ASP A 1 105 ? 115.790 9.011   -6.998  1.00 0.00 ? 105 ASP A C    2  
ATOM 4031  O O    . ASP A 1 105 ? 114.939 8.298   -7.534  1.00 0.00 ? 105 ASP A O    2  
ATOM 4032  C CB   . ASP A 1 105 ? 115.554 11.492  -6.766  1.00 0.00 ? 105 ASP A CB   2  
ATOM 4033  C CG   . ASP A 1 105 ? 114.779 11.566  -8.074  1.00 0.00 ? 105 ASP A CG   2  
ATOM 4034  O OD1  . ASP A 1 105 ? 113.578 11.912  -8.041  1.00 0.00 ? 105 ASP A OD1  2  
ATOM 4035  O OD2  . ASP A 1 105 ? 115.366 11.281  -9.141  1.00 0.00 ? 105 ASP A OD2  2  
ATOM 4036  H H    . ASP A 1 105 ? 116.828 10.845  -4.672  1.00 0.00 ? 105 ASP A H    2  
ATOM 4037  H HA   . ASP A 1 105 ? 114.355 10.015  -5.770  1.00 0.00 ? 105 ASP A HA   2  
ATOM 4038  H HB2  . ASP A 1 105 ? 115.203 12.279  -6.114  1.00 0.00 ? 105 ASP A HB2  2  
ATOM 4039  H HB3  . ASP A 1 105 ? 116.603 11.653  -6.979  1.00 0.00 ? 105 ASP A HB3  2  
ATOM 4040  N N    . GLN A 1 106 ? 117.098 8.858   -7.186  1.00 0.00 ? 106 GLN A N    2  
ATOM 4041  C CA   . GLN A 1 106 ? 117.643 7.815   -8.048  1.00 0.00 ? 106 GLN A CA   2  
ATOM 4042  C C    . GLN A 1 106 ? 117.148 6.446   -7.589  1.00 0.00 ? 106 GLN A C    2  
ATOM 4043  O O    . GLN A 1 106 ? 116.478 5.730   -8.340  1.00 0.00 ? 106 GLN A O    2  
ATOM 4044  C CB   . GLN A 1 106 ? 119.185 7.882   -8.032  1.00 0.00 ? 106 GLN A CB   2  
ATOM 4045  C CG   . GLN A 1 106 ? 119.893 7.032   -9.094  1.00 0.00 ? 106 GLN A CG   2  
ATOM 4046  C CD   . GLN A 1 106 ? 119.856 5.536   -8.812  1.00 0.00 ? 106 GLN A CD   2  
ATOM 4047  O OE1  . GLN A 1 106 ? 118.968 4.820   -9.269  1.00 0.00 ? 106 GLN A OE1  2  
ATOM 4048  N NE2  . GLN A 1 106 ? 120.819 5.057   -8.043  1.00 0.00 ? 106 GLN A NE2  2  
ATOM 4049  H H    . GLN A 1 106 ? 117.716 9.472   -6.737  1.00 0.00 ? 106 GLN A H    2  
ATOM 4050  H HA   . GLN A 1 106 ? 117.292 7.997   -9.054  1.00 0.00 ? 106 GLN A HA   2  
ATOM 4051  H HB2  . GLN A 1 106 ? 119.483 8.910   -8.180  1.00 0.00 ? 106 GLN A HB2  2  
ATOM 4052  H HB3  . GLN A 1 106 ? 119.533 7.563   -7.058  1.00 0.00 ? 106 GLN A HB3  2  
ATOM 4053  H HG2  . GLN A 1 106 ? 119.418 7.209   -10.048 1.00 0.00 ? 106 GLN A HG2  2  
ATOM 4054  H HG3  . GLN A 1 106 ? 120.927 7.345   -9.151  1.00 0.00 ? 106 GLN A HG3  2  
ATOM 4055  H HE21 . GLN A 1 106 ? 121.493 5.680   -7.702  1.00 0.00 ? 106 GLN A HE21 2  
ATOM 4056  H HE22 . GLN A 1 106 ? 120.814 4.100   -7.841  1.00 0.00 ? 106 GLN A HE22 2  
ATOM 4057  N N    . ILE A 1 107 ? 117.448 6.101   -6.337  1.00 0.00 ? 107 ILE A N    2  
ATOM 4058  C CA   . ILE A 1 107 ? 117.087 4.795   -5.803  1.00 0.00 ? 107 ILE A CA   2  
ATOM 4059  C C    . ILE A 1 107 ? 115.572 4.659   -5.694  1.00 0.00 ? 107 ILE A C    2  
ATOM 4060  O O    . ILE A 1 107 ? 115.063 3.556   -5.615  1.00 0.00 ? 107 ILE A O    2  
ATOM 4061  C CB   . ILE A 1 107 ? 117.736 4.516   -4.416  1.00 0.00 ? 107 ILE A CB   2  
ATOM 4062  C CG1  . ILE A 1 107 ? 117.719 3.006   -4.102  1.00 0.00 ? 107 ILE A CG1  2  
ATOM 4063  C CG2  . ILE A 1 107 ? 117.018 5.288   -3.311  1.00 0.00 ? 107 ILE A CG2  2  
ATOM 4064  C CD1  . ILE A 1 107 ? 118.514 2.167   -5.084  1.00 0.00 ? 107 ILE A CD1  2  
ATOM 4065  H H    . ILE A 1 107 ? 117.918 6.739   -5.763  1.00 0.00 ? 107 ILE A H    2  
ATOM 4066  H HA   . ILE A 1 107 ? 117.449 4.049   -6.499  1.00 0.00 ? 107 ILE A HA   2  
ATOM 4067  H HB   . ILE A 1 107 ? 118.762 4.857   -4.449  1.00 0.00 ? 107 ILE A HB   2  
ATOM 4068  H HG12 . ILE A 1 107 ? 118.139 2.844   -3.120  1.00 0.00 ? 107 ILE A HG12 2  
ATOM 4069  H HG13 . ILE A 1 107 ? 116.696 2.651   -4.114  1.00 0.00 ? 107 ILE A HG13 2  
ATOM 4070  H HG21 . ILE A 1 107 ? 117.016 6.342   -3.547  1.00 0.00 ? 107 ILE A HG21 2  
ATOM 4071  H HG22 . ILE A 1 107 ? 117.528 5.132   -2.371  1.00 0.00 ? 107 ILE A HG22 2  
ATOM 4072  H HG23 . ILE A 1 107 ? 115.997 4.934   -3.227  1.00 0.00 ? 107 ILE A HG23 2  
ATOM 4073  H HD11 . ILE A 1 107 ? 118.115 2.299   -6.079  1.00 0.00 ? 107 ILE A HD11 2  
ATOM 4074  H HD12 . ILE A 1 107 ? 118.445 1.126   -4.805  1.00 0.00 ? 107 ILE A HD12 2  
ATOM 4075  H HD13 . ILE A 1 107 ? 119.550 2.475   -5.067  1.00 0.00 ? 107 ILE A HD13 2  
ATOM 4076  N N    . PHE A 1 108 ? 114.859 5.785   -5.684  1.00 0.00 ? 108 PHE A N    2  
ATOM 4077  C CA   . PHE A 1 108 ? 113.397 5.767   -5.678  1.00 0.00 ? 108 PHE A CA   2  
ATOM 4078  C C    . PHE A 1 108 ? 112.888 5.217   -7.010  1.00 0.00 ? 108 PHE A C    2  
ATOM 4079  O O    . PHE A 1 108 ? 112.048 4.314   -7.046  1.00 0.00 ? 108 PHE A O    2  
ATOM 4080  C CB   . PHE A 1 108 ? 112.845 7.180   -5.432  1.00 0.00 ? 108 PHE A CB   2  
ATOM 4081  C CG   . PHE A 1 108 ? 111.340 7.253   -5.336  1.00 0.00 ? 108 PHE A CG   2  
ATOM 4082  C CD1  . PHE A 1 108 ? 110.696 7.011   -4.130  1.00 0.00 ? 108 PHE A CD1  2  
ATOM 4083  C CD2  . PHE A 1 108 ? 110.571 7.567   -6.449  1.00 0.00 ? 108 PHE A CD2  2  
ATOM 4084  C CE1  . PHE A 1 108 ? 109.319 7.082   -4.038  1.00 0.00 ? 108 PHE A CE1  2  
ATOM 4085  C CE2  . PHE A 1 108 ? 109.195 7.637   -6.360  1.00 0.00 ? 108 PHE A CE2  2  
ATOM 4086  C CZ   . PHE A 1 108 ? 108.569 7.394   -5.154  1.00 0.00 ? 108 PHE A CZ   2  
ATOM 4087  H H    . PHE A 1 108 ? 115.326 6.648   -5.675  1.00 0.00 ? 108 PHE A H    2  
ATOM 4088  H HA   . PHE A 1 108 ? 113.073 5.113   -4.879  1.00 0.00 ? 108 PHE A HA   2  
ATOM 4089  H HB2  . PHE A 1 108 ? 113.252 7.557   -4.505  1.00 0.00 ? 108 PHE A HB2  2  
ATOM 4090  H HB3  . PHE A 1 108 ? 113.160 7.826   -6.241  1.00 0.00 ? 108 PHE A HB3  2  
ATOM 4091  H HD1  . PHE A 1 108 ? 111.282 6.766   -3.256  1.00 0.00 ? 108 PHE A HD1  2  
ATOM 4092  H HD2  . PHE A 1 108 ? 111.059 7.757   -7.394  1.00 0.00 ? 108 PHE A HD2  2  
ATOM 4093  H HE1  . PHE A 1 108 ? 108.830 6.892   -3.093  1.00 0.00 ? 108 PHE A HE1  2  
ATOM 4094  H HE2  . PHE A 1 108 ? 108.608 7.883   -7.234  1.00 0.00 ? 108 PHE A HE2  2  
ATOM 4095  H HZ   . PHE A 1 108 ? 107.492 7.449   -5.083  1.00 0.00 ? 108 PHE A HZ   2  
ATOM 4096  N N    . ASN A 1 109 ? 113.419 5.765   -8.102  1.00 0.00 ? 109 ASN A N    2  
ATOM 4097  C CA   . ASN A 1 109 ? 113.094 5.294   -9.449  1.00 0.00 ? 109 ASN A CA   2  
ATOM 4098  C C    . ASN A 1 109 ? 113.498 3.831   -9.615  1.00 0.00 ? 109 ASN A C    2  
ATOM 4099  O O    . ASN A 1 109 ? 112.720 3.007   -10.103 1.00 0.00 ? 109 ASN A O    2  
ATOM 4100  C CB   . ASN A 1 109 ? 113.797 6.171   -10.500 1.00 0.00 ? 109 ASN A CB   2  
ATOM 4101  C CG   . ASN A 1 109 ? 113.893 5.507   -11.868 1.00 0.00 ? 109 ASN A CG   2  
ATOM 4102  O OD1  . ASN A 1 109 ? 112.958 5.554   -12.669 1.00 0.00 ? 109 ASN A OD1  2  
ATOM 4103  N ND2  . ASN A 1 109 ? 115.035 4.895   -12.150 1.00 0.00 ? 109 ASN A ND2  2  
ATOM 4104  H H    . ASN A 1 109 ? 114.054 6.508   -7.999  1.00 0.00 ? 109 ASN A H    2  
ATOM 4105  H HA   . ASN A 1 109 ? 112.023 5.377   -9.580  1.00 0.00 ? 109 ASN A HA   2  
ATOM 4106  H HB2  . ASN A 1 109 ? 113.250 7.096   -10.612 1.00 0.00 ? 109 ASN A HB2  2  
ATOM 4107  H HB3  . ASN A 1 109 ? 114.799 6.394   -10.159 1.00 0.00 ? 109 ASN A HB3  2  
ATOM 4108  H HD21 . ASN A 1 109 ? 115.745 4.903   -11.474 1.00 0.00 ? 109 ASN A HD21 2  
ATOM 4109  H HD22 . ASN A 1 109 ? 115.131 4.467   -13.030 1.00 0.00 ? 109 ASN A HD22 2  
ATOM 4110  N N    . LEU A 1 110 ? 114.719 3.520   -9.191  1.00 0.00 ? 110 LEU A N    2  
ATOM 4111  C CA   . LEU A 1 110 ? 115.248 2.164   -9.269  1.00 0.00 ? 110 LEU A CA   2  
ATOM 4112  C C    . LEU A 1 110 ? 114.405 1.224   -8.404  1.00 0.00 ? 110 LEU A C    2  
ATOM 4113  O O    . LEU A 1 110 ? 114.078 0.108   -8.815  1.00 0.00 ? 110 LEU A O    2  
ATOM 4114  C CB   . LEU A 1 110 ? 116.722 2.170   -8.817  1.00 0.00 ? 110 LEU A CB   2  
ATOM 4115  C CG   . LEU A 1 110 ? 117.555 0.905   -9.118  1.00 0.00 ? 110 LEU A CG   2  
ATOM 4116  C CD1  . LEU A 1 110 ? 117.182 -0.258  -8.197  1.00 0.00 ? 110 LEU A CD1  2  
ATOM 4117  C CD2  . LEU A 1 110 ? 117.414 0.500   -10.585 1.00 0.00 ? 110 LEU A CD2  2  
ATOM 4118  H H    . LEU A 1 110 ? 115.287 4.226   -8.814  1.00 0.00 ? 110 LEU A H    2  
ATOM 4119  H HA   . LEU A 1 110 ? 115.192 1.842   -10.300 1.00 0.00 ? 110 LEU A HA   2  
ATOM 4120  H HB2  . LEU A 1 110 ? 117.210 3.009   -9.294  1.00 0.00 ? 110 LEU A HB2  2  
ATOM 4121  H HB3  . LEU A 1 110 ? 116.742 2.338   -7.748  1.00 0.00 ? 110 LEU A HB3  2  
ATOM 4122  H HG   . LEU A 1 110 ? 118.595 1.135   -8.942  1.00 0.00 ? 110 LEU A HG   2  
ATOM 4123  H HD11 . LEU A 1 110 ? 116.149 -0.530  -8.354  1.00 0.00 ? 110 LEU A HD11 2  
ATOM 4124  H HD12 . LEU A 1 110 ? 117.323 0.039   -7.167  1.00 0.00 ? 110 LEU A HD12 2  
ATOM 4125  H HD13 . LEU A 1 110 ? 117.815 -1.106  -8.414  1.00 0.00 ? 110 LEU A HD13 2  
ATOM 4126  H HD21 . LEU A 1 110 ? 117.726 1.319   -11.217 1.00 0.00 ? 110 LEU A HD21 2  
ATOM 4127  H HD22 . LEU A 1 110 ? 116.382 0.256   -10.798 1.00 0.00 ? 110 LEU A HD22 2  
ATOM 4128  H HD23 . LEU A 1 110 ? 118.035 -0.361  -10.783 1.00 0.00 ? 110 LEU A HD23 2  
ATOM 4129  N N    . MET A 1 111 ? 114.042 1.700   -7.215  1.00 0.00 ? 111 MET A N    2  
ATOM 4130  C CA   . MET A 1 111 ? 113.274 0.908   -6.257  1.00 0.00 ? 111 MET A CA   2  
ATOM 4131  C C    . MET A 1 111 ? 111.931 0.534   -6.855  1.00 0.00 ? 111 MET A C    2  
ATOM 4132  O O    . MET A 1 111 ? 111.488 -0.604  -6.738  1.00 0.00 ? 111 MET A O    2  
ATOM 4133  C CB   . MET A 1 111 ? 113.043 1.688   -4.955  1.00 0.00 ? 111 MET A CB   2  
ATOM 4134  C CG   . MET A 1 111 ? 112.571 0.825   -3.794  1.00 0.00 ? 111 MET A CG   2  
ATOM 4135  S SD   . MET A 1 111 ? 111.801 1.782   -2.476  1.00 0.00 ? 111 MET A SD   2  
ATOM 4136  C CE   . MET A 1 111 ? 113.141 2.881   -2.038  1.00 0.00 ? 111 MET A CE   2  
ATOM 4137  H H    . MET A 1 111 ? 114.295 2.614   -6.976  1.00 0.00 ? 111 MET A H    2  
ATOM 4138  H HA   . MET A 1 111 ? 113.830 0.006   -6.041  1.00 0.00 ? 111 MET A HA   2  
ATOM 4139  H HB2  . MET A 1 111 ? 113.970 2.160   -4.665  1.00 0.00 ? 111 MET A HB2  2  
ATOM 4140  H HB3  . MET A 1 111 ? 112.302 2.455   -5.131  1.00 0.00 ? 111 MET A HB3  2  
ATOM 4141  H HG2  . MET A 1 111 ? 111.857 0.102   -4.158  1.00 0.00 ? 111 MET A HG2  2  
ATOM 4142  H HG3  . MET A 1 111 ? 113.430 0.309   -3.385  1.00 0.00 ? 111 MET A HG3  2  
ATOM 4143  H HE1  . MET A 1 111 ? 113.993 2.299   -1.715  1.00 0.00 ? 111 MET A HE1  2  
ATOM 4144  H HE2  . MET A 1 111 ? 112.825 3.532   -1.237  1.00 0.00 ? 111 MET A HE2  2  
ATOM 4145  H HE3  . MET A 1 111 ? 113.417 3.474   -2.897  1.00 0.00 ? 111 MET A HE3  2  
ATOM 4146  N N    . LYS A 1 112 ? 111.290 1.510   -7.494  1.00 0.00 ? 112 LYS A N    2  
ATOM 4147  C CA   . LYS A 1 112 ? 110.005 1.293   -8.142  1.00 0.00 ? 112 LYS A CA   2  
ATOM 4148  C C    . LYS A 1 112 ? 110.109 0.130   -9.124  1.00 0.00 ? 112 LYS A C    2  
ATOM 4149  O O    . LYS A 1 112 ? 109.527 -0.932  -8.905  1.00 0.00 ? 112 LYS A O    2  
ATOM 4150  C CB   . LYS A 1 112 ? 109.549 2.572   -8.860  1.00 0.00 ? 112 LYS A CB   2  
ATOM 4151  C CG   . LYS A 1 112 ? 108.200 2.445   -9.562  1.00 0.00 ? 112 LYS A CG   2  
ATOM 4152  C CD   . LYS A 1 112 ? 107.802 3.741   -10.262 1.00 0.00 ? 112 LYS A CD   2  
ATOM 4153  C CE   . LYS A 1 112 ? 106.497 3.592   -11.035 1.00 0.00 ? 112 LYS A CE   2  
ATOM 4154  N NZ   . LYS A 1 112 ? 106.139 4.835   -11.765 1.00 0.00 ? 112 LYS A NZ   2  
ATOM 4155  H H    . LYS A 1 112 ? 111.697 2.403   -7.529  1.00 0.00 ? 112 LYS A H    2  
ATOM 4156  H HA   . LYS A 1 112 ? 109.284 1.042   -7.375  1.00 0.00 ? 112 LYS A HA   2  
ATOM 4157  H HB2  . LYS A 1 112 ? 109.479 3.370   -8.133  1.00 0.00 ? 112 LYS A HB2  2  
ATOM 4158  H HB3  . LYS A 1 112 ? 110.293 2.839   -9.599  1.00 0.00 ? 112 LYS A HB3  2  
ATOM 4159  H HG2  . LYS A 1 112 ? 108.263 1.656   -10.299 1.00 0.00 ? 112 LYS A HG2  2  
ATOM 4160  H HG3  . LYS A 1 112 ? 107.445 2.194   -8.829  1.00 0.00 ? 112 LYS A HG3  2  
ATOM 4161  H HD2  . LYS A 1 112 ? 107.681 4.518   -9.521  1.00 0.00 ? 112 LYS A HD2  2  
ATOM 4162  H HD3  . LYS A 1 112 ? 108.587 4.022   -10.952 1.00 0.00 ? 112 LYS A HD3  2  
ATOM 4163  H HE2  . LYS A 1 112 ? 106.603 2.787   -11.748 1.00 0.00 ? 112 LYS A HE2  2  
ATOM 4164  H HE3  . LYS A 1 112 ? 105.704 3.352   -10.340 1.00 0.00 ? 112 LYS A HE3  2  
ATOM 4165  H HZ1  . LYS A 1 112 ? 105.296 4.676   -12.355 1.00 0.00 ? 112 LYS A HZ1  2  
ATOM 4166  H HZ2  . LYS A 1 112 ? 106.923 5.129   -12.380 1.00 0.00 ? 112 LYS A HZ2  2  
ATOM 4167  H HZ3  . LYS A 1 112 ? 105.937 5.602   -11.094 1.00 0.00 ? 112 LYS A HZ3  2  
ATOM 4168  N N    . TYR A 1 113 ? 110.888 0.325   -10.182 1.00 0.00 ? 113 TYR A N    2  
ATOM 4169  C CA   . TYR A 1 113 ? 111.113 -0.720  -11.175 1.00 0.00 ? 113 TYR A CA   2  
ATOM 4170  C C    . TYR A 1 113 ? 111.486 -2.042  -10.495 1.00 0.00 ? 113 TYR A C    2  
ATOM 4171  O O    . TYR A 1 113 ? 110.672 -2.969  -10.418 1.00 0.00 ? 113 TYR A O    2  
ATOM 4172  C CB   . TYR A 1 113 ? 112.214 -0.276  -12.158 1.00 0.00 ? 113 TYR A CB   2  
ATOM 4173  C CG   . TYR A 1 113 ? 112.819 -1.403  -12.983 1.00 0.00 ? 113 TYR A CG   2  
ATOM 4174  C CD1  . TYR A 1 113 ? 112.096 -2.031  -13.992 1.00 0.00 ? 113 TYR A CD1  2  
ATOM 4175  C CD2  . TYR A 1 113 ? 114.121 -1.837  -12.743 1.00 0.00 ? 113 TYR A CD2  2  
ATOM 4176  C CE1  . TYR A 1 113 ? 112.652 -3.058  -14.734 1.00 0.00 ? 113 TYR A CE1  2  
ATOM 4177  C CE2  . TYR A 1 113 ? 114.681 -2.859  -13.481 1.00 0.00 ? 113 TYR A CE2  2  
ATOM 4178  C CZ   . TYR A 1 113 ? 113.945 -3.467  -14.473 1.00 0.00 ? 113 TYR A CZ   2  
ATOM 4179  O OH   . TYR A 1 113 ? 114.504 -4.491  -15.206 1.00 0.00 ? 113 TYR A OH   2  
ATOM 4180  H H    . TYR A 1 113 ? 111.331 1.194   -10.294 1.00 0.00 ? 113 TYR A H    2  
ATOM 4181  H HA   . TYR A 1 113 ? 110.190 -0.858  -11.721 1.00 0.00 ? 113 TYR A HA   2  
ATOM 4182  H HB2  . TYR A 1 113 ? 111.799 0.446   -12.845 1.00 0.00 ? 113 TYR A HB2  2  
ATOM 4183  H HB3  . TYR A 1 113 ? 113.013 0.193   -11.599 1.00 0.00 ? 113 TYR A HB3  2  
ATOM 4184  H HD1  . TYR A 1 113 ? 111.085 -1.708  -14.195 1.00 0.00 ? 113 TYR A HD1  2  
ATOM 4185  H HD2  . TYR A 1 113 ? 114.698 -1.361  -11.963 1.00 0.00 ? 113 TYR A HD2  2  
ATOM 4186  H HE1  . TYR A 1 113 ? 112.076 -3.533  -15.515 1.00 0.00 ? 113 TYR A HE1  2  
ATOM 4187  H HE2  . TYR A 1 113 ? 115.692 -3.180  -13.277 1.00 0.00 ? 113 TYR A HE2  2  
ATOM 4188  H HH   . TYR A 1 113 ? 114.336 -4.341  -16.145 1.00 0.00 ? 113 TYR A HH   2  
ATOM 4189  N N    . ASP A 1 114 ? 112.694 -2.089  -9.951  1.00 0.00 ? 114 ASP A N    2  
ATOM 4190  C CA   . ASP A 1 114 ? 113.250 -3.317  -9.395  1.00 0.00 ? 114 ASP A CA   2  
ATOM 4191  C C    . ASP A 1 114 ? 112.454 -3.796  -8.182  1.00 0.00 ? 114 ASP A C    2  
ATOM 4192  O O    . ASP A 1 114 ? 111.671 -4.744  -8.271  1.00 0.00 ? 114 ASP A O    2  
ATOM 4193  C CB   . ASP A 1 114 ? 114.726 -3.098  -9.016  1.00 0.00 ? 114 ASP A CB   2  
ATOM 4194  C CG   . ASP A 1 114 ? 115.355 -4.304  -8.329  1.00 0.00 ? 114 ASP A CG   2  
ATOM 4195  O OD1  . ASP A 1 114 ? 115.851 -5.211  -9.035  1.00 0.00 ? 114 ASP A OD1  2  
ATOM 4196  O OD2  . ASP A 1 114 ? 115.360 -4.351  -7.080  1.00 0.00 ? 114 ASP A OD2  2  
ATOM 4197  H H    . ASP A 1 114 ? 113.228 -1.267  -9.910  1.00 0.00 ? 114 ASP A H    2  
ATOM 4198  H HA   . ASP A 1 114 ? 113.199 -4.077  -10.163 1.00 0.00 ? 114 ASP A HA   2  
ATOM 4199  H HB2  . ASP A 1 114 ? 115.290 -2.885  -9.912  1.00 0.00 ? 114 ASP A HB2  2  
ATOM 4200  H HB3  . ASP A 1 114 ? 114.794 -2.249  -8.349  1.00 0.00 ? 114 ASP A HB3  2  
ATOM 4201  N N    . SER A 1 115 ? 112.627 -3.105  -7.065  1.00 0.00 ? 115 SER A N    2  
ATOM 4202  C CA   . SER A 1 115 ? 112.153 -3.588  -5.775  1.00 0.00 ? 115 SER A CA   2  
ATOM 4203  C C    . SER A 1 115 ? 110.623 -3.656  -5.684  1.00 0.00 ? 115 SER A C    2  
ATOM 4204  O O    . SER A 1 115 ? 110.088 -4.574  -5.061  1.00 0.00 ? 115 SER A O    2  
ATOM 4205  C CB   . SER A 1 115 ? 112.720 -2.707  -4.661  1.00 0.00 ? 115 SER A CB   2  
ATOM 4206  O OG   . SER A 1 115 ? 114.137 -2.647  -4.734  1.00 0.00 ? 115 SER A OG   2  
ATOM 4207  H H    . SER A 1 115 ? 113.081 -2.238  -7.109  1.00 0.00 ? 115 SER A H    2  
ATOM 4208  H HA   . SER A 1 115 ? 112.543 -4.588  -5.645  1.00 0.00 ? 115 SER A HA   2  
ATOM 4209  H HB2  . SER A 1 115 ? 112.325 -1.706  -4.757  1.00 0.00 ? 115 SER A HB2  2  
ATOM 4210  H HB3  . SER A 1 115 ? 112.439 -3.115  -3.701  1.00 0.00 ? 115 SER A HB3  2  
ATOM 4211  H HG   . SER A 1 115 ? 114.451 -3.226  -5.445  1.00 0.00 ? 115 SER A HG   2  
ATOM 4212  N N    . TYR A 1 116 ? 109.913 -2.716  -6.312  1.00 0.00 ? 116 TYR A N    2  
ATOM 4213  C CA   . TYR A 1 116 ? 108.458 -2.671  -6.188  1.00 0.00 ? 116 TYR A CA   2  
ATOM 4214  C C    . TYR A 1 116 ? 107.827 -3.766  -7.042  1.00 0.00 ? 116 TYR A C    2  
ATOM 4215  O O    . TYR A 1 116 ? 106.853 -4.398  -6.623  1.00 0.00 ? 116 TYR A O    2  
ATOM 4216  C CB   . TYR A 1 116 ? 107.920 -1.282  -6.563  1.00 0.00 ? 116 TYR A CB   2  
ATOM 4217  C CG   . TYR A 1 116 ? 106.407 -1.143  -6.502  1.00 0.00 ? 116 TYR A CG   2  
ATOM 4218  C CD1  . TYR A 1 116 ? 105.733 -1.141  -5.285  1.00 0.00 ? 116 TYR A CD1  2  
ATOM 4219  C CD2  . TYR A 1 116 ? 105.656 -0.997  -7.666  1.00 0.00 ? 116 TYR A CD2  2  
ATOM 4220  C CE1  . TYR A 1 116 ? 104.359 -1.000  -5.231  1.00 0.00 ? 116 TYR A CE1  2  
ATOM 4221  C CE2  . TYR A 1 116 ? 104.284 -0.858  -7.617  1.00 0.00 ? 116 TYR A CE2  2  
ATOM 4222  C CZ   . TYR A 1 116 ? 103.639 -0.859  -6.400  1.00 0.00 ? 116 TYR A CZ   2  
ATOM 4223  O OH   . TYR A 1 116 ? 102.270 -0.718  -6.354  1.00 0.00 ? 116 TYR A OH   2  
ATOM 4224  H H    . TYR A 1 116 ? 110.368 -2.059  -6.888  1.00 0.00 ? 116 TYR A H    2  
ATOM 4225  H HA   . TYR A 1 116 ? 108.216 -2.868  -5.152  1.00 0.00 ? 116 TYR A HA   2  
ATOM 4226  H HB2  . TYR A 1 116 ? 108.342 -0.551  -5.889  1.00 0.00 ? 116 TYR A HB2  2  
ATOM 4227  H HB3  . TYR A 1 116 ? 108.232 -1.048  -7.567  1.00 0.00 ? 116 TYR A HB3  2  
ATOM 4228  H HD1  . TYR A 1 116 ? 106.299 -1.253  -4.370  1.00 0.00 ? 116 TYR A HD1  2  
ATOM 4229  H HD2  . TYR A 1 116 ? 106.162 -0.997  -8.621  1.00 0.00 ? 116 TYR A HD2  2  
ATOM 4230  H HE1  . TYR A 1 116 ? 103.855 -1.001  -4.276  1.00 0.00 ? 116 TYR A HE1  2  
ATOM 4231  H HE2  . TYR A 1 116 ? 103.720 -0.747  -8.533  1.00 0.00 ? 116 TYR A HE2  2  
ATOM 4232  H HH   . TYR A 1 116 ? 101.870 -1.240  -7.054  1.00 0.00 ? 116 TYR A HH   2  
ATOM 4233  N N    . SER A 1 117 ? 108.393 -4.014  -8.226  1.00 0.00 ? 117 SER A N    2  
ATOM 4234  C CA   . SER A 1 117 ? 107.934 -5.123  -9.053  1.00 0.00 ? 117 SER A CA   2  
ATOM 4235  C C    . SER A 1 117 ? 108.202 -6.446  -8.330  1.00 0.00 ? 117 SER A C    2  
ATOM 4236  O O    . SER A 1 117 ? 107.341 -7.326  -8.277  1.00 0.00 ? 117 SER A O    2  
ATOM 4237  C CB   . SER A 1 117 ? 108.630 -5.106  -10.420 1.00 0.00 ? 117 SER A CB   2  
ATOM 4238  O OG   . SER A 1 117 ? 108.145 -6.143  -11.261 1.00 0.00 ? 117 SER A OG   2  
ATOM 4239  H H    . SER A 1 117 ? 109.129 -3.437  -8.553  1.00 0.00 ? 117 SER A H    2  
ATOM 4240  H HA   . SER A 1 117 ? 106.867 -5.012  -9.196  1.00 0.00 ? 117 SER A HA   2  
ATOM 4241  H HB2  . SER A 1 117 ? 108.447 -4.157  -10.903 1.00 0.00 ? 117 SER A HB2  2  
ATOM 4242  H HB3  . SER A 1 117 ? 109.694 -5.239  -10.283 1.00 0.00 ? 117 SER A HB3  2  
ATOM 4243  H HG   . SER A 1 117 ? 107.177 -6.135  -11.249 1.00 0.00 ? 117 SER A HG   2  
ATOM 4244  N N    . ARG A 1 118 ? 109.397 -6.558  -7.748  1.00 0.00 ? 118 ARG A N    2  
ATOM 4245  C CA   . ARG A 1 118 ? 109.803 -7.759  -7.015  1.00 0.00 ? 118 ARG A CA   2  
ATOM 4246  C C    . ARG A 1 118 ? 108.917 -7.979  -5.791  1.00 0.00 ? 118 ARG A C    2  
ATOM 4247  O O    . ARG A 1 118 ? 108.570 -9.115  -5.460  1.00 0.00 ? 118 ARG A O    2  
ATOM 4248  C CB   . ARG A 1 118 ? 111.273 -7.642  -6.588  1.00 0.00 ? 118 ARG A CB   2  
ATOM 4249  C CG   . ARG A 1 118 ? 112.246 -7.592  -7.761  1.00 0.00 ? 118 ARG A CG   2  
ATOM 4250  C CD   . ARG A 1 118 ? 113.638 -7.157  -7.321  1.00 0.00 ? 118 ARG A CD   2  
ATOM 4251  N NE   . ARG A 1 118 ? 114.219 -8.068  -6.339  1.00 0.00 ? 118 ARG A NE   2  
ATOM 4252  C CZ   . ARG A 1 118 ? 115.333 -7.822  -5.650  1.00 0.00 ? 118 ARG A CZ   2  
ATOM 4253  N NH1  . ARG A 1 118 ? 115.975 -6.668  -5.784  1.00 0.00 ? 118 ARG A NH1  2  
ATOM 4254  N NH2  . ARG A 1 118 ? 115.795 -8.732  -4.809  1.00 0.00 ? 118 ARG A NH2  2  
ATOM 4255  H H    . ARG A 1 118 ? 110.027 -5.807  -7.814  1.00 0.00 ? 118 ARG A H    2  
ATOM 4256  H HA   . ARG A 1 118 ? 109.697 -8.606  -7.680  1.00 0.00 ? 118 ARG A HA   2  
ATOM 4257  H HB2  . ARG A 1 118 ? 111.395 -6.739  -6.005  1.00 0.00 ? 118 ARG A HB2  2  
ATOM 4258  H HB3  . ARG A 1 118 ? 111.528 -8.494  -5.973  1.00 0.00 ? 118 ARG A HB3  2  
ATOM 4259  H HG2  . ARG A 1 118 ? 112.310 -8.574  -8.206  1.00 0.00 ? 118 ARG A HG2  2  
ATOM 4260  H HG3  . ARG A 1 118 ? 111.874 -6.888  -8.494  1.00 0.00 ? 118 ARG A HG3  2  
ATOM 4261  H HD2  . ARG A 1 118 ? 114.281 -7.124  -8.189  1.00 0.00 ? 118 ARG A HD2  2  
ATOM 4262  H HD3  . ARG A 1 118 ? 113.572 -6.169  -6.888  1.00 0.00 ? 118 ARG A HD3  2  
ATOM 4263  H HE   . ARG A 1 118 ? 113.754 -8.920  -6.190  1.00 0.00 ? 118 ARG A HE   2  
ATOM 4264  H HH11 . ARG A 1 118 ? 115.627 -5.960  -6.411  1.00 0.00 ? 118 ARG A HH11 2  
ATOM 4265  H HH12 . ARG A 1 118 ? 116.807 -6.492  -5.249  1.00 0.00 ? 118 ARG A HH12 2  
ATOM 4266  H HH21 . ARG A 1 118 ? 115.306 -9.602  -4.691  1.00 0.00 ? 118 ARG A HH21 2  
ATOM 4267  H HH22 . ARG A 1 118 ? 116.637 -8.557  -4.289  1.00 0.00 ? 118 ARG A HH22 2  
ATOM 4268  N N    . PHE A 1 119 ? 108.552 -6.884  -5.129  1.00 0.00 ? 119 PHE A N    2  
ATOM 4269  C CA   . PHE A 1 119 ? 107.711 -6.941  -3.936  1.00 0.00 ? 119 PHE A CA   2  
ATOM 4270  C C    . PHE A 1 119 ? 106.346 -7.539  -4.275  1.00 0.00 ? 119 PHE A C    2  
ATOM 4271  O O    . PHE A 1 119 ? 105.913 -8.510  -3.659  1.00 0.00 ? 119 PHE A O    2  
ATOM 4272  C CB   . PHE A 1 119 ? 107.554 -5.538  -3.334  1.00 0.00 ? 119 PHE A CB   2  
ATOM 4273  C CG   . PHE A 1 119 ? 106.804 -5.508  -2.024  1.00 0.00 ? 119 PHE A CG   2  
ATOM 4274  C CD1  . PHE A 1 119 ? 107.389 -5.997  -0.862  1.00 0.00 ? 119 PHE A CD1  2  
ATOM 4275  C CD2  . PHE A 1 119 ? 105.519 -4.985  -1.951  1.00 0.00 ? 119 PHE A CD2  2  
ATOM 4276  C CE1  . PHE A 1 119 ? 106.709 -5.961  0.340   1.00 0.00 ? 119 PHE A CE1  2  
ATOM 4277  C CE2  . PHE A 1 119 ? 104.837 -4.950  -0.751  1.00 0.00 ? 119 PHE A CE2  2  
ATOM 4278  C CZ   . PHE A 1 119 ? 105.432 -5.437  0.395   1.00 0.00 ? 119 PHE A CZ   2  
ATOM 4279  H H    . PHE A 1 119 ? 108.863 -6.011  -5.448  1.00 0.00 ? 119 PHE A H    2  
ATOM 4280  H HA   . PHE A 1 119 ? 108.203 -7.580  -3.216  1.00 0.00 ? 119 PHE A HA   2  
ATOM 4281  H HB2  . PHE A 1 119 ? 108.535 -5.118  -3.161  1.00 0.00 ? 119 PHE A HB2  2  
ATOM 4282  H HB3  . PHE A 1 119 ? 107.024 -4.910  -4.038  1.00 0.00 ? 119 PHE A HB3  2  
ATOM 4283  H HD1  . PHE A 1 119 ? 108.391 -6.405  -0.902  1.00 0.00 ? 119 PHE A HD1  2  
ATOM 4284  H HD2  . PHE A 1 119 ? 105.050 -4.602  -2.847  1.00 0.00 ? 119 PHE A HD2  2  
ATOM 4285  H HE1  . PHE A 1 119 ? 107.174 -6.345  1.236   1.00 0.00 ? 119 PHE A HE1  2  
ATOM 4286  H HE2  . PHE A 1 119 ? 103.838 -4.539  -0.709  1.00 0.00 ? 119 PHE A HE2  2  
ATOM 4287  H HZ   . PHE A 1 119 ? 104.898 -5.409  1.336   1.00 0.00 ? 119 PHE A HZ   2  
ATOM 4288  N N    . LEU A 1 120 ? 105.680 -6.962  -5.272  1.00 0.00 ? 120 LEU A N    2  
ATOM 4289  C CA   . LEU A 1 120 ? 104.384 -7.462  -5.720  1.00 0.00 ? 120 LEU A CA   2  
ATOM 4290  C C    . LEU A 1 120 ? 104.522 -8.879  -6.276  1.00 0.00 ? 120 LEU A C    2  
ATOM 4291  O O    . LEU A 1 120 ? 103.590 -9.682  -6.196  1.00 0.00 ? 120 LEU A O    2  
ATOM 4292  C CB   . LEU A 1 120 ? 103.788 -6.532  -6.786  1.00 0.00 ? 120 LEU A CB   2  
ATOM 4293  C CG   . LEU A 1 120 ? 103.683 -5.052  -6.383  1.00 0.00 ? 120 LEU A CG   2  
ATOM 4294  C CD1  . LEU A 1 120 ? 102.920 -4.257  -7.440  1.00 0.00 ? 120 LEU A CD1  2  
ATOM 4295  C CD2  . LEU A 1 120 ? 103.029 -4.906  -5.011  1.00 0.00 ? 120 LEU A CD2  2  
ATOM 4296  H H    . LEU A 1 120 ? 106.064 -6.177  -5.710  1.00 0.00 ? 120 LEU A H    2  
ATOM 4297  H HA   . LEU A 1 120 ? 103.724 -7.487  -4.864  1.00 0.00 ? 120 LEU A HA   2  
ATOM 4298  H HB2  . LEU A 1 120 ? 104.402 -6.599  -7.675  1.00 0.00 ? 120 LEU A HB2  2  
ATOM 4299  H HB3  . LEU A 1 120 ? 102.796 -6.888  -7.028  1.00 0.00 ? 120 LEU A HB3  2  
ATOM 4300  H HG   . LEU A 1 120 ? 104.680 -4.637  -6.320  1.00 0.00 ? 120 LEU A HG   2  
ATOM 4301  H HD11 . LEU A 1 120 ? 101.920 -4.655  -7.542  1.00 0.00 ? 120 LEU A HD11 2  
ATOM 4302  H HD12 . LEU A 1 120 ? 103.434 -4.329  -8.387  1.00 0.00 ? 120 LEU A HD12 2  
ATOM 4303  H HD13 . LEU A 1 120 ? 102.864 -3.220  -7.141  1.00 0.00 ? 120 LEU A HD13 2  
ATOM 4304  H HD21 . LEU A 1 120 ? 102.042 -5.346  -5.031  1.00 0.00 ? 120 LEU A HD21 2  
ATOM 4305  H HD22 . LEU A 1 120 ? 102.949 -3.858  -4.758  1.00 0.00 ? 120 LEU A HD22 2  
ATOM 4306  H HD23 . LEU A 1 120 ? 103.631 -5.408  -4.268  1.00 0.00 ? 120 LEU A HD23 2  
ATOM 4307  N N    . LYS A 1 121 ? 105.697 -9.168  -6.836  1.00 0.00 ? 121 LYS A N    2  
ATOM 4308  C CA   . LYS A 1 121 ? 106.003 -10.485 -7.386  1.00 0.00 ? 121 LYS A CA   2  
ATOM 4309  C C    . LYS A 1 121 ? 105.970 -11.548 -6.289  1.00 0.00 ? 121 LYS A C    2  
ATOM 4310  O O    . LYS A 1 121 ? 105.510 -12.670 -6.518  1.00 0.00 ? 121 LYS A O    2  
ATOM 4311  C CB   . LYS A 1 121 ? 107.368 -10.439 -8.103  1.00 0.00 ? 121 LYS A CB   2  
ATOM 4312  C CG   . LYS A 1 121 ? 107.867 -11.773 -8.678  1.00 0.00 ? 121 LYS A CG   2  
ATOM 4313  C CD   . LYS A 1 121 ? 108.643 -12.605 -7.652  1.00 0.00 ? 121 LYS A CD   2  
ATOM 4314  C CE   . LYS A 1 121 ? 109.794 -11.814 -7.036  1.00 0.00 ? 121 LYS A CE   2  
ATOM 4315  N NZ   . LYS A 1 121 ? 110.589 -12.631 -6.079  1.00 0.00 ? 121 LYS A NZ   2  
ATOM 4316  H H    . LYS A 1 121 ? 106.379 -8.466  -6.886  1.00 0.00 ? 121 LYS A H    2  
ATOM 4317  H HA   . LYS A 1 121 ? 105.242 -10.722 -8.110  1.00 0.00 ? 121 LYS A HA   2  
ATOM 4318  H HB2  . LYS A 1 121 ? 107.295 -9.736  -8.921  1.00 0.00 ? 121 LYS A HB2  2  
ATOM 4319  H HB3  . LYS A 1 121 ? 108.106 -10.072 -7.406  1.00 0.00 ? 121 LYS A HB3  2  
ATOM 4320  H HG2  . LYS A 1 121 ? 107.017 -12.347 -9.016  1.00 0.00 ? 121 LYS A HG2  2  
ATOM 4321  H HG3  . LYS A 1 121 ? 108.514 -11.567 -9.520  1.00 0.00 ? 121 LYS A HG3  2  
ATOM 4322  H HD2  . LYS A 1 121 ? 107.969 -12.911 -6.865  1.00 0.00 ? 121 LYS A HD2  2  
ATOM 4323  H HD3  . LYS A 1 121 ? 109.043 -13.482 -8.143  1.00 0.00 ? 121 LYS A HD3  2  
ATOM 4324  H HE2  . LYS A 1 121 ? 110.443 -11.470 -7.827  1.00 0.00 ? 121 LYS A HE2  2  
ATOM 4325  H HE3  . LYS A 1 121 ? 109.383 -10.962 -6.513  1.00 0.00 ? 121 LYS A HE3  2  
ATOM 4326  H HZ1  . LYS A 1 121 ? 109.972 -13.004 -5.331  1.00 0.00 ? 121 LYS A HZ1  2  
ATOM 4327  H HZ2  . LYS A 1 121 ? 111.333 -12.051 -5.637  1.00 0.00 ? 121 LYS A HZ2  2  
ATOM 4328  H HZ3  . LYS A 1 121 ? 111.036 -13.427 -6.573  1.00 0.00 ? 121 LYS A HZ3  2  
ATOM 4329  N N    . SER A 1 122 ? 106.443 -11.199 -5.095  1.00 0.00 ? 122 SER A N    2  
ATOM 4330  C CA   . SER A 1 122 ? 106.411 -12.130 -3.973  1.00 0.00 ? 122 SER A CA   2  
ATOM 4331  C C    . SER A 1 122 ? 106.514 -11.406 -2.630  1.00 0.00 ? 122 SER A C    2  
ATOM 4332  O O    . SER A 1 122 ? 107.573 -11.387 -2.002  1.00 0.00 ? 122 SER A O    2  
ATOM 4333  C CB   . SER A 1 122 ? 107.525 -13.180 -4.106  1.00 0.00 ? 122 SER A CB   2  
ATOM 4334  O OG   . SER A 1 122 ? 108.799 -12.565 -4.192  1.00 0.00 ? 122 SER A OG   2  
ATOM 4335  H H    . SER A 1 122 ? 106.815 -10.299 -4.964  1.00 0.00 ? 122 SER A H    2  
ATOM 4336  H HA   . SER A 1 122 ? 105.458 -12.639 -4.008  1.00 0.00 ? 122 SER A HA   2  
ATOM 4337  H HB2  . SER A 1 122 ? 107.513 -13.831 -3.244  1.00 0.00 ? 122 SER A HB2  2  
ATOM 4338  H HB3  . SER A 1 122 ? 107.362 -13.766 -5.000  1.00 0.00 ? 122 SER A HB3  2  
ATOM 4339  H HG   . SER A 1 122 ? 108.877 -11.906 -3.488  1.00 0.00 ? 122 SER A HG   2  
ATOM 4340  N N    . ASP A 1 123 ? 105.419 -10.777 -2.219  1.00 0.00 ? 123 ASP A N    2  
ATOM 4341  C CA   . ASP A 1 123 ? 105.287 -10.262 -0.856  1.00 0.00 ? 123 ASP A CA   2  
ATOM 4342  C C    . ASP A 1 123 ? 105.093 -11.448 0.094   1.00 0.00 ? 123 ASP A C    2  
ATOM 4343  O O    . ASP A 1 123 ? 105.058 -12.601 -0.352  1.00 0.00 ? 123 ASP A O    2  
ATOM 4344  C CB   . ASP A 1 123 ? 104.102 -9.268  -0.784  1.00 0.00 ? 123 ASP A CB   2  
ATOM 4345  C CG   . ASP A 1 123 ? 103.685 -8.897  0.636   1.00 0.00 ? 123 ASP A CG   2  
ATOM 4346  O OD1  . ASP A 1 123 ? 104.509 -8.316  1.370   1.00 0.00 ? 123 ASP A OD1  2  
ATOM 4347  O OD2  . ASP A 1 123 ? 102.547 -9.229  1.032   1.00 0.00 ? 123 ASP A OD2  2  
ATOM 4348  H H    . ASP A 1 123 ? 104.681 -10.647 -2.848  1.00 0.00 ? 123 ASP A H    2  
ATOM 4349  H HA   . ASP A 1 123 ? 106.204 -9.748  -0.598  1.00 0.00 ? 123 ASP A HA   2  
ATOM 4350  H HB2  . ASP A 1 123 ? 104.378 -8.359  -1.299  1.00 0.00 ? 123 ASP A HB2  2  
ATOM 4351  H HB3  . ASP A 1 123 ? 103.252 -9.706  -1.286  1.00 0.00 ? 123 ASP A HB3  2  
ATOM 4352  N N    . LEU A 1 124 ? 104.957 -11.188 1.386   1.00 0.00 ? 124 LEU A N    2  
ATOM 4353  C CA   . LEU A 1 124 ? 104.765 -12.244 2.375   1.00 0.00 ? 124 LEU A CA   2  
ATOM 4354  C C    . LEU A 1 124 ? 103.367 -12.885 2.268   1.00 0.00 ? 124 LEU A C    2  
ATOM 4355  O O    . LEU A 1 124 ? 102.800 -13.322 3.278   1.00 0.00 ? 124 LEU A O    2  
ATOM 4356  C CB   . LEU A 1 124 ? 104.996 -11.693 3.794   1.00 0.00 ? 124 LEU A CB   2  
ATOM 4357  C CG   . LEU A 1 124 ? 106.434 -11.225 4.110   1.00 0.00 ? 124 LEU A CG   2  
ATOM 4358  C CD1  . LEU A 1 124 ? 107.444 -12.332 3.822   1.00 0.00 ? 124 LEU A CD1  2  
ATOM 4359  C CD2  . LEU A 1 124 ? 106.793 -9.949  3.347   1.00 0.00 ? 124 LEU A CD2  2  
ATOM 4360  H H    . LEU A 1 124 ? 104.992 -10.254 1.690   1.00 0.00 ? 124 LEU A H    2  
ATOM 4361  H HA   . LEU A 1 124 ? 105.503 -13.010 2.180   1.00 0.00 ? 124 LEU A HA   2  
ATOM 4362  H HB2  . LEU A 1 124 ? 104.327 -10.857 3.945   1.00 0.00 ? 124 LEU A HB2  2  
ATOM 4363  H HB3  . LEU A 1 124 ? 104.735 -12.468 4.501   1.00 0.00 ? 124 LEU A HB3  2  
ATOM 4364  H HG   . LEU A 1 124 ? 106.496 -11.002 5.165   1.00 0.00 ? 124 LEU A HG   2  
ATOM 4365  H HD11 . LEU A 1 124 ? 107.198 -13.205 4.409   1.00 0.00 ? 124 LEU A HD11 2  
ATOM 4366  H HD12 . LEU A 1 124 ? 108.436 -11.993 4.084   1.00 0.00 ? 124 LEU A HD12 2  
ATOM 4367  H HD13 . LEU A 1 124 ? 107.417 -12.585 2.772   1.00 0.00 ? 124 LEU A HD13 2  
ATOM 4368  H HD21 . LEU A 1 124 ? 106.087 -9.170  3.596   1.00 0.00 ? 124 LEU A HD21 2  
ATOM 4369  H HD22 . LEU A 1 124 ? 106.759 -10.139 2.284   1.00 0.00 ? 124 LEU A HD22 2  
ATOM 4370  H HD23 . LEU A 1 124 ? 107.789 -9.632  3.624   1.00 0.00 ? 124 LEU A HD23 2  
ATOM 4371  N N    . PHE A 1 125 ? 102.823 -12.950 1.042   1.00 0.00 ? 125 PHE A N    2  
ATOM 4372  C CA   . PHE A 1 125 ? 101.600 -13.704 0.768   1.00 0.00 ? 125 PHE A CA   2  
ATOM 4373  C C    . PHE A 1 125 ? 101.821 -15.167 1.141   1.00 0.00 ? 125 PHE A C    2  
ATOM 4374  O O    . PHE A 1 125 ? 100.898 -15.874 1.548   1.00 0.00 ? 125 PHE A O    2  
ATOM 4375  C CB   . PHE A 1 125 ? 101.222 -13.643 -0.727  1.00 0.00 ? 125 PHE A CB   2  
ATOM 4376  C CG   . PHE A 1 125 ? 101.201 -12.263 -1.342  1.00 0.00 ? 125 PHE A CG   2  
ATOM 4377  C CD1  . PHE A 1 125 ? 100.369 -11.269 -0.846  1.00 0.00 ? 125 PHE A CD1  2  
ATOM 4378  C CD2  . PHE A 1 125 ? 102.001 -11.971 -2.441  1.00 0.00 ? 125 PHE A CD2  2  
ATOM 4379  C CE1  . PHE A 1 125 ? 100.340 -10.015 -1.431  1.00 0.00 ? 125 PHE A CE1  2  
ATOM 4380  C CE2  . PHE A 1 125 ? 101.975 -10.720 -3.027  1.00 0.00 ? 125 PHE A CE2  2  
ATOM 4381  C CZ   . PHE A 1 125 ? 101.144 -9.740  -2.521  1.00 0.00 ? 125 PHE A CZ   2  
ATOM 4382  H H    . PHE A 1 125 ? 103.249 -12.471 0.308   1.00 0.00 ? 125 PHE A H    2  
ATOM 4383  H HA   . PHE A 1 125 ? 100.798 -13.293 1.365   1.00 0.00 ? 125 PHE A HA   2  
ATOM 4384  H HB2  . PHE A 1 125 ? 101.930 -14.236 -1.288  1.00 0.00 ? 125 PHE A HB2  2  
ATOM 4385  H HB3  . PHE A 1 125 ? 100.237 -14.072 -0.852  1.00 0.00 ? 125 PHE A HB3  2  
ATOM 4386  H HD1  . PHE A 1 125 ? 99.740  -11.480 0.007   1.00 0.00 ? 125 PHE A HD1  2  
ATOM 4387  H HD2  . PHE A 1 125 ? 102.654 -12.735 -2.839  1.00 0.00 ? 125 PHE A HD2  2  
ATOM 4388  H HE1  . PHE A 1 125 ? 99.687  -9.252  -1.037  1.00 0.00 ? 125 PHE A HE1  2  
ATOM 4389  H HE2  . PHE A 1 125 ? 102.606 -10.508 -3.879  1.00 0.00 ? 125 PHE A HE2  2  
ATOM 4390  H HZ   . PHE A 1 125 ? 101.125 -8.757  -2.977  1.00 0.00 ? 125 PHE A HZ   2  
ATOM 4391  N N    . LEU A 1 126 ? 103.071 -15.602 0.990   1.00 0.00 ? 126 LEU A N    2  
ATOM 4392  C CA   . LEU A 1 126 ? 103.458 -16.978 1.238   1.00 0.00 ? 126 LEU A CA   2  
ATOM 4393  C C    . LEU A 1 126 ? 103.717 -17.159 2.721   1.00 0.00 ? 126 LEU A C    2  
ATOM 4394  O O    . LEU A 1 126 ? 104.518 -16.425 3.314   1.00 0.00 ? 126 LEU A O    2  
ATOM 4395  C CB   . LEU A 1 126 ? 104.719 -17.352 0.435   1.00 0.00 ? 126 LEU A CB   2  
ATOM 4396  C CG   . LEU A 1 126 ? 104.601 -17.263 -1.101  1.00 0.00 ? 126 LEU A CG   2  
ATOM 4397  C CD1  . LEU A 1 126 ? 103.371 -18.016 -1.599  1.00 0.00 ? 126 LEU A CD1  2  
ATOM 4398  C CD2  . LEU A 1 126 ? 104.581 -15.810 -1.575  1.00 0.00 ? 126 LEU A CD2  2  
ATOM 4399  H H    . LEU A 1 126 ? 103.760 -14.962 0.734   1.00 0.00 ? 126 LEU A H    2  
ATOM 4400  H HA   . LEU A 1 126 ? 102.640 -17.620 0.938   1.00 0.00 ? 126 LEU A HA   2  
ATOM 4401  H HB2  . LEU A 1 126 ? 105.523 -16.700 0.749   1.00 0.00 ? 126 LEU A HB2  2  
ATOM 4402  H HB3  . LEU A 1 126 ? 104.990 -18.367 0.692   1.00 0.00 ? 126 LEU A HB3  2  
ATOM 4403  H HG   . LEU A 1 126 ? 105.468 -17.739 -1.540  1.00 0.00 ? 126 LEU A HG   2  
ATOM 4404  H HD11 . LEU A 1 126 ? 103.429 -19.049 -1.286  1.00 0.00 ? 126 LEU A HD11 2  
ATOM 4405  H HD12 . LEU A 1 126 ? 103.332 -17.970 -2.677  1.00 0.00 ? 126 LEU A HD12 2  
ATOM 4406  H HD13 . LEU A 1 126 ? 102.478 -17.566 -1.188  1.00 0.00 ? 126 LEU A HD13 2  
ATOM 4407  H HD21 . LEU A 1 126 ? 104.516 -15.783 -2.653  1.00 0.00 ? 126 LEU A HD21 2  
ATOM 4408  H HD22 . LEU A 1 126 ? 105.488 -15.315 -1.259  1.00 0.00 ? 126 LEU A HD22 2  
ATOM 4409  H HD23 . LEU A 1 126 ? 103.727 -15.301 -1.151  1.00 0.00 ? 126 LEU A HD23 2  
ATOM 4410  N N    . LYS A 1 127 ? 103.063 -18.141 3.317   1.00 0.00 ? 127 LYS A N    2  
ATOM 4411  C CA   . LYS A 1 127 ? 103.143 -18.338 4.747   1.00 0.00 ? 127 LYS A CA   2  
ATOM 4412  C C    . LYS A 1 127 ? 104.535 -18.819 5.116   1.00 0.00 ? 127 LYS A C    2  
ATOM 4413  O O    . LYS A 1 127 ? 105.022 -18.557 6.212   1.00 0.00 ? 127 LYS A O    2  
ATOM 4414  C CB   . LYS A 1 127 ? 102.088 -19.349 5.221   1.00 0.00 ? 127 LYS A CB   2  
ATOM 4415  C CG   . LYS A 1 127 ? 100.648 -18.917 4.954   1.00 0.00 ? 127 LYS A CG   2  
ATOM 4416  C CD   . LYS A 1 127 ? 99.654  -19.975 5.424   1.00 0.00 ? 127 LYS A CD   2  
ATOM 4417  C CE   . LYS A 1 127 ? 98.208  -19.547 5.200   1.00 0.00 ? 127 LYS A CE   2  
ATOM 4418  N NZ   . LYS A 1 127 ? 97.896  -19.328 3.761   1.00 0.00 ? 127 LYS A NZ   2  
ATOM 4419  H H    . LYS A 1 127 ? 102.544 -18.772 2.775   1.00 0.00 ? 127 LYS A H    2  
ATOM 4420  H HA   . LYS A 1 127 ? 102.963 -17.382 5.217   1.00 0.00 ? 127 LYS A HA   2  
ATOM 4421  H HB2  . LYS A 1 127 ? 102.257 -20.290 4.716   1.00 0.00 ? 127 LYS A HB2  2  
ATOM 4422  H HB3  . LYS A 1 127 ? 102.205 -19.499 6.286   1.00 0.00 ? 127 LYS A HB3  2  
ATOM 4423  H HG2  . LYS A 1 127 ? 100.456 -17.994 5.484   1.00 0.00 ? 127 LYS A HG2  2  
ATOM 4424  H HG3  . LYS A 1 127 ? 100.520 -18.757 3.893   1.00 0.00 ? 127 LYS A HG3  2  
ATOM 4425  H HD2  . LYS A 1 127 ? 99.833  -20.890 4.877   1.00 0.00 ? 127 LYS A HD2  2  
ATOM 4426  H HD3  . LYS A 1 127 ? 99.807  -20.154 6.480   1.00 0.00 ? 127 LYS A HD3  2  
ATOM 4427  H HE2  . LYS A 1 127 ? 97.555  -20.319 5.582   1.00 0.00 ? 127 LYS A HE2  2  
ATOM 4428  H HE3  . LYS A 1 127 ? 98.029  -18.629 5.741   1.00 0.00 ? 127 LYS A HE3  2  
ATOM 4429  H HZ1  . LYS A 1 127 ? 98.351  -18.458 3.422   1.00 0.00 ? 127 LYS A HZ1  2  
ATOM 4430  H HZ2  . LYS A 1 127 ? 96.868  -19.242 3.626   1.00 0.00 ? 127 LYS A HZ2  2  
ATOM 4431  H HZ3  . LYS A 1 127 ? 98.238  -20.129 3.195   1.00 0.00 ? 127 LYS A HZ3  2  
ATOM 4432  N N    . HIS A 1 128 ? 105.177 -19.499 4.169   1.00 0.00 ? 128 HIS A N    2  
ATOM 4433  C CA   . HIS A 1 128 ? 106.504 -20.052 4.387   1.00 0.00 ? 128 HIS A CA   2  
ATOM 4434  C C    . HIS A 1 128 ? 107.587 -18.973 4.267   1.00 0.00 ? 128 HIS A C    2  
ATOM 4435  O O    . HIS A 1 128 ? 108.758 -19.222 4.547   1.00 0.00 ? 128 HIS A O    2  
ATOM 4436  C CB   . HIS A 1 128 ? 106.779 -21.199 3.404   1.00 0.00 ? 128 HIS A CB   2  
ATOM 4437  C CG   . HIS A 1 128 ? 108.084 -21.897 3.651   1.00 0.00 ? 128 HIS A CG   2  
ATOM 4438  N ND1  . HIS A 1 128 ? 108.970 -22.226 2.651   1.00 0.00 ? 128 HIS A ND1  2  
ATOM 4439  C CD2  . HIS A 1 128 ? 108.650 -22.324 4.805   1.00 0.00 ? 128 HIS A CD2  2  
ATOM 4440  C CE1  . HIS A 1 128 ? 110.022 -22.824 3.177   1.00 0.00 ? 128 HIS A CE1  2  
ATOM 4441  N NE2  . HIS A 1 128 ? 109.855 -22.894 4.485   1.00 0.00 ? 128 HIS A NE2  2  
ATOM 4442  H H    . HIS A 1 128 ? 104.736 -19.643 3.304   1.00 0.00 ? 128 HIS A H    2  
ATOM 4443  H HA   . HIS A 1 128 ? 106.520 -20.445 5.389   1.00 0.00 ? 128 HIS A HA   2  
ATOM 4444  H HB2  . HIS A 1 128 ? 105.989 -21.932 3.486   1.00 0.00 ? 128 HIS A HB2  2  
ATOM 4445  H HB3  . HIS A 1 128 ? 106.794 -20.807 2.396   1.00 0.00 ? 128 HIS A HB3  2  
ATOM 4446  H HD1  . HIS A 1 128 ? 108.848 -22.047 1.690   1.00 0.00 ? 128 HIS A HD1  2  
ATOM 4447  H HD2  . HIS A 1 128 ? 108.231 -22.229 5.797   1.00 0.00 ? 128 HIS A HD2  2  
ATOM 4448  H HE1  . HIS A 1 128 ? 110.877 -23.192 2.631   1.00 0.00 ? 128 HIS A HE1  2  
ATOM 4449  H HE2  . HIS A 1 128 ? 110.577 -23.071 5.128   1.00 0.00 ? 128 HIS A HE2  2  
ATOM 4450  N N    . LYS A 1 129 ? 107.195 -17.781 3.830   1.00 0.00 ? 129 LYS A N    2  
ATOM 4451  C CA   . LYS A 1 129 ? 108.118 -16.646 3.770   1.00 0.00 ? 129 LYS A CA   2  
ATOM 4452  C C    . LYS A 1 129 ? 107.903 -15.730 4.965   1.00 0.00 ? 129 LYS A C    2  
ATOM 4453  O O    . LYS A 1 129 ? 108.836 -15.071 5.437   1.00 0.00 ? 129 LYS A O    2  
ATOM 4454  C CB   . LYS A 1 129 ? 107.948 -15.876 2.453   1.00 0.00 ? 129 LYS A CB   2  
ATOM 4455  C CG   . LYS A 1 129 ? 108.533 -16.612 1.251   1.00 0.00 ? 129 LYS A CG   2  
ATOM 4456  C CD   . LYS A 1 129 ? 110.034 -16.844 1.426   1.00 0.00 ? 129 LYS A CD   2  
ATOM 4457  C CE   . LYS A 1 129 ? 110.633 -17.668 0.293   1.00 0.00 ? 129 LYS A CE   2  
ATOM 4458  N NZ   . LYS A 1 129 ? 112.100 -17.847 0.466   1.00 0.00 ? 129 LYS A NZ   2  
ATOM 4459  H H    . LYS A 1 129 ? 106.267 -17.659 3.544   1.00 0.00 ? 129 LYS A H    2  
ATOM 4460  H HA   . LYS A 1 129 ? 109.126 -17.037 3.818   1.00 0.00 ? 129 LYS A HA   2  
ATOM 4461  H HB2  . LYS A 1 129 ? 106.893 -15.712 2.275   1.00 0.00 ? 129 LYS A HB2  2  
ATOM 4462  H HB3  . LYS A 1 129 ? 108.443 -14.918 2.538   1.00 0.00 ? 129 LYS A HB3  2  
ATOM 4463  H HG2  . LYS A 1 129 ? 108.037 -17.567 1.147   1.00 0.00 ? 129 LYS A HG2  2  
ATOM 4464  H HG3  . LYS A 1 129 ? 108.369 -16.020 0.361   1.00 0.00 ? 129 LYS A HG3  2  
ATOM 4465  H HD2  . LYS A 1 129 ? 110.534 -15.887 1.459   1.00 0.00 ? 129 LYS A HD2  2  
ATOM 4466  H HD3  . LYS A 1 129 ? 110.199 -17.365 2.359   1.00 0.00 ? 129 LYS A HD3  2  
ATOM 4467  H HE2  . LYS A 1 129 ? 110.160 -18.639 0.277   1.00 0.00 ? 129 LYS A HE2  2  
ATOM 4468  H HE3  . LYS A 1 129 ? 110.448 -17.162 -0.645  1.00 0.00 ? 129 LYS A HE3  2  
ATOM 4469  H HZ1  . LYS A 1 129 ? 112.302 -18.305 1.381   1.00 0.00 ? 129 LYS A HZ1  2  
ATOM 4470  H HZ2  . LYS A 1 129 ? 112.578 -16.924 0.442   1.00 0.00 ? 129 LYS A HZ2  2  
ATOM 4471  H HZ3  . LYS A 1 129 ? 112.480 -18.441 -0.297  1.00 0.00 ? 129 LYS A HZ3  2  
ATOM 4472  N N    . ARG A 1 130 ? 106.664 -15.694 5.440   1.00 0.00 ? 130 ARG A N    2  
ATOM 4473  C CA   . ARG A 1 130 ? 106.316 -14.967 6.653   1.00 0.00 ? 130 ARG A CA   2  
ATOM 4474  C C    . ARG A 1 130 ? 106.854 -15.736 7.857   1.00 0.00 ? 130 ARG A C    2  
ATOM 4475  O O    . ARG A 1 130 ? 107.653 -15.223 8.642   1.00 0.00 ? 130 ARG A O    2  
ATOM 4476  C CB   . ARG A 1 130 ? 104.794 -14.819 6.737   1.00 0.00 ? 130 ARG A CB   2  
ATOM 4477  C CG   . ARG A 1 130 ? 104.310 -13.899 7.850   1.00 0.00 ? 130 ARG A CG   2  
ATOM 4478  C CD   . ARG A 1 130 ? 102.794 -13.761 7.828   1.00 0.00 ? 130 ARG A CD   2  
ATOM 4479  N NE   . ARG A 1 130 ? 102.301 -13.396 6.496   1.00 0.00 ? 130 ARG A NE   2  
ATOM 4480  C CZ   . ARG A 1 130 ? 101.126 -12.818 6.260   1.00 0.00 ? 130 ARG A CZ   2  
ATOM 4481  N NH1  . ARG A 1 130 ? 100.303 -12.528 7.264   1.00 0.00 ? 130 ARG A NH1  2  
ATOM 4482  N NH2  . ARG A 1 130 ? 100.774 -12.542 5.013   1.00 0.00 ? 130 ARG A NH2  2  
ATOM 4483  H H    . ARG A 1 130 ? 105.959 -16.176 4.958   1.00 0.00 ? 130 ARG A H    2  
ATOM 4484  H HA   . ARG A 1 130 ? 106.776 -13.989 6.613   1.00 0.00 ? 130 ARG A HA   2  
ATOM 4485  H HB2  . ARG A 1 130 ? 104.435 -14.425 5.796   1.00 0.00 ? 130 ARG A HB2  2  
ATOM 4486  H HB3  . ARG A 1 130 ? 104.358 -15.796 6.892   1.00 0.00 ? 130 ARG A HB3  2  
ATOM 4487  H HG2  . ARG A 1 130 ? 104.613 -14.309 8.804   1.00 0.00 ? 130 ARG A HG2  2  
ATOM 4488  H HG3  . ARG A 1 130 ? 104.754 -12.922 7.719   1.00 0.00 ? 130 ARG A HG3  2  
ATOM 4489  H HD2  . ARG A 1 130 ? 102.352 -14.703 8.121   1.00 0.00 ? 130 ARG A HD2  2  
ATOM 4490  H HD3  . ARG A 1 130 ? 102.504 -12.994 8.533   1.00 0.00 ? 130 ARG A HD3  2  
ATOM 4491  H HE   . ARG A 1 130 ? 102.883 -13.601 5.731   1.00 0.00 ? 130 ARG A HE   2  
ATOM 4492  H HH11 . ARG A 1 130 ? 100.563 -12.745 8.211   1.00 0.00 ? 130 ARG A HH11 2  
ATOM 4493  H HH12 . ARG A 1 130 ? 99.418  -12.086 7.083   1.00 0.00 ? 130 ARG A HH12 2  
ATOM 4494  H HH21 . ARG A 1 130 ? 101.388 -12.773 4.250   1.00 0.00 ? 130 ARG A HH21 2  
ATOM 4495  H HH22 . ARG A 1 130 ? 99.901  -12.082 4.824   1.00 0.00 ? 130 ARG A HH22 2  
ATOM 4496  N N    . THR A 1 131 ? 106.406 -16.979 7.976   1.00 0.00 ? 131 THR A N    2  
ATOM 4497  C CA   . THR A 1 131 ? 106.968 -17.930 8.918   1.00 0.00 ? 131 THR A CA   2  
ATOM 4498  C C    . THR A 1 131 ? 107.846 -18.910 8.140   1.00 0.00 ? 131 THR A C    2  
ATOM 4499  O O    . THR A 1 131 ? 107.341 -19.824 7.487   1.00 0.00 ? 131 THR A O    2  
ATOM 4500  C CB   . THR A 1 131 ? 105.853 -18.691 9.676   1.00 0.00 ? 131 THR A CB   2  
ATOM 4501  O OG1  . THR A 1 131 ? 104.961 -17.747 10.292  1.00 0.00 ? 131 THR A OG1  2  
ATOM 4502  C CG2  . THR A 1 131 ? 106.434 -19.614 10.747  1.00 0.00 ? 131 THR A CG2  2  
ATOM 4503  H H    . THR A 1 131 ? 105.670 -17.274 7.400   1.00 0.00 ? 131 THR A H    2  
ATOM 4504  H HA   . THR A 1 131 ? 107.575 -17.391 9.635   1.00 0.00 ? 131 THR A HA   2  
ATOM 4505  H HB   . THR A 1 131 ? 105.296 -19.288 8.966   1.00 0.00 ? 131 THR A HB   2  
ATOM 4506  H HG1  . THR A 1 131 ? 105.431 -17.279 10.993  1.00 0.00 ? 131 THR A HG1  2  
ATOM 4507  H HG21 . THR A 1 131 ? 106.990 -19.029 11.465  1.00 0.00 ? 131 THR A HG21 2  
ATOM 4508  H HG22 . THR A 1 131 ? 107.092 -20.336 10.286  1.00 0.00 ? 131 THR A HG22 2  
ATOM 4509  H HG23 . THR A 1 131 ? 105.630 -20.132 11.251  1.00 0.00 ? 131 THR A HG23 2  
ATOM 4510  N N    . GLU A 1 132 ? 109.157 -18.686 8.178   1.00 0.00 ? 132 GLU A N    2  
ATOM 4511  C CA   . GLU A 1 132 ? 110.091 -19.447 7.349   1.00 0.00 ? 132 GLU A CA   2  
ATOM 4512  C C    . GLU A 1 132 ? 110.161 -20.907 7.785   1.00 0.00 ? 132 GLU A C    2  
ATOM 4513  O O    . GLU A 1 132 ? 110.620 -21.769 7.033   1.00 0.00 ? 132 GLU A O    2  
ATOM 4514  C CB   . GLU A 1 132 ? 111.473 -18.787 7.366   1.00 0.00 ? 132 GLU A CB   2  
ATOM 4515  C CG   . GLU A 1 132 ? 111.458 -17.380 6.773   1.00 0.00 ? 132 GLU A CG   2  
ATOM 4516  C CD   . GLU A 1 132 ? 112.825 -16.724 6.758   1.00 0.00 ? 132 GLU A CD   2  
ATOM 4517  O OE1  . GLU A 1 132 ? 113.181 -16.064 7.757   1.00 0.00 ? 132 GLU A OE1  2  
ATOM 4518  O OE2  . GLU A 1 132 ? 113.540 -16.850 5.743   1.00 0.00 ? 132 GLU A OE2  2  
ATOM 4519  H H    . GLU A 1 132 ? 109.507 -18.002 8.788   1.00 0.00 ? 132 GLU A H    2  
ATOM 4520  H HA   . GLU A 1 132 ? 109.713 -19.420 6.336   1.00 0.00 ? 132 GLU A HA   2  
ATOM 4521  H HB2  . GLU A 1 132 ? 111.823 -18.726 8.388   1.00 0.00 ? 132 GLU A HB2  2  
ATOM 4522  H HB3  . GLU A 1 132 ? 112.161 -19.391 6.792   1.00 0.00 ? 132 GLU A HB3  2  
ATOM 4523  H HG2  . GLU A 1 132 ? 111.092 -17.437 5.758   1.00 0.00 ? 132 GLU A HG2  2  
ATOM 4524  H HG3  . GLU A 1 132 ? 110.786 -16.766 7.358   1.00 0.00 ? 132 GLU A HG3  2  
ATOM 4525  N N    . GLU A 1 133 ? 109.701 -21.178 8.998   1.00 0.00 ? 133 GLU A N    2  
ATOM 4526  C CA   . GLU A 1 133 ? 109.519 -22.547 9.458   1.00 0.00 ? 133 GLU A CA   2  
ATOM 4527  C C    . GLU A 1 133 ? 108.135 -23.035 9.033   1.00 0.00 ? 133 GLU A C    2  
ATOM 4528  O O    . GLU A 1 133 ? 107.154 -22.299 9.135   1.00 0.00 ? 133 GLU A O    2  
ATOM 4529  C CB   . GLU A 1 133 ? 109.687 -22.629 10.980  1.00 0.00 ? 133 GLU A CB   2  
ATOM 4530  C CG   . GLU A 1 133 ? 111.060 -22.166 11.459  1.00 0.00 ? 133 GLU A CG   2  
ATOM 4531  C CD   . GLU A 1 133 ? 111.248 -22.326 12.957  1.00 0.00 ? 133 GLU A CD   2  
ATOM 4532  O OE1  . GLU A 1 133 ? 110.815 -21.437 13.716  1.00 0.00 ? 133 GLU A OE1  2  
ATOM 4533  O OE2  . GLU A 1 133 ? 111.833 -23.345 13.385  1.00 0.00 ? 133 GLU A OE2  2  
ATOM 4534  H H    . GLU A 1 133 ? 109.473 -20.437 9.598   1.00 0.00 ? 133 GLU A H    2  
ATOM 4535  H HA   . GLU A 1 133 ? 110.271 -23.164 8.982   1.00 0.00 ? 133 GLU A HA   2  
ATOM 4536  H HB2  . GLU A 1 133 ? 108.936 -22.008 11.449  1.00 0.00 ? 133 GLU A HB2  2  
ATOM 4537  H HB3  . GLU A 1 133 ? 109.545 -23.653 11.294  1.00 0.00 ? 133 GLU A HB3  2  
ATOM 4538  H HG2  . GLU A 1 133 ? 111.819 -22.746 10.952  1.00 0.00 ? 133 GLU A HG2  2  
ATOM 4539  H HG3  . GLU A 1 133 ? 111.183 -21.122 11.204  1.00 0.00 ? 133 GLU A HG3  2  
ATOM 4540  N N    . GLU A 1 134 ? 108.053 -24.279 8.574   1.00 0.00 ? 134 GLU A N    2  
ATOM 4541  C CA   . GLU A 1 134 ? 106.824 -24.809 7.977   1.00 0.00 ? 134 GLU A CA   2  
ATOM 4542  C C    . GLU A 1 134 ? 105.799 -25.219 9.040   1.00 0.00 ? 134 GLU A C    2  
ATOM 4543  O O    . GLU A 1 134 ? 104.916 -26.044 8.781   1.00 0.00 ? 134 GLU A O    2  
ATOM 4544  C CB   . GLU A 1 134 ? 107.161 -25.999 7.068   1.00 0.00 ? 134 GLU A CB   2  
ATOM 4545  C CG   . GLU A 1 134 ? 108.138 -25.650 5.950   1.00 0.00 ? 134 GLU A CG   2  
ATOM 4546  C CD   . GLU A 1 134 ? 108.398 -26.814 5.011   1.00 0.00 ? 134 GLU A CD   2  
ATOM 4547  O OE1  . GLU A 1 134 ? 109.265 -27.657 5.321   1.00 0.00 ? 134 GLU A OE1  2  
ATOM 4548  O OE2  . GLU A 1 134 ? 107.736 -26.894 3.954   1.00 0.00 ? 134 GLU A OE2  2  
ATOM 4549  H H    . GLU A 1 134 ? 108.836 -24.866 8.650   1.00 0.00 ? 134 GLU A H    2  
ATOM 4550  H HA   . GLU A 1 134 ? 106.391 -24.026 7.370   1.00 0.00 ? 134 GLU A HA   2  
ATOM 4551  H HB2  . GLU A 1 134 ? 107.598 -26.786 7.668   1.00 0.00 ? 134 GLU A HB2  2  
ATOM 4552  H HB3  . GLU A 1 134 ? 106.248 -26.366 6.619   1.00 0.00 ? 134 GLU A HB3  2  
ATOM 4553  H HG2  . GLU A 1 134 ? 107.730 -24.828 5.378   1.00 0.00 ? 134 GLU A HG2  2  
ATOM 4554  H HG3  . GLU A 1 134 ? 109.076 -25.343 6.392   1.00 0.00 ? 134 GLU A HG3  2  
ATOM 4555  N N    . GLU A 1 135 ? 105.902 -24.626 10.226  1.00 0.00 ? 135 GLU A N    2  
ATOM 4556  C CA   . GLU A 1 135 ? 104.947 -24.870 11.299  1.00 0.00 ? 135 GLU A CA   2  
ATOM 4557  C C    . GLU A 1 135 ? 104.002 -23.675 11.421  1.00 0.00 ? 135 GLU A C    2  
ATOM 4558  O O    . GLU A 1 135 ? 104.392 -22.621 11.931  1.00 0.00 ? 135 GLU A O    2  
ATOM 4559  C CB   . GLU A 1 135 ? 105.673 -25.099 12.635  1.00 0.00 ? 135 GLU A CB   2  
ATOM 4560  C CG   . GLU A 1 135 ? 106.814 -26.112 12.571  1.00 0.00 ? 135 GLU A CG   2  
ATOM 4561  C CD   . GLU A 1 135 ? 106.418 -27.428 11.917  1.00 0.00 ? 135 GLU A CD   2  
ATOM 4562  O OE1  . GLU A 1 135 ? 105.393 -28.020 12.322  1.00 0.00 ? 135 GLU A OE1  2  
ATOM 4563  O OE2  . GLU A 1 135 ? 107.137 -27.881 10.999  1.00 0.00 ? 135 GLU A OE2  2  
ATOM 4564  H H    . GLU A 1 135 ? 106.633 -23.996 10.379  1.00 0.00 ? 135 GLU A H    2  
ATOM 4565  H HA   . GLU A 1 135 ? 104.372 -25.753 11.051  1.00 0.00 ? 135 GLU A HA   2  
ATOM 4566  H HB2  . GLU A 1 135 ? 106.082 -24.156 12.973  1.00 0.00 ? 135 GLU A HB2  2  
ATOM 4567  H HB3  . GLU A 1 135 ? 104.954 -25.446 13.364  1.00 0.00 ? 135 GLU A HB3  2  
ATOM 4568  H HG2  . GLU A 1 135 ? 107.629 -25.679 12.008  1.00 0.00 ? 135 GLU A HG2  2  
ATOM 4569  H HG3  . GLU A 1 135 ? 107.150 -26.317 13.579  1.00 0.00 ? 135 GLU A HG3  2  
ATOM 4570  N N    . GLU A 1 136 ? 102.771 -23.832 10.938  1.00 0.00 ? 136 GLU A N    2  
ATOM 4571  C CA   . GLU A 1 136 ? 101.794 -22.746 10.965  1.00 0.00 ? 136 GLU A CA   2  
ATOM 4572  C C    . GLU A 1 136 ? 101.369 -22.419 12.395  1.00 0.00 ? 136 GLU A C    2  
ATOM 4573  O O    . GLU A 1 136 ? 100.389 -22.970 12.907  1.00 0.00 ? 136 GLU A O    2  
ATOM 4574  C CB   . GLU A 1 136 ? 100.553 -23.081 10.117  1.00 0.00 ? 136 GLU A CB   2  
ATOM 4575  C CG   . GLU A 1 136 ? 100.795 -23.065 8.612   1.00 0.00 ? 136 GLU A CG   2  
ATOM 4576  C CD   . GLU A 1 136 ? 99.515  -23.277 7.814   1.00 0.00 ? 136 GLU A CD   2  
ATOM 4577  O OE1  . GLU A 1 136 ? 98.653  -22.373 7.811   1.00 0.00 ? 136 GLU A OE1  2  
ATOM 4578  O OE2  . GLU A 1 136 ? 99.356  -24.353 7.197   1.00 0.00 ? 136 GLU A OE2  2  
ATOM 4579  H H    . GLU A 1 136 ? 102.511 -24.702 10.564  1.00 0.00 ? 136 GLU A H    2  
ATOM 4580  H HA   . GLU A 1 136 ? 102.271 -21.871 10.543  1.00 0.00 ? 136 GLU A HA   2  
ATOM 4581  H HB2  . GLU A 1 136 ? 100.202 -24.066 10.391  1.00 0.00 ? 136 GLU A HB2  2  
ATOM 4582  H HB3  . GLU A 1 136 ? 99.776  -22.362 10.341  1.00 0.00 ? 136 GLU A HB3  2  
ATOM 4583  H HG2  . GLU A 1 136 ? 101.218 -22.109 8.337   1.00 0.00 ? 136 GLU A HG2  2  
ATOM 4584  H HG3  . GLU A 1 136 ? 101.496 -23.850 8.363   1.00 0.00 ? 136 GLU A HG3  2  
ATOM 4585  N N    . ASP A 1 137 ? 102.133 -21.550 13.049  1.00 0.00 ? 137 ASP A N    2  
ATOM 4586  C CA   . ASP A 1 137 ? 101.755 -21.027 14.358  1.00 0.00 ? 137 ASP A CA   2  
ATOM 4587  C C    . ASP A 1 137 ? 100.773 -19.877 14.172  1.00 0.00 ? 137 ASP A C    2  
ATOM 4588  O O    . ASP A 1 137 ? 101.156 -18.775 13.766  1.00 0.00 ? 137 ASP A O    2  
ATOM 4589  C CB   . ASP A 1 137 ? 102.988 -20.558 15.143  1.00 0.00 ? 137 ASP A CB   2  
ATOM 4590  C CG   . ASP A 1 137 ? 102.630 -20.010 16.519  1.00 0.00 ? 137 ASP A CG   2  
ATOM 4591  O OD1  . ASP A 1 137 ? 102.180 -20.798 17.381  1.00 0.00 ? 137 ASP A OD1  2  
ATOM 4592  O OD2  . ASP A 1 137 ? 102.804 -18.794 16.749  1.00 0.00 ? 137 ASP A OD2  2  
ATOM 4593  H H    . ASP A 1 137 ? 102.978 -21.259 12.643  1.00 0.00 ? 137 ASP A H    2  
ATOM 4594  H HA   . ASP A 1 137 ? 101.266 -21.823 14.908  1.00 0.00 ? 137 ASP A HA   2  
ATOM 4595  H HB2  . ASP A 1 137 ? 103.661 -21.394 15.273  1.00 0.00 ? 137 ASP A HB2  2  
ATOM 4596  H HB3  . ASP A 1 137 ? 103.492 -19.783 14.581  1.00 0.00 ? 137 ASP A HB3  2  
ATOM 4597  N N    . LEU A 1 138 ? 99.503  -20.148 14.438  1.00 0.00 ? 138 LEU A N    2  
ATOM 4598  C CA   . LEU A 1 138 ? 98.432  -19.191 14.186  1.00 0.00 ? 138 LEU A CA   2  
ATOM 4599  C C    . LEU A 1 138 ? 97.909  -18.614 15.502  1.00 0.00 ? 138 LEU A C    2  
ATOM 4600  O O    . LEU A 1 138 ? 98.157  -17.420 15.776  1.00 0.00 ? 138 LEU A O    2  
ATOM 4601  C CB   . LEU A 1 138 ? 97.303  -19.883 13.407  1.00 0.00 ? 138 LEU A CB   2  
ATOM 4602  C CG   . LEU A 1 138 ? 97.752  -20.606 12.123  1.00 0.00 ? 138 LEU A CG   2  
ATOM 4603  C CD1  . LEU A 1 138 ? 96.587  -21.352 11.482  1.00 0.00 ? 138 LEU A CD1  2  
ATOM 4604  C CD2  . LEU A 1 138 ? 98.375  -19.621 11.135  1.00 0.00 ? 138 LEU A CD2  2  
ATOM 4605  O OXT  . LEU A 1 138 ? 97.269  -19.366 16.268  1.00 0.00 ? 138 LEU A OXT  2  
ATOM 4606  H H    . LEU A 1 138 ? 99.275  -21.021 14.823  1.00 0.00 ? 138 LEU A H    2  
ATOM 4607  H HA   . LEU A 1 138 ? 98.833  -18.387 13.582  1.00 0.00 ? 138 LEU A HA   2  
ATOM 4608  H HB2  . LEU A 1 138 ? 96.834  -20.609 14.060  1.00 0.00 ? 138 LEU A HB2  2  
ATOM 4609  H HB3  . LEU A 1 138 ? 96.567  -19.139 13.137  1.00 0.00 ? 138 LEU A HB3  2  
ATOM 4610  H HG   . LEU A 1 138 ? 98.506  -21.337 12.380  1.00 0.00 ? 138 LEU A HG   2  
ATOM 4611  H HD11 . LEU A 1 138 ? 96.191  -22.073 12.182  1.00 0.00 ? 138 LEU A HD11 2  
ATOM 4612  H HD12 . LEU A 1 138 ? 96.932  -21.866 10.596  1.00 0.00 ? 138 LEU A HD12 2  
ATOM 4613  H HD13 . LEU A 1 138 ? 95.812  -20.650 11.210  1.00 0.00 ? 138 LEU A HD13 2  
ATOM 4614  H HD21 . LEU A 1 138 ? 98.682  -20.150 10.244  1.00 0.00 ? 138 LEU A HD21 2  
ATOM 4615  H HD22 . LEU A 1 138 ? 99.237  -19.152 11.587  1.00 0.00 ? 138 LEU A HD22 2  
ATOM 4616  H HD23 . LEU A 1 138 ? 97.650  -18.863 10.871  1.00 0.00 ? 138 LEU A HD23 2  
ATOM 4617  N N    . SER A 1 1   ? 92.826  -5.754  11.036  1.00 0.00 ? 1   SER A N    3  
ATOM 4618  C CA   . SER A 1 1   ? 93.911  -5.562  10.053  1.00 0.00 ? 1   SER A CA   3  
ATOM 4619  C C    . SER A 1 1   ? 94.511  -6.909  9.666   1.00 0.00 ? 1   SER A C    3  
ATOM 4620  O O    . SER A 1 1   ? 94.172  -7.942  10.250  1.00 0.00 ? 1   SER A O    3  
ATOM 4621  C CB   . SER A 1 1   ? 94.993  -4.639  10.631  1.00 0.00 ? 1   SER A CB   3  
ATOM 4622  O OG   . SER A 1 1   ? 96.044  -4.422  9.698   1.00 0.00 ? 1   SER A OG   3  
ATOM 4623  H H1   . SER A 1 1   ? 92.436  -4.839  11.326  1.00 0.00 ? 1   SER A H1   3  
ATOM 4624  H H2   . SER A 1 1   ? 93.191  -6.244  11.877  1.00 0.00 ? 1   SER A H2   3  
ATOM 4625  H H3   . SER A 1 1   ? 92.065  -6.328  10.618  1.00 0.00 ? 1   SER A H3   3  
ATOM 4626  H HA   . SER A 1 1   ? 93.487  -5.104  9.170   1.00 0.00 ? 1   SER A HA   3  
ATOM 4627  H HB2  . SER A 1 1   ? 94.552  -3.685  10.881  1.00 0.00 ? 1   SER A HB2  3  
ATOM 4628  H HB3  . SER A 1 1   ? 95.407  -5.087  11.523  1.00 0.00 ? 1   SER A HB3  3  
ATOM 4629  H HG   . SER A 1 1   ? 95.874  -3.605  9.210   1.00 0.00 ? 1   SER A HG   3  
ATOM 4630  N N    . MET A 1 2   ? 95.406  -6.892  8.684   1.00 0.00 ? 2   MET A N    3  
ATOM 4631  C CA   . MET A 1 2   ? 96.049  -8.106  8.197   1.00 0.00 ? 2   MET A CA   3  
ATOM 4632  C C    . MET A 1 2   ? 97.386  -7.762  7.550   1.00 0.00 ? 2   MET A C    3  
ATOM 4633  O O    . MET A 1 2   ? 97.558  -6.669  7.011   1.00 0.00 ? 2   MET A O    3  
ATOM 4634  C CB   . MET A 1 2   ? 95.140  -8.830  7.187   1.00 0.00 ? 2   MET A CB   3  
ATOM 4635  C CG   . MET A 1 2   ? 95.705  -10.155 6.687   1.00 0.00 ? 2   MET A CG   3  
ATOM 4636  S SD   . MET A 1 2   ? 94.645  -10.950 5.463   1.00 0.00 ? 2   MET A SD   3  
ATOM 4637  C CE   . MET A 1 2   ? 95.589  -12.435 5.116   1.00 0.00 ? 2   MET A CE   3  
ATOM 4638  H H    . MET A 1 2   ? 95.659  -6.031  8.284   1.00 0.00 ? 2   MET A H    3  
ATOM 4639  H HA   . MET A 1 2   ? 96.227  -8.755  9.044   1.00 0.00 ? 2   MET A HA   3  
ATOM 4640  H HB2  . MET A 1 2   ? 94.186  -9.027  7.656   1.00 0.00 ? 2   MET A HB2  3  
ATOM 4641  H HB3  . MET A 1 2   ? 94.982  -8.185  6.334   1.00 0.00 ? 2   MET A HB3  3  
ATOM 4642  H HG2  . MET A 1 2   ? 96.671  -9.974  6.239   1.00 0.00 ? 2   MET A HG2  3  
ATOM 4643  H HG3  . MET A 1 2   ? 95.821  -10.823 7.529   1.00 0.00 ? 2   MET A HG3  3  
ATOM 4644  H HE1  . MET A 1 2   ? 95.070  -13.027 4.377   1.00 0.00 ? 2   MET A HE1  3  
ATOM 4645  H HE2  . MET A 1 2   ? 95.702  -13.011 6.023   1.00 0.00 ? 2   MET A HE2  3  
ATOM 4646  H HE3  . MET A 1 2   ? 96.564  -12.164 4.738   1.00 0.00 ? 2   MET A HE3  3  
ATOM 4647  N N    . GLN A 1 3   ? 98.321  -8.703  7.593   1.00 0.00 ? 3   GLN A N    3  
ATOM 4648  C CA   . GLN A 1 3   ? 99.650  -8.517  7.008   1.00 0.00 ? 3   GLN A CA   3  
ATOM 4649  C C    . GLN A 1 3   ? 99.613  -8.643  5.479   1.00 0.00 ? 3   GLN A C    3  
ATOM 4650  O O    . GLN A 1 3   ? 100.660 -8.703  4.831   1.00 0.00 ? 3   GLN A O    3  
ATOM 4651  C CB   . GLN A 1 3   ? 100.619 -9.549  7.603   1.00 0.00 ? 3   GLN A CB   3  
ATOM 4652  C CG   . GLN A 1 3   ? 100.806 -9.411  9.112   1.00 0.00 ? 3   GLN A CG   3  
ATOM 4653  C CD   . GLN A 1 3   ? 101.576 -10.571 9.721   1.00 0.00 ? 3   GLN A CD   3  
ATOM 4654  O OE1  . GLN A 1 3   ? 102.804 -10.546 9.799   1.00 0.00 ? 3   GLN A OE1  3  
ATOM 4655  N NE2  . GLN A 1 3   ? 100.855 -11.591 10.162  1.00 0.00 ? 3   GLN A NE2  3  
ATOM 4656  H H    . GLN A 1 3   ? 98.120  -9.551  8.047   1.00 0.00 ? 3   GLN A H    3  
ATOM 4657  H HA   . GLN A 1 3   ? 99.993  -7.526  7.268   1.00 0.00 ? 3   GLN A HA   3  
ATOM 4658  H HB2  . GLN A 1 3   ? 100.241 -10.541 7.397   1.00 0.00 ? 3   GLN A HB2  3  
ATOM 4659  H HB3  . GLN A 1 3   ? 101.585 -9.436  7.131   1.00 0.00 ? 3   GLN A HB3  3  
ATOM 4660  H HG2  . GLN A 1 3   ? 101.346 -8.497  9.312   1.00 0.00 ? 3   GLN A HG2  3  
ATOM 4661  H HG3  . GLN A 1 3   ? 99.833  -9.359  9.580   1.00 0.00 ? 3   GLN A HG3  3  
ATOM 4662  H HE21 . GLN A 1 3   ? 99.878  -11.542 10.069  1.00 0.00 ? 3   GLN A HE21 3  
ATOM 4663  H HE22 . GLN A 1 3   ? 101.324 -12.349 10.572  1.00 0.00 ? 3   GLN A HE22 3  
ATOM 4664  N N    . SER A 1 4   ? 98.408  -8.658  4.908   1.00 0.00 ? 4   SER A N    3  
ATOM 4665  C CA   . SER A 1 4   ? 98.231  -8.830  3.471   1.00 0.00 ? 4   SER A CA   3  
ATOM 4666  C C    . SER A 1 4   ? 96.859  -8.292  3.040   1.00 0.00 ? 4   SER A C    3  
ATOM 4667  O O    . SER A 1 4   ? 96.209  -7.559  3.794   1.00 0.00 ? 4   SER A O    3  
ATOM 4668  C CB   . SER A 1 4   ? 98.378  -10.320 3.107   1.00 0.00 ? 4   SER A CB   3  
ATOM 4669  O OG   . SER A 1 4   ? 98.408  -10.516 1.702   1.00 0.00 ? 4   SER A OG   3  
ATOM 4670  H H    . SER A 1 4   ? 97.616  -8.539  5.466   1.00 0.00 ? 4   SER A H    3  
ATOM 4671  H HA   . SER A 1 4   ? 99.002  -8.264  2.966   1.00 0.00 ? 4   SER A HA   3  
ATOM 4672  H HB2  . SER A 1 4   ? 99.297  -10.702 3.527   1.00 0.00 ? 4   SER A HB2  3  
ATOM 4673  H HB3  . SER A 1 4   ? 97.542  -10.871 3.517   1.00 0.00 ? 4   SER A HB3  3  
ATOM 4674  H HG   . SER A 1 4   ? 98.934  -11.298 1.500   1.00 0.00 ? 4   SER A HG   3  
ATOM 4675  N N    . LEU A 1 5   ? 96.449  -8.642  1.820   1.00 0.00 ? 5   LEU A N    3  
ATOM 4676  C CA   . LEU A 1 5   ? 95.154  -8.251  1.259   1.00 0.00 ? 5   LEU A CA   3  
ATOM 4677  C C    . LEU A 1 5   ? 95.122  -6.749  0.979   1.00 0.00 ? 5   LEU A C    3  
ATOM 4678  O O    . LEU A 1 5   ? 95.500  -6.296  -0.107  1.00 0.00 ? 5   LEU A O    3  
ATOM 4679  C CB   . LEU A 1 5   ? 93.989  -8.705  2.177   1.00 0.00 ? 5   LEU A CB   3  
ATOM 4680  C CG   . LEU A 1 5   ? 92.604  -8.862  1.506   1.00 0.00 ? 5   LEU A CG   3  
ATOM 4681  C CD1  . LEU A 1 5   ? 91.621  -9.533  2.463   1.00 0.00 ? 5   LEU A CD1  3  
ATOM 4682  C CD2  . LEU A 1 5   ? 92.046  -7.517  1.040   1.00 0.00 ? 5   LEU A CD2  3  
ATOM 4683  H H    . LEU A 1 5   ? 97.054  -9.179  1.262   1.00 0.00 ? 5   LEU A H    3  
ATOM 4684  H HA   . LEU A 1 5   ? 95.055  -8.748  0.323   1.00 0.00 ? 5   LEU A HA   3  
ATOM 4685  H HB2  . LEU A 1 5   ? 94.259  -9.659  2.607   1.00 0.00 ? 5   LEU A HB2  3  
ATOM 4686  H HB3  . LEU A 1 5   ? 93.892  -7.992  2.981   1.00 0.00 ? 5   LEU A HB3  3  
ATOM 4687  H HG   . LEU A 1 5   ? 92.704  -9.500  0.638   1.00 0.00 ? 5   LEU A HG   3  
ATOM 4688  H HD11 . LEU A 1 5   ? 91.513  -8.928  3.352   1.00 0.00 ? 5   LEU A HD11 3  
ATOM 4689  H HD12 . LEU A 1 5   ? 91.994  -10.509 2.735   1.00 0.00 ? 5   LEU A HD12 3  
ATOM 4690  H HD13 . LEU A 1 5   ? 90.661  -9.638  1.980   1.00 0.00 ? 5   LEU A HD13 3  
ATOM 4691  H HD21 . LEU A 1 5   ? 92.720  -7.076  0.320   1.00 0.00 ? 5   LEU A HD21 3  
ATOM 4692  H HD22 . LEU A 1 5   ? 91.942  -6.855  1.888   1.00 0.00 ? 5   LEU A HD22 3  
ATOM 4693  H HD23 . LEU A 1 5   ? 91.079  -7.666  0.582   1.00 0.00 ? 5   LEU A HD23 3  
ATOM 4694  N N    . LYS A 1 6   ? 94.703  -5.990  1.967   1.00 0.00 ? 6   LYS A N    3  
ATOM 4695  C CA   . LYS A 1 6   ? 94.577  -4.542  1.833   1.00 0.00 ? 6   LYS A CA   3  
ATOM 4696  C C    . LYS A 1 6   ? 95.944  -3.885  1.960   1.00 0.00 ? 6   LYS A C    3  
ATOM 4697  O O    . LYS A 1 6   ? 96.300  -2.999  1.182   1.00 0.00 ? 6   LYS A O    3  
ATOM 4698  C CB   . LYS A 1 6   ? 93.617  -3.975  2.889   1.00 0.00 ? 6   LYS A CB   3  
ATOM 4699  C CG   . LYS A 1 6   ? 93.444  -2.459  2.803   1.00 0.00 ? 6   LYS A CG   3  
ATOM 4700  C CD   . LYS A 1 6   ? 92.490  -1.927  3.869   1.00 0.00 ? 6   LYS A CD   3  
ATOM 4701  C CE   . LYS A 1 6   ? 92.339  -0.411  3.783   1.00 0.00 ? 6   LYS A CE   3  
ATOM 4702  N NZ   . LYS A 1 6   ? 91.384  0.109   4.796   1.00 0.00 ? 6   LYS A NZ   3  
ATOM 4703  H H    . LYS A 1 6   ? 94.481  -6.416  2.809   1.00 0.00 ? 6   LYS A H    3  
ATOM 4704  H HA   . LYS A 1 6   ? 94.179  -4.337  0.849   1.00 0.00 ? 6   LYS A HA   3  
ATOM 4705  H HB2  . LYS A 1 6   ? 92.646  -4.436  2.762   1.00 0.00 ? 6   LYS A HB2  3  
ATOM 4706  H HB3  . LYS A 1 6   ? 93.995  -4.219  3.872   1.00 0.00 ? 6   LYS A HB3  3  
ATOM 4707  H HG2  . LYS A 1 6   ? 94.409  -1.989  2.935   1.00 0.00 ? 6   LYS A HG2  3  
ATOM 4708  H HG3  . LYS A 1 6   ? 93.055  -2.207  1.825   1.00 0.00 ? 6   LYS A HG3  3  
ATOM 4709  H HD2  . LYS A 1 6   ? 91.520  -2.382  3.731   1.00 0.00 ? 6   LYS A HD2  3  
ATOM 4710  H HD3  . LYS A 1 6   ? 92.874  -2.186  4.846   1.00 0.00 ? 6   LYS A HD3  3  
ATOM 4711  H HE2  . LYS A 1 6   ? 93.304  0.047   3.945   1.00 0.00 ? 6   LYS A HE2  3  
ATOM 4712  H HE3  . LYS A 1 6   ? 91.979  -0.151  2.796   1.00 0.00 ? 6   LYS A HE3  3  
ATOM 4713  H HZ1  . LYS A 1 6   ? 91.720  -0.114  5.755   1.00 0.00 ? 6   LYS A HZ1  3  
ATOM 4714  H HZ2  . LYS A 1 6   ? 90.448  -0.324  4.664   1.00 0.00 ? 6   LYS A HZ2  3  
ATOM 4715  H HZ3  . LYS A 1 6   ? 91.292  1.140   4.706   1.00 0.00 ? 6   LYS A HZ3  3  
ATOM 4716  N N    . SER A 1 7   ? 96.713  -4.340  2.939   1.00 0.00 ? 7   SER A N    3  
ATOM 4717  C CA   . SER A 1 7   ? 98.051  -3.820  3.170   1.00 0.00 ? 7   SER A CA   3  
ATOM 4718  C C    . SER A 1 7   ? 98.923  -4.036  1.932   1.00 0.00 ? 7   SER A C    3  
ATOM 4719  O O    . SER A 1 7   ? 99.679  -3.152  1.524   1.00 0.00 ? 7   SER A O    3  
ATOM 4720  C CB   . SER A 1 7   ? 98.656  -4.501  4.400   1.00 0.00 ? 7   SER A CB   3  
ATOM 4721  O OG   . SER A 1 7   ? 97.788  -4.376  5.513   1.00 0.00 ? 7   SER A OG   3  
ATOM 4722  H H    . SER A 1 7   ? 96.369  -5.043  3.530   1.00 0.00 ? 7   SER A H    3  
ATOM 4723  H HA   . SER A 1 7   ? 97.967  -2.758  3.359   1.00 0.00 ? 7   SER A HA   3  
ATOM 4724  H HB2  . SER A 1 7   ? 98.810  -5.551  4.194   1.00 0.00 ? 7   SER A HB2  3  
ATOM 4725  H HB3  . SER A 1 7   ? 99.602  -4.037  4.642   1.00 0.00 ? 7   SER A HB3  3  
ATOM 4726  H HG   . SER A 1 7   ? 98.016  -5.036  6.177   1.00 0.00 ? 7   SER A HG   3  
ATOM 4727  N N    . THR A 1 8   ? 98.783  -5.206  1.315   1.00 0.00 ? 8   THR A N    3  
ATOM 4728  C CA   . THR A 1 8   ? 99.520  -5.520  0.100   1.00 0.00 ? 8   THR A CA   3  
ATOM 4729  C C    . THR A 1 8   ? 99.013  -4.679  -1.070  1.00 0.00 ? 8   THR A C    3  
ATOM 4730  O O    . THR A 1 8   ? 99.772  -4.352  -1.983  1.00 0.00 ? 8   THR A O    3  
ATOM 4731  C CB   . THR A 1 8   ? 99.423  -7.024  -0.237  1.00 0.00 ? 8   THR A CB   3  
ATOM 4732  O OG1  . THR A 1 8   ? 98.084  -7.486  -0.019  1.00 0.00 ? 8   THR A OG1  3  
ATOM 4733  C CG2  . THR A 1 8   ? 100.391 -7.843  0.613   1.00 0.00 ? 8   THR A CG2  3  
ATOM 4734  H H    . THR A 1 8   ? 98.161  -5.870  1.678   1.00 0.00 ? 8   THR A H    3  
ATOM 4735  H HA   . THR A 1 8   ? 100.561 -5.278  0.273   1.00 0.00 ? 8   THR A HA   3  
ATOM 4736  H HB   . THR A 1 8   ? 99.679  -7.165  -1.280  1.00 0.00 ? 8   THR A HB   3  
ATOM 4737  H HG1  . THR A 1 8   ? 97.721  -7.822  -0.848  1.00 0.00 ? 8   THR A HG1  3  
ATOM 4738  H HG21 . THR A 1 8   ? 100.162 -7.703  1.660   1.00 0.00 ? 8   THR A HG21 3  
ATOM 4739  H HG22 . THR A 1 8   ? 101.404 -7.519  0.421   1.00 0.00 ? 8   THR A HG22 3  
ATOM 4740  H HG23 . THR A 1 8   ? 100.296 -8.890  0.361   1.00 0.00 ? 8   THR A HG23 3  
ATOM 4741  N N    . ALA A 1 9   ? 97.729  -4.321  -1.031  1.00 0.00 ? 9   ALA A N    3  
ATOM 4742  C CA   . ALA A 1 9   ? 97.152  -3.428  -2.032  1.00 0.00 ? 9   ALA A CA   3  
ATOM 4743  C C    . ALA A 1 9   ? 97.811  -2.050  -1.954  1.00 0.00 ? 9   ALA A C    3  
ATOM 4744  O O    . ALA A 1 9   ? 98.024  -1.395  -2.972  1.00 0.00 ? 9   ALA A O    3  
ATOM 4745  C CB   . ALA A 1 9   ? 95.642  -3.317  -1.847  1.00 0.00 ? 9   ALA A CB   3  
ATOM 4746  H H    . ALA A 1 9   ? 97.155  -4.676  -0.318  1.00 0.00 ? 9   ALA A H    3  
ATOM 4747  H HA   . ALA A 1 9   ? 97.343  -3.854  -3.009  1.00 0.00 ? 9   ALA A HA   3  
ATOM 4748  H HB1  . ALA A 1 9   ? 95.198  -4.301  -1.901  1.00 0.00 ? 9   ALA A HB1  3  
ATOM 4749  H HB2  . ALA A 1 9   ? 95.226  -2.693  -2.626  1.00 0.00 ? 9   ALA A HB2  3  
ATOM 4750  H HB3  . ALA A 1 9   ? 95.427  -2.879  -0.883  1.00 0.00 ? 9   ALA A HB3  3  
ATOM 4751  N N    . LYS A 1 10  ? 98.135  -1.630  -0.730  1.00 0.00 ? 10  LYS A N    3  
ATOM 4752  C CA   . LYS A 1 10  ? 98.847  -0.374  -0.486  1.00 0.00 ? 10  LYS A CA   3  
ATOM 4753  C C    . LYS A 1 10  ? 100.179 -0.361  -1.231  1.00 0.00 ? 10  LYS A C    3  
ATOM 4754  O O    . LYS A 1 10  ? 100.413 0.446   -2.136  1.00 0.00 ? 10  LYS A O    3  
ATOM 4755  C CB   . LYS A 1 10  ? 99.118  -0.211  1.022   1.00 0.00 ? 10  LYS A CB   3  
ATOM 4756  C CG   . LYS A 1 10  ? 97.857  -0.109  1.880   1.00 0.00 ? 10  LYS A CG   3  
ATOM 4757  C CD   . LYS A 1 10  ? 97.172  1.256   1.759   1.00 0.00 ? 10  LYS A CD   3  
ATOM 4758  C CE   . LYS A 1 10  ? 97.728  2.285   2.750   1.00 0.00 ? 10  LYS A CE   3  
ATOM 4759  N NZ   . LYS A 1 10  ? 99.158  2.618   2.506   1.00 0.00 ? 10  LYS A NZ   3  
ATOM 4760  H H    . LYS A 1 10  ? 97.880  -2.185  0.038   1.00 0.00 ? 10  LYS A H    3  
ATOM 4761  H HA   . LYS A 1 10  ? 98.231  0.444   -0.832  1.00 0.00 ? 10  LYS A HA   3  
ATOM 4762  H HB2  . LYS A 1 10  ? 99.694  -1.069  1.363   1.00 0.00 ? 10  LYS A HB2  3  
ATOM 4763  H HB3  . LYS A 1 10  ? 99.707  0.683   1.176   1.00 0.00 ? 10  LYS A HB3  3  
ATOM 4764  H HG2  . LYS A 1 10  ? 97.161  -0.875  1.565   1.00 0.00 ? 10  LYS A HG2  3  
ATOM 4765  H HG3  . LYS A 1 10  ? 98.126  -0.278  2.914   1.00 0.00 ? 10  LYS A HG3  3  
ATOM 4766  H HD2  . LYS A 1 10  ? 97.316  1.631   0.756   1.00 0.00 ? 10  LYS A HD2  3  
ATOM 4767  H HD3  . LYS A 1 10  ? 96.113  1.132   1.943   1.00 0.00 ? 10  LYS A HD3  3  
ATOM 4768  H HE2  . LYS A 1 10  ? 97.145  3.191   2.669   1.00 0.00 ? 10  LYS A HE2  3  
ATOM 4769  H HE3  . LYS A 1 10  ? 97.627  1.889   3.752   1.00 0.00 ? 10  LYS A HE3  3  
ATOM 4770  H HZ1  . LYS A 1 10  ? 99.291  2.947   1.531   1.00 0.00 ? 10  LYS A HZ1  3  
ATOM 4771  H HZ2  . LYS A 1 10  ? 99.760  1.784   2.668   1.00 0.00 ? 10  LYS A HZ2  3  
ATOM 4772  H HZ3  . LYS A 1 10  ? 99.464  3.372   3.156   1.00 0.00 ? 10  LYS A HZ3  3  
ATOM 4773  N N    . TRP A 1 11  ? 101.041 -1.280  -0.839  1.00 0.00 ? 11  TRP A N    3  
ATOM 4774  C CA   . TRP A 1 11  ? 102.406 -1.338  -1.342  1.00 0.00 ? 11  TRP A CA   3  
ATOM 4775  C C    . TRP A 1 11  ? 102.435 -1.671  -2.832  1.00 0.00 ? 11  TRP A C    3  
ATOM 4776  O O    . TRP A 1 11  ? 103.275 -1.157  -3.572  1.00 0.00 ? 11  TRP A O    3  
ATOM 4777  C CB   . TRP A 1 11  ? 103.200 -2.365  -0.532  1.00 0.00 ? 11  TRP A CB   3  
ATOM 4778  C CG   . TRP A 1 11  ? 103.006 -2.201  0.950   1.00 0.00 ? 11  TRP A CG   3  
ATOM 4779  C CD1  . TRP A 1 11  ? 103.095 -1.043  1.667   1.00 0.00 ? 11  TRP A CD1  3  
ATOM 4780  C CD2  . TRP A 1 11  ? 102.683 -3.227  1.891   1.00 0.00 ? 11  TRP A CD2  3  
ATOM 4781  N NE1  . TRP A 1 11  ? 102.851 -1.289  2.993   1.00 0.00 ? 11  TRP A NE1  3  
ATOM 4782  C CE2  . TRP A 1 11  ? 102.598 -2.624  3.158   1.00 0.00 ? 11  TRP A CE2  3  
ATOM 4783  C CE3  . TRP A 1 11  ? 102.459 -4.596  1.782   1.00 0.00 ? 11  TRP A CE3  3  
ATOM 4784  C CZ2  . TRP A 1 11  ? 102.299 -3.349  4.310   1.00 0.00 ? 11  TRP A CZ2  3  
ATOM 4785  C CZ3  . TRP A 1 11  ? 102.163 -5.318  2.922   1.00 0.00 ? 11  TRP A CZ3  3  
ATOM 4786  C CH2  . TRP A 1 11  ? 102.088 -4.694  4.173   1.00 0.00 ? 11  TRP A CH2  3  
ATOM 4787  H H    . TRP A 1 11  ? 100.753 -1.942  -0.177  1.00 0.00 ? 11  TRP A H    3  
ATOM 4788  H HA   . TRP A 1 11  ? 102.850 -0.363  -1.197  1.00 0.00 ? 11  TRP A HA   3  
ATOM 4789  H HB2  . TRP A 1 11  ? 102.880 -3.361  -0.806  1.00 0.00 ? 11  TRP A HB2  3  
ATOM 4790  H HB3  . TRP A 1 11  ? 104.253 -2.255  -0.748  1.00 0.00 ? 11  TRP A HB3  3  
ATOM 4791  H HD1  . TRP A 1 11  ? 103.325 -0.079  1.238   1.00 0.00 ? 11  TRP A HD1  3  
ATOM 4792  H HE1  . TRP A 1 11  ? 102.858 -0.615  3.704   1.00 0.00 ? 11  TRP A HE1  3  
ATOM 4793  H HE3  . TRP A 1 11  ? 102.502 -5.085  0.824   1.00 0.00 ? 11  TRP A HE3  3  
ATOM 4794  H HZ2  . TRP A 1 11  ? 102.238 -2.880  5.282   1.00 0.00 ? 11  TRP A HZ2  3  
ATOM 4795  H HZ3  . TRP A 1 11  ? 101.990 -6.383  2.853   1.00 0.00 ? 11  TRP A HZ3  3  
ATOM 4796  H HH2  . TRP A 1 11  ? 101.854 -5.296  5.040   1.00 0.00 ? 11  TRP A HH2  3  
ATOM 4797  N N    . ALA A 1 12  ? 101.506 -2.516  -3.276  1.00 0.00 ? 12  ALA A N    3  
ATOM 4798  C CA   . ALA A 1 12  ? 101.415 -2.864  -4.692  1.00 0.00 ? 12  ALA A CA   3  
ATOM 4799  C C    . ALA A 1 12  ? 100.625 -1.799  -5.464  1.00 0.00 ? 12  ALA A C    3  
ATOM 4800  O O    . ALA A 1 12  ? 100.490 -1.880  -6.688  1.00 0.00 ? 12  ALA A O    3  
ATOM 4801  C CB   . ALA A 1 12  ? 100.835 -4.272  -4.882  1.00 0.00 ? 12  ALA A CB   3  
ATOM 4802  H H    . ALA A 1 12  ? 100.876 -2.918  -2.642  1.00 0.00 ? 12  ALA A H    3  
ATOM 4803  H HA   . ALA A 1 12  ? 102.424 -2.872  -5.082  1.00 0.00 ? 12  ALA A HA   3  
ATOM 4804  H HB1  . ALA A 1 12  ? 100.795 -4.509  -5.937  1.00 0.00 ? 12  ALA A HB1  3  
ATOM 4805  H HB2  . ALA A 1 12  ? 99.843  -4.328  -4.463  1.00 0.00 ? 12  ALA A HB2  3  
ATOM 4806  H HB3  . ALA A 1 12  ? 101.472 -4.991  -4.384  1.00 0.00 ? 12  ALA A HB3  3  
ATOM 4807  N N    . ALA A 1 13  ? 100.106 -0.794  -4.744  1.00 0.00 ? 13  ALA A N    3  
ATOM 4808  C CA   . ALA A 1 13  ? 99.556  0.404   -5.386  1.00 0.00 ? 13  ALA A CA   3  
ATOM 4809  C C    . ALA A 1 13  ? 100.705 1.285   -5.845  1.00 0.00 ? 13  ALA A C    3  
ATOM 4810  O O    . ALA A 1 13  ? 100.713 1.783   -6.973  1.00 0.00 ? 13  ALA A O    3  
ATOM 4811  C CB   . ALA A 1 13  ? 98.640  1.209   -4.450  1.00 0.00 ? 13  ALA A CB   3  
ATOM 4812  H H    . ALA A 1 13  ? 100.093 -0.865  -3.768  1.00 0.00 ? 13  ALA A H    3  
ATOM 4813  H HA   . ALA A 1 13  ? 98.979  0.094   -6.248  1.00 0.00 ? 13  ALA A HA   3  
ATOM 4814  H HB1  . ALA A 1 13  ? 97.793  0.610   -4.152  1.00 0.00 ? 13  ALA A HB1  3  
ATOM 4815  H HB2  . ALA A 1 13  ? 98.284  2.091   -4.968  1.00 0.00 ? 13  ALA A HB2  3  
ATOM 4816  H HB3  . ALA A 1 13  ? 99.193  1.514   -3.571  1.00 0.00 ? 13  ALA A HB3  3  
ATOM 4817  N N    . SER A 1 14  ? 101.685 1.458   -4.960  1.00 0.00 ? 14  SER A N    3  
ATOM 4818  C CA   . SER A 1 14  ? 102.837 2.297   -5.251  1.00 0.00 ? 14  SER A CA   3  
ATOM 4819  C C    . SER A 1 14  ? 103.961 2.085   -4.237  1.00 0.00 ? 14  SER A C    3  
ATOM 4820  O O    . SER A 1 14  ? 103.715 1.846   -3.045  1.00 0.00 ? 14  SER A O    3  
ATOM 4821  C CB   . SER A 1 14  ? 102.412 3.772   -5.283  1.00 0.00 ? 14  SER A CB   3  
ATOM 4822  O OG   . SER A 1 14  ? 101.646 4.111   -4.136  1.00 0.00 ? 14  SER A OG   3  
ATOM 4823  H H    . SER A 1 14  ? 101.633 1.006   -4.087  1.00 0.00 ? 14  SER A H    3  
ATOM 4824  H HA   . SER A 1 14  ? 103.204 2.021   -6.227  1.00 0.00 ? 14  SER A HA   3  
ATOM 4825  H HB2  . SER A 1 14  ? 103.291 4.401   -5.311  1.00 0.00 ? 14  SER A HB2  3  
ATOM 4826  H HB3  . SER A 1 14  ? 101.814 3.953   -6.165  1.00 0.00 ? 14  SER A HB3  3  
ATOM 4827  H HG   . SER A 1 14  ? 100.717 4.182   -4.388  1.00 0.00 ? 14  SER A HG   3  
ATOM 4828  N N    . LEU A 1 15  ? 105.195 2.179   -4.735  1.00 0.00 ? 15  LEU A N    3  
ATOM 4829  C CA   . LEU A 1 15  ? 106.396 2.122   -3.905  1.00 0.00 ? 15  LEU A CA   3  
ATOM 4830  C C    . LEU A 1 15  ? 106.313 3.168   -2.794  1.00 0.00 ? 15  LEU A C    3  
ATOM 4831  O O    . LEU A 1 15  ? 106.922 3.022   -1.736  1.00 0.00 ? 15  LEU A O    3  
ATOM 4832  C CB   . LEU A 1 15  ? 107.636 2.370   -4.782  1.00 0.00 ? 15  LEU A CB   3  
ATOM 4833  C CG   . LEU A 1 15  ? 108.995 2.287   -4.068  1.00 0.00 ? 15  LEU A CG   3  
ATOM 4834  C CD1  . LEU A 1 15  ? 109.247 0.879   -3.533  1.00 0.00 ? 15  LEU A CD1  3  
ATOM 4835  C CD2  . LEU A 1 15  ? 110.120 2.719   -5.007  1.00 0.00 ? 15  LEU A CD2  3  
ATOM 4836  H H    . LEU A 1 15  ? 105.303 2.281   -5.705  1.00 0.00 ? 15  LEU A H    3  
ATOM 4837  H HA   . LEU A 1 15  ? 106.459 1.137   -3.466  1.00 0.00 ? 15  LEU A HA   3  
ATOM 4838  H HB2  . LEU A 1 15  ? 107.631 1.643   -5.584  1.00 0.00 ? 15  LEU A HB2  3  
ATOM 4839  H HB3  . LEU A 1 15  ? 107.545 3.355   -5.219  1.00 0.00 ? 15  LEU A HB3  3  
ATOM 4840  H HG   . LEU A 1 15  ? 108.990 2.963   -3.224  1.00 0.00 ? 15  LEU A HG   3  
ATOM 4841  H HD11 . LEU A 1 15  ? 109.229 0.171   -4.349  1.00 0.00 ? 15  LEU A HD11 3  
ATOM 4842  H HD12 . LEU A 1 15  ? 108.480 0.622   -2.817  1.00 0.00 ? 15  LEU A HD12 3  
ATOM 4843  H HD13 . LEU A 1 15  ? 110.213 0.845   -3.049  1.00 0.00 ? 15  LEU A HD13 3  
ATOM 4844  H HD21 . LEU A 1 15  ? 110.144 2.066   -5.869  1.00 0.00 ? 15  LEU A HD21 3  
ATOM 4845  H HD22 . LEU A 1 15  ? 111.065 2.664   -4.487  1.00 0.00 ? 15  LEU A HD22 3  
ATOM 4846  H HD23 . LEU A 1 15  ? 109.948 3.735   -5.331  1.00 0.00 ? 15  LEU A HD23 3  
ATOM 4847  N N    . GLU A 1 16  ? 105.540 4.218   -3.062  1.00 0.00 ? 16  GLU A N    3  
ATOM 4848  C CA   . GLU A 1 16  ? 105.278 5.277   -2.094  1.00 0.00 ? 16  GLU A CA   3  
ATOM 4849  C C    . GLU A 1 16  ? 104.760 4.680   -0.781  1.00 0.00 ? 16  GLU A C    3  
ATOM 4850  O O    . GLU A 1 16  ? 105.403 4.809   0.264   1.00 0.00 ? 16  GLU A O    3  
ATOM 4851  C CB   . GLU A 1 16  ? 104.260 6.264   -2.687  1.00 0.00 ? 16  GLU A CB   3  
ATOM 4852  C CG   . GLU A 1 16  ? 104.670 6.801   -4.058  1.00 0.00 ? 16  GLU A CG   3  
ATOM 4853  C CD   . GLU A 1 16  ? 103.600 7.664   -4.712  1.00 0.00 ? 16  GLU A CD   3  
ATOM 4854  O OE1  . GLU A 1 16  ? 103.607 8.897   -4.502  1.00 0.00 ? 16  GLU A OE1  3  
ATOM 4855  O OE2  . GLU A 1 16  ? 102.756 7.117   -5.456  1.00 0.00 ? 16  GLU A OE2  3  
ATOM 4856  H H    . GLU A 1 16  ? 105.134 4.285   -3.948  1.00 0.00 ? 16  GLU A H    3  
ATOM 4857  H HA   . GLU A 1 16  ? 106.207 5.796   -1.904  1.00 0.00 ? 16  GLU A HA   3  
ATOM 4858  H HB2  . GLU A 1 16  ? 103.306 5.765   -2.787  1.00 0.00 ? 16  GLU A HB2  3  
ATOM 4859  H HB3  . GLU A 1 16  ? 104.149 7.102   -2.012  1.00 0.00 ? 16  GLU A HB3  3  
ATOM 4860  H HG2  . GLU A 1 16  ? 105.566 7.393   -3.943  1.00 0.00 ? 16  GLU A HG2  3  
ATOM 4861  H HG3  . GLU A 1 16  ? 104.882 5.962   -4.707  1.00 0.00 ? 16  GLU A HG3  3  
ATOM 4862  N N    . ASN A 1 17  ? 103.616 3.988   -0.850  1.00 0.00 ? 17  ASN A N    3  
ATOM 4863  C CA   . ASN A 1 17  ? 103.045 3.329   0.321   1.00 0.00 ? 17  ASN A CA   3  
ATOM 4864  C C    . ASN A 1 17  ? 104.074 2.416   0.964   1.00 0.00 ? 17  ASN A C    3  
ATOM 4865  O O    . ASN A 1 17  ? 104.247 2.412   2.181   1.00 0.00 ? 17  ASN A O    3  
ATOM 4866  C CB   . ASN A 1 17  ? 101.825 2.485   -0.053  1.00 0.00 ? 17  ASN A CB   3  
ATOM 4867  C CG   . ASN A 1 17  ? 100.643 3.295   -0.545  1.00 0.00 ? 17  ASN A CG   3  
ATOM 4868  O OD1  . ASN A 1 17  ? 99.946  3.938   0.240   1.00 0.00 ? 17  ASN A OD1  3  
ATOM 4869  N ND2  . ASN A 1 17  ? 100.360 3.199   -1.832  1.00 0.00 ? 17  ASN A ND2  3  
ATOM 4870  H H    . ASN A 1 17  ? 103.150 3.915   -1.706  1.00 0.00 ? 17  ASN A H    3  
ATOM 4871  H HA   . ASN A 1 17  ? 102.751 4.091   1.029   1.00 0.00 ? 17  ASN A HA   3  
ATOM 4872  H HB2  . ASN A 1 17  ? 102.106 1.792   -0.833  1.00 0.00 ? 17  ASN A HB2  3  
ATOM 4873  H HB3  . ASN A 1 17  ? 101.518 1.924   0.809   1.00 0.00 ? 17  ASN A HB3  3  
ATOM 4874  H HD21 . ASN A 1 17  ? 100.918 2.607   -2.383  1.00 0.00 ? 17  ASN A HD21 3  
ATOM 4875  H HD22 . ASN A 1 17  ? 99.613  3.726   -2.184  1.00 0.00 ? 17  ASN A HD22 3  
ATOM 4876  N N    . LEU A 1 18  ? 104.742 1.640   0.120   1.00 0.00 ? 18  LEU A N    3  
ATOM 4877  C CA   . LEU A 1 18  ? 105.752 0.682   0.565   1.00 0.00 ? 18  LEU A CA   3  
ATOM 4878  C C    . LEU A 1 18  ? 106.790 1.359   1.467   1.00 0.00 ? 18  LEU A C    3  
ATOM 4879  O O    . LEU A 1 18  ? 107.101 0.865   2.552   1.00 0.00 ? 18  LEU A O    3  
ATOM 4880  C CB   . LEU A 1 18  ? 106.410 0.035   -0.668  1.00 0.00 ? 18  LEU A CB   3  
ATOM 4881  C CG   . LEU A 1 18  ? 107.377 -1.138  -0.406  1.00 0.00 ? 18  LEU A CG   3  
ATOM 4882  C CD1  . LEU A 1 18  ? 107.587 -1.943  -1.684  1.00 0.00 ? 18  LEU A CD1  3  
ATOM 4883  C CD2  . LEU A 1 18  ? 108.723 -0.643  0.124   1.00 0.00 ? 18  LEU A CD2  3  
ATOM 4884  H H    . LEU A 1 18  ? 104.543 1.712   -0.843  1.00 0.00 ? 18  LEU A H    3  
ATOM 4885  H HA   . LEU A 1 18  ? 105.248 -0.086  1.135   1.00 0.00 ? 18  LEU A HA   3  
ATOM 4886  H HB2  . LEU A 1 18  ? 105.618 -0.324  -1.313  1.00 0.00 ? 18  LEU A HB2  3  
ATOM 4887  H HB3  . LEU A 1 18  ? 106.952 0.805   -1.201  1.00 0.00 ? 18  LEU A HB3  3  
ATOM 4888  H HG   . LEU A 1 18  ? 106.945 -1.797  0.334   1.00 0.00 ? 18  LEU A HG   3  
ATOM 4889  H HD11 . LEU A 1 18  ? 108.004 -1.303  -2.449  1.00 0.00 ? 18  LEU A HD11 3  
ATOM 4890  H HD12 . LEU A 1 18  ? 106.639 -2.336  -2.022  1.00 0.00 ? 18  LEU A HD12 3  
ATOM 4891  H HD13 . LEU A 1 18  ? 108.265 -2.761  -1.489  1.00 0.00 ? 18  LEU A HD13 3  
ATOM 4892  H HD21 . LEU A 1 18  ? 108.578 -0.154  1.076   1.00 0.00 ? 18  LEU A HD21 3  
ATOM 4893  H HD22 . LEU A 1 18  ? 109.155 0.056   -0.577  1.00 0.00 ? 18  LEU A HD22 3  
ATOM 4894  H HD23 . LEU A 1 18  ? 109.389 -1.482  0.251   1.00 0.00 ? 18  LEU A HD23 3  
ATOM 4895  N N    . LEU A 1 19  ? 107.310 2.492   1.010   1.00 0.00 ? 19  LEU A N    3  
ATOM 4896  C CA   . LEU A 1 19  ? 108.359 3.216   1.730   1.00 0.00 ? 19  LEU A CA   3  
ATOM 4897  C C    . LEU A 1 19  ? 107.793 4.039   2.893   1.00 0.00 ? 19  LEU A C    3  
ATOM 4898  O O    . LEU A 1 19  ? 108.552 4.562   3.718   1.00 0.00 ? 19  LEU A O    3  
ATOM 4899  C CB   . LEU A 1 19  ? 109.124 4.128   0.761   1.00 0.00 ? 19  LEU A CB   3  
ATOM 4900  C CG   . LEU A 1 19  ? 109.911 3.395   -0.340  1.00 0.00 ? 19  LEU A CG   3  
ATOM 4901  C CD1  . LEU A 1 19  ? 110.525 4.390   -1.322  1.00 0.00 ? 19  LEU A CD1  3  
ATOM 4902  C CD2  . LEU A 1 19  ? 110.993 2.505   0.273   1.00 0.00 ? 19  LEU A CD2  3  
ATOM 4903  H H    . LEU A 1 19  ? 106.986 2.850   0.156   1.00 0.00 ? 19  LEU A H    3  
ATOM 4904  H HA   . LEU A 1 19  ? 109.046 2.485   2.132   1.00 0.00 ? 19  LEU A HA   3  
ATOM 4905  H HB2  . LEU A 1 19  ? 108.412 4.791   0.287   1.00 0.00 ? 19  LEU A HB2  3  
ATOM 4906  H HB3  . LEU A 1 19  ? 109.820 4.726   1.333   1.00 0.00 ? 19  LEU A HB3  3  
ATOM 4907  H HG   . LEU A 1 19  ? 109.234 2.760   -0.894  1.00 0.00 ? 19  LEU A HG   3  
ATOM 4908  H HD11 . LEU A 1 19  ? 109.741 4.981   -1.773  1.00 0.00 ? 19  LEU A HD11 3  
ATOM 4909  H HD12 . LEU A 1 19  ? 111.057 3.853   -2.093  1.00 0.00 ? 19  LEU A HD12 3  
ATOM 4910  H HD13 . LEU A 1 19  ? 111.210 5.040   -0.798  1.00 0.00 ? 19  LEU A HD13 3  
ATOM 4911  H HD21 . LEU A 1 19  ? 111.540 2.007   -0.514  1.00 0.00 ? 19  LEU A HD21 3  
ATOM 4912  H HD22 . LEU A 1 19  ? 110.533 1.766   0.912   1.00 0.00 ? 19  LEU A HD22 3  
ATOM 4913  H HD23 . LEU A 1 19  ? 111.673 3.111   0.856   1.00 0.00 ? 19  LEU A HD23 3  
ATOM 4914  N N    . GLU A 1 20  ? 106.470 4.156   2.962   1.00 0.00 ? 20  GLU A N    3  
ATOM 4915  C CA   . GLU A 1 20  ? 105.826 4.928   4.027   1.00 0.00 ? 20  GLU A CA   3  
ATOM 4916  C C    . GLU A 1 20  ? 105.393 4.021   5.177   1.00 0.00 ? 20  GLU A C    3  
ATOM 4917  O O    . GLU A 1 20  ? 105.825 4.208   6.320   1.00 0.00 ? 20  GLU A O    3  
ATOM 4918  C CB   . GLU A 1 20  ? 104.623 5.715   3.485   1.00 0.00 ? 20  GLU A CB   3  
ATOM 4919  C CG   . GLU A 1 20  ? 105.008 6.844   2.534   1.00 0.00 ? 20  GLU A CG   3  
ATOM 4920  C CD   . GLU A 1 20  ? 103.815 7.675   2.091   1.00 0.00 ? 20  GLU A CD   3  
ATOM 4921  O OE1  . GLU A 1 20  ? 103.485 8.665   2.779   1.00 0.00 ? 20  GLU A OE1  3  
ATOM 4922  O OE2  . GLU A 1 20  ? 103.202 7.348   1.052   1.00 0.00 ? 20  GLU A OE2  3  
ATOM 4923  H H    . GLU A 1 20  ? 105.914 3.707   2.287   1.00 0.00 ? 20  GLU A H    3  
ATOM 4924  H HA   . GLU A 1 20  ? 106.554 5.634   4.408   1.00 0.00 ? 20  GLU A HA   3  
ATOM 4925  H HB2  . GLU A 1 20  ? 103.968 5.035   2.958   1.00 0.00 ? 20  GLU A HB2  3  
ATOM 4926  H HB3  . GLU A 1 20  ? 104.082 6.145   4.318   1.00 0.00 ? 20  GLU A HB3  3  
ATOM 4927  H HG2  . GLU A 1 20  ? 105.716 7.492   3.033   1.00 0.00 ? 20  GLU A HG2  3  
ATOM 4928  H HG3  . GLU A 1 20  ? 105.477 6.415   1.658   1.00 0.00 ? 20  GLU A HG3  3  
ATOM 4929  N N    . ASP A 1 21  ? 104.542 3.043   4.872   1.00 0.00 ? 21  ASP A N    3  
ATOM 4930  C CA   . ASP A 1 21  ? 104.035 2.111   5.880   1.00 0.00 ? 21  ASP A CA   3  
ATOM 4931  C C    . ASP A 1 21  ? 105.172 1.274   6.459   1.00 0.00 ? 21  ASP A C    3  
ATOM 4932  O O    . ASP A 1 21  ? 105.832 0.536   5.725   1.00 0.00 ? 21  ASP A O    3  
ATOM 4933  C CB   . ASP A 1 21  ? 102.971 1.171   5.288   1.00 0.00 ? 21  ASP A CB   3  
ATOM 4934  C CG   . ASP A 1 21  ? 101.681 1.882   4.912   1.00 0.00 ? 21  ASP A CG   3  
ATOM 4935  O OD1  . ASP A 1 21  ? 101.049 2.481   5.810   1.00 0.00 ? 21  ASP A OD1  3  
ATOM 4936  O OD2  . ASP A 1 21  ? 101.285 1.833   3.727   1.00 0.00 ? 21  ASP A OD2  3  
ATOM 4937  H H    . ASP A 1 21  ? 104.254 2.939   3.942   1.00 0.00 ? 21  ASP A H    3  
ATOM 4938  H HA   . ASP A 1 21  ? 103.586 2.694   6.672   1.00 0.00 ? 21  ASP A HA   3  
ATOM 4939  H HB2  . ASP A 1 21  ? 103.373 0.702   4.400   1.00 0.00 ? 21  ASP A HB2  3  
ATOM 4940  H HB3  . ASP A 1 21  ? 102.736 0.403   6.013   1.00 0.00 ? 21  ASP A HB3  3  
ATOM 4941  N N    . PRO A 1 22  ? 105.410 1.362   7.783   1.00 0.00 ? 22  PRO A N    3  
ATOM 4942  C CA   . PRO A 1 22  ? 106.460 0.582   8.450   1.00 0.00 ? 22  PRO A CA   3  
ATOM 4943  C C    . PRO A 1 22  ? 106.315 -0.910  8.161   1.00 0.00 ? 22  PRO A C    3  
ATOM 4944  O O    . PRO A 1 22  ? 107.299 -1.603  7.913   1.00 0.00 ? 22  PRO A O    3  
ATOM 4945  C CB   . PRO A 1 22  ? 106.237 0.877   9.941   1.00 0.00 ? 22  PRO A CB   3  
ATOM 4946  C CG   . PRO A 1 22  ? 105.553 2.201   9.961   1.00 0.00 ? 22  PRO A CG   3  
ATOM 4947  C CD   . PRO A 1 22  ? 104.681 2.226   8.734   1.00 0.00 ? 22  PRO A CD   3  
ATOM 4948  H HA   . PRO A 1 22  ? 107.446 0.913   8.153   1.00 0.00 ? 22  PRO A HA   3  
ATOM 4949  H HB2  . PRO A 1 22  ? 105.618 0.104   10.379  1.00 0.00 ? 22  PRO A HB2  3  
ATOM 4950  H HB3  . PRO A 1 22  ? 107.188 0.915   10.452  1.00 0.00 ? 22  PRO A HB3  3  
ATOM 4951  H HG2  . PRO A 1 22  ? 104.951 2.293   10.854  1.00 0.00 ? 22  PRO A HG2  3  
ATOM 4952  H HG3  . PRO A 1 22  ? 106.284 2.996   9.918   1.00 0.00 ? 22  PRO A HG3  3  
ATOM 4953  H HD2  . PRO A 1 22  ? 103.703 1.820   8.953   1.00 0.00 ? 22  PRO A HD2  3  
ATOM 4954  H HD3  . PRO A 1 22  ? 104.595 3.233   8.351   1.00 0.00 ? 22  PRO A HD3  3  
ATOM 4955  N N    . GLU A 1 23  ? 105.070 -1.379  8.158   1.00 0.00 ? 23  GLU A N    3  
ATOM 4956  C CA   . GLU A 1 23  ? 104.760 -2.777  7.870   1.00 0.00 ? 23  GLU A CA   3  
ATOM 4957  C C    . GLU A 1 23  ? 105.308 -3.157  6.498   1.00 0.00 ? 23  GLU A C    3  
ATOM 4958  O O    . GLU A 1 23  ? 105.815 -4.265  6.295   1.00 0.00 ? 23  GLU A O    3  
ATOM 4959  C CB   . GLU A 1 23  ? 103.239 -3.017  7.911   1.00 0.00 ? 23  GLU A CB   3  
ATOM 4960  C CG   . GLU A 1 23  ? 102.596 -2.836  9.289   1.00 0.00 ? 23  GLU A CG   3  
ATOM 4961  C CD   . GLU A 1 23  ? 102.738 -1.427  9.848   1.00 0.00 ? 23  GLU A CD   3  
ATOM 4962  O OE1  . GLU A 1 23  ? 102.471 -0.456  9.110   1.00 0.00 ? 23  GLU A OE1  3  
ATOM 4963  O OE2  . GLU A 1 23  ? 103.109 -1.284  11.034  1.00 0.00 ? 23  GLU A OE2  3  
ATOM 4964  H H    . GLU A 1 23  ? 104.337 -0.760  8.348   1.00 0.00 ? 23  GLU A H    3  
ATOM 4965  H HA   . GLU A 1 23  ? 105.238 -3.390  8.623   1.00 0.00 ? 23  GLU A HA   3  
ATOM 4966  H HB2  . GLU A 1 23  ? 102.763 -2.327  7.228   1.00 0.00 ? 23  GLU A HB2  3  
ATOM 4967  H HB3  . GLU A 1 23  ? 103.039 -4.026  7.577   1.00 0.00 ? 23  GLU A HB3  3  
ATOM 4968  H HG2  . GLU A 1 23  ? 101.543 -3.065  9.211   1.00 0.00 ? 23  GLU A HG2  3  
ATOM 4969  H HG3  . GLU A 1 23  ? 103.059 -3.531  9.977   1.00 0.00 ? 23  GLU A HG3  3  
ATOM 4970  N N    . GLY A 1 24  ? 105.214 -2.215  5.564   1.00 0.00 ? 24  GLY A N    3  
ATOM 4971  C CA   . GLY A 1 24  ? 105.737 -2.425  4.231   1.00 0.00 ? 24  GLY A CA   3  
ATOM 4972  C C    . GLY A 1 24  ? 107.244 -2.438  4.230   1.00 0.00 ? 24  GLY A C    3  
ATOM 4973  O O    . GLY A 1 24  ? 107.859 -3.366  3.714   1.00 0.00 ? 24  GLY A O    3  
ATOM 4974  H H    . GLY A 1 24  ? 104.798 -1.358  5.791   1.00 0.00 ? 24  GLY A H    3  
ATOM 4975  H HA2  . GLY A 1 24  ? 105.371 -3.369  3.851   1.00 0.00 ? 24  GLY A HA2  3  
ATOM 4976  H HA3  . GLY A 1 24  ? 105.392 -1.629  3.588   1.00 0.00 ? 24  GLY A HA3  3  
ATOM 4977  N N    . VAL A 1 25  ? 107.831 -1.412  4.837   1.00 0.00 ? 25  VAL A N    3  
ATOM 4978  C CA   . VAL A 1 25  ? 109.282 -1.293  4.943   1.00 0.00 ? 25  VAL A CA   3  
ATOM 4979  C C    . VAL A 1 25  ? 109.903 -2.531  5.591   1.00 0.00 ? 25  VAL A C    3  
ATOM 4980  O O    . VAL A 1 25  ? 110.977 -2.971  5.188   1.00 0.00 ? 25  VAL A O    3  
ATOM 4981  C CB   . VAL A 1 25  ? 109.688 -0.034  5.749   1.00 0.00 ? 25  VAL A CB   3  
ATOM 4982  C CG1  . VAL A 1 25  ? 111.208 0.065   5.873   1.00 0.00 ? 25  VAL A CG1  3  
ATOM 4983  C CG2  . VAL A 1 25  ? 109.114 1.226   5.101   1.00 0.00 ? 25  VAL A CG2  3  
ATOM 4984  H H    . VAL A 1 25  ? 107.269 -0.700  5.215   1.00 0.00 ? 25  VAL A H    3  
ATOM 4985  H HA   . VAL A 1 25  ? 109.680 -1.192  3.945   1.00 0.00 ? 25  VAL A HA   3  
ATOM 4986  H HB   . VAL A 1 25  ? 109.274 -0.120  6.746   1.00 0.00 ? 25  VAL A HB   3  
ATOM 4987  H HG11 . VAL A 1 25  ? 111.467 0.954   6.430   1.00 0.00 ? 25  VAL A HG11 3  
ATOM 4988  H HG12 . VAL A 1 25  ? 111.649 0.117   4.886   1.00 0.00 ? 25  VAL A HG12 3  
ATOM 4989  H HG13 . VAL A 1 25  ? 111.587 -0.805  6.390   1.00 0.00 ? 25  VAL A HG13 3  
ATOM 4990  H HG21 . VAL A 1 25  ? 109.401 2.093   5.678   1.00 0.00 ? 25  VAL A HG21 3  
ATOM 4991  H HG22 . VAL A 1 25  ? 108.036 1.158   5.070   1.00 0.00 ? 25  VAL A HG22 3  
ATOM 4992  H HG23 . VAL A 1 25  ? 109.497 1.322   4.093   1.00 0.00 ? 25  VAL A HG23 3  
ATOM 4993  N N    . LYS A 1 26  ? 109.219 -3.104  6.579   1.00 0.00 ? 26  LYS A N    3  
ATOM 4994  C CA   . LYS A 1 26  ? 109.771 -4.229  7.337   1.00 0.00 ? 26  LYS A CA   3  
ATOM 4995  C C    . LYS A 1 26  ? 109.619 -5.551  6.586   1.00 0.00 ? 26  LYS A C    3  
ATOM 4996  O O    . LYS A 1 26  ? 110.535 -6.378  6.590   1.00 0.00 ? 26  LYS A O    3  
ATOM 4997  C CB   . LYS A 1 26  ? 109.135 -4.297  8.729   1.00 0.00 ? 26  LYS A CB   3  
ATOM 4998  C CG   . LYS A 1 26  ? 109.345 -3.018  9.539   1.00 0.00 ? 26  LYS A CG   3  
ATOM 4999  C CD   . LYS A 1 26  ? 110.822 -2.622  9.620   1.00 0.00 ? 26  LYS A CD   3  
ATOM 5000  C CE   . LYS A 1 26  ? 110.995 -1.117  9.797   1.00 0.00 ? 26  LYS A CE   3  
ATOM 5001  N NZ   . LYS A 1 26  ? 110.395 -0.625  11.066  1.00 0.00 ? 26  LYS A NZ   3  
ATOM 5002  H H    . LYS A 1 26  ? 108.326 -2.758  6.808   1.00 0.00 ? 26  LYS A H    3  
ATOM 5003  H HA   . LYS A 1 26  ? 110.829 -4.042  7.457   1.00 0.00 ? 26  LYS A HA   3  
ATOM 5004  H HB2  . LYS A 1 26  ? 108.071 -4.461  8.619   1.00 0.00 ? 26  LYS A HB2  3  
ATOM 5005  H HB3  . LYS A 1 26  ? 109.567 -5.124  9.276   1.00 0.00 ? 26  LYS A HB3  3  
ATOM 5006  H HG2  . LYS A 1 26  ? 108.794 -2.217  9.071   1.00 0.00 ? 26  LYS A HG2  3  
ATOM 5007  H HG3  . LYS A 1 26  ? 108.968 -3.174  10.541  1.00 0.00 ? 26  LYS A HG3  3  
ATOM 5008  H HD2  . LYS A 1 26  ? 111.274 -3.124  10.464  1.00 0.00 ? 26  LYS A HD2  3  
ATOM 5009  H HD3  . LYS A 1 26  ? 111.324 -2.924  8.714   1.00 0.00 ? 26  LYS A HD3  3  
ATOM 5010  H HE2  . LYS A 1 26  ? 112.050 -0.886  9.797   1.00 0.00 ? 26  LYS A HE2  3  
ATOM 5011  H HE3  . LYS A 1 26  ? 110.519 -0.615  8.962   1.00 0.00 ? 26  LYS A HE3  3  
ATOM 5012  H HZ1  . LYS A 1 26  ? 109.363 -0.753  11.051  1.00 0.00 ? 26  LYS A HZ1  3  
ATOM 5013  H HZ2  . LYS A 1 26  ? 110.607 0.386   11.196  1.00 0.00 ? 26  LYS A HZ2  3  
ATOM 5014  H HZ3  . LYS A 1 26  ? 110.785 -1.152  11.873  1.00 0.00 ? 26  LYS A HZ3  3  
ATOM 5015  N N    . ARG A 1 27  ? 108.479 -5.751  5.935   1.00 0.00 ? 27  ARG A N    3  
ATOM 5016  C CA   . ARG A 1 27  ? 108.309 -6.905  5.052   1.00 0.00 ? 27  ARG A CA   3  
ATOM 5017  C C    . ARG A 1 27  ? 109.289 -6.808  3.888   1.00 0.00 ? 27  ARG A C    3  
ATOM 5018  O O    . ARG A 1 27  ? 109.885 -7.794  3.473   1.00 0.00 ? 27  ARG A O    3  
ATOM 5019  C CB   . ARG A 1 27  ? 106.875 -6.985  4.515   1.00 0.00 ? 27  ARG A CB   3  
ATOM 5020  C CG   . ARG A 1 27  ? 105.927 -7.809  5.379   1.00 0.00 ? 27  ARG A CG   3  
ATOM 5021  C CD   . ARG A 1 27  ? 104.569 -7.964  4.707   1.00 0.00 ? 27  ARG A CD   3  
ATOM 5022  N NE   . ARG A 1 27  ? 104.701 -8.353  3.296   1.00 0.00 ? 27  ARG A NE   3  
ATOM 5023  C CZ   . ARG A 1 27  ? 103.688 -8.721  2.510   1.00 0.00 ? 27  ARG A CZ   3  
ATOM 5024  N NH1  . ARG A 1 27  ? 102.461 -8.846  2.999   1.00 0.00 ? 27  ARG A NH1  3  
ATOM 5025  N NH2  . ARG A 1 27  ? 103.910 -8.981  1.232   1.00 0.00 ? 27  ARG A NH2  3  
ATOM 5026  H H    . ARG A 1 27  ? 107.739 -5.114  6.048   1.00 0.00 ? 27  ARG A H    3  
ATOM 5027  H HA   . ARG A 1 27  ? 108.528 -7.800  5.623   1.00 0.00 ? 27  ARG A HA   3  
ATOM 5028  H HB2  . ARG A 1 27  ? 106.477 -5.983  4.440   1.00 0.00 ? 27  ARG A HB2  3  
ATOM 5029  H HB3  . ARG A 1 27  ? 106.895 -7.425  3.527   1.00 0.00 ? 27  ARG A HB3  3  
ATOM 5030  H HG2  . ARG A 1 27  ? 106.355 -8.789  5.538   1.00 0.00 ? 27  ARG A HG2  3  
ATOM 5031  H HG3  . ARG A 1 27  ? 105.795 -7.313  6.331   1.00 0.00 ? 27  ARG A HG3  3  
ATOM 5032  H HD2  . ARG A 1 27  ? 104.008 -8.724  5.231   1.00 0.00 ? 27  ARG A HD2  3  
ATOM 5033  H HD3  . ARG A 1 27  ? 104.042 -7.023  4.764   1.00 0.00 ? 27  ARG A HD3  3  
ATOM 5034  H HE   . ARG A 1 27  ? 105.602 -8.312  2.906   1.00 0.00 ? 27  ARG A HE   3  
ATOM 5035  H HH11 . ARG A 1 27  ? 102.279 -8.663  3.968   1.00 0.00 ? 27  ARG A HH11 3  
ATOM 5036  H HH12 . ARG A 1 27  ? 101.712 -9.129  2.402   1.00 0.00 ? 27  ARG A HH12 3  
ATOM 5037  H HH21 . ARG A 1 27  ? 104.838 -8.902  0.845   1.00 0.00 ? 27  ARG A HH21 3  
ATOM 5038  H HH22 . ARG A 1 27  ? 103.156 -9.256  0.626   1.00 0.00 ? 27  ARG A HH22 3  
ATOM 5039  N N    . PHE A 1 28  ? 109.441 -5.593  3.385   1.00 0.00 ? 28  PHE A N    3  
ATOM 5040  C CA   . PHE A 1 28  ? 110.361 -5.284  2.294   1.00 0.00 ? 28  PHE A CA   3  
ATOM 5041  C C    . PHE A 1 28  ? 111.799 -5.496  2.765   1.00 0.00 ? 28  PHE A C    3  
ATOM 5042  O O    . PHE A 1 28  ? 112.657 -5.978  2.023   1.00 0.00 ? 28  PHE A O    3  
ATOM 5043  C CB   . PHE A 1 28  ? 110.121 -3.828  1.874   1.00 0.00 ? 28  PHE A CB   3  
ATOM 5044  C CG   . PHE A 1 28  ? 110.852 -3.361  0.646   1.00 0.00 ? 28  PHE A CG   3  
ATOM 5045  C CD1  . PHE A 1 28  ? 110.644 -3.968  -0.583  1.00 0.00 ? 28  PHE A CD1  3  
ATOM 5046  C CD2  . PHE A 1 28  ? 111.707 -2.273  0.715   1.00 0.00 ? 28  PHE A CD2  3  
ATOM 5047  C CE1  . PHE A 1 28  ? 111.278 -3.497  -1.716  1.00 0.00 ? 28  PHE A CE1  3  
ATOM 5048  C CE2  . PHE A 1 28  ? 112.348 -1.802  -0.409  1.00 0.00 ? 28  PHE A CE2  3  
ATOM 5049  C CZ   . PHE A 1 28  ? 112.132 -2.412  -1.628  1.00 0.00 ? 28  PHE A CZ   3  
ATOM 5050  H H    . PHE A 1 28  ? 108.914 -4.864  3.768   1.00 0.00 ? 28  PHE A H    3  
ATOM 5051  H HA   . PHE A 1 28  ? 110.148 -5.944  1.463   1.00 0.00 ? 28  PHE A HA   3  
ATOM 5052  H HB2  . PHE A 1 28  ? 109.066 -3.693  1.687   1.00 0.00 ? 28  PHE A HB2  3  
ATOM 5053  H HB3  . PHE A 1 28  ? 110.408 -3.183  2.696   1.00 0.00 ? 28  PHE A HB3  3  
ATOM 5054  H HD1  . PHE A 1 28  ? 109.979 -4.818  -0.652  1.00 0.00 ? 28  PHE A HD1  3  
ATOM 5055  H HD2  . PHE A 1 28  ? 111.877 -1.794  1.669   1.00 0.00 ? 28  PHE A HD2  3  
ATOM 5056  H HE1  . PHE A 1 28  ? 111.109 -3.977  -2.669  1.00 0.00 ? 28  PHE A HE1  3  
ATOM 5057  H HE2  . PHE A 1 28  ? 113.014 -0.954  -0.335  1.00 0.00 ? 28  PHE A HE2  3  
ATOM 5058  H HZ   . PHE A 1 28  ? 112.628 -2.042  -2.514  1.00 0.00 ? 28  PHE A HZ   3  
ATOM 5059  N N    . ARG A 1 29  ? 112.027 -5.146  4.026   1.00 0.00 ? 29  ARG A N    3  
ATOM 5060  C CA   . ARG A 1 29  ? 113.310 -5.333  4.692   1.00 0.00 ? 29  ARG A CA   3  
ATOM 5061  C C    . ARG A 1 29  ? 113.705 -6.807  4.698   1.00 0.00 ? 29  ARG A C    3  
ATOM 5062  O O    . ARG A 1 29  ? 114.801 -7.164  4.263   1.00 0.00 ? 29  ARG A O    3  
ATOM 5063  C CB   . ARG A 1 29  ? 113.210 -4.797  6.129   1.00 0.00 ? 29  ARG A CB   3  
ATOM 5064  C CG   . ARG A 1 29  ? 114.406 -5.097  7.027   1.00 0.00 ? 29  ARG A CG   3  
ATOM 5065  C CD   . ARG A 1 29  ? 115.685 -4.421  6.550   1.00 0.00 ? 29  ARG A CD   3  
ATOM 5066  N NE   . ARG A 1 29  ? 116.724 -4.470  7.581   1.00 0.00 ? 29  ARG A NE   3  
ATOM 5067  C CZ   . ARG A 1 29  ? 117.970 -4.899  7.387   1.00 0.00 ? 29  ARG A CZ   3  
ATOM 5068  N NH1  . ARG A 1 29  ? 118.354 -5.325  6.191   1.00 0.00 ? 29  ARG A NH1  3  
ATOM 5069  N NH2  . ARG A 1 29  ? 118.828 -4.899  8.397   1.00 0.00 ? 29  ARG A NH2  3  
ATOM 5070  H H    . ARG A 1 29  ? 111.295 -4.736  4.533   1.00 0.00 ? 29  ARG A H    3  
ATOM 5071  H HA   . ARG A 1 29  ? 114.056 -4.766  4.152   1.00 0.00 ? 29  ARG A HA   3  
ATOM 5072  H HB2  . ARG A 1 29  ? 113.086 -3.725  6.087   1.00 0.00 ? 29  ARG A HB2  3  
ATOM 5073  H HB3  . ARG A 1 29  ? 112.331 -5.223  6.591   1.00 0.00 ? 29  ARG A HB3  3  
ATOM 5074  H HG2  . ARG A 1 29  ? 114.184 -4.746  8.024   1.00 0.00 ? 29  ARG A HG2  3  
ATOM 5075  H HG3  . ARG A 1 29  ? 114.563 -6.167  7.051   1.00 0.00 ? 29  ARG A HG3  3  
ATOM 5076  H HD2  . ARG A 1 29  ? 116.038 -4.926  5.661   1.00 0.00 ? 29  ARG A HD2  3  
ATOM 5077  H HD3  . ARG A 1 29  ? 115.470 -3.387  6.317   1.00 0.00 ? 29  ARG A HD3  3  
ATOM 5078  H HE   . ARG A 1 29  ? 116.471 -4.157  8.481   1.00 0.00 ? 29  ARG A HE   3  
ATOM 5079  H HH11 . ARG A 1 29  ? 117.711 -5.328  5.428   1.00 0.00 ? 29  ARG A HH11 3  
ATOM 5080  H HH12 . ARG A 1 29  ? 119.302 -5.640  6.046   1.00 0.00 ? 29  ARG A HH12 3  
ATOM 5081  H HH21 . ARG A 1 29  ? 118.538 -4.578  9.303   1.00 0.00 ? 29  ARG A HH21 3  
ATOM 5082  H HH22 . ARG A 1 29  ? 119.776 -5.215  8.261   1.00 0.00 ? 29  ARG A HH22 3  
ATOM 5083  N N    . GLU A 1 30  ? 112.801 -7.658  5.182   1.00 0.00 ? 30  GLU A N    3  
ATOM 5084  C CA   . GLU A 1 30  ? 113.087 -9.087  5.299   1.00 0.00 ? 30  GLU A CA   3  
ATOM 5085  C C    . GLU A 1 30  ? 113.085 -9.750  3.920   1.00 0.00 ? 30  GLU A C    3  
ATOM 5086  O O    . GLU A 1 30  ? 113.925 -10.603 3.629   1.00 0.00 ? 30  GLU A O    3  
ATOM 5087  C CB   . GLU A 1 30  ? 112.078 -9.778  6.237   1.00 0.00 ? 30  GLU A CB   3  
ATOM 5088  C CG   . GLU A 1 30  ? 110.694 -10.008 5.637   1.00 0.00 ? 30  GLU A CG   3  
ATOM 5089  C CD   . GLU A 1 30  ? 109.793 -10.822 6.554   1.00 0.00 ? 30  GLU A CD   3  
ATOM 5090  O OE1  . GLU A 1 30  ? 110.071 -12.027 6.744   1.00 0.00 ? 30  GLU A OE1  3  
ATOM 5091  O OE2  . GLU A 1 30  ? 108.814 -10.263 7.091   1.00 0.00 ? 30  GLU A OE2  3  
ATOM 5092  H H    . GLU A 1 30  ? 111.922 -7.317  5.466   1.00 0.00 ? 30  GLU A H    3  
ATOM 5093  H HA   . GLU A 1 30  ? 114.078 -9.187  5.723   1.00 0.00 ? 30  GLU A HA   3  
ATOM 5094  H HB2  . GLU A 1 30  ? 112.480 -10.736 6.532   1.00 0.00 ? 30  GLU A HB2  3  
ATOM 5095  H HB3  . GLU A 1 30  ? 111.960 -9.165  7.121   1.00 0.00 ? 30  GLU A HB3  3  
ATOM 5096  H HG2  . GLU A 1 30  ? 110.231 -9.048  5.454   1.00 0.00 ? 30  GLU A HG2  3  
ATOM 5097  H HG3  . GLU A 1 30  ? 110.803 -10.536 4.700   1.00 0.00 ? 30  GLU A HG3  3  
ATOM 5098  N N    . PHE A 1 31  ? 112.150 -9.327  3.075   1.00 0.00 ? 31  PHE A N    3  
ATOM 5099  C CA   . PHE A 1 31  ? 112.013 -9.852  1.717   1.00 0.00 ? 31  PHE A CA   3  
ATOM 5100  C C    . PHE A 1 31  ? 113.334 -9.709  0.966   1.00 0.00 ? 31  PHE A C    3  
ATOM 5101  O O    . PHE A 1 31  ? 113.931 -10.695 0.518   1.00 0.00 ? 31  PHE A O    3  
ATOM 5102  C CB   . PHE A 1 31  ? 110.893 -9.086  0.989   1.00 0.00 ? 31  PHE A CB   3  
ATOM 5103  C CG   . PHE A 1 31  ? 110.525 -9.633  -0.370  1.00 0.00 ? 31  PHE A CG   3  
ATOM 5104  C CD1  . PHE A 1 31  ? 111.177 -9.195  -1.514  1.00 0.00 ? 31  PHE A CD1  3  
ATOM 5105  C CD2  . PHE A 1 31  ? 109.516 -10.576 -0.501  1.00 0.00 ? 31  PHE A CD2  3  
ATOM 5106  C CE1  . PHE A 1 31  ? 110.831 -9.688  -2.756  1.00 0.00 ? 31  PHE A CE1  3  
ATOM 5107  C CE2  . PHE A 1 31  ? 109.167 -11.072 -1.741  1.00 0.00 ? 31  PHE A CE2  3  
ATOM 5108  C CZ   . PHE A 1 31  ? 109.825 -10.628 -2.870  1.00 0.00 ? 31  PHE A CZ   3  
ATOM 5109  H H    . PHE A 1 31  ? 111.524 -8.636  3.375   1.00 0.00 ? 31  PHE A H    3  
ATOM 5110  H HA   . PHE A 1 31  ? 111.749 -10.898 1.782   1.00 0.00 ? 31  PHE A HA   3  
ATOM 5111  H HB2  . PHE A 1 31  ? 110.003 -9.108  1.601   1.00 0.00 ? 31  PHE A HB2  3  
ATOM 5112  H HB3  . PHE A 1 31  ? 111.200 -8.057  0.861   1.00 0.00 ? 31  PHE A HB3  3  
ATOM 5113  H HD1  . PHE A 1 31  ? 111.964 -8.460  -1.427  1.00 0.00 ? 31  PHE A HD1  3  
ATOM 5114  H HD2  . PHE A 1 31  ? 108.999 -10.926 0.382   1.00 0.00 ? 31  PHE A HD2  3  
ATOM 5115  H HE1  . PHE A 1 31  ? 111.347 -9.340  -3.639  1.00 0.00 ? 31  PHE A HE1  3  
ATOM 5116  H HE2  . PHE A 1 31  ? 108.381 -11.808 -1.828  1.00 0.00 ? 31  PHE A HE2  3  
ATOM 5117  H HZ   . PHE A 1 31  ? 109.554 -11.015 -3.841  1.00 0.00 ? 31  PHE A HZ   3  
ATOM 5118  N N    . LEU A 1 32  ? 113.804 -8.472  0.869   1.00 0.00 ? 32  LEU A N    3  
ATOM 5119  C CA   . LEU A 1 32  ? 115.040 -8.178  0.162   1.00 0.00 ? 32  LEU A CA   3  
ATOM 5120  C C    . LEU A 1 32  ? 116.243 -8.780  0.885   1.00 0.00 ? 32  LEU A C    3  
ATOM 5121  O O    . LEU A 1 32  ? 117.231 -9.145  0.253   1.00 0.00 ? 32  LEU A O    3  
ATOM 5122  C CB   . LEU A 1 32  ? 115.224 -6.667  0.003   1.00 0.00 ? 32  LEU A CB   3  
ATOM 5123  C CG   . LEU A 1 32  ? 114.175 -5.948  -0.861  1.00 0.00 ? 32  LEU A CG   3  
ATOM 5124  C CD1  . LEU A 1 32  ? 114.626 -4.520  -1.152  1.00 0.00 ? 32  LEU A CD1  3  
ATOM 5125  C CD2  . LEU A 1 32  ? 113.905 -6.709  -2.160  1.00 0.00 ? 32  LEU A CD2  3  
ATOM 5126  H H    . LEU A 1 32  ? 113.305 -7.736  1.286   1.00 0.00 ? 32  LEU A H    3  
ATOM 5127  H HA   . LEU A 1 32  ? 114.971 -8.625  -0.820  1.00 0.00 ? 32  LEU A HA   3  
ATOM 5128  H HB2  . LEU A 1 32  ? 115.209 -6.220  0.988   1.00 0.00 ? 32  LEU A HB2  3  
ATOM 5129  H HB3  . LEU A 1 32  ? 116.196 -6.491  -0.434  1.00 0.00 ? 32  LEU A HB3  3  
ATOM 5130  H HG   . LEU A 1 32  ? 113.246 -5.892  -0.310  1.00 0.00 ? 32  LEU A HG   3  
ATOM 5131  H HD11 . LEU A 1 32  ? 115.589 -4.536  -1.642  1.00 0.00 ? 32  LEU A HD11 3  
ATOM 5132  H HD12 . LEU A 1 32  ? 114.703 -3.971  -0.225  1.00 0.00 ? 32  LEU A HD12 3  
ATOM 5133  H HD13 . LEU A 1 32  ? 113.905 -4.038  -1.794  1.00 0.00 ? 32  LEU A HD13 3  
ATOM 5134  H HD21 . LEU A 1 32  ? 113.165 -6.179  -2.742  1.00 0.00 ? 32  LEU A HD21 3  
ATOM 5135  H HD22 . LEU A 1 32  ? 113.536 -7.698  -1.929  1.00 0.00 ? 32  LEU A HD22 3  
ATOM 5136  H HD23 . LEU A 1 32  ? 114.820 -6.792  -2.730  1.00 0.00 ? 32  LEU A HD23 3  
ATOM 5137  N N    . LYS A 1 33  ? 116.158 -8.881  2.208   1.00 0.00 ? 33  LYS A N    3  
ATOM 5138  C CA   . LYS A 1 33  ? 117.235 -9.476  3.002   1.00 0.00 ? 33  LYS A CA   3  
ATOM 5139  C C    . LYS A 1 33  ? 117.500 -10.911 2.563   1.00 0.00 ? 33  LYS A C    3  
ATOM 5140  O O    . LYS A 1 33  ? 118.648 -11.313 2.368   1.00 0.00 ? 33  LYS A O    3  
ATOM 5141  C CB   . LYS A 1 33  ? 116.886 -9.438  4.498   1.00 0.00 ? 33  LYS A CB   3  
ATOM 5142  C CG   . LYS A 1 33  ? 117.798 -10.300 5.373   1.00 0.00 ? 33  LYS A CG   3  
ATOM 5143  C CD   . LYS A 1 33  ? 117.477 -10.148 6.856   1.00 0.00 ? 33  LYS A CD   3  
ATOM 5144  C CE   . LYS A 1 33  ? 117.878 -8.778  7.384   1.00 0.00 ? 33  LYS A CE   3  
ATOM 5145  N NZ   . LYS A 1 33  ? 119.344 -8.553  7.271   1.00 0.00 ? 33  LYS A NZ   3  
ATOM 5146  H H    . LYS A 1 33  ? 115.353 -8.552  2.663   1.00 0.00 ? 33  LYS A H    3  
ATOM 5147  H HA   . LYS A 1 33  ? 118.129 -8.892  2.835   1.00 0.00 ? 33  LYS A HA   3  
ATOM 5148  H HB2  . LYS A 1 33  ? 116.953 -8.415  4.844   1.00 0.00 ? 33  LYS A HB2  3  
ATOM 5149  H HB3  . LYS A 1 33  ? 115.869 -9.783  4.627   1.00 0.00 ? 33  LYS A HB3  3  
ATOM 5150  H HG2  . LYS A 1 33  ? 117.671 -11.338 5.095   1.00 0.00 ? 33  LYS A HG2  3  
ATOM 5151  H HG3  . LYS A 1 33  ? 118.825 -10.008 5.203   1.00 0.00 ? 33  LYS A HG3  3  
ATOM 5152  H HD2  . LYS A 1 33  ? 116.414 -10.281 7.001   1.00 0.00 ? 33  LYS A HD2  3  
ATOM 5153  H HD3  . LYS A 1 33  ? 118.012 -10.908 7.410   1.00 0.00 ? 33  LYS A HD3  3  
ATOM 5154  H HE2  . LYS A 1 33  ? 117.361 -8.018  6.816   1.00 0.00 ? 33  LYS A HE2  3  
ATOM 5155  H HE3  . LYS A 1 33  ? 117.590 -8.707  8.423   1.00 0.00 ? 33  LYS A HE3  3  
ATOM 5156  H HZ1  . LYS A 1 33  ? 119.861 -9.335  7.722   1.00 0.00 ? 33  LYS A HZ1  3  
ATOM 5157  H HZ2  . LYS A 1 33  ? 119.609 -7.667  7.746   1.00 0.00 ? 33  LYS A HZ2  3  
ATOM 5158  H HZ3  . LYS A 1 33  ? 119.629 -8.496  6.271   1.00 0.00 ? 33  LYS A HZ3  3  
ATOM 5159  N N    . LYS A 1 34  ? 116.428 -11.668 2.400   1.00 0.00 ? 34  LYS A N    3  
ATOM 5160  C CA   . LYS A 1 34  ? 116.519 -13.081 2.045   1.00 0.00 ? 34  LYS A CA   3  
ATOM 5161  C C    . LYS A 1 34  ? 116.931 -13.256 0.584   1.00 0.00 ? 34  LYS A C    3  
ATOM 5162  O O    . LYS A 1 34  ? 117.573 -14.242 0.222   1.00 0.00 ? 34  LYS A O    3  
ATOM 5163  C CB   . LYS A 1 34  ? 115.165 -13.759 2.292   1.00 0.00 ? 34  LYS A CB   3  
ATOM 5164  C CG   . LYS A 1 34  ? 114.653 -13.593 3.722   1.00 0.00 ? 34  LYS A CG   3  
ATOM 5165  C CD   . LYS A 1 34  ? 113.211 -14.070 3.873   1.00 0.00 ? 34  LYS A CD   3  
ATOM 5166  C CE   . LYS A 1 34  ? 112.619 -13.664 5.220   1.00 0.00 ? 34  LYS A CE   3  
ATOM 5167  N NZ   . LYS A 1 34  ? 111.188 -14.053 5.340   1.00 0.00 ? 34  LYS A NZ   3  
ATOM 5168  H H    . LYS A 1 34  ? 115.540 -11.266 2.523   1.00 0.00 ? 34  LYS A H    3  
ATOM 5169  H HA   . LYS A 1 34  ? 117.264 -13.540 2.680   1.00 0.00 ? 34  LYS A HA   3  
ATOM 5170  H HB2  . LYS A 1 34  ? 114.434 -13.333 1.618   1.00 0.00 ? 34  LYS A HB2  3  
ATOM 5171  H HB3  . LYS A 1 34  ? 115.261 -14.814 2.084   1.00 0.00 ? 34  LYS A HB3  3  
ATOM 5172  H HG2  . LYS A 1 34  ? 115.283 -14.167 4.387   1.00 0.00 ? 34  LYS A HG2  3  
ATOM 5173  H HG3  . LYS A 1 34  ? 114.708 -12.547 3.991   1.00 0.00 ? 34  LYS A HG3  3  
ATOM 5174  H HD2  . LYS A 1 34  ? 112.612 -13.635 3.085   1.00 0.00 ? 34  LYS A HD2  3  
ATOM 5175  H HD3  . LYS A 1 34  ? 113.187 -15.148 3.790   1.00 0.00 ? 34  LYS A HD3  3  
ATOM 5176  H HE2  . LYS A 1 34  ? 113.179 -14.146 6.008   1.00 0.00 ? 34  LYS A HE2  3  
ATOM 5177  H HE3  . LYS A 1 34  ? 112.700 -12.591 5.328   1.00 0.00 ? 34  LYS A HE3  3  
ATOM 5178  H HZ1  . LYS A 1 34  ? 110.657 -13.730 4.506   1.00 0.00 ? 34  LYS A HZ1  3  
ATOM 5179  H HZ2  . LYS A 1 34  ? 110.769 -13.620 6.189   1.00 0.00 ? 34  LYS A HZ2  3  
ATOM 5180  H HZ3  . LYS A 1 34  ? 111.102 -15.086 5.416   1.00 0.00 ? 34  LYS A HZ3  3  
ATOM 5181  N N    . GLU A 1 35  ? 116.559 -12.287 -0.247  1.00 0.00 ? 35  GLU A N    3  
ATOM 5182  C CA   . GLU A 1 35  ? 116.766 -12.379 -1.695  1.00 0.00 ? 35  GLU A CA   3  
ATOM 5183  C C    . GLU A 1 35  ? 117.866 -11.442 -2.198  1.00 0.00 ? 35  GLU A C    3  
ATOM 5184  O O    . GLU A 1 35  ? 117.986 -11.207 -3.401  1.00 0.00 ? 35  GLU A O    3  
ATOM 5185  C CB   . GLU A 1 35  ? 115.446 -12.081 -2.394  1.00 0.00 ? 35  GLU A CB   3  
ATOM 5186  C CG   . GLU A 1 35  ? 114.376 -13.123 -2.073  1.00 0.00 ? 35  GLU A CG   3  
ATOM 5187  C CD   . GLU A 1 35  ? 113.043 -12.868 -2.749  1.00 0.00 ? 35  GLU A CD   3  
ATOM 5188  O OE1  . GLU A 1 35  ? 112.997 -12.858 -3.996  1.00 0.00 ? 35  GLU A OE1  3  
ATOM 5189  O OE2  . GLU A 1 35  ? 112.030 -12.726 -2.037  1.00 0.00 ? 35  GLU A OE2  3  
ATOM 5190  H H    . GLU A 1 35  ? 116.107 -11.497 0.120   1.00 0.00 ? 35  GLU A H    3  
ATOM 5191  H HA   . GLU A 1 35  ? 117.055 -13.395 -1.926  1.00 0.00 ? 35  GLU A HA   3  
ATOM 5192  H HB2  . GLU A 1 35  ? 115.100 -11.105 -2.069  1.00 0.00 ? 35  GLU A HB2  3  
ATOM 5193  H HB3  . GLU A 1 35  ? 115.606 -12.064 -3.461  1.00 0.00 ? 35  GLU A HB3  3  
ATOM 5194  H HG2  . GLU A 1 35  ? 114.735 -14.092 -2.390  1.00 0.00 ? 35  GLU A HG2  3  
ATOM 5195  H HG3  . GLU A 1 35  ? 114.224 -13.139 -1.000  1.00 0.00 ? 35  GLU A HG3  3  
ATOM 5196  N N    . PHE A 1 36  ? 118.658 -10.926 -1.271  1.00 0.00 ? 36  PHE A N    3  
ATOM 5197  C CA   . PHE A 1 36  ? 119.821 -10.093 -1.591  1.00 0.00 ? 36  PHE A CA   3  
ATOM 5198  C C    . PHE A 1 36  ? 119.426 -8.810  -2.322  1.00 0.00 ? 36  PHE A C    3  
ATOM 5199  O O    . PHE A 1 36  ? 119.595 -8.671  -3.536  1.00 0.00 ? 36  PHE A O    3  
ATOM 5200  C CB   . PHE A 1 36  ? 120.865 -10.880 -2.392  1.00 0.00 ? 36  PHE A CB   3  
ATOM 5201  C CG   . PHE A 1 36  ? 122.124 -10.098 -2.700  1.00 0.00 ? 36  PHE A CG   3  
ATOM 5202  C CD1  . PHE A 1 36  ? 123.015 -9.768  -1.690  1.00 0.00 ? 36  PHE A CD1  3  
ATOM 5203  C CD2  . PHE A 1 36  ? 122.412 -9.690  -3.997  1.00 0.00 ? 36  PHE A CD2  3  
ATOM 5204  C CE1  . PHE A 1 36  ? 124.164 -9.052  -1.965  1.00 0.00 ? 36  PHE A CE1  3  
ATOM 5205  C CE2  . PHE A 1 36  ? 123.560 -8.973  -4.276  1.00 0.00 ? 36  PHE A CE2  3  
ATOM 5206  C CZ   . PHE A 1 36  ? 124.437 -8.654  -3.259  1.00 0.00 ? 36  PHE A CZ   3  
ATOM 5207  H H    . PHE A 1 36  ? 118.449 -11.100 -0.331  1.00 0.00 ? 36  PHE A H    3  
ATOM 5208  H HA   . PHE A 1 36  ? 120.266 -9.810  -0.647  1.00 0.00 ? 36  PHE A HA   3  
ATOM 5209  H HB2  . PHE A 1 36  ? 121.146 -11.749 -1.823  1.00 0.00 ? 36  PHE A HB2  3  
ATOM 5210  H HB3  . PHE A 1 36  ? 120.426 -11.196 -3.327  1.00 0.00 ? 36  PHE A HB3  3  
ATOM 5211  H HD1  . PHE A 1 36  ? 122.806 -10.078 -0.676  1.00 0.00 ? 36  PHE A HD1  3  
ATOM 5212  H HD2  . PHE A 1 36  ? 121.727 -9.938  -4.796  1.00 0.00 ? 36  PHE A HD2  3  
ATOM 5213  H HE1  . PHE A 1 36  ? 124.850 -8.803  -1.167  1.00 0.00 ? 36  PHE A HE1  3  
ATOM 5214  H HE2  . PHE A 1 36  ? 123.771 -8.663  -5.289  1.00 0.00 ? 36  PHE A HE2  3  
ATOM 5215  H HZ   . PHE A 1 36  ? 125.335 -8.093  -3.475  1.00 0.00 ? 36  PHE A HZ   3  
ATOM 5216  N N    . SER A 1 37  ? 118.837 -7.910  -1.565  1.00 0.00 ? 37  SER A N    3  
ATOM 5217  C CA   . SER A 1 37  ? 118.590 -6.541  -2.013  1.00 0.00 ? 37  SER A CA   3  
ATOM 5218  C C    . SER A 1 37  ? 118.353 -5.631  -0.799  1.00 0.00 ? 37  SER A C    3  
ATOM 5219  O O    . SER A 1 37  ? 117.824 -4.514  -0.916  1.00 0.00 ? 37  SER A O    3  
ATOM 5220  C CB   . SER A 1 37  ? 117.393 -6.507  -2.980  1.00 0.00 ? 37  SER A CB   3  
ATOM 5221  O OG   . SER A 1 37  ? 117.180 -5.208  -3.514  1.00 0.00 ? 37  SER A OG   3  
ATOM 5222  H H    . SER A 1 37  ? 118.521 -8.191  -0.686  1.00 0.00 ? 37  SER A H    3  
ATOM 5223  H HA   . SER A 1 37  ? 119.475 -6.197  -2.533  1.00 0.00 ? 37  SER A HA   3  
ATOM 5224  H HB2  . SER A 1 37  ? 117.577 -7.187  -3.799  1.00 0.00 ? 37  SER A HB2  3  
ATOM 5225  H HB3  . SER A 1 37  ? 116.501 -6.815  -2.455  1.00 0.00 ? 37  SER A HB3  3  
ATOM 5226  H HG   . SER A 1 37  ? 116.906 -5.279  -4.436  1.00 0.00 ? 37  SER A HG   3  
ATOM 5227  N N    . GLU A 1 38  ? 118.768 -6.096  0.383   1.00 0.00 ? 38  GLU A N    3  
ATOM 5228  C CA   . GLU A 1 38  ? 118.560 -5.323  1.603   1.00 0.00 ? 38  GLU A CA   3  
ATOM 5229  C C    . GLU A 1 38  ? 119.452 -4.087  1.592   1.00 0.00 ? 38  GLU A C    3  
ATOM 5230  O O    . GLU A 1 38  ? 119.211 -3.129  2.322   1.00 0.00 ? 38  GLU A O    3  
ATOM 5231  C CB   . GLU A 1 38  ? 118.793 -6.166  2.865   1.00 0.00 ? 38  GLU A CB   3  
ATOM 5232  C CG   . GLU A 1 38  ? 120.228 -6.627  3.070   1.00 0.00 ? 38  GLU A CG   3  
ATOM 5233  C CD   . GLU A 1 38  ? 120.386 -7.469  4.326   1.00 0.00 ? 38  GLU A CD   3  
ATOM 5234  O OE1  . GLU A 1 38  ? 120.378 -6.898  5.436   1.00 0.00 ? 38  GLU A OE1  3  
ATOM 5235  O OE2  . GLU A 1 38  ? 120.492 -8.704  4.216   1.00 0.00 ? 38  GLU A OE2  3  
ATOM 5236  H H    . GLU A 1 38  ? 119.241 -6.953  0.428   1.00 0.00 ? 38  GLU A H    3  
ATOM 5237  H HA   . GLU A 1 38  ? 117.529 -4.991  1.597   1.00 0.00 ? 38  GLU A HA   3  
ATOM 5238  H HB2  . GLU A 1 38  ? 118.502 -5.583  3.728   1.00 0.00 ? 38  GLU A HB2  3  
ATOM 5239  H HB3  . GLU A 1 38  ? 118.162 -7.042  2.813   1.00 0.00 ? 38  GLU A HB3  3  
ATOM 5240  H HG2  . GLU A 1 38  ? 120.531 -7.213  2.216   1.00 0.00 ? 38  GLU A HG2  3  
ATOM 5241  H HG3  . GLU A 1 38  ? 120.866 -5.757  3.152   1.00 0.00 ? 38  GLU A HG3  3  
ATOM 5242  N N    . GLU A 1 39  ? 120.471 -4.122  0.738   1.00 0.00 ? 39  GLU A N    3  
ATOM 5243  C CA   . GLU A 1 39  ? 121.312 -2.958  0.475   1.00 0.00 ? 39  GLU A CA   3  
ATOM 5244  C C    . GLU A 1 39  ? 120.438 -1.818  -0.041  1.00 0.00 ? 39  GLU A C    3  
ATOM 5245  O O    . GLU A 1 39  ? 120.585 -0.663  0.361   1.00 0.00 ? 39  GLU A O    3  
ATOM 5246  C CB   . GLU A 1 39  ? 122.391 -3.297  -0.572  1.00 0.00 ? 39  GLU A CB   3  
ATOM 5247  C CG   . GLU A 1 39  ? 123.435 -4.320  -0.117  1.00 0.00 ? 39  GLU A CG   3  
ATOM 5248  C CD   . GLU A 1 39  ? 122.843 -5.659  0.303   1.00 0.00 ? 39  GLU A CD   3  
ATOM 5249  O OE1  . GLU A 1 39  ? 122.041 -6.232  -0.466  1.00 0.00 ? 39  GLU A OE1  3  
ATOM 5250  O OE2  . GLU A 1 39  ? 123.164 -6.134  1.414   1.00 0.00 ? 39  GLU A OE2  3  
ATOM 5251  H H    . GLU A 1 39  ? 120.664 -4.961  0.268   1.00 0.00 ? 39  GLU A H    3  
ATOM 5252  H HA   . GLU A 1 39  ? 121.786 -2.660  1.401   1.00 0.00 ? 39  GLU A HA   3  
ATOM 5253  H HB2  . GLU A 1 39  ? 121.904 -3.687  -1.455  1.00 0.00 ? 39  GLU A HB2  3  
ATOM 5254  H HB3  . GLU A 1 39  ? 122.909 -2.385  -0.839  1.00 0.00 ? 39  GLU A HB3  3  
ATOM 5255  H HG2  . GLU A 1 39  ? 124.124 -4.494  -0.932  1.00 0.00 ? 39  GLU A HG2  3  
ATOM 5256  H HG3  . GLU A 1 39  ? 123.979 -3.903  0.721   1.00 0.00 ? 39  GLU A HG3  3  
ATOM 5257  N N    . ASN A 1 40  ? 119.509 -2.183  -0.925  1.00 0.00 ? 40  ASN A N    3  
ATOM 5258  C CA   . ASN A 1 40  ? 118.565 -1.242  -1.523  1.00 0.00 ? 40  ASN A CA   3  
ATOM 5259  C C    . ASN A 1 40  ? 117.667 -0.628  -0.451  1.00 0.00 ? 40  ASN A C    3  
ATOM 5260  O O    . ASN A 1 40  ? 117.668 0.592   -0.251  1.00 0.00 ? 40  ASN A O    3  
ATOM 5261  C CB   . ASN A 1 40  ? 117.718 -1.971  -2.582  1.00 0.00 ? 40  ASN A CB   3  
ATOM 5262  C CG   . ASN A 1 40  ? 116.572 -1.137  -3.134  1.00 0.00 ? 40  ASN A CG   3  
ATOM 5263  O OD1  . ASN A 1 40  ? 116.668 0.082   -3.256  1.00 0.00 ? 40  ASN A OD1  3  
ATOM 5264  N ND2  . ASN A 1 40  ? 115.475 -1.801  -3.475  1.00 0.00 ? 40  ASN A ND2  3  
ATOM 5265  H H    . ASN A 1 40  ? 119.451 -3.128  -1.178  1.00 0.00 ? 40  ASN A H    3  
ATOM 5266  H HA   . ASN A 1 40  ? 119.132 -0.456  -2.002  1.00 0.00 ? 40  ASN A HA   3  
ATOM 5267  H HB2  . ASN A 1 40  ? 118.356 -2.251  -3.408  1.00 0.00 ? 40  ASN A HB2  3  
ATOM 5268  H HB3  . ASN A 1 40  ? 117.303 -2.867  -2.141  1.00 0.00 ? 40  ASN A HB3  3  
ATOM 5269  H HD21 . ASN A 1 40  ? 115.468 -2.774  -3.356  1.00 0.00 ? 40  ASN A HD21 3  
ATOM 5270  H HD22 . ASN A 1 40  ? 114.715 -1.292  -3.826  1.00 0.00 ? 40  ASN A HD22 3  
ATOM 5271  N N    . VAL A 1 41  ? 116.921 -1.479  0.259   1.00 0.00 ? 41  VAL A N    3  
ATOM 5272  C CA   . VAL A 1 41  ? 115.978 -0.992  1.273   1.00 0.00 ? 41  VAL A CA   3  
ATOM 5273  C C    . VAL A 1 41  ? 116.696 -0.185  2.360   1.00 0.00 ? 41  VAL A C    3  
ATOM 5274  O O    . VAL A 1 41  ? 116.260 0.910   2.721   1.00 0.00 ? 41  VAL A O    3  
ATOM 5275  C CB   . VAL A 1 41  ? 115.154 -2.140  1.926   1.00 0.00 ? 41  VAL A CB   3  
ATOM 5276  C CG1  . VAL A 1 41  ? 116.058 -3.188  2.563   1.00 0.00 ? 41  VAL A CG1  3  
ATOM 5277  C CG2  . VAL A 1 41  ? 114.168 -1.585  2.957   1.00 0.00 ? 41  VAL A CG2  3  
ATOM 5278  H H    . VAL A 1 41  ? 117.009 -2.448  0.097   1.00 0.00 ? 41  VAL A H    3  
ATOM 5279  H HA   . VAL A 1 41  ? 115.282 -0.333  0.767   1.00 0.00 ? 41  VAL A HA   3  
ATOM 5280  H HB   . VAL A 1 41  ? 114.581 -2.625  1.147   1.00 0.00 ? 41  VAL A HB   3  
ATOM 5281  H HG11 . VAL A 1 41  ? 116.710 -3.606  1.811   1.00 0.00 ? 41  VAL A HG11 3  
ATOM 5282  H HG12 . VAL A 1 41  ? 115.455 -3.976  2.991   1.00 0.00 ? 41  VAL A HG12 3  
ATOM 5283  H HG13 . VAL A 1 41  ? 116.654 -2.730  3.340   1.00 0.00 ? 41  VAL A HG13 3  
ATOM 5284  H HG21 . VAL A 1 41  ? 113.590 -2.396  3.377   1.00 0.00 ? 41  VAL A HG21 3  
ATOM 5285  H HG22 . VAL A 1 41  ? 113.503 -0.880  2.479   1.00 0.00 ? 41  VAL A HG22 3  
ATOM 5286  H HG23 . VAL A 1 41  ? 114.712 -1.086  3.746   1.00 0.00 ? 41  VAL A HG23 3  
ATOM 5287  N N    . LEU A 1 42  ? 117.814 -0.712  2.854   1.00 0.00 ? 42  LEU A N    3  
ATOM 5288  C CA   . LEU A 1 42  ? 118.560 -0.058  3.926   1.00 0.00 ? 42  LEU A CA   3  
ATOM 5289  C C    . LEU A 1 42  ? 119.078 1.304   3.490   1.00 0.00 ? 42  LEU A C    3  
ATOM 5290  O O    . LEU A 1 42  ? 119.097 2.240   4.282   1.00 0.00 ? 42  LEU A O    3  
ATOM 5291  C CB   . LEU A 1 42  ? 119.730 -0.934  4.398   1.00 0.00 ? 42  LEU A CB   3  
ATOM 5292  C CG   . LEU A 1 42  ? 119.349 -2.089  5.334   1.00 0.00 ? 42  LEU A CG   3  
ATOM 5293  C CD1  . LEU A 1 42  ? 120.571 -2.945  5.656   1.00 0.00 ? 42  LEU A CD1  3  
ATOM 5294  C CD2  . LEU A 1 42  ? 118.714 -1.545  6.614   1.00 0.00 ? 42  LEU A CD2  3  
ATOM 5295  H H    . LEU A 1 42  ? 118.150 -1.554  2.483   1.00 0.00 ? 42  LEU A H    3  
ATOM 5296  H HA   . LEU A 1 42  ? 117.880 0.085   4.754   1.00 0.00 ? 42  LEU A HA   3  
ATOM 5297  H HB2  . LEU A 1 42  ? 120.214 -1.351  3.524   1.00 0.00 ? 42  LEU A HB2  3  
ATOM 5298  H HB3  . LEU A 1 42  ? 120.443 -0.305  4.913   1.00 0.00 ? 42  LEU A HB3  3  
ATOM 5299  H HG   . LEU A 1 42  ? 118.622 -2.720  4.841   1.00 0.00 ? 42  LEU A HG   3  
ATOM 5300  H HD11 . LEU A 1 42  ? 121.322 -2.336  6.138   1.00 0.00 ? 42  LEU A HD11 3  
ATOM 5301  H HD12 . LEU A 1 42  ? 120.973 -3.357  4.742   1.00 0.00 ? 42  LEU A HD12 3  
ATOM 5302  H HD13 . LEU A 1 42  ? 120.283 -3.751  6.316   1.00 0.00 ? 42  LEU A HD13 3  
ATOM 5303  H HD21 . LEU A 1 42  ? 117.815 -0.999  6.367   1.00 0.00 ? 42  LEU A HD21 3  
ATOM 5304  H HD22 . LEU A 1 42  ? 119.410 -0.883  7.110   1.00 0.00 ? 42  LEU A HD22 3  
ATOM 5305  H HD23 . LEU A 1 42  ? 118.466 -2.365  7.272   1.00 0.00 ? 42  LEU A HD23 3  
ATOM 5306  N N    . PHE A 1 43  ? 119.487 1.413   2.231   1.00 0.00 ? 43  PHE A N    3  
ATOM 5307  C CA   . PHE A 1 43  ? 120.048 2.658   1.720   1.00 0.00 ? 43  PHE A CA   3  
ATOM 5308  C C    . PHE A 1 43  ? 119.014 3.783   1.769   1.00 0.00 ? 43  PHE A C    3  
ATOM 5309  O O    . PHE A 1 43  ? 119.303 4.878   2.259   1.00 0.00 ? 43  PHE A O    3  
ATOM 5310  C CB   . PHE A 1 43  ? 120.570 2.473   0.290   1.00 0.00 ? 43  PHE A CB   3  
ATOM 5311  C CG   . PHE A 1 43  ? 121.166 3.728   -0.301  1.00 0.00 ? 43  PHE A CG   3  
ATOM 5312  C CD1  . PHE A 1 43  ? 122.152 4.431   0.381   1.00 0.00 ? 43  PHE A CD1  3  
ATOM 5313  C CD2  . PHE A 1 43  ? 120.743 4.204   -1.535  1.00 0.00 ? 43  PHE A CD2  3  
ATOM 5314  C CE1  . PHE A 1 43  ? 122.699 5.580   -0.156  1.00 0.00 ? 43  PHE A CE1  3  
ATOM 5315  C CE2  . PHE A 1 43  ? 121.289 5.353   -2.075  1.00 0.00 ? 43  PHE A CE2  3  
ATOM 5316  C CZ   . PHE A 1 43  ? 122.268 6.041   -1.385  1.00 0.00 ? 43  PHE A CZ   3  
ATOM 5317  H H    . PHE A 1 43  ? 119.409 0.640   1.630   1.00 0.00 ? 43  PHE A H    3  
ATOM 5318  H HA   . PHE A 1 43  ? 120.877 2.927   2.360   1.00 0.00 ? 43  PHE A HA   3  
ATOM 5319  H HB2  . PHE A 1 43  ? 121.335 1.709   0.289   1.00 0.00 ? 43  PHE A HB2  3  
ATOM 5320  H HB3  . PHE A 1 43  ? 119.754 2.156   -0.345  1.00 0.00 ? 43  PHE A HB3  3  
ATOM 5321  H HD1  . PHE A 1 43  ? 122.493 4.073   1.344   1.00 0.00 ? 43  PHE A HD1  3  
ATOM 5322  H HD2  . PHE A 1 43  ? 119.977 3.668   -2.077  1.00 0.00 ? 43  PHE A HD2  3  
ATOM 5323  H HE1  . PHE A 1 43  ? 123.464 6.118   0.385   1.00 0.00 ? 43  PHE A HE1  3  
ATOM 5324  H HE2  . PHE A 1 43  ? 120.951 5.714   -3.036  1.00 0.00 ? 43  PHE A HE2  3  
ATOM 5325  H HZ   . PHE A 1 43  ? 122.695 6.940   -1.805  1.00 0.00 ? 43  PHE A HZ   3  
ATOM 5326  N N    . TRP A 1 44  ? 117.807 3.507   1.277   1.00 0.00 ? 44  TRP A N    3  
ATOM 5327  C CA   . TRP A 1 44  ? 116.757 4.522   1.242   1.00 0.00 ? 44  TRP A CA   3  
ATOM 5328  C C    . TRP A 1 44  ? 116.365 4.928   2.663   1.00 0.00 ? 44  TRP A C    3  
ATOM 5329  O O    . TRP A 1 44  ? 116.315 6.116   2.989   1.00 0.00 ? 44  TRP A O    3  
ATOM 5330  C CB   . TRP A 1 44  ? 115.526 4.016   0.477   1.00 0.00 ? 44  TRP A CB   3  
ATOM 5331  C CG   . TRP A 1 44  ? 114.578 5.118   0.084   1.00 0.00 ? 44  TRP A CG   3  
ATOM 5332  C CD1  . TRP A 1 44  ? 114.571 5.808   -1.097  1.00 0.00 ? 44  TRP A CD1  3  
ATOM 5333  C CD2  . TRP A 1 44  ? 113.508 5.664   0.871   1.00 0.00 ? 44  TRP A CD2  3  
ATOM 5334  N NE1  . TRP A 1 44  ? 113.567 6.743   -1.093  1.00 0.00 ? 44  TRP A NE1  3  
ATOM 5335  C CE2  . TRP A 1 44  ? 112.900 6.675   0.102   1.00 0.00 ? 44  TRP A CE2  3  
ATOM 5336  C CE3  . TRP A 1 44  ? 113.005 5.395   2.148   1.00 0.00 ? 44  TRP A CE3  3  
ATOM 5337  C CZ2  . TRP A 1 44  ? 111.817 7.416   0.569   1.00 0.00 ? 44  TRP A CZ2  3  
ATOM 5338  C CZ3  . TRP A 1 44  ? 111.930 6.131   2.609   1.00 0.00 ? 44  TRP A CZ3  3  
ATOM 5339  C CH2  . TRP A 1 44  ? 111.346 7.131   1.821   1.00 0.00 ? 44  TRP A CH2  3  
ATOM 5340  H H    . TRP A 1 44  ? 117.622 2.606   0.929   1.00 0.00 ? 44  TRP A H    3  
ATOM 5341  H HA   . TRP A 1 44  ? 117.156 5.389   0.731   1.00 0.00 ? 44  TRP A HA   3  
ATOM 5342  H HB2  . TRP A 1 44  ? 115.851 3.518   -0.426  1.00 0.00 ? 44  TRP A HB2  3  
ATOM 5343  H HB3  . TRP A 1 44  ? 114.986 3.312   1.094   1.00 0.00 ? 44  TRP A HB3  3  
ATOM 5344  H HD1  . TRP A 1 44  ? 115.265 5.632   -1.907  1.00 0.00 ? 44  TRP A HD1  3  
ATOM 5345  H HE1  . TRP A 1 44  ? 113.360 7.363   -1.830  1.00 0.00 ? 44  TRP A HE1  3  
ATOM 5346  H HE3  . TRP A 1 44  ? 113.442 4.629   2.770   1.00 0.00 ? 44  TRP A HE3  3  
ATOM 5347  H HZ2  . TRP A 1 44  ? 111.355 8.189   -0.027  1.00 0.00 ? 44  TRP A HZ2  3  
ATOM 5348  H HZ3  . TRP A 1 44  ? 111.528 5.937   3.594   1.00 0.00 ? 44  TRP A HZ3  3  
ATOM 5349  H HH2  . TRP A 1 44  ? 110.508 7.680   2.222   1.00 0.00 ? 44  TRP A HH2  3  
ATOM 5350  N N    . LEU A 1 45  ? 116.102 3.933   3.509   1.00 0.00 ? 45  LEU A N    3  
ATOM 5351  C CA   . LEU A 1 45  ? 115.731 4.184   4.903   1.00 0.00 ? 45  LEU A CA   3  
ATOM 5352  C C    . LEU A 1 45  ? 116.866 4.888   5.646   1.00 0.00 ? 45  LEU A C    3  
ATOM 5353  O O    . LEU A 1 45  ? 116.625 5.717   6.527   1.00 0.00 ? 45  LEU A O    3  
ATOM 5354  C CB   . LEU A 1 45  ? 115.345 2.874   5.617   1.00 0.00 ? 45  LEU A CB   3  
ATOM 5355  C CG   . LEU A 1 45  ? 113.910 2.371   5.358   1.00 0.00 ? 45  LEU A CG   3  
ATOM 5356  C CD1  . LEU A 1 45  ? 112.885 3.397   5.841   1.00 0.00 ? 45  LEU A CD1  3  
ATOM 5357  C CD2  . LEU A 1 45  ? 113.692 2.046   3.881   1.00 0.00 ? 45  LEU A CD2  3  
ATOM 5358  H H    . LEU A 1 45  ? 116.160 3.006   3.190   1.00 0.00 ? 45  LEU A H    3  
ATOM 5359  H HA   . LEU A 1 45  ? 114.871 4.841   4.894   1.00 0.00 ? 45  LEU A HA   3  
ATOM 5360  H HB2  . LEU A 1 45  ? 116.036 2.103   5.305   1.00 0.00 ? 45  LEU A HB2  3  
ATOM 5361  H HB3  . LEU A 1 45  ? 115.460 3.021   6.683   1.00 0.00 ? 45  LEU A HB3  3  
ATOM 5362  H HG   . LEU A 1 45  ? 113.754 1.461   5.923   1.00 0.00 ? 45  LEU A HG   3  
ATOM 5363  H HD11 . LEU A 1 45  ? 113.017 4.325   5.303   1.00 0.00 ? 45  LEU A HD11 3  
ATOM 5364  H HD12 . LEU A 1 45  ? 113.021 3.572   6.899   1.00 0.00 ? 45  LEU A HD12 3  
ATOM 5365  H HD13 . LEU A 1 45  ? 111.887 3.019   5.667   1.00 0.00 ? 45  LEU A HD13 3  
ATOM 5366  H HD21 . LEU A 1 45  ? 113.892 2.923   3.283   1.00 0.00 ? 45  LEU A HD21 3  
ATOM 5367  H HD22 . LEU A 1 45  ? 112.670 1.731   3.727   1.00 0.00 ? 45  LEU A HD22 3  
ATOM 5368  H HD23 . LEU A 1 45  ? 114.359 1.250   3.586   1.00 0.00 ? 45  LEU A HD23 3  
ATOM 5369  N N    . ALA A 1 46  ? 118.103 4.562   5.283   1.00 0.00 ? 46  ALA A N    3  
ATOM 5370  C CA   . ALA A 1 46  ? 119.269 5.219   5.865   1.00 0.00 ? 46  ALA A CA   3  
ATOM 5371  C C    . ALA A 1 46  ? 119.294 6.685   5.452   1.00 0.00 ? 46  ALA A C    3  
ATOM 5372  O O    . ALA A 1 46  ? 119.610 7.559   6.255   1.00 0.00 ? 46  ALA A O    3  
ATOM 5373  C CB   . ALA A 1 46  ? 120.558 4.515   5.447   1.00 0.00 ? 46  ALA A CB   3  
ATOM 5374  H H    . ALA A 1 46  ? 118.235 3.865   4.606   1.00 0.00 ? 46  ALA A H    3  
ATOM 5375  H HA   . ALA A 1 46  ? 119.183 5.159   6.942   1.00 0.00 ? 46  ALA A HA   3  
ATOM 5376  H HB1  . ALA A 1 46  ? 120.513 3.475   5.743   1.00 0.00 ? 46  ALA A HB1  3  
ATOM 5377  H HB2  . ALA A 1 46  ? 121.403 4.988   5.927   1.00 0.00 ? 46  ALA A HB2  3  
ATOM 5378  H HB3  . ALA A 1 46  ? 120.673 4.577   4.374   1.00 0.00 ? 46  ALA A HB3  3  
ATOM 5379  N N    . CYS A 1 47  ? 118.928 6.941   4.197   1.00 0.00 ? 47  CYS A N    3  
ATOM 5380  C CA   . CYS A 1 47  ? 118.861 8.301   3.667   1.00 0.00 ? 47  CYS A CA   3  
ATOM 5381  C C    . CYS A 1 47  ? 117.719 9.070   4.333   1.00 0.00 ? 47  CYS A C    3  
ATOM 5382  O O    . CYS A 1 47  ? 117.805 10.284  4.539   1.00 0.00 ? 47  CYS A O    3  
ATOM 5383  C CB   . CYS A 1 47  ? 118.676 8.275   2.143   1.00 0.00 ? 47  CYS A CB   3  
ATOM 5384  S SG   . CYS A 1 47  ? 118.670 9.908   1.365   1.00 0.00 ? 47  CYS A SG   3  
ATOM 5385  H H    . CYS A 1 47  ? 118.697 6.191   3.608   1.00 0.00 ? 47  CYS A H    3  
ATOM 5386  H HA   . CYS A 1 47  ? 119.795 8.793   3.900   1.00 0.00 ? 47  CYS A HA   3  
ATOM 5387  H HB2  . CYS A 1 47  ? 119.481 7.707   1.699   1.00 0.00 ? 47  CYS A HB2  3  
ATOM 5388  H HB3  . CYS A 1 47  ? 117.736 7.795   1.909   1.00 0.00 ? 47  CYS A HB3  3  
ATOM 5389  H HG   . CYS A 1 47  ? 117.417 10.341  1.342   1.00 0.00 ? 47  CYS A HG   3  
ATOM 5390  N N    . GLU A 1 48  ? 116.655 8.350   4.682   1.00 0.00 ? 48  GLU A N    3  
ATOM 5391  C CA   . GLU A 1 48  ? 115.521 8.940   5.384   1.00 0.00 ? 48  GLU A CA   3  
ATOM 5392  C C    . GLU A 1 48  ? 115.998 9.510   6.722   1.00 0.00 ? 48  GLU A C    3  
ATOM 5393  O O    . GLU A 1 48  ? 115.863 10.710  6.982   1.00 0.00 ? 48  GLU A O    3  
ATOM 5394  C CB   . GLU A 1 48  ? 114.423 7.880   5.598   1.00 0.00 ? 48  GLU A CB   3  
ATOM 5395  C CG   . GLU A 1 48  ? 113.024 8.442   5.867   1.00 0.00 ? 48  GLU A CG   3  
ATOM 5396  C CD   . GLU A 1 48  ? 112.917 9.242   7.158   1.00 0.00 ? 48  GLU A CD   3  
ATOM 5397  O OE1  . GLU A 1 48  ? 112.863 8.623   8.244   1.00 0.00 ? 48  GLU A OE1  3  
ATOM 5398  O OE2  . GLU A 1 48  ? 112.873 10.492  7.089   1.00 0.00 ? 48  GLU A OE2  3  
ATOM 5399  H H    . GLU A 1 48  ? 116.630 7.397   4.451   1.00 0.00 ? 48  GLU A H    3  
ATOM 5400  H HA   . GLU A 1 48  ? 115.131 9.744   4.776   1.00 0.00 ? 48  GLU A HA   3  
ATOM 5401  H HB2  . GLU A 1 48  ? 114.366 7.262   4.712   1.00 0.00 ? 48  GLU A HB2  3  
ATOM 5402  H HB3  . GLU A 1 48  ? 114.702 7.255   6.435   1.00 0.00 ? 48  GLU A HB3  3  
ATOM 5403  H HG2  . GLU A 1 48  ? 112.747 9.083   5.042   1.00 0.00 ? 48  GLU A HG2  3  
ATOM 5404  H HG3  . GLU A 1 48  ? 112.328 7.615   5.917   1.00 0.00 ? 48  GLU A HG3  3  
ATOM 5405  N N    . ASP A 1 49  ? 116.581 8.643   7.551   1.00 0.00 ? 49  ASP A N    3  
ATOM 5406  C CA   . ASP A 1 49  ? 117.124 9.050   8.851   1.00 0.00 ? 49  ASP A CA   3  
ATOM 5407  C C    . ASP A 1 49  ? 118.280 10.033  8.675   1.00 0.00 ? 49  ASP A C    3  
ATOM 5408  O O    . ASP A 1 49  ? 118.500 10.898  9.521   1.00 0.00 ? 49  ASP A O    3  
ATOM 5409  C CB   . ASP A 1 49  ? 117.586 7.825   9.660   1.00 0.00 ? 49  ASP A CB   3  
ATOM 5410  C CG   . ASP A 1 49  ? 116.431 7.085   10.326  1.00 0.00 ? 49  ASP A CG   3  
ATOM 5411  O OD1  . ASP A 1 49  ? 115.696 6.357   9.628   1.00 0.00 ? 49  ASP A OD1  3  
ATOM 5412  O OD2  . ASP A 1 49  ? 116.250 7.235   11.553  1.00 0.00 ? 49  ASP A OD2  3  
ATOM 5413  H H    . ASP A 1 49  ? 116.645 7.698   7.283   1.00 0.00 ? 49  ASP A H    3  
ATOM 5414  H HA   . ASP A 1 49  ? 116.331 9.547   9.393   1.00 0.00 ? 49  ASP A HA   3  
ATOM 5415  H HB2  . ASP A 1 49  ? 118.094 7.137   8.998   1.00 0.00 ? 49  ASP A HB2  3  
ATOM 5416  H HB3  . ASP A 1 49  ? 118.276 8.147   10.428  1.00 0.00 ? 49  ASP A HB3  3  
ATOM 5417  N N    . PHE A 1 50  ? 119.006 9.894   7.572   1.00 0.00 ? 50  PHE A N    3  
ATOM 5418  C CA   . PHE A 1 50  ? 120.108 10.797  7.233   1.00 0.00 ? 50  PHE A CA   3  
ATOM 5419  C C    . PHE A 1 50  ? 119.590 12.232  7.130   1.00 0.00 ? 50  PHE A C    3  
ATOM 5420  O O    . PHE A 1 50  ? 120.204 13.173  7.630   1.00 0.00 ? 50  PHE A O    3  
ATOM 5421  C CB   . PHE A 1 50  ? 120.724 10.354  5.899   1.00 0.00 ? 50  PHE A CB   3  
ATOM 5422  C CG   . PHE A 1 50  ? 122.031 11.012  5.536   1.00 0.00 ? 50  PHE A CG   3  
ATOM 5423  C CD1  . PHE A 1 50  ? 123.229 10.470  5.971   1.00 0.00 ? 50  PHE A CD1  3  
ATOM 5424  C CD2  . PHE A 1 50  ? 122.064 12.147  4.736   1.00 0.00 ? 50  PHE A CD2  3  
ATOM 5425  C CE1  . PHE A 1 50  ? 124.434 11.047  5.623   1.00 0.00 ? 50  PHE A CE1  3  
ATOM 5426  C CE2  . PHE A 1 50  ? 123.267 12.723  4.379   1.00 0.00 ? 50  PHE A CE2  3  
ATOM 5427  C CZ   . PHE A 1 50  ? 124.453 12.173  4.824   1.00 0.00 ? 50  PHE A CZ   3  
ATOM 5428  H H    . PHE A 1 50  ? 118.800 9.153   6.962   1.00 0.00 ? 50  PHE A H    3  
ATOM 5429  H HA   . PHE A 1 50  ? 120.853 10.737  8.014   1.00 0.00 ? 50  PHE A HA   3  
ATOM 5430  H HB2  . PHE A 1 50  ? 120.899 9.289   5.936   1.00 0.00 ? 50  PHE A HB2  3  
ATOM 5431  H HB3  . PHE A 1 50  ? 120.018 10.560  5.105   1.00 0.00 ? 50  PHE A HB3  3  
ATOM 5432  H HD1  . PHE A 1 50  ? 123.215 9.590   6.599   1.00 0.00 ? 50  PHE A HD1  3  
ATOM 5433  H HD2  . PHE A 1 50  ? 121.138 12.583  4.394   1.00 0.00 ? 50  PHE A HD2  3  
ATOM 5434  H HE1  . PHE A 1 50  ? 125.361 10.615  5.971   1.00 0.00 ? 50  PHE A HE1  3  
ATOM 5435  H HE2  . PHE A 1 50  ? 123.281 13.605  3.756   1.00 0.00 ? 50  PHE A HE2  3  
ATOM 5436  H HZ   . PHE A 1 50  ? 125.395 12.623  4.546   1.00 0.00 ? 50  PHE A HZ   3  
ATOM 5437  N N    . LYS A 1 51  ? 118.443 12.372  6.477   1.00 0.00 ? 51  LYS A N    3  
ATOM 5438  C CA   . LYS A 1 51  ? 117.783 13.659  6.314   1.00 0.00 ? 51  LYS A CA   3  
ATOM 5439  C C    . LYS A 1 51  ? 117.064 14.063  7.603   1.00 0.00 ? 51  LYS A C    3  
ATOM 5440  O O    . LYS A 1 51  ? 116.986 15.245  7.947   1.00 0.00 ? 51  LYS A O    3  
ATOM 5441  C CB   . LYS A 1 51  ? 116.796 13.560  5.131   1.00 0.00 ? 51  LYS A CB   3  
ATOM 5442  C CG   . LYS A 1 51  ? 115.911 14.788  4.911   1.00 0.00 ? 51  LYS A CG   3  
ATOM 5443  C CD   . LYS A 1 51  ? 114.613 14.755  5.733   1.00 0.00 ? 51  LYS A CD   3  
ATOM 5444  C CE   . LYS A 1 51  ? 113.587 13.749  5.198   1.00 0.00 ? 51  LYS A CE   3  
ATOM 5445  N NZ   . LYS A 1 51  ? 114.008 12.329  5.373   1.00 0.00 ? 51  LYS A NZ   3  
ATOM 5446  H H    . LYS A 1 51  ? 118.029 11.579  6.077   1.00 0.00 ? 51  LYS A H    3  
ATOM 5447  H HA   . LYS A 1 51  ? 118.538 14.399  6.083   1.00 0.00 ? 51  LYS A HA   3  
ATOM 5448  H HB2  . LYS A 1 51  ? 117.364 13.394  4.227   1.00 0.00 ? 51  LYS A HB2  3  
ATOM 5449  H HB3  . LYS A 1 51  ? 116.153 12.704  5.292   1.00 0.00 ? 51  LYS A HB3  3  
ATOM 5450  H HG2  . LYS A 1 51  ? 116.471 15.669  5.187   1.00 0.00 ? 51  LYS A HG2  3  
ATOM 5451  H HG3  . LYS A 1 51  ? 115.657 14.845  3.861   1.00 0.00 ? 51  LYS A HG3  3  
ATOM 5452  H HD2  . LYS A 1 51  ? 114.852 14.491  6.752   1.00 0.00 ? 51  LYS A HD2  3  
ATOM 5453  H HD3  . LYS A 1 51  ? 114.171 15.742  5.718   1.00 0.00 ? 51  LYS A HD3  3  
ATOM 5454  H HE2  . LYS A 1 51  ? 112.654 13.897  5.722   1.00 0.00 ? 51  LYS A HE2  3  
ATOM 5455  H HE3  . LYS A 1 51  ? 113.434 13.940  4.145   1.00 0.00 ? 51  LYS A HE3  3  
ATOM 5456  H HZ1  . LYS A 1 51  ? 114.877 12.140  4.836   1.00 0.00 ? 51  LYS A HZ1  3  
ATOM 5457  H HZ2  . LYS A 1 51  ? 113.261 11.694  5.025   1.00 0.00 ? 51  LYS A HZ2  3  
ATOM 5458  H HZ3  . LYS A 1 51  ? 114.176 12.120  6.379   1.00 0.00 ? 51  LYS A HZ3  3  
ATOM 5459  N N    . LYS A 1 52  ? 116.550 13.068  8.312   1.00 0.00 ? 52  LYS A N    3  
ATOM 5460  C CA   . LYS A 1 52  ? 115.719 13.284  9.486   1.00 0.00 ? 52  LYS A CA   3  
ATOM 5461  C C    . LYS A 1 52  ? 116.529 13.778  10.681  1.00 0.00 ? 52  LYS A C    3  
ATOM 5462  O O    . LYS A 1 52  ? 116.080 14.653  11.424  1.00 0.00 ? 52  LYS A O    3  
ATOM 5463  C CB   . LYS A 1 52  ? 114.993 11.976  9.815   1.00 0.00 ? 52  LYS A CB   3  
ATOM 5464  C CG   . LYS A 1 52  ? 114.055 12.052  11.007  1.00 0.00 ? 52  LYS A CG   3  
ATOM 5465  C CD   . LYS A 1 52  ? 113.210 10.784  11.130  1.00 0.00 ? 52  LYS A CD   3  
ATOM 5466  C CE   . LYS A 1 52  ? 114.072 9.536   11.289  1.00 0.00 ? 52  LYS A CE   3  
ATOM 5467  N NZ   . LYS A 1 52  ? 113.296 8.288   11.067  1.00 0.00 ? 52  LYS A NZ   3  
ATOM 5468  H H    . LYS A 1 52  ? 116.731 12.148  8.035   1.00 0.00 ? 52  LYS A H    3  
ATOM 5469  H HA   . LYS A 1 52  ? 114.988 14.035  9.242   1.00 0.00 ? 52  LYS A HA   3  
ATOM 5470  H HB2  . LYS A 1 52  ? 114.414 11.678  8.951   1.00 0.00 ? 52  LYS A HB2  3  
ATOM 5471  H HB3  . LYS A 1 52  ? 115.733 11.213  10.015  1.00 0.00 ? 52  LYS A HB3  3  
ATOM 5472  H HG2  . LYS A 1 52  ? 114.641 12.176  11.905  1.00 0.00 ? 52  LYS A HG2  3  
ATOM 5473  H HG3  . LYS A 1 52  ? 113.402 12.901  10.879  1.00 0.00 ? 52  LYS A HG3  3  
ATOM 5474  H HD2  . LYS A 1 52  ? 112.566 10.876  11.993  1.00 0.00 ? 52  LYS A HD2  3  
ATOM 5475  H HD3  . LYS A 1 52  ? 112.603 10.681  10.241  1.00 0.00 ? 52  LYS A HD3  3  
ATOM 5476  H HE2  . LYS A 1 52  ? 114.879 9.574   10.572  1.00 0.00 ? 52  LYS A HE2  3  
ATOM 5477  H HE3  . LYS A 1 52  ? 114.482 9.521   12.289  1.00 0.00 ? 52  LYS A HE3  3  
ATOM 5478  H HZ1  . LYS A 1 52  ? 112.935 8.261   10.090  1.00 0.00 ? 52  LYS A HZ1  3  
ATOM 5479  H HZ2  . LYS A 1 52  ? 112.487 8.243   11.720  1.00 0.00 ? 52  LYS A HZ2  3  
ATOM 5480  H HZ3  . LYS A 1 52  ? 113.902 7.456   11.224  1.00 0.00 ? 52  LYS A HZ3  3  
ATOM 5481  N N    . MET A 1 53  ? 117.727 13.243  10.851  1.00 0.00 ? 53  MET A N    3  
ATOM 5482  C CA   . MET A 1 53  ? 118.563 13.599  11.993  1.00 0.00 ? 53  MET A CA   3  
ATOM 5483  C C    . MET A 1 53  ? 119.993 13.891  11.536  1.00 0.00 ? 53  MET A C    3  
ATOM 5484  O O    . MET A 1 53  ? 120.215 14.186  10.361  1.00 0.00 ? 53  MET A O    3  
ATOM 5485  C CB   . MET A 1 53  ? 118.541 12.466  13.038  1.00 0.00 ? 53  MET A CB   3  
ATOM 5486  C CG   . MET A 1 53  ? 119.113 11.145  12.539  1.00 0.00 ? 53  MET A CG   3  
ATOM 5487  S SD   . MET A 1 53  ? 119.101 9.857   13.804  1.00 0.00 ? 53  MET A SD   3  
ATOM 5488  C CE   . MET A 1 53  ? 119.928 8.522   12.937  1.00 0.00 ? 53  MET A CE   3  
ATOM 5489  H H    . MET A 1 53  ? 118.069 12.607  10.188  1.00 0.00 ? 53  MET A H    3  
ATOM 5490  H HA   . MET A 1 53  ? 118.148 14.495  12.433  1.00 0.00 ? 53  MET A HA   3  
ATOM 5491  H HB2  . MET A 1 53  ? 119.114 12.777  13.900  1.00 0.00 ? 53  MET A HB2  3  
ATOM 5492  H HB3  . MET A 1 53  ? 117.518 12.297  13.343  1.00 0.00 ? 53  MET A HB3  3  
ATOM 5493  H HG2  . MET A 1 53  ? 118.524 10.807  11.698  1.00 0.00 ? 53  MET A HG2  3  
ATOM 5494  H HG3  . MET A 1 53  ? 120.132 11.306  12.220  1.00 0.00 ? 53  MET A HG3  3  
ATOM 5495  H HE1  . MET A 1 53  ? 120.001 7.662   13.587  1.00 0.00 ? 53  MET A HE1  3  
ATOM 5496  H HE2  . MET A 1 53  ? 120.919 8.840   12.647  1.00 0.00 ? 53  MET A HE2  3  
ATOM 5497  H HE3  . MET A 1 53  ? 119.361 8.259   12.056  1.00 0.00 ? 53  MET A HE3  3  
ATOM 5498  N N    . GLN A 1 54  ? 120.943 13.838  12.478  1.00 0.00 ? 54  GLN A N    3  
ATOM 5499  C CA   . GLN A 1 54  ? 122.375 14.009  12.190  1.00 0.00 ? 54  GLN A CA   3  
ATOM 5500  C C    . GLN A 1 54  ? 122.726 15.477  11.942  1.00 0.00 ? 54  GLN A C    3  
ATOM 5501  O O    . GLN A 1 54  ? 122.133 16.136  11.082  1.00 0.00 ? 54  GLN A O    3  
ATOM 5502  C CB   . GLN A 1 54  ? 122.811 13.158  10.982  1.00 0.00 ? 54  GLN A CB   3  
ATOM 5503  C CG   . GLN A 1 54  ? 122.607 11.656  11.165  1.00 0.00 ? 54  GLN A CG   3  
ATOM 5504  C CD   . GLN A 1 54  ? 122.905 10.871  9.899   1.00 0.00 ? 54  GLN A CD   3  
ATOM 5505  O OE1  . GLN A 1 54  ? 123.732 11.274  9.086   1.00 0.00 ? 54  GLN A OE1  3  
ATOM 5506  N NE2  . GLN A 1 54  ? 122.235 9.742   9.726   1.00 0.00 ? 54  GLN A NE2  3  
ATOM 5507  H H    . GLN A 1 54  ? 120.670 13.698  13.410  1.00 0.00 ? 54  GLN A H    3  
ATOM 5508  H HA   . GLN A 1 54  ? 122.917 13.671  13.062  1.00 0.00 ? 54  GLN A HA   3  
ATOM 5509  H HB2  . GLN A 1 54  ? 122.245 13.470  10.115  1.00 0.00 ? 54  GLN A HB2  3  
ATOM 5510  H HB3  . GLN A 1 54  ? 123.861 13.335  10.794  1.00 0.00 ? 54  GLN A HB3  3  
ATOM 5511  H HG2  . GLN A 1 54  ? 123.264 11.308  11.949  1.00 0.00 ? 54  GLN A HG2  3  
ATOM 5512  H HG3  . GLN A 1 54  ? 121.580 11.477  11.450  1.00 0.00 ? 54  GLN A HG3  3  
ATOM 5513  H HE21 . GLN A 1 54  ? 121.592 9.476   10.414  1.00 0.00 ? 54  GLN A HE21 3  
ATOM 5514  H HE22 . GLN A 1 54  ? 122.409 9.223   8.915   1.00 0.00 ? 54  GLN A HE22 3  
ATOM 5515  N N    . ASP A 1 55  ? 123.684 15.990  12.711  1.00 0.00 ? 55  ASP A N    3  
ATOM 5516  C CA   . ASP A 1 55  ? 124.209 17.341  12.494  1.00 0.00 ? 55  ASP A CA   3  
ATOM 5517  C C    . ASP A 1 55  ? 125.267 17.298  11.392  1.00 0.00 ? 55  ASP A C    3  
ATOM 5518  O O    . ASP A 1 55  ? 125.671 16.217  10.980  1.00 0.00 ? 55  ASP A O    3  
ATOM 5519  C CB   . ASP A 1 55  ? 124.810 17.907  13.792  1.00 0.00 ? 55  ASP A CB   3  
ATOM 5520  C CG   . ASP A 1 55  ? 125.253 19.358  13.647  1.00 0.00 ? 55  ASP A CG   3  
ATOM 5521  O OD1  . ASP A 1 55  ? 124.381 20.252  13.663  1.00 0.00 ? 55  ASP A OD1  3  
ATOM 5522  O OD2  . ASP A 1 55  ? 126.466 19.612  13.485  1.00 0.00 ? 55  ASP A OD2  3  
ATOM 5523  H H    . ASP A 1 55  ? 124.052 15.447  13.439  1.00 0.00 ? 55  ASP A H    3  
ATOM 5524  H HA   . ASP A 1 55  ? 123.390 17.972  12.173  1.00 0.00 ? 55  ASP A HA   3  
ATOM 5525  H HB2  . ASP A 1 55  ? 124.068 17.853  14.576  1.00 0.00 ? 55  ASP A HB2  3  
ATOM 5526  H HB3  . ASP A 1 55  ? 125.666 17.311  14.076  1.00 0.00 ? 55  ASP A HB3  3  
ATOM 5527  N N    . LYS A 1 56  ? 125.710 18.468  10.931  1.00 0.00 ? 56  LYS A N    3  
ATOM 5528  C CA   . LYS A 1 56  ? 126.700 18.577  9.852   1.00 0.00 ? 56  LYS A CA   3  
ATOM 5529  C C    . LYS A 1 56  ? 127.829 17.546  9.991   1.00 0.00 ? 56  LYS A C    3  
ATOM 5530  O O    . LYS A 1 56  ? 128.039 16.731  9.093   1.00 0.00 ? 56  LYS A O    3  
ATOM 5531  C CB   . LYS A 1 56  ? 127.278 20.003  9.824   1.00 0.00 ? 56  LYS A CB   3  
ATOM 5532  C CG   . LYS A 1 56  ? 128.498 20.184  8.919   1.00 0.00 ? 56  LYS A CG   3  
ATOM 5533  C CD   . LYS A 1 56  ? 128.195 19.894  7.450   1.00 0.00 ? 56  LYS A CD   3  
ATOM 5534  C CE   . LYS A 1 56  ? 129.432 20.096  6.582   1.00 0.00 ? 56  LYS A CE   3  
ATOM 5535  N NZ   . LYS A 1 56  ? 129.186 19.758  5.156   1.00 0.00 ? 56  LYS A NZ   3  
ATOM 5536  H H    . LYS A 1 56  ? 125.362 19.292  11.330  1.00 0.00 ? 56  LYS A H    3  
ATOM 5537  H HA   . LYS A 1 56  ? 126.184 18.397  8.919   1.00 0.00 ? 56  LYS A HA   3  
ATOM 5538  H HB2  . LYS A 1 56  ? 126.508 20.682  9.486   1.00 0.00 ? 56  LYS A HB2  3  
ATOM 5539  H HB3  . LYS A 1 56  ? 127.564 20.279  10.830  1.00 0.00 ? 56  LYS A HB3  3  
ATOM 5540  H HG2  . LYS A 1 56  ? 128.844 21.204  9.004   1.00 0.00 ? 56  LYS A HG2  3  
ATOM 5541  H HG3  . LYS A 1 56  ? 129.279 19.515  9.254   1.00 0.00 ? 56  LYS A HG3  3  
ATOM 5542  H HD2  . LYS A 1 56  ? 127.862 18.870  7.353   1.00 0.00 ? 56  LYS A HD2  3  
ATOM 5543  H HD3  . LYS A 1 56  ? 127.414 20.562  7.112   1.00 0.00 ? 56  LYS A HD3  3  
ATOM 5544  H HE2  . LYS A 1 56  ? 129.736 21.131  6.644   1.00 0.00 ? 56  LYS A HE2  3  
ATOM 5545  H HE3  . LYS A 1 56  ? 130.226 19.469  6.958   1.00 0.00 ? 56  LYS A HE3  3  
ATOM 5546  H HZ1  . LYS A 1 56  ? 128.436 20.363  4.770   1.00 0.00 ? 56  LYS A HZ1  3  
ATOM 5547  H HZ2  . LYS A 1 56  ? 128.895 18.766  5.064   1.00 0.00 ? 56  LYS A HZ2  3  
ATOM 5548  H HZ3  . LYS A 1 56  ? 130.052 19.906  4.601   1.00 0.00 ? 56  LYS A HZ3  3  
ATOM 5549  N N    . THR A 1 57  ? 128.534 17.578  11.121  1.00 0.00 ? 57  THR A N    3  
ATOM 5550  C CA   . THR A 1 57  ? 129.699 16.717  11.335  1.00 0.00 ? 57  THR A CA   3  
ATOM 5551  C C    . THR A 1 57  ? 129.337 15.228  11.227  1.00 0.00 ? 57  THR A C    3  
ATOM 5552  O O    . THR A 1 57  ? 129.960 14.478  10.468  1.00 0.00 ? 57  THR A O    3  
ATOM 5553  C CB   . THR A 1 57  ? 130.340 17.001  12.712  1.00 0.00 ? 57  THR A CB   3  
ATOM 5554  O OG1  . THR A 1 57  ? 130.631 18.403  12.825  1.00 0.00 ? 57  THR A OG1  3  
ATOM 5555  C CG2  . THR A 1 57  ? 131.624 16.195  12.907  1.00 0.00 ? 57  THR A CG2  3  
ATOM 5556  H H    . THR A 1 57  ? 128.263 18.196  11.834  1.00 0.00 ? 57  THR A H    3  
ATOM 5557  H HA   . THR A 1 57  ? 130.428 16.954  10.571  1.00 0.00 ? 57  THR A HA   3  
ATOM 5558  H HB   . THR A 1 57  ? 129.636 16.725  13.487  1.00 0.00 ? 57  THR A HB   3  
ATOM 5559  H HG1  . THR A 1 57  ? 130.912 18.600  13.728  1.00 0.00 ? 57  THR A HG1  3  
ATOM 5560  H HG21 . THR A 1 57  ? 131.402 15.139  12.842  1.00 0.00 ? 57  THR A HG21 3  
ATOM 5561  H HG22 . THR A 1 57  ? 132.044 16.413  13.877  1.00 0.00 ? 57  THR A HG22 3  
ATOM 5562  H HG23 . THR A 1 57  ? 132.336 16.460  12.139  1.00 0.00 ? 57  THR A HG23 3  
ATOM 5563  N N    . GLN A 1 58  ? 128.316 14.814  11.973  1.00 0.00 ? 58  GLN A N    3  
ATOM 5564  C CA   . GLN A 1 58  ? 127.881 13.416  11.984  1.00 0.00 ? 58  GLN A CA   3  
ATOM 5565  C C    . GLN A 1 58  ? 127.423 12.993  10.594  1.00 0.00 ? 58  GLN A C    3  
ATOM 5566  O O    . GLN A 1 58  ? 127.805 11.936  10.092  1.00 0.00 ? 58  GLN A O    3  
ATOM 5567  C CB   . GLN A 1 58  ? 126.742 13.214  12.998  1.00 0.00 ? 58  GLN A CB   3  
ATOM 5568  C CG   . GLN A 1 58  ? 127.186 13.299  14.459  1.00 0.00 ? 58  GLN A CG   3  
ATOM 5569  C CD   . GLN A 1 58  ? 127.690 14.678  14.858  1.00 0.00 ? 58  GLN A CD   3  
ATOM 5570  O OE1  . GLN A 1 58  ? 127.226 15.698  14.343  1.00 0.00 ? 58  GLN A OE1  3  
ATOM 5571  N NE2  . GLN A 1 58  ? 128.652 14.719  15.763  1.00 0.00 ? 58  GLN A NE2  3  
ATOM 5572  H H    . GLN A 1 58  ? 127.833 15.467  12.522  1.00 0.00 ? 58  GLN A H    3  
ATOM 5573  H HA   . GLN A 1 58  ? 128.726 12.807  12.275  1.00 0.00 ? 58  GLN A HA   3  
ATOM 5574  H HB2  . GLN A 1 58  ? 125.990 13.972  12.829  1.00 0.00 ? 58  GLN A HB2  3  
ATOM 5575  H HB3  . GLN A 1 58  ? 126.299 12.243  12.833  1.00 0.00 ? 58  GLN A HB3  3  
ATOM 5576  H HG2  . GLN A 1 58  ? 126.345 13.049  15.090  1.00 0.00 ? 58  GLN A HG2  3  
ATOM 5577  H HG3  . GLN A 1 58  ? 127.978 12.580  14.621  1.00 0.00 ? 58  GLN A HG3  3  
ATOM 5578  H HE21 . GLN A 1 58  ? 128.984 13.868  16.126  1.00 0.00 ? 58  GLN A HE21 3  
ATOM 5579  H HE22 . GLN A 1 58  ? 128.998 15.596  16.035  1.00 0.00 ? 58  GLN A HE22 3  
ATOM 5580  N N    . MET A 1 59  ? 126.618 13.850  9.988   1.00 0.00 ? 59  MET A N    3  
ATOM 5581  C CA   . MET A 1 59  ? 126.083 13.639  8.646   1.00 0.00 ? 59  MET A CA   3  
ATOM 5582  C C    . MET A 1 59  ? 127.203 13.375  7.642   1.00 0.00 ? 59  MET A C    3  
ATOM 5583  O O    . MET A 1 59  ? 127.053 12.577  6.718   1.00 0.00 ? 59  MET A O    3  
ATOM 5584  C CB   . MET A 1 59  ? 125.267 14.871  8.232   1.00 0.00 ? 59  MET A CB   3  
ATOM 5585  C CG   . MET A 1 59  ? 124.569 14.756  6.884   1.00 0.00 ? 59  MET A CG   3  
ATOM 5586  S SD   . MET A 1 59  ? 123.771 16.300  6.396   1.00 0.00 ? 59  MET A SD   3  
ATOM 5587  C CE   . MET A 1 59  ? 125.175 17.414  6.368   1.00 0.00 ? 59  MET A CE   3  
ATOM 5588  H H    . MET A 1 59  ? 126.364 14.659  10.468  1.00 0.00 ? 59  MET A H    3  
ATOM 5589  H HA   . MET A 1 59  ? 125.440 12.784  8.678   1.00 0.00 ? 59  MET A HA   3  
ATOM 5590  H HB2  . MET A 1 59  ? 124.512 15.052  8.983   1.00 0.00 ? 59  MET A HB2  3  
ATOM 5591  H HB3  . MET A 1 59  ? 125.928 15.726  8.196   1.00 0.00 ? 59  MET A HB3  3  
ATOM 5592  H HG2  . MET A 1 59  ? 125.297 14.489  6.131   1.00 0.00 ? 59  MET A HG2  3  
ATOM 5593  H HG3  . MET A 1 59  ? 123.815 13.981  6.942   1.00 0.00 ? 59  MET A HG3  3  
ATOM 5594  H HE1  . MET A 1 59  ? 125.912 17.048  5.667   1.00 0.00 ? 59  MET A HE1  3  
ATOM 5595  H HE2  . MET A 1 59  ? 125.612 17.470  7.354   1.00 0.00 ? 59  MET A HE2  3  
ATOM 5596  H HE3  . MET A 1 59  ? 124.848 18.398  6.064   1.00 0.00 ? 59  MET A HE3  3  
ATOM 5597  N N    . GLN A 1 60  ? 128.327 14.046  7.843   1.00 0.00 ? 60  GLN A N    3  
ATOM 5598  C CA   . GLN A 1 60  ? 129.505 13.850  6.998   1.00 0.00 ? 60  GLN A CA   3  
ATOM 5599  C C    . GLN A 1 60  ? 129.989 12.412  7.092   1.00 0.00 ? 60  GLN A C    3  
ATOM 5600  O O    . GLN A 1 60  ? 130.099 11.706  6.087   1.00 0.00 ? 60  GLN A O    3  
ATOM 5601  C CB   . GLN A 1 60  ? 130.653 14.777  7.411   1.00 0.00 ? 60  GLN A CB   3  
ATOM 5602  C CG   . GLN A 1 60  ? 130.382 16.259  7.214   1.00 0.00 ? 60  GLN A CG   3  
ATOM 5603  C CD   . GLN A 1 60  ? 131.541 17.126  7.679   1.00 0.00 ? 60  GLN A CD   3  
ATOM 5604  O OE1  . GLN A 1 60  ? 131.777 18.204  7.139   1.00 0.00 ? 60  GLN A OE1  3  
ATOM 5605  N NE2  . GLN A 1 60  ? 132.274 16.661  8.682   1.00 0.00 ? 60  GLN A NE2  3  
ATOM 5606  H H    . GLN A 1 60  ? 128.364 14.682  8.586   1.00 0.00 ? 60  GLN A H    3  
ATOM 5607  H HA   . GLN A 1 60  ? 129.225 14.063  5.975   1.00 0.00 ? 60  GLN A HA   3  
ATOM 5608  H HB2  . GLN A 1 60  ? 130.869 14.613  8.458   1.00 0.00 ? 60  GLN A HB2  3  
ATOM 5609  H HB3  . GLN A 1 60  ? 131.531 14.517  6.833   1.00 0.00 ? 60  GLN A HB3  3  
ATOM 5610  H HG2  . GLN A 1 60  ? 130.210 16.445  6.163   1.00 0.00 ? 60  GLN A HG2  3  
ATOM 5611  H HG3  . GLN A 1 60  ? 129.501 16.530  7.775   1.00 0.00 ? 60  GLN A HG3  3  
ATOM 5612  H HE21 . GLN A 1 60  ? 132.039 15.790  9.070   1.00 0.00 ? 60  GLN A HE21 3  
ATOM 5613  H HE22 . GLN A 1 60  ? 133.025 17.207  8.998   1.00 0.00 ? 60  GLN A HE22 3  
ATOM 5614  N N    . GLU A 1 61  ? 130.274 11.987  8.315   1.00 0.00 ? 61  GLU A N    3  
ATOM 5615  C CA   . GLU A 1 61  ? 130.836 10.668  8.552   1.00 0.00 ? 61  GLU A CA   3  
ATOM 5616  C C    . GLU A 1 61  ? 129.832 9.579   8.183   1.00 0.00 ? 61  GLU A C    3  
ATOM 5617  O O    . GLU A 1 61  ? 130.211 8.492   7.744   1.00 0.00 ? 61  GLU A O    3  
ATOM 5618  C CB   . GLU A 1 61  ? 131.279 10.537  10.013  1.00 0.00 ? 61  GLU A CB   3  
ATOM 5619  C CG   . GLU A 1 61  ? 132.174 11.684  10.484  1.00 0.00 ? 61  GLU A CG   3  
ATOM 5620  C CD   . GLU A 1 61  ? 133.267 12.037  9.480   1.00 0.00 ? 61  GLU A CD   3  
ATOM 5621  O OE1  . GLU A 1 61  ? 134.141 11.186  9.217   1.00 0.00 ? 61  GLU A OE1  3  
ATOM 5622  O OE2  . GLU A 1 61  ? 133.247 13.160  8.931   1.00 0.00 ? 61  GLU A OE2  3  
ATOM 5623  H H    . GLU A 1 61  ? 130.102 12.582  9.080   1.00 0.00 ? 61  GLU A H    3  
ATOM 5624  H HA   . GLU A 1 61  ? 131.704 10.564  7.916   1.00 0.00 ? 61  GLU A HA   3  
ATOM 5625  H HB2  . GLU A 1 61  ? 130.401 10.510  10.644  1.00 0.00 ? 61  GLU A HB2  3  
ATOM 5626  H HB3  . GLU A 1 61  ? 131.825 9.611   10.131  1.00 0.00 ? 61  GLU A HB3  3  
ATOM 5627  H HG2  . GLU A 1 61  ? 131.558 12.558  10.649  1.00 0.00 ? 61  GLU A HG2  3  
ATOM 5628  H HG3  . GLU A 1 61  ? 132.641 11.398  11.416  1.00 0.00 ? 61  GLU A HG3  3  
ATOM 5629  N N    . LYS A 1 62  ? 128.548 9.889   8.339   1.00 0.00 ? 62  LYS A N    3  
ATOM 5630  C CA   . LYS A 1 62  ? 127.484 8.965   7.964   1.00 0.00 ? 62  LYS A CA   3  
ATOM 5631  C C    . LYS A 1 62  ? 127.353 8.881   6.448   1.00 0.00 ? 62  LYS A C    3  
ATOM 5632  O O    . LYS A 1 62  ? 126.980 7.835   5.912   1.00 0.00 ? 62  LYS A O    3  
ATOM 5633  C CB   . LYS A 1 62  ? 126.151 9.375   8.605   1.00 0.00 ? 62  LYS A CB   3  
ATOM 5634  C CG   . LYS A 1 62  ? 126.083 9.081   10.101  1.00 0.00 ? 62  LYS A CG   3  
ATOM 5635  C CD   . LYS A 1 62  ? 126.273 7.591   10.379  1.00 0.00 ? 62  LYS A CD   3  
ATOM 5636  C CE   . LYS A 1 62  ? 126.204 7.266   11.864  1.00 0.00 ? 62  LYS A CE   3  
ATOM 5637  N NZ   . LYS A 1 62  ? 126.440 5.819   12.122  1.00 0.00 ? 62  LYS A NZ   3  
ATOM 5638  H H    . LYS A 1 62  ? 128.310 10.761  8.716   1.00 0.00 ? 62  LYS A H    3  
ATOM 5639  H HA   . LYS A 1 62  ? 127.759 7.986   8.335   1.00 0.00 ? 62  LYS A HA   3  
ATOM 5640  H HB2  . LYS A 1 62  ? 126.004 10.436  8.459   1.00 0.00 ? 62  LYS A HB2  3  
ATOM 5641  H HB3  . LYS A 1 62  ? 125.347 8.840   8.118   1.00 0.00 ? 62  LYS A HB3  3  
ATOM 5642  H HG2  . LYS A 1 62  ? 126.863 9.637   10.603  1.00 0.00 ? 62  LYS A HG2  3  
ATOM 5643  H HG3  . LYS A 1 62  ? 125.118 9.391   10.477  1.00 0.00 ? 62  LYS A HG3  3  
ATOM 5644  H HD2  . LYS A 1 62  ? 125.498 7.039   9.869   1.00 0.00 ? 62  LYS A HD2  3  
ATOM 5645  H HD3  . LYS A 1 62  ? 127.239 7.285   9.999   1.00 0.00 ? 62  LYS A HD3  3  
ATOM 5646  H HE2  . LYS A 1 62  ? 126.956 7.841   12.384  1.00 0.00 ? 62  LYS A HE2  3  
ATOM 5647  H HE3  . LYS A 1 62  ? 125.225 7.534   12.236  1.00 0.00 ? 62  LYS A HE3  3  
ATOM 5648  H HZ1  . LYS A 1 62  ? 126.333 5.611   13.133  1.00 0.00 ? 62  LYS A HZ1  3  
ATOM 5649  H HZ2  . LYS A 1 62  ? 127.402 5.553   11.826  1.00 0.00 ? 62  LYS A HZ2  3  
ATOM 5650  H HZ3  . LYS A 1 62  ? 125.761 5.242   11.586  1.00 0.00 ? 62  LYS A HZ3  3  
ATOM 5651  N N    . ALA A 1 63  ? 127.684 9.975   5.760   1.00 0.00 ? 63  ALA A N    3  
ATOM 5652  C CA   . ALA A 1 63  ? 127.697 9.984   4.300   1.00 0.00 ? 63  ALA A CA   3  
ATOM 5653  C C    . ALA A 1 63  ? 128.720 8.975   3.807   1.00 0.00 ? 63  ALA A C    3  
ATOM 5654  O O    . ALA A 1 63  ? 128.457 8.162   2.917   1.00 0.00 ? 63  ALA A O    3  
ATOM 5655  C CB   . ALA A 1 63  ? 128.031 11.377  3.765   1.00 0.00 ? 63  ALA A CB   3  
ATOM 5656  H H    . ALA A 1 63  ? 127.933 10.791  6.247   1.00 0.00 ? 63  ALA A H    3  
ATOM 5657  H HA   . ALA A 1 63  ? 126.714 9.703   3.947   1.00 0.00 ? 63  ALA A HA   3  
ATOM 5658  H HB1  . ALA A 1 63  ? 127.314 12.093  4.138   1.00 0.00 ? 63  ALA A HB1  3  
ATOM 5659  H HB2  . ALA A 1 63  ? 127.998 11.368  2.684   1.00 0.00 ? 63  ALA A HB2  3  
ATOM 5660  H HB3  . ALA A 1 63  ? 129.023 11.661  4.089   1.00 0.00 ? 63  ALA A HB3  3  
ATOM 5661  N N    . LYS A 1 64  ? 129.885 9.034   4.432   1.00 0.00 ? 64  LYS A N    3  
ATOM 5662  C CA   . LYS A 1 64  ? 130.984 8.130   4.139   1.00 0.00 ? 64  LYS A CA   3  
ATOM 5663  C C    . LYS A 1 64  ? 130.620 6.708   4.558   1.00 0.00 ? 64  LYS A C    3  
ATOM 5664  O O    . LYS A 1 64  ? 130.976 5.742   3.886   1.00 0.00 ? 64  LYS A O    3  
ATOM 5665  C CB   . LYS A 1 64  ? 132.231 8.598   4.895   1.00 0.00 ? 64  LYS A CB   3  
ATOM 5666  C CG   . LYS A 1 64  ? 132.569 10.068  4.662   1.00 0.00 ? 64  LYS A CG   3  
ATOM 5667  C CD   . LYS A 1 64  ? 133.500 10.612  5.741   1.00 0.00 ? 64  LYS A CD   3  
ATOM 5668  C CE   . LYS A 1 64  ? 133.793 12.093  5.541   1.00 0.00 ? 64  LYS A CE   3  
ATOM 5669  N NZ   . LYS A 1 64  ? 134.690 12.629  6.597   1.00 0.00 ? 64  LYS A NZ   3  
ATOM 5670  H H    . LYS A 1 64  ? 130.009 9.719   5.125   1.00 0.00 ? 64  LYS A H    3  
ATOM 5671  H HA   . LYS A 1 64  ? 131.176 8.156   3.075   1.00 0.00 ? 64  LYS A HA   3  
ATOM 5672  H HB2  . LYS A 1 64  ? 132.072 8.448   5.955   1.00 0.00 ? 64  LYS A HB2  3  
ATOM 5673  H HB3  . LYS A 1 64  ? 133.076 8.001   4.580   1.00 0.00 ? 64  LYS A HB3  3  
ATOM 5674  H HG2  . LYS A 1 64  ? 133.051 10.170  3.699   1.00 0.00 ? 64  LYS A HG2  3  
ATOM 5675  H HG3  . LYS A 1 64  ? 131.652 10.644  4.667   1.00 0.00 ? 64  LYS A HG3  3  
ATOM 5676  H HD2  . LYS A 1 64  ? 133.027 10.480  6.705   1.00 0.00 ? 64  LYS A HD2  3  
ATOM 5677  H HD3  . LYS A 1 64  ? 134.429 10.061  5.715   1.00 0.00 ? 64  LYS A HD3  3  
ATOM 5678  H HE2  . LYS A 1 64  ? 134.266 12.228  4.580   1.00 0.00 ? 64  LYS A HE2  3  
ATOM 5679  H HE3  . LYS A 1 64  ? 132.860 12.639  5.562   1.00 0.00 ? 64  LYS A HE3  3  
ATOM 5680  H HZ1  . LYS A 1 64  ? 134.841 13.648  6.454   1.00 0.00 ? 64  LYS A HZ1  3  
ATOM 5681  H HZ2  . LYS A 1 64  ? 135.611 12.149  6.563   1.00 0.00 ? 64  LYS A HZ2  3  
ATOM 5682  H HZ3  . LYS A 1 64  ? 134.269 12.481  7.538   1.00 0.00 ? 64  LYS A HZ3  3  
ATOM 5683  N N    . GLU A 1 65  ? 129.895 6.603   5.671   1.00 0.00 ? 65  GLU A N    3  
ATOM 5684  C CA   . GLU A 1 65  ? 129.518 5.313   6.245   1.00 0.00 ? 65  GLU A CA   3  
ATOM 5685  C C    . GLU A 1 65  ? 128.590 4.536   5.312   1.00 0.00 ? 65  GLU A C    3  
ATOM 5686  O O    . GLU A 1 65  ? 128.945 3.456   4.834   1.00 0.00 ? 65  GLU A O    3  
ATOM 5687  C CB   . GLU A 1 65  ? 128.843 5.519   7.607   1.00 0.00 ? 65  GLU A CB   3  
ATOM 5688  C CG   . GLU A 1 65  ? 128.450 4.223   8.308   1.00 0.00 ? 65  GLU A CG   3  
ATOM 5689  C CD   . GLU A 1 65  ? 127.807 4.471   9.661   1.00 0.00 ? 65  GLU A CD   3  
ATOM 5690  O OE1  . GLU A 1 65  ? 128.537 4.817   10.615  1.00 0.00 ? 65  GLU A OE1  3  
ATOM 5691  O OE2  . GLU A 1 65  ? 126.574 4.326   9.783   1.00 0.00 ? 65  GLU A OE2  3  
ATOM 5692  H H    . GLU A 1 65  ? 129.608 7.423   6.124   1.00 0.00 ? 65  GLU A H    3  
ATOM 5693  H HA   . GLU A 1 65  ? 130.423 4.740   6.390   1.00 0.00 ? 65  GLU A HA   3  
ATOM 5694  H HB2  . GLU A 1 65  ? 129.521 6.060   8.252   1.00 0.00 ? 65  GLU A HB2  3  
ATOM 5695  H HB3  . GLU A 1 65  ? 127.950 6.112   7.466   1.00 0.00 ? 65  GLU A HB3  3  
ATOM 5696  H HG2  . GLU A 1 65  ? 127.749 3.687   7.682   1.00 0.00 ? 65  GLU A HG2  3  
ATOM 5697  H HG3  . GLU A 1 65  ? 129.336 3.620   8.450   1.00 0.00 ? 65  GLU A HG3  3  
ATOM 5698  N N    . ILE A 1 66  ? 127.403 5.086   5.047   1.00 0.00 ? 66  ILE A N    3  
ATOM 5699  C CA   . ILE A 1 66  ? 126.421 4.401   4.206   1.00 0.00 ? 66  ILE A CA   3  
ATOM 5700  C C    . ILE A 1 66  ? 126.985 4.160   2.808   1.00 0.00 ? 66  ILE A C    3  
ATOM 5701  O O    . ILE A 1 66  ? 126.685 3.147   2.174   1.00 0.00 ? 66  ILE A O    3  
ATOM 5702  C CB   . ILE A 1 66  ? 125.074 5.168   4.111   1.00 0.00 ? 66  ILE A CB   3  
ATOM 5703  C CG1  . ILE A 1 66  ? 125.278 6.595   3.576   1.00 0.00 ? 66  ILE A CG1  3  
ATOM 5704  C CG2  . ILE A 1 66  ? 124.377 5.192   5.470   1.00 0.00 ? 66  ILE A CG2  3  
ATOM 5705  C CD1  . ILE A 1 66  ? 123.996 7.402   3.482   1.00 0.00 ? 66  ILE A CD1  3  
ATOM 5706  H H    . ILE A 1 66  ? 127.185 5.968   5.421   1.00 0.00 ? 66  ILE A H    3  
ATOM 5707  H HA   . ILE A 1 66  ? 126.225 3.438   4.662   1.00 0.00 ? 66  ILE A HA   3  
ATOM 5708  H HB   . ILE A 1 66  ? 124.434 4.627   3.426   1.00 0.00 ? 66  ILE A HB   3  
ATOM 5709  H HG12 . ILE A 1 66  ? 125.954 7.127   4.228   1.00 0.00 ? 66  ILE A HG12 3  
ATOM 5710  H HG13 . ILE A 1 66  ? 125.709 6.544   2.586   1.00 0.00 ? 66  ILE A HG13 3  
ATOM 5711  H HG21 . ILE A 1 66  ? 124.220 4.179   5.813   1.00 0.00 ? 66  ILE A HG21 3  
ATOM 5712  H HG22 . ILE A 1 66  ? 123.422 5.690   5.377   1.00 0.00 ? 66  ILE A HG22 3  
ATOM 5713  H HG23 . ILE A 1 66  ? 124.991 5.723   6.184   1.00 0.00 ? 66  ILE A HG23 3  
ATOM 5714  H HD11 . ILE A 1 66  ? 123.303 6.903   2.821   1.00 0.00 ? 66  ILE A HD11 3  
ATOM 5715  H HD12 . ILE A 1 66  ? 124.219 8.384   3.092   1.00 0.00 ? 66  ILE A HD12 3  
ATOM 5716  H HD13 . ILE A 1 66  ? 123.554 7.497   4.463   1.00 0.00 ? 66  ILE A HD13 3  
ATOM 5717  N N    . TYR A 1 67  ? 127.822 5.083   2.340   1.00 0.00 ? 67  TYR A N    3  
ATOM 5718  C CA   . TYR A 1 67  ? 128.510 4.910   1.067   1.00 0.00 ? 67  TYR A CA   3  
ATOM 5719  C C    . TYR A 1 67  ? 129.456 3.712   1.138   1.00 0.00 ? 67  TYR A C    3  
ATOM 5720  O O    . TYR A 1 67  ? 129.461 2.857   0.251   1.00 0.00 ? 67  TYR A O    3  
ATOM 5721  C CB   . TYR A 1 67  ? 129.289 6.179   0.691   1.00 0.00 ? 67  TYR A CB   3  
ATOM 5722  C CG   . TYR A 1 67  ? 130.151 6.012   -0.548  1.00 0.00 ? 67  TYR A CG   3  
ATOM 5723  C CD1  . TYR A 1 67  ? 129.577 5.719   -1.779  1.00 0.00 ? 67  TYR A CD1  3  
ATOM 5724  C CD2  . TYR A 1 67  ? 131.538 6.125   -0.483  1.00 0.00 ? 67  TYR A CD2  3  
ATOM 5725  C CE1  . TYR A 1 67  ? 130.353 5.548   -2.907  1.00 0.00 ? 67  TYR A CE1  3  
ATOM 5726  C CE2  . TYR A 1 67  ? 132.321 5.954   -1.609  1.00 0.00 ? 67  TYR A CE2  3  
ATOM 5727  C CZ   . TYR A 1 67  ? 131.723 5.666   -2.818  1.00 0.00 ? 67  TYR A CZ   3  
ATOM 5728  O OH   . TYR A 1 67  ? 132.497 5.492   -3.943  1.00 0.00 ? 67  TYR A OH   3  
ATOM 5729  H H    . TYR A 1 67  ? 127.975 5.902   2.862   1.00 0.00 ? 67  TYR A H    3  
ATOM 5730  H HA   . TYR A 1 67  ? 127.762 4.719   0.309   1.00 0.00 ? 67  TYR A HA   3  
ATOM 5731  H HB2  . TYR A 1 67  ? 128.590 6.981   0.503   1.00 0.00 ? 67  TYR A HB2  3  
ATOM 5732  H HB3  . TYR A 1 67  ? 129.934 6.456   1.514   1.00 0.00 ? 67  TYR A HB3  3  
ATOM 5733  H HD1  . TYR A 1 67  ? 128.502 5.628   -1.848  1.00 0.00 ? 67  TYR A HD1  3  
ATOM 5734  H HD2  . TYR A 1 67  ? 132.003 6.352   0.466   1.00 0.00 ? 67  TYR A HD2  3  
ATOM 5735  H HE1  . TYR A 1 67  ? 129.884 5.322   -3.854  1.00 0.00 ? 67  TYR A HE1  3  
ATOM 5736  H HE2  . TYR A 1 67  ? 133.395 6.047   -1.538  1.00 0.00 ? 67  TYR A HE2  3  
ATOM 5737  H HH   . TYR A 1 67  ? 132.045 5.886   -4.701  1.00 0.00 ? 67  TYR A HH   3  
ATOM 5738  N N    . MET A 1 68  ? 130.237 3.652   2.211   1.00 0.00 ? 68  MET A N    3  
ATOM 5739  C CA   . MET A 1 68  ? 131.234 2.597   2.395   1.00 0.00 ? 68  MET A CA   3  
ATOM 5740  C C    . MET A 1 68  ? 130.568 1.244   2.644   1.00 0.00 ? 68  MET A C    3  
ATOM 5741  O O    . MET A 1 68  ? 131.155 0.195   2.377   1.00 0.00 ? 68  MET A O    3  
ATOM 5742  C CB   . MET A 1 68  ? 132.169 2.950   3.564   1.00 0.00 ? 68  MET A CB   3  
ATOM 5743  C CG   . MET A 1 68  ? 133.237 1.900   3.849   1.00 0.00 ? 68  MET A CG   3  
ATOM 5744  S SD   . MET A 1 68  ? 134.295 2.339   5.244   1.00 0.00 ? 68  MET A SD   3  
ATOM 5745  C CE   . MET A 1 68  ? 135.345 0.889   5.342   1.00 0.00 ? 68  MET A CE   3  
ATOM 5746  H H    . MET A 1 68  ? 130.142 4.339   2.906   1.00 0.00 ? 68  MET A H    3  
ATOM 5747  H HA   . MET A 1 68  ? 131.818 2.531   1.487   1.00 0.00 ? 68  MET A HA   3  
ATOM 5748  H HB2  . MET A 1 68  ? 132.667 3.883   3.341   1.00 0.00 ? 68  MET A HB2  3  
ATOM 5749  H HB3  . MET A 1 68  ? 131.575 3.078   4.459   1.00 0.00 ? 68  MET A HB3  3  
ATOM 5750  H HG2  . MET A 1 68  ? 132.751 0.958   4.067   1.00 0.00 ? 68  MET A HG2  3  
ATOM 5751  H HG3  . MET A 1 68  ? 133.855 1.787   2.969   1.00 0.00 ? 68  MET A HG3  3  
ATOM 5752  H HE1  . MET A 1 68  ? 135.892 0.777   4.418   1.00 0.00 ? 68  MET A HE1  3  
ATOM 5753  H HE2  . MET A 1 68  ? 134.735 0.014   5.508   1.00 0.00 ? 68  MET A HE2  3  
ATOM 5754  H HE3  . MET A 1 68  ? 136.040 1.004   6.161   1.00 0.00 ? 68  MET A HE3  3  
ATOM 5755  N N    . THR A 1 69  ? 129.340 1.270   3.144   1.00 0.00 ? 69  THR A N    3  
ATOM 5756  C CA   . THR A 1 69  ? 128.630 0.045   3.495   1.00 0.00 ? 69  THR A CA   3  
ATOM 5757  C C    . THR A 1 69  ? 127.796 -0.492  2.324   1.00 0.00 ? 69  THR A C    3  
ATOM 5758  O O    . THR A 1 69  ? 127.895 -1.669  1.973   1.00 0.00 ? 69  THR A O    3  
ATOM 5759  C CB   . THR A 1 69  ? 127.714 0.276   4.719   1.00 0.00 ? 69  THR A CB   3  
ATOM 5760  O OG1  . THR A 1 69  ? 128.490 0.795   5.812   1.00 0.00 ? 69  THR A OG1  3  
ATOM 5761  C CG2  . THR A 1 69  ? 127.024 -1.016  5.153   1.00 0.00 ? 69  THR A CG2  3  
ATOM 5762  H H    . THR A 1 69  ? 128.903 2.134   3.290   1.00 0.00 ? 69  THR A H    3  
ATOM 5763  H HA   . THR A 1 69  ? 129.367 -0.700  3.766   1.00 0.00 ? 69  THR A HA   3  
ATOM 5764  H HB   . THR A 1 69  ? 126.956 1.001   4.452   1.00 0.00 ? 69  THR A HB   3  
ATOM 5765  H HG1  . THR A 1 69  ? 128.812 1.675   5.586   1.00 0.00 ? 69  THR A HG1  3  
ATOM 5766  H HG21 . THR A 1 69  ? 126.402 -0.820  6.015   1.00 0.00 ? 69  THR A HG21 3  
ATOM 5767  H HG22 . THR A 1 69  ? 127.770 -1.755  5.409   1.00 0.00 ? 69  THR A HG22 3  
ATOM 5768  H HG23 . THR A 1 69  ? 126.411 -1.388  4.345   1.00 0.00 ? 69  THR A HG23 3  
ATOM 5769  N N    . PHE A 1 70  ? 126.994 0.373   1.705   1.00 0.00 ? 70  PHE A N    3  
ATOM 5770  C CA   . PHE A 1 70  ? 125.991 -0.074  0.734   1.00 0.00 ? 70  PHE A CA   3  
ATOM 5771  C C    . PHE A 1 70  ? 126.443 0.153   -0.707  1.00 0.00 ? 70  PHE A C    3  
ATOM 5772  O O    . PHE A 1 70  ? 126.060 -0.597  -1.606  1.00 0.00 ? 70  PHE A O    3  
ATOM 5773  C CB   . PHE A 1 70  ? 124.656 0.643   0.983   1.00 0.00 ? 70  PHE A CB   3  
ATOM 5774  C CG   . PHE A 1 70  ? 124.130 0.458   2.386   1.00 0.00 ? 70  PHE A CG   3  
ATOM 5775  C CD1  . PHE A 1 70  ? 123.726 -0.793  2.829   1.00 0.00 ? 70  PHE A CD1  3  
ATOM 5776  C CD2  . PHE A 1 70  ? 124.046 1.533   3.262   1.00 0.00 ? 70  PHE A CD2  3  
ATOM 5777  C CE1  . PHE A 1 70  ? 123.251 -0.968  4.114   1.00 0.00 ? 70  PHE A CE1  3  
ATOM 5778  C CE2  . PHE A 1 70  ? 123.570 1.362   4.548   1.00 0.00 ? 70  PHE A CE2  3  
ATOM 5779  C CZ   . PHE A 1 70  ? 123.172 0.111   4.975   1.00 0.00 ? 70  PHE A CZ   3  
ATOM 5780  H H    . PHE A 1 70  ? 127.085 1.331   1.892   1.00 0.00 ? 70  PHE A H    3  
ATOM 5781  H HA   . PHE A 1 70  ? 125.840 -1.136  0.880   1.00 0.00 ? 70  PHE A HA   3  
ATOM 5782  H HB2  . PHE A 1 70  ? 124.786 1.702   0.810   1.00 0.00 ? 70  PHE A HB2  3  
ATOM 5783  H HB3  . PHE A 1 70  ? 123.914 0.262   0.295   1.00 0.00 ? 70  PHE A HB3  3  
ATOM 5784  H HD1  . PHE A 1 70  ? 123.785 -1.639  2.158   1.00 0.00 ? 70  PHE A HD1  3  
ATOM 5785  H HD2  . PHE A 1 70  ? 124.357 2.513   2.929   1.00 0.00 ? 70  PHE A HD2  3  
ATOM 5786  H HE1  . PHE A 1 70  ? 122.939 -1.948  4.447   1.00 0.00 ? 70  PHE A HE1  3  
ATOM 5787  H HE2  . PHE A 1 70  ? 123.509 2.208   5.219   1.00 0.00 ? 70  PHE A HE2  3  
ATOM 5788  H HZ   . PHE A 1 70  ? 122.800 -0.025  5.980   1.00 0.00 ? 70  PHE A HZ   3  
ATOM 5789  N N    . LEU A 1 71  ? 127.248 1.190   -0.934  1.00 0.00 ? 71  LEU A N    3  
ATOM 5790  C CA   . LEU A 1 71  ? 127.679 1.529   -2.290  1.00 0.00 ? 71  LEU A CA   3  
ATOM 5791  C C    . LEU A 1 71  ? 129.148 1.166   -2.511  1.00 0.00 ? 71  LEU A C    3  
ATOM 5792  O O    . LEU A 1 71  ? 129.467 0.025   -2.855  1.00 0.00 ? 71  LEU A O    3  
ATOM 5793  C CB   . LEU A 1 71  ? 127.447 3.024   -2.599  1.00 0.00 ? 71  LEU A CB   3  
ATOM 5794  C CG   . LEU A 1 71  ? 125.983 3.511   -2.550  1.00 0.00 ? 71  LEU A CG   3  
ATOM 5795  C CD1  . LEU A 1 71  ? 125.471 3.584   -1.115  1.00 0.00 ? 71  LEU A CD1  3  
ATOM 5796  C CD2  . LEU A 1 71  ? 125.842 4.867   -3.241  1.00 0.00 ? 71  LEU A CD2  3  
ATOM 5797  H H    . LEU A 1 71  ? 127.562 1.730   -0.181  1.00 0.00 ? 71  LEU A H    3  
ATOM 5798  H HA   . LEU A 1 71  ? 127.083 0.944   -2.978  1.00 0.00 ? 71  LEU A HA   3  
ATOM 5799  H HB2  . LEU A 1 71  ? 128.019 3.606   -1.889  1.00 0.00 ? 71  LEU A HB2  3  
ATOM 5800  H HB3  . LEU A 1 71  ? 127.834 3.224   -3.589  1.00 0.00 ? 71  LEU A HB3  3  
ATOM 5801  H HG   . LEU A 1 71  ? 125.363 2.804   -3.083  1.00 0.00 ? 71  LEU A HG   3  
ATOM 5802  H HD11 . LEU A 1 71  ? 124.445 3.922   -1.116  1.00 0.00 ? 71  LEU A HD11 3  
ATOM 5803  H HD12 . LEU A 1 71  ? 126.077 4.277   -0.548  1.00 0.00 ? 71  LEU A HD12 3  
ATOM 5804  H HD13 . LEU A 1 71  ? 125.525 2.605   -0.662  1.00 0.00 ? 71  LEU A HD13 3  
ATOM 5805  H HD21 . LEU A 1 71  ? 126.466 5.595   -2.742  1.00 0.00 ? 71  LEU A HD21 3  
ATOM 5806  H HD22 . LEU A 1 71  ? 124.812 5.188   -3.198  1.00 0.00 ? 71  LEU A HD22 3  
ATOM 5807  H HD23 . LEU A 1 71  ? 126.147 4.779   -4.274  1.00 0.00 ? 71  LEU A HD23 3  
ATOM 5808  N N    . SER A 1 72  ? 130.039 2.129   -2.253  1.00 0.00 ? 72  SER A N    3  
ATOM 5809  C CA   . SER A 1 72  ? 131.447 2.010   -2.602  1.00 0.00 ? 72  SER A CA   3  
ATOM 5810  C C    . SER A 1 72  ? 131.621 1.512   -4.044  1.00 0.00 ? 72  SER A C    3  
ATOM 5811  O O    . SER A 1 72  ? 130.709 1.624   -4.867  1.00 0.00 ? 72  SER A O    3  
ATOM 5812  C CB   . SER A 1 72  ? 132.137 1.072   -1.616  1.00 0.00 ? 72  SER A CB   3  
ATOM 5813  O OG   . SER A 1 72  ? 131.863 1.446   -0.280  1.00 0.00 ? 72  SER A OG   3  
ATOM 5814  H H    . SER A 1 72  ? 129.748 2.925   -1.779  1.00 0.00 ? 72  SER A H    3  
ATOM 5815  H HA   . SER A 1 72  ? 131.890 2.992   -2.519  1.00 0.00 ? 72  SER A HA   3  
ATOM 5816  H HB2  . SER A 1 72  ? 131.793 0.062   -1.771  1.00 0.00 ? 72  SER A HB2  3  
ATOM 5817  H HB3  . SER A 1 72  ? 133.196 1.120   -1.774  1.00 0.00 ? 72  SER A HB3  3  
ATOM 5818  H HG   . SER A 1 72  ? 130.930 1.677   -0.201  1.00 0.00 ? 72  SER A HG   3  
ATOM 5819  N N    . SER A 1 73  ? 132.806 1.001   -4.354  1.00 0.00 ? 73  SER A N    3  
ATOM 5820  C CA   . SER A 1 73  ? 133.060 0.367   -5.642  1.00 0.00 ? 73  SER A CA   3  
ATOM 5821  C C    . SER A 1 73  ? 133.365 -1.119  -5.437  1.00 0.00 ? 73  SER A C    3  
ATOM 5822  O O    . SER A 1 73  ? 133.868 -1.793  -6.338  1.00 0.00 ? 73  SER A O    3  
ATOM 5823  C CB   . SER A 1 73  ? 134.227 1.075   -6.341  1.00 0.00 ? 73  SER A CB   3  
ATOM 5824  O OG   . SER A 1 73  ? 133.969 2.468   -6.461  1.00 0.00 ? 73  SER A OG   3  
ATOM 5825  H H    . SER A 1 73  ? 133.542 1.069   -3.709  1.00 0.00 ? 73  SER A H    3  
ATOM 5826  H HA   . SER A 1 73  ? 132.171 0.460   -6.251  1.00 0.00 ? 73  SER A HA   3  
ATOM 5827  H HB2  . SER A 1 73  ? 135.130 0.937   -5.765  1.00 0.00 ? 73  SER A HB2  3  
ATOM 5828  H HB3  . SER A 1 73  ? 134.361 0.659   -7.330  1.00 0.00 ? 73  SER A HB3  3  
ATOM 5829  H HG   . SER A 1 73  ? 133.062 2.595   -6.772  1.00 0.00 ? 73  SER A HG   3  
ATOM 5830  N N    . LYS A 1 74  ? 133.019 -1.624  -4.248  1.00 0.00 ? 74  LYS A N    3  
ATOM 5831  C CA   . LYS A 1 74  ? 133.297 -2.994  -3.860  1.00 0.00 ? 74  LYS A CA   3  
ATOM 5832  C C    . LYS A 1 74  ? 132.661 -3.272  -2.496  1.00 0.00 ? 74  LYS A C    3  
ATOM 5833  O O    . LYS A 1 74  ? 131.703 -4.042  -2.410  1.00 0.00 ? 74  LYS A O    3  
ATOM 5834  C CB   . LYS A 1 74  ? 134.816 -3.267  -3.843  1.00 0.00 ? 74  LYS A CB   3  
ATOM 5835  C CG   . LYS A 1 74  ? 135.640 -2.280  -3.013  1.00 0.00 ? 74  LYS A CG   3  
ATOM 5836  C CD   . LYS A 1 74  ? 137.119 -2.655  -2.983  1.00 0.00 ? 74  LYS A CD   3  
ATOM 5837  C CE   . LYS A 1 74  ? 137.932 -1.687  -2.128  1.00 0.00 ? 74  LYS A CE   3  
ATOM 5838  N NZ   . LYS A 1 74  ? 137.902 -0.301  -2.668  1.00 0.00 ? 74  LYS A NZ   3  
ATOM 5839  H H    . LYS A 1 74  ? 132.529 -1.063  -3.618  1.00 0.00 ? 74  LYS A H    3  
ATOM 5840  H HA   . LYS A 1 74  ? 132.833 -3.640  -4.593  1.00 0.00 ? 74  LYS A HA   3  
ATOM 5841  H HB2  . LYS A 1 74  ? 134.984 -4.258  -3.452  1.00 0.00 ? 74  LYS A HB2  3  
ATOM 5842  H HB3  . LYS A 1 74  ? 135.174 -3.229  -4.860  1.00 0.00 ? 74  LYS A HB3  3  
ATOM 5843  H HG2  . LYS A 1 74  ? 135.538 -1.294  -3.443  1.00 0.00 ? 74  LYS A HG2  3  
ATOM 5844  H HG3  . LYS A 1 74  ? 135.259 -2.272  -2.001  1.00 0.00 ? 74  LYS A HG3  3  
ATOM 5845  H HD2  . LYS A 1 74  ? 137.222 -3.650  -2.574  1.00 0.00 ? 74  LYS A HD2  3  
ATOM 5846  H HD3  . LYS A 1 74  ? 137.506 -2.639  -3.993  1.00 0.00 ? 74  LYS A HD3  3  
ATOM 5847  H HE2  . LYS A 1 74  ? 137.525 -1.680  -1.127  1.00 0.00 ? 74  LYS A HE2  3  
ATOM 5848  H HE3  . LYS A 1 74  ? 138.957 -2.028  -2.095  1.00 0.00 ? 74  LYS A HE3  3  
ATOM 5849  H HZ1  . LYS A 1 74  ? 138.412 0.343   -2.029  1.00 0.00 ? 74  LYS A HZ1  3  
ATOM 5850  H HZ2  . LYS A 1 74  ? 136.922 0.029   -2.764  1.00 0.00 ? 74  LYS A HZ2  3  
ATOM 5851  H HZ3  . LYS A 1 74  ? 138.357 -0.273  -3.604  1.00 0.00 ? 74  LYS A HZ3  3  
ATOM 5852  N N    . ALA A 1 75  ? 133.168 -2.592  -1.454  1.00 0.00 ? 75  ALA A N    3  
ATOM 5853  C CA   . ALA A 1 75  ? 132.678 -2.727  -0.078  1.00 0.00 ? 75  ALA A CA   3  
ATOM 5854  C C    . ALA A 1 75  ? 132.515 -4.189  0.333   1.00 0.00 ? 75  ALA A C    3  
ATOM 5855  O O    . ALA A 1 75  ? 133.390 -4.782  0.966   1.00 0.00 ? 75  ALA A O    3  
ATOM 5856  C CB   . ALA A 1 75  ? 131.358 -1.973  0.091   1.00 0.00 ? 75  ALA A CB   3  
ATOM 5857  H H    . ALA A 1 75  ? 133.898 -1.968  -1.618  1.00 0.00 ? 75  ALA A H    3  
ATOM 5858  H HA   . ALA A 1 75  ? 133.407 -2.265  0.573   1.00 0.00 ? 75  ALA A HA   3  
ATOM 5859  H HB1  . ALA A 1 75  ? 131.030 -2.042  1.119   1.00 0.00 ? 75  ALA A HB1  3  
ATOM 5860  H HB2  . ALA A 1 75  ? 130.608 -2.406  -0.556  1.00 0.00 ? 75  ALA A HB2  3  
ATOM 5861  H HB3  . ALA A 1 75  ? 131.500 -0.935  -0.170  1.00 0.00 ? 75  ALA A HB3  3  
ATOM 5862  N N    . SER A 1 76  ? 131.392 -4.750  -0.074  1.00 0.00 ? 76  SER A N    3  
ATOM 5863  C CA   . SER A 1 76  ? 130.997 -6.113  0.252   1.00 0.00 ? 76  SER A CA   3  
ATOM 5864  C C    . SER A 1 76  ? 129.886 -6.541  -0.698  1.00 0.00 ? 76  SER A C    3  
ATOM 5865  O O    . SER A 1 76  ? 129.792 -7.709  -1.084  1.00 0.00 ? 76  SER A O    3  
ATOM 5866  C CB   . SER A 1 76  ? 130.515 -6.208  1.709   1.00 0.00 ? 76  SER A CB   3  
ATOM 5867  O OG   . SER A 1 76  ? 131.512 -5.759  2.613   1.00 0.00 ? 76  SER A OG   3  
ATOM 5868  H H    . SER A 1 76  ? 130.815 -4.230  -0.658  1.00 0.00 ? 76  SER A H    3  
ATOM 5869  H HA   . SER A 1 76  ? 131.848 -6.759  0.107   1.00 0.00 ? 76  SER A HA   3  
ATOM 5870  H HB2  . SER A 1 76  ? 129.633 -5.597  1.838   1.00 0.00 ? 76  SER A HB2  3  
ATOM 5871  H HB3  . SER A 1 76  ? 130.276 -7.236  1.942   1.00 0.00 ? 76  SER A HB3  3  
ATOM 5872  H HG   . SER A 1 76  ? 132.383 -5.986  2.263   1.00 0.00 ? 76  SER A HG   3  
ATOM 5873  N N    . SER A 1 77  ? 129.072 -5.566  -1.098  1.00 0.00 ? 77  SER A N    3  
ATOM 5874  C CA   . SER A 1 77  ? 127.956 -5.799  -1.990  1.00 0.00 ? 77  SER A CA   3  
ATOM 5875  C C    . SER A 1 77  ? 127.339 -4.460  -2.384  1.00 0.00 ? 77  SER A C    3  
ATOM 5876  O O    . SER A 1 77  ? 126.494 -3.918  -1.668  1.00 0.00 ? 77  SER A O    3  
ATOM 5877  C CB   . SER A 1 77  ? 126.914 -6.716  -1.328  1.00 0.00 ? 77  SER A CB   3  
ATOM 5878  O OG   . SER A 1 77  ? 126.615 -6.288  -0.007  1.00 0.00 ? 77  SER A OG   3  
ATOM 5879  H H    . SER A 1 77  ? 129.235 -4.650  -0.791  1.00 0.00 ? 77  SER A H    3  
ATOM 5880  H HA   . SER A 1 77  ? 128.345 -6.282  -2.876  1.00 0.00 ? 77  SER A HA   3  
ATOM 5881  H HB2  . SER A 1 77  ? 126.004 -6.707  -1.911  1.00 0.00 ? 77  SER A HB2  3  
ATOM 5882  H HB3  . SER A 1 77  ? 127.302 -7.724  -1.286  1.00 0.00 ? 77  SER A HB3  3  
ATOM 5883  H HG   . SER A 1 77  ? 126.347 -5.359  -0.025  1.00 0.00 ? 77  SER A HG   3  
ATOM 5884  N N    . GLN A 1 78  ? 127.816 -3.906  -3.491  1.00 0.00 ? 78  GLN A N    3  
ATOM 5885  C CA   . GLN A 1 78  ? 127.348 -2.620  -3.975  1.00 0.00 ? 78  GLN A CA   3  
ATOM 5886  C C    . GLN A 1 78  ? 125.900 -2.725  -4.442  1.00 0.00 ? 78  GLN A C    3  
ATOM 5887  O O    . GLN A 1 78  ? 125.500 -3.724  -5.050  1.00 0.00 ? 78  GLN A O    3  
ATOM 5888  C CB   . GLN A 1 78  ? 128.246 -2.127  -5.118  1.00 0.00 ? 78  GLN A CB   3  
ATOM 5889  C CG   . GLN A 1 78  ? 128.300 -3.078  -6.310  1.00 0.00 ? 78  GLN A CG   3  
ATOM 5890  C CD   . GLN A 1 78  ? 129.343 -2.675  -7.334  1.00 0.00 ? 78  GLN A CD   3  
ATOM 5891  O OE1  . GLN A 1 78  ? 129.061 -1.927  -8.270  1.00 0.00 ? 78  GLN A OE1  3  
ATOM 5892  N NE2  . GLN A 1 78  ? 130.560 -3.166  -7.158  1.00 0.00 ? 78  GLN A NE2  3  
ATOM 5893  H H    . GLN A 1 78  ? 128.500 -4.378  -4.002  1.00 0.00 ? 78  GLN A H    3  
ATOM 5894  H HA   . GLN A 1 78  ? 127.405 -1.916  -3.155  1.00 0.00 ? 78  GLN A HA   3  
ATOM 5895  H HB2  . GLN A 1 78  ? 127.880 -1.169  -5.462  1.00 0.00 ? 78  GLN A HB2  3  
ATOM 5896  H HB3  . GLN A 1 78  ? 129.251 -2.001  -4.739  1.00 0.00 ? 78  GLN A HB3  3  
ATOM 5897  H HG2  . GLN A 1 78  ? 128.533 -4.071  -5.954  1.00 0.00 ? 78  GLN A HG2  3  
ATOM 5898  H HG3  . GLN A 1 78  ? 127.331 -3.090  -6.789  1.00 0.00 ? 78  GLN A HG3  3  
ATOM 5899  H HE21 . GLN A 1 78  ? 130.715 -3.751  -6.386  1.00 0.00 ? 78  GLN A HE21 3  
ATOM 5900  H HE22 . GLN A 1 78  ? 131.252 -2.932  -7.811  1.00 0.00 ? 78  GLN A HE22 3  
ATOM 5901  N N    . VAL A 1 79  ? 125.124 -1.697  -4.142  1.00 0.00 ? 79  VAL A N    3  
ATOM 5902  C CA   . VAL A 1 79  ? 123.726 -1.643  -4.541  1.00 0.00 ? 79  VAL A CA   3  
ATOM 5903  C C    . VAL A 1 79  ? 123.620 -1.226  -6.002  1.00 0.00 ? 79  VAL A C    3  
ATOM 5904  O O    . VAL A 1 79  ? 124.461 -0.481  -6.514  1.00 0.00 ? 79  VAL A O    3  
ATOM 5905  C CB   . VAL A 1 79  ? 122.909 -0.675  -3.645  1.00 0.00 ? 79  VAL A CB   3  
ATOM 5906  C CG1  . VAL A 1 79  ? 123.516 0.728   -3.647  1.00 0.00 ? 79  VAL A CG1  3  
ATOM 5907  C CG2  . VAL A 1 79  ? 121.438 -0.634  -4.068  1.00 0.00 ? 79  VAL A CG2  3  
ATOM 5908  H H    . VAL A 1 79  ? 125.507 -0.950  -3.646  1.00 0.00 ? 79  VAL A H    3  
ATOM 5909  H HA   . VAL A 1 79  ? 123.312 -2.639  -4.431  1.00 0.00 ? 79  VAL A HA   3  
ATOM 5910  H HB   . VAL A 1 79  ? 122.949 -1.052  -2.636  1.00 0.00 ? 79  VAL A HB   3  
ATOM 5911  H HG11 . VAL A 1 79  ? 123.523 1.118   -4.654  1.00 0.00 ? 79  VAL A HG11 3  
ATOM 5912  H HG12 . VAL A 1 79  ? 124.529 0.684   -3.272  1.00 0.00 ? 79  VAL A HG12 3  
ATOM 5913  H HG13 . VAL A 1 79  ? 122.929 1.378   -3.014  1.00 0.00 ? 79  VAL A HG13 3  
ATOM 5914  H HG21 . VAL A 1 79  ? 121.364 -0.286  -5.089  1.00 0.00 ? 79  VAL A HG21 3  
ATOM 5915  H HG22 . VAL A 1 79  ? 120.894 0.039   -3.420  1.00 0.00 ? 79  VAL A HG22 3  
ATOM 5916  H HG23 . VAL A 1 79  ? 121.012 -1.624  -3.994  1.00 0.00 ? 79  VAL A HG23 3  
ATOM 5917  N N    . ASN A 1 80  ? 122.591 -1.719  -6.669  1.00 0.00 ? 80  ASN A N    3  
ATOM 5918  C CA   . ASN A 1 80  ? 122.403 -1.452  -8.087  1.00 0.00 ? 80  ASN A CA   3  
ATOM 5919  C C    . ASN A 1 80  ? 121.861 -0.042  -8.296  1.00 0.00 ? 80  ASN A C    3  
ATOM 5920  O O    . ASN A 1 80  ? 120.656 0.172   -8.294  1.00 0.00 ? 80  ASN A O    3  
ATOM 5921  C CB   . ASN A 1 80  ? 121.461 -2.485  -8.730  1.00 0.00 ? 80  ASN A CB   3  
ATOM 5922  C CG   . ASN A 1 80  ? 121.959 -3.913  -8.571  1.00 0.00 ? 80  ASN A CG   3  
ATOM 5923  O OD1  . ASN A 1 80  ? 122.800 -4.380  -9.341  1.00 0.00 ? 80  ASN A OD1  3  
ATOM 5924  N ND2  . ASN A 1 80  ? 121.422 -4.631  -7.593  1.00 0.00 ? 80  ASN A ND2  3  
ATOM 5925  H H    . ASN A 1 80  ? 121.935 -2.266  -6.190  1.00 0.00 ? 80  ASN A H    3  
ATOM 5926  H HA   . ASN A 1 80  ? 123.372 -1.522  -8.566  1.00 0.00 ? 80  ASN A HA   3  
ATOM 5927  H HB2  . ASN A 1 80  ? 120.486 -2.410  -8.269  1.00 0.00 ? 80  ASN A HB2  3  
ATOM 5928  H HB3  . ASN A 1 80  ? 121.369 -2.271  -9.786  1.00 0.00 ? 80  ASN A HB3  3  
ATOM 5929  H HD21 . ASN A 1 80  ? 120.734 -4.214  -7.031  1.00 0.00 ? 80  ASN A HD21 3  
ATOM 5930  H HD22 . ASN A 1 80  ? 121.732 -5.554  -7.473  1.00 0.00 ? 80  ASN A HD22 3  
ATOM 5931  N N    . VAL A 1 81  ? 122.760 0.925   -8.417  1.00 0.00 ? 81  VAL A N    3  
ATOM 5932  C CA   . VAL A 1 81  ? 122.381 2.289   -8.750  1.00 0.00 ? 81  VAL A CA   3  
ATOM 5933  C C    . VAL A 1 81  ? 122.655 2.558   -10.223 1.00 0.00 ? 81  VAL A C    3  
ATOM 5934  O O    . VAL A 1 81  ? 123.573 1.980   -10.812 1.00 0.00 ? 81  VAL A O    3  
ATOM 5935  C CB   . VAL A 1 81  ? 123.123 3.326   -7.871  1.00 0.00 ? 81  VAL A CB   3  
ATOM 5936  C CG1  . VAL A 1 81  ? 122.693 3.187   -6.412  1.00 0.00 ? 81  VAL A CG1  3  
ATOM 5937  C CG2  . VAL A 1 81  ? 124.638 3.181   -8.014  1.00 0.00 ? 81  VAL A CG2  3  
ATOM 5938  H H    . VAL A 1 81  ? 123.704 0.719   -8.274  1.00 0.00 ? 81  VAL A H    3  
ATOM 5939  H HA   . VAL A 1 81  ? 121.318 2.395   -8.571  1.00 0.00 ? 81  VAL A HA   3  
ATOM 5940  H HB   . VAL A 1 81  ? 122.844 4.317   -8.209  1.00 0.00 ? 81  VAL A HB   3  
ATOM 5941  H HG11 . VAL A 1 81  ? 123.200 3.929   -5.812  1.00 0.00 ? 81  VAL A HG11 3  
ATOM 5942  H HG12 . VAL A 1 81  ? 122.947 2.199   -6.053  1.00 0.00 ? 81  VAL A HG12 3  
ATOM 5943  H HG13 . VAL A 1 81  ? 121.623 3.331   -6.335  1.00 0.00 ? 81  VAL A HG13 3  
ATOM 5944  H HG21 . VAL A 1 81  ? 124.920 3.341   -9.045  1.00 0.00 ? 81  VAL A HG21 3  
ATOM 5945  H HG22 . VAL A 1 81  ? 124.937 2.188   -7.710  1.00 0.00 ? 81  VAL A HG22 3  
ATOM 5946  H HG23 . VAL A 1 81  ? 125.133 3.912   -7.389  1.00 0.00 ? 81  VAL A HG23 3  
ATOM 5947  N N    . GLU A 1 82  ? 121.851 3.434   -10.804 1.00 0.00 ? 82  GLU A N    3  
ATOM 5948  C CA   . GLU A 1 82  ? 121.930 3.755   -12.233 1.00 0.00 ? 82  GLU A CA   3  
ATOM 5949  C C    . GLU A 1 82  ? 123.329 4.244   -12.627 1.00 0.00 ? 82  GLU A C    3  
ATOM 5950  O O    . GLU A 1 82  ? 123.714 4.175   -13.794 1.00 0.00 ? 82  GLU A O    3  
ATOM 5951  C CB   . GLU A 1 82  ? 120.874 4.809   -12.598 1.00 0.00 ? 82  GLU A CB   3  
ATOM 5952  C CG   . GLU A 1 82  ? 119.444 4.376   -12.282 1.00 0.00 ? 82  GLU A CG   3  
ATOM 5953  C CD   . GLU A 1 82  ? 118.406 5.393   -12.732 1.00 0.00 ? 82  GLU A CD   3  
ATOM 5954  O OE1  . GLU A 1 82  ? 117.995 5.348   -13.912 1.00 0.00 ? 82  GLU A OE1  3  
ATOM 5955  O OE2  . GLU A 1 82  ? 117.996 6.242   -11.915 1.00 0.00 ? 82  GLU A OE2  3  
ATOM 5956  H H    . GLU A 1 82  ? 121.172 3.870   -10.256 1.00 0.00 ? 82  GLU A H    3  
ATOM 5957  H HA   . GLU A 1 82  ? 121.718 2.848   -12.783 1.00 0.00 ? 82  GLU A HA   3  
ATOM 5958  H HB2  . GLU A 1 82  ? 121.084 5.717   -12.049 1.00 0.00 ? 82  GLU A HB2  3  
ATOM 5959  H HB3  . GLU A 1 82  ? 120.939 5.017   -13.657 1.00 0.00 ? 82  GLU A HB3  3  
ATOM 5960  H HG2  . GLU A 1 82  ? 119.248 3.438   -12.783 1.00 0.00 ? 82  GLU A HG2  3  
ATOM 5961  H HG3  . GLU A 1 82  ? 119.352 4.235   -11.214 1.00 0.00 ? 82  GLU A HG3  3  
ATOM 5962  N N    . GLY A 1 83  ? 124.077 4.749   -11.649 1.00 0.00 ? 83  GLY A N    3  
ATOM 5963  C CA   . GLY A 1 83  ? 125.451 5.162   -11.888 1.00 0.00 ? 83  GLY A CA   3  
ATOM 5964  C C    . GLY A 1 83  ? 125.546 6.532   -12.527 1.00 0.00 ? 83  GLY A C    3  
ATOM 5965  O O    . GLY A 1 83  ? 126.622 6.948   -12.960 1.00 0.00 ? 83  GLY A O    3  
ATOM 5966  H H    . GLY A 1 83  ? 123.688 4.852   -10.757 1.00 0.00 ? 83  GLY A H    3  
ATOM 5967  H HA2  . GLY A 1 83  ? 125.976 5.182   -10.943 1.00 0.00 ? 83  GLY A HA2  3  
ATOM 5968  H HA3  . GLY A 1 83  ? 125.929 4.440   -12.535 1.00 0.00 ? 83  GLY A HA3  3  
ATOM 5969  N N    . GLN A 1 84  ? 124.417 7.235   -12.579 1.00 0.00 ? 84  GLN A N    3  
ATOM 5970  C CA   . GLN A 1 84  ? 124.365 8.582   -13.144 1.00 0.00 ? 84  GLN A CA   3  
ATOM 5971  C C    . GLN A 1 84  ? 125.181 9.543   -12.287 1.00 0.00 ? 84  GLN A C    3  
ATOM 5972  O O    . GLN A 1 84  ? 125.800 10.482  -12.792 1.00 0.00 ? 84  GLN A O    3  
ATOM 5973  C CB   . GLN A 1 84  ? 122.915 9.062   -13.240 1.00 0.00 ? 84  GLN A CB   3  
ATOM 5974  C CG   . GLN A 1 84  ? 122.055 8.227   -14.181 1.00 0.00 ? 84  GLN A CG   3  
ATOM 5975  C CD   . GLN A 1 84  ? 120.603 8.665   -14.182 1.00 0.00 ? 84  GLN A CD   3  
ATOM 5976  O OE1  . GLN A 1 84  ? 120.294 9.830   -13.939 1.00 0.00 ? 84  GLN A OE1  3  
ATOM 5977  N NE2  . GLN A 1 84  ? 119.705 7.740   -14.467 1.00 0.00 ? 84  GLN A NE2  3  
ATOM 5978  H H    . GLN A 1 84  ? 123.594 6.838   -12.223 1.00 0.00 ? 84  GLN A H    3  
ATOM 5979  H HA   . GLN A 1 84  ? 124.794 8.546   -14.137 1.00 0.00 ? 84  GLN A HA   3  
ATOM 5980  H HB2  . GLN A 1 84  ? 122.470 9.028   -12.255 1.00 0.00 ? 84  GLN A HB2  3  
ATOM 5981  H HB3  . GLN A 1 84  ? 122.907 10.085  -13.592 1.00 0.00 ? 84  GLN A HB3  3  
ATOM 5982  H HG2  . GLN A 1 84  ? 122.445 8.322   -15.185 1.00 0.00 ? 84  GLN A HG2  3  
ATOM 5983  H HG3  . GLN A 1 84  ? 122.105 7.192   -13.874 1.00 0.00 ? 84  GLN A HG3  3  
ATOM 5984  H HE21 . GLN A 1 84  ? 120.016 6.832   -14.662 1.00 0.00 ? 84  GLN A HE21 3  
ATOM 5985  H HE22 . GLN A 1 84  ? 118.763 8.001   -14.471 1.00 0.00 ? 84  GLN A HE22 3  
ATOM 5986  N N    . SER A 1 85  ? 125.169 9.294   -10.984 1.00 0.00 ? 85  SER A N    3  
ATOM 5987  C CA   . SER A 1 85  ? 125.969 10.058  -10.041 1.00 0.00 ? 85  SER A CA   3  
ATOM 5988  C C    . SER A 1 85  ? 126.621 9.106   -9.042  1.00 0.00 ? 85  SER A C    3  
ATOM 5989  O O    . SER A 1 85  ? 125.936 8.473   -8.232  1.00 0.00 ? 85  SER A O    3  
ATOM 5990  C CB   . SER A 1 85  ? 125.103 11.099  -9.312  1.00 0.00 ? 85  SER A CB   3  
ATOM 5991  O OG   . SER A 1 85  ? 125.890 11.920  -8.460  1.00 0.00 ? 85  SER A OG   3  
ATOM 5992  H H    . SER A 1 85  ? 124.603 8.569   -10.647 1.00 0.00 ? 85  SER A H    3  
ATOM 5993  H HA   . SER A 1 85  ? 126.747 10.569  -10.594 1.00 0.00 ? 85  SER A HA   3  
ATOM 5994  H HB2  . SER A 1 85  ? 124.614 11.729  -10.040 1.00 0.00 ? 85  SER A HB2  3  
ATOM 5995  H HB3  . SER A 1 85  ? 124.356 10.594  -8.716  1.00 0.00 ? 85  SER A HB3  3  
ATOM 5996  H HG   . SER A 1 85  ? 125.309 12.444  -7.889  1.00 0.00 ? 85  SER A HG   3  
ATOM 5997  N N    . ARG A 1 86  ? 127.940 8.973   -9.141  1.00 0.00 ? 86  ARG A N    3  
ATOM 5998  C CA   . ARG A 1 86  ? 128.712 8.157   -8.214  1.00 0.00 ? 86  ARG A CA   3  
ATOM 5999  C C    . ARG A 1 86  ? 129.476 9.060   -7.256  1.00 0.00 ? 86  ARG A C    3  
ATOM 6000  O O    . ARG A 1 86  ? 129.719 10.236  -7.557  1.00 0.00 ? 86  ARG A O    3  
ATOM 6001  C CB   . ARG A 1 86  ? 129.674 7.239   -8.978  1.00 0.00 ? 86  ARG A CB   3  
ATOM 6002  C CG   . ARG A 1 86  ? 128.969 6.220   -9.867  1.00 0.00 ? 86  ARG A CG   3  
ATOM 6003  C CD   . ARG A 1 86  ? 129.962 5.332   -10.606 1.00 0.00 ? 86  ARG A CD   3  
ATOM 6004  N NE   . ARG A 1 86  ? 130.889 6.115   -11.426 1.00 0.00 ? 86  ARG A NE   3  
ATOM 6005  C CZ   . ARG A 1 86  ? 131.054 5.954   -12.740 1.00 0.00 ? 86  ARG A CZ   3  
ATOM 6006  N NH1  . ARG A 1 86  ? 130.339 5.051   -13.403 1.00 0.00 ? 86  ARG A NH1  3  
ATOM 6007  N NH2  . ARG A 1 86  ? 131.932 6.704   -13.389 1.00 0.00 ? 86  ARG A NH2  3  
ATOM 6008  H H    . ARG A 1 86  ? 128.413 9.449   -9.858  1.00 0.00 ? 86  ARG A H    3  
ATOM 6009  H HA   . ARG A 1 86  ? 128.021 7.549   -7.643  1.00 0.00 ? 86  ARG A HA   3  
ATOM 6010  H HB2  . ARG A 1 86  ? 130.315 7.847   -9.601  1.00 0.00 ? 86  ARG A HB2  3  
ATOM 6011  H HB3  . ARG A 1 86  ? 130.284 6.702   -8.266  1.00 0.00 ? 86  ARG A HB3  3  
ATOM 6012  H HG2  . ARG A 1 86  ? 128.334 5.597   -9.251  1.00 0.00 ? 86  ARG A HG2  3  
ATOM 6013  H HG3  . ARG A 1 86  ? 128.362 6.746   -10.591 1.00 0.00 ? 86  ARG A HG3  3  
ATOM 6014  H HD2  . ARG A 1 86  ? 130.529 4.766   -9.881  1.00 0.00 ? 86  ARG A HD2  3  
ATOM 6015  H HD3  . ARG A 1 86  ? 129.413 4.651   -11.242 1.00 0.00 ? 86  ARG A HD3  3  
ATOM 6016  H HE   . ARG A 1 86  ? 131.424 6.799   -10.965 1.00 0.00 ? 86  ARG A HE   3  
ATOM 6017  H HH11 . ARG A 1 86  ? 129.666 4.481   -12.920 1.00 0.00 ? 86  ARG A HH11 3  
ATOM 6018  H HH12 . ARG A 1 86  ? 130.470 4.933   -14.392 1.00 0.00 ? 86  ARG A HH12 3  
ATOM 6019  H HH21 . ARG A 1 86  ? 132.476 7.389   -12.895 1.00 0.00 ? 86  ARG A HH21 3  
ATOM 6020  H HH22 . ARG A 1 86  ? 132.055 6.599   -14.383 1.00 0.00 ? 86  ARG A HH22 3  
ATOM 6021  N N    . LEU A 1 87  ? 129.859 8.517   -6.108  1.00 0.00 ? 87  LEU A N    3  
ATOM 6022  C CA   . LEU A 1 87  ? 130.451 9.317   -5.045  1.00 0.00 ? 87  LEU A CA   3  
ATOM 6023  C C    . LEU A 1 87  ? 131.971 9.162   -5.007  1.00 0.00 ? 87  LEU A C    3  
ATOM 6024  O O    . LEU A 1 87  ? 132.493 8.047   -4.925  1.00 0.00 ? 87  LEU A O    3  
ATOM 6025  C CB   . LEU A 1 87  ? 129.848 8.945   -3.680  1.00 0.00 ? 87  LEU A CB   3  
ATOM 6026  C CG   . LEU A 1 87  ? 128.328 9.167   -3.529  1.00 0.00 ? 87  LEU A CG   3  
ATOM 6027  C CD1  . LEU A 1 87  ? 127.535 8.120   -4.308  1.00 0.00 ? 87  LEU A CD1  3  
ATOM 6028  C CD2  . LEU A 1 87  ? 127.927 9.162   -2.056  1.00 0.00 ? 87  LEU A CD2  3  
ATOM 6029  H H    . LEU A 1 87  ? 129.752 7.549   -5.976  1.00 0.00 ? 87  LEU A H    3  
ATOM 6030  H HA   . LEU A 1 87  ? 130.218 10.354  -5.249  1.00 0.00 ? 87  LEU A HA   3  
ATOM 6031  H HB2  . LEU A 1 87  ? 130.057 7.902   -3.493  1.00 0.00 ? 87  LEU A HB2  3  
ATOM 6032  H HB3  . LEU A 1 87  ? 130.348 9.532   -2.922  1.00 0.00 ? 87  LEU A HB3  3  
ATOM 6033  H HG   . LEU A 1 87  ? 128.076 10.136  -3.936  1.00 0.00 ? 87  LEU A HG   3  
ATOM 6034  H HD11 . LEU A 1 87  ? 127.780 7.133   -3.942  1.00 0.00 ? 87  LEU A HD11 3  
ATOM 6035  H HD12 . LEU A 1 87  ? 127.784 8.186   -5.357  1.00 0.00 ? 87  LEU A HD12 3  
ATOM 6036  H HD13 . LEU A 1 87  ? 126.477 8.299   -4.179  1.00 0.00 ? 87  LEU A HD13 3  
ATOM 6037  H HD21 . LEU A 1 87  ? 128.454 9.950   -1.536  1.00 0.00 ? 87  LEU A HD21 3  
ATOM 6038  H HD22 . LEU A 1 87  ? 128.179 8.209   -1.613  1.00 0.00 ? 87  LEU A HD22 3  
ATOM 6039  H HD23 . LEU A 1 87  ? 126.863 9.328   -1.971  1.00 0.00 ? 87  LEU A HD23 3  
ATOM 6040  N N    . ASN A 1 88  ? 132.666 10.296  -5.078  1.00 0.00 ? 88  ASN A N    3  
ATOM 6041  C CA   . ASN A 1 88  ? 134.123 10.349  -4.949  1.00 0.00 ? 88  ASN A CA   3  
ATOM 6042  C C    . ASN A 1 88  ? 134.590 11.799  -4.940  1.00 0.00 ? 88  ASN A C    3  
ATOM 6043  O O    . ASN A 1 88  ? 135.227 12.266  -3.995  1.00 0.00 ? 88  ASN A O    3  
ATOM 6044  C CB   . ASN A 1 88  ? 134.807 9.597   -6.106  1.00 0.00 ? 88  ASN A CB   3  
ATOM 6045  C CG   . ASN A 1 88  ? 136.325 9.657   -6.031  1.00 0.00 ? 88  ASN A CG   3  
ATOM 6046  O OD1  . ASN A 1 88  ? 136.906 9.704   -4.947  1.00 0.00 ? 88  ASN A OD1  3  
ATOM 6047  N ND2  . ASN A 1 88  ? 136.978 9.660   -7.183  1.00 0.00 ? 88  ASN A ND2  3  
ATOM 6048  H H    . ASN A 1 88  ? 132.180 11.131  -5.233  1.00 0.00 ? 88  ASN A H    3  
ATOM 6049  H HA   . ASN A 1 88  ? 134.393 9.888   -4.015  1.00 0.00 ? 88  ASN A HA   3  
ATOM 6050  H HB2  . ASN A 1 88  ? 134.508 8.559   -6.080  1.00 0.00 ? 88  ASN A HB2  3  
ATOM 6051  H HB3  . ASN A 1 88  ? 134.492 10.032  -7.044  1.00 0.00 ? 88  ASN A HB3  3  
ATOM 6052  H HD21 . ASN A 1 88  ? 136.457 9.624   -8.015  1.00 0.00 ? 88  ASN A HD21 3  
ATOM 6053  H HD22 . ASN A 1 88  ? 137.958 9.698   -7.160  1.00 0.00 ? 88  ASN A HD22 3  
ATOM 6054  N N    . GLU A 1 89  ? 134.212 12.504  -5.990  1.00 0.00 ? 89  GLU A N    3  
ATOM 6055  C CA   . GLU A 1 89  ? 134.676 13.860  -6.258  1.00 0.00 ? 89  GLU A CA   3  
ATOM 6056  C C    . GLU A 1 89  ? 134.130 14.861  -5.238  1.00 0.00 ? 89  GLU A C    3  
ATOM 6057  O O    . GLU A 1 89  ? 133.026 15.384  -5.390  1.00 0.00 ? 89  GLU A O    3  
ATOM 6058  C CB   . GLU A 1 89  ? 134.268 14.251  -7.685  1.00 0.00 ? 89  GLU A CB   3  
ATOM 6059  C CG   . GLU A 1 89  ? 134.754 13.254  -8.736  1.00 0.00 ? 89  GLU A CG   3  
ATOM 6060  C CD   . GLU A 1 89  ? 134.091 13.438  -10.090 1.00 0.00 ? 89  GLU A CD   3  
ATOM 6061  O OE1  . GLU A 1 89  ? 132.961 12.934  -10.278 1.00 0.00 ? 89  GLU A OE1  3  
ATOM 6062  O OE2  . GLU A 1 89  ? 134.698 14.071  -10.980 1.00 0.00 ? 89  GLU A OE2  3  
ATOM 6063  H H    . GLU A 1 89  ? 133.594 12.093  -6.620  1.00 0.00 ? 89  GLU A H    3  
ATOM 6064  H HA   . GLU A 1 89  ? 135.755 13.857  -6.197  1.00 0.00 ? 89  GLU A HA   3  
ATOM 6065  H HB2  . GLU A 1 89  ? 133.188 14.308  -7.739  1.00 0.00 ? 89  GLU A HB2  3  
ATOM 6066  H HB3  . GLU A 1 89  ? 134.684 15.221  -7.917  1.00 0.00 ? 89  GLU A HB3  3  
ATOM 6067  H HG2  . GLU A 1 89  ? 135.822 13.372  -8.856  1.00 0.00 ? 89  GLU A HG2  3  
ATOM 6068  H HG3  . GLU A 1 89  ? 134.547 12.252  -8.384  1.00 0.00 ? 89  GLU A HG3  3  
ATOM 6069  N N    . LYS A 1 90  ? 134.910 15.079  -4.179  1.00 0.00 ? 90  LYS A N    3  
ATOM 6070  C CA   . LYS A 1 90  ? 134.613 16.064  -3.132  1.00 0.00 ? 90  LYS A CA   3  
ATOM 6071  C C    . LYS A 1 90  ? 133.189 15.952  -2.576  1.00 0.00 ? 90  LYS A C    3  
ATOM 6072  O O    . LYS A 1 90  ? 132.702 16.868  -1.909  1.00 0.00 ? 90  LYS A O    3  
ATOM 6073  C CB   . LYS A 1 90  ? 134.881 17.479  -3.658  1.00 0.00 ? 90  LYS A CB   3  
ATOM 6074  C CG   . LYS A 1 90  ? 136.366 17.831  -3.768  1.00 0.00 ? 90  LYS A CG   3  
ATOM 6075  C CD   . LYS A 1 90  ? 137.080 17.046  -4.867  1.00 0.00 ? 90  LYS A CD   3  
ATOM 6076  C CE   . LYS A 1 90  ? 138.584 17.302  -4.868  1.00 0.00 ? 90  LYS A CE   3  
ATOM 6077  N NZ   . LYS A 1 90  ? 138.912 18.742  -5.038  1.00 0.00 ? 90  LYS A NZ   3  
ATOM 6078  H H    . LYS A 1 90  ? 135.740 14.573  -4.109  1.00 0.00 ? 90  LYS A H    3  
ATOM 6079  H HA   . LYS A 1 90  ? 135.299 15.873  -2.320  1.00 0.00 ? 90  LYS A HA   3  
ATOM 6080  H HB2  . LYS A 1 90  ? 134.441 17.566  -4.641  1.00 0.00 ? 90  LYS A HB2  3  
ATOM 6081  H HB3  . LYS A 1 90  ? 134.411 18.194  -2.999  1.00 0.00 ? 90  LYS A HB3  3  
ATOM 6082  H HG2  . LYS A 1 90  ? 136.455 18.879  -3.986  1.00 0.00 ? 90  LYS A HG2  3  
ATOM 6083  H HG3  . LYS A 1 90  ? 136.845 17.621  -2.821  1.00 0.00 ? 90  LYS A HG3  3  
ATOM 6084  H HD2  . LYS A 1 90  ? 136.907 15.990  -4.712  1.00 0.00 ? 90  LYS A HD2  3  
ATOM 6085  H HD3  . LYS A 1 90  ? 136.673 17.339  -5.826  1.00 0.00 ? 90  LYS A HD3  3  
ATOM 6086  H HE2  . LYS A 1 90  ? 138.997 16.960  -3.931  1.00 0.00 ? 90  LYS A HE2  3  
ATOM 6087  H HE3  . LYS A 1 90  ? 139.031 16.743  -5.679  1.00 0.00 ? 90  LYS A HE3  3  
ATOM 6088  H HZ1  . LYS A 1 90  ? 138.452 19.119  -5.890  1.00 0.00 ? 90  LYS A HZ1  3  
ATOM 6089  H HZ2  . LYS A 1 90  ? 139.940 18.865  -5.136  1.00 0.00 ? 90  LYS A HZ2  3  
ATOM 6090  H HZ3  . LYS A 1 90  ? 138.589 19.287  -4.213  1.00 0.00 ? 90  LYS A HZ3  3  
ATOM 6091  N N    . ILE A 1 91  ? 132.536 14.822  -2.812  1.00 0.00 ? 91  ILE A N    3  
ATOM 6092  C CA   . ILE A 1 91  ? 131.163 14.628  -2.356  1.00 0.00 ? 91  ILE A CA   3  
ATOM 6093  C C    . ILE A 1 91  ? 131.138 13.904  -1.002  1.00 0.00 ? 91  ILE A C    3  
ATOM 6094  O O    . ILE A 1 91  ? 130.214 14.086  -0.211  1.00 0.00 ? 91  ILE A O    3  
ATOM 6095  C CB   . ILE A 1 91  ? 130.326 13.873  -3.420  1.00 0.00 ? 91  ILE A CB   3  
ATOM 6096  C CG1  . ILE A 1 91  ? 128.837 13.847  -3.038  1.00 0.00 ? 91  ILE A CG1  3  
ATOM 6097  C CG2  . ILE A 1 91  ? 130.854 12.462  -3.621  1.00 0.00 ? 91  ILE A CG2  3  
ATOM 6098  C CD1  . ILE A 1 91  ? 127.948 13.209  -4.088  1.00 0.00 ? 91  ILE A CD1  3  
ATOM 6099  H H    . ILE A 1 91  ? 132.981 14.109  -3.314  1.00 0.00 ? 91  ILE A H    3  
ATOM 6100  H HA   . ILE A 1 91  ? 130.722 15.610  -2.222  1.00 0.00 ? 91  ILE A HA   3  
ATOM 6101  H HB   . ILE A 1 91  ? 130.434 14.400  -4.359  1.00 0.00 ? 91  ILE A HB   3  
ATOM 6102  H HG12 . ILE A 1 91  ? 128.714 13.290  -2.120  1.00 0.00 ? 91  ILE A HG12 3  
ATOM 6103  H HG13 . ILE A 1 91  ? 128.493 14.861  -2.886  1.00 0.00 ? 91  ILE A HG13 3  
ATOM 6104  H HG21 . ILE A 1 91  ? 130.309 11.984  -4.422  1.00 0.00 ? 91  ILE A HG21 3  
ATOM 6105  H HG22 . ILE A 1 91  ? 130.722 11.894  -2.711  1.00 0.00 ? 91  ILE A HG22 3  
ATOM 6106  H HG23 . ILE A 1 91  ? 131.904 12.500  -3.873  1.00 0.00 ? 91  ILE A HG23 3  
ATOM 6107  H HD11 . ILE A 1 91  ? 126.922 13.235  -3.753  1.00 0.00 ? 91  ILE A HD11 3  
ATOM 6108  H HD12 . ILE A 1 91  ? 128.249 12.182  -4.241  1.00 0.00 ? 91  ILE A HD12 3  
ATOM 6109  H HD13 . ILE A 1 91  ? 128.037 13.753  -5.017  1.00 0.00 ? 91  ILE A HD13 3  
ATOM 6110  N N    . LEU A 1 92  ? 132.166 13.088  -0.733  1.00 0.00 ? 92  LEU A N    3  
ATOM 6111  C CA   . LEU A 1 92  ? 132.368 12.527  0.613   1.00 0.00 ? 92  LEU A CA   3  
ATOM 6112  C C    . LEU A 1 92  ? 133.223 13.486  1.430   1.00 0.00 ? 92  LEU A C    3  
ATOM 6113  O O    . LEU A 1 92  ? 133.244 13.434  2.660   1.00 0.00 ? 92  LEU A O    3  
ATOM 6114  C CB   . LEU A 1 92  ? 133.066 11.150  0.586   1.00 0.00 ? 92  LEU A CB   3  
ATOM 6115  C CG   . LEU A 1 92  ? 132.331 10.012  -0.144  1.00 0.00 ? 92  LEU A CG   3  
ATOM 6116  C CD1  . LEU A 1 92  ? 130.837 10.017  0.174   1.00 0.00 ? 92  LEU A CD1  3  
ATOM 6117  C CD2  . LEU A 1 92  ? 132.584 10.079  -1.644  1.00 0.00 ? 92  LEU A CD2  3  
ATOM 6118  H H    . LEU A 1 92  ? 132.794 12.857  -1.446  1.00 0.00 ? 92  LEU A H    3  
ATOM 6119  H HA   . LEU A 1 92  ? 131.400 12.429  1.087   1.00 0.00 ? 92  LEU A HA   3  
ATOM 6120  H HB2  . LEU A 1 92  ? 134.035 11.275  0.122   1.00 0.00 ? 92  LEU A HB2  3  
ATOM 6121  H HB3  . LEU A 1 92  ? 133.224 10.840  1.611   1.00 0.00 ? 92  LEU A HB3  3  
ATOM 6122  H HG   . LEU A 1 92  ? 132.728 9.069   0.209   1.00 0.00 ? 92  LEU A HG   3  
ATOM 6123  H HD11 . LEU A 1 92  ? 130.397 10.945  -0.164  1.00 0.00 ? 92  LEU A HD11 3  
ATOM 6124  H HD12 . LEU A 1 92  ? 130.695 9.919   1.241   1.00 0.00 ? 92  LEU A HD12 3  
ATOM 6125  H HD13 . LEU A 1 92  ? 130.359 9.188   -0.328  1.00 0.00 ? 92  LEU A HD13 3  
ATOM 6126  H HD21 . LEU A 1 92  ? 132.041 9.286   -2.138  1.00 0.00 ? 92  LEU A HD21 3  
ATOM 6127  H HD22 . LEU A 1 92  ? 133.640 9.962   -1.837  1.00 0.00 ? 92  LEU A HD22 3  
ATOM 6128  H HD23 . LEU A 1 92  ? 132.253 11.033  -2.025  1.00 0.00 ? 92  LEU A HD23 3  
ATOM 6129  N N    . GLU A 1 93  ? 133.940 14.350  0.724   1.00 0.00 ? 93  GLU A N    3  
ATOM 6130  C CA   . GLU A 1 93  ? 134.862 15.288  1.345   1.00 0.00 ? 93  GLU A CA   3  
ATOM 6131  C C    . GLU A 1 93  ? 134.104 16.462  1.959   1.00 0.00 ? 93  GLU A C    3  
ATOM 6132  O O    . GLU A 1 93  ? 134.463 16.951  3.034   1.00 0.00 ? 93  GLU A O    3  
ATOM 6133  C CB   . GLU A 1 93  ? 135.879 15.768  0.307   1.00 0.00 ? 93  GLU A CB   3  
ATOM 6134  C CG   . GLU A 1 93  ? 136.703 14.632  -0.296  1.00 0.00 ? 93  GLU A CG   3  
ATOM 6135  C CD   . GLU A 1 93  ? 137.674 15.104  -1.365  1.00 0.00 ? 93  GLU A CD   3  
ATOM 6136  O OE1  . GLU A 1 93  ? 138.619 15.848  -1.025  1.00 0.00 ? 93  GLU A OE1  3  
ATOM 6137  O OE2  . GLU A 1 93  ? 137.494 14.742  -2.547  1.00 0.00 ? 93  GLU A OE2  3  
ATOM 6138  H H    . GLU A 1 93  ? 133.844 14.357  -0.248  1.00 0.00 ? 93  GLU A H    3  
ATOM 6139  H HA   . GLU A 1 93  ? 135.387 14.766  2.133   1.00 0.00 ? 93  GLU A HA   3  
ATOM 6140  H HB2  . GLU A 1 93  ? 135.353 16.272  -0.493  1.00 0.00 ? 93  GLU A HB2  3  
ATOM 6141  H HB3  . GLU A 1 93  ? 136.557 16.467  0.776   1.00 0.00 ? 93  GLU A HB3  3  
ATOM 6142  H HG2  . GLU A 1 93  ? 137.267 14.156  0.494   1.00 0.00 ? 93  GLU A HG2  3  
ATOM 6143  H HG3  . GLU A 1 93  ? 136.026 13.910  -0.734  1.00 0.00 ? 93  GLU A HG3  3  
ATOM 6144  N N    . GLU A 1 94  ? 133.053 16.903  1.271   1.00 0.00 ? 94  GLU A N    3  
ATOM 6145  C CA   . GLU A 1 94  ? 132.172 17.954  1.779   1.00 0.00 ? 94  GLU A CA   3  
ATOM 6146  C C    . GLU A 1 94  ? 130.708 17.543  1.595   1.00 0.00 ? 94  GLU A C    3  
ATOM 6147  O O    . GLU A 1 94  ? 130.024 18.025  0.692   1.00 0.00 ? 94  GLU A O    3  
ATOM 6148  C CB   . GLU A 1 94  ? 132.454 19.287  1.069   1.00 0.00 ? 94  GLU A CB   3  
ATOM 6149  C CG   . GLU A 1 94  ? 133.845 19.847  1.345   1.00 0.00 ? 94  GLU A CG   3  
ATOM 6150  C CD   . GLU A 1 94  ? 134.117 21.135  0.589   1.00 0.00 ? 94  GLU A CD   3  
ATOM 6151  O OE1  . GLU A 1 94  ? 133.708 22.213  1.068   1.00 0.00 ? 94  GLU A OE1  3  
ATOM 6152  O OE2  . GLU A 1 94  ? 134.735 21.077  -0.494  1.00 0.00 ? 94  GLU A OE2  3  
ATOM 6153  H H    . GLU A 1 94  ? 132.863 16.514  0.393   1.00 0.00 ? 94  GLU A H    3  
ATOM 6154  H HA   . GLU A 1 94  ? 132.366 18.071  2.837   1.00 0.00 ? 94  GLU A HA   3  
ATOM 6155  H HB2  . GLU A 1 94  ? 132.352 19.142  0.002   1.00 0.00 ? 94  GLU A HB2  3  
ATOM 6156  H HB3  . GLU A 1 94  ? 131.725 20.017  1.394   1.00 0.00 ? 94  GLU A HB3  3  
ATOM 6157  H HG2  . GLU A 1 94  ? 133.938 20.041  2.405   1.00 0.00 ? 94  GLU A HG2  3  
ATOM 6158  H HG3  . GLU A 1 94  ? 134.581 19.109  1.052   1.00 0.00 ? 94  GLU A HG3  3  
ATOM 6159  N N    . PRO A 1 95  ? 130.221 16.604  2.428   1.00 0.00 ? 95  PRO A N    3  
ATOM 6160  C CA   . PRO A 1 95  ? 128.843 16.112  2.350   1.00 0.00 ? 95  PRO A CA   3  
ATOM 6161  C C    . PRO A 1 95  ? 127.824 17.145  2.839   1.00 0.00 ? 95  PRO A C    3  
ATOM 6162  O O    . PRO A 1 95  ? 128.014 17.786  3.878   1.00 0.00 ? 95  PRO A O    3  
ATOM 6163  C CB   . PRO A 1 95  ? 128.840 14.869  3.265   1.00 0.00 ? 95  PRO A CB   3  
ATOM 6164  C CG   . PRO A 1 95  ? 130.280 14.592  3.560   1.00 0.00 ? 95  PRO A CG   3  
ATOM 6165  C CD   . PRO A 1 95  ? 130.970 15.923  3.494   1.00 0.00 ? 95  PRO A CD   3  
ATOM 6166  H HA   . PRO A 1 95  ? 128.593 15.816  1.340   1.00 0.00 ? 95  PRO A HA   3  
ATOM 6167  H HB2  . PRO A 1 95  ? 128.287 15.083  4.169   1.00 0.00 ? 95  PRO A HB2  3  
ATOM 6168  H HB3  . PRO A 1 95  ? 128.379 14.039  2.748   1.00 0.00 ? 95  PRO A HB3  3  
ATOM 6169  H HG2  . PRO A 1 95  ? 130.380 14.164  4.548   1.00 0.00 ? 95  PRO A HG2  3  
ATOM 6170  H HG3  . PRO A 1 95  ? 130.688 13.920  2.818   1.00 0.00 ? 95  PRO A HG3  3  
ATOM 6171  H HD2  . PRO A 1 95  ? 130.878 16.450  4.434   1.00 0.00 ? 95  PRO A HD2  3  
ATOM 6172  H HD3  . PRO A 1 95  ? 132.009 15.802  3.224   1.00 0.00 ? 95  PRO A HD3  3  
ATOM 6173  N N    . HIS A 1 96  ? 126.751 17.299  2.072   1.00 0.00 ? 96  HIS A N    3  
ATOM 6174  C CA   . HIS A 1 96  ? 125.643 18.192  2.416   1.00 0.00 ? 96  HIS A CA   3  
ATOM 6175  C C    . HIS A 1 96  ? 124.387 17.356  2.688   1.00 0.00 ? 96  HIS A C    3  
ATOM 6176  O O    . HIS A 1 96  ? 124.343 16.186  2.322   1.00 0.00 ? 96  HIS A O    3  
ATOM 6177  C CB   . HIS A 1 96  ? 125.396 19.189  1.272   1.00 0.00 ? 96  HIS A CB   3  
ATOM 6178  C CG   . HIS A 1 96  ? 126.508 20.177  1.075   1.00 0.00 ? 96  HIS A CG   3  
ATOM 6179  N ND1  . HIS A 1 96  ? 126.411 21.504  1.440   1.00 0.00 ? 96  HIS A ND1  3  
ATOM 6180  C CD2  . HIS A 1 96  ? 127.747 20.026  0.549   1.00 0.00 ? 96  HIS A CD2  3  
ATOM 6181  C CE1  . HIS A 1 96  ? 127.540 22.123  1.145   1.00 0.00 ? 96  HIS A CE1  3  
ATOM 6182  N NE2  . HIS A 1 96  ? 128.365 21.248  0.605   1.00 0.00 ? 96  HIS A NE2  3  
ATOM 6183  H H    . HIS A 1 96  ? 126.692 16.780  1.245   1.00 0.00 ? 96  HIS A H    3  
ATOM 6184  H HA   . HIS A 1 96  ? 125.907 18.734  3.315   1.00 0.00 ? 96  HIS A HA   3  
ATOM 6185  H HB2  . HIS A 1 96  ? 125.272 18.644  0.347   1.00 0.00 ? 96  HIS A HB2  3  
ATOM 6186  H HB3  . HIS A 1 96  ? 124.492 19.745  1.477   1.00 0.00 ? 96  HIS A HB3  3  
ATOM 6187  H HD1  . HIS A 1 96  ? 125.627 21.931  1.852   1.00 0.00 ? 96  HIS A HD1  3  
ATOM 6188  H HD2  . HIS A 1 96  ? 128.169 19.112  0.156   1.00 0.00 ? 96  HIS A HD2  3  
ATOM 6189  H HE1  . HIS A 1 96  ? 127.751 23.169  1.318   1.00 0.00 ? 96  HIS A HE1  3  
ATOM 6190  H HE2  . HIS A 1 96  ? 129.224 21.471  0.178   1.00 0.00 ? 96  HIS A HE2  3  
ATOM 6191  N N    . PRO A 1 97  ? 123.350 17.925  3.331   1.00 0.00 ? 97  PRO A N    3  
ATOM 6192  C CA   . PRO A 1 97  ? 122.141 17.162  3.691   1.00 0.00 ? 97  PRO A CA   3  
ATOM 6193  C C    . PRO A 1 97  ? 121.365 16.641  2.473   1.00 0.00 ? 97  PRO A C    3  
ATOM 6194  O O    . PRO A 1 97  ? 120.735 15.581  2.538   1.00 0.00 ? 97  PRO A O    3  
ATOM 6195  C CB   . PRO A 1 97  ? 121.295 18.178  4.480   1.00 0.00 ? 97  PRO A CB   3  
ATOM 6196  C CG   . PRO A 1 97  ? 121.795 19.515  4.044   1.00 0.00 ? 97  PRO A CG   3  
ATOM 6197  C CD   . PRO A 1 97  ? 123.263 19.332  3.777   1.00 0.00 ? 97  PRO A CD   3  
ATOM 6198  H HA   . PRO A 1 97  ? 122.387 16.328  4.333   1.00 0.00 ? 97  PRO A HA   3  
ATOM 6199  H HB2  . PRO A 1 97  ? 120.248 18.049  4.242   1.00 0.00 ? 97  PRO A HB2  3  
ATOM 6200  H HB3  . PRO A 1 97  ? 121.446 18.029  5.541   1.00 0.00 ? 97  PRO A HB3  3  
ATOM 6201  H HG2  . PRO A 1 97  ? 121.283 19.824  3.143   1.00 0.00 ? 97  PRO A HG2  3  
ATOM 6202  H HG3  . PRO A 1 97  ? 121.643 20.241  4.831   1.00 0.00 ? 97  PRO A HG3  3  
ATOM 6203  H HD2  . PRO A 1 97  ? 123.593 20.007  2.999   1.00 0.00 ? 97  PRO A HD2  3  
ATOM 6204  H HD3  . PRO A 1 97  ? 123.837 19.485  4.680   1.00 0.00 ? 97  PRO A HD3  3  
ATOM 6205  N N    . LEU A 1 98  ? 121.421 17.375  1.361   1.00 0.00 ? 98  LEU A N    3  
ATOM 6206  C CA   . LEU A 1 98  ? 120.586 17.065  0.198   1.00 0.00 ? 98  LEU A CA   3  
ATOM 6207  C C    . LEU A 1 98  ? 121.351 16.318  -0.900  1.00 0.00 ? 98  LEU A C    3  
ATOM 6208  O O    . LEU A 1 98  ? 120.749 15.892  -1.886  1.00 0.00 ? 98  LEU A O    3  
ATOM 6209  C CB   . LEU A 1 98  ? 119.978 18.354  -0.375  1.00 0.00 ? 98  LEU A CB   3  
ATOM 6210  C CG   . LEU A 1 98  ? 119.125 19.173  0.611   1.00 0.00 ? 98  LEU A CG   3  
ATOM 6211  C CD1  . LEU A 1 98  ? 118.634 20.463  -0.040  1.00 0.00 ? 98  LEU A CD1  3  
ATOM 6212  C CD2  . LEU A 1 98  ? 117.947 18.346  1.125   1.00 0.00 ? 98  LEU A CD2  3  
ATOM 6213  H H    . LEU A 1 98  ? 122.027 18.146  1.324   1.00 0.00 ? 98  LEU A H    3  
ATOM 6214  H HA   . LEU A 1 98  ? 119.778 16.429  0.535   1.00 0.00 ? 98  LEU A HA   3  
ATOM 6215  H HB2  . LEU A 1 98  ? 120.787 18.981  -0.726  1.00 0.00 ? 98  LEU A HB2  3  
ATOM 6216  H HB3  . LEU A 1 98  ? 119.358 18.092  -1.221  1.00 0.00 ? 98  LEU A HB3  3  
ATOM 6217  H HG   . LEU A 1 98  ? 119.736 19.446  1.461   1.00 0.00 ? 98  LEU A HG   3  
ATOM 6218  H HD11 . LEU A 1 98  ? 118.013 20.226  -0.893  1.00 0.00 ? 98  LEU A HD11 3  
ATOM 6219  H HD12 . LEU A 1 98  ? 119.483 21.048  -0.365  1.00 0.00 ? 98  LEU A HD12 3  
ATOM 6220  H HD13 . LEU A 1 98  ? 118.060 21.033  0.676   1.00 0.00 ? 98  LEU A HD13 3  
ATOM 6221  H HD21 . LEU A 1 98  ? 117.354 18.944  1.802   1.00 0.00 ? 98  LEU A HD21 3  
ATOM 6222  H HD22 . LEU A 1 98  ? 118.318 17.476  1.648   1.00 0.00 ? 98  LEU A HD22 3  
ATOM 6223  H HD23 . LEU A 1 98  ? 117.334 18.030  0.293   1.00 0.00 ? 98  LEU A HD23 3  
ATOM 6224  N N    . MET A 1 99  ? 122.664 16.136  -0.741  1.00 0.00 ? 99  MET A N    3  
ATOM 6225  C CA   . MET A 1 99  ? 123.449 15.458  -1.782  1.00 0.00 ? 99  MET A CA   3  
ATOM 6226  C C    . MET A 1 99  ? 123.003 14.004  -1.941  1.00 0.00 ? 99  MET A C    3  
ATOM 6227  O O    . MET A 1 99  ? 122.950 13.483  -3.056  1.00 0.00 ? 99  MET A O    3  
ATOM 6228  C CB   . MET A 1 99  ? 124.970 15.548  -1.528  1.00 0.00 ? 99  MET A CB   3  
ATOM 6229  C CG   . MET A 1 99  ? 125.432 15.079  -0.154  1.00 0.00 ? 99  MET A CG   3  
ATOM 6230  S SD   . MET A 1 99  ? 125.155 13.327  0.152   1.00 0.00 ? 99  MET A SD   3  
ATOM 6231  C CE   . MET A 1 99  ? 126.238 12.576  -1.060  1.00 0.00 ? 99  MET A CE   3  
ATOM 6232  H H    . MET A 1 99  ? 123.103 16.455  0.075   1.00 0.00 ? 99  MET A H    3  
ATOM 6233  H HA   . MET A 1 99  ? 123.233 15.968  -2.713  1.00 0.00 ? 99  MET A HA   3  
ATOM 6234  H HB2  . MET A 1 99  ? 125.479 14.950  -2.270  1.00 0.00 ? 99  MET A HB2  3  
ATOM 6235  H HB3  . MET A 1 99  ? 125.276 16.578  -1.650  1.00 0.00 ? 99  MET A HB3  3  
ATOM 6236  H HG2  . MET A 1 99  ? 126.489 15.276  -0.059  1.00 0.00 ? 99  MET A HG2  3  
ATOM 6237  H HG3  . MET A 1 99  ? 124.901 15.645  0.594   1.00 0.00 ? 99  MET A HG3  3  
ATOM 6238  H HE1  . MET A 1 99  ? 127.256 12.882  -0.871  1.00 0.00 ? 99  MET A HE1  3  
ATOM 6239  H HE2  . MET A 1 99  ? 125.944 12.892  -2.050  1.00 0.00 ? 99  MET A HE2  3  
ATOM 6240  H HE3  . MET A 1 99  ? 126.166 11.500  -0.991  1.00 0.00 ? 99  MET A HE3  3  
ATOM 6241  N N    . PHE A 1 100 ? 122.653 13.359  -0.828  1.00 0.00 ? 100 PHE A N    3  
ATOM 6242  C CA   . PHE A 1 100 ? 122.168 11.979  -0.866  1.00 0.00 ? 100 PHE A CA   3  
ATOM 6243  C C    . PHE A 1 100 ? 120.720 11.912  -1.337  1.00 0.00 ? 100 PHE A C    3  
ATOM 6244  O O    . PHE A 1 100 ? 120.204 10.828  -1.592  1.00 0.00 ? 100 PHE A O    3  
ATOM 6245  C CB   . PHE A 1 100 ? 122.325 11.285  0.501   1.00 0.00 ? 100 PHE A CB   3  
ATOM 6246  C CG   . PHE A 1 100 ? 123.540 10.391  0.574   1.00 0.00 ? 100 PHE A CG   3  
ATOM 6247  C CD1  . PHE A 1 100 ? 123.623 9.255   -0.219  1.00 0.00 ? 100 PHE A CD1  3  
ATOM 6248  C CD2  . PHE A 1 100 ? 124.598 10.685  1.421   1.00 0.00 ? 100 PHE A CD2  3  
ATOM 6249  C CE1  . PHE A 1 100 ? 124.733 8.434   -0.170  1.00 0.00 ? 100 PHE A CE1  3  
ATOM 6250  C CE2  . PHE A 1 100 ? 125.709 9.865   1.472   1.00 0.00 ? 100 PHE A CE2  3  
ATOM 6251  C CZ   . PHE A 1 100 ? 125.777 8.740   0.676   1.00 0.00 ? 100 PHE A CZ   3  
ATOM 6252  H H    . PHE A 1 100 ? 122.741 13.812  0.037   1.00 0.00 ? 100 PHE A H    3  
ATOM 6253  H HA   . PHE A 1 100 ? 122.775 11.450  -1.589  1.00 0.00 ? 100 PHE A HA   3  
ATOM 6254  H HB2  . PHE A 1 100 ? 122.412 12.036  1.274   1.00 0.00 ? 100 PHE A HB2  3  
ATOM 6255  H HB3  . PHE A 1 100 ? 121.452 10.676  0.698   1.00 0.00 ? 100 PHE A HB3  3  
ATOM 6256  H HD1  . PHE A 1 100 ? 122.806 9.013   -0.885  1.00 0.00 ? 100 PHE A HD1  3  
ATOM 6257  H HD2  . PHE A 1 100 ? 124.550 11.564  2.047   1.00 0.00 ? 100 PHE A HD2  3  
ATOM 6258  H HE1  . PHE A 1 100 ? 124.782 7.553   -0.793  1.00 0.00 ? 100 PHE A HE1  3  
ATOM 6259  H HE2  . PHE A 1 100 ? 126.526 10.106  2.134   1.00 0.00 ? 100 PHE A HE2  3  
ATOM 6260  H HZ   . PHE A 1 100 ? 126.647 8.099   0.717   1.00 0.00 ? 100 PHE A HZ   3  
ATOM 6261  N N    . GLN A 1 101 ? 120.068 13.067  -1.471  1.00 0.00 ? 101 GLN A N    3  
ATOM 6262  C CA   . GLN A 1 101 ? 118.701 13.105  -1.988  1.00 0.00 ? 101 GLN A CA   3  
ATOM 6263  C C    . GLN A 1 101 ? 118.708 12.797  -3.484  1.00 0.00 ? 101 GLN A C    3  
ATOM 6264  O O    . GLN A 1 101 ? 117.740 12.262  -4.020  1.00 0.00 ? 101 GLN A O    3  
ATOM 6265  C CB   . GLN A 1 101 ? 118.021 14.462  -1.707  1.00 0.00 ? 101 GLN A CB   3  
ATOM 6266  C CG   . GLN A 1 101 ? 117.104 14.479  -0.476  1.00 0.00 ? 101 GLN A CG   3  
ATOM 6267  C CD   . GLN A 1 101 ? 117.824 14.584  0.870   1.00 0.00 ? 101 GLN A CD   3  
ATOM 6268  O OE1  . GLN A 1 101 ? 117.296 15.179  1.809   1.00 0.00 ? 101 GLN A OE1  3  
ATOM 6269  N NE2  . GLN A 1 101 ? 118.999 13.987  0.999   1.00 0.00 ? 101 GLN A NE2  3  
ATOM 6270  H H    . GLN A 1 101 ? 120.520 13.907  -1.239  1.00 0.00 ? 101 GLN A H    3  
ATOM 6271  H HA   . GLN A 1 101 ? 118.144 12.325  -1.485  1.00 0.00 ? 101 GLN A HA   3  
ATOM 6272  H HB2  . GLN A 1 101 ? 118.786 15.211  -1.564  1.00 0.00 ? 101 GLN A HB2  3  
ATOM 6273  H HB3  . GLN A 1 101 ? 117.426 14.739  -2.568  1.00 0.00 ? 101 GLN A HB3  3  
ATOM 6274  H HG2  . GLN A 1 101 ? 116.437 15.324  -0.562  1.00 0.00 ? 101 GLN A HG2  3  
ATOM 6275  H HG3  . GLN A 1 101 ? 116.517 13.570  -0.477  1.00 0.00 ? 101 GLN A HG3  3  
ATOM 6276  H HE21 . GLN A 1 101 ? 119.358 13.498  0.239   1.00 0.00 ? 101 GLN A HE21 3  
ATOM 6277  H HE22 . GLN A 1 101 ? 119.465 14.070  1.860   1.00 0.00 ? 101 GLN A HE22 3  
ATOM 6278  N N    . LYS A 1 102 ? 119.816 13.123  -4.151  1.00 0.00 ? 102 LYS A N    3  
ATOM 6279  C CA   . LYS A 1 102 ? 119.994 12.764  -5.556  1.00 0.00 ? 102 LYS A CA   3  
ATOM 6280  C C    . LYS A 1 102 ? 120.221 11.261  -5.684  1.00 0.00 ? 102 LYS A C    3  
ATOM 6281  O O    . LYS A 1 102 ? 119.733 10.624  -6.616  1.00 0.00 ? 102 LYS A O    3  
ATOM 6282  C CB   . LYS A 1 102 ? 121.166 13.535  -6.176  1.00 0.00 ? 102 LYS A CB   3  
ATOM 6283  C CG   . LYS A 1 102 ? 120.919 15.035  -6.296  1.00 0.00 ? 102 LYS A CG   3  
ATOM 6284  C CD   . LYS A 1 102 ? 122.050 15.731  -7.047  1.00 0.00 ? 102 LYS A CD   3  
ATOM 6285  C CE   . LYS A 1 102 ? 121.748 17.204  -7.288  1.00 0.00 ? 102 LYS A CE   3  
ATOM 6286  N NZ   . LYS A 1 102 ? 120.495 17.395  -8.067  1.00 0.00 ? 102 LYS A NZ   3  
ATOM 6287  H H    . LYS A 1 102 ? 120.526 13.618  -3.689  1.00 0.00 ? 102 LYS A H    3  
ATOM 6288  H HA   . LYS A 1 102 ? 119.084 13.024  -6.082  1.00 0.00 ? 102 LYS A HA   3  
ATOM 6289  H HB2  . LYS A 1 102 ? 122.046 13.384  -5.565  1.00 0.00 ? 102 LYS A HB2  3  
ATOM 6290  H HB3  . LYS A 1 102 ? 121.358 13.143  -7.167  1.00 0.00 ? 102 LYS A HB3  3  
ATOM 6291  H HG2  . LYS A 1 102 ? 119.993 15.195  -6.830  1.00 0.00 ? 102 LYS A HG2  3  
ATOM 6292  H HG3  . LYS A 1 102 ? 120.841 15.458  -5.304  1.00 0.00 ? 102 LYS A HG3  3  
ATOM 6293  H HD2  . LYS A 1 102 ? 122.958 15.652  -6.466  1.00 0.00 ? 102 LYS A HD2  3  
ATOM 6294  H HD3  . LYS A 1 102 ? 122.189 15.242  -8.002  1.00 0.00 ? 102 LYS A HD3  3  
ATOM 6295  H HE2  . LYS A 1 102 ? 121.646 17.701  -6.334  1.00 0.00 ? 102 LYS A HE2  3  
ATOM 6296  H HE3  . LYS A 1 102 ? 122.571 17.643  -7.834  1.00 0.00 ? 102 LYS A HE3  3  
ATOM 6297  H HZ1  . LYS A 1 102 ? 120.516 16.813  -8.929  1.00 0.00 ? 102 LYS A HZ1  3  
ATOM 6298  H HZ2  . LYS A 1 102 ? 120.395 18.391  -8.344  1.00 0.00 ? 102 LYS A HZ2  3  
ATOM 6299  H HZ3  . LYS A 1 102 ? 119.669 17.122  -7.498  1.00 0.00 ? 102 LYS A HZ3  3  
ATOM 6300  N N    . LEU A 1 103 ? 120.960 10.698  -4.730  1.00 0.00 ? 103 LEU A N    3  
ATOM 6301  C CA   . LEU A 1 103 ? 121.169 9.254   -4.675  1.00 0.00 ? 103 LEU A CA   3  
ATOM 6302  C C    . LEU A 1 103 ? 119.862 8.558   -4.305  1.00 0.00 ? 103 LEU A C    3  
ATOM 6303  O O    . LEU A 1 103 ? 119.569 7.467   -4.791  1.00 0.00 ? 103 LEU A O    3  
ATOM 6304  C CB   . LEU A 1 103 ? 122.275 8.887   -3.668  1.00 0.00 ? 103 LEU A CB   3  
ATOM 6305  C CG   . LEU A 1 103 ? 123.719 9.216   -4.101  1.00 0.00 ? 103 LEU A CG   3  
ATOM 6306  C CD1  . LEU A 1 103 ? 124.047 8.562   -5.443  1.00 0.00 ? 103 LEU A CD1  3  
ATOM 6307  C CD2  . LEU A 1 103 ? 123.954 10.725  -4.160  1.00 0.00 ? 103 LEU A CD2  3  
ATOM 6308  H H    . LEU A 1 103 ? 121.370 11.268  -4.048  1.00 0.00 ? 103 LEU A H    3  
ATOM 6309  H HA   . LEU A 1 103 ? 121.468 8.926   -5.661  1.00 0.00 ? 103 LEU A HA   3  
ATOM 6310  H HB2  . LEU A 1 103 ? 122.073 9.407   -2.742  1.00 0.00 ? 103 LEU A HB2  3  
ATOM 6311  H HB3  . LEU A 1 103 ? 122.217 7.824   -3.477  1.00 0.00 ? 103 LEU A HB3  3  
ATOM 6312  H HG   . LEU A 1 103 ? 124.401 8.806   -3.367  1.00 0.00 ? 103 LEU A HG   3  
ATOM 6313  H HD11 . LEU A 1 103 ? 125.071 8.782   -5.711  1.00 0.00 ? 103 LEU A HD11 3  
ATOM 6314  H HD12 . LEU A 1 103 ? 123.386 8.948   -6.207  1.00 0.00 ? 103 LEU A HD12 3  
ATOM 6315  H HD13 . LEU A 1 103 ? 123.919 7.492   -5.365  1.00 0.00 ? 103 LEU A HD13 3  
ATOM 6316  H HD21 . LEU A 1 103 ? 123.290 11.168  -4.889  1.00 0.00 ? 103 LEU A HD21 3  
ATOM 6317  H HD22 . LEU A 1 103 ? 124.979 10.920  -4.443  1.00 0.00 ? 103 LEU A HD22 3  
ATOM 6318  H HD23 . LEU A 1 103 ? 123.763 11.158  -3.189  1.00 0.00 ? 103 LEU A HD23 3  
ATOM 6319  N N    . GLN A 1 104 ? 119.081 9.214   -3.450  1.00 0.00 ? 104 GLN A N    3  
ATOM 6320  C CA   . GLN A 1 104 ? 117.770 8.731   -3.054  1.00 0.00 ? 104 GLN A CA   3  
ATOM 6321  C C    . GLN A 1 104 ? 116.838 8.711   -4.265  1.00 0.00 ? 104 GLN A C    3  
ATOM 6322  O O    . GLN A 1 104 ? 116.107 7.748   -4.490  1.00 0.00 ? 104 GLN A O    3  
ATOM 6323  C CB   . GLN A 1 104 ? 117.201 9.643   -1.961  1.00 0.00 ? 104 GLN A CB   3  
ATOM 6324  C CG   . GLN A 1 104 ? 115.910 9.135   -1.351  1.00 0.00 ? 104 GLN A CG   3  
ATOM 6325  C CD   . GLN A 1 104 ? 115.255 10.149  -0.428  1.00 0.00 ? 104 GLN A CD   3  
ATOM 6326  O OE1  . GLN A 1 104 ? 115.530 10.190  0.772   1.00 0.00 ? 104 GLN A OE1  3  
ATOM 6327  N NE2  . GLN A 1 104 ? 114.382 10.977  -0.983  1.00 0.00 ? 104 GLN A NE2  3  
ATOM 6328  H H    . GLN A 1 104 ? 119.400 10.051  -3.066  1.00 0.00 ? 104 GLN A H    3  
ATOM 6329  H HA   . GLN A 1 104 ? 117.878 7.728   -2.665  1.00 0.00 ? 104 GLN A HA   3  
ATOM 6330  H HB2  . GLN A 1 104 ? 117.934 9.741   -1.172  1.00 0.00 ? 104 GLN A HB2  3  
ATOM 6331  H HB3  . GLN A 1 104 ? 117.014 10.621  -2.386  1.00 0.00 ? 104 GLN A HB3  3  
ATOM 6332  H HG2  . GLN A 1 104 ? 115.224 8.895   -2.148  1.00 0.00 ? 104 GLN A HG2  3  
ATOM 6333  H HG3  . GLN A 1 104 ? 116.128 8.241   -0.786  1.00 0.00 ? 104 GLN A HG3  3  
ATOM 6334  H HE21 . GLN A 1 104 ? 114.209 10.891  -1.947  1.00 0.00 ? 104 GLN A HE21 3  
ATOM 6335  H HE22 . GLN A 1 104 ? 113.940 11.635  -0.411  1.00 0.00 ? 104 GLN A HE22 3  
ATOM 6336  N N    . ASP A 1 105 ? 116.885 9.788   -5.044  1.00 0.00 ? 105 ASP A N    3  
ATOM 6337  C CA   . ASP A 1 105 ? 116.112 9.897   -6.281  1.00 0.00 ? 105 ASP A CA   3  
ATOM 6338  C C    . ASP A 1 105 ? 116.536 8.811   -7.269  1.00 0.00 ? 105 ASP A C    3  
ATOM 6339  O O    . ASP A 1 105 ? 115.698 8.123   -7.859  1.00 0.00 ? 105 ASP A O    3  
ATOM 6340  C CB   . ASP A 1 105 ? 116.312 11.288  -6.901  1.00 0.00 ? 105 ASP A CB   3  
ATOM 6341  C CG   . ASP A 1 105 ? 115.635 11.439  -8.256  1.00 0.00 ? 105 ASP A CG   3  
ATOM 6342  O OD1  . ASP A 1 105 ? 114.403 11.645  -8.291  1.00 0.00 ? 105 ASP A OD1  3  
ATOM 6343  O OD2  . ASP A 1 105 ? 116.334 11.370  -9.287  1.00 0.00 ? 105 ASP A OD2  3  
ATOM 6344  H H    . ASP A 1 105 ? 117.454 10.539  -4.776  1.00 0.00 ? 105 ASP A H    3  
ATOM 6345  H HA   . ASP A 1 105 ? 115.067 9.763   -6.037  1.00 0.00 ? 105 ASP A HA   3  
ATOM 6346  H HB2  . ASP A 1 105 ? 115.903 12.033  -6.233  1.00 0.00 ? 105 ASP A HB2  3  
ATOM 6347  H HB3  . ASP A 1 105 ? 117.372 11.470  -7.023  1.00 0.00 ? 105 ASP A HB3  3  
ATOM 6348  N N    . GLN A 1 106 ? 117.849 8.657   -7.420  1.00 0.00 ? 106 GLN A N    3  
ATOM 6349  C CA   . GLN A 1 106 ? 118.423 7.650   -8.307  1.00 0.00 ? 106 GLN A CA   3  
ATOM 6350  C C    . GLN A 1 106 ? 117.970 6.247   -7.904  1.00 0.00 ? 106 GLN A C    3  
ATOM 6351  O O    . GLN A 1 106 ? 117.491 5.472   -8.738  1.00 0.00 ? 106 GLN A O    3  
ATOM 6352  C CB   . GLN A 1 106 ? 119.948 7.734   -8.286  1.00 0.00 ? 106 GLN A CB   3  
ATOM 6353  C CG   . GLN A 1 106 ? 120.626 6.775   -9.257  1.00 0.00 ? 106 GLN A CG   3  
ATOM 6354  C CD   . GLN A 1 106 ? 122.133 6.919   -9.264  1.00 0.00 ? 106 GLN A CD   3  
ATOM 6355  O OE1  . GLN A 1 106 ? 122.789 6.691   -10.280 1.00 0.00 ? 106 GLN A OE1  3  
ATOM 6356  N NE2  . GLN A 1 106 ? 122.697 7.288   -8.129  1.00 0.00 ? 106 GLN A NE2  3  
ATOM 6357  H H    . GLN A 1 106 ? 118.452 9.248   -6.923  1.00 0.00 ? 106 GLN A H    3  
ATOM 6358  H HA   . GLN A 1 106 ? 118.086 7.854   -9.310  1.00 0.00 ? 106 GLN A HA   3  
ATOM 6359  H HB2  . GLN A 1 106 ? 120.245 8.742   -8.541  1.00 0.00 ? 106 GLN A HB2  3  
ATOM 6360  H HB3  . GLN A 1 106 ? 120.296 7.509   -7.287  1.00 0.00 ? 106 GLN A HB3  3  
ATOM 6361  H HG2  . GLN A 1 106 ? 120.381 5.761   -8.975  1.00 0.00 ? 106 GLN A HG2  3  
ATOM 6362  H HG3  . GLN A 1 106 ? 120.254 6.969   -10.254 1.00 0.00 ? 106 GLN A HG3  3  
ATOM 6363  H HE21 . GLN A 1 106 ? 122.123 7.444   -7.351  1.00 0.00 ? 106 GLN A HE21 3  
ATOM 6364  H HE22 . GLN A 1 106 ? 123.661 7.400   -8.115  1.00 0.00 ? 106 GLN A HE22 3  
ATOM 6365  N N    . ILE A 1 107 ? 118.109 5.926   -6.618  1.00 0.00 ? 107 ILE A N    3  
ATOM 6366  C CA   . ILE A 1 107 ? 117.765 4.596   -6.131  1.00 0.00 ? 107 ILE A CA   3  
ATOM 6367  C C    . ILE A 1 107 ? 116.256 4.396   -6.160  1.00 0.00 ? 107 ILE A C    3  
ATOM 6368  O O    . ILE A 1 107 ? 115.795 3.279   -6.289  1.00 0.00 ? 107 ILE A O    3  
ATOM 6369  C CB   . ILE A 1 107 ? 118.297 4.318   -4.695  1.00 0.00 ? 107 ILE A CB   3  
ATOM 6370  C CG1  . ILE A 1 107 ? 118.262 2.808   -4.387  1.00 0.00 ? 107 ILE A CG1  3  
ATOM 6371  C CG2  . ILE A 1 107 ? 117.486 5.081   -3.647  1.00 0.00 ? 107 ILE A CG2  3  
ATOM 6372  C CD1  . ILE A 1 107 ? 119.119 1.970   -5.316  1.00 0.00 ? 107 ILE A CD1  3  
ATOM 6373  H H    . ILE A 1 107 ? 118.438 6.598   -5.986  1.00 0.00 ? 107 ILE A H    3  
ATOM 6374  H HA   . ILE A 1 107 ? 118.219 3.878   -6.803  1.00 0.00 ? 107 ILE A HA   3  
ATOM 6375  H HB   . ILE A 1 107 ? 119.319 4.663   -4.641  1.00 0.00 ? 107 ILE A HB   3  
ATOM 6376  H HG12 . ILE A 1 107 ? 118.616 2.644   -3.380  1.00 0.00 ? 107 ILE A HG12 3  
ATOM 6377  H HG13 . ILE A 1 107 ? 117.242 2.451   -4.466  1.00 0.00 ? 107 ILE A HG13 3  
ATOM 6378  H HG21 . ILE A 1 107 ? 117.504 6.136   -3.875  1.00 0.00 ? 107 ILE A HG21 3  
ATOM 6379  H HG22 . ILE A 1 107 ? 117.915 4.917   -2.669  1.00 0.00 ? 107 ILE A HG22 3  
ATOM 6380  H HG23 . ILE A 1 107 ? 116.462 4.728   -3.654  1.00 0.00 ? 107 ILE A HG23 3  
ATOM 6381  H HD11 . ILE A 1 107 ? 120.144 2.305   -5.261  1.00 0.00 ? 107 ILE A HD11 3  
ATOM 6382  H HD12 . ILE A 1 107 ? 118.760 2.073   -6.330  1.00 0.00 ? 107 ILE A HD12 3  
ATOM 6383  H HD13 . ILE A 1 107 ? 119.063 0.933   -5.019  1.00 0.00 ? 107 ILE A HD13 3  
ATOM 6384  N N    . PHE A 1 108 ? 115.498 5.487   -6.053  1.00 0.00 ? 108 PHE A N    3  
ATOM 6385  C CA   . PHE A 1 108 ? 114.035 5.417   -6.075  1.00 0.00 ? 108 PHE A CA   3  
ATOM 6386  C C    . PHE A 1 108 ? 113.546 4.903   -7.429  1.00 0.00 ? 108 PHE A C    3  
ATOM 6387  O O    . PHE A 1 108 ? 112.671 4.036   -7.500  1.00 0.00 ? 108 PHE A O    3  
ATOM 6388  C CB   . PHE A 1 108 ? 113.425 6.796   -5.776  1.00 0.00 ? 108 PHE A CB   3  
ATOM 6389  C CG   . PHE A 1 108 ? 111.916 6.797   -5.696  1.00 0.00 ? 108 PHE A CG   3  
ATOM 6390  C CD1  . PHE A 1 108 ? 111.269 6.430   -4.524  1.00 0.00 ? 108 PHE A CD1  3  
ATOM 6391  C CD2  . PHE A 1 108 ? 111.145 7.165   -6.792  1.00 0.00 ? 108 PHE A CD2  3  
ATOM 6392  C CE1  . PHE A 1 108 ? 109.888 6.429   -4.447  1.00 0.00 ? 108 PHE A CE1  3  
ATOM 6393  C CE2  . PHE A 1 108 ? 109.765 7.165   -6.719  1.00 0.00 ? 108 PHE A CE2  3  
ATOM 6394  C CZ   . PHE A 1 108 ? 109.136 6.797   -5.545  1.00 0.00 ? 108 PHE A CZ   3  
ATOM 6395  H H    . PHE A 1 108 ? 115.931 6.361   -5.949  1.00 0.00 ? 108 PHE A H    3  
ATOM 6396  H HA   . PHE A 1 108 ? 113.726 4.722   -5.305  1.00 0.00 ? 108 PHE A HA   3  
ATOM 6397  H HB2  . PHE A 1 108 ? 113.806 7.151   -4.829  1.00 0.00 ? 108 PHE A HB2  3  
ATOM 6398  H HB3  . PHE A 1 108 ? 113.721 7.489   -6.553  1.00 0.00 ? 108 PHE A HB3  3  
ATOM 6399  H HD1  . PHE A 1 108 ? 111.855 6.143   -3.662  1.00 0.00 ? 108 PHE A HD1  3  
ATOM 6400  H HD2  . PHE A 1 108 ? 111.634 7.453   -7.712  1.00 0.00 ? 108 PHE A HD2  3  
ATOM 6401  H HE1  . PHE A 1 108 ? 109.398 6.141   -3.528  1.00 0.00 ? 108 PHE A HE1  3  
ATOM 6402  H HE2  . PHE A 1 108 ? 109.178 7.453   -7.579  1.00 0.00 ? 108 PHE A HE2  3  
ATOM 6403  H HZ   . PHE A 1 108 ? 108.057 6.797   -5.486  1.00 0.00 ? 108 PHE A HZ   3  
ATOM 6404  N N    . ASN A 1 109 ? 114.126 5.437   -8.500  1.00 0.00 ? 109 ASN A N    3  
ATOM 6405  C CA   . ASN A 1 109 ? 113.765 5.028   -9.857  1.00 0.00 ? 109 ASN A CA   3  
ATOM 6406  C C    . ASN A 1 109 ? 114.115 3.559   -10.081 1.00 0.00 ? 109 ASN A C    3  
ATOM 6407  O O    . ASN A 1 109 ? 113.282 2.771   -10.539 1.00 0.00 ? 109 ASN A O    3  
ATOM 6408  C CB   . ASN A 1 109 ? 114.484 5.903   -10.893 1.00 0.00 ? 109 ASN A CB   3  
ATOM 6409  C CG   . ASN A 1 109 ? 114.197 5.475   -12.325 1.00 0.00 ? 109 ASN A CG   3  
ATOM 6410  O OD1  . ASN A 1 109 ? 113.117 4.963   -12.637 1.00 0.00 ? 109 ASN A OD1  3  
ATOM 6411  N ND2  . ASN A 1 109 ? 115.166 5.666   -13.203 1.00 0.00 ? 109 ASN A ND2  3  
ATOM 6412  H H    . ASN A 1 109 ? 114.816 6.123   -8.375  1.00 0.00 ? 109 ASN A H    3  
ATOM 6413  H HA   . ASN A 1 109 ? 112.697 5.155   -9.968  1.00 0.00 ? 109 ASN A HA   3  
ATOM 6414  H HB2  . ASN A 1 109 ? 114.161 6.927   -10.774 1.00 0.00 ? 109 ASN A HB2  3  
ATOM 6415  H HB3  . ASN A 1 109 ? 115.551 5.846   -10.724 1.00 0.00 ? 109 ASN A HB3  3  
ATOM 6416  H HD21 . ASN A 1 109 ? 116.007 6.066   -12.885 1.00 0.00 ? 109 ASN A HD21 3  
ATOM 6417  H HD22 . ASN A 1 109 ? 115.009 5.404   -14.135 1.00 0.00 ? 109 ASN A HD22 3  
ATOM 6418  N N    . LEU A 1 110 ? 115.350 3.197   -9.747  1.00 0.00 ? 110 LEU A N    3  
ATOM 6419  C CA   . LEU A 1 110 ? 115.815 1.822   -9.872  1.00 0.00 ? 110 LEU A CA   3  
ATOM 6420  C C    . LEU A 1 110 ? 115.000 0.909   -8.953  1.00 0.00 ? 110 LEU A C    3  
ATOM 6421  O O    . LEU A 1 110 ? 114.672 -0.222  -9.313  1.00 0.00 ? 110 LEU A O    3  
ATOM 6422  C CB   . LEU A 1 110 ? 117.318 1.762   -9.538  1.00 0.00 ? 110 LEU A CB   3  
ATOM 6423  C CG   . LEU A 1 110 ? 118.030 0.410   -9.752  1.00 0.00 ? 110 LEU A CG   3  
ATOM 6424  C CD1  . LEU A 1 110 ? 117.778 -0.555  -8.592  1.00 0.00 ? 110 LEU A CD1  3  
ATOM 6425  C CD2  . LEU A 1 110 ? 117.621 -0.220  -11.084 1.00 0.00 ? 110 LEU A CD2  3  
ATOM 6426  H H    . LEU A 1 110 ? 115.973 3.878   -9.409  1.00 0.00 ? 110 LEU A H    3  
ATOM 6427  H HA   . LEU A 1 110 ? 115.666 1.511   -10.897 1.00 0.00 ? 110 LEU A HA   3  
ATOM 6428  H HB2  . LEU A 1 110 ? 117.822 2.500   -10.147 1.00 0.00 ? 110 LEU A HB2  3  
ATOM 6429  H HB3  . LEU A 1 110 ? 117.441 2.045   -8.501  1.00 0.00 ? 110 LEU A HB3  3  
ATOM 6430  H HG   . LEU A 1 110 ? 119.093 0.593   -9.792  1.00 0.00 ? 110 LEU A HG   3  
ATOM 6431  H HD11 . LEU A 1 110 ? 116.719 -0.750  -8.502  1.00 0.00 ? 110 LEU A HD11 3  
ATOM 6432  H HD12 . LEU A 1 110 ? 118.143 -0.115  -7.674  1.00 0.00 ? 110 LEU A HD12 3  
ATOM 6433  H HD13 . LEU A 1 110 ? 118.301 -1.483  -8.775  1.00 0.00 ? 110 LEU A HD13 3  
ATOM 6434  H HD21 . LEU A 1 110 ? 116.560 -0.428  -11.077 1.00 0.00 ? 110 LEU A HD21 3  
ATOM 6435  H HD22 . LEU A 1 110 ? 118.167 -1.141  -11.229 1.00 0.00 ? 110 LEU A HD22 3  
ATOM 6436  H HD23 . LEU A 1 110 ? 117.849 0.462   -11.890 1.00 0.00 ? 110 LEU A HD23 3  
ATOM 6437  N N    . MET A 1 111 ? 114.665 1.427   -7.777  1.00 0.00 ? 111 MET A N    3  
ATOM 6438  C CA   . MET A 1 111 ? 113.875 0.694   -6.791  1.00 0.00 ? 111 MET A CA   3  
ATOM 6439  C C    . MET A 1 111 ? 112.519 0.358   -7.389  1.00 0.00 ? 111 MET A C    3  
ATOM 6440  O O    . MET A 1 111 ? 112.024 -0.753  -7.257  1.00 0.00 ? 111 MET A O    3  
ATOM 6441  C CB   . MET A 1 111 ? 113.699 1.533   -5.515  1.00 0.00 ? 111 MET A CB   3  
ATOM 6442  C CG   . MET A 1 111 ? 113.205 0.752   -4.309  1.00 0.00 ? 111 MET A CG   3  
ATOM 6443  S SD   . MET A 1 111 ? 112.878 1.809   -2.887  1.00 0.00 ? 111 MET A SD   3  
ATOM 6444  C CE   . MET A 1 111 ? 114.503 2.511   -2.616  1.00 0.00 ? 111 MET A CE   3  
ATOM 6445  H H    . MET A 1 111 ? 114.956 2.335   -7.564  1.00 0.00 ? 111 MET A H    3  
ATOM 6446  H HA   . MET A 1 111 ? 114.398 -0.222  -6.552  1.00 0.00 ? 111 MET A HA   3  
ATOM 6447  H HB2  . MET A 1 111 ? 114.651 1.972   -5.258  1.00 0.00 ? 111 MET A HB2  3  
ATOM 6448  H HB3  . MET A 1 111 ? 112.995 2.329   -5.714  1.00 0.00 ? 111 MET A HB3  3  
ATOM 6449  H HG2  . MET A 1 111 ? 112.296 0.234   -4.573  1.00 0.00 ? 111 MET A HG2  3  
ATOM 6450  H HG3  . MET A 1 111 ? 113.965 0.034   -4.034  1.00 0.00 ? 111 MET A HG3  3  
ATOM 6451  H HE1  . MET A 1 111 ? 114.814 3.055   -3.496  1.00 0.00 ? 111 MET A HE1  3  
ATOM 6452  H HE2  . MET A 1 111 ? 115.209 1.719   -2.414  1.00 0.00 ? 111 MET A HE2  3  
ATOM 6453  H HE3  . MET A 1 111 ? 114.468 3.183   -1.772  1.00 0.00 ? 111 MET A HE3  3  
ATOM 6454  N N    . LYS A 1 112 ? 111.938 1.332   -8.072  1.00 0.00 ? 112 LYS A N    3  
ATOM 6455  C CA   . LYS A 1 112 ? 110.685 1.136   -8.786  1.00 0.00 ? 112 LYS A CA   3  
ATOM 6456  C C    . LYS A 1 112 ? 110.792 -0.076  -9.718  1.00 0.00 ? 112 LYS A C    3  
ATOM 6457  O O    . LYS A 1 112 ? 109.938 -0.963  -9.700  1.00 0.00 ? 112 LYS A O    3  
ATOM 6458  C CB   . LYS A 1 112 ? 110.333 2.419   -9.557  1.00 0.00 ? 112 LYS A CB   3  
ATOM 6459  C CG   . LYS A 1 112 ? 109.186 2.281   -10.555 1.00 0.00 ? 112 LYS A CG   3  
ATOM 6460  C CD   . LYS A 1 112 ? 108.671 3.647   -11.019 1.00 0.00 ? 112 LYS A CD   3  
ATOM 6461  C CE   . LYS A 1 112 ? 109.793 4.568   -11.505 1.00 0.00 ? 112 LYS A CE   3  
ATOM 6462  N NZ   . LYS A 1 112 ? 110.499 4.030   -12.697 1.00 0.00 ? 112 LYS A NZ   3  
ATOM 6463  H H    . LYS A 1 112 ? 112.367 2.214   -8.097  1.00 0.00 ? 112 LYS A H    3  
ATOM 6464  H HA   . LYS A 1 112 ? 109.914 0.944   -8.052  1.00 0.00 ? 112 LYS A HA   3  
ATOM 6465  H HB2  . LYS A 1 112 ? 110.065 3.186   -8.843  1.00 0.00 ? 112 LYS A HB2  3  
ATOM 6466  H HB3  . LYS A 1 112 ? 111.211 2.746   -10.098 1.00 0.00 ? 112 LYS A HB3  3  
ATOM 6467  H HG2  . LYS A 1 112 ? 109.535 1.728   -11.416 1.00 0.00 ? 112 LYS A HG2  3  
ATOM 6468  H HG3  . LYS A 1 112 ? 108.375 1.742   -10.085 1.00 0.00 ? 112 LYS A HG3  3  
ATOM 6469  H HD2  . LYS A 1 112 ? 107.973 3.497   -11.830 1.00 0.00 ? 112 LYS A HD2  3  
ATOM 6470  H HD3  . LYS A 1 112 ? 108.161 4.124   -10.193 1.00 0.00 ? 112 LYS A HD3  3  
ATOM 6471  H HE2  . LYS A 1 112 ? 109.366 5.526   -11.761 1.00 0.00 ? 112 LYS A HE2  3  
ATOM 6472  H HE3  . LYS A 1 112 ? 110.507 4.700   -10.704 1.00 0.00 ? 112 LYS A HE3  3  
ATOM 6473  H HZ1  . LYS A 1 112 ? 111.205 4.718   -13.035 1.00 0.00 ? 112 LYS A HZ1  3  
ATOM 6474  H HZ2  . LYS A 1 112 ? 109.821 3.841   -13.462 1.00 0.00 ? 112 LYS A HZ2  3  
ATOM 6475  H HZ3  . LYS A 1 112 ? 110.986 3.143   -12.457 1.00 0.00 ? 112 LYS A HZ3  3  
ATOM 6476  N N    . TYR A 1 113 ? 111.870 -0.130  -10.494 1.00 0.00 ? 113 TYR A N    3  
ATOM 6477  C CA   . TYR A 1 113 ? 112.099 -1.239  -11.419 1.00 0.00 ? 113 TYR A CA   3  
ATOM 6478  C C    . TYR A 1 113 ? 112.277 -2.566  -10.669 1.00 0.00 ? 113 TYR A C    3  
ATOM 6479  O O    . TYR A 1 113 ? 111.483 -3.499  -10.831 1.00 0.00 ? 113 TYR A O    3  
ATOM 6480  C CB   . TYR A 1 113 ? 113.332 -0.960  -12.295 1.00 0.00 ? 113 TYR A CB   3  
ATOM 6481  C CG   . TYR A 1 113 ? 113.700 -2.114  -13.214 1.00 0.00 ? 113 TYR A CG   3  
ATOM 6482  C CD1  . TYR A 1 113 ? 113.046 -2.298  -14.428 1.00 0.00 ? 113 TYR A CD1  3  
ATOM 6483  C CD2  . TYR A 1 113 ? 114.691 -3.026  -12.859 1.00 0.00 ? 113 TYR A CD2  3  
ATOM 6484  C CE1  . TYR A 1 113 ? 113.369 -3.355  -15.258 1.00 0.00 ? 113 TYR A CE1  3  
ATOM 6485  C CE2  . TYR A 1 113 ? 115.020 -4.082  -13.685 1.00 0.00 ? 113 TYR A CE2  3  
ATOM 6486  C CZ   . TYR A 1 113 ? 114.356 -4.244  -14.883 1.00 0.00 ? 113 TYR A CZ   3  
ATOM 6487  O OH   . TYR A 1 113 ? 114.676 -5.301  -15.709 1.00 0.00 ? 113 TYR A OH   3  
ATOM 6488  H H    . TYR A 1 113 ? 112.532 0.594   -10.443 1.00 0.00 ? 113 TYR A H    3  
ATOM 6489  H HA   . TYR A 1 113 ? 111.230 -1.317  -12.058 1.00 0.00 ? 113 TYR A HA   3  
ATOM 6490  H HB2  . TYR A 1 113 ? 113.139 -0.093  -12.910 1.00 0.00 ? 113 TYR A HB2  3  
ATOM 6491  H HB3  . TYR A 1 113 ? 114.181 -0.757  -11.656 1.00 0.00 ? 113 TYR A HB3  3  
ATOM 6492  H HD1  . TYR A 1 113 ? 112.275 -1.601  -14.722 1.00 0.00 ? 113 TYR A HD1  3  
ATOM 6493  H HD2  . TYR A 1 113 ? 115.210 -2.898  -11.919 1.00 0.00 ? 113 TYR A HD2  3  
ATOM 6494  H HE1  . TYR A 1 113 ? 112.850 -3.480  -16.197 1.00 0.00 ? 113 TYR A HE1  3  
ATOM 6495  H HE2  . TYR A 1 113 ? 115.793 -4.777  -13.387 1.00 0.00 ? 113 TYR A HE2  3  
ATOM 6496  H HH   . TYR A 1 113 ? 114.731 -6.112  -15.186 1.00 0.00 ? 113 TYR A HH   3  
ATOM 6497  N N    . ASP A 1 114 ? 113.319 -2.638  -9.849  1.00 0.00 ? 114 ASP A N    3  
ATOM 6498  C CA   . ASP A 1 114 ? 113.705 -3.883  -9.180  1.00 0.00 ? 114 ASP A CA   3  
ATOM 6499  C C    . ASP A 1 114 ? 112.672 -4.313  -8.142  1.00 0.00 ? 114 ASP A C    3  
ATOM 6500  O O    . ASP A 1 114 ? 112.186 -5.444  -8.164  1.00 0.00 ? 114 ASP A O    3  
ATOM 6501  C CB   . ASP A 1 114 ? 115.079 -3.722  -8.515  1.00 0.00 ? 114 ASP A CB   3  
ATOM 6502  C CG   . ASP A 1 114 ? 115.516 -4.971  -7.756  1.00 0.00 ? 114 ASP A CG   3  
ATOM 6503  O OD1  . ASP A 1 114 ? 115.931 -5.949  -8.408  1.00 0.00 ? 114 ASP A OD1  3  
ATOM 6504  O OD2  . ASP A 1 114 ? 115.463 -4.978  -6.505  1.00 0.00 ? 114 ASP A OD2  3  
ATOM 6505  H H    . ASP A 1 114 ? 113.847 -1.828  -9.683  1.00 0.00 ? 114 ASP A H    3  
ATOM 6506  H HA   . ASP A 1 114 ? 113.775 -4.653  -9.937  1.00 0.00 ? 114 ASP A HA   3  
ATOM 6507  H HB2  . ASP A 1 114 ? 115.816 -3.513  -9.280  1.00 0.00 ? 114 ASP A HB2  3  
ATOM 6508  H HB3  . ASP A 1 114 ? 115.044 -2.892  -7.823  1.00 0.00 ? 114 ASP A HB3  3  
ATOM 6509  N N    . SER A 1 115 ? 112.327 -3.402  -7.247  1.00 0.00 ? 115 SER A N    3  
ATOM 6510  C CA   . SER A 1 115 ? 111.454 -3.720  -6.127  1.00 0.00 ? 115 SER A CA   3  
ATOM 6511  C C    . SER A 1 115 ? 110.038 -4.074  -6.585  1.00 0.00 ? 115 SER A C    3  
ATOM 6512  O O    . SER A 1 115 ? 109.340 -4.810  -5.895  1.00 0.00 ? 115 SER A O    3  
ATOM 6513  C CB   . SER A 1 115 ? 111.437 -2.564  -5.129  1.00 0.00 ? 115 SER A CB   3  
ATOM 6514  O OG   . SER A 1 115 ? 112.761 -2.249  -4.719  1.00 0.00 ? 115 SER A OG   3  
ATOM 6515  H H    . SER A 1 115 ? 112.665 -2.488  -7.342  1.00 0.00 ? 115 SER A H    3  
ATOM 6516  H HA   . SER A 1 115 ? 111.872 -4.587  -5.633  1.00 0.00 ? 115 SER A HA   3  
ATOM 6517  H HB2  . SER A 1 115 ? 110.998 -1.692  -5.593  1.00 0.00 ? 115 SER A HB2  3  
ATOM 6518  H HB3  . SER A 1 115 ? 110.859 -2.842  -4.260  1.00 0.00 ? 115 SER A HB3  3  
ATOM 6519  H HG   . SER A 1 115 ? 113.385 -2.791  -5.214  1.00 0.00 ? 115 SER A HG   3  
ATOM 6520  N N    . TYR A 1 116 ? 109.598 -3.565  -7.739  1.00 0.00 ? 116 TYR A N    3  
ATOM 6521  C CA   . TYR A 1 116 ? 108.317 -4.006  -8.293  1.00 0.00 ? 116 TYR A CA   3  
ATOM 6522  C C    . TYR A 1 116 ? 108.442 -5.430  -8.832  1.00 0.00 ? 116 TYR A C    3  
ATOM 6523  O O    . TYR A 1 116 ? 107.629 -6.295  -8.514  1.00 0.00 ? 116 TYR A O    3  
ATOM 6524  C CB   . TYR A 1 116 ? 107.803 -3.056  -9.387  1.00 0.00 ? 116 TYR A CB   3  
ATOM 6525  C CG   . TYR A 1 116 ? 107.177 -1.769  -8.862  1.00 0.00 ? 116 TYR A CG   3  
ATOM 6526  C CD1  . TYR A 1 116 ? 106.934 -1.580  -7.502  1.00 0.00 ? 116 TYR A CD1  3  
ATOM 6527  C CD2  . TYR A 1 116 ? 106.820 -0.746  -9.735  1.00 0.00 ? 116 TYR A CD2  3  
ATOM 6528  C CE1  . TYR A 1 116 ? 106.356 -0.414  -7.035  1.00 0.00 ? 116 TYR A CE1  3  
ATOM 6529  C CE2  . TYR A 1 116 ? 106.245 0.422   -9.273  1.00 0.00 ? 116 TYR A CE2  3  
ATOM 6530  C CZ   . TYR A 1 116 ? 106.014 0.583   -7.924  1.00 0.00 ? 116 TYR A CZ   3  
ATOM 6531  O OH   . TYR A 1 116 ? 105.440 1.748   -7.463  1.00 0.00 ? 116 TYR A OH   3  
ATOM 6532  H H    . TYR A 1 116 ? 110.128 -2.881  -8.213  1.00 0.00 ? 116 TYR A H    3  
ATOM 6533  H HA   . TYR A 1 116 ? 107.602 -4.017  -7.480  1.00 0.00 ? 116 TYR A HA   3  
ATOM 6534  H HB2  . TYR A 1 116 ? 108.627 -2.782  -10.029 1.00 0.00 ? 116 TYR A HB2  3  
ATOM 6535  H HB3  . TYR A 1 116 ? 107.055 -3.569  -9.977  1.00 0.00 ? 116 TYR A HB3  3  
ATOM 6536  H HD1  . TYR A 1 116 ? 107.202 -2.361  -6.805  1.00 0.00 ? 116 TYR A HD1  3  
ATOM 6537  H HD2  . TYR A 1 116 ? 106.999 -0.872  -10.794 1.00 0.00 ? 116 TYR A HD2  3  
ATOM 6538  H HE1  . TYR A 1 116 ? 106.177 -0.287  -5.977  1.00 0.00 ? 116 TYR A HE1  3  
ATOM 6539  H HE2  . TYR A 1 116 ? 105.976 1.204   -9.969  1.00 0.00 ? 116 TYR A HE2  3  
ATOM 6540  H HH   . TYR A 1 116 ? 104.742 2.020   -8.069  1.00 0.00 ? 116 TYR A HH   3  
ATOM 6541  N N    . SER A 1 117 ? 109.488 -5.686  -9.609  1.00 0.00 ? 117 SER A N    3  
ATOM 6542  C CA   . SER A 1 117 ? 109.690 -7.008  -10.201 1.00 0.00 ? 117 SER A CA   3  
ATOM 6543  C C    . SER A 1 117 ? 110.028 -8.050  -9.127  1.00 0.00 ? 117 SER A C    3  
ATOM 6544  O O    . SER A 1 117 ? 110.054 -9.251  -9.400  1.00 0.00 ? 117 SER A O    3  
ATOM 6545  C CB   . SER A 1 117 ? 110.793 -6.951  -11.266 1.00 0.00 ? 117 SER A CB   3  
ATOM 6546  O OG   . SER A 1 117 ? 111.972 -6.342  -10.759 1.00 0.00 ? 117 SER A OG   3  
ATOM 6547  H H    . SER A 1 117 ? 110.143 -4.978  -9.784  1.00 0.00 ? 117 SER A H    3  
ATOM 6548  H HA   . SER A 1 117 ? 108.760 -7.295  -10.676 1.00 0.00 ? 117 SER A HA   3  
ATOM 6549  H HB2  . SER A 1 117 ? 111.034 -7.953  -11.590 1.00 0.00 ? 117 SER A HB2  3  
ATOM 6550  H HB3  . SER A 1 117 ? 110.443 -6.376  -12.112 1.00 0.00 ? 117 SER A HB3  3  
ATOM 6551  H HG   . SER A 1 117 ? 111.947 -5.397  -10.941 1.00 0.00 ? 117 SER A HG   3  
ATOM 6552  N N    . ARG A 1 118 ? 110.292 -7.578  -7.911  1.00 0.00 ? 118 ARG A N    3  
ATOM 6553  C CA   . ARG A 1 118 ? 110.594 -8.455  -6.784  1.00 0.00 ? 118 ARG A CA   3  
ATOM 6554  C C    . ARG A 1 118 ? 109.420 -8.544  -5.812  1.00 0.00 ? 118 ARG A C    3  
ATOM 6555  O O    . ARG A 1 118 ? 108.855 -9.611  -5.625  1.00 0.00 ? 118 ARG A O    3  
ATOM 6556  C CB   . ARG A 1 118 ? 111.855 -7.978  -6.045  1.00 0.00 ? 118 ARG A CB   3  
ATOM 6557  C CG   . ARG A 1 118 ? 113.150 -8.564  -6.599  1.00 0.00 ? 118 ARG A CG   3  
ATOM 6558  C CD   . ARG A 1 118 ? 114.367 -8.105  -5.804  1.00 0.00 ? 118 ARG A CD   3  
ATOM 6559  N NE   . ARG A 1 118 ? 115.504 -9.020  -5.958  1.00 0.00 ? 118 ARG A NE   3  
ATOM 6560  C CZ   . ARG A 1 118 ? 116.776 -8.626  -6.061  1.00 0.00 ? 118 ARG A CZ   3  
ATOM 6561  N NH1  . ARG A 1 118 ? 117.064 -7.336  -6.199  1.00 0.00 ? 118 ARG A NH1  3  
ATOM 6562  N NH2  . ARG A 1 118 ? 117.753 -9.527  -6.063  1.00 0.00 ? 118 ARG A NH2  3  
ATOM 6563  H H    . ARG A 1 118 ? 110.290 -6.614  -7.772  1.00 0.00 ? 118 ARG A H    3  
ATOM 6564  H HA   . ARG A 1 118 ? 110.781 -9.444  -7.180  1.00 0.00 ? 118 ARG A HA   3  
ATOM 6565  H HB2  . ARG A 1 118 ? 111.914 -6.901  -6.113  1.00 0.00 ? 118 ARG A HB2  3  
ATOM 6566  H HB3  . ARG A 1 118 ? 111.779 -8.257  -5.003  1.00 0.00 ? 118 ARG A HB3  3  
ATOM 6567  H HG2  . ARG A 1 118 ? 113.090 -9.641  -6.555  1.00 0.00 ? 118 ARG A HG2  3  
ATOM 6568  H HG3  . ARG A 1 118 ? 113.263 -8.252  -7.628  1.00 0.00 ? 118 ARG A HG3  3  
ATOM 6569  H HD2  . ARG A 1 118 ? 114.656 -7.121  -6.147  1.00 0.00 ? 118 ARG A HD2  3  
ATOM 6570  H HD3  . ARG A 1 118 ? 114.101 -8.054  -4.757  1.00 0.00 ? 118 ARG A HD3  3  
ATOM 6571  H HE   . ARG A 1 118 ? 115.306 -9.984  -5.938  1.00 0.00 ? 118 ARG A HE   3  
ATOM 6572  H HH11 . ARG A 1 118 ? 116.323 -6.652  -6.232  1.00 0.00 ? 118 ARG A HH11 3  
ATOM 6573  H HH12 . ARG A 1 118 ? 118.017 -7.035  -6.284  1.00 0.00 ? 118 ARG A HH12 3  
ATOM 6574  H HH21 . ARG A 1 118 ? 117.539 -10.502 -5.990  1.00 0.00 ? 118 ARG A HH21 3  
ATOM 6575  H HH22 . ARG A 1 118 ? 118.712 -9.237  -6.129  1.00 0.00 ? 118 ARG A HH22 3  
ATOM 6576  N N    . PHE A 1 119 ? 109.047 -7.421  -5.209  1.00 0.00 ? 119 PHE A N    3  
ATOM 6577  C CA   . PHE A 1 119 ? 108.046 -7.413  -4.136  1.00 0.00 ? 119 PHE A CA   3  
ATOM 6578  C C    . PHE A 1 119 ? 106.648 -7.769  -4.663  1.00 0.00 ? 119 PHE A C    3  
ATOM 6579  O O    . PHE A 1 119 ? 105.735 -8.029  -3.886  1.00 0.00 ? 119 PHE A O    3  
ATOM 6580  C CB   . PHE A 1 119 ? 108.032 -6.044  -3.432  1.00 0.00 ? 119 PHE A CB   3  
ATOM 6581  C CG   . PHE A 1 119 ? 107.308 -6.040  -2.104  1.00 0.00 ? 119 PHE A CG   3  
ATOM 6582  C CD1  . PHE A 1 119 ? 107.945 -6.485  -0.950  1.00 0.00 ? 119 PHE A CD1  3  
ATOM 6583  C CD2  . PHE A 1 119 ? 105.998 -5.590  -2.007  1.00 0.00 ? 119 PHE A CD2  3  
ATOM 6584  C CE1  . PHE A 1 119 ? 107.289 -6.480  0.267   1.00 0.00 ? 119 PHE A CE1  3  
ATOM 6585  C CE2  . PHE A 1 119 ? 105.340 -5.584  -0.791  1.00 0.00 ? 119 PHE A CE2  3  
ATOM 6586  C CZ   . PHE A 1 119 ? 105.986 -6.029  0.346   1.00 0.00 ? 119 PHE A CZ   3  
ATOM 6587  H H    . PHE A 1 119 ? 109.450 -6.576  -5.487  1.00 0.00 ? 119 PHE A H    3  
ATOM 6588  H HA   . PHE A 1 119 ? 108.340 -8.167  -3.418  1.00 0.00 ? 119 PHE A HA   3  
ATOM 6589  H HB2  . PHE A 1 119 ? 109.052 -5.732  -3.252  1.00 0.00 ? 119 PHE A HB2  3  
ATOM 6590  H HB3  . PHE A 1 119 ? 107.554 -5.320  -4.077  1.00 0.00 ? 119 PHE A HB3  3  
ATOM 6591  H HD1  . PHE A 1 119 ? 108.967 -6.837  -1.009  1.00 0.00 ? 119 PHE A HD1  3  
ATOM 6592  H HD2  . PHE A 1 119 ? 105.489 -5.242  -2.895  1.00 0.00 ? 119 PHE A HD2  3  
ATOM 6593  H HE1  . PHE A 1 119 ? 107.796 -6.829  1.156   1.00 0.00 ? 119 PHE A HE1  3  
ATOM 6594  H HE2  . PHE A 1 119 ? 104.320 -5.232  -0.731  1.00 0.00 ? 119 PHE A HE2  3  
ATOM 6595  H HZ   . PHE A 1 119 ? 105.473 -6.025  1.297   1.00 0.00 ? 119 PHE A HZ   3  
ATOM 6596  N N    . LEU A 1 120 ? 106.477 -7.770  -5.984  1.00 0.00 ? 120 LEU A N    3  
ATOM 6597  C CA   . LEU A 1 120 ? 105.209 -8.187  -6.593  1.00 0.00 ? 120 LEU A CA   3  
ATOM 6598  C C    . LEU A 1 120 ? 105.277 -9.652  -7.023  1.00 0.00 ? 120 LEU A C    3  
ATOM 6599  O O    . LEU A 1 120 ? 104.288 -10.225 -7.486  1.00 0.00 ? 120 LEU A O    3  
ATOM 6600  C CB   . LEU A 1 120 ? 104.876 -7.304  -7.805  1.00 0.00 ? 120 LEU A CB   3  
ATOM 6601  C CG   . LEU A 1 120 ? 104.776 -5.797  -7.518  1.00 0.00 ? 120 LEU A CG   3  
ATOM 6602  C CD1  . LEU A 1 120 ? 104.501 -5.022  -8.805  1.00 0.00 ? 120 LEU A CD1  3  
ATOM 6603  C CD2  . LEU A 1 120 ? 103.704 -5.512  -6.469  1.00 0.00 ? 120 LEU A CD2  3  
ATOM 6604  H H    . LEU A 1 120 ? 107.212 -7.477  -6.564  1.00 0.00 ? 120 LEU A H    3  
ATOM 6605  H HA   . LEU A 1 120 ? 104.428 -8.077  -5.852  1.00 0.00 ? 120 LEU A HA   3  
ATOM 6606  H HB2  . LEU A 1 120 ? 105.643 -7.455  -8.553  1.00 0.00 ? 120 LEU A HB2  3  
ATOM 6607  H HB3  . LEU A 1 120 ? 103.930 -7.632  -8.215  1.00 0.00 ? 120 LEU A HB3  3  
ATOM 6608  H HG   . LEU A 1 120 ? 105.724 -5.453  -7.126  1.00 0.00 ? 120 LEU A HG   3  
ATOM 6609  H HD11 . LEU A 1 120 ? 103.564 -5.349  -9.233  1.00 0.00 ? 120 LEU A HD11 3  
ATOM 6610  H HD12 . LEU A 1 120 ? 105.301 -5.202  -9.510  1.00 0.00 ? 120 LEU A HD12 3  
ATOM 6611  H HD13 . LEU A 1 120 ? 104.448 -3.965  -8.586  1.00 0.00 ? 120 LEU A HD13 3  
ATOM 6612  H HD21 . LEU A 1 120 ? 102.746 -5.866  -6.823  1.00 0.00 ? 120 LEU A HD21 3  
ATOM 6613  H HD22 . LEU A 1 120 ? 103.650 -4.448  -6.288  1.00 0.00 ? 120 LEU A HD22 3  
ATOM 6614  H HD23 . LEU A 1 120 ? 103.957 -6.018  -5.549  1.00 0.00 ? 120 LEU A HD23 3  
ATOM 6615  N N    . LYS A 1 121 ? 106.450 -10.256 -6.857  1.00 0.00 ? 121 LYS A N    3  
ATOM 6616  C CA   . LYS A 1 121 ? 106.698 -11.624 -7.301  1.00 0.00 ? 121 LYS A CA   3  
ATOM 6617  C C    . LYS A 1 121 ? 107.289 -12.460 -6.169  1.00 0.00 ? 121 LYS A C    3  
ATOM 6618  O O    . LYS A 1 121 ? 108.219 -12.032 -5.489  1.00 0.00 ? 121 LYS A O    3  
ATOM 6619  C CB   . LYS A 1 121 ? 107.640 -11.623 -8.512  1.00 0.00 ? 121 LYS A CB   3  
ATOM 6620  C CG   . LYS A 1 121 ? 107.023 -11.005 -9.764  1.00 0.00 ? 121 LYS A CG   3  
ATOM 6621  C CD   . LYS A 1 121 ? 107.915 -11.191 -10.987 1.00 0.00 ? 121 LYS A CD   3  
ATOM 6622  C CE   . LYS A 1 121 ? 108.170 -12.667 -11.276 1.00 0.00 ? 121 LYS A CE   3  
ATOM 6623  N NZ   . LYS A 1 121 ? 109.018 -12.858 -12.482 1.00 0.00 ? 121 LYS A NZ   3  
ATOM 6624  H H    . LYS A 1 121 ? 107.171 -9.771  -6.403  1.00 0.00 ? 121 LYS A H    3  
ATOM 6625  H HA   . LYS A 1 121 ? 105.751 -12.057 -7.594  1.00 0.00 ? 121 LYS A HA   3  
ATOM 6626  H HB2  . LYS A 1 121 ? 108.531 -11.058 -8.260  1.00 0.00 ? 121 LYS A HB2  3  
ATOM 6627  H HB3  . LYS A 1 121 ? 107.921 -12.642 -8.737  1.00 0.00 ? 121 LYS A HB3  3  
ATOM 6628  H HG2  . LYS A 1 121 ? 106.068 -11.476 -9.954  1.00 0.00 ? 121 LYS A HG2  3  
ATOM 6629  H HG3  . LYS A 1 121 ? 106.874 -9.947  -9.596  1.00 0.00 ? 121 LYS A HG3  3  
ATOM 6630  H HD2  . LYS A 1 121 ? 107.432 -10.746 -11.845 1.00 0.00 ? 121 LYS A HD2  3  
ATOM 6631  H HD3  . LYS A 1 121 ? 108.861 -10.698 -10.810 1.00 0.00 ? 121 LYS A HD3  3  
ATOM 6632  H HE2  . LYS A 1 121 ? 108.666 -13.110 -10.422 1.00 0.00 ? 121 LYS A HE2  3  
ATOM 6633  H HE3  . LYS A 1 121 ? 107.221 -13.160 -11.431 1.00 0.00 ? 121 LYS A HE3  3  
ATOM 6634  H HZ1  . LYS A 1 121 ? 109.226 -13.869 -12.617 1.00 0.00 ? 121 LYS A HZ1  3  
ATOM 6635  H HZ2  . LYS A 1 121 ? 109.915 -12.341 -12.380 1.00 0.00 ? 121 LYS A HZ2  3  
ATOM 6636  H HZ3  . LYS A 1 121 ? 108.523 -12.503 -13.326 1.00 0.00 ? 121 LYS A HZ3  3  
ATOM 6637  N N    . SER A 1 122 ? 106.746 -13.661 -5.985  1.00 0.00 ? 122 SER A N    3  
ATOM 6638  C CA   . SER A 1 122 ? 107.145 -14.538 -4.882  1.00 0.00 ? 122 SER A CA   3  
ATOM 6639  C C    . SER A 1 122 ? 106.912 -13.849 -3.529  1.00 0.00 ? 122 SER A C    3  
ATOM 6640  O O    . SER A 1 122 ? 107.499 -14.229 -2.513  1.00 0.00 ? 122 SER A O    3  
ATOM 6641  C CB   . SER A 1 122 ? 108.619 -14.951 -5.041  1.00 0.00 ? 122 SER A CB   3  
ATOM 6642  O OG   . SER A 1 122 ? 109.008 -15.883 -4.047  1.00 0.00 ? 122 SER A OG   3  
ATOM 6643  H H    . SER A 1 122 ? 106.072 -13.978 -6.624  1.00 0.00 ? 122 SER A H    3  
ATOM 6644  H HA   . SER A 1 122 ? 106.526 -15.423 -4.927  1.00 0.00 ? 122 SER A HA   3  
ATOM 6645  H HB2  . SER A 1 122 ? 108.760 -15.405 -6.011  1.00 0.00 ? 122 SER A HB2  3  
ATOM 6646  H HB3  . SER A 1 122 ? 109.247 -14.075 -4.961  1.00 0.00 ? 122 SER A HB3  3  
ATOM 6647  H HG   . SER A 1 122 ? 108.963 -15.457 -3.181  1.00 0.00 ? 122 SER A HG   3  
ATOM 6648  N N    . ASP A 1 123 ? 106.030 -12.850 -3.527  1.00 0.00 ? 123 ASP A N    3  
ATOM 6649  C CA   . ASP A 1 123 ? 105.740 -12.064 -2.327  1.00 0.00 ? 123 ASP A CA   3  
ATOM 6650  C C    . ASP A 1 123 ? 104.871 -12.848 -1.343  1.00 0.00 ? 123 ASP A C    3  
ATOM 6651  O O    . ASP A 1 123 ? 104.319 -13.901 -1.680  1.00 0.00 ? 123 ASP A O    3  
ATOM 6652  C CB   . ASP A 1 123 ? 105.055 -10.741 -2.711  1.00 0.00 ? 123 ASP A CB   3  
ATOM 6653  C CG   . ASP A 1 123 ? 104.651 -9.913  -1.496  1.00 0.00 ? 123 ASP A CG   3  
ATOM 6654  O OD1  . ASP A 1 123 ? 105.551 -9.434  -0.771  1.00 0.00 ? 123 ASP A OD1  3  
ATOM 6655  O OD2  . ASP A 1 123 ? 103.434 -9.783  -1.227  1.00 0.00 ? 123 ASP A OD2  3  
ATOM 6656  H H    . ASP A 1 123 ? 105.561 -12.635 -4.358  1.00 0.00 ? 123 ASP A H    3  
ATOM 6657  H HA   . ASP A 1 123 ? 106.683 -11.839 -1.848  1.00 0.00 ? 123 ASP A HA   3  
ATOM 6658  H HB2  . ASP A 1 123 ? 105.736 -10.154 -3.312  1.00 0.00 ? 123 ASP A HB2  3  
ATOM 6659  H HB3  . ASP A 1 123 ? 104.170 -10.957 -3.292  1.00 0.00 ? 123 ASP A HB3  3  
ATOM 6660  N N    . LEU A 1 124 ? 104.739 -12.305 -0.135  1.00 0.00 ? 124 LEU A N    3  
ATOM 6661  C CA   . LEU A 1 124 ? 103.998 -12.928 0.958   1.00 0.00 ? 124 LEU A CA   3  
ATOM 6662  C C    . LEU A 1 124 ? 102.475 -12.814 0.755   1.00 0.00 ? 124 LEU A C    3  
ATOM 6663  O O    . LEU A 1 124 ? 101.726 -12.628 1.716   1.00 0.00 ? 124 LEU A O    3  
ATOM 6664  C CB   . LEU A 1 124 ? 104.401 -12.270 2.297   1.00 0.00 ? 124 LEU A CB   3  
ATOM 6665  C CG   . LEU A 1 124 ? 105.865 -12.476 2.758   1.00 0.00 ? 124 LEU A CG   3  
ATOM 6666  C CD1  . LEU A 1 124 ? 106.862 -11.883 1.763   1.00 0.00 ? 124 LEU A CD1  3  
ATOM 6667  C CD2  . LEU A 1 124 ? 106.080 -11.866 4.143   1.00 0.00 ? 124 LEU A CD2  3  
ATOM 6668  H H    . LEU A 1 124 ? 105.162 -11.434 0.029   1.00 0.00 ? 124 LEU A H    3  
ATOM 6669  H HA   . LEU A 1 124 ? 104.265 -13.975 0.989   1.00 0.00 ? 124 LEU A HA   3  
ATOM 6670  H HB2  . LEU A 1 124 ? 104.224 -11.207 2.212   1.00 0.00 ? 124 LEU A HB2  3  
ATOM 6671  H HB3  . LEU A 1 124 ? 103.751 -12.659 3.069   1.00 0.00 ? 124 LEU A HB3  3  
ATOM 6672  H HG   . LEU A 1 124 ? 106.063 -13.536 2.830   1.00 0.00 ? 124 LEU A HG   3  
ATOM 6673  H HD11 . LEU A 1 124 ? 106.752 -12.374 0.806   1.00 0.00 ? 124 LEU A HD11 3  
ATOM 6674  H HD12 . LEU A 1 124 ? 107.869 -12.032 2.127   1.00 0.00 ? 124 LEU A HD12 3  
ATOM 6675  H HD13 . LEU A 1 124 ? 106.674 -10.825 1.648   1.00 0.00 ? 124 LEU A HD13 3  
ATOM 6676  H HD21 . LEU A 1 124 ? 105.883 -10.803 4.106   1.00 0.00 ? 124 LEU A HD21 3  
ATOM 6677  H HD22 . LEU A 1 124 ? 107.101 -12.031 4.455   1.00 0.00 ? 124 LEU A HD22 3  
ATOM 6678  H HD23 . LEU A 1 124 ? 105.410 -12.331 4.850   1.00 0.00 ? 124 LEU A HD23 3  
ATOM 6679  N N    . PHE A 1 125 ? 102.020 -12.937 -0.493  1.00 0.00 ? 125 PHE A N    3  
ATOM 6680  C CA   . PHE A 1 125 ? 100.587 -12.976 -0.793  1.00 0.00 ? 125 PHE A CA   3  
ATOM 6681  C C    . PHE A 1 125 ? 99.992  -14.315 -0.354  1.00 0.00 ? 125 PHE A C    3  
ATOM 6682  O O    . PHE A 1 125 ? 98.773  -14.464 -0.244  1.00 0.00 ? 125 PHE A O    3  
ATOM 6683  C CB   . PHE A 1 125 ? 100.331 -12.775 -2.297  1.00 0.00 ? 125 PHE A CB   3  
ATOM 6684  C CG   . PHE A 1 125 ? 100.712 -11.412 -2.825  1.00 0.00 ? 125 PHE A CG   3  
ATOM 6685  C CD1  . PHE A 1 125 ? 100.116 -10.268 -2.319  1.00 0.00 ? 125 PHE A CD1  3  
ATOM 6686  C CD2  . PHE A 1 125 ? 101.658 -11.277 -3.832  1.00 0.00 ? 125 PHE A CD2  3  
ATOM 6687  C CE1  . PHE A 1 125 ? 100.455 -9.020  -2.805  1.00 0.00 ? 125 PHE A CE1  3  
ATOM 6688  C CE2  . PHE A 1 125 ? 101.998 -10.029 -4.322  1.00 0.00 ? 125 PHE A CE2  3  
ATOM 6689  C CZ   . PHE A 1 125 ? 101.396 -8.900  -3.806  1.00 0.00 ? 125 PHE A CZ   3  
ATOM 6690  H H    . PHE A 1 125 ? 102.659 -12.998 -1.229  1.00 0.00 ? 125 PHE A H    3  
ATOM 6691  H HA   . PHE A 1 125 ? 100.106 -12.180 -0.241  1.00 0.00 ? 125 PHE A HA   3  
ATOM 6692  H HB2  . PHE A 1 125 ? 100.894 -13.512 -2.849  1.00 0.00 ? 125 PHE A HB2  3  
ATOM 6693  H HB3  . PHE A 1 125 ? 99.277  -12.920 -2.495  1.00 0.00 ? 125 PHE A HB3  3  
ATOM 6694  H HD1  . PHE A 1 125 ? 99.379  -10.355 -1.534  1.00 0.00 ? 125 PHE A HD1  3  
ATOM 6695  H HD2  . PHE A 1 125 ? 102.130 -12.160 -4.238  1.00 0.00 ? 125 PHE A HD2  3  
ATOM 6696  H HE1  . PHE A 1 125 ? 99.984  -8.136  -2.401  1.00 0.00 ? 125 PHE A HE1  3  
ATOM 6697  H HE2  . PHE A 1 125 ? 102.736 -9.938  -5.106  1.00 0.00 ? 125 PHE A HE2  3  
ATOM 6698  H HZ   . PHE A 1 125 ? 101.658 -7.923  -4.185  1.00 0.00 ? 125 PHE A HZ   3  
ATOM 6699  N N    . LEU A 1 126 ? 100.869 -15.283 -0.095  1.00 0.00 ? 126 LEU A N    3  
ATOM 6700  C CA   . LEU A 1 126 ? 100.460 -16.634 0.257   1.00 0.00 ? 126 LEU A CA   3  
ATOM 6701  C C    . LEU A 1 126 ? 100.514 -16.805 1.768   1.00 0.00 ? 126 LEU A C    3  
ATOM 6702  O O    . LEU A 1 126 ? 101.429 -16.298 2.425   1.00 0.00 ? 126 LEU A O    3  
ATOM 6703  C CB   . LEU A 1 126 ? 101.366 -17.679 -0.423  1.00 0.00 ? 126 LEU A CB   3  
ATOM 6704  C CG   . LEU A 1 126 ? 101.405 -17.654 -1.966  1.00 0.00 ? 126 LEU A CG   3  
ATOM 6705  C CD1  . LEU A 1 126 ? 99.995  -17.635 -2.552  1.00 0.00 ? 126 LEU A CD1  3  
ATOM 6706  C CD2  . LEU A 1 126 ? 102.232 -16.474 -2.478  1.00 0.00 ? 126 LEU A CD2  3  
ATOM 6707  H H    . LEU A 1 126 ? 101.820 -15.072 -0.109  1.00 0.00 ? 126 LEU A H    3  
ATOM 6708  H HA   . LEU A 1 126 ? 99.441  -16.777 -0.077  1.00 0.00 ? 126 LEU A HA   3  
ATOM 6709  H HB2  . LEU A 1 126 ? 102.373 -17.534 -0.061  1.00 0.00 ? 126 LEU A HB2  3  
ATOM 6710  H HB3  . LEU A 1 126 ? 101.035 -18.661 -0.114  1.00 0.00 ? 126 LEU A HB3  3  
ATOM 6711  H HG   . LEU A 1 126 ? 101.883 -18.561 -2.311  1.00 0.00 ? 126 LEU A HG   3  
ATOM 6712  H HD11 . LEU A 1 126 ? 99.449  -18.501 -2.207  1.00 0.00 ? 126 LEU A HD11 3  
ATOM 6713  H HD12 . LEU A 1 126 ? 100.053 -17.656 -3.631  1.00 0.00 ? 126 LEU A HD12 3  
ATOM 6714  H HD13 . LEU A 1 126 ? 99.482  -16.737 -2.238  1.00 0.00 ? 126 LEU A HD13 3  
ATOM 6715  H HD21 . LEU A 1 126 ? 103.242 -16.552 -2.102  1.00 0.00 ? 126 LEU A HD21 3  
ATOM 6716  H HD22 . LEU A 1 126 ? 101.792 -15.547 -2.139  1.00 0.00 ? 126 LEU A HD22 3  
ATOM 6717  H HD23 . LEU A 1 126 ? 102.250 -16.488 -3.559  1.00 0.00 ? 126 LEU A HD23 3  
ATOM 6718  N N    . LYS A 1 127 ? 99.559  -17.548 2.308   1.00 0.00 ? 127 LYS A N    3  
ATOM 6719  C CA   . LYS A 1 127 ? 99.424  -17.704 3.747   1.00 0.00 ? 127 LYS A CA   3  
ATOM 6720  C C    . LYS A 1 127 ? 100.493 -18.664 4.258   1.00 0.00 ? 127 LYS A C    3  
ATOM 6721  O O    . LYS A 1 127 ? 100.793 -18.713 5.452   1.00 0.00 ? 127 LYS A O    3  
ATOM 6722  C CB   . LYS A 1 127 ? 98.020  -18.233 4.087   1.00 0.00 ? 127 LYS A CB   3  
ATOM 6723  C CG   . LYS A 1 127 ? 97.665  -18.189 5.573   1.00 0.00 ? 127 LYS A CG   3  
ATOM 6724  C CD   . LYS A 1 127 ? 96.345  -18.908 5.857   1.00 0.00 ? 127 LYS A CD   3  
ATOM 6725  C CE   . LYS A 1 127 ? 95.870  -18.698 7.292   1.00 0.00 ? 127 LYS A CE   3  
ATOM 6726  N NZ   . LYS A 1 127 ? 95.435  -17.295 7.538   1.00 0.00 ? 127 LYS A NZ   3  
ATOM 6727  H H    . LYS A 1 127 ? 98.942  -18.029 1.721   1.00 0.00 ? 127 LYS A H    3  
ATOM 6728  H HA   . LYS A 1 127 ? 99.568  -16.734 4.201   1.00 0.00 ? 127 LYS A HA   3  
ATOM 6729  H HB2  . LYS A 1 127 ? 97.289  -17.641 3.552   1.00 0.00 ? 127 LYS A HB2  3  
ATOM 6730  H HB3  . LYS A 1 127 ? 97.946  -19.259 3.752   1.00 0.00 ? 127 LYS A HB3  3  
ATOM 6731  H HG2  . LYS A 1 127 ? 98.453  -18.670 6.136   1.00 0.00 ? 127 LYS A HG2  3  
ATOM 6732  H HG3  . LYS A 1 127 ? 97.578  -17.157 5.883   1.00 0.00 ? 127 LYS A HG3  3  
ATOM 6733  H HD2  . LYS A 1 127 ? 95.589  -18.529 5.183   1.00 0.00 ? 127 LYS A HD2  3  
ATOM 6734  H HD3  . LYS A 1 127 ? 96.481  -19.967 5.684   1.00 0.00 ? 127 LYS A HD3  3  
ATOM 6735  H HE2  . LYS A 1 127 ? 95.038  -19.360 7.483   1.00 0.00 ? 127 LYS A HE2  3  
ATOM 6736  H HE3  . LYS A 1 127 ? 96.680  -18.938 7.967   1.00 0.00 ? 127 LYS A HE3  3  
ATOM 6737  H HZ1  . LYS A 1 127 ? 94.613  -17.064 6.945   1.00 0.00 ? 127 LYS A HZ1  3  
ATOM 6738  H HZ2  . LYS A 1 127 ? 96.205  -16.632 7.315   1.00 0.00 ? 127 LYS A HZ2  3  
ATOM 6739  H HZ3  . LYS A 1 127 ? 95.173  -17.169 8.538   1.00 0.00 ? 127 LYS A HZ3  3  
ATOM 6740  N N    . HIS A 1 128 ? 101.058 -19.438 3.335   1.00 0.00 ? 128 HIS A N    3  
ATOM 6741  C CA   . HIS A 1 128 ? 102.117 -20.378 3.666   1.00 0.00 ? 128 HIS A CA   3  
ATOM 6742  C C    . HIS A 1 128 ? 103.491 -19.781 3.360   1.00 0.00 ? 128 HIS A C    3  
ATOM 6743  O O    . HIS A 1 128 ? 104.501 -20.224 3.907   1.00 0.00 ? 128 HIS A O    3  
ATOM 6744  C CB   . HIS A 1 128 ? 101.919 -21.707 2.922   1.00 0.00 ? 128 HIS A CB   3  
ATOM 6745  C CG   . HIS A 1 128 ? 100.705 -22.467 3.376   1.00 0.00 ? 128 HIS A CG   3  
ATOM 6746  N ND1  . HIS A 1 128 ? 100.727 -23.358 4.424   1.00 0.00 ? 128 HIS A ND1  3  
ATOM 6747  C CD2  . HIS A 1 128 ? 99.427  -22.456 2.927   1.00 0.00 ? 128 HIS A CD2  3  
ATOM 6748  C CE1  . HIS A 1 128 ? 99.521  -23.859 4.601   1.00 0.00 ? 128 HIS A CE1  3  
ATOM 6749  N NE2  . HIS A 1 128 ? 98.712  -23.328 3.707   1.00 0.00 ? 128 HIS A NE2  3  
ATOM 6750  H H    . HIS A 1 128 ? 100.745 -19.377 2.408   1.00 0.00 ? 128 HIS A H    3  
ATOM 6751  H HA   . HIS A 1 128 ? 102.057 -20.565 4.726   1.00 0.00 ? 128 HIS A HA   3  
ATOM 6752  H HB2  . HIS A 1 128 ? 101.814 -21.512 1.865   1.00 0.00 ? 128 HIS A HB2  3  
ATOM 6753  H HB3  . HIS A 1 128 ? 102.783 -22.337 3.083   1.00 0.00 ? 128 HIS A HB3  3  
ATOM 6754  H HD1  . HIS A 1 128 ? 101.513 -23.582 4.971   1.00 0.00 ? 128 HIS A HD1  3  
ATOM 6755  H HD2  . HIS A 1 128 ? 99.041  -21.868 2.107   1.00 0.00 ? 128 HIS A HD2  3  
ATOM 6756  H HE1  . HIS A 1 128 ? 99.244  -24.585 5.351   1.00 0.00 ? 128 HIS A HE1  3  
ATOM 6757  H HE2  . HIS A 1 128 ? 97.729  -23.366 3.753   1.00 0.00 ? 128 HIS A HE2  3  
ATOM 6758  N N    . LYS A 1 129 ? 103.523 -18.768 2.489   1.00 0.00 ? 129 LYS A N    3  
ATOM 6759  C CA   . LYS A 1 129 ? 104.764 -18.047 2.193   1.00 0.00 ? 129 LYS A CA   3  
ATOM 6760  C C    . LYS A 1 129 ? 105.235 -17.324 3.450   1.00 0.00 ? 129 LYS A C    3  
ATOM 6761  O O    . LYS A 1 129 ? 106.431 -17.243 3.733   1.00 0.00 ? 129 LYS A O    3  
ATOM 6762  C CB   . LYS A 1 129 ? 104.552 -17.048 1.042   1.00 0.00 ? 129 LYS A CB   3  
ATOM 6763  C CG   . LYS A 1 129 ? 105.791 -16.230 0.673   1.00 0.00 ? 129 LYS A CG   3  
ATOM 6764  C CD   . LYS A 1 129 ? 106.952 -17.111 0.214   1.00 0.00 ? 129 LYS A CD   3  
ATOM 6765  C CE   . LYS A 1 129 ? 108.165 -16.277 -0.190  1.00 0.00 ? 129 LYS A CE   3  
ATOM 6766  N NZ   . LYS A 1 129 ? 109.325 -17.122 -0.579  1.00 0.00 ? 129 LYS A NZ   3  
ATOM 6767  H H    . LYS A 1 129 ? 102.695 -18.496 2.045   1.00 0.00 ? 129 LYS A H    3  
ATOM 6768  H HA   . LYS A 1 129 ? 105.512 -18.773 1.903   1.00 0.00 ? 129 LYS A HA   3  
ATOM 6769  H HB2  . LYS A 1 129 ? 104.237 -17.594 0.164   1.00 0.00 ? 129 LYS A HB2  3  
ATOM 6770  H HB3  . LYS A 1 129 ? 103.765 -16.360 1.322   1.00 0.00 ? 129 LYS A HB3  3  
ATOM 6771  H HG2  . LYS A 1 129 ? 105.533 -15.550 -0.126  1.00 0.00 ? 129 LYS A HG2  3  
ATOM 6772  H HG3  . LYS A 1 129 ? 106.103 -15.662 1.540   1.00 0.00 ? 129 LYS A HG3  3  
ATOM 6773  H HD2  . LYS A 1 129 ? 107.236 -17.769 1.023   1.00 0.00 ? 129 LYS A HD2  3  
ATOM 6774  H HD3  . LYS A 1 129 ? 106.633 -17.700 -0.635  1.00 0.00 ? 129 LYS A HD3  3  
ATOM 6775  H HE2  . LYS A 1 129 ? 107.894 -15.652 -1.028  1.00 0.00 ? 129 LYS A HE2  3  
ATOM 6776  H HE3  . LYS A 1 129 ? 108.451 -15.652 0.644   1.00 0.00 ? 129 LYS A HE3  3  
ATOM 6777  H HZ1  . LYS A 1 129 ? 109.053 -17.781 -1.335  1.00 0.00 ? 129 LYS A HZ1  3  
ATOM 6778  H HZ2  . LYS A 1 129 ? 109.661 -17.670 0.240   1.00 0.00 ? 129 LYS A HZ2  3  
ATOM 6779  H HZ3  . LYS A 1 129 ? 110.104 -16.523 -0.922  1.00 0.00 ? 129 LYS A HZ3  3  
ATOM 6780  N N    . ARG A 1 130 ? 104.271 -16.793 4.193   1.00 0.00 ? 130 ARG A N    3  
ATOM 6781  C CA   . ARG A 1 130 ? 104.516 -16.243 5.519   1.00 0.00 ? 130 ARG A CA   3  
ATOM 6782  C C    . ARG A 1 130 ? 103.641 -17.006 6.502   1.00 0.00 ? 130 ARG A C    3  
ATOM 6783  O O    . ARG A 1 130 ? 102.447 -16.730 6.614   1.00 0.00 ? 130 ARG A O    3  
ATOM 6784  C CB   . ARG A 1 130 ? 104.196 -14.733 5.555   1.00 0.00 ? 130 ARG A CB   3  
ATOM 6785  C CG   . ARG A 1 130 ? 104.779 -13.969 6.757   1.00 0.00 ? 130 ARG A CG   3  
ATOM 6786  C CD   . ARG A 1 130 ? 104.118 -14.331 8.087   1.00 0.00 ? 130 ARG A CD   3  
ATOM 6787  N NE   . ARG A 1 130 ? 104.589 -13.478 9.184   1.00 0.00 ? 130 ARG A NE   3  
ATOM 6788  C CZ   . ARG A 1 130 ? 104.383 -13.730 10.482  1.00 0.00 ? 130 ARG A CZ   3  
ATOM 6789  N NH1  . ARG A 1 130 ? 103.783 -14.851 10.868  1.00 0.00 ? 130 ARG A NH1  3  
ATOM 6790  N NH2  . ARG A 1 130 ? 104.791 -12.865 11.400  1.00 0.00 ? 130 ARG A NH2  3  
ATOM 6791  H H    . ARG A 1 130 ? 103.356 -16.775 3.838   1.00 0.00 ? 130 ARG A H    3  
ATOM 6792  H HA   . ARG A 1 130 ? 105.558 -16.399 5.771   1.00 0.00 ? 130 ARG A HA   3  
ATOM 6793  H HB2  . ARG A 1 130 ? 104.586 -14.279 4.655   1.00 0.00 ? 130 ARG A HB2  3  
ATOM 6794  H HB3  . ARG A 1 130 ? 103.122 -14.607 5.566   1.00 0.00 ? 130 ARG A HB3  3  
ATOM 6795  H HG2  . ARG A 1 130 ? 105.834 -14.191 6.827   1.00 0.00 ? 130 ARG A HG2  3  
ATOM 6796  H HG3  . ARG A 1 130 ? 104.652 -12.909 6.583   1.00 0.00 ? 130 ARG A HG3  3  
ATOM 6797  H HD2  . ARG A 1 130 ? 103.048 -14.214 7.989   1.00 0.00 ? 130 ARG A HD2  3  
ATOM 6798  H HD3  . ARG A 1 130 ? 104.346 -15.362 8.321   1.00 0.00 ? 130 ARG A HD3  3  
ATOM 6799  H HE   . ARG A 1 130 ? 105.072 -12.654 8.934   1.00 0.00 ? 130 ARG A HE   3  
ATOM 6800  H HH11 . ARG A 1 130 ? 103.481 -15.526 10.190  1.00 0.00 ? 130 ARG A HH11 3  
ATOM 6801  H HH12 . ARG A 1 130 ? 103.626 -15.024 11.844  1.00 0.00 ? 130 ARG A HH12 3  
ATOM 6802  H HH21 . ARG A 1 130 ? 105.257 -12.016 11.127  1.00 0.00 ? 130 ARG A HH21 3  
ATOM 6803  H HH22 . ARG A 1 130 ? 104.636 -13.053 12.375  1.00 0.00 ? 130 ARG A HH22 3  
ATOM 6804  N N    . THR A 1 131 ? 104.231 -17.987 7.177   1.00 0.00 ? 131 THR A N    3  
ATOM 6805  C CA   . THR A 1 131 ? 103.503 -18.818 8.127   1.00 0.00 ? 131 THR A CA   3  
ATOM 6806  C C    . THR A 1 131 ? 102.752 -17.954 9.138   1.00 0.00 ? 131 THR A C    3  
ATOM 6807  O O    . THR A 1 131 ? 103.354 -17.394 10.061  1.00 0.00 ? 131 THR A O    3  
ATOM 6808  C CB   . THR A 1 131 ? 104.459 -19.780 8.873   1.00 0.00 ? 131 THR A CB   3  
ATOM 6809  O OG1  . THR A 1 131 ? 105.554 -19.039 9.438   1.00 0.00 ? 131 THR A OG1  3  
ATOM 6810  C CG2  . THR A 1 131 ? 105.002 -20.855 7.937   1.00 0.00 ? 131 THR A CG2  3  
ATOM 6811  H H    . THR A 1 131 ? 105.187 -18.154 7.035   1.00 0.00 ? 131 THR A H    3  
ATOM 6812  H HA   . THR A 1 131 ? 102.788 -19.412 7.572   1.00 0.00 ? 131 THR A HA   3  
ATOM 6813  H HB   . THR A 1 131 ? 103.913 -20.261 9.673   1.00 0.00 ? 131 THR A HB   3  
ATOM 6814  H HG1  . THR A 1 131 ? 105.211 -18.432 10.109  1.00 0.00 ? 131 THR A HG1  3  
ATOM 6815  H HG21 . THR A 1 131 ? 105.667 -21.508 8.484   1.00 0.00 ? 131 THR A HG21 3  
ATOM 6816  H HG22 . THR A 1 131 ? 105.543 -20.390 7.126   1.00 0.00 ? 131 THR A HG22 3  
ATOM 6817  H HG23 . THR A 1 131 ? 104.181 -21.433 7.537   1.00 0.00 ? 131 THR A HG23 3  
ATOM 6818  N N    . GLU A 1 132 ? 101.450 -17.803 8.923   1.00 0.00 ? 132 GLU A N    3  
ATOM 6819  C CA   . GLU A 1 132 ? 100.612 -17.044 9.837   1.00 0.00 ? 132 GLU A CA   3  
ATOM 6820  C C    . GLU A 1 132 ? 100.569 -17.753 11.184  1.00 0.00 ? 132 GLU A C    3  
ATOM 6821  O O    . GLU A 1 132 ? 100.316 -18.957 11.254  1.00 0.00 ? 132 GLU A O    3  
ATOM 6822  C CB   . GLU A 1 132 ? 99.196  -16.880 9.268   1.00 0.00 ? 132 GLU A CB   3  
ATOM 6823  C CG   . GLU A 1 132 ? 98.307  -15.956 10.095  1.00 0.00 ? 132 GLU A CG   3  
ATOM 6824  C CD   . GLU A 1 132 ? 96.933  -15.760 9.476   1.00 0.00 ? 132 GLU A CD   3  
ATOM 6825  O OE1  . GLU A 1 132 ? 96.850  -15.169 8.378   1.00 0.00 ? 132 GLU A OE1  3  
ATOM 6826  O OE2  . GLU A 1 132 ? 95.927  -16.201 10.073  1.00 0.00 ? 132 GLU A OE2  3  
ATOM 6827  H H    . GLU A 1 132 ? 101.045 -18.209 8.128   1.00 0.00 ? 132 GLU A H    3  
ATOM 6828  H HA   . GLU A 1 132 ? 101.059 -16.067 9.966   1.00 0.00 ? 132 GLU A HA   3  
ATOM 6829  H HB2  . GLU A 1 132 ? 99.268  -16.476 8.268   1.00 0.00 ? 132 GLU A HB2  3  
ATOM 6830  H HB3  . GLU A 1 132 ? 98.724  -17.852 9.220   1.00 0.00 ? 132 GLU A HB3  3  
ATOM 6831  H HG2  . GLU A 1 132 ? 98.187  -16.381 11.082  1.00 0.00 ? 132 GLU A HG2  3  
ATOM 6832  H HG3  . GLU A 1 132 ? 98.789  -14.992 10.178  1.00 0.00 ? 132 GLU A HG3  3  
ATOM 6833  N N    . GLU A 1 133 ? 100.848 -17.012 12.242  1.00 0.00 ? 133 GLU A N    3  
ATOM 6834  C CA   . GLU A 1 133 ? 100.897 -17.574 13.582  1.00 0.00 ? 133 GLU A CA   3  
ATOM 6835  C C    . GLU A 1 133 ? 99.483  -17.874 14.078  1.00 0.00 ? 133 GLU A C    3  
ATOM 6836  O O    . GLU A 1 133 ? 98.765  -16.988 14.547  1.00 0.00 ? 133 GLU A O    3  
ATOM 6837  C CB   . GLU A 1 133 ? 101.650 -16.610 14.502  1.00 0.00 ? 133 GLU A CB   3  
ATOM 6838  C CG   . GLU A 1 133 ? 103.104 -16.416 14.069  1.00 0.00 ? 133 GLU A CG   3  
ATOM 6839  C CD   . GLU A 1 133 ? 103.732 -15.145 14.608  1.00 0.00 ? 133 GLU A CD   3  
ATOM 6840  O OE1  . GLU A 1 133 ? 104.213 -15.151 15.761  1.00 0.00 ? 133 GLU A OE1  3  
ATOM 6841  O OE2  . GLU A 1 133 ? 103.755 -14.133 13.871  1.00 0.00 ? 133 GLU A OE2  3  
ATOM 6842  H H    . GLU A 1 133 ? 101.012 -16.052 12.123  1.00 0.00 ? 133 GLU A H    3  
ATOM 6843  H HA   . GLU A 1 133 ? 101.446 -18.505 13.527  1.00 0.00 ? 133 GLU A HA   3  
ATOM 6844  H HB2  . GLU A 1 133 ? 101.153 -15.649 14.489  1.00 0.00 ? 133 GLU A HB2  3  
ATOM 6845  H HB3  . GLU A 1 133 ? 101.642 -17.001 15.509  1.00 0.00 ? 133 GLU A HB3  3  
ATOM 6846  H HG2  . GLU A 1 133 ? 103.684 -17.260 14.418  1.00 0.00 ? 133 GLU A HG2  3  
ATOM 6847  H HG3  . GLU A 1 133 ? 103.142 -16.388 12.987  1.00 0.00 ? 133 GLU A HG3  3  
ATOM 6848  N N    . GLU A 1 134 ? 99.093  -19.137 13.923  1.00 0.00 ? 134 GLU A N    3  
ATOM 6849  C CA   . GLU A 1 134 ? 97.738  -19.594 14.208  1.00 0.00 ? 134 GLU A CA   3  
ATOM 6850  C C    . GLU A 1 134 ? 97.508  -19.770 15.713  1.00 0.00 ? 134 GLU A C    3  
ATOM 6851  O O    . GLU A 1 134 ? 98.293  -19.286 16.531  1.00 0.00 ? 134 GLU A O    3  
ATOM 6852  C CB   . GLU A 1 134 ? 97.481  -20.912 13.458  1.00 0.00 ? 134 GLU A CB   3  
ATOM 6853  C CG   . GLU A 1 134 ? 97.551  -20.774 11.935  1.00 0.00 ? 134 GLU A CG   3  
ATOM 6854  C CD   . GLU A 1 134 ? 97.450  -22.108 11.206  1.00 0.00 ? 134 GLU A CD   3  
ATOM 6855  O OE1  . GLU A 1 134 ? 96.518  -22.886 11.504  1.00 0.00 ? 134 GLU A OE1  3  
ATOM 6856  O OE2  . GLU A 1 134 ? 98.306  -22.388 10.335  1.00 0.00 ? 134 GLU A OE2  3  
ATOM 6857  H H    . GLU A 1 134 ? 99.749  -19.791 13.605  1.00 0.00 ? 134 GLU A H    3  
ATOM 6858  H HA   . GLU A 1 134 ? 97.050  -18.844 13.841  1.00 0.00 ? 134 GLU A HA   3  
ATOM 6859  H HB2  . GLU A 1 134 ? 98.219  -21.639 13.767  1.00 0.00 ? 134 GLU A HB2  3  
ATOM 6860  H HB3  . GLU A 1 134 ? 96.497  -21.278 13.719  1.00 0.00 ? 134 GLU A HB3  3  
ATOM 6861  H HG2  . GLU A 1 134 ? 96.736  -20.144 11.607  1.00 0.00 ? 134 GLU A HG2  3  
ATOM 6862  H HG3  . GLU A 1 134 ? 98.490  -20.305 11.674  1.00 0.00 ? 134 GLU A HG3  3  
ATOM 6863  N N    . GLU A 1 135 ? 96.423  -20.469 16.058  1.00 0.00 ? 135 GLU A N    3  
ATOM 6864  C CA   . GLU A 1 135 ? 96.001  -20.654 17.448  1.00 0.00 ? 135 GLU A CA   3  
ATOM 6865  C C    . GLU A 1 135 ? 97.165  -21.074 18.348  1.00 0.00 ? 135 GLU A C    3  
ATOM 6866  O O    . GLU A 1 135 ? 97.616  -22.224 18.319  1.00 0.00 ? 135 GLU A O    3  
ATOM 6867  C CB   . GLU A 1 135 ? 94.865  -21.682 17.514  1.00 0.00 ? 135 GLU A CB   3  
ATOM 6868  C CG   . GLU A 1 135 ? 93.622  -21.249 16.742  1.00 0.00 ? 135 GLU A CG   3  
ATOM 6869  C CD   . GLU A 1 135 ? 92.514  -22.291 16.722  1.00 0.00 ? 135 GLU A CD   3  
ATOM 6870  O OE1  . GLU A 1 135 ? 92.612  -23.307 17.444  1.00 0.00 ? 135 GLU A OE1  3  
ATOM 6871  O OE2  . GLU A 1 135 ? 91.530  -22.093 15.979  1.00 0.00 ? 135 GLU A OE2  3  
ATOM 6872  H H    . GLU A 1 135 ? 95.885  -20.877 15.348  1.00 0.00 ? 135 GLU A H    3  
ATOM 6873  H HA   . GLU A 1 135 ? 95.623  -19.703 17.799  1.00 0.00 ? 135 GLU A HA   3  
ATOM 6874  H HB2  . GLU A 1 135 ? 95.214  -22.619 17.101  1.00 0.00 ? 135 GLU A HB2  3  
ATOM 6875  H HB3  . GLU A 1 135 ? 94.587  -21.835 18.547  1.00 0.00 ? 135 GLU A HB3  3  
ATOM 6876  H HG2  . GLU A 1 135 ? 93.232  -20.348 17.196  1.00 0.00 ? 135 GLU A HG2  3  
ATOM 6877  H HG3  . GLU A 1 135 ? 93.909  -21.034 15.721  1.00 0.00 ? 135 GLU A HG3  3  
ATOM 6878  N N    . GLU A 1 136 ? 97.637  -20.115 19.137  1.00 0.00 ? 136 GLU A N    3  
ATOM 6879  C CA   . GLU A 1 136 ? 98.771  -20.300 20.035  1.00 0.00 ? 136 GLU A CA   3  
ATOM 6880  C C    . GLU A 1 136 ? 98.476  -21.362 21.094  1.00 0.00 ? 136 GLU A C    3  
ATOM 6881  O O    . GLU A 1 136 ? 97.359  -21.439 21.615  1.00 0.00 ? 136 GLU A O    3  
ATOM 6882  C CB   . GLU A 1 136 ? 99.097  -18.963 20.715  1.00 0.00 ? 136 GLU A CB   3  
ATOM 6883  C CG   . GLU A 1 136 ? 99.426  -17.839 19.734  1.00 0.00 ? 136 GLU A CG   3  
ATOM 6884  C CD   . GLU A 1 136 ? 99.237  -16.456 20.337  1.00 0.00 ? 136 GLU A CD   3  
ATOM 6885  O OE1  . GLU A 1 136 ? 100.116 -16.000 21.096  1.00 0.00 ? 136 GLU A OE1  3  
ATOM 6886  O OE2  . GLU A 1 136 ? 98.195  -15.821 20.059  1.00 0.00 ? 136 GLU A OE2  3  
ATOM 6887  H H    . GLU A 1 136 ? 97.203  -19.236 19.110  1.00 0.00 ? 136 GLU A H    3  
ATOM 6888  H HA   . GLU A 1 136 ? 99.621  -20.613 19.445  1.00 0.00 ? 136 GLU A HA   3  
ATOM 6889  H HB2  . GLU A 1 136 ? 98.246  -18.657 21.308  1.00 0.00 ? 136 GLU A HB2  3  
ATOM 6890  H HB3  . GLU A 1 136 ? 99.948  -19.101 21.370  1.00 0.00 ? 136 GLU A HB3  3  
ATOM 6891  H HG2  . GLU A 1 136 ? 100.456 -17.941 19.421  1.00 0.00 ? 136 GLU A HG2  3  
ATOM 6892  H HG3  . GLU A 1 136 ? 98.782  -17.932 18.869  1.00 0.00 ? 136 GLU A HG3  3  
ATOM 6893  N N    . ASP A 1 137 ? 99.479  -22.178 21.400  1.00 0.00 ? 137 ASP A N    3  
ATOM 6894  C CA   . ASP A 1 137 ? 99.378  -23.172 22.468  1.00 0.00 ? 137 ASP A CA   3  
ATOM 6895  C C    . ASP A 1 137 ? 100.166 -22.700 23.689  1.00 0.00 ? 137 ASP A C    3  
ATOM 6896  O O    . ASP A 1 137 ? 101.137 -21.944 23.559  1.00 0.00 ? 137 ASP A O    3  
ATOM 6897  C CB   . ASP A 1 137 ? 99.902  -24.537 21.993  1.00 0.00 ? 137 ASP A CB   3  
ATOM 6898  C CG   . ASP A 1 137 ? 101.401 -24.536 21.729  1.00 0.00 ? 137 ASP A CG   3  
ATOM 6899  O OD1  . ASP A 1 137 ? 101.821 -24.053 20.656  1.00 0.00 ? 137 ASP A OD1  3  
ATOM 6900  O OD2  . ASP A 1 137 ? 102.164 -25.024 22.587  1.00 0.00 ? 137 ASP A OD2  3  
ATOM 6901  H H    . ASP A 1 137 ? 100.315 -22.113 20.891  1.00 0.00 ? 137 ASP A H    3  
ATOM 6902  H HA   . ASP A 1 137 ? 98.336  -23.269 22.742  1.00 0.00 ? 137 ASP A HA   3  
ATOM 6903  H HB2  . ASP A 1 137 ? 99.687  -25.280 22.749  1.00 0.00 ? 137 ASP A HB2  3  
ATOM 6904  H HB3  . ASP A 1 137 ? 99.393  -24.810 21.079  1.00 0.00 ? 137 ASP A HB3  3  
ATOM 6905  N N    . LEU A 1 138 ? 99.745  -23.138 24.869  1.00 0.00 ? 138 LEU A N    3  
ATOM 6906  C CA   . LEU A 1 138 ? 100.366 -22.720 26.123  1.00 0.00 ? 138 LEU A CA   3  
ATOM 6907  C C    . LEU A 1 138 ? 101.112 -23.889 26.765  1.00 0.00 ? 138 LEU A C    3  
ATOM 6908  O O    . LEU A 1 138 ? 102.327 -23.756 27.026  1.00 0.00 ? 138 LEU A O    3  
ATOM 6909  C CB   . LEU A 1 138 ? 99.307  -22.165 27.087  1.00 0.00 ? 138 LEU A CB   3  
ATOM 6910  C CG   . LEU A 1 138 ? 98.534  -20.935 26.576  1.00 0.00 ? 138 LEU A CG   3  
ATOM 6911  C CD1  . LEU A 1 138 ? 97.518  -20.462 27.613  1.00 0.00 ? 138 LEU A CD1  3  
ATOM 6912  C CD2  . LEU A 1 138 ? 99.496  -19.806 26.207  1.00 0.00 ? 138 LEU A CD2  3  
ATOM 6913  O OXT  . LEU A 1 138 ? 100.488 -24.948 26.980  1.00 0.00 ? 138 LEU A OXT  3  
ATOM 6914  H H    . LEU A 1 138 ? 98.996  -23.772 24.901  1.00 0.00 ? 138 LEU A H    3  
ATOM 6915  H HA   . LEU A 1 138 ? 101.078 -21.935 25.897  1.00 0.00 ? 138 LEU A HA   3  
ATOM 6916  H HB2  . LEU A 1 138 ? 98.594  -22.952 27.297  1.00 0.00 ? 138 LEU A HB2  3  
ATOM 6917  H HB3  . LEU A 1 138 ? 99.798  -21.895 28.012  1.00 0.00 ? 138 LEU A HB3  3  
ATOM 6918  H HG   . LEU A 1 138 ? 97.989  -21.210 25.684  1.00 0.00 ? 138 LEU A HG   3  
ATOM 6919  H HD11 . LEU A 1 138 ? 96.816  -21.257 27.818  1.00 0.00 ? 138 LEU A HD11 3  
ATOM 6920  H HD12 . LEU A 1 138 ? 96.985  -19.604 27.230  1.00 0.00 ? 138 LEU A HD12 3  
ATOM 6921  H HD13 . LEU A 1 138 ? 98.030  -20.189 28.525  1.00 0.00 ? 138 LEU A HD13 3  
ATOM 6922  H HD21 . LEU A 1 138 ? 100.163 -20.140 25.425  1.00 0.00 ? 138 LEU A HD21 3  
ATOM 6923  H HD22 . LEU A 1 138 ? 100.075 -19.523 27.076  1.00 0.00 ? 138 LEU A HD22 3  
ATOM 6924  H HD23 . LEU A 1 138 ? 98.933  -18.953 25.858  1.00 0.00 ? 138 LEU A HD23 3  
ATOM 6925  N N    . SER A 1 1   ? 96.235  -11.020 10.521  1.00 0.00 ? 1   SER A N    4  
ATOM 6926  C CA   . SER A 1 1   ? 95.229  -10.158 9.869   1.00 0.00 ? 1   SER A CA   4  
ATOM 6927  C C    . SER A 1 1   ? 95.799  -8.767  9.570   1.00 0.00 ? 1   SER A C    4  
ATOM 6928  O O    . SER A 1 1   ? 95.947  -8.395  8.408   1.00 0.00 ? 1   SER A O    4  
ATOM 6929  C CB   . SER A 1 1   ? 93.983  -10.058 10.755  1.00 0.00 ? 1   SER A CB   4  
ATOM 6930  O OG   . SER A 1 1   ? 93.396  -11.337 10.947  1.00 0.00 ? 1   SER A OG   4  
ATOM 6931  H H1   . SER A 1 1   ? 97.066  -11.128 9.911   1.00 0.00 ? 1   SER A H1   4  
ATOM 6932  H H2   . SER A 1 1   ? 95.832  -11.961 10.708  1.00 0.00 ? 1   SER A H2   4  
ATOM 6933  H H3   . SER A 1 1   ? 96.534  -10.604 11.427  1.00 0.00 ? 1   SER A H3   4  
ATOM 6934  H HA   . SER A 1 1   ? 94.953  -10.623 8.933   1.00 0.00 ? 1   SER A HA   4  
ATOM 6935  H HB2  . SER A 1 1   ? 94.257  -9.653  11.719  1.00 0.00 ? 1   SER A HB2  4  
ATOM 6936  H HB3  . SER A 1 1   ? 93.257  -9.410  10.285  1.00 0.00 ? 1   SER A HB3  4  
ATOM 6937  H HG   . SER A 1 1   ? 93.049  -11.658 10.103  1.00 0.00 ? 1   SER A HG   4  
ATOM 6938  N N    . MET A 1 2   ? 96.152  -8.011  10.614  1.00 0.00 ? 2   MET A N    4  
ATOM 6939  C CA   . MET A 1 2   ? 96.623  -6.628  10.445  1.00 0.00 ? 2   MET A CA   4  
ATOM 6940  C C    . MET A 1 2   ? 98.029  -6.573  9.843   1.00 0.00 ? 2   MET A C    4  
ATOM 6941  O O    . MET A 1 2   ? 98.507  -5.505  9.470   1.00 0.00 ? 2   MET A O    4  
ATOM 6942  C CB   . MET A 1 2   ? 96.601  -5.871  11.784  1.00 0.00 ? 2   MET A CB   4  
ATOM 6943  C CG   . MET A 1 2   ? 95.204  -5.637  12.347  1.00 0.00 ? 2   MET A CG   4  
ATOM 6944  S SD   . MET A 1 2   ? 95.226  -4.637  13.853  1.00 0.00 ? 2   MET A SD   4  
ATOM 6945  C CE   . MET A 1 2   ? 93.477  -4.562  14.240  1.00 0.00 ? 2   MET A CE   4  
ATOM 6946  H H    . MET A 1 2   ? 96.102  -8.390  11.520  1.00 0.00 ? 2   MET A H    4  
ATOM 6947  H HA   . MET A 1 2   ? 95.944  -6.137  9.761   1.00 0.00 ? 2   MET A HA   4  
ATOM 6948  H HB2  . MET A 1 2   ? 97.166  -6.435  12.511  1.00 0.00 ? 2   MET A HB2  4  
ATOM 6949  H HB3  . MET A 1 2   ? 97.074  -4.908  11.647  1.00 0.00 ? 2   MET A HB3  4  
ATOM 6950  H HG2  . MET A 1 2   ? 94.608  -5.127  11.603  1.00 0.00 ? 2   MET A HG2  4  
ATOM 6951  H HG3  . MET A 1 2   ? 94.754  -6.593  12.574  1.00 0.00 ? 2   MET A HG3  4  
ATOM 6952  H HE1  . MET A 1 2   ? 92.948  -4.087  13.426  1.00 0.00 ? 2   MET A HE1  4  
ATOM 6953  H HE2  . MET A 1 2   ? 93.333  -3.989  15.144  1.00 0.00 ? 2   MET A HE2  4  
ATOM 6954  H HE3  . MET A 1 2   ? 93.096  -5.562  14.382  1.00 0.00 ? 2   MET A HE3  4  
ATOM 6955  N N    . GLN A 1 3   ? 98.695  -7.721  9.767   1.00 0.00 ? 3   GLN A N    4  
ATOM 6956  C CA   . GLN A 1 3   ? 100.023 -7.807  9.155   1.00 0.00 ? 3   GLN A CA   4  
ATOM 6957  C C    . GLN A 1 3   ? 99.921  -8.364  7.735   1.00 0.00 ? 3   GLN A C    4  
ATOM 6958  O O    . GLN A 1 3   ? 100.931 -8.656  7.092   1.00 0.00 ? 3   GLN A O    4  
ATOM 6959  C CB   . GLN A 1 3   ? 100.938 -8.697  10.006  1.00 0.00 ? 3   GLN A CB   4  
ATOM 6960  C CG   . GLN A 1 3   ? 101.138 -8.193  11.431  1.00 0.00 ? 3   GLN A CG   4  
ATOM 6961  C CD   . GLN A 1 3   ? 101.958 -9.149  12.279  1.00 0.00 ? 3   GLN A CD   4  
ATOM 6962  O OE1  . GLN A 1 3   ? 101.414 -10.046 12.923  1.00 0.00 ? 3   GLN A OE1  4  
ATOM 6963  N NE2  . GLN A 1 3   ? 103.268 -8.969  12.285  1.00 0.00 ? 3   GLN A NE2  4  
ATOM 6964  H H    . GLN A 1 3   ? 98.290  -8.531  10.140  1.00 0.00 ? 3   GLN A H    4  
ATOM 6965  H HA   . GLN A 1 3   ? 100.441 -6.810  9.109   1.00 0.00 ? 3   GLN A HA   4  
ATOM 6966  H HB2  . GLN A 1 3   ? 100.510 -9.689  10.055  1.00 0.00 ? 3   GLN A HB2  4  
ATOM 6967  H HB3  . GLN A 1 3   ? 101.907 -8.758  9.529   1.00 0.00 ? 3   GLN A HB3  4  
ATOM 6968  H HG2  . GLN A 1 3   ? 101.645 -7.239  11.395  1.00 0.00 ? 3   GLN A HG2  4  
ATOM 6969  H HG3  . GLN A 1 3   ? 100.169 -8.065  11.893  1.00 0.00 ? 3   GLN A HG3  4  
ATOM 6970  H HE21 . GLN A 1 3   ? 103.639 -8.234  11.749  1.00 0.00 ? 3   GLN A HE21 4  
ATOM 6971  H HE22 . GLN A 1 3   ? 103.816 -9.572  12.832  1.00 0.00 ? 3   GLN A HE22 4  
ATOM 6972  N N    . SER A 1 4   ? 98.690  -8.506  7.254   1.00 0.00 ? 4   SER A N    4  
ATOM 6973  C CA   . SER A 1 4   ? 98.424  -9.084  5.942   1.00 0.00 ? 4   SER A CA   4  
ATOM 6974  C C    . SER A 1 4   ? 97.065  -8.582  5.432   1.00 0.00 ? 4   SER A C    4  
ATOM 6975  O O    . SER A 1 4   ? 96.544  -7.591  5.946   1.00 0.00 ? 4   SER A O    4  
ATOM 6976  C CB   . SER A 1 4   ? 98.423  -10.618 6.044   1.00 0.00 ? 4   SER A CB   4  
ATOM 6977  O OG   . SER A 1 4   ? 99.606  -11.094 6.669   1.00 0.00 ? 4   SER A OG   4  
ATOM 6978  H H    . SER A 1 4   ? 97.931  -8.197  7.793   1.00 0.00 ? 4   SER A H    4  
ATOM 6979  H HA   . SER A 1 4   ? 99.209  -8.766  5.263   1.00 0.00 ? 4   SER A HA   4  
ATOM 6980  H HB2  . SER A 1 4   ? 97.571  -10.939 6.626   1.00 0.00 ? 4   SER A HB2  4  
ATOM 6981  H HB3  . SER A 1 4   ? 98.360  -11.043 5.052   1.00 0.00 ? 4   SER A HB3  4  
ATOM 6982  H HG   . SER A 1 4   ? 100.323 -10.463 6.525   1.00 0.00 ? 4   SER A HG   4  
ATOM 6983  N N    . LEU A 1 5   ? 96.512  -9.254  4.415   1.00 0.00 ? 5   LEU A N    4  
ATOM 6984  C CA   . LEU A 1 5   ? 95.164  -8.960  3.904   1.00 0.00 ? 5   LEU A CA   4  
ATOM 6985  C C    . LEU A 1 5   ? 94.996  -7.487  3.538   1.00 0.00 ? 5   LEU A C    4  
ATOM 6986  O O    . LEU A 1 5   ? 95.286  -7.067  2.418   1.00 0.00 ? 5   LEU A O    4  
ATOM 6987  C CB   . LEU A 1 5   ? 94.093  -9.391  4.926   1.00 0.00 ? 5   LEU A CB   4  
ATOM 6988  C CG   . LEU A 1 5   ? 92.634  -9.276  4.446   1.00 0.00 ? 5   LEU A CG   4  
ATOM 6989  C CD1  . LEU A 1 5   ? 92.377  -10.203 3.259   1.00 0.00 ? 5   LEU A CD1  4  
ATOM 6990  C CD2  . LEU A 1 5   ? 91.664  -9.569  5.592   1.00 0.00 ? 5   LEU A CD2  4  
ATOM 6991  H H    . LEU A 1 5   ? 97.029  -9.972  3.986   1.00 0.00 ? 5   LEU A H    4  
ATOM 6992  H HA   . LEU A 1 5   ? 95.028  -9.531  3.017   1.00 0.00 ? 5   LEU A HA   4  
ATOM 6993  H HB2  . LEU A 1 5   ? 94.281  -10.419 5.201   1.00 0.00 ? 5   LEU A HB2  4  
ATOM 6994  H HB3  . LEU A 1 5   ? 94.205  -8.776  5.807   1.00 0.00 ? 5   LEU A HB3  4  
ATOM 6995  H HG   . LEU A 1 5   ? 92.456  -8.263  4.114   1.00 0.00 ? 5   LEU A HG   4  
ATOM 6996  H HD11 . LEU A 1 5   ? 93.036  -9.939  2.445   1.00 0.00 ? 5   LEU A HD11 4  
ATOM 6997  H HD12 . LEU A 1 5   ? 91.351  -10.100 2.936   1.00 0.00 ? 5   LEU A HD12 4  
ATOM 6998  H HD13 . LEU A 1 5   ? 92.559  -11.228 3.552   1.00 0.00 ? 5   LEU A HD13 4  
ATOM 6999  H HD21 . LEU A 1 5   ? 91.822  -10.575 5.955   1.00 0.00 ? 5   LEU A HD21 4  
ATOM 7000  H HD22 . LEU A 1 5   ? 90.648  -9.470  5.239   1.00 0.00 ? 5   LEU A HD22 4  
ATOM 7001  H HD23 . LEU A 1 5   ? 91.833  -8.866  6.396   1.00 0.00 ? 5   LEU A HD23 4  
ATOM 7002  N N    . LYS A 1 6   ? 94.544  -6.711  4.499   1.00 0.00 ? 6   LYS A N    4  
ATOM 7003  C CA   . LYS A 1 6   ? 94.334  -5.285  4.308   1.00 0.00 ? 6   LYS A CA   4  
ATOM 7004  C C    . LYS A 1 6   ? 95.668  -4.604  4.043   1.00 0.00 ? 6   LYS A C    4  
ATOM 7005  O O    . LYS A 1 6   ? 95.784  -3.728  3.183   1.00 0.00 ? 6   LYS A O    4  
ATOM 7006  C CB   . LYS A 1 6   ? 93.651  -4.672  5.539   1.00 0.00 ? 6   LYS A CB   4  
ATOM 7007  C CG   . LYS A 1 6   ? 93.421  -3.165  5.435   1.00 0.00 ? 6   LYS A CG   4  
ATOM 7008  C CD   . LYS A 1 6   ? 92.660  -2.620  6.640   1.00 0.00 ? 6   LYS A CD   4  
ATOM 7009  C CE   . LYS A 1 6   ? 91.263  -3.223  6.747   1.00 0.00 ? 6   LYS A CE   4  
ATOM 7010  N NZ   . LYS A 1 6   ? 90.526  -2.709  7.928   1.00 0.00 ? 6   LYS A NZ   4  
ATOM 7011  H H    . LYS A 1 6   ? 94.355  -7.112  5.362   1.00 0.00 ? 6   LYS A H    4  
ATOM 7012  H HA   . LYS A 1 6   ? 93.697  -5.159  3.449   1.00 0.00 ? 6   LYS A HA   4  
ATOM 7013  H HB2  . LYS A 1 6   ? 92.693  -5.153  5.678   1.00 0.00 ? 6   LYS A HB2  4  
ATOM 7014  H HB3  . LYS A 1 6   ? 94.266  -4.862  6.409   1.00 0.00 ? 6   LYS A HB3  4  
ATOM 7015  H HG2  . LYS A 1 6   ? 94.379  -2.668  5.374   1.00 0.00 ? 6   LYS A HG2  4  
ATOM 7016  H HG3  . LYS A 1 6   ? 92.852  -2.960  4.538   1.00 0.00 ? 6   LYS A HG3  4  
ATOM 7017  H HD2  . LYS A 1 6   ? 93.212  -2.854  7.540   1.00 0.00 ? 6   LYS A HD2  4  
ATOM 7018  H HD3  . LYS A 1 6   ? 92.572  -1.547  6.541   1.00 0.00 ? 6   LYS A HD3  4  
ATOM 7019  H HE2  . LYS A 1 6   ? 90.707  -2.975  5.854   1.00 0.00 ? 6   LYS A HE2  4  
ATOM 7020  H HE3  . LYS A 1 6   ? 91.351  -4.298  6.827   1.00 0.00 ? 6   LYS A HE3  4  
ATOM 7021  H HZ1  . LYS A 1 6   ? 89.577  -3.132  7.970   1.00 0.00 ? 6   LYS A HZ1  4  
ATOM 7022  H HZ2  . LYS A 1 6   ? 90.428  -1.677  7.871   1.00 0.00 ? 6   LYS A HZ2  4  
ATOM 7023  H HZ3  . LYS A 1 6   ? 91.036  -2.948  8.800   1.00 0.00 ? 6   LYS A HZ3  4  
ATOM 7024  N N    . SER A 1 7   ? 96.679  -5.043  4.776   1.00 0.00 ? 7   SER A N    4  
ATOM 7025  C CA   . SER A 1 7   ? 98.018  -4.513  4.633   1.00 0.00 ? 7   SER A CA   4  
ATOM 7026  C C    . SER A 1 7   ? 98.605  -4.867  3.265   1.00 0.00 ? 7   SER A C    4  
ATOM 7027  O O    . SER A 1 7   ? 99.389  -4.106  2.706   1.00 0.00 ? 7   SER A O    4  
ATOM 7028  C CB   . SER A 1 7   ? 98.899  -5.037  5.765   1.00 0.00 ? 7   SER A CB   4  
ATOM 7029  O OG   . SER A 1 7   ? 98.314  -4.742  7.022   1.00 0.00 ? 7   SER A OG   4  
ATOM 7030  H H    . SER A 1 7   ? 96.515  -5.745  5.443   1.00 0.00 ? 7   SER A H    4  
ATOM 7031  H HA   . SER A 1 7   ? 97.955  -3.437  4.712   1.00 0.00 ? 7   SER A HA   4  
ATOM 7032  H HB2  . SER A 1 7   ? 99.006  -6.109  5.674   1.00 0.00 ? 7   SER A HB2  4  
ATOM 7033  H HB3  . SER A 1 7   ? 99.871  -4.570  5.715   1.00 0.00 ? 7   SER A HB3  4  
ATOM 7034  H HG   . SER A 1 7   ? 99.010  -4.655  7.689   1.00 0.00 ? 7   SER A HG   4  
ATOM 7035  N N    . THR A 1 8   ? 98.202  -6.007  2.703   1.00 0.00 ? 8   THR A N    4  
ATOM 7036  C CA   . THR A 1 8   ? 98.700  -6.408  1.391   1.00 0.00 ? 8   THR A CA   4  
ATOM 7037  C C    . THR A 1 8   ? 98.094  -5.511  0.319   1.00 0.00 ? 8   THR A C    4  
ATOM 7038  O O    . THR A 1 8   ? 98.755  -5.146  -0.656  1.00 0.00 ? 8   THR A O    4  
ATOM 7039  C CB   . THR A 1 8   ? 98.405  -7.898  1.087   1.00 0.00 ? 8   THR A CB   4  
ATOM 7040  O OG1  . THR A 1 8   ? 97.001  -8.113  0.883   1.00 0.00 ? 8   THR A OG1  4  
ATOM 7041  C CG2  . THR A 1 8   ? 98.873  -8.775  2.239   1.00 0.00 ? 8   THR A CG2  4  
ATOM 7042  H H    . THR A 1 8   ? 97.554  -6.575  3.169   1.00 0.00 ? 8   THR A H    4  
ATOM 7043  H HA   . THR A 1 8   ? 99.775  -6.269  1.390   1.00 0.00 ? 8   THR A HA   4  
ATOM 7044  H HB   . THR A 1 8   ? 98.945  -8.187  0.191   1.00 0.00 ? 8   THR A HB   4  
ATOM 7045  H HG1  . THR A 1 8   ? 96.692  -7.558  0.155   1.00 0.00 ? 8   THR A HG1  4  
ATOM 7046  H HG21 . THR A 1 8   ? 98.662  -9.810  2.014   1.00 0.00 ? 8   THR A HG21 4  
ATOM 7047  H HG22 . THR A 1 8   ? 98.353  -8.492  3.143   1.00 0.00 ? 8   THR A HG22 4  
ATOM 7048  H HG23 . THR A 1 8   ? 99.937  -8.648  2.381   1.00 0.00 ? 8   THR A HG23 4  
ATOM 7049  N N    . ALA A 1 9   ? 96.831  -5.136  0.532   1.00 0.00 ? 9   ALA A N    4  
ATOM 7050  C CA   . ALA A 1 9   ? 96.150  -4.184  -0.338  1.00 0.00 ? 9   ALA A CA   4  
ATOM 7051  C C    . ALA A 1 9   ? 96.845  -2.826  -0.269  1.00 0.00 ? 9   ALA A C    4  
ATOM 7052  O O    . ALA A 1 9   ? 96.918  -2.101  -1.261  1.00 0.00 ? 9   ALA A O    4  
ATOM 7053  C CB   . ALA A 1 9   ? 94.682  -4.061  0.059   1.00 0.00 ? 9   ALA A CB   4  
ATOM 7054  H H    . ALA A 1 9   ? 96.345  -5.513  1.298   1.00 0.00 ? 9   ALA A H    4  
ATOM 7055  H HA   . ALA A 1 9   ? 96.201  -4.557  -1.353  1.00 0.00 ? 9   ALA A HA   4  
ATOM 7056  H HB1  . ALA A 1 9   ? 94.210  -5.032  0.002   1.00 0.00 ? 9   ALA A HB1  4  
ATOM 7057  H HB2  . ALA A 1 9   ? 94.181  -3.379  -0.614  1.00 0.00 ? 9   ALA A HB2  4  
ATOM 7058  H HB3  . ALA A 1 9   ? 94.610  -3.686  1.070   1.00 0.00 ? 9   ALA A HB3  4  
ATOM 7059  N N    . LYS A 1 10  ? 97.352  -2.497  0.919   1.00 0.00 ? 10  LYS A N    4  
ATOM 7060  C CA   . LYS A 1 10  ? 98.134  -1.279  1.130   1.00 0.00 ? 10  LYS A CA   4  
ATOM 7061  C C    . LYS A 1 10  ? 99.320  -1.225  0.175   1.00 0.00 ? 10  LYS A C    4  
ATOM 7062  O O    . LYS A 1 10  ? 99.396  -0.368  -0.714  1.00 0.00 ? 10  LYS A O    4  
ATOM 7063  C CB   . LYS A 1 10  ? 98.663  -1.228  2.573   1.00 0.00 ? 10  LYS A CB   4  
ATOM 7064  C CG   . LYS A 1 10  ? 97.598  -0.934  3.626   1.00 0.00 ? 10  LYS A CG   4  
ATOM 7065  C CD   . LYS A 1 10  ? 98.196  -0.898  5.033   1.00 0.00 ? 10  LYS A CD   4  
ATOM 7066  C CE   . LYS A 1 10  ? 97.213  -0.340  6.056   1.00 0.00 ? 10  LYS A CE   4  
ATOM 7067  N NZ   . LYS A 1 10  ? 96.909  1.095   5.802   1.00 0.00 ? 10  LYS A NZ   4  
ATOM 7068  H H    . LYS A 1 10  ? 97.189  -3.092  1.681   1.00 0.00 ? 10  LYS A H    4  
ATOM 7069  H HA   . LYS A 1 10  ? 97.492  -0.428  0.955   1.00 0.00 ? 10  LYS A HA   4  
ATOM 7070  H HB2  . LYS A 1 10  ? 99.119  -2.188  2.804   1.00 0.00 ? 10  LYS A HB2  4  
ATOM 7071  H HB3  . LYS A 1 10  ? 99.425  -0.464  2.638   1.00 0.00 ? 10  LYS A HB3  4  
ATOM 7072  H HG2  . LYS A 1 10  ? 97.147  0.024   3.412   1.00 0.00 ? 10  LYS A HG2  4  
ATOM 7073  H HG3  . LYS A 1 10  ? 96.840  -1.708  3.586   1.00 0.00 ? 10  LYS A HG3  4  
ATOM 7074  H HD2  . LYS A 1 10  ? 98.468  -1.903  5.324   1.00 0.00 ? 10  LYS A HD2  4  
ATOM 7075  H HD3  . LYS A 1 10  ? 99.081  -0.276  5.023   1.00 0.00 ? 10  LYS A HD3  4  
ATOM 7076  H HE2  . LYS A 1 10  ? 96.294  -0.908  6.006   1.00 0.00 ? 10  LYS A HE2  4  
ATOM 7077  H HE3  . LYS A 1 10  ? 97.642  -0.439  7.043   1.00 0.00 ? 10  LYS A HE3  4  
ATOM 7078  H HZ1  . LYS A 1 10  ? 97.769  1.670   5.922   1.00 0.00 ? 10  LYS A HZ1  4  
ATOM 7079  H HZ2  . LYS A 1 10  ? 96.186  1.435   6.467   1.00 0.00 ? 10  LYS A HZ2  4  
ATOM 7080  H HZ3  . LYS A 1 10  ? 96.558  1.222   4.832   1.00 0.00 ? 10  LYS A HZ3  4  
ATOM 7081  N N    . TRP A 1 11  ? 100.235 -2.164  0.364   1.00 0.00 ? 11  TRP A N    4  
ATOM 7082  C CA   . TRP A 1 11  ? 101.501 -2.168  -0.350  1.00 0.00 ? 11  TRP A CA   4  
ATOM 7083  C C    . TRP A 1 11  ? 101.285 -2.366  -1.848  1.00 0.00 ? 11  TRP A C    4  
ATOM 7084  O O    . TRP A 1 11  ? 102.000 -1.790  -2.666  1.00 0.00 ? 11  TRP A O    4  
ATOM 7085  C CB   . TRP A 1 11  ? 102.411 -3.261  0.213   1.00 0.00 ? 11  TRP A CB   4  
ATOM 7086  C CG   . TRP A 1 11  ? 102.457 -3.278  1.716   1.00 0.00 ? 11  TRP A CG   4  
ATOM 7087  C CD1  . TRP A 1 11  ? 102.677 -2.221  2.552   1.00 0.00 ? 11  TRP A CD1  4  
ATOM 7088  C CD2  . TRP A 1 11  ? 102.273 -4.417  2.558   1.00 0.00 ? 11  TRP A CD2  4  
ATOM 7089  N NE1  . TRP A 1 11  ? 102.647 -2.642  3.858   1.00 0.00 ? 11  TRP A NE1  4  
ATOM 7090  C CE2  . TRP A 1 11  ? 102.403 -3.987  3.887   1.00 0.00 ? 11  TRP A CE2  4  
ATOM 7091  C CE3  . TRP A 1 11  ? 102.011 -5.758  2.311   1.00 0.00 ? 11  TRP A CE3  4  
ATOM 7092  C CZ2  . TRP A 1 11  ? 102.285 -4.857  4.967   1.00 0.00 ? 11  TRP A CZ2  4  
ATOM 7093  C CZ3  . TRP A 1 11  ? 101.891 -6.627  3.378   1.00 0.00 ? 11  TRP A CZ3  4  
ATOM 7094  C CH2  . TRP A 1 11  ? 102.030 -6.173  4.695   1.00 0.00 ? 11  TRP A CH2  4  
ATOM 7095  H H    . TRP A 1 11  ? 100.052 -2.881  1.012   1.00 0.00 ? 11  TRP A H    4  
ATOM 7096  H HA   . TRP A 1 11  ? 101.971 -1.207  -0.192  1.00 0.00 ? 11  TRP A HA   4  
ATOM 7097  H HB2  . TRP A 1 11  ? 102.057 -4.227  -0.121  1.00 0.00 ? 11  TRP A HB2  4  
ATOM 7098  H HB3  . TRP A 1 11  ? 103.419 -3.108  -0.149  1.00 0.00 ? 11  TRP A HB3  4  
ATOM 7099  H HD1  . TRP A 1 11  ? 102.846 -1.209  2.220   1.00 0.00 ? 11  TRP A HD1  4  
ATOM 7100  H HE1  . TRP A 1 11  ? 102.782 -2.072  4.646   1.00 0.00 ? 11  TRP A HE1  4  
ATOM 7101  H HE3  . TRP A 1 11  ? 101.889 -6.114  1.304   1.00 0.00 ? 11  TRP A HE3  4  
ATOM 7102  H HZ2  . TRP A 1 11  ? 102.389 -4.517  5.987   1.00 0.00 ? 11  TRP A HZ2  4  
ATOM 7103  H HZ3  . TRP A 1 11  ? 101.690 -7.674  3.200   1.00 0.00 ? 11  TRP A HZ3  4  
ATOM 7104  H HH2  . TRP A 1 11  ? 101.929 -6.885  5.502   1.00 0.00 ? 11  TRP A HH2  4  
ATOM 7105  N N    . ALA A 1 12  ? 100.285 -3.171  -2.207  1.00 0.00 ? 12  ALA A N    4  
ATOM 7106  C CA   . ALA A 1 12  ? 99.973  -3.407  -3.613  1.00 0.00 ? 12  ALA A CA   4  
ATOM 7107  C C    . ALA A 1 12  ? 99.054  -2.305  -4.166  1.00 0.00 ? 12  ALA A C    4  
ATOM 7108  O O    . ALA A 1 12  ? 98.675  -2.336  -5.341  1.00 0.00 ? 12  ALA A O    4  
ATOM 7109  C CB   . ALA A 1 12  ? 99.389  -4.813  -3.819  1.00 0.00 ? 12  ALA A CB   4  
ATOM 7110  H H    . ALA A 1 12  ? 99.751  -3.616  -1.514  1.00 0.00 ? 12  ALA A H    4  
ATOM 7111  H HA   . ALA A 1 12  ? 100.907 -3.360  -4.158  1.00 0.00 ? 12  ALA A HA   4  
ATOM 7112  H HB1  . ALA A 1 12  ? 100.120 -5.551  -3.514  1.00 0.00 ? 12  ALA A HB1  4  
ATOM 7113  H HB2  . ALA A 1 12  ? 99.154  -4.961  -4.865  1.00 0.00 ? 12  ALA A HB2  4  
ATOM 7114  H HB3  . ALA A 1 12  ? 98.495  -4.937  -3.229  1.00 0.00 ? 12  ALA A HB3  4  
ATOM 7115  N N    . ALA A 1 13  ? 98.698  -1.327  -3.318  1.00 0.00 ? 13  ALA A N    4  
ATOM 7116  C CA   . ALA A 1 13  ? 98.041  -0.100  -3.791  1.00 0.00 ? 13  ALA A CA   4  
ATOM 7117  C C    . ALA A 1 13  ? 99.090  0.877   -4.308  1.00 0.00 ? 13  ALA A C    4  
ATOM 7118  O O    . ALA A 1 13  ? 98.898  1.513   -5.344  1.00 0.00 ? 13  ALA A O    4  
ATOM 7119  C CB   . ALA A 1 13  ? 97.205  0.582   -2.698  1.00 0.00 ? 13  ALA A CB   4  
ATOM 7120  H H    . ALA A 1 13  ? 98.869  -1.441  -2.360  1.00 0.00 ? 13  ALA A H    4  
ATOM 7121  H HA   . ALA A 1 13  ? 97.379  -0.367  -4.606  1.00 0.00 ? 13  ALA A HA   4  
ATOM 7122  H HB1  . ALA A 1 13  ? 96.820  1.521   -3.074  1.00 0.00 ? 13  ALA A HB1  4  
ATOM 7123  H HB2  . ALA A 1 13  ? 97.821  0.774   -1.833  1.00 0.00 ? 13  ALA A HB2  4  
ATOM 7124  H HB3  . ALA A 1 13  ? 96.377  -0.050  -2.415  1.00 0.00 ? 13  ALA A HB3  4  
ATOM 7125  N N    . SER A 1 14  ? 100.202 0.996   -3.580  1.00 0.00 ? 14  SER A N    4  
ATOM 7126  C CA   . SER A 1 14  ? 101.268 1.916   -3.965  1.00 0.00 ? 14  SER A CA   4  
ATOM 7127  C C    . SER A 1 14  ? 102.575 1.593   -3.240  1.00 0.00 ? 14  SER A C    4  
ATOM 7128  O O    . SER A 1 14  ? 102.566 1.096   -2.109  1.00 0.00 ? 14  SER A O    4  
ATOM 7129  C CB   . SER A 1 14  ? 100.852 3.363   -3.657  1.00 0.00 ? 14  SER A CB   4  
ATOM 7130  O OG   . SER A 1 14  ? 100.624 3.546   -2.267  1.00 0.00 ? 14  SER A OG   4  
ATOM 7131  H H    . SER A 1 14  ? 100.308 0.453   -2.765  1.00 0.00 ? 14  SER A H    4  
ATOM 7132  H HA   . SER A 1 14  ? 101.426 1.816   -5.029  1.00 0.00 ? 14  SER A HA   4  
ATOM 7133  H HB2  . SER A 1 14  ? 101.636 4.037   -3.970  1.00 0.00 ? 14  SER A HB2  4  
ATOM 7134  H HB3  . SER A 1 14  ? 99.943  3.597   -4.192  1.00 0.00 ? 14  SER A HB3  4  
ATOM 7135  H HG   . SER A 1 14  ? 99.684  3.707   -2.116  1.00 0.00 ? 14  SER A HG   4  
ATOM 7136  N N    . LEU A 1 15  ? 103.697 1.890   -3.901  1.00 0.00 ? 15  LEU A N    4  
ATOM 7137  C CA   . LEU A 1 15  ? 105.017 1.796   -3.278  1.00 0.00 ? 15  LEU A CA   4  
ATOM 7138  C C    . LEU A 1 15  ? 105.080 2.755   -2.090  1.00 0.00 ? 15  LEU A C    4  
ATOM 7139  O O    . LEU A 1 15  ? 105.794 2.524   -1.114  1.00 0.00 ? 15  LEU A O    4  
ATOM 7140  C CB   . LEU A 1 15  ? 106.111 2.138   -4.306  1.00 0.00 ? 15  LEU A CB   4  
ATOM 7141  C CG   . LEU A 1 15  ? 107.562 2.088   -3.786  1.00 0.00 ? 15  LEU A CG   4  
ATOM 7142  C CD1  . LEU A 1 15  ? 107.940 0.675   -3.348  1.00 0.00 ? 15  LEU A CD1  4  
ATOM 7143  C CD2  . LEU A 1 15  ? 108.534 2.603   -4.847  1.00 0.00 ? 15  LEU A CD2  4  
ATOM 7144  H H    . LEU A 1 15  ? 103.634 2.181   -4.835  1.00 0.00 ? 15  LEU A H    4  
ATOM 7145  H HA   . LEU A 1 15  ? 105.155 0.782   -2.926  1.00 0.00 ? 15  LEU A HA   4  
ATOM 7146  H HB2  . LEU A 1 15  ? 106.023 1.445   -5.132  1.00 0.00 ? 15  LEU A HB2  4  
ATOM 7147  H HB3  . LEU A 1 15  ? 105.921 3.135   -4.679  1.00 0.00 ? 15  LEU A HB3  4  
ATOM 7148  H HG   . LEU A 1 15  ? 107.646 2.732   -2.921  1.00 0.00 ? 15  LEU A HG   4  
ATOM 7149  H HD11 . LEU A 1 15  ? 108.955 0.672   -2.975  1.00 0.00 ? 15  LEU A HD11 4  
ATOM 7150  H HD12 . LEU A 1 15  ? 107.865 0.000   -4.189  1.00 0.00 ? 15  LEU A HD12 4  
ATOM 7151  H HD13 . LEU A 1 15  ? 107.270 0.348   -2.565  1.00 0.00 ? 15  LEU A HD13 4  
ATOM 7152  H HD21 . LEU A 1 15  ? 108.277 3.619   -5.109  1.00 0.00 ? 15  LEU A HD21 4  
ATOM 7153  H HD22 . LEU A 1 15  ? 108.475 1.979   -5.728  1.00 0.00 ? 15  LEU A HD22 4  
ATOM 7154  H HD23 . LEU A 1 15  ? 109.541 2.578   -4.456  1.00 0.00 ? 15  LEU A HD23 4  
ATOM 7155  N N    . GLU A 1 16  ? 104.301 3.828   -2.195  1.00 0.00 ? 16  GLU A N    4  
ATOM 7156  C CA   . GLU A 1 16  ? 104.168 4.819   -1.134  1.00 0.00 ? 16  GLU A CA   4  
ATOM 7157  C C    . GLU A 1 16  ? 103.730 4.150   0.169   1.00 0.00 ? 16  GLU A C    4  
ATOM 7158  O O    . GLU A 1 16  ? 104.407 4.253   1.195   1.00 0.00 ? 16  GLU A O    4  
ATOM 7159  C CB   . GLU A 1 16  ? 103.142 5.873   -1.566  1.00 0.00 ? 16  GLU A CB   4  
ATOM 7160  C CG   . GLU A 1 16  ? 103.527 6.600   -2.852  1.00 0.00 ? 16  GLU A CG   4  
ATOM 7161  C CD   . GLU A 1 16  ? 102.334 7.197   -3.578  1.00 0.00 ? 16  GLU A CD   4  
ATOM 7162  O OE1  . GLU A 1 16  ? 101.737 8.167   -3.065  1.00 0.00 ? 16  GLU A OE1  4  
ATOM 7163  O OE2  . GLU A 1 16  ? 101.997 6.711   -4.681  1.00 0.00 ? 16  GLU A OE2  4  
ATOM 7164  H H    . GLU A 1 16  ? 103.793 3.956   -3.022  1.00 0.00 ? 16  GLU A H    4  
ATOM 7165  H HA   . GLU A 1 16  ? 105.129 5.292   -0.988  1.00 0.00 ? 16  GLU A HA   4  
ATOM 7166  H HB2  . GLU A 1 16  ? 102.187 5.388   -1.720  1.00 0.00 ? 16  GLU A HB2  4  
ATOM 7167  H HB3  . GLU A 1 16  ? 103.039 6.607   -0.779  1.00 0.00 ? 16  GLU A HB3  4  
ATOM 7168  H HG2  . GLU A 1 16  ? 104.215 7.397   -2.608  1.00 0.00 ? 16  GLU A HG2  4  
ATOM 7169  H HG3  . GLU A 1 16  ? 104.020 5.898   -3.512  1.00 0.00 ? 16  GLU A HG3  4  
ATOM 7170  N N    . ASN A 1 17  ? 102.603 3.441   0.104   1.00 0.00 ? 17  ASN A N    4  
ATOM 7171  C CA   . ASN A 1 17  ? 102.073 2.714   1.251   1.00 0.00 ? 17  ASN A CA   4  
ATOM 7172  C C    . ASN A 1 17  ? 103.110 1.745   1.798   1.00 0.00 ? 17  ASN A C    4  
ATOM 7173  O O    . ASN A 1 17  ? 103.259 1.601   3.008   1.00 0.00 ? 17  ASN A O    4  
ATOM 7174  C CB   . ASN A 1 17  ? 100.812 1.946   0.854   1.00 0.00 ? 17  ASN A CB   4  
ATOM 7175  C CG   . ASN A 1 17  ? 99.608  2.848   0.642   1.00 0.00 ? 17  ASN A CG   4  
ATOM 7176  O OD1  . ASN A 1 17  ? 99.484  3.901   1.265   1.00 0.00 ? 17  ASN A OD1  4  
ATOM 7177  N ND2  . ASN A 1 17  ? 98.711  2.434   -0.237  1.00 0.00 ? 17  ASN A ND2  4  
ATOM 7178  H H    . ASN A 1 17  ? 102.113 3.401   -0.745  1.00 0.00 ? 17  ASN A H    4  
ATOM 7179  H HA   . ASN A 1 17  ? 101.824 3.433   2.018   1.00 0.00 ? 17  ASN A HA   4  
ATOM 7180  H HB2  . ASN A 1 17  ? 101.002 1.412   -0.066  1.00 0.00 ? 17  ASN A HB2  4  
ATOM 7181  H HB3  . ASN A 1 17  ? 100.578 1.237   1.626   1.00 0.00 ? 17  ASN A HB3  4  
ATOM 7182  H HD21 . ASN A 1 17  ? 98.873  1.581   -0.691  1.00 0.00 ? 17  ASN A HD21 4  
ATOM 7183  H HD22 . ASN A 1 17  ? 97.925  2.998   -0.400  1.00 0.00 ? 17  ASN A HD22 4  
ATOM 7184  N N    . LEU A 1 18  ? 103.818 1.084   0.894   1.00 0.00 ? 18  LEU A N    4  
ATOM 7185  C CA   . LEU A 1 18  ? 104.895 0.170   1.269   1.00 0.00 ? 18  LEU A CA   4  
ATOM 7186  C C    . LEU A 1 18  ? 105.954 0.885   2.113   1.00 0.00 ? 18  LEU A C    4  
ATOM 7187  O O    . LEU A 1 18  ? 106.426 0.347   3.112   1.00 0.00 ? 18  LEU A O    4  
ATOM 7188  C CB   . LEU A 1 18  ? 105.521 -0.450  0.009   1.00 0.00 ? 18  LEU A CB   4  
ATOM 7189  C CG   . LEU A 1 18  ? 106.777 -1.313  0.233   1.00 0.00 ? 18  LEU A CG   4  
ATOM 7190  C CD1  . LEU A 1 18  ? 106.560 -2.322  1.356   1.00 0.00 ? 18  LEU A CD1  4  
ATOM 7191  C CD2  . LEU A 1 18  ? 107.173 -2.025  -1.058  1.00 0.00 ? 18  LEU A CD2  4  
ATOM 7192  H H    . LEU A 1 18  ? 103.602 1.206   -0.055  1.00 0.00 ? 18  LEU A H    4  
ATOM 7193  H HA   . LEU A 1 18  ? 104.461 -0.619  1.864   1.00 0.00 ? 18  LEU A HA   4  
ATOM 7194  H HB2  . LEU A 1 18  ? 104.771 -1.065  -0.470  1.00 0.00 ? 18  LEU A HB2  4  
ATOM 7195  H HB3  . LEU A 1 18  ? 105.782 0.352   -0.666  1.00 0.00 ? 18  LEU A HB3  4  
ATOM 7196  H HG   . LEU A 1 18  ? 107.597 -0.671  0.523   1.00 0.00 ? 18  LEU A HG   4  
ATOM 7197  H HD11 . LEU A 1 18  ? 105.653 -2.881  1.174   1.00 0.00 ? 18  LEU A HD11 4  
ATOM 7198  H HD12 . LEU A 1 18  ? 106.482 -1.797  2.301   1.00 0.00 ? 18  LEU A HD12 4  
ATOM 7199  H HD13 . LEU A 1 18  ? 107.399 -3.000  1.393   1.00 0.00 ? 18  LEU A HD13 4  
ATOM 7200  H HD21 . LEU A 1 18  ? 107.375 -1.292  -1.826  1.00 0.00 ? 18  LEU A HD21 4  
ATOM 7201  H HD22 . LEU A 1 18  ? 106.367 -2.669  -1.380  1.00 0.00 ? 18  LEU A HD22 4  
ATOM 7202  H HD23 . LEU A 1 18  ? 108.060 -2.617  -0.886  1.00 0.00 ? 18  LEU A HD23 4  
ATOM 7203  N N    . LEU A 1 19  ? 106.301 2.104   1.718   1.00 0.00 ? 19  LEU A N    4  
ATOM 7204  C CA   . LEU A 1 19  ? 107.310 2.891   2.429   1.00 0.00 ? 19  LEU A CA   4  
ATOM 7205  C C    . LEU A 1 19  ? 106.677 3.702   3.566   1.00 0.00 ? 19  LEU A C    4  
ATOM 7206  O O    . LEU A 1 19  ? 107.365 4.447   4.272   1.00 0.00 ? 19  LEU A O    4  
ATOM 7207  C CB   . LEU A 1 19  ? 108.038 3.821   1.447   1.00 0.00 ? 19  LEU A CB   4  
ATOM 7208  C CG   . LEU A 1 19  ? 108.799 3.109   0.314   1.00 0.00 ? 19  LEU A CG   4  
ATOM 7209  C CD1  . LEU A 1 19  ? 109.399 4.120   -0.659  1.00 0.00 ? 19  LEU A CD1  4  
ATOM 7210  C CD2  . LEU A 1 19  ? 109.887 2.197   0.881   1.00 0.00 ? 19  LEU A CD2  4  
ATOM 7211  H H    . LEU A 1 19  ? 105.871 2.488   0.923   1.00 0.00 ? 19  LEU A H    4  
ATOM 7212  H HA   . LEU A 1 19  ? 108.028 2.204   2.856   1.00 0.00 ? 19  LEU A HA   4  
ATOM 7213  H HB2  . LEU A 1 19  ? 107.305 4.482   1.002   1.00 0.00 ? 19  LEU A HB2  4  
ATOM 7214  H HB3  . LEU A 1 19  ? 108.744 4.421   2.005   1.00 0.00 ? 19  LEU A HB3  4  
ATOM 7215  H HG   . LEU A 1 19  ? 108.105 2.492   -0.240  1.00 0.00 ? 19  LEU A HG   4  
ATOM 7216  H HD11 . LEU A 1 19  ? 110.095 4.760   -0.135  1.00 0.00 ? 19  LEU A HD11 4  
ATOM 7217  H HD12 . LEU A 1 19  ? 108.609 4.721   -1.086  1.00 0.00 ? 19  LEU A HD12 4  
ATOM 7218  H HD13 . LEU A 1 19  ? 109.917 3.597   -1.450  1.00 0.00 ? 19  LEU A HD13 4  
ATOM 7219  H HD21 . LEU A 1 19  ? 110.590 2.785   1.455   1.00 0.00 ? 19  LEU A HD21 4  
ATOM 7220  H HD22 . LEU A 1 19  ? 110.406 1.708   0.070   1.00 0.00 ? 19  LEU A HD22 4  
ATOM 7221  H HD23 . LEU A 1 19  ? 109.437 1.451   1.519   1.00 0.00 ? 19  LEU A HD23 4  
ATOM 7222  N N    . GLU A 1 20  ? 105.365 3.553   3.735   1.00 0.00 ? 20  GLU A N    4  
ATOM 7223  C CA   . GLU A 1 20  ? 104.621 4.280   4.767   1.00 0.00 ? 20  GLU A CA   4  
ATOM 7224  C C    . GLU A 1 20  ? 104.185 3.346   5.904   1.00 0.00 ? 20  GLU A C    4  
ATOM 7225  O O    . GLU A 1 20  ? 104.108 3.759   7.065   1.00 0.00 ? 20  GLU A O    4  
ATOM 7226  C CB   . GLU A 1 20  ? 103.396 4.960   4.135   1.00 0.00 ? 20  GLU A CB   4  
ATOM 7227  C CG   . GLU A 1 20  ? 102.571 5.802   5.104   1.00 0.00 ? 20  GLU A CG   4  
ATOM 7228  C CD   . GLU A 1 20  ? 101.421 6.523   4.416   1.00 0.00 ? 20  GLU A CD   4  
ATOM 7229  O OE1  . GLU A 1 20  ? 101.653 7.609   3.837   1.00 0.00 ? 20  GLU A OE1  4  
ATOM 7230  O OE2  . GLU A 1 20  ? 100.280 6.013   4.448   1.00 0.00 ? 20  GLU A OE2  4  
ATOM 7231  H H    . GLU A 1 20  ? 104.878 2.948   3.136   1.00 0.00 ? 20  GLU A H    4  
ATOM 7232  H HA   . GLU A 1 20  ? 105.273 5.042   5.175   1.00 0.00 ? 20  GLU A HA   4  
ATOM 7233  H HB2  . GLU A 1 20  ? 103.733 5.603   3.334   1.00 0.00 ? 20  GLU A HB2  4  
ATOM 7234  H HB3  . GLU A 1 20  ? 102.753 4.196   3.719   1.00 0.00 ? 20  GLU A HB3  4  
ATOM 7235  H HG2  . GLU A 1 20  ? 102.167 5.155   5.871   1.00 0.00 ? 20  GLU A HG2  4  
ATOM 7236  H HG3  . GLU A 1 20  ? 103.217 6.537   5.562   1.00 0.00 ? 20  GLU A HG3  4  
ATOM 7237  N N    . ASP A 1 21  ? 103.914 2.087   5.568   1.00 0.00 ? 21  ASP A N    4  
ATOM 7238  C CA   . ASP A 1 21  ? 103.388 1.116   6.533   1.00 0.00 ? 21  ASP A CA   4  
ATOM 7239  C C    . ASP A 1 21  ? 104.526 0.374   7.238   1.00 0.00 ? 21  ASP A C    4  
ATOM 7240  O O    . ASP A 1 21  ? 105.473 -0.076  6.588   1.00 0.00 ? 21  ASP A O    4  
ATOM 7241  C CB   . ASP A 1 21  ? 102.460 0.117   5.823   1.00 0.00 ? 21  ASP A CB   4  
ATOM 7242  C CG   . ASP A 1 21  ? 101.889 -0.937  6.765   1.00 0.00 ? 21  ASP A CG   4  
ATOM 7243  O OD1  . ASP A 1 21  ? 100.856 -0.665  7.416   1.00 0.00 ? 21  ASP A OD1  4  
ATOM 7244  O OD2  . ASP A 1 21  ? 102.473 -2.037  6.858   1.00 0.00 ? 21  ASP A OD2  4  
ATOM 7245  H H    . ASP A 1 21  ? 104.083 1.796   4.649   1.00 0.00 ? 21  ASP A H    4  
ATOM 7246  H HA   . ASP A 1 21  ? 102.815 1.661   7.270   1.00 0.00 ? 21  ASP A HA   4  
ATOM 7247  H HB2  . ASP A 1 21  ? 101.636 0.657   5.378   1.00 0.00 ? 21  ASP A HB2  4  
ATOM 7248  H HB3  . ASP A 1 21  ? 103.014 -0.385  5.041   1.00 0.00 ? 21  ASP A HB3  4  
ATOM 7249  N N    . PRO A 1 22  ? 104.448 0.237   8.582   1.00 0.00 ? 22  PRO A N    4  
ATOM 7250  C CA   . PRO A 1 22  ? 105.483 -0.440  9.379   1.00 0.00 ? 22  PRO A CA   4  
ATOM 7251  C C    . PRO A 1 22  ? 105.769 -1.861  8.886   1.00 0.00 ? 22  PRO A C    4  
ATOM 7252  O O    . PRO A 1 22  ? 106.895 -2.168  8.488   1.00 0.00 ? 22  PRO A O    4  
ATOM 7253  C CB   . PRO A 1 22  ? 104.901 -0.459  10.809  1.00 0.00 ? 22  PRO A CB   4  
ATOM 7254  C CG   . PRO A 1 22  ? 103.449 -0.147  10.647  1.00 0.00 ? 22  PRO A CG   4  
ATOM 7255  C CD   . PRO A 1 22  ? 103.352 0.735   9.434   1.00 0.00 ? 22  PRO A CD   4  
ATOM 7256  H HA   . PRO A 1 22  ? 106.407 0.125   9.376   1.00 0.00 ? 22  PRO A HA   4  
ATOM 7257  H HB2  . PRO A 1 22  ? 105.049 -1.434  11.254  1.00 0.00 ? 22  PRO A HB2  4  
ATOM 7258  H HB3  . PRO A 1 22  ? 105.398 0.290   11.411  1.00 0.00 ? 22  PRO A HB3  4  
ATOM 7259  H HG2  . PRO A 1 22  ? 102.891 -1.061  10.492  1.00 0.00 ? 22  PRO A HG2  4  
ATOM 7260  H HG3  . PRO A 1 22  ? 103.081 0.372   11.521  1.00 0.00 ? 22  PRO A HG3  4  
ATOM 7261  H HD2  . PRO A 1 22  ? 102.394 0.610   8.949   1.00 0.00 ? 22  PRO A HD2  4  
ATOM 7262  H HD3  . PRO A 1 22  ? 103.511 1.771   9.702   1.00 0.00 ? 22  PRO A HD3  4  
ATOM 7263  N N    . GLU A 1 23  ? 104.743 -2.714  8.889   1.00 0.00 ? 23  GLU A N    4  
ATOM 7264  C CA   . GLU A 1 23  ? 104.894 -4.107  8.468   1.00 0.00 ? 23  GLU A CA   4  
ATOM 7265  C C    . GLU A 1 23  ? 105.429 -4.174  7.050   1.00 0.00 ? 23  GLU A C    4  
ATOM 7266  O O    . GLU A 1 23  ? 106.220 -5.055  6.716   1.00 0.00 ? 23  GLU A O    4  
ATOM 7267  C CB   . GLU A 1 23  ? 103.560 -4.861  8.558   1.00 0.00 ? 23  GLU A CB   4  
ATOM 7268  C CG   . GLU A 1 23  ? 103.150 -5.221  9.978   1.00 0.00 ? 23  GLU A CG   4  
ATOM 7269  C CD   . GLU A 1 23  ? 104.170 -6.114  10.669  1.00 0.00 ? 23  GLU A CD   4  
ATOM 7270  O OE1  . GLU A 1 23  ? 104.370 -7.266  10.218  1.00 0.00 ? 23  GLU A OE1  4  
ATOM 7271  O OE2  . GLU A 1 23  ? 104.777 -5.672  11.667  1.00 0.00 ? 23  GLU A OE2  4  
ATOM 7272  H H    . GLU A 1 23  ? 103.861 -2.392  9.155   1.00 0.00 ? 23  GLU A H    4  
ATOM 7273  H HA   . GLU A 1 23  ? 105.609 -4.576  9.131   1.00 0.00 ? 23  GLU A HA   4  
ATOM 7274  H HB2  . GLU A 1 23  ? 102.783 -4.245  8.127   1.00 0.00 ? 23  GLU A HB2  4  
ATOM 7275  H HB3  . GLU A 1 23  ? 103.635 -5.777  7.986   1.00 0.00 ? 23  GLU A HB3  4  
ATOM 7276  H HG2  . GLU A 1 23  ? 103.037 -4.309  10.549  1.00 0.00 ? 23  GLU A HG2  4  
ATOM 7277  H HG3  . GLU A 1 23  ? 102.201 -5.740  9.945   1.00 0.00 ? 23  GLU A HG3  4  
ATOM 7278  N N    . GLY A 1 24  ? 104.993 -3.227  6.229   1.00 0.00 ? 24  GLY A N    4  
ATOM 7279  C CA   . GLY A 1 24  ? 105.483 -3.132  4.875   1.00 0.00 ? 24  GLY A CA   4  
ATOM 7280  C C    . GLY A 1 24  ? 106.984 -3.002  4.839   1.00 0.00 ? 24  GLY A C    4  
ATOM 7281  O O    . GLY A 1 24  ? 107.671 -3.886  4.348   1.00 0.00 ? 24  GLY A O    4  
ATOM 7282  H H    . GLY A 1 24  ? 104.326 -2.585  6.552   1.00 0.00 ? 24  GLY A H    4  
ATOM 7283  H HA2  . GLY A 1 24  ? 105.188 -4.018  4.329   1.00 0.00 ? 24  GLY A HA2  4  
ATOM 7284  H HA3  . GLY A 1 24  ? 105.045 -2.266  4.403   1.00 0.00 ? 24  GLY A HA3  4  
ATOM 7285  N N    . VAL A 1 25  ? 107.493 -1.918  5.410   1.00 0.00 ? 25  VAL A N    4  
ATOM 7286  C CA   . VAL A 1 25  ? 108.926 -1.644  5.407   1.00 0.00 ? 25  VAL A CA   4  
ATOM 7287  C C    . VAL A 1 25  ? 109.714 -2.746  6.125   1.00 0.00 ? 25  VAL A C    4  
ATOM 7288  O O    . VAL A 1 25  ? 110.831 -3.078  5.723   1.00 0.00 ? 25  VAL A O    4  
ATOM 7289  C CB   . VAL A 1 25  ? 109.230 -0.270  6.051   1.00 0.00 ? 25  VAL A CB   4  
ATOM 7290  C CG1  . VAL A 1 25  ? 110.726 0.044   6.002   1.00 0.00 ? 25  VAL A CG1  4  
ATOM 7291  C CG2  . VAL A 1 25  ? 108.420 0.822   5.357   1.00 0.00 ? 25  VAL A CG2  4  
ATOM 7292  H H    . VAL A 1 25  ? 106.882 -1.278  5.842   1.00 0.00 ? 25  VAL A H    4  
ATOM 7293  H HA   . VAL A 1 25  ? 109.249 -1.607  4.374   1.00 0.00 ? 25  VAL A HA   4  
ATOM 7294  H HB   . VAL A 1 25  ? 108.927 -0.306  7.089   1.00 0.00 ? 25  VAL A HB   4  
ATOM 7295  H HG11 . VAL A 1 25  ? 111.056 0.066   4.973   1.00 0.00 ? 25  VAL A HG11 4  
ATOM 7296  H HG12 . VAL A 1 25  ? 111.274 -0.718  6.538   1.00 0.00 ? 25  VAL A HG12 4  
ATOM 7297  H HG13 . VAL A 1 25  ? 110.909 1.005   6.459   1.00 0.00 ? 25  VAL A HG13 4  
ATOM 7298  H HG21 . VAL A 1 25  ? 108.671 0.843   4.304   1.00 0.00 ? 25  VAL A HG21 4  
ATOM 7299  H HG22 . VAL A 1 25  ? 108.645 1.781   5.800   1.00 0.00 ? 25  VAL A HG22 4  
ATOM 7300  H HG23 . VAL A 1 25  ? 107.365 0.613   5.466   1.00 0.00 ? 25  VAL A HG23 4  
ATOM 7301  N N    . LYS A 1 26  ? 109.127 -3.320  7.179   1.00 0.00 ? 26  LYS A N    4  
ATOM 7302  C CA   . LYS A 1 26  ? 109.781 -4.404  7.919   1.00 0.00 ? 26  LYS A CA   4  
ATOM 7303  C C    . LYS A 1 26  ? 109.943 -5.641  7.031   1.00 0.00 ? 26  LYS A C    4  
ATOM 7304  O O    . LYS A 1 26  ? 111.063 -6.089  6.771   1.00 0.00 ? 26  LYS A O    4  
ATOM 7305  C CB   . LYS A 1 26  ? 108.994 -4.766  9.199   1.00 0.00 ? 26  LYS A CB   4  
ATOM 7306  C CG   . LYS A 1 26  ? 109.459 -4.059  10.484  1.00 0.00 ? 26  LYS A CG   4  
ATOM 7307  C CD   . LYS A 1 26  ? 109.066 -2.579  10.549  1.00 0.00 ? 26  LYS A CD   4  
ATOM 7308  C CE   . LYS A 1 26  ? 110.055 -1.666  9.828   1.00 0.00 ? 26  LYS A CE   4  
ATOM 7309  N NZ   . LYS A 1 26  ? 111.388 -1.659  10.486  1.00 0.00 ? 26  LYS A NZ   4  
ATOM 7310  H H    . LYS A 1 26  ? 108.231 -3.019  7.453   1.00 0.00 ? 26  LYS A H    4  
ATOM 7311  H HA   . LYS A 1 26  ? 110.765 -4.057  8.203   1.00 0.00 ? 26  LYS A HA   4  
ATOM 7312  H HB2  . LYS A 1 26  ? 107.953 -4.520  9.044   1.00 0.00 ? 26  LYS A HB2  4  
ATOM 7313  H HB3  . LYS A 1 26  ? 109.070 -5.834  9.362   1.00 0.00 ? 26  LYS A HB3  4  
ATOM 7314  H HG2  . LYS A 1 26  ? 109.019 -4.565  11.332  1.00 0.00 ? 26  LYS A HG2  4  
ATOM 7315  H HG3  . LYS A 1 26  ? 110.537 -4.138  10.549  1.00 0.00 ? 26  LYS A HG3  4  
ATOM 7316  H HD2  . LYS A 1 26  ? 108.093 -2.458  10.099  1.00 0.00 ? 26  LYS A HD2  4  
ATOM 7317  H HD3  . LYS A 1 26  ? 109.013 -2.282  11.588  1.00 0.00 ? 26  LYS A HD3  4  
ATOM 7318  H HE2  . LYS A 1 26  ? 110.168 -2.006  8.810   1.00 0.00 ? 26  LYS A HE2  4  
ATOM 7319  H HE3  . LYS A 1 26  ? 109.660 -0.659  9.827   1.00 0.00 ? 26  LYS A HE3  4  
ATOM 7320  H HZ1  . LYS A 1 26  ? 112.017 -0.980  10.013  1.00 0.00 ? 26  LYS A HZ1  4  
ATOM 7321  H HZ2  . LYS A 1 26  ? 111.820 -2.604  10.439  1.00 0.00 ? 26  LYS A HZ2  4  
ATOM 7322  H HZ3  . LYS A 1 26  ? 111.293 -1.386  11.486  1.00 0.00 ? 26  LYS A HZ3  4  
ATOM 7323  N N    . ARG A 1 27  ? 108.820 -6.172  6.545   1.00 0.00 ? 27  ARG A N    4  
ATOM 7324  C CA   . ARG A 1 27  ? 108.830 -7.392  5.738   1.00 0.00 ? 27  ARG A CA   4  
ATOM 7325  C C    . ARG A 1 27  ? 109.499 -7.139  4.388   1.00 0.00 ? 27  ARG A C    4  
ATOM 7326  O O    . ARG A 1 27  ? 110.088 -8.042  3.803   1.00 0.00 ? 27  ARG A O    4  
ATOM 7327  C CB   . ARG A 1 27  ? 107.403 -7.933  5.544   1.00 0.00 ? 27  ARG A CB   4  
ATOM 7328  C CG   . ARG A 1 27  ? 106.675 -8.207  6.860   1.00 0.00 ? 27  ARG A CG   4  
ATOM 7329  C CD   . ARG A 1 27  ? 105.271 -8.777  6.653   1.00 0.00 ? 27  ARG A CD   4  
ATOM 7330  N NE   . ARG A 1 27  ? 104.640 -9.115  7.932   1.00 0.00 ? 27  ARG A NE   4  
ATOM 7331  C CZ   . ARG A 1 27  ? 104.038 -10.278 8.195   1.00 0.00 ? 27  ARG A CZ   4  
ATOM 7332  N NH1  . ARG A 1 27  ? 103.939 -11.214 7.256   1.00 0.00 ? 27  ARG A NH1  4  
ATOM 7333  N NH2  . ARG A 1 27  ? 103.536 -10.503 9.402   1.00 0.00 ? 27  ARG A NH2  4  
ATOM 7334  H H    . ARG A 1 27  ? 107.966 -5.726  6.724   1.00 0.00 ? 27  ARG A H    4  
ATOM 7335  H HA   . ARG A 1 27  ? 109.412 -8.131  6.273   1.00 0.00 ? 27  ARG A HA   4  
ATOM 7336  H HB2  . ARG A 1 27  ? 106.827 -7.215  4.977   1.00 0.00 ? 27  ARG A HB2  4  
ATOM 7337  H HB3  . ARG A 1 27  ? 107.459 -8.861  4.990   1.00 0.00 ? 27  ARG A HB3  4  
ATOM 7338  H HG2  . ARG A 1 27  ? 107.253 -8.915  7.436   1.00 0.00 ? 27  ARG A HG2  4  
ATOM 7339  H HG3  . ARG A 1 27  ? 106.597 -7.279  7.412   1.00 0.00 ? 27  ARG A HG3  4  
ATOM 7340  H HD2  . ARG A 1 27  ? 104.658 -8.042  6.144   1.00 0.00 ? 27  ARG A HD2  4  
ATOM 7341  H HD3  . ARG A 1 27  ? 105.339 -9.670  6.045   1.00 0.00 ? 27  ARG A HD3  4  
ATOM 7342  H HE   . ARG A 1 27  ? 104.680 -8.433  8.644   1.00 0.00 ? 27  ARG A HE   4  
ATOM 7343  H HH11 . ARG A 1 27  ? 104.317 -11.054 6.344   1.00 0.00 ? 27  ARG A HH11 4  
ATOM 7344  H HH12 . ARG A 1 27  ? 103.480 -12.088 7.458   1.00 0.00 ? 27  ARG A HH12 4  
ATOM 7345  H HH21 . ARG A 1 27  ? 103.607 -9.802  10.116  1.00 0.00 ? 27  ARG A HH21 4  
ATOM 7346  H HH22 . ARG A 1 27  ? 103.087 -11.379 9.609   1.00 0.00 ? 27  ARG A HH22 4  
ATOM 7347  N N    . PHE A 1 28  ? 109.421 -5.897  3.918   1.00 0.00 ? 28  PHE A N    4  
ATOM 7348  C CA   . PHE A 1 28  ? 110.071 -5.487  2.675   1.00 0.00 ? 28  PHE A CA   4  
ATOM 7349  C C    . PHE A 1 28  ? 111.583 -5.573  2.825   1.00 0.00 ? 28  PHE A C    4  
ATOM 7350  O O    . PHE A 1 28  ? 112.277 -6.120  1.963   1.00 0.00 ? 28  PHE A O    4  
ATOM 7351  C CB   . PHE A 1 28  ? 109.655 -4.054  2.319   1.00 0.00 ? 28  PHE A CB   4  
ATOM 7352  C CG   . PHE A 1 28  ? 110.182 -3.540  1.002   1.00 0.00 ? 28  PHE A CG   4  
ATOM 7353  C CD1  . PHE A 1 28  ? 110.036 -4.282  -0.159  1.00 0.00 ? 28  PHE A CD1  4  
ATOM 7354  C CD2  . PHE A 1 28  ? 110.797 -2.298  0.924   1.00 0.00 ? 28  PHE A CD2  4  
ATOM 7355  C CE1  . PHE A 1 28  ? 110.493 -3.799  -1.370  1.00 0.00 ? 28  PHE A CE1  4  
ATOM 7356  C CE2  . PHE A 1 28  ? 111.259 -1.812  -0.283  1.00 0.00 ? 28  PHE A CE2  4  
ATOM 7357  C CZ   . PHE A 1 28  ? 111.106 -2.562  -1.432  1.00 0.00 ? 28  PHE A CZ   4  
ATOM 7358  H H    . PHE A 1 28  ? 108.902 -5.237  4.418   1.00 0.00 ? 28  PHE A H    4  
ATOM 7359  H HA   . PHE A 1 28  ? 109.752 -6.157  1.889   1.00 0.00 ? 28  PHE A HA   4  
ATOM 7360  H HB2  . PHE A 1 28  ? 108.578 -4.008  2.278   1.00 0.00 ? 28  PHE A HB2  4  
ATOM 7361  H HB3  . PHE A 1 28  ? 110.000 -3.388  3.100   1.00 0.00 ? 28  PHE A HB3  4  
ATOM 7362  H HD1  . PHE A 1 28  ? 109.560 -5.251  -0.112  1.00 0.00 ? 28  PHE A HD1  4  
ATOM 7363  H HD2  . PHE A 1 28  ? 110.919 -1.710  1.823   1.00 0.00 ? 28  PHE A HD2  4  
ATOM 7364  H HE1  . PHE A 1 28  ? 110.372 -4.388  -2.267  1.00 0.00 ? 28  PHE A HE1  4  
ATOM 7365  H HE2  . PHE A 1 28  ? 111.737 -0.844  -0.328  1.00 0.00 ? 28  PHE A HE2  4  
ATOM 7366  H HZ   . PHE A 1 28  ? 111.463 -2.181  -2.378  1.00 0.00 ? 28  PHE A HZ   4  
ATOM 7367  N N    . ARG A 1 29  ? 112.089 -5.037  3.934   1.00 0.00 ? 29  ARG A N    4  
ATOM 7368  C CA   . ARG A 1 29  ? 113.513 -5.096  4.225   1.00 0.00 ? 29  ARG A CA   4  
ATOM 7369  C C    . ARG A 1 29  ? 113.946 -6.542  4.398   1.00 0.00 ? 29  ARG A C    4  
ATOM 7370  O O    . ARG A 1 29  ? 115.015 -6.934  3.947   1.00 0.00 ? 29  ARG A O    4  
ATOM 7371  C CB   . ARG A 1 29  ? 113.860 -4.311  5.495   1.00 0.00 ? 29  ARG A CB   4  
ATOM 7372  C CG   . ARG A 1 29  ? 115.353 -4.330  5.803   1.00 0.00 ? 29  ARG A CG   4  
ATOM 7373  C CD   . ARG A 1 29  ? 115.690 -3.715  7.152   1.00 0.00 ? 29  ARG A CD   4  
ATOM 7374  N NE   . ARG A 1 29  ? 117.087 -3.972  7.504   1.00 0.00 ? 29  ARG A NE   4  
ATOM 7375  C CZ   . ARG A 1 29  ? 117.726 -3.440  8.542   1.00 0.00 ? 29  ARG A CZ   4  
ATOM 7376  N NH1  . ARG A 1 29  ? 117.126 -2.551  9.331   1.00 0.00 ? 29  ARG A NH1  4  
ATOM 7377  N NH2  . ARG A 1 29  ? 118.983 -3.787  8.772   1.00 0.00 ? 29  ARG A NH2  4  
ATOM 7378  H H    . ARG A 1 29  ? 111.486 -4.596  4.571   1.00 0.00 ? 29  ARG A H    4  
ATOM 7379  H HA   . ARG A 1 29  ? 114.043 -4.667  3.385   1.00 0.00 ? 29  ARG A HA   4  
ATOM 7380  H HB2  . ARG A 1 29  ? 113.544 -3.287  5.371   1.00 0.00 ? 29  ARG A HB2  4  
ATOM 7381  H HB3  . ARG A 1 29  ? 113.332 -4.744  6.333   1.00 0.00 ? 29  ARG A HB3  4  
ATOM 7382  H HG2  . ARG A 1 29  ? 115.696 -5.355  5.797   1.00 0.00 ? 29  ARG A HG2  4  
ATOM 7383  H HG3  . ARG A 1 29  ? 115.873 -3.778  5.029   1.00 0.00 ? 29  ARG A HG3  4  
ATOM 7384  H HD2  . ARG A 1 29  ? 115.524 -2.648  7.105   1.00 0.00 ? 29  ARG A HD2  4  
ATOM 7385  H HD3  . ARG A 1 29  ? 115.051 -4.150  7.908   1.00 0.00 ? 29  ARG A HD3  4  
ATOM 7386  H HE   . ARG A 1 29  ? 117.583 -4.601  6.927   1.00 0.00 ? 29  ARG A HE   4  
ATOM 7387  H HH11 . ARG A 1 29  ? 116.180 -2.269  9.148   1.00 0.00 ? 29  ARG A HH11 4  
ATOM 7388  H HH12 . ARG A 1 29  ? 117.623 -2.148  10.109  1.00 0.00 ? 29  ARG A HH12 4  
ATOM 7389  H HH21 . ARG A 1 29  ? 119.444 -4.444  8.162   1.00 0.00 ? 29  ARG A HH21 4  
ATOM 7390  H HH22 . ARG A 1 29  ? 119.480 -3.401  9.552   1.00 0.00 ? 29  ARG A HH22 4  
ATOM 7391  N N    . GLU A 1 30  ? 113.100 -7.320  5.059   1.00 0.00 ? 30  GLU A N    4  
ATOM 7392  C CA   . GLU A 1 30  ? 113.354 -8.719  5.324   1.00 0.00 ? 30  GLU A CA   4  
ATOM 7393  C C    . GLU A 1 30  ? 113.354 -9.540  4.030   1.00 0.00 ? 30  GLU A C    4  
ATOM 7394  O O    . GLU A 1 30  ? 114.206 -10.410 3.832   1.00 0.00 ? 30  GLU A O    4  
ATOM 7395  C CB   . GLU A 1 30  ? 112.288 -9.198  6.309   1.00 0.00 ? 30  GLU A CB   4  
ATOM 7396  C CG   . GLU A 1 30  ? 112.080 -10.694 6.359   1.00 0.00 ? 30  GLU A CG   4  
ATOM 7397  C CD   . GLU A 1 30  ? 113.317 -11.463 6.806   1.00 0.00 ? 30  GLU A CD   4  
ATOM 7398  O OE1  . GLU A 1 30  ? 113.956 -11.051 7.800   1.00 0.00 ? 30  GLU A OE1  4  
ATOM 7399  O OE2  . GLU A 1 30  ? 113.648 -12.486 6.175   1.00 0.00 ? 30  GLU A OE2  4  
ATOM 7400  H H    . GLU A 1 30  ? 112.259 -6.938  5.390   1.00 0.00 ? 30  GLU A H    4  
ATOM 7401  H HA   . GLU A 1 30  ? 114.325 -8.800  5.791   1.00 0.00 ? 30  GLU A HA   4  
ATOM 7402  H HB2  . GLU A 1 30  ? 112.571 -8.872  7.300   1.00 0.00 ? 30  GLU A HB2  4  
ATOM 7403  H HB3  . GLU A 1 30  ? 111.345 -8.736  6.049   1.00 0.00 ? 30  GLU A HB3  4  
ATOM 7404  H HG2  . GLU A 1 30  ? 111.279 -10.887 7.046   1.00 0.00 ? 30  GLU A HG2  4  
ATOM 7405  H HG3  . GLU A 1 30  ? 111.792 -11.030 5.372   1.00 0.00 ? 30  GLU A HG3  4  
ATOM 7406  N N    . PHE A 1 31  ? 112.416 -9.247  3.141   1.00 0.00 ? 31  PHE A N    4  
ATOM 7407  C CA   . PHE A 1 31  ? 112.343 -9.935  1.860   1.00 0.00 ? 31  PHE A CA   4  
ATOM 7408  C C    . PHE A 1 31  ? 113.579 -9.596  1.031   1.00 0.00 ? 31  PHE A C    4  
ATOM 7409  O O    . PHE A 1 31  ? 114.273 -10.486 0.530   1.00 0.00 ? 31  PHE A O    4  
ATOM 7410  C CB   . PHE A 1 31  ? 111.062 -9.548  1.109   1.00 0.00 ? 31  PHE A CB   4  
ATOM 7411  C CG   . PHE A 1 31  ? 110.836 -10.355 -0.145  1.00 0.00 ? 31  PHE A CG   4  
ATOM 7412  C CD1  . PHE A 1 31  ? 110.474 -11.693 -0.065  1.00 0.00 ? 31  PHE A CD1  4  
ATOM 7413  C CD2  . PHE A 1 31  ? 110.988 -9.780  -1.399  1.00 0.00 ? 31  PHE A CD2  4  
ATOM 7414  C CE1  . PHE A 1 31  ? 110.269 -12.439 -1.209  1.00 0.00 ? 31  PHE A CE1  4  
ATOM 7415  C CE2  . PHE A 1 31  ? 110.782 -10.524 -2.544  1.00 0.00 ? 31  PHE A CE2  4  
ATOM 7416  C CZ   . PHE A 1 31  ? 110.423 -11.854 -2.449  1.00 0.00 ? 31  PHE A CZ   4  
ATOM 7417  H H    . PHE A 1 31  ? 111.757 -8.554  3.350   1.00 0.00 ? 31  PHE A H    4  
ATOM 7418  H HA   . PHE A 1 31  ? 112.333 -11.000 2.055   1.00 0.00 ? 31  PHE A HA   4  
ATOM 7419  H HB2  . PHE A 1 31  ? 110.212 -9.701  1.760   1.00 0.00 ? 31  PHE A HB2  4  
ATOM 7420  H HB3  . PHE A 1 31  ? 111.114 -8.503  0.835   1.00 0.00 ? 31  PHE A HB3  4  
ATOM 7421  H HD1  . PHE A 1 31  ? 110.353 -12.153 0.905   1.00 0.00 ? 31  PHE A HD1  4  
ATOM 7422  H HD2  . PHE A 1 31  ? 111.269 -8.740  -1.476  1.00 0.00 ? 31  PHE A HD2  4  
ATOM 7423  H HE1  . PHE A 1 31  ? 109.988 -13.480 -1.133  1.00 0.00 ? 31  PHE A HE1  4  
ATOM 7424  H HE2  . PHE A 1 31  ? 110.903 -10.066 -3.515  1.00 0.00 ? 31  PHE A HE2  4  
ATOM 7425  H HZ   . PHE A 1 31  ? 110.263 -12.437 -3.345  1.00 0.00 ? 31  PHE A HZ   4  
ATOM 7426  N N    . LEU A 1 32  ? 113.866 -8.298  0.922   1.00 0.00 ? 32  LEU A N    4  
ATOM 7427  C CA   . LEU A 1 32  ? 115.060 -7.823  0.229   1.00 0.00 ? 32  LEU A CA   4  
ATOM 7428  C C    . LEU A 1 32  ? 116.324 -8.325  0.931   1.00 0.00 ? 32  LEU A C    4  
ATOM 7429  O O    . LEU A 1 32  ? 117.359 -8.512  0.302   1.00 0.00 ? 32  LEU A O    4  
ATOM 7430  C CB   . LEU A 1 32  ? 115.069 -6.288  0.148   1.00 0.00 ? 32  LEU A CB   4  
ATOM 7431  C CG   . LEU A 1 32  ? 114.071 -5.660  -0.841  1.00 0.00 ? 32  LEU A CG   4  
ATOM 7432  C CD1  . LEU A 1 32  ? 114.252 -4.144  -0.893  1.00 0.00 ? 32  LEU A CD1  4  
ATOM 7433  C CD2  . LEU A 1 32  ? 114.224 -6.273  -2.234  1.00 0.00 ? 32  LEU A CD2  4  
ATOM 7434  H H    . LEU A 1 32  ? 113.254 -7.642  1.320   1.00 0.00 ? 32  LEU A H    4  
ATOM 7435  H HA   . LEU A 1 32  ? 115.041 -8.227  -0.774  1.00 0.00 ? 32  LEU A HA   4  
ATOM 7436  H HB2  . LEU A 1 32  ? 114.850 -5.900  1.133   1.00 0.00 ? 32  LEU A HB2  4  
ATOM 7437  H HB3  . LEU A 1 32  ? 116.063 -5.968  -0.131  1.00 0.00 ? 32  LEU A HB3  4  
ATOM 7438  H HG   . LEU A 1 32  ? 113.066 -5.858  -0.499  1.00 0.00 ? 32  LEU A HG   4  
ATOM 7439  H HD11 . LEU A 1 32  ? 113.540 -3.718  -1.586  1.00 0.00 ? 32  LEU A HD11 4  
ATOM 7440  H HD12 . LEU A 1 32  ? 115.255 -3.909  -1.218  1.00 0.00 ? 32  LEU A HD12 4  
ATOM 7441  H HD13 . LEU A 1 32  ? 114.086 -3.728  0.091   1.00 0.00 ? 32  LEU A HD13 4  
ATOM 7442  H HD21 . LEU A 1 32  ? 114.025 -7.334  -2.186  1.00 0.00 ? 32  LEU A HD21 4  
ATOM 7443  H HD22 . LEU A 1 32  ? 115.231 -6.112  -2.593  1.00 0.00 ? 32  LEU A HD22 4  
ATOM 7444  H HD23 . LEU A 1 32  ? 113.523 -5.808  -2.912  1.00 0.00 ? 32  LEU A HD23 4  
ATOM 7445  N N    . LYS A 1 33  ? 116.219 -8.548  2.235   1.00 0.00 ? 33  LYS A N    4  
ATOM 7446  C CA   . LYS A 1 33  ? 117.317 -9.091  3.037   1.00 0.00 ? 33  LYS A CA   4  
ATOM 7447  C C    . LYS A 1 33  ? 117.722 -10.462 2.503   1.00 0.00 ? 33  LYS A C    4  
ATOM 7448  O O    . LYS A 1 33  ? 118.907 -10.796 2.428   1.00 0.00 ? 33  LYS A O    4  
ATOM 7449  C CB   . LYS A 1 33  ? 116.866 -9.201  4.501   1.00 0.00 ? 33  LYS A CB   4  
ATOM 7450  C CG   . LYS A 1 33  ? 117.898 -9.769  5.467   1.00 0.00 ? 33  LYS A CG   4  
ATOM 7451  C CD   . LYS A 1 33  ? 117.261 -10.080 6.821   1.00 0.00 ? 33  LYS A CD   4  
ATOM 7452  C CE   . LYS A 1 33  ? 116.624 -8.847  7.453   1.00 0.00 ? 33  LYS A CE   4  
ATOM 7453  N NZ   . LYS A 1 33  ? 115.837 -9.194  8.666   1.00 0.00 ? 33  LYS A NZ   4  
ATOM 7454  H H    . LYS A 1 33  ? 115.371 -8.339  2.681   1.00 0.00 ? 33  LYS A H    4  
ATOM 7455  H HA   . LYS A 1 33  ? 118.158 -8.416  2.968   1.00 0.00 ? 33  LYS A HA   4  
ATOM 7456  H HB2  . LYS A 1 33  ? 116.596 -8.214  4.849   1.00 0.00 ? 33  LYS A HB2  4  
ATOM 7457  H HB3  . LYS A 1 33  ? 115.988 -9.830  4.541   1.00 0.00 ? 33  LYS A HB3  4  
ATOM 7458  H HG2  . LYS A 1 33  ? 118.307 -10.679 5.052   1.00 0.00 ? 33  LYS A HG2  4  
ATOM 7459  H HG3  . LYS A 1 33  ? 118.690 -9.045  5.606   1.00 0.00 ? 33  LYS A HG3  4  
ATOM 7460  H HD2  . LYS A 1 33  ? 116.493 -10.829 6.681   1.00 0.00 ? 33  LYS A HD2  4  
ATOM 7461  H HD3  . LYS A 1 33  ? 118.021 -10.464 7.486   1.00 0.00 ? 33  LYS A HD3  4  
ATOM 7462  H HE2  . LYS A 1 33  ? 117.404 -8.153  7.729   1.00 0.00 ? 33  LYS A HE2  4  
ATOM 7463  H HE3  . LYS A 1 33  ? 115.967 -8.382  6.731   1.00 0.00 ? 33  LYS A HE3  4  
ATOM 7464  H HZ1  . LYS A 1 33  ? 115.120 -9.913  8.435   1.00 0.00 ? 33  LYS A HZ1  4  
ATOM 7465  H HZ2  . LYS A 1 33  ? 115.355 -8.350  9.032   1.00 0.00 ? 33  LYS A HZ2  4  
ATOM 7466  H HZ3  . LYS A 1 33  ? 116.463 -9.569  9.405   1.00 0.00 ? 33  LYS A HZ3  4  
ATOM 7467  N N    . LYS A 1 34  ? 116.721 -11.246 2.124   1.00 0.00 ? 34  LYS A N    4  
ATOM 7468  C CA   . LYS A 1 34  ? 116.943 -12.568 1.549   1.00 0.00 ? 34  LYS A CA   4  
ATOM 7469  C C    . LYS A 1 34  ? 117.252 -12.473 0.053   1.00 0.00 ? 34  LYS A C    4  
ATOM 7470  O O    . LYS A 1 34  ? 117.798 -13.403 -0.541  1.00 0.00 ? 34  LYS A O    4  
ATOM 7471  C CB   . LYS A 1 34  ? 115.736 -13.459 1.819   1.00 0.00 ? 34  LYS A CB   4  
ATOM 7472  C CG   . LYS A 1 34  ? 115.662 -13.863 3.284   1.00 0.00 ? 34  LYS A CG   4  
ATOM 7473  C CD   . LYS A 1 34  ? 114.611 -14.924 3.544   1.00 0.00 ? 34  LYS A CD   4  
ATOM 7474  C CE   . LYS A 1 34  ? 114.894 -15.664 4.842   1.00 0.00 ? 34  LYS A CE   4  
ATOM 7475  N NZ   . LYS A 1 34  ? 114.896 -14.762 6.024   1.00 0.00 ? 34  LYS A NZ   4  
ATOM 7476  H H    . LYS A 1 34  ? 115.798 -10.927 2.241   1.00 0.00 ? 34  LYS A H    4  
ATOM 7477  H HA   . LYS A 1 34  ? 117.795 -13.007 2.054   1.00 0.00 ? 34  LYS A HA   4  
ATOM 7478  H HB2  . LYS A 1 34  ? 114.831 -12.926 1.556   1.00 0.00 ? 34  LYS A HB2  4  
ATOM 7479  H HB3  . LYS A 1 34  ? 115.811 -14.355 1.219   1.00 0.00 ? 34  LYS A HB3  4  
ATOM 7480  H HG2  . LYS A 1 34  ? 116.626 -14.247 3.586   1.00 0.00 ? 34  LYS A HG2  4  
ATOM 7481  H HG3  . LYS A 1 34  ? 115.428 -12.986 3.875   1.00 0.00 ? 34  LYS A HG3  4  
ATOM 7482  H HD2  . LYS A 1 34  ? 113.641 -14.453 3.611   1.00 0.00 ? 34  LYS A HD2  4  
ATOM 7483  H HD3  . LYS A 1 34  ? 114.615 -15.633 2.728   1.00 0.00 ? 34  LYS A HD3  4  
ATOM 7484  H HE2  . LYS A 1 34  ? 114.142 -16.411 4.974   1.00 0.00 ? 34  LYS A HE2  4  
ATOM 7485  H HE3  . LYS A 1 34  ? 115.860 -16.143 4.766   1.00 0.00 ? 34  LYS A HE3  4  
ATOM 7486  H HZ1  . LYS A 1 34  ? 114.009 -14.218 6.065   1.00 0.00 ? 34  LYS A HZ1  4  
ATOM 7487  H HZ2  . LYS A 1 34  ? 115.693 -14.097 5.969   1.00 0.00 ? 34  LYS A HZ2  4  
ATOM 7488  H HZ3  . LYS A 1 34  ? 114.986 -15.319 6.898   1.00 0.00 ? 34  LYS A HZ3  4  
ATOM 7489  N N    . GLU A 1 35  ? 116.895 -11.337 -0.546  1.00 0.00 ? 35  GLU A N    4  
ATOM 7490  C CA   . GLU A 1 35  ? 117.255 -11.034 -1.936  1.00 0.00 ? 35  GLU A CA   4  
ATOM 7491  C C    . GLU A 1 35  ? 118.681 -10.482 -2.008  1.00 0.00 ? 35  GLU A C    4  
ATOM 7492  O O    . GLU A 1 35  ? 119.284 -10.432 -3.084  1.00 0.00 ? 35  GLU A O    4  
ATOM 7493  C CB   . GLU A 1 35  ? 116.286 -9.995  -2.527  1.00 0.00 ? 35  GLU A CB   4  
ATOM 7494  C CG   . GLU A 1 35  ? 114.837 -10.459 -2.613  1.00 0.00 ? 35  GLU A CG   4  
ATOM 7495  C CD   . GLU A 1 35  ? 114.646 -11.609 -3.585  1.00 0.00 ? 35  GLU A CD   4  
ATOM 7496  O OE1  . GLU A 1 35  ? 114.630 -11.361 -4.810  1.00 0.00 ? 35  GLU A OE1  4  
ATOM 7497  O OE2  . GLU A 1 35  ? 114.506 -12.760 -3.133  1.00 0.00 ? 35  GLU A OE2  4  
ATOM 7498  H H    . GLU A 1 35  ? 116.364 -10.686 -0.042  1.00 0.00 ? 35  GLU A H    4  
ATOM 7499  H HA   . GLU A 1 35  ? 117.197 -11.946 -2.511  1.00 0.00 ? 35  GLU A HA   4  
ATOM 7500  H HB2  . GLU A 1 35  ? 116.316 -9.105  -1.914  1.00 0.00 ? 35  GLU A HB2  4  
ATOM 7501  H HB3  . GLU A 1 35  ? 116.618 -9.738  -3.525  1.00 0.00 ? 35  GLU A HB3  4  
ATOM 7502  H HG2  . GLU A 1 35  ? 114.514 -10.775 -1.631  1.00 0.00 ? 35  GLU A HG2  4  
ATOM 7503  H HG3  . GLU A 1 35  ? 114.225 -9.627  -2.937  1.00 0.00 ? 35  GLU A HG3  4  
ATOM 7504  N N    . PHE A 1 36  ? 119.202 -10.086 -0.844  1.00 0.00 ? 36  PHE A N    4  
ATOM 7505  C CA   . PHE A 1 36  ? 120.463 -9.354  -0.738  1.00 0.00 ? 36  PHE A CA   4  
ATOM 7506  C C    . PHE A 1 36  ? 120.295 -7.979  -1.374  1.00 0.00 ? 36  PHE A C    4  
ATOM 7507  O O    . PHE A 1 36  ? 120.891 -7.659  -2.408  1.00 0.00 ? 36  PHE A O    4  
ATOM 7508  C CB   . PHE A 1 36  ? 121.632 -10.132 -1.354  1.00 0.00 ? 36  PHE A CB   4  
ATOM 7509  C CG   . PHE A 1 36  ? 122.984 -9.503  -1.110  1.00 0.00 ? 36  PHE A CG   4  
ATOM 7510  C CD1  . PHE A 1 36  ? 123.548 -9.515  0.159   1.00 0.00 ? 36  PHE A CD1  4  
ATOM 7511  C CD2  . PHE A 1 36  ? 123.688 -8.897  -2.144  1.00 0.00 ? 36  PHE A CD2  4  
ATOM 7512  C CE1  . PHE A 1 36  ? 124.782 -8.937  0.390   1.00 0.00 ? 36  PHE A CE1  4  
ATOM 7513  C CE2  . PHE A 1 36  ? 124.922 -8.317  -1.915  1.00 0.00 ? 36  PHE A CE2  4  
ATOM 7514  C CZ   . PHE A 1 36  ? 125.469 -8.338  -0.647  1.00 0.00 ? 36  PHE A CZ   4  
ATOM 7515  H H    . PHE A 1 36  ? 118.712 -10.288 -0.022  1.00 0.00 ? 36  PHE A H    4  
ATOM 7516  H HA   . PHE A 1 36  ? 120.658 -9.214  0.318   1.00 0.00 ? 36  PHE A HA   4  
ATOM 7517  H HB2  . PHE A 1 36  ? 121.645 -11.119 -0.928  1.00 0.00 ? 36  PHE A HB2  4  
ATOM 7518  H HB3  . PHE A 1 36  ? 121.482 -10.209 -2.423  1.00 0.00 ? 36  PHE A HB3  4  
ATOM 7519  H HD1  . PHE A 1 36  ? 123.014 -9.983  0.973   1.00 0.00 ? 36  PHE A HD1  4  
ATOM 7520  H HD2  . PHE A 1 36  ? 123.261 -8.879  -3.137  1.00 0.00 ? 36  PHE A HD2  4  
ATOM 7521  H HE1  . PHE A 1 36  ? 125.210 -8.956  1.382   1.00 0.00 ? 36  PHE A HE1  4  
ATOM 7522  H HE2  . PHE A 1 36  ? 125.458 -7.850  -2.728  1.00 0.00 ? 36  PHE A HE2  4  
ATOM 7523  H HZ   . PHE A 1 36  ? 126.434 -7.886  -0.467  1.00 0.00 ? 36  PHE A HZ   4  
ATOM 7524  N N    . SER A 1 37  ? 119.423 -7.200  -0.752  1.00 0.00 ? 37  SER A N    4  
ATOM 7525  C CA   . SER A 1 37  ? 119.068 -5.863  -1.218  1.00 0.00 ? 37  SER A CA   4  
ATOM 7526  C C    . SER A 1 37  ? 118.496 -5.014  -0.071  1.00 0.00 ? 37  SER A C    4  
ATOM 7527  O O    . SER A 1 37  ? 117.881 -3.964  -0.306  1.00 0.00 ? 37  SER A O    4  
ATOM 7528  C CB   . SER A 1 37  ? 118.043 -5.951  -2.363  1.00 0.00 ? 37  SER A CB   4  
ATOM 7529  O OG   . SER A 1 37  ? 118.548 -6.686  -3.467  1.00 0.00 ? 37  SER A OG   4  
ATOM 7530  H H    . SER A 1 37  ? 118.998 -7.549  0.058   1.00 0.00 ? 37  SER A H    4  
ATOM 7531  H HA   . SER A 1 37  ? 119.967 -5.388  -1.585  1.00 0.00 ? 37  SER A HA   4  
ATOM 7532  H HB2  . SER A 1 37  ? 117.149 -6.440  -2.006  1.00 0.00 ? 37  SER A HB2  4  
ATOM 7533  H HB3  . SER A 1 37  ? 117.795 -4.953  -2.697  1.00 0.00 ? 37  SER A HB3  4  
ATOM 7534  H HG   . SER A 1 37  ? 119.491 -6.838  -3.348  1.00 0.00 ? 37  SER A HG   4  
ATOM 7535  N N    . GLU A 1 38  ? 118.697 -5.448  1.178   1.00 0.00 ? 38  GLU A N    4  
ATOM 7536  C CA   . GLU A 1 38  ? 118.245 -4.652  2.317   1.00 0.00 ? 38  GLU A CA   4  
ATOM 7537  C C    . GLU A 1 38  ? 119.059 -3.363  2.357   1.00 0.00 ? 38  GLU A C    4  
ATOM 7538  O O    . GLU A 1 38  ? 118.626 -2.351  2.902   1.00 0.00 ? 38  GLU A O    4  
ATOM 7539  C CB   . GLU A 1 38  ? 118.361 -5.418  3.648   1.00 0.00 ? 38  GLU A CB   4  
ATOM 7540  C CG   . GLU A 1 38  ? 119.770 -5.474  4.229   1.00 0.00 ? 38  GLU A CG   4  
ATOM 7541  C CD   . GLU A 1 38  ? 119.820 -6.146  5.594   1.00 0.00 ? 38  GLU A CD   4  
ATOM 7542  O OE1  . GLU A 1 38  ? 119.225 -5.605  6.552   1.00 0.00 ? 38  GLU A OE1  4  
ATOM 7543  O OE2  . GLU A 1 38  ? 120.456 -7.213  5.718   1.00 0.00 ? 38  GLU A OE2  4  
ATOM 7544  H H    . GLU A 1 38  ? 119.166 -6.296  1.332   1.00 0.00 ? 38  GLU A H    4  
ATOM 7545  H HA   . GLU A 1 38  ? 117.206 -4.397  2.145   1.00 0.00 ? 38  GLU A HA   4  
ATOM 7546  H HB2  . GLU A 1 38  ? 117.718 -4.944  4.376   1.00 0.00 ? 38  GLU A HB2  4  
ATOM 7547  H HB3  . GLU A 1 38  ? 118.019 -6.432  3.493   1.00 0.00 ? 38  GLU A HB3  4  
ATOM 7548  H HG2  . GLU A 1 38  ? 120.405 -6.023  3.548   1.00 0.00 ? 38  GLU A HG2  4  
ATOM 7549  H HG3  . GLU A 1 38  ? 120.145 -4.465  4.329   1.00 0.00 ? 38  GLU A HG3  4  
ATOM 7550  N N    . GLU A 1 39  ? 120.241 -3.425  1.748   1.00 0.00 ? 39  GLU A N    4  
ATOM 7551  C CA   . GLU A 1 39  ? 121.091 -2.260  1.545   1.00 0.00 ? 39  GLU A CA   4  
ATOM 7552  C C    . GLU A 1 39  ? 120.320 -1.197  0.761   1.00 0.00 ? 39  GLU A C    4  
ATOM 7553  O O    . GLU A 1 39  ? 120.367 -0.009  1.079   1.00 0.00 ? 39  GLU A O    4  
ATOM 7554  C CB   . GLU A 1 39  ? 122.368 -2.661  0.777   1.00 0.00 ? 39  GLU A CB   4  
ATOM 7555  C CG   . GLU A 1 39  ? 123.326 -3.578  1.550   1.00 0.00 ? 39  GLU A CG   4  
ATOM 7556  C CD   . GLU A 1 39  ? 122.705 -4.902  1.982   1.00 0.00 ? 39  GLU A CD   4  
ATOM 7557  O OE1  . GLU A 1 39  ? 122.043 -5.558  1.151   1.00 0.00 ? 39  GLU A OE1  4  
ATOM 7558  O OE2  . GLU A 1 39  ? 122.859 -5.278  3.167   1.00 0.00 ? 39  GLU A OE2  4  
ATOM 7559  H H    . GLU A 1 39  ? 120.552 -4.296  1.422   1.00 0.00 ? 39  GLU A H    4  
ATOM 7560  H HA   . GLU A 1 39  ? 121.363 -1.863  2.514   1.00 0.00 ? 39  GLU A HA   4  
ATOM 7561  H HB2  . GLU A 1 39  ? 122.079 -3.170  -0.131  1.00 0.00 ? 39  GLU A HB2  4  
ATOM 7562  H HB3  . GLU A 1 39  ? 122.907 -1.762  0.512   1.00 0.00 ? 39  GLU A HB3  4  
ATOM 7563  H HG2  . GLU A 1 39  ? 124.177 -3.794  0.920   1.00 0.00 ? 39  GLU A HG2  4  
ATOM 7564  H HG3  . GLU A 1 39  ? 123.666 -3.049  2.431   1.00 0.00 ? 39  GLU A HG3  4  
ATOM 7565  N N    . ASN A 1 40  ? 119.593 -1.663  -0.254  1.00 0.00 ? 40  ASN A N    4  
ATOM 7566  C CA   . ASN A 1 40  ? 118.745 -0.809  -1.089  1.00 0.00 ? 40  ASN A CA   4  
ATOM 7567  C C    . ASN A 1 40  ? 117.709 -0.079  -0.238  1.00 0.00 ? 40  ASN A C    4  
ATOM 7568  O O    . ASN A 1 40  ? 117.713 1.155   -0.158  1.00 0.00 ? 40  ASN A O    4  
ATOM 7569  C CB   . ASN A 1 40  ? 118.056 -1.667  -2.172  1.00 0.00 ? 40  ASN A CB   4  
ATOM 7570  C CG   . ASN A 1 40  ? 116.840 -1.007  -2.813  1.00 0.00 ? 40  ASN A CG   4  
ATOM 7571  O OD1  . ASN A 1 40  ? 116.757 0.210   -2.929  1.00 0.00 ? 40  ASN A OD1  4  
ATOM 7572  N ND2  . ASN A 1 40  ? 115.884 -1.823  -3.234  1.00 0.00 ? 40  ASN A ND2  4  
ATOM 7573  H H    . ASN A 1 40  ? 119.622 -2.622  -0.446  1.00 0.00 ? 40  ASN A H    4  
ATOM 7574  H HA   . ASN A 1 40  ? 119.381 -0.079  -1.570  1.00 0.00 ? 40  ASN A HA   4  
ATOM 7575  H HB2  . ASN A 1 40  ? 118.769 -1.880  -2.955  1.00 0.00 ? 40  ASN A HB2  4  
ATOM 7576  H HB3  . ASN A 1 40  ? 117.738 -2.599  -1.729  1.00 0.00 ? 40  ASN A HB3  4  
ATOM 7577  H HD21 . ASN A 1 40  ? 116.007 -2.787  -3.111  1.00 0.00 ? 40  ASN A HD21 4  
ATOM 7578  H HD22 . ASN A 1 40  ? 115.095 -1.431  -3.659  1.00 0.00 ? 40  ASN A HD22 4  
ATOM 7579  N N    . VAL A 1 41  ? 116.839 -0.843  0.422   1.00 0.00 ? 41  VAL A N    4  
ATOM 7580  C CA   . VAL A 1 41  ? 115.756 -0.246  1.210   1.00 0.00 ? 41  VAL A CA   4  
ATOM 7581  C C    . VAL A 1 41  ? 116.312 0.637   2.334   1.00 0.00 ? 41  VAL A C    4  
ATOM 7582  O O    . VAL A 1 41  ? 115.764 1.705   2.626   1.00 0.00 ? 41  VAL A O    4  
ATOM 7583  C CB   . VAL A 1 41  ? 114.799 -1.319  1.798   1.00 0.00 ? 41  VAL A CB   4  
ATOM 7584  C CG1  . VAL A 1 41  ? 115.547 -2.294  2.700   1.00 0.00 ? 41  VAL A CG1  4  
ATOM 7585  C CG2  . VAL A 1 41  ? 113.637 -0.665  2.549   1.00 0.00 ? 41  VAL A CG2  4  
ATOM 7586  H H    . VAL A 1 41  ? 116.929 -1.825  0.378   1.00 0.00 ? 41  VAL A H    4  
ATOM 7587  H HA   . VAL A 1 41  ? 115.180 0.380   0.540   1.00 0.00 ? 41  VAL A HA   4  
ATOM 7588  H HB   . VAL A 1 41  ? 114.386 -1.883  0.972   1.00 0.00 ? 41  VAL A HB   4  
ATOM 7589  H HG11 . VAL A 1 41  ? 115.988 -1.757  3.528   1.00 0.00 ? 41  VAL A HG11 4  
ATOM 7590  H HG12 . VAL A 1 41  ? 116.326 -2.785  2.135   1.00 0.00 ? 41  VAL A HG12 4  
ATOM 7591  H HG13 . VAL A 1 41  ? 114.859 -3.036  3.079   1.00 0.00 ? 41  VAL A HG13 4  
ATOM 7592  H HG21 . VAL A 1 41  ? 112.970 -1.431  2.919   1.00 0.00 ? 41  VAL A HG21 4  
ATOM 7593  H HG22 . VAL A 1 41  ? 113.097 -0.010  1.881   1.00 0.00 ? 41  VAL A HG22 4  
ATOM 7594  H HG23 . VAL A 1 41  ? 114.021 -0.092  3.382   1.00 0.00 ? 41  VAL A HG23 4  
ATOM 7595  N N    . LEU A 1 42  ? 117.415 0.205   2.941   1.00 0.00 ? 42  LEU A N    4  
ATOM 7596  C CA   . LEU A 1 42  ? 118.043 0.964   4.020   1.00 0.00 ? 42  LEU A CA   4  
ATOM 7597  C C    . LEU A 1 42  ? 118.625 2.272   3.506   1.00 0.00 ? 42  LEU A C    4  
ATOM 7598  O O    . LEU A 1 42  ? 118.577 3.283   4.200   1.00 0.00 ? 42  LEU A O    4  
ATOM 7599  C CB   . LEU A 1 42  ? 119.141 0.142   4.709   1.00 0.00 ? 42  LEU A CB   4  
ATOM 7600  C CG   . LEU A 1 42  ? 118.640 -0.930  5.686   1.00 0.00 ? 42  LEU A CG   4  
ATOM 7601  C CD1  . LEU A 1 42  ? 119.814 -1.707  6.274   1.00 0.00 ? 42  LEU A CD1  4  
ATOM 7602  C CD2  . LEU A 1 42  ? 117.799 -0.291  6.793   1.00 0.00 ? 42  LEU A CD2  4  
ATOM 7603  H H    . LEU A 1 42  ? 117.819 -0.641  2.655   1.00 0.00 ? 42  LEU A H    4  
ATOM 7604  H HA   . LEU A 1 42  ? 117.275 1.193   4.747   1.00 0.00 ? 42  LEU A HA   4  
ATOM 7605  H HB2  . LEU A 1 42  ? 119.729 -0.345  3.942   1.00 0.00 ? 42  LEU A HB2  4  
ATOM 7606  H HB3  . LEU A 1 42  ? 119.785 0.819   5.253   1.00 0.00 ? 42  LEU A HB3  4  
ATOM 7607  H HG   . LEU A 1 42  ? 118.013 -1.631  5.153   1.00 0.00 ? 42  LEU A HG   4  
ATOM 7608  H HD11 . LEU A 1 42  ? 120.468 -1.029  6.805   1.00 0.00 ? 42  LEU A HD11 4  
ATOM 7609  H HD12 . LEU A 1 42  ? 120.363 -2.187  5.478   1.00 0.00 ? 42  LEU A HD12 4  
ATOM 7610  H HD13 . LEU A 1 42  ? 119.445 -2.457  6.957   1.00 0.00 ? 42  LEU A HD13 4  
ATOM 7611  H HD21 . LEU A 1 42  ? 117.475 -1.053  7.487   1.00 0.00 ? 42  LEU A HD21 4  
ATOM 7612  H HD22 . LEU A 1 42  ? 116.934 0.188   6.358   1.00 0.00 ? 42  LEU A HD22 4  
ATOM 7613  H HD23 . LEU A 1 42  ? 118.391 0.447   7.318   1.00 0.00 ? 42  LEU A HD23 4  
ATOM 7614  N N    . PHE A 1 43  ? 119.173 2.250   2.295   1.00 0.00 ? 43  PHE A N    4  
ATOM 7615  C CA   . PHE A 1 43  ? 119.771 3.445   1.713   1.00 0.00 ? 43  PHE A CA   4  
ATOM 7616  C C    . PHE A 1 43  ? 118.730 4.548   1.575   1.00 0.00 ? 43  PHE A C    4  
ATOM 7617  O O    . PHE A 1 43  ? 118.987 5.702   1.920   1.00 0.00 ? 43  PHE A O    4  
ATOM 7618  C CB   . PHE A 1 43  ? 120.400 3.141   0.347   1.00 0.00 ? 43  PHE A CB   4  
ATOM 7619  C CG   . PHE A 1 43  ? 121.019 4.352   -0.307  1.00 0.00 ? 43  PHE A CG   4  
ATOM 7620  C CD1  . PHE A 1 43  ? 122.188 4.906   0.197   1.00 0.00 ? 43  PHE A CD1  4  
ATOM 7621  C CD2  . PHE A 1 43  ? 120.431 4.939   -1.420  1.00 0.00 ? 43  PHE A CD2  4  
ATOM 7622  C CE1  . PHE A 1 43  ? 122.756 6.018   -0.395  1.00 0.00 ? 43  PHE A CE1  4  
ATOM 7623  C CE2  . PHE A 1 43  ? 120.996 6.051   -2.014  1.00 0.00 ? 43  PHE A CE2  4  
ATOM 7624  C CZ   . PHE A 1 43  ? 122.160 6.591   -1.501  1.00 0.00 ? 43  PHE A CZ   4  
ATOM 7625  H H    . PHE A 1 43  ? 119.174 1.413   1.781   1.00 0.00 ? 43  PHE A H    4  
ATOM 7626  H HA   . PHE A 1 43  ? 120.547 3.784   2.388   1.00 0.00 ? 43  PHE A HA   4  
ATOM 7627  H HB2  . PHE A 1 43  ? 121.174 2.396   0.472   1.00 0.00 ? 43  PHE A HB2  4  
ATOM 7628  H HB3  . PHE A 1 43  ? 119.639 2.752   -0.315  1.00 0.00 ? 43  PHE A HB3  4  
ATOM 7629  H HD1  . PHE A 1 43  ? 122.657 4.460   1.063   1.00 0.00 ? 43  PHE A HD1  4  
ATOM 7630  H HD2  . PHE A 1 43  ? 119.521 4.519   -1.824  1.00 0.00 ? 43  PHE A HD2  4  
ATOM 7631  H HE1  . PHE A 1 43  ? 123.666 6.440   0.008   1.00 0.00 ? 43  PHE A HE1  4  
ATOM 7632  H HE2  . PHE A 1 43  ? 120.528 6.499   -2.880  1.00 0.00 ? 43  PHE A HE2  4  
ATOM 7633  H HZ   . PHE A 1 43  ? 122.603 7.460   -1.964  1.00 0.00 ? 43  PHE A HZ   4  
ATOM 7634  N N    . TRP A 1 44  ? 117.549 4.183   1.082   1.00 0.00 ? 44  TRP A N    4  
ATOM 7635  C CA   . TRP A 1 44  ? 116.473 5.150   0.890   1.00 0.00 ? 44  TRP A CA   4  
ATOM 7636  C C    . TRP A 1 44  ? 116.043 5.737   2.234   1.00 0.00 ? 44  TRP A C    4  
ATOM 7637  O O    . TRP A 1 44  ? 115.940 6.958   2.383   1.00 0.00 ? 44  TRP A O    4  
ATOM 7638  C CB   . TRP A 1 44  ? 115.279 4.500   0.182   1.00 0.00 ? 44  TRP A CB   4  
ATOM 7639  C CG   . TRP A 1 44  ? 114.262 5.493   -0.309  1.00 0.00 ? 44  TRP A CG   4  
ATOM 7640  C CD1  . TRP A 1 44  ? 114.281 6.160   -1.501  1.00 0.00 ? 44  TRP A CD1  4  
ATOM 7641  C CD2  . TRP A 1 44  ? 113.082 5.931   0.376   1.00 0.00 ? 44  TRP A CD2  4  
ATOM 7642  N NE1  . TRP A 1 44  ? 113.192 6.990   -1.595  1.00 0.00 ? 44  TRP A NE1  4  
ATOM 7643  C CE2  . TRP A 1 44  ? 112.438 6.865   -0.458  1.00 0.00 ? 44  TRP A CE2  4  
ATOM 7644  C CE3  . TRP A 1 44  ? 112.508 5.623   1.610   1.00 0.00 ? 44  TRP A CE3  4  
ATOM 7645  C CZ2  . TRP A 1 44  ? 111.249 7.492   -0.095  1.00 0.00 ? 44  TRP A CZ2  4  
ATOM 7646  C CZ3  . TRP A 1 44  ? 111.329 6.247   1.972   1.00 0.00 ? 44  TRP A CZ3  4  
ATOM 7647  C CH2  . TRP A 1 44  ? 110.710 7.171   1.122   1.00 0.00 ? 44  TRP A CH2  4  
ATOM 7648  H H    . TRP A 1 44  ? 117.402 3.242   0.838   1.00 0.00 ? 44  TRP A H    4  
ATOM 7649  H HA   . TRP A 1 44  ? 116.856 5.948   0.270   1.00 0.00 ? 44  TRP A HA   4  
ATOM 7650  H HB2  . TRP A 1 44  ? 115.636 3.940   -0.670  1.00 0.00 ? 44  TRP A HB2  4  
ATOM 7651  H HB3  . TRP A 1 44  ? 114.784 3.823   0.866   1.00 0.00 ? 44  TRP A HB3  4  
ATOM 7652  H HD1  . TRP A 1 44  ? 115.053 6.048   -2.248  1.00 0.00 ? 44  TRP A HD1  4  
ATOM 7653  H HE1  . TRP A 1 44  ? 112.986 7.573   -2.356  1.00 0.00 ? 44  TRP A HE1  4  
ATOM 7654  H HE3  . TRP A 1 44  ? 112.972 4.913   2.277   1.00 0.00 ? 44  TRP A HE3  4  
ATOM 7655  H HZ2  . TRP A 1 44  ? 110.759 8.208   -0.741  1.00 0.00 ? 44  TRP A HZ2  4  
ATOM 7656  H HZ3  . TRP A 1 44  ? 110.871 6.019   2.923   1.00 0.00 ? 44  TRP A HZ3  4  
ATOM 7657  H HH2  . TRP A 1 44  ? 109.787 7.633   1.444   1.00 0.00 ? 44  TRP A HH2  4  
ATOM 7658  N N    . LEU A 1 45  ? 115.811 4.860   3.215   1.00 0.00 ? 45  LEU A N    4  
ATOM 7659  C CA   . LEU A 1 45  ? 115.435 5.293   4.564   1.00 0.00 ? 45  LEU A CA   4  
ATOM 7660  C C    . LEU A 1 45  ? 116.522 6.187   5.154   1.00 0.00 ? 45  LEU A C    4  
ATOM 7661  O O    . LEU A 1 45  ? 116.238 7.227   5.755   1.00 0.00 ? 45  LEU A O    4  
ATOM 7662  C CB   . LEU A 1 45  ? 115.215 4.086   5.497   1.00 0.00 ? 45  LEU A CB   4  
ATOM 7663  C CG   . LEU A 1 45  ? 114.088 3.111   5.107   1.00 0.00 ? 45  LEU A CG   4  
ATOM 7664  C CD1  . LEU A 1 45  ? 113.878 2.075   6.208   1.00 0.00 ? 45  LEU A CD1  4  
ATOM 7665  C CD2  . LEU A 1 45  ? 112.788 3.862   4.820   1.00 0.00 ? 45  LEU A CD2  4  
ATOM 7666  H H    . LEU A 1 45  ? 115.894 3.900   3.026   1.00 0.00 ? 45  LEU A H    4  
ATOM 7667  H HA   . LEU A 1 45  ? 114.516 5.857   4.490   1.00 0.00 ? 45  LEU A HA   4  
ATOM 7668  H HB2  . LEU A 1 45  ? 116.139 3.526   5.542   1.00 0.00 ? 45  LEU A HB2  4  
ATOM 7669  H HB3  . LEU A 1 45  ? 115.002 4.465   6.488   1.00 0.00 ? 45  LEU A HB3  4  
ATOM 7670  H HG   . LEU A 1 45  ? 114.375 2.576   4.210   1.00 0.00 ? 45  LEU A HG   4  
ATOM 7671  H HD11 . LEU A 1 45  ? 113.574 2.572   7.120   1.00 0.00 ? 45  LEU A HD11 4  
ATOM 7672  H HD12 . LEU A 1 45  ? 114.801 1.543   6.382   1.00 0.00 ? 45  LEU A HD12 4  
ATOM 7673  H HD13 . LEU A 1 45  ? 113.111 1.378   5.906   1.00 0.00 ? 45  LEU A HD13 4  
ATOM 7674  H HD21 . LEU A 1 45  ? 112.028 3.162   4.505   1.00 0.00 ? 45  LEU A HD21 4  
ATOM 7675  H HD22 . LEU A 1 45  ? 112.954 4.586   4.037   1.00 0.00 ? 45  LEU A HD22 4  
ATOM 7676  H HD23 . LEU A 1 45  ? 112.458 4.371   5.715   1.00 0.00 ? 45  LEU A HD23 4  
ATOM 7677  N N    . ALA A 1 46  ? 117.768 5.773   4.960   1.00 0.00 ? 46  ALA A N    4  
ATOM 7678  C CA   . ALA A 1 46  ? 118.916 6.471   5.520   1.00 0.00 ? 46  ALA A CA   4  
ATOM 7679  C C    . ALA A 1 46  ? 119.139 7.809   4.826   1.00 0.00 ? 46  ALA A C    4  
ATOM 7680  O O    . ALA A 1 46  ? 119.603 8.758   5.449   1.00 0.00 ? 46  ALA A O    4  
ATOM 7681  C CB   . ALA A 1 46  ? 120.165 5.603   5.423   1.00 0.00 ? 46  ALA A CB   4  
ATOM 7682  H H    . ALA A 1 46  ? 117.920 4.972   4.419   1.00 0.00 ? 46  ALA A H    4  
ATOM 7683  H HA   . ALA A 1 46  ? 118.717 6.652   6.569   1.00 0.00 ? 46  ALA A HA   4  
ATOM 7684  H HB1  . ALA A 1 46  ? 119.987 4.658   5.919   1.00 0.00 ? 46  ALA A HB1  4  
ATOM 7685  H HB2  . ALA A 1 46  ? 120.995 6.108   5.897   1.00 0.00 ? 46  ALA A HB2  4  
ATOM 7686  H HB3  . ALA A 1 46  ? 120.400 5.424   4.383   1.00 0.00 ? 46  ALA A HB3  4  
ATOM 7687  N N    . CYS A 1 47  ? 118.804 7.878   3.538   1.00 0.00 ? 47  CYS A N    4  
ATOM 7688  C CA   . CYS A 1 47  ? 118.958 9.110   2.767   1.00 0.00 ? 47  CYS A CA   4  
ATOM 7689  C C    . CYS A 1 47  ? 117.852 10.103  3.122   1.00 0.00 ? 47  CYS A C    4  
ATOM 7690  O O    . CYS A 1 47  ? 118.073 11.317  3.138   1.00 0.00 ? 47  CYS A O    4  
ATOM 7691  C CB   . CYS A 1 47  ? 118.946 8.821   1.261   1.00 0.00 ? 47  CYS A CB   4  
ATOM 7692  S SG   . CYS A 1 47  ? 119.182 10.292  0.235   1.00 0.00 ? 47  CYS A SG   4  
ATOM 7693  H H    . CYS A 1 47  ? 118.447 7.079   3.095   1.00 0.00 ? 47  CYS A H    4  
ATOM 7694  H HA   . CYS A 1 47  ? 119.912 9.547   3.030   1.00 0.00 ? 47  CYS A HA   4  
ATOM 7695  H HB2  . CYS A 1 47  ? 119.740 8.126   1.026   1.00 0.00 ? 47  CYS A HB2  4  
ATOM 7696  H HB3  . CYS A 1 47  ? 117.997 8.380   0.991   1.00 0.00 ? 47  CYS A HB3  4  
ATOM 7697  H HG   . CYS A 1 47  ? 118.720 11.333  0.914   1.00 0.00 ? 47  CYS A HG   4  
ATOM 7698  N N    . GLU A 1 48  ? 116.663 9.575   3.400   1.00 0.00 ? 48  GLU A N    4  
ATOM 7699  C CA   . GLU A 1 48  ? 115.543 10.385  3.867   1.00 0.00 ? 48  GLU A CA   4  
ATOM 7700  C C    . GLU A 1 48  ? 115.930 11.023  5.202   1.00 0.00 ? 48  GLU A C    4  
ATOM 7701  O O    . GLU A 1 48  ? 115.908 12.247  5.364   1.00 0.00 ? 48  GLU A O    4  
ATOM 7702  C CB   . GLU A 1 48  ? 114.294 9.487   4.006   1.00 0.00 ? 48  GLU A CB   4  
ATOM 7703  C CG   . GLU A 1 48  ? 112.970 10.223  4.230   1.00 0.00 ? 48  GLU A CG   4  
ATOM 7704  C CD   . GLU A 1 48  ? 112.801 10.766  5.642   1.00 0.00 ? 48  GLU A CD   4  
ATOM 7705  O OE1  . GLU A 1 48  ? 112.638 9.953   6.579   1.00 0.00 ? 48  GLU A OE1  4  
ATOM 7706  O OE2  . GLU A 1 48  ? 112.819 12.002  5.820   1.00 0.00 ? 48  GLU A OE2  4  
ATOM 7707  H H    . GLU A 1 48  ? 116.535 8.608   3.286   1.00 0.00 ? 48  GLU A H    4  
ATOM 7708  H HA   . GLU A 1 48  ? 115.355 11.162  3.138   1.00 0.00 ? 48  GLU A HA   4  
ATOM 7709  H HB2  . GLU A 1 48  ? 114.195 8.901   3.103   1.00 0.00 ? 48  GLU A HB2  4  
ATOM 7710  H HB3  . GLU A 1 48  ? 114.447 8.812   4.837   1.00 0.00 ? 48  GLU A HB3  4  
ATOM 7711  H HG2  . GLU A 1 48  ? 112.913 11.049  3.535   1.00 0.00 ? 48  GLU A HG2  4  
ATOM 7712  H HG3  . GLU A 1 48  ? 112.158 9.538   4.027   1.00 0.00 ? 48  GLU A HG3  4  
ATOM 7713  N N    . ASP A 1 49  ? 116.332 10.164  6.133   1.00 0.00 ? 49  ASP A N    4  
ATOM 7714  C CA   . ASP A 1 49  ? 116.818 10.582  7.446   1.00 0.00 ? 49  ASP A CA   4  
ATOM 7715  C C    . ASP A 1 49  ? 118.019 11.524  7.312   1.00 0.00 ? 49  ASP A C    4  
ATOM 7716  O O    . ASP A 1 49  ? 118.135 12.516  8.034   1.00 0.00 ? 49  ASP A O    4  
ATOM 7717  C CB   . ASP A 1 49  ? 117.203 9.334   8.252   1.00 0.00 ? 49  ASP A CB   4  
ATOM 7718  C CG   . ASP A 1 49  ? 117.870 9.660   9.575   1.00 0.00 ? 49  ASP A CG   4  
ATOM 7719  O OD1  . ASP A 1 49  ? 117.155 10.036  10.525  1.00 0.00 ? 49  ASP A OD1  4  
ATOM 7720  O OD2  . ASP A 1 49  ? 119.111 9.515   9.675   1.00 0.00 ? 49  ASP A OD2  4  
ATOM 7721  H H    . ASP A 1 49  ? 116.299 9.205   5.929   1.00 0.00 ? 49  ASP A H    4  
ATOM 7722  H HA   . ASP A 1 49  ? 116.015 11.099  7.953   1.00 0.00 ? 49  ASP A HA   4  
ATOM 7723  H HB2  . ASP A 1 49  ? 116.312 8.758   8.454   1.00 0.00 ? 49  ASP A HB2  4  
ATOM 7724  H HB3  . ASP A 1 49  ? 117.883 8.732   7.663   1.00 0.00 ? 49  ASP A HB3  4  
ATOM 7725  N N    . PHE A 1 50  ? 118.889 11.206  6.359   1.00 0.00 ? 50  PHE A N    4  
ATOM 7726  C CA   . PHE A 1 50  ? 120.104 11.979  6.094   1.00 0.00 ? 50  PHE A CA   4  
ATOM 7727  C C    . PHE A 1 50  ? 119.778 13.442  5.812   1.00 0.00 ? 50  PHE A C    4  
ATOM 7728  O O    . PHE A 1 50  ? 120.400 14.351  6.361   1.00 0.00 ? 50  PHE A O    4  
ATOM 7729  C CB   . PHE A 1 50  ? 120.831 11.370  4.890   1.00 0.00 ? 50  PHE A CB   4  
ATOM 7730  C CG   . PHE A 1 50  ? 122.158 12.001  4.571   1.00 0.00 ? 50  PHE A CG   4  
ATOM 7731  C CD1  . PHE A 1 50  ? 123.278 11.668  5.308   1.00 0.00 ? 50  PHE A CD1  4  
ATOM 7732  C CD2  . PHE A 1 50  ? 122.289 12.908  3.527   1.00 0.00 ? 50  PHE A CD2  4  
ATOM 7733  C CE1  . PHE A 1 50  ? 124.508 12.224  5.016   1.00 0.00 ? 50  PHE A CE1  4  
ATOM 7734  C CE2  . PHE A 1 50  ? 123.518 13.466  3.229   1.00 0.00 ? 50  PHE A CE2  4  
ATOM 7735  C CZ   . PHE A 1 50  ? 124.629 13.123  3.974   1.00 0.00 ? 50  PHE A CZ   4  
ATOM 7736  H H    . PHE A 1 50  ? 118.710 10.413  5.812   1.00 0.00 ? 50  PHE A H    4  
ATOM 7737  H HA   . PHE A 1 50  ? 120.742 11.916  6.963   1.00 0.00 ? 50  PHE A HA   4  
ATOM 7738  H HB2  . PHE A 1 50  ? 121.006 10.321  5.082   1.00 0.00 ? 50  PHE A HB2  4  
ATOM 7739  H HB3  . PHE A 1 50  ? 120.199 11.462  4.016   1.00 0.00 ? 50  PHE A HB3  4  
ATOM 7740  H HD1  . PHE A 1 50  ? 123.179 10.967  6.129   1.00 0.00 ? 50  PHE A HD1  4  
ATOM 7741  H HD2  . PHE A 1 50  ? 121.419 13.178  2.944   1.00 0.00 ? 50  PHE A HD2  4  
ATOM 7742  H HE1  . PHE A 1 50  ? 125.375 11.954  5.601   1.00 0.00 ? 50  PHE A HE1  4  
ATOM 7743  H HE2  . PHE A 1 50  ? 123.609 14.170  2.414   1.00 0.00 ? 50  PHE A HE2  4  
ATOM 7744  H HZ   . PHE A 1 50  ? 125.591 13.558  3.743   1.00 0.00 ? 50  PHE A HZ   4  
ATOM 7745  N N    . LYS A 1 51  ? 118.797 13.648  4.946   1.00 0.00 ? 51  LYS A N    4  
ATOM 7746  C CA   . LYS A 1 51  ? 118.378 14.981  4.535   1.00 0.00 ? 51  LYS A CA   4  
ATOM 7747  C C    . LYS A 1 51  ? 117.542 15.648  5.633   1.00 0.00 ? 51  LYS A C    4  
ATOM 7748  O O    . LYS A 1 51  ? 117.430 16.875  5.692   1.00 0.00 ? 51  LYS A O    4  
ATOM 7749  C CB   . LYS A 1 51  ? 117.597 14.852  3.208   1.00 0.00 ? 51  LYS A CB   4  
ATOM 7750  C CG   . LYS A 1 51  ? 116.883 16.120  2.732   1.00 0.00 ? 51  LYS A CG   4  
ATOM 7751  C CD   . LYS A 1 51  ? 115.425 16.173  3.194   1.00 0.00 ? 51  LYS A CD   4  
ATOM 7752  C CE   . LYS A 1 51  ? 114.609 15.005  2.645   1.00 0.00 ? 51  LYS A CE   4  
ATOM 7753  N NZ   . LYS A 1 51  ? 114.554 15.002  1.156   1.00 0.00 ? 51  LYS A NZ   4  
ATOM 7754  H H    . LYS A 1 51  ? 118.332 12.872  4.566   1.00 0.00 ? 51  LYS A H    4  
ATOM 7755  H HA   . LYS A 1 51  ? 119.266 15.573  4.363   1.00 0.00 ? 51  LYS A HA   4  
ATOM 7756  H HB2  . LYS A 1 51  ? 118.291 14.555  2.434   1.00 0.00 ? 51  LYS A HB2  4  
ATOM 7757  H HB3  . LYS A 1 51  ? 116.858 14.070  3.322   1.00 0.00 ? 51  LYS A HB3  4  
ATOM 7758  H HG2  . LYS A 1 51  ? 117.403 16.980  3.125   1.00 0.00 ? 51  LYS A HG2  4  
ATOM 7759  H HG3  . LYS A 1 51  ? 116.909 16.149  1.651   1.00 0.00 ? 51  LYS A HG3  4  
ATOM 7760  H HD2  . LYS A 1 51  ? 115.397 16.141  4.274   1.00 0.00 ? 51  LYS A HD2  4  
ATOM 7761  H HD3  . LYS A 1 51  ? 114.984 17.099  2.851   1.00 0.00 ? 51  LYS A HD3  4  
ATOM 7762  H HE2  . LYS A 1 51  ? 115.057 14.080  2.978   1.00 0.00 ? 51  LYS A HE2  4  
ATOM 7763  H HE3  . LYS A 1 51  ? 113.602 15.072  3.032   1.00 0.00 ? 51  LYS A HE3  4  
ATOM 7764  H HZ1  . LYS A 1 51  ? 114.047 15.842  0.813   1.00 0.00 ? 51  LYS A HZ1  4  
ATOM 7765  H HZ2  . LYS A 1 51  ? 114.059 14.152  0.817   1.00 0.00 ? 51  LYS A HZ2  4  
ATOM 7766  H HZ3  . LYS A 1 51  ? 115.514 15.006  0.759   1.00 0.00 ? 51  LYS A HZ3  4  
ATOM 7767  N N    . LYS A 1 52  ? 116.985 14.828  6.516   1.00 0.00 ? 52  LYS A N    4  
ATOM 7768  C CA   . LYS A 1 52  ? 116.060 15.288  7.537   1.00 0.00 ? 52  LYS A CA   4  
ATOM 7769  C C    . LYS A 1 52  ? 116.766 15.820  8.783   1.00 0.00 ? 52  LYS A C    4  
ATOM 7770  O O    . LYS A 1 52  ? 116.313 16.802  9.380   1.00 0.00 ? 52  LYS A O    4  
ATOM 7771  C CB   . LYS A 1 52  ? 115.122 14.135  7.895   1.00 0.00 ? 52  LYS A CB   4  
ATOM 7772  C CG   . LYS A 1 52  ? 114.064 14.486  8.926   1.00 0.00 ? 52  LYS A CG   4  
ATOM 7773  C CD   . LYS A 1 52  ? 112.954 13.438  8.967   1.00 0.00 ? 52  LYS A CD   4  
ATOM 7774  C CE   . LYS A 1 52  ? 113.496 12.038  9.241   1.00 0.00 ? 52  LYS A CE   4  
ATOM 7775  N NZ   . LYS A 1 52  ? 112.455 10.997  9.049   1.00 0.00 ? 52  LYS A NZ   4  
ATOM 7776  H H    . LYS A 1 52  ? 117.188 13.872  6.471   1.00 0.00 ? 52  LYS A H    4  
ATOM 7777  H HA   . LYS A 1 52  ? 115.476 16.089  7.118   1.00 0.00 ? 52  LYS A HA   4  
ATOM 7778  H HB2  . LYS A 1 52  ? 114.623 13.806  6.995   1.00 0.00 ? 52  LYS A HB2  4  
ATOM 7779  H HB3  . LYS A 1 52  ? 115.714 13.316  8.282   1.00 0.00 ? 52  LYS A HB3  4  
ATOM 7780  H HG2  . LYS A 1 52  ? 114.532 14.547  9.897   1.00 0.00 ? 52  LYS A HG2  4  
ATOM 7781  H HG3  . LYS A 1 52  ? 113.638 15.443  8.669   1.00 0.00 ? 52  LYS A HG3  4  
ATOM 7782  H HD2  . LYS A 1 52  ? 112.255 13.699  9.749   1.00 0.00 ? 52  LYS A HD2  4  
ATOM 7783  H HD3  . LYS A 1 52  ? 112.441 13.435  8.015   1.00 0.00 ? 52  LYS A HD3  4  
ATOM 7784  H HE2  . LYS A 1 52  ? 114.315 11.839  8.566   1.00 0.00 ? 52  LYS A HE2  4  
ATOM 7785  H HE3  . LYS A 1 52  ? 113.852 11.994  10.260  1.00 0.00 ? 52  LYS A HE3  4  
ATOM 7786  H HZ1  . LYS A 1 52  ? 111.628 11.202  9.644   1.00 0.00 ? 52  LYS A HZ1  4  
ATOM 7787  H HZ2  . LYS A 1 52  ? 112.829 10.061  9.305   1.00 0.00 ? 52  LYS A HZ2  4  
ATOM 7788  H HZ3  . LYS A 1 52  ? 112.153 10.976  8.052   1.00 0.00 ? 52  LYS A HZ3  4  
ATOM 7789  N N    . MET A 1 53  ? 117.866 15.193  9.183   1.00 0.00 ? 53  MET A N    4  
ATOM 7790  C CA   . MET A 1 53  ? 118.543 15.588  10.420  1.00 0.00 ? 53  MET A CA   4  
ATOM 7791  C C    . MET A 1 53  ? 120.069 15.503  10.286  1.00 0.00 ? 53  MET A C    4  
ATOM 7792  O O    . MET A 1 53  ? 120.600 15.484  9.174   1.00 0.00 ? 53  MET A O    4  
ATOM 7793  C CB   . MET A 1 53  ? 118.075 14.699  11.588  1.00 0.00 ? 53  MET A CB   4  
ATOM 7794  C CG   . MET A 1 53  ? 118.549 13.251  11.490  1.00 0.00 ? 53  MET A CG   4  
ATOM 7795  S SD   . MET A 1 53  ? 118.367 12.345  13.040  1.00 0.00 ? 53  MET A SD   4  
ATOM 7796  C CE   . MET A 1 53  ? 119.298 10.855  12.672  1.00 0.00 ? 53  MET A CE   4  
ATOM 7797  H H    . MET A 1 53  ? 118.231 14.458  8.643   1.00 0.00 ? 53  MET A H    4  
ATOM 7798  H HA   . MET A 1 53  ? 118.268 16.613  10.626  1.00 0.00 ? 53  MET A HA   4  
ATOM 7799  H HB2  . MET A 1 53  ? 118.448 15.114  12.514  1.00 0.00 ? 53  MET A HB2  4  
ATOM 7800  H HB3  . MET A 1 53  ? 116.994 14.700  11.617  1.00 0.00 ? 53  MET A HB3  4  
ATOM 7801  H HG2  . MET A 1 53  ? 117.972 12.747  10.728  1.00 0.00 ? 53  MET A HG2  4  
ATOM 7802  H HG3  . MET A 1 53  ? 119.592 13.245  11.209  1.00 0.00 ? 53  MET A HG3  4  
ATOM 7803  H HE1  . MET A 1 53  ? 118.860 10.354  11.821  1.00 0.00 ? 53  MET A HE1  4  
ATOM 7804  H HE2  . MET A 1 53  ? 119.274 10.196  13.526  1.00 0.00 ? 53  MET A HE2  4  
ATOM 7805  H HE3  . MET A 1 53  ? 120.322 11.115  12.447  1.00 0.00 ? 53  MET A HE3  4  
ATOM 7806  N N    . GLN A 1 54  ? 120.752 15.480  11.446  1.00 0.00 ? 54  GLN A N    4  
ATOM 7807  C CA   . GLN A 1 54  ? 122.201 15.242  11.550  1.00 0.00 ? 54  GLN A CA   4  
ATOM 7808  C C    . GLN A 1 54  ? 123.018 16.519  11.366  1.00 0.00 ? 54  GLN A C    4  
ATOM 7809  O O    . GLN A 1 54  ? 122.857 17.245  10.380  1.00 0.00 ? 54  GLN A O    4  
ATOM 7810  C CB   . GLN A 1 54  ? 122.678 14.170  10.557  1.00 0.00 ? 54  GLN A CB   4  
ATOM 7811  C CG   . GLN A 1 54  ? 122.101 12.783  10.817  1.00 0.00 ? 54  GLN A CG   4  
ATOM 7812  C CD   . GLN A 1 54  ? 122.429 11.794  9.715   1.00 0.00 ? 54  GLN A CD   4  
ATOM 7813  O OE1  . GLN A 1 54  ? 122.584 10.602  9.966   1.00 0.00 ? 54  GLN A OE1  4  
ATOM 7814  N NE2  . GLN A 1 54  ? 122.514 12.274  8.481   1.00 0.00 ? 54  GLN A NE2  4  
ATOM 7815  H H    . GLN A 1 54  ? 120.255 15.652  12.276  1.00 0.00 ? 54  GLN A H    4  
ATOM 7816  H HA   . GLN A 1 54  ? 122.381 14.874  12.552  1.00 0.00 ? 54  GLN A HA   4  
ATOM 7817  H HB2  . GLN A 1 54  ? 122.397 14.471  9.559   1.00 0.00 ? 54  GLN A HB2  4  
ATOM 7818  H HB3  . GLN A 1 54  ? 123.757 14.100  10.609  1.00 0.00 ? 54  GLN A HB3  4  
ATOM 7819  H HG2  . GLN A 1 54  ? 122.503 12.408  11.748  1.00 0.00 ? 54  GLN A HG2  4  
ATOM 7820  H HG3  . GLN A 1 54  ? 121.027 12.864  10.899  1.00 0.00 ? 54  GLN A HG3  4  
ATOM 7821  H HE21 . GLN A 1 54  ? 122.358 13.234  8.344   1.00 0.00 ? 54  GLN A HE21 4  
ATOM 7822  H HE22 . GLN A 1 54  ? 122.730 11.653  7.757   1.00 0.00 ? 54  GLN A HE22 4  
ATOM 7823  N N    . ASP A 1 55  ? 123.891 16.787  12.338  1.00 0.00 ? 55  ASP A N    4  
ATOM 7824  C CA   . ASP A 1 55  ? 124.862 17.879  12.244  1.00 0.00 ? 55  ASP A CA   4  
ATOM 7825  C C    . ASP A 1 55  ? 125.952 17.513  11.241  1.00 0.00 ? 55  ASP A C    4  
ATOM 7826  O O    . ASP A 1 55  ? 125.994 16.379  10.765  1.00 0.00 ? 55  ASP A O    4  
ATOM 7827  C CB   . ASP A 1 55  ? 125.496 18.166  13.616  1.00 0.00 ? 55  ASP A CB   4  
ATOM 7828  C CG   . ASP A 1 55  ? 124.472 18.577  14.661  1.00 0.00 ? 55  ASP A CG   4  
ATOM 7829  O OD1  . ASP A 1 55  ? 124.021 19.741  14.636  1.00 0.00 ? 55  ASP A OD1  4  
ATOM 7830  O OD2  . ASP A 1 55  ? 124.103 17.736  15.507  1.00 0.00 ? 55  ASP A OD2  4  
ATOM 7831  H H    . ASP A 1 55  ? 123.874 16.236  13.150  1.00 0.00 ? 55  ASP A H    4  
ATOM 7832  H HA   . ASP A 1 55  ? 124.345 18.763  11.897  1.00 0.00 ? 55  ASP A HA   4  
ATOM 7833  H HB2  . ASP A 1 55  ? 126.003 17.277  13.964  1.00 0.00 ? 55  ASP A HB2  4  
ATOM 7834  H HB3  . ASP A 1 55  ? 126.217 18.966  13.511  1.00 0.00 ? 55  ASP A HB3  4  
ATOM 7835  N N    . LYS A 1 56  ? 126.841 18.461  10.943  1.00 0.00 ? 56  LYS A N    4  
ATOM 7836  C CA   . LYS A 1 56  ? 127.902 18.252  9.950   1.00 0.00 ? 56  LYS A CA   4  
ATOM 7837  C C    . LYS A 1 56  ? 128.682 16.963  10.227  1.00 0.00 ? 56  LYS A C    4  
ATOM 7838  O O    . LYS A 1 56  ? 128.795 16.104  9.357   1.00 0.00 ? 56  LYS A O    4  
ATOM 7839  C CB   . LYS A 1 56  ? 128.862 19.449  9.935   1.00 0.00 ? 56  LYS A CB   4  
ATOM 7840  C CG   . LYS A 1 56  ? 129.968 19.360  8.880   1.00 0.00 ? 56  LYS A CG   4  
ATOM 7841  C CD   . LYS A 1 56  ? 129.414 19.442  7.458   1.00 0.00 ? 56  LYS A CD   4  
ATOM 7842  C CE   . LYS A 1 56  ? 130.526 19.478  6.411   1.00 0.00 ? 56  LYS A CE   4  
ATOM 7843  N NZ   . LYS A 1 56  ? 129.995 19.711  5.039   1.00 0.00 ? 56  LYS A NZ   4  
ATOM 7844  H H    . LYS A 1 56  ? 126.782 19.328  11.399  1.00 0.00 ? 56  LYS A H    4  
ATOM 7845  H HA   . LYS A 1 56  ? 127.431 18.170  8.980   1.00 0.00 ? 56  LYS A HA   4  
ATOM 7846  H HB2  . LYS A 1 56  ? 128.292 20.348  9.750   1.00 0.00 ? 56  LYS A HB2  4  
ATOM 7847  H HB3  . LYS A 1 56  ? 129.329 19.530  10.906  1.00 0.00 ? 56  LYS A HB3  4  
ATOM 7848  H HG2  . LYS A 1 56  ? 130.661 20.176  9.032   1.00 0.00 ? 56  LYS A HG2  4  
ATOM 7849  H HG3  . LYS A 1 56  ? 130.490 18.420  9.001   1.00 0.00 ? 56  LYS A HG3  4  
ATOM 7850  H HD2  . LYS A 1 56  ? 128.791 18.578  7.274   1.00 0.00 ? 56  LYS A HD2  4  
ATOM 7851  H HD3  . LYS A 1 56  ? 128.819 20.340  7.366   1.00 0.00 ? 56  LYS A HD3  4  
ATOM 7852  H HE2  . LYS A 1 56  ? 131.214 20.274  6.659   1.00 0.00 ? 56  LYS A HE2  4  
ATOM 7853  H HE3  . LYS A 1 56  ? 131.052 18.533  6.428   1.00 0.00 ? 56  LYS A HE3  4  
ATOM 7854  H HZ1  . LYS A 1 56  ? 130.780 19.851  4.369   1.00 0.00 ? 56  LYS A HZ1  4  
ATOM 7855  H HZ2  . LYS A 1 56  ? 129.392 20.560  5.027   1.00 0.00 ? 56  LYS A HZ2  4  
ATOM 7856  H HZ3  . LYS A 1 56  ? 129.431 18.896  4.725   1.00 0.00 ? 56  LYS A HZ3  4  
ATOM 7857  N N    . THR A 1 57  ? 129.208 16.838  11.444  1.00 0.00 ? 57  THR A N    4  
ATOM 7858  C CA   . THR A 1 57  ? 130.002 15.674  11.840  1.00 0.00 ? 57  THR A CA   4  
ATOM 7859  C C    . THR A 1 57  ? 129.256 14.365  11.565  1.00 0.00 ? 57  THR A C    4  
ATOM 7860  O O    . THR A 1 57  ? 129.708 13.531  10.774  1.00 0.00 ? 57  THR A O    4  
ATOM 7861  C CB   . THR A 1 57  ? 130.364 15.754  13.338  1.00 0.00 ? 57  THR A CB   4  
ATOM 7862  O OG1  . THR A 1 57  ? 129.179 16.033  14.100  1.00 0.00 ? 57  THR A OG1  4  
ATOM 7863  C CG2  . THR A 1 57  ? 131.409 16.836  13.594  1.00 0.00 ? 57  THR A CG2  4  
ATOM 7864  H H    . THR A 1 57  ? 129.056 17.550  12.102  1.00 0.00 ? 57  THR A H    4  
ATOM 7865  H HA   . THR A 1 57  ? 130.919 15.683  11.266  1.00 0.00 ? 57  THR A HA   4  
ATOM 7866  H HB   . THR A 1 57  ? 130.768 14.801  13.652  1.00 0.00 ? 57  THR A HB   4  
ATOM 7867  H HG1  . THR A 1 57  ? 129.427 16.393  14.961  1.00 0.00 ? 57  THR A HG1  4  
ATOM 7868  H HG21 . THR A 1 57  ? 132.298 16.624  13.017  1.00 0.00 ? 57  THR A HG21 4  
ATOM 7869  H HG22 . THR A 1 57  ? 131.659 16.854  14.645  1.00 0.00 ? 57  THR A HG22 4  
ATOM 7870  H HG23 . THR A 1 57  ? 131.012 17.797  13.302  1.00 0.00 ? 57  THR A HG23 4  
ATOM 7871  N N    . GLN A 1 58  ? 128.107 14.209  12.218  1.00 0.00 ? 58  GLN A N    4  
ATOM 7872  C CA   . GLN A 1 58  ? 127.254 13.033  12.044  1.00 0.00 ? 58  GLN A CA   4  
ATOM 7873  C C    . GLN A 1 58  ? 126.964 12.774  10.567  1.00 0.00 ? 58  GLN A C    4  
ATOM 7874  O O    . GLN A 1 58  ? 127.066 11.642  10.087  1.00 0.00 ? 58  GLN A O    4  
ATOM 7875  C CB   . GLN A 1 58  ? 125.931 13.231  12.793  1.00 0.00 ? 58  GLN A CB   4  
ATOM 7876  C CG   . GLN A 1 58  ? 126.059 13.183  14.311  1.00 0.00 ? 58  GLN A CG   4  
ATOM 7877  C CD   . GLN A 1 58  ? 124.738 13.455  15.010  1.00 0.00 ? 58  GLN A CD   4  
ATOM 7878  O OE1  . GLN A 1 58  ? 123.955 12.539  15.268  1.00 0.00 ? 58  GLN A OE1  4  
ATOM 7879  N NE2  . GLN A 1 58  ? 124.483 14.715  15.326  1.00 0.00 ? 58  GLN A NE2  4  
ATOM 7880  H H    . GLN A 1 58  ? 127.828 14.908  12.848  1.00 0.00 ? 58  GLN A H    4  
ATOM 7881  H HA   . GLN A 1 58  ? 127.771 12.180  12.457  1.00 0.00 ? 58  GLN A HA   4  
ATOM 7882  H HB2  . GLN A 1 58  ? 125.522 14.195  12.522  1.00 0.00 ? 58  GLN A HB2  4  
ATOM 7883  H HB3  . GLN A 1 58  ? 125.239 12.463  12.484  1.00 0.00 ? 58  GLN A HB3  4  
ATOM 7884  H HG2  . GLN A 1 58  ? 126.408 12.201  14.600  1.00 0.00 ? 58  GLN A HG2  4  
ATOM 7885  H HG3  . GLN A 1 58  ? 126.779 13.926  14.624  1.00 0.00 ? 58  GLN A HG3  4  
ATOM 7886  H HE21 . GLN A 1 58  ? 125.148 15.397  15.100  1.00 0.00 ? 58  GLN A HE21 4  
ATOM 7887  H HE22 . GLN A 1 58  ? 123.632 14.918  15.776  1.00 0.00 ? 58  GLN A HE22 4  
ATOM 7888  N N    . MET A 1 59  ? 126.604 13.840  9.867   1.00 0.00 ? 59  MET A N    4  
ATOM 7889  C CA   . MET A 1 59  ? 126.236 13.774  8.455   1.00 0.00 ? 59  MET A CA   4  
ATOM 7890  C C    . MET A 1 59  ? 127.394 13.267  7.604   1.00 0.00 ? 59  MET A C    4  
ATOM 7891  O O    . MET A 1 59  ? 127.198 12.495  6.666   1.00 0.00 ? 59  MET A O    4  
ATOM 7892  C CB   . MET A 1 59  ? 125.786 15.160  7.971   1.00 0.00 ? 59  MET A CB   4  
ATOM 7893  C CG   . MET A 1 59  ? 125.244 15.182  6.550   1.00 0.00 ? 59  MET A CG   4  
ATOM 7894  S SD   . MET A 1 59  ? 124.826 16.847  5.994   1.00 0.00 ? 59  MET A SD   4  
ATOM 7895  C CE   . MET A 1 59  ? 126.447 17.611  5.958   1.00 0.00 ? 59  MET A CE   4  
ATOM 7896  H H    . MET A 1 59  ? 126.577 14.706  10.319  1.00 0.00 ? 59  MET A H    4  
ATOM 7897  H HA   . MET A 1 59  ? 125.419 13.088  8.363   1.00 0.00 ? 59  MET A HA   4  
ATOM 7898  H HB2  . MET A 1 59  ? 125.010 15.521  8.631   1.00 0.00 ? 59  MET A HB2  4  
ATOM 7899  H HB3  . MET A 1 59  ? 126.628 15.837  8.023   1.00 0.00 ? 59  MET A HB3  4  
ATOM 7900  H HG2  . MET A 1 59  ? 125.991 14.771  5.885   1.00 0.00 ? 59  MET A HG2  4  
ATOM 7901  H HG3  . MET A 1 59  ? 124.353 14.568  6.507   1.00 0.00 ? 59  MET A HG3  4  
ATOM 7902  H HE1  . MET A 1 59  ? 126.880 17.586  6.948   1.00 0.00 ? 59  MET A HE1  4  
ATOM 7903  H HE2  . MET A 1 59  ? 126.354 18.635  5.631   1.00 0.00 ? 59  MET A HE2  4  
ATOM 7904  H HE3  . MET A 1 59  ? 127.085 17.072  5.272   1.00 0.00 ? 59  MET A HE3  4  
ATOM 7905  N N    . GLN A 1 60  ? 128.595 13.695  7.952   1.00 0.00 ? 60  GLN A N    4  
ATOM 7906  C CA   . GLN A 1 60  ? 129.796 13.310  7.212   1.00 0.00 ? 60  GLN A CA   4  
ATOM 7907  C C    . GLN A 1 60  ? 130.010 11.803  7.288   1.00 0.00 ? 60  GLN A C    4  
ATOM 7908  O O    . GLN A 1 60  ? 130.167 11.134  6.262   1.00 0.00 ? 60  GLN A O    4  
ATOM 7909  C CB   . GLN A 1 60  ? 131.032 14.057  7.735   1.00 0.00 ? 60  GLN A CB   4  
ATOM 7910  C CG   . GLN A 1 60  ? 131.022 15.548  7.416   1.00 0.00 ? 60  GLN A CG   4  
ATOM 7911  C CD   . GLN A 1 60  ? 132.258 16.272  7.923   1.00 0.00 ? 60  GLN A CD   4  
ATOM 7912  O OE1  . GLN A 1 60  ? 133.257 16.389  7.213   1.00 0.00 ? 60  GLN A OE1  4  
ATOM 7913  N NE2  . GLN A 1 60  ? 132.196 16.766  9.150   1.00 0.00 ? 60  GLN A NE2  4  
ATOM 7914  H H    . GLN A 1 60  ? 128.675 14.276  8.735   1.00 0.00 ? 60  GLN A H    4  
ATOM 7915  H HA   . GLN A 1 60  ? 129.638 13.580  6.177   1.00 0.00 ? 60  GLN A HA   4  
ATOM 7916  H HB2  . GLN A 1 60  ? 131.083 13.938  8.809   1.00 0.00 ? 60  GLN A HB2  4  
ATOM 7917  H HB3  . GLN A 1 60  ? 131.918 13.622  7.292   1.00 0.00 ? 60  GLN A HB3  4  
ATOM 7918  H HG2  . GLN A 1 60  ? 130.969 15.672  6.344   1.00 0.00 ? 60  GLN A HG2  4  
ATOM 7919  H HG3  . GLN A 1 60  ? 130.149 15.995  7.869   1.00 0.00 ? 60  GLN A HG3  4  
ATOM 7920  H HE21 . GLN A 1 60  ? 131.371 16.639  9.660   1.00 0.00 ? 60  GLN A HE21 4  
ATOM 7921  H HE22 . GLN A 1 60  ? 132.982 17.243  9.499   1.00 0.00 ? 60  GLN A HE22 4  
ATOM 7922  N N    . GLU A 1 61  ? 129.999 11.274  8.507   1.00 0.00 ? 61  GLU A N    4  
ATOM 7923  C CA   . GLU A 1 61  ? 130.123 9.836   8.716   1.00 0.00 ? 61  GLU A CA   4  
ATOM 7924  C C    . GLU A 1 61  ? 129.015 9.113   7.957   1.00 0.00 ? 61  GLU A C    4  
ATOM 7925  O O    . GLU A 1 61  ? 129.269 8.181   7.196   1.00 0.00 ? 61  GLU A O    4  
ATOM 7926  C CB   . GLU A 1 61  ? 130.032 9.497   10.208  1.00 0.00 ? 61  GLU A CB   4  
ATOM 7927  C CG   . GLU A 1 61  ? 131.005 10.273  11.087  1.00 0.00 ? 61  GLU A CG   4  
ATOM 7928  C CD   . GLU A 1 61  ? 130.883 9.901   12.556  1.00 0.00 ? 61  GLU A CD   4  
ATOM 7929  O OE1  . GLU A 1 61  ? 129.965 10.416  13.233  1.00 0.00 ? 61  GLU A OE1  4  
ATOM 7930  O OE2  . GLU A 1 61  ? 131.698 9.083   13.040  1.00 0.00 ? 61  GLU A OE2  4  
ATOM 7931  H H    . GLU A 1 61  ? 129.908 11.866  9.285   1.00 0.00 ? 61  GLU A H    4  
ATOM 7932  H HA   . GLU A 1 61  ? 131.084 9.520   8.333   1.00 0.00 ? 61  GLU A HA   4  
ATOM 7933  H HB2  . GLU A 1 61  ? 129.028 9.706   10.550  1.00 0.00 ? 61  GLU A HB2  4  
ATOM 7934  H HB3  . GLU A 1 61  ? 130.230 8.441   10.335  1.00 0.00 ? 61  GLU A HB3  4  
ATOM 7935  H HG2  . GLU A 1 61  ? 132.013 10.066  10.757  1.00 0.00 ? 61  GLU A HG2  4  
ATOM 7936  H HG3  . GLU A 1 61  ? 130.804 11.331  10.979  1.00 0.00 ? 61  GLU A HG3  4  
ATOM 7937  N N    . LYS A 1 62  ? 127.788 9.593   8.151   1.00 0.00 ? 62  LYS A N    4  
ATOM 7938  C CA   . LYS A 1 62  ? 126.603 8.997   7.540   1.00 0.00 ? 62  LYS A CA   4  
ATOM 7939  C C    . LYS A 1 62  ? 126.751 8.946   6.015   1.00 0.00 ? 62  LYS A C    4  
ATOM 7940  O O    . LYS A 1 62  ? 126.324 7.986   5.379   1.00 0.00 ? 62  LYS A O    4  
ATOM 7941  C CB   . LYS A 1 62  ? 125.354 9.806   7.933   1.00 0.00 ? 62  LYS A CB   4  
ATOM 7942  C CG   . LYS A 1 62  ? 124.016 9.106   7.674   1.00 0.00 ? 62  LYS A CG   4  
ATOM 7943  C CD   . LYS A 1 62  ? 123.816 7.884   8.575   1.00 0.00 ? 62  LYS A CD   4  
ATOM 7944  C CE   . LYS A 1 62  ? 122.350 7.446   8.634   1.00 0.00 ? 62  LYS A CE   4  
ATOM 7945  N NZ   . LYS A 1 62  ? 121.501 8.421   9.375   1.00 0.00 ? 62  LYS A NZ   4  
ATOM 7946  H H    . LYS A 1 62  ? 127.676 10.380  8.725   1.00 0.00 ? 62  LYS A H    4  
ATOM 7947  H HA   . LYS A 1 62  ? 126.505 7.988   7.917   1.00 0.00 ? 62  LYS A HA   4  
ATOM 7948  H HB2  . LYS A 1 62  ? 125.411 10.034  8.989   1.00 0.00 ? 62  LYS A HB2  4  
ATOM 7949  H HB3  . LYS A 1 62  ? 125.359 10.737  7.382   1.00 0.00 ? 62  LYS A HB3  4  
ATOM 7950  H HG2  . LYS A 1 62  ? 123.215 9.809   7.858   1.00 0.00 ? 62  LYS A HG2  4  
ATOM 7951  H HG3  . LYS A 1 62  ? 123.982 8.789   6.640   1.00 0.00 ? 62  LYS A HG3  4  
ATOM 7952  H HD2  . LYS A 1 62  ? 124.409 7.066   8.191   1.00 0.00 ? 62  LYS A HD2  4  
ATOM 7953  H HD3  . LYS A 1 62  ? 124.148 8.128   9.575   1.00 0.00 ? 62  LYS A HD3  4  
ATOM 7954  H HE2  . LYS A 1 62  ? 121.971 7.350   7.628   1.00 0.00 ? 62  LYS A HE2  4  
ATOM 7955  H HE3  . LYS A 1 62  ? 122.293 6.489   9.131   1.00 0.00 ? 62  LYS A HE3  4  
ATOM 7956  H HZ1  . LYS A 1 62  ? 120.497 8.151   9.314   1.00 0.00 ? 62  LYS A HZ1  4  
ATOM 7957  H HZ2  . LYS A 1 62  ? 121.613 9.374   8.981   1.00 0.00 ? 62  LYS A HZ2  4  
ATOM 7958  H HZ3  . LYS A 1 62  ? 121.776 8.444   10.377  1.00 0.00 ? 62  LYS A HZ3  4  
ATOM 7959  N N    . ALA A 1 63  ? 127.387 9.977   5.447   1.00 0.00 ? 63  ALA A N    4  
ATOM 7960  C CA   . ALA A 1 63  ? 127.600 10.062  4.000   1.00 0.00 ? 63  ALA A CA   4  
ATOM 7961  C C    . ALA A 1 63  ? 128.472 8.913   3.520   1.00 0.00 ? 63  ALA A C    4  
ATOM 7962  O O    . ALA A 1 63  ? 128.160 8.233   2.537   1.00 0.00 ? 63  ALA A O    4  
ATOM 7963  C CB   . ALA A 1 63  ? 128.267 11.386  3.630   1.00 0.00 ? 63  ALA A CB   4  
ATOM 7964  H H    . ALA A 1 63  ? 127.735 10.695  6.020   1.00 0.00 ? 63  ALA A H    4  
ATOM 7965  H HA   . ALA A 1 63  ? 126.638 10.013  3.509   1.00 0.00 ? 63  ALA A HA   4  
ATOM 7966  H HB1  . ALA A 1 63  ? 127.672 12.210  3.988   1.00 0.00 ? 63  ALA A HB1  4  
ATOM 7967  H HB2  . ALA A 1 63  ? 128.364 11.454  2.555   1.00 0.00 ? 63  ALA A HB2  4  
ATOM 7968  H HB3  . ALA A 1 63  ? 129.250 11.431  4.080   1.00 0.00 ? 63  ALA A HB3  4  
ATOM 7969  N N    . LYS A 1 64  ? 129.550 8.686   4.257   1.00 0.00 ? 64  LYS A N    4  
ATOM 7970  C CA   . LYS A 1 64  ? 130.564 7.724   3.870   1.00 0.00 ? 64  LYS A CA   4  
ATOM 7971  C C    . LYS A 1 64  ? 129.991 6.336   4.039   1.00 0.00 ? 64  LYS A C    4  
ATOM 7972  O O    . LYS A 1 64  ? 130.102 5.479   3.166   1.00 0.00 ? 64  LYS A O    4  
ATOM 7973  C CB   . LYS A 1 64  ? 131.801 7.899   4.761   1.00 0.00 ? 64  LYS A CB   4  
ATOM 7974  C CG   . LYS A 1 64  ? 132.382 9.311   4.739   1.00 0.00 ? 64  LYS A CG   4  
ATOM 7975  C CD   . LYS A 1 64  ? 133.262 9.572   5.957   1.00 0.00 ? 64  LYS A CD   4  
ATOM 7976  C CE   . LYS A 1 64  ? 133.959 10.927  5.884   1.00 0.00 ? 64  LYS A CE   4  
ATOM 7977  N NZ   . LYS A 1 64  ? 134.923 10.998  4.755   1.00 0.00 ? 64  LYS A NZ   4  
ATOM 7978  H H    . LYS A 1 64  ? 129.635 9.141   5.124   1.00 0.00 ? 64  LYS A H    4  
ATOM 7979  H HA   . LYS A 1 64  ? 130.830 7.890   2.835   1.00 0.00 ? 64  LYS A HA   4  
ATOM 7980  H HB2  . LYS A 1 64  ? 131.529 7.660   5.780   1.00 0.00 ? 64  LYS A HB2  4  
ATOM 7981  H HB3  . LYS A 1 64  ? 132.568 7.211   4.433   1.00 0.00 ? 64  LYS A HB3  4  
ATOM 7982  H HG2  . LYS A 1 64  ? 132.975 9.435   3.843   1.00 0.00 ? 64  LYS A HG2  4  
ATOM 7983  H HG3  . LYS A 1 64  ? 131.569 10.025  4.736   1.00 0.00 ? 64  LYS A HG3  4  
ATOM 7984  H HD2  . LYS A 1 64  ? 132.642 9.549   6.843   1.00 0.00 ? 64  LYS A HD2  4  
ATOM 7985  H HD3  . LYS A 1 64  ? 134.011 8.795   6.022   1.00 0.00 ? 64  LYS A HD3  4  
ATOM 7986  H HE2  . LYS A 1 64  ? 133.212 11.697  5.755   1.00 0.00 ? 64  LYS A HE2  4  
ATOM 7987  H HE3  . LYS A 1 64  ? 134.489 11.096  6.811   1.00 0.00 ? 64  LYS A HE3  4  
ATOM 7988  H HZ1  . LYS A 1 64  ? 135.445 11.896  4.785   1.00 0.00 ? 64  LYS A HZ1  4  
ATOM 7989  H HZ2  . LYS A 1 64  ? 134.423 10.936  3.846   1.00 0.00 ? 64  LYS A HZ2  4  
ATOM 7990  H HZ3  . LYS A 1 64  ? 135.604 10.214  4.813   1.00 0.00 ? 64  LYS A HZ3  4  
ATOM 7991  N N    . GLU A 1 65  ? 129.334 6.165   5.170   1.00 0.00 ? 65  GLU A N    4  
ATOM 7992  C CA   . GLU A 1 65  ? 128.724 4.912   5.546   1.00 0.00 ? 65  GLU A CA   4  
ATOM 7993  C C    . GLU A 1 65  ? 127.693 4.458   4.513   1.00 0.00 ? 65  GLU A C    4  
ATOM 7994  O O    . GLU A 1 65  ? 127.881 3.435   3.858   1.00 0.00 ? 65  GLU A O    4  
ATOM 7995  C CB   . GLU A 1 65  ? 128.077 5.067   6.926   1.00 0.00 ? 65  GLU A CB   4  
ATOM 7996  C CG   . GLU A 1 65  ? 129.081 5.276   8.057   1.00 0.00 ? 65  GLU A CG   4  
ATOM 7997  C CD   . GLU A 1 65  ? 130.104 4.155   8.148   1.00 0.00 ? 65  GLU A CD   4  
ATOM 7998  O OE1  . GLU A 1 65  ? 129.771 3.090   8.709   1.00 0.00 ? 65  GLU A OE1  4  
ATOM 7999  O OE2  . GLU A 1 65  ? 131.244 4.331   7.658   1.00 0.00 ? 65  GLU A OE2  4  
ATOM 8000  H H    . GLU A 1 65  ? 129.256 6.925   5.783   1.00 0.00 ? 65  GLU A H    4  
ATOM 8001  H HA   . GLU A 1 65  ? 129.505 4.168   5.610   1.00 0.00 ? 65  GLU A HA   4  
ATOM 8002  H HB2  . GLU A 1 65  ? 127.413 5.920   6.904   1.00 0.00 ? 65  GLU A HB2  4  
ATOM 8003  H HB3  . GLU A 1 65  ? 127.503 4.191   7.139   1.00 0.00 ? 65  GLU A HB3  4  
ATOM 8004  H HG2  . GLU A 1 65  ? 129.602 6.208   7.892   1.00 0.00 ? 65  GLU A HG2  4  
ATOM 8005  H HG3  . GLU A 1 65  ? 128.543 5.331   8.994   1.00 0.00 ? 65  GLU A HG3  4  
ATOM 8006  N N    . ILE A 1 66  ? 126.625 5.236   4.343   1.00 0.00 ? 66  ILE A N    4  
ATOM 8007  C CA   . ILE A 1 66  ? 125.503 4.812   3.508   1.00 0.00 ? 66  ILE A CA   4  
ATOM 8008  C C    . ILE A 1 66  ? 125.932 4.560   2.061   1.00 0.00 ? 66  ILE A C    4  
ATOM 8009  O O    . ILE A 1 66  ? 125.496 3.588   1.443   1.00 0.00 ? 66  ILE A O    4  
ATOM 8010  C CB   . ILE A 1 66  ? 124.320 5.820   3.541   1.00 0.00 ? 66  ILE A CB   4  
ATOM 8011  C CG1  . ILE A 1 66  ? 124.721 7.181   2.943   1.00 0.00 ? 66  ILE A CG1  4  
ATOM 8012  C CG2  . ILE A 1 66  ? 123.807 5.987   4.972   1.00 0.00 ? 66  ILE A CG2  4  
ATOM 8013  C CD1  . ILE A 1 66  ? 123.602 8.207   2.950   1.00 0.00 ? 66  ILE A CD1  4  
ATOM 8014  H H    . ILE A 1 66  ? 126.594 6.113   4.783   1.00 0.00 ? 66  ILE A H    4  
ATOM 8015  H HA   . ILE A 1 66  ? 125.143 3.875   3.916   1.00 0.00 ? 66  ILE A HA   4  
ATOM 8016  H HB   . ILE A 1 66  ? 123.515 5.404   2.951   1.00 0.00 ? 66  ILE A HB   4  
ATOM 8017  H HG12 . ILE A 1 66  ? 125.546 7.590   3.508   1.00 0.00 ? 66  ILE A HG12 4  
ATOM 8018  H HG13 . ILE A 1 66  ? 125.032 7.039   1.917   1.00 0.00 ? 66  ILE A HG13 4  
ATOM 8019  H HG21 . ILE A 1 66  ? 123.480 5.030   5.352   1.00 0.00 ? 66  ILE A HG21 4  
ATOM 8020  H HG22 . ILE A 1 66  ? 122.976 6.678   4.980   1.00 0.00 ? 66  ILE A HG22 4  
ATOM 8021  H HG23 . ILE A 1 66  ? 124.599 6.371   5.599   1.00 0.00 ? 66  ILE A HG23 4  
ATOM 8022  H HD11 . ILE A 1 66  ? 122.763 7.831   2.384   1.00 0.00 ? 66  ILE A HD11 4  
ATOM 8023  H HD12 . ILE A 1 66  ? 123.955 9.125   2.503   1.00 0.00 ? 66  ILE A HD12 4  
ATOM 8024  H HD13 . ILE A 1 66  ? 123.294 8.400   3.968   1.00 0.00 ? 66  ILE A HD13 4  
ATOM 8025  N N    . TYR A 1 67  ? 126.804 5.411   1.524   1.00 0.00 ? 67  TYR A N    4  
ATOM 8026  C CA   . TYR A 1 67  ? 127.230 5.255   0.137   1.00 0.00 ? 67  TYR A CA   4  
ATOM 8027  C C    . TYR A 1 67  ? 128.174 4.065   -0.009  1.00 0.00 ? 67  TYR A C    4  
ATOM 8028  O O    . TYR A 1 67  ? 128.025 3.259   -0.927  1.00 0.00 ? 67  TYR A O    4  
ATOM 8029  C CB   . TYR A 1 67  ? 127.903 6.526   -0.395  1.00 0.00 ? 67  TYR A CB   4  
ATOM 8030  C CG   . TYR A 1 67  ? 128.125 6.491   -1.900  1.00 0.00 ? 67  TYR A CG   4  
ATOM 8031  C CD1  . TYR A 1 67  ? 127.041 6.450   -2.772  1.00 0.00 ? 67  TYR A CD1  4  
ATOM 8032  C CD2  . TYR A 1 67  ? 129.406 6.479   -2.448  1.00 0.00 ? 67  TYR A CD2  4  
ATOM 8033  C CE1  . TYR A 1 67  ? 127.224 6.402   -4.140  1.00 0.00 ? 67  TYR A CE1  4  
ATOM 8034  C CE2  . TYR A 1 67  ? 129.594 6.430   -3.817  1.00 0.00 ? 67  TYR A CE2  4  
ATOM 8035  C CZ   . TYR A 1 67  ? 128.500 6.392   -4.658  1.00 0.00 ? 67  TYR A CZ   4  
ATOM 8036  O OH   . TYR A 1 67  ? 128.682 6.346   -6.022  1.00 0.00 ? 67  TYR A OH   4  
ATOM 8037  H H    . TYR A 1 67  ? 127.164 6.151   2.065   1.00 0.00 ? 67  TYR A H    4  
ATOM 8038  H HA   . TYR A 1 67  ? 126.344 5.061   -0.454  1.00 0.00 ? 67  TYR A HA   4  
ATOM 8039  H HB2  . TYR A 1 67  ? 127.280 7.380   -0.170  1.00 0.00 ? 67  TYR A HB2  4  
ATOM 8040  H HB3  . TYR A 1 67  ? 128.864 6.651   0.085   1.00 0.00 ? 67  TYR A HB3  4  
ATOM 8041  H HD1  . TYR A 1 67  ? 126.039 6.459   -2.366  1.00 0.00 ? 67  TYR A HD1  4  
ATOM 8042  H HD2  . TYR A 1 67  ? 130.261 6.514   -1.790  1.00 0.00 ? 67  TYR A HD2  4  
ATOM 8043  H HE1  . TYR A 1 67  ? 126.367 6.373   -4.798  1.00 0.00 ? 67  TYR A HE1  4  
ATOM 8044  H HE2  . TYR A 1 67  ? 130.595 6.422   -4.223  1.00 0.00 ? 67  TYR A HE2  4  
ATOM 8045  H HH   . TYR A 1 67  ? 129.427 5.766   -6.229  1.00 0.00 ? 67  TYR A HH   4  
ATOM 8046  N N    . MET A 1 68  ? 129.125 3.947   0.917   1.00 0.00 ? 68  MET A N    4  
ATOM 8047  C CA   . MET A 1 68  ? 130.176 2.932   0.820   1.00 0.00 ? 68  MET A CA   4  
ATOM 8048  C C    . MET A 1 68  ? 129.672 1.553   1.244   1.00 0.00 ? 68  MET A C    4  
ATOM 8049  O O    . MET A 1 68  ? 130.232 0.530   0.848   1.00 0.00 ? 68  MET A O    4  
ATOM 8050  C CB   . MET A 1 68  ? 131.386 3.337   1.673   1.00 0.00 ? 68  MET A CB   4  
ATOM 8051  C CG   . MET A 1 68  ? 132.617 2.465   1.459   1.00 0.00 ? 68  MET A CG   4  
ATOM 8052  S SD   . MET A 1 68  ? 133.233 2.531   -0.239  1.00 0.00 ? 68  MET A SD   4  
ATOM 8053  C CE   . MET A 1 68  ? 133.607 4.278   -0.412  1.00 0.00 ? 68  MET A CE   4  
ATOM 8054  H H    . MET A 1 68  ? 129.123 4.559   1.685   1.00 0.00 ? 68  MET A H    4  
ATOM 8055  H HA   . MET A 1 68  ? 130.484 2.881   -0.212  1.00 0.00 ? 68  MET A HA   4  
ATOM 8056  H HB2  . MET A 1 68  ? 131.652 4.358   1.435   1.00 0.00 ? 68  MET A HB2  4  
ATOM 8057  H HB3  . MET A 1 68  ? 131.111 3.284   2.717   1.00 0.00 ? 68  MET A HB3  4  
ATOM 8058  H HG2  . MET A 1 68  ? 133.400 2.799   2.123   1.00 0.00 ? 68  MET A HG2  4  
ATOM 8059  H HG3  . MET A 1 68  ? 132.361 1.441   1.694   1.00 0.00 ? 68  MET A HG3  4  
ATOM 8060  H HE1  . MET A 1 68  ? 132.709 4.856   -0.253  1.00 0.00 ? 68  MET A HE1  4  
ATOM 8061  H HE2  . MET A 1 68  ? 133.986 4.468   -1.405  1.00 0.00 ? 68  MET A HE2  4  
ATOM 8062  H HE3  . MET A 1 68  ? 134.352 4.561   0.317   1.00 0.00 ? 68  MET A HE3  4  
ATOM 8063  N N    . THR A 1 69  ? 128.620 1.523   2.053   1.00 0.00 ? 69  THR A N    4  
ATOM 8064  C CA   . THR A 1 69  ? 128.080 0.263   2.557   1.00 0.00 ? 69  THR A CA   4  
ATOM 8065  C C    . THR A 1 69  ? 126.983 -0.285  1.639   1.00 0.00 ? 69  THR A C    4  
ATOM 8066  O O    . THR A 1 69  ? 126.819 -1.500  1.520   1.00 0.00 ? 69  THR A O    4  
ATOM 8067  C CB   . THR A 1 69  ? 127.514 0.430   3.990   1.00 0.00 ? 69  THR A CB   4  
ATOM 8068  O OG1  . THR A 1 69  ? 128.500 1.046   4.835   1.00 0.00 ? 69  THR A OG1  4  
ATOM 8069  C CG2  . THR A 1 69  ? 127.104 -0.913  4.590   1.00 0.00 ? 69  THR A CG2  4  
ATOM 8070  H H    . THR A 1 69  ? 128.198 2.366   2.321   1.00 0.00 ? 69  THR A H    4  
ATOM 8071  H HA   . THR A 1 69  ? 128.890 -0.454  2.598   1.00 0.00 ? 69  THR A HA   4  
ATOM 8072  H HB   . THR A 1 69  ? 126.643 1.070   3.946   1.00 0.00 ? 69  THR A HB   4  
ATOM 8073  H HG1  . THR A 1 69  ? 128.987 1.705   4.326   1.00 0.00 ? 69  THR A HG1  4  
ATOM 8074  H HG21 . THR A 1 69  ? 126.342 -1.368  3.972   1.00 0.00 ? 69  THR A HG21 4  
ATOM 8075  H HG22 . THR A 1 69  ? 126.714 -0.761  5.586   1.00 0.00 ? 69  THR A HG22 4  
ATOM 8076  H HG23 . THR A 1 69  ? 127.964 -1.566  4.638   1.00 0.00 ? 69  THR A HG23 4  
ATOM 8077  N N    . PHE A 1 70  ? 126.244 0.609   0.979   1.00 0.00 ? 70  PHE A N    4  
ATOM 8078  C CA   . PHE A 1 70  ? 125.068 0.200   0.205   1.00 0.00 ? 70  PHE A CA   4  
ATOM 8079  C C    . PHE A 1 70  ? 125.304 0.309   -1.305  1.00 0.00 ? 70  PHE A C    4  
ATOM 8080  O O    . PHE A 1 70  ? 124.821 -0.523  -2.076  1.00 0.00 ? 70  PHE A O    4  
ATOM 8081  C CB   . PHE A 1 70  ? 123.844 1.043   0.604   1.00 0.00 ? 70  PHE A CB   4  
ATOM 8082  C CG   . PHE A 1 70  ? 123.527 1.026   2.086   1.00 0.00 ? 70  PHE A CG   4  
ATOM 8083  C CD1  . PHE A 1 70  ? 123.658 -0.138  2.832   1.00 0.00 ? 70  PHE A CD1  4  
ATOM 8084  C CD2  . PHE A 1 70  ? 123.088 2.176   2.729   1.00 0.00 ? 70  PHE A CD2  4  
ATOM 8085  C CE1  . PHE A 1 70  ? 123.360 -0.153  4.182   1.00 0.00 ? 70  PHE A CE1  4  
ATOM 8086  C CE2  . PHE A 1 70  ? 122.790 2.165   4.079   1.00 0.00 ? 70  PHE A CE2  4  
ATOM 8087  C CZ   . PHE A 1 70  ? 122.926 0.999   4.805   1.00 0.00 ? 70  PHE A CZ   4  
ATOM 8088  H H    . PHE A 1 70  ? 126.494 1.557   1.007   1.00 0.00 ? 70  PHE A H    4  
ATOM 8089  H HA   . PHE A 1 70  ? 124.862 -0.835  0.442   1.00 0.00 ? 70  PHE A HA   4  
ATOM 8090  H HB2  . PHE A 1 70  ? 124.017 2.070   0.315   1.00 0.00 ? 70  PHE A HB2  4  
ATOM 8091  H HB3  . PHE A 1 70  ? 122.975 0.672   0.077   1.00 0.00 ? 70  PHE A HB3  4  
ATOM 8092  H HD1  . PHE A 1 70  ? 124.001 -1.041  2.348   1.00 0.00 ? 70  PHE A HD1  4  
ATOM 8093  H HD2  . PHE A 1 70  ? 122.979 3.090   2.163   1.00 0.00 ? 70  PHE A HD2  4  
ATOM 8094  H HE1  . PHE A 1 70  ? 123.466 -1.067  4.748   1.00 0.00 ? 70  PHE A HE1  4  
ATOM 8095  H HE2  . PHE A 1 70  ? 122.451 3.069   4.564   1.00 0.00 ? 70  PHE A HE2  4  
ATOM 8096  H HZ   . PHE A 1 70  ? 122.693 0.988   5.860   1.00 0.00 ? 70  PHE A HZ   4  
ATOM 8097  N N    . LEU A 1 71  ? 126.028 1.342   -1.739  1.00 0.00 ? 71  LEU A N    4  
ATOM 8098  C CA   . LEU A 1 71  ? 126.235 1.576   -3.171  1.00 0.00 ? 71  LEU A CA   4  
ATOM 8099  C C    . LEU A 1 71  ? 127.697 1.378   -3.574  1.00 0.00 ? 71  LEU A C    4  
ATOM 8100  O O    . LEU A 1 71  ? 128.137 0.249   -3.800  1.00 0.00 ? 71  LEU A O    4  
ATOM 8101  C CB   . LEU A 1 71  ? 125.755 2.984   -3.590  1.00 0.00 ? 71  LEU A CB   4  
ATOM 8102  C CG   . LEU A 1 71  ? 124.235 3.159   -3.774  1.00 0.00 ? 71  LEU A CG   4  
ATOM 8103  C CD1  . LEU A 1 71  ? 123.489 2.969   -2.459  1.00 0.00 ? 71  LEU A CD1  4  
ATOM 8104  C CD2  . LEU A 1 71  ? 123.921 4.526   -4.380  1.00 0.00 ? 71  LEU A CD2  4  
ATOM 8105  H H    . LEU A 1 71  ? 126.442 1.947   -1.089  1.00 0.00 ? 71  LEU A H    4  
ATOM 8106  H HA   . LEU A 1 71  ? 125.642 0.845   -3.707  1.00 0.00 ? 71  LEU A HA   4  
ATOM 8107  H HB2  . LEU A 1 71  ? 126.086 3.688   -2.838  1.00 0.00 ? 71  LEU A HB2  4  
ATOM 8108  H HB3  . LEU A 1 71  ? 126.236 3.239   -4.525  1.00 0.00 ? 71  LEU A HB3  4  
ATOM 8109  H HG   . LEU A 1 71  ? 123.878 2.405   -4.463  1.00 0.00 ? 71  LEU A HG   4  
ATOM 8110  H HD11 . LEU A 1 71  ? 123.661 1.970   -2.088  1.00 0.00 ? 71  LEU A HD11 4  
ATOM 8111  H HD12 . LEU A 1 71  ? 122.430 3.114   -2.619  1.00 0.00 ? 71  LEU A HD12 4  
ATOM 8112  H HD13 . LEU A 1 71  ? 123.845 3.688   -1.734  1.00 0.00 ? 71  LEU A HD13 4  
ATOM 8113  H HD21 . LEU A 1 71  ? 124.401 4.613   -5.344  1.00 0.00 ? 71  LEU A HD21 4  
ATOM 8114  H HD22 . LEU A 1 71  ? 124.286 5.306   -3.725  1.00 0.00 ? 71  LEU A HD22 4  
ATOM 8115  H HD23 . LEU A 1 71  ? 122.852 4.631   -4.502  1.00 0.00 ? 71  LEU A HD23 4  
ATOM 8116  N N    . SER A 1 72  ? 128.454 2.477   -3.611  1.00 0.00 ? 72  SER A N    4  
ATOM 8117  C CA   . SER A 1 72  ? 129.769 2.502   -4.234  1.00 0.00 ? 72  SER A CA   4  
ATOM 8118  C C    . SER A 1 72  ? 129.771 1.765   -5.585  1.00 0.00 ? 72  SER A C    4  
ATOM 8119  O O    . SER A 1 72  ? 128.727 1.610   -6.231  1.00 0.00 ? 72  SER A O    4  
ATOM 8120  C CB   . SER A 1 72  ? 130.793 1.897   -3.277  1.00 0.00 ? 72  SER A CB   4  
ATOM 8121  O OG   . SER A 1 72  ? 130.857 2.638   -2.076  1.00 0.00 ? 72  SER A OG   4  
ATOM 8122  H H    . SER A 1 72  ? 128.153 3.271   -3.145  1.00 0.00 ? 72  SER A H    4  
ATOM 8123  H HA   . SER A 1 72  ? 130.027 3.536   -4.408  1.00 0.00 ? 72  SER A HA   4  
ATOM 8124  H HB2  . SER A 1 72  ? 130.518 0.878   -3.046  1.00 0.00 ? 72  SER A HB2  4  
ATOM 8125  H HB3  . SER A 1 72  ? 131.757 1.914   -3.743  1.00 0.00 ? 72  SER A HB3  4  
ATOM 8126  H HG   . SER A 1 72  ? 131.716 2.502   -1.661  1.00 0.00 ? 72  SER A HG   4  
ATOM 8127  N N    . SER A 1 73  ? 130.957 1.370   -6.026  1.00 0.00 ? 73  SER A N    4  
ATOM 8128  C CA   . SER A 1 73  ? 131.118 0.505   -7.188  1.00 0.00 ? 73  SER A CA   4  
ATOM 8129  C C    . SER A 1 73  ? 131.953 -0.704  -6.760  1.00 0.00 ? 73  SER A C    4  
ATOM 8130  O O    . SER A 1 73  ? 132.544 -1.411  -7.578  1.00 0.00 ? 73  SER A O    4  
ATOM 8131  C CB   . SER A 1 73  ? 131.798 1.280   -8.330  1.00 0.00 ? 73  SER A CB   4  
ATOM 8132  O OG   . SER A 1 73  ? 131.729 0.570   -9.558  1.00 0.00 ? 73  SER A OG   4  
ATOM 8133  H H    . SER A 1 73  ? 131.762 1.680   -5.559  1.00 0.00 ? 73  SER A H    4  
ATOM 8134  H HA   . SER A 1 73  ? 130.140 0.167   -7.507  1.00 0.00 ? 73  SER A HA   4  
ATOM 8135  H HB2  . SER A 1 73  ? 131.305 2.234   -8.456  1.00 0.00 ? 73  SER A HB2  4  
ATOM 8136  H HB3  . SER A 1 73  ? 132.837 1.446   -8.083  1.00 0.00 ? 73  SER A HB3  4  
ATOM 8137  H HG   . SER A 1 73  ? 131.633 1.203   -10.285 1.00 0.00 ? 73  SER A HG   4  
ATOM 8138  N N    . LYS A 1 74  ? 131.940 -0.943  -5.447  1.00 0.00 ? 74  LYS A N    4  
ATOM 8139  C CA   . LYS A 1 74  ? 132.798 -1.923  -4.787  1.00 0.00 ? 74  LYS A CA   4  
ATOM 8140  C C    . LYS A 1 74  ? 132.029 -2.499  -3.594  1.00 0.00 ? 74  LYS A C    4  
ATOM 8141  O O    . LYS A 1 74  ? 130.827 -2.754  -3.700  1.00 0.00 ? 74  LYS A O    4  
ATOM 8142  C CB   . LYS A 1 74  ? 134.090 -1.234  -4.297  1.00 0.00 ? 74  LYS A CB   4  
ATOM 8143  C CG   . LYS A 1 74  ? 134.949 -0.606  -5.393  1.00 0.00 ? 74  LYS A CG   4  
ATOM 8144  C CD   . LYS A 1 74  ? 135.609 -1.654  -6.287  1.00 0.00 ? 74  LYS A CD   4  
ATOM 8145  C CE   . LYS A 1 74  ? 136.507 -1.006  -7.335  1.00 0.00 ? 74  LYS A CE   4  
ATOM 8146  N NZ   . LYS A 1 74  ? 137.233 -2.012  -8.155  1.00 0.00 ? 74  LYS A NZ   4  
ATOM 8147  H H    . LYS A 1 74  ? 131.295 -0.455  -4.893  1.00 0.00 ? 74  LYS A H    4  
ATOM 8148  H HA   . LYS A 1 74  ? 133.037 -2.713  -5.485  1.00 0.00 ? 74  LYS A HA   4  
ATOM 8149  H HB2  . LYS A 1 74  ? 133.820 -0.453  -3.600  1.00 0.00 ? 74  LYS A HB2  4  
ATOM 8150  H HB3  . LYS A 1 74  ? 134.693 -1.966  -3.775  1.00 0.00 ? 74  LYS A HB3  4  
ATOM 8151  H HG2  . LYS A 1 74  ? 134.323 0.028   -6.006  1.00 0.00 ? 74  LYS A HG2  4  
ATOM 8152  H HG3  . LYS A 1 74  ? 135.720 -0.005  -4.930  1.00 0.00 ? 74  LYS A HG3  4  
ATOM 8153  H HD2  . LYS A 1 74  ? 136.207 -2.314  -5.674  1.00 0.00 ? 74  LYS A HD2  4  
ATOM 8154  H HD3  . LYS A 1 74  ? 134.839 -2.225  -6.788  1.00 0.00 ? 74  LYS A HD3  4  
ATOM 8155  H HE2  . LYS A 1 74  ? 135.897 -0.400  -7.989  1.00 0.00 ? 74  LYS A HE2  4  
ATOM 8156  H HE3  . LYS A 1 74  ? 137.228 -0.376  -6.834  1.00 0.00 ? 74  LYS A HE3  4  
ATOM 8157  H HZ1  . LYS A 1 74  ? 136.561 -2.583  -8.705  1.00 0.00 ? 74  LYS A HZ1  4  
ATOM 8158  H HZ2  . LYS A 1 74  ? 137.786 -2.643  -7.541  1.00 0.00 ? 74  LYS A HZ2  4  
ATOM 8159  H HZ3  . LYS A 1 74  ? 137.885 -1.534  -8.812  1.00 0.00 ? 74  LYS A HZ3  4  
ATOM 8160  N N    . ALA A 1 75  ? 132.732 -2.730  -2.481  1.00 0.00 ? 75  ALA A N    4  
ATOM 8161  C CA   . ALA A 1 75  ? 132.103 -2.996  -1.181  1.00 0.00 ? 75  ALA A CA   4  
ATOM 8162  C C    . ALA A 1 75  ? 131.581 -4.428  -1.045  1.00 0.00 ? 75  ALA A C    4  
ATOM 8163  O O    . ALA A 1 75  ? 131.432 -4.925  0.074   1.00 0.00 ? 75  ALA A O    4  
ATOM 8164  C CB   . ALA A 1 75  ? 130.982 -1.987  -0.908  1.00 0.00 ? 75  ALA A CB   4  
ATOM 8165  H H    . ALA A 1 75  ? 133.712 -2.739  -2.534  1.00 0.00 ? 75  ALA A H    4  
ATOM 8166  H HA   . ALA A 1 75  ? 132.862 -2.844  -0.426  1.00 0.00 ? 75  ALA A HA   4  
ATOM 8167  H HB1  . ALA A 1 75  ? 131.366 -0.981  -1.018  1.00 0.00 ? 75  ALA A HB1  4  
ATOM 8168  H HB2  . ALA A 1 75  ? 130.610 -2.120  0.097   1.00 0.00 ? 75  ALA A HB2  4  
ATOM 8169  H HB3  . ALA A 1 75  ? 130.176 -2.142  -1.612  1.00 0.00 ? 75  ALA A HB3  4  
ATOM 8170  N N    . SER A 1 76  ? 131.300 -5.084  -2.173  1.00 0.00 ? 76  SER A N    4  
ATOM 8171  C CA   . SER A 1 76  ? 130.727 -6.432  -2.167  1.00 0.00 ? 76  SER A CA   4  
ATOM 8172  C C    . SER A 1 76  ? 129.382 -6.448  -1.429  1.00 0.00 ? 76  SER A C    4  
ATOM 8173  O O    . SER A 1 76  ? 128.944 -7.484  -0.917  1.00 0.00 ? 76  SER A O    4  
ATOM 8174  C CB   . SER A 1 76  ? 131.714 -7.432  -1.542  1.00 0.00 ? 76  SER A CB   4  
ATOM 8175  O OG   . SER A 1 76  ? 132.877 -7.575  -2.349  1.00 0.00 ? 76  SER A OG   4  
ATOM 8176  H H    . SER A 1 76  ? 131.485 -4.652  -3.032  1.00 0.00 ? 76  SER A H    4  
ATOM 8177  H HA   . SER A 1 76  ? 130.552 -6.713  -3.196  1.00 0.00 ? 76  SER A HA   4  
ATOM 8178  H HB2  . SER A 1 76  ? 132.011 -7.082  -0.565  1.00 0.00 ? 76  SER A HB2  4  
ATOM 8179  H HB3  . SER A 1 76  ? 131.236 -8.398  -1.449  1.00 0.00 ? 76  SER A HB3  4  
ATOM 8180  H HG   . SER A 1 76  ? 132.825 -8.416  -2.826  1.00 0.00 ? 76  SER A HG   4  
ATOM 8181  N N    . SER A 1 77  ? 128.735 -5.289  -1.397  1.00 0.00 ? 77  SER A N    4  
ATOM 8182  C CA   . SER A 1 77  ? 127.413 -5.132  -0.793  1.00 0.00 ? 77  SER A CA   4  
ATOM 8183  C C    . SER A 1 77  ? 126.644 -4.078  -1.578  1.00 0.00 ? 77  SER A C    4  
ATOM 8184  O O    . SER A 1 77  ? 125.781 -3.379  -1.049  1.00 0.00 ? 77  SER A O    4  
ATOM 8185  C CB   . SER A 1 77  ? 127.548 -4.732  0.684   1.00 0.00 ? 77  SER A CB   4  
ATOM 8186  O OG   . SER A 1 77  ? 128.228 -5.739  1.423   1.00 0.00 ? 77  SER A OG   4  
ATOM 8187  H H    . SER A 1 77  ? 129.160 -4.500  -1.806  1.00 0.00 ? 77  SER A H    4  
ATOM 8188  H HA   . SER A 1 77  ? 126.890 -6.077  -0.865  1.00 0.00 ? 77  SER A HA   4  
ATOM 8189  H HB2  . SER A 1 77  ? 128.107 -3.810  0.758   1.00 0.00 ? 77  SER A HB2  4  
ATOM 8190  H HB3  . SER A 1 77  ? 126.565 -4.592  1.111   1.00 0.00 ? 77  SER A HB3  4  
ATOM 8191  H HG   . SER A 1 77  ? 127.797 -6.590  1.267   1.00 0.00 ? 77  SER A HG   4  
ATOM 8192  N N    . GLN A 1 78  ? 126.961 -4.012  -2.865  1.00 0.00 ? 78  GLN A N    4  
ATOM 8193  C CA   . GLN A 1 78  ? 126.451 -2.983  -3.750  1.00 0.00 ? 78  GLN A CA   4  
ATOM 8194  C C    . GLN A 1 78  ? 125.069 -3.350  -4.270  1.00 0.00 ? 78  GLN A C    4  
ATOM 8195  O O    . GLN A 1 78  ? 124.778 -4.517  -4.545  1.00 0.00 ? 78  GLN A O    4  
ATOM 8196  C CB   . GLN A 1 78  ? 127.415 -2.808  -4.927  1.00 0.00 ? 78  GLN A CB   4  
ATOM 8197  C CG   . GLN A 1 78  ? 127.038 -1.704  -5.909  1.00 0.00 ? 78  GLN A CG   4  
ATOM 8198  C CD   . GLN A 1 78  ? 127.937 -1.679  -7.137  1.00 0.00 ? 78  GLN A CD   4  
ATOM 8199  O OE1  . GLN A 1 78  ? 127.516 -1.281  -8.224  1.00 0.00 ? 78  GLN A OE1  4  
ATOM 8200  N NE2  . GLN A 1 78  ? 129.183 -2.112  -6.981  1.00 0.00 ? 78  GLN A NE2  4  
ATOM 8201  H H    . GLN A 1 78  ? 127.545 -4.700  -3.239  1.00 0.00 ? 78  GLN A H    4  
ATOM 8202  H HA   . GLN A 1 78  ? 126.394 -2.055  -3.198  1.00 0.00 ? 78  GLN A HA   4  
ATOM 8203  H HB2  . GLN A 1 78  ? 128.395 -2.584  -4.536  1.00 0.00 ? 78  GLN A HB2  4  
ATOM 8204  H HB3  . GLN A 1 78  ? 127.462 -3.738  -5.471  1.00 0.00 ? 78  GLN A HB3  4  
ATOM 8205  H HG2  . GLN A 1 78  ? 126.018 -1.858  -6.231  1.00 0.00 ? 78  GLN A HG2  4  
ATOM 8206  H HG3  . GLN A 1 78  ? 127.114 -0.749  -5.407  1.00 0.00 ? 78  GLN A HG3  4  
ATOM 8207  H HE21 . GLN A 1 78  ? 129.459 -2.421  -6.092  1.00 0.00 ? 78  GLN A HE21 4  
ATOM 8208  H HE22 . GLN A 1 78  ? 129.772 -2.114  -7.761  1.00 0.00 ? 78  GLN A HE22 4  
ATOM 8209  N N    . VAL A 1 79  ? 124.233 -2.341  -4.397  1.00 0.00 ? 79  VAL A N    4  
ATOM 8210  C CA   . VAL A 1 79  ? 122.920 -2.485  -5.017  1.00 0.00 ? 79  VAL A CA   4  
ATOM 8211  C C    . VAL A 1 79  ? 123.047 -2.243  -6.519  1.00 0.00 ? 79  VAL A C    4  
ATOM 8212  O O    . VAL A 1 79  ? 124.007 -1.608  -6.970  1.00 0.00 ? 79  VAL A O    4  
ATOM 8213  C CB   . VAL A 1 79  ? 121.889 -1.504  -4.396  1.00 0.00 ? 79  VAL A CB   4  
ATOM 8214  C CG1  . VAL A 1 79  ? 122.355 -0.057  -4.534  1.00 0.00 ? 79  VAL A CG1  4  
ATOM 8215  C CG2  . VAL A 1 79  ? 120.502 -1.692  -5.012  1.00 0.00 ? 79  VAL A CG2  4  
ATOM 8216  H H    . VAL A 1 79  ? 124.515 -1.465  -4.067  1.00 0.00 ? 79  VAL A H    4  
ATOM 8217  H HA   . VAL A 1 79  ? 122.576 -3.499  -4.850  1.00 0.00 ? 79  VAL A HA   4  
ATOM 8218  H HB   . VAL A 1 79  ? 121.816 -1.730  -3.344  1.00 0.00 ? 79  VAL A HB   4  
ATOM 8219  H HG11 . VAL A 1 79  ? 121.635 0.602   -4.071  1.00 0.00 ? 79  VAL A HG11 4  
ATOM 8220  H HG12 . VAL A 1 79  ? 122.450 0.195   -5.581  1.00 0.00 ? 79  VAL A HG12 4  
ATOM 8221  H HG13 . VAL A 1 79  ? 123.314 0.062   -4.049  1.00 0.00 ? 79  VAL A HG13 4  
ATOM 8222  H HG21 . VAL A 1 79  ? 120.169 -2.707  -4.850  1.00 0.00 ? 79  VAL A HG21 4  
ATOM 8223  H HG22 . VAL A 1 79  ? 120.546 -1.494  -6.073  1.00 0.00 ? 79  VAL A HG22 4  
ATOM 8224  H HG23 . VAL A 1 79  ? 119.805 -1.008  -4.547  1.00 0.00 ? 79  VAL A HG23 4  
ATOM 8225  N N    . ASN A 1 80  ? 122.104 -2.759  -7.296  1.00 0.00 ? 80  ASN A N    4  
ATOM 8226  C CA   . ASN A 1 80  ? 122.161 -2.624  -8.751  1.00 0.00 ? 80  ASN A CA   4  
ATOM 8227  C C    . ASN A 1 80  ? 121.879 -1.186  -9.181  1.00 0.00 ? 80  ASN A C    4  
ATOM 8228  O O    . ASN A 1 80  ? 120.750 -0.830  -9.522  1.00 0.00 ? 80  ASN A O    4  
ATOM 8229  C CB   . ASN A 1 80  ? 121.197 -3.603  -9.445  1.00 0.00 ? 80  ASN A CB   4  
ATOM 8230  C CG   . ASN A 1 80  ? 121.729 -5.030  -9.469  1.00 0.00 ? 80  ASN A CG   4  
ATOM 8231  O OD1  . ASN A 1 80  ? 122.441 -5.423  -10.397 1.00 0.00 ? 80  ASN A OD1  4  
ATOM 8232  N ND2  . ASN A 1 80  ? 121.388 -5.815  -8.459  1.00 0.00 ? 80  ASN A ND2  4  
ATOM 8233  H H    . ASN A 1 80  ? 121.348 -3.231  -6.881  1.00 0.00 ? 80  ASN A H    4  
ATOM 8234  H HA   . ASN A 1 80  ? 123.171 -2.870  -9.054  1.00 0.00 ? 80  ASN A HA   4  
ATOM 8235  H HB2  . ASN A 1 80  ? 120.251 -3.600  -8.922  1.00 0.00 ? 80  ASN A HB2  4  
ATOM 8236  H HB3  . ASN A 1 80  ? 121.037 -3.282  -10.466 1.00 0.00 ? 80  ASN A HB3  4  
ATOM 8237  H HD21 . ASN A 1 80  ? 120.817 -5.442  -7.754  1.00 0.00 ? 80  ASN A HD21 4  
ATOM 8238  H HD22 . ASN A 1 80  ? 121.717 -6.739  -8.457  1.00 0.00 ? 80  ASN A HD22 4  
ATOM 8239  N N    . VAL A 1 81  ? 122.918 -0.355  -9.121  1.00 0.00 ? 81  VAL A N    4  
ATOM 8240  C CA   . VAL A 1 81  ? 122.854 1.024   -9.589  1.00 0.00 ? 81  VAL A CA   4  
ATOM 8241  C C    . VAL A 1 81  ? 124.055 1.322   -10.486 1.00 0.00 ? 81  VAL A C    4  
ATOM 8242  O O    . VAL A 1 81  ? 125.202 1.325   -10.034 1.00 0.00 ? 81  VAL A O    4  
ATOM 8243  C CB   . VAL A 1 81  ? 122.801 2.044   -8.415  1.00 0.00 ? 81  VAL A CB   4  
ATOM 8244  C CG1  . VAL A 1 81  ? 121.458 1.967   -7.691  1.00 0.00 ? 81  VAL A CG1  4  
ATOM 8245  C CG2  . VAL A 1 81  ? 123.955 1.821   -7.433  1.00 0.00 ? 81  VAL A CG2  4  
ATOM 8246  H H    . VAL A 1 81  ? 123.763 -0.685  -8.744  1.00 0.00 ? 81  VAL A H    4  
ATOM 8247  H HA   . VAL A 1 81  ? 121.950 1.136   -10.176 1.00 0.00 ? 81  VAL A HA   4  
ATOM 8248  H HB   . VAL A 1 81  ? 122.899 3.040   -8.828  1.00 0.00 ? 81  VAL A HB   4  
ATOM 8249  H HG11 . VAL A 1 81  ? 121.323 0.976   -7.281  1.00 0.00 ? 81  VAL A HG11 4  
ATOM 8250  H HG12 . VAL A 1 81  ? 120.659 2.178   -8.388  1.00 0.00 ? 81  VAL A HG12 4  
ATOM 8251  H HG13 . VAL A 1 81  ? 121.435 2.693   -6.891  1.00 0.00 ? 81  VAL A HG13 4  
ATOM 8252  H HG21 . VAL A 1 81  ? 123.903 0.818   -7.034  1.00 0.00 ? 81  VAL A HG21 4  
ATOM 8253  H HG22 . VAL A 1 81  ? 123.885 2.534   -6.624  1.00 0.00 ? 81  VAL A HG22 4  
ATOM 8254  H HG23 . VAL A 1 81  ? 124.896 1.955   -7.947  1.00 0.00 ? 81  VAL A HG23 4  
ATOM 8255  N N    . GLU A 1 82  ? 123.785 1.541   -11.766 1.00 0.00 ? 82  GLU A N    4  
ATOM 8256  C CA   . GLU A 1 82  ? 124.835 1.810   -12.744 1.00 0.00 ? 82  GLU A CA   4  
ATOM 8257  C C    . GLU A 1 82  ? 125.356 3.244   -12.614 1.00 0.00 ? 82  GLU A C    4  
ATOM 8258  O O    . GLU A 1 82  ? 124.986 3.972   -11.685 1.00 0.00 ? 82  GLU A O    4  
ATOM 8259  C CB   . GLU A 1 82  ? 124.305 1.559   -14.159 1.00 0.00 ? 82  GLU A CB   4  
ATOM 8260  C CG   . GLU A 1 82  ? 123.065 2.371   -14.503 1.00 0.00 ? 82  GLU A CG   4  
ATOM 8261  C CD   . GLU A 1 82  ? 122.598 2.143   -15.927 1.00 0.00 ? 82  GLU A CD   4  
ATOM 8262  O OE1  . GLU A 1 82  ? 121.889 1.150   -16.174 1.00 0.00 ? 82  GLU A OE1  4  
ATOM 8263  O OE2  . GLU A 1 82  ? 122.950 2.952   -16.810 1.00 0.00 ? 82  GLU A OE2  4  
ATOM 8264  H H    . GLU A 1 82  ? 122.854 1.518   -12.065 1.00 0.00 ? 82  GLU A H    4  
ATOM 8265  H HA   . GLU A 1 82  ? 125.651 1.128   -12.551 1.00 0.00 ? 82  GLU A HA   4  
ATOM 8266  H HB2  . GLU A 1 82  ? 125.081 1.805   -14.871 1.00 0.00 ? 82  GLU A HB2  4  
ATOM 8267  H HB3  . GLU A 1 82  ? 124.061 0.511   -14.258 1.00 0.00 ? 82  GLU A HB3  4  
ATOM 8268  H HG2  . GLU A 1 82  ? 122.267 2.093   -13.827 1.00 0.00 ? 82  GLU A HG2  4  
ATOM 8269  H HG3  . GLU A 1 82  ? 123.290 3.421   -14.374 1.00 0.00 ? 82  GLU A HG3  4  
ATOM 8270  N N    . GLY A 1 83  ? 126.190 3.653   -13.568 1.00 0.00 ? 83  GLY A N    4  
ATOM 8271  C CA   . GLY A 1 83  ? 126.834 4.955   -13.514 1.00 0.00 ? 83  GLY A CA   4  
ATOM 8272  C C    . GLY A 1 83  ? 125.915 6.107   -13.888 1.00 0.00 ? 83  GLY A C    4  
ATOM 8273  O O    . GLY A 1 83  ? 126.321 7.018   -14.612 1.00 0.00 ? 83  GLY A O    4  
ATOM 8274  H H    . GLY A 1 83  ? 126.371 3.059   -14.327 1.00 0.00 ? 83  GLY A H    4  
ATOM 8275  H HA2  . GLY A 1 83  ? 127.202 5.119   -12.511 1.00 0.00 ? 83  GLY A HA2  4  
ATOM 8276  H HA3  . GLY A 1 83  ? 127.676 4.949   -14.191 1.00 0.00 ? 83  GLY A HA3  4  
ATOM 8277  N N    . GLN A 1 84  ? 124.675 6.070   -13.404 1.00 0.00 ? 84  GLN A N    4  
ATOM 8278  C CA   . GLN A 1 84  ? 123.746 7.182   -13.585 1.00 0.00 ? 84  GLN A CA   4  
ATOM 8279  C C    . GLN A 1 84  ? 124.088 8.297   -12.601 1.00 0.00 ? 84  GLN A C    4  
ATOM 8280  O O    . GLN A 1 84  ? 123.909 9.479   -12.894 1.00 0.00 ? 84  GLN A O    4  
ATOM 8281  C CB   . GLN A 1 84  ? 122.296 6.716   -13.391 1.00 0.00 ? 84  GLN A CB   4  
ATOM 8282  C CG   . GLN A 1 84  ? 121.826 5.726   -14.452 1.00 0.00 ? 84  GLN A CG   4  
ATOM 8283  C CD   . GLN A 1 84  ? 120.427 5.193   -14.187 1.00 0.00 ? 84  GLN A CD   4  
ATOM 8284  O OE1  . GLN A 1 84  ? 120.002 5.074   -13.039 1.00 0.00 ? 84  GLN A OE1  4  
ATOM 8285  N NE2  . GLN A 1 84  ? 119.704 4.864   -15.248 1.00 0.00 ? 84  GLN A NE2  4  
ATOM 8286  H H    . GLN A 1 84  ? 124.378 5.278   -12.913 1.00 0.00 ? 84  GLN A H    4  
ATOM 8287  H HA   . GLN A 1 84  ? 123.866 7.557   -14.594 1.00 0.00 ? 84  GLN A HA   4  
ATOM 8288  H HB2  . GLN A 1 84  ? 122.208 6.243   -12.423 1.00 0.00 ? 84  GLN A HB2  4  
ATOM 8289  H HB3  . GLN A 1 84  ? 121.644 7.578   -13.421 1.00 0.00 ? 84  GLN A HB3  4  
ATOM 8290  H HG2  . GLN A 1 84  ? 121.829 6.220   -15.413 1.00 0.00 ? 84  GLN A HG2  4  
ATOM 8291  H HG3  . GLN A 1 84  ? 122.513 4.893   -14.477 1.00 0.00 ? 84  GLN A HG3  4  
ATOM 8292  H HE21 . GLN A 1 84  ? 120.103 4.979   -16.138 1.00 0.00 ? 84  GLN A HE21 4  
ATOM 8293  H HE22 . GLN A 1 84  ? 118.802 4.509   -15.100 1.00 0.00 ? 84  GLN A HE22 4  
ATOM 8294  N N    . SER A 1 85  ? 124.591 7.894   -11.436 1.00 0.00 ? 85  SER A N    4  
ATOM 8295  C CA   . SER A 1 85  ? 125.054 8.823   -10.413 1.00 0.00 ? 85  SER A CA   4  
ATOM 8296  C C    . SER A 1 85  ? 126.206 8.187   -9.630  1.00 0.00 ? 85  SER A C    4  
ATOM 8297  O O    . SER A 1 85  ? 125.998 7.253   -8.849  1.00 0.00 ? 85  SER A O    4  
ATOM 8298  C CB   . SER A 1 85  ? 123.906 9.193   -9.463  1.00 0.00 ? 85  SER A CB   4  
ATOM 8299  O OG   . SER A 1 85  ? 122.789 9.703   -10.174 1.00 0.00 ? 85  SER A OG   4  
ATOM 8300  H H    . SER A 1 85  ? 124.649 6.934   -11.257 1.00 0.00 ? 85  SER A H    4  
ATOM 8301  H HA   . SER A 1 85  ? 125.413 9.718   -10.905 1.00 0.00 ? 85  SER A HA   4  
ATOM 8302  H HB2  . SER A 1 85  ? 123.595 8.315   -8.918  1.00 0.00 ? 85  SER A HB2  4  
ATOM 8303  H HB3  . SER A 1 85  ? 124.246 9.946   -8.766  1.00 0.00 ? 85  SER A HB3  4  
ATOM 8304  H HG   . SER A 1 85  ? 122.143 8.999   -10.299 1.00 0.00 ? 85  SER A HG   4  
ATOM 8305  N N    . ARG A 1 86  ? 127.423 8.662   -9.873  1.00 0.00 ? 86  ARG A N    4  
ATOM 8306  C CA   . ARG A 1 86  ? 128.610 8.148   -9.190  1.00 0.00 ? 86  ARG A CA   4  
ATOM 8307  C C    . ARG A 1 86  ? 129.257 9.249   -8.357  1.00 0.00 ? 86  ARG A C    4  
ATOM 8308  O O    . ARG A 1 86  ? 129.385 10.389  -8.811  1.00 0.00 ? 86  ARG A O    4  
ATOM 8309  C CB   . ARG A 1 86  ? 129.618 7.593   -10.209 1.00 0.00 ? 86  ARG A CB   4  
ATOM 8310  C CG   . ARG A 1 86  ? 129.099 6.414   -11.036 1.00 0.00 ? 86  ARG A CG   4  
ATOM 8311  C CD   . ARG A 1 86  ? 129.003 5.118   -10.231 1.00 0.00 ? 86  ARG A CD   4  
ATOM 8312  N NE   . ARG A 1 86  ? 127.982 5.166   -9.178  1.00 0.00 ? 86  ARG A NE   4  
ATOM 8313  C CZ   . ARG A 1 86  ? 127.701 4.147   -8.363  1.00 0.00 ? 86  ARG A CZ   4  
ATOM 8314  N NH1  . ARG A 1 86  ? 128.297 2.970   -8.530  1.00 0.00 ? 86  ARG A NH1  4  
ATOM 8315  N NH2  . ARG A 1 86  ? 126.805 4.299   -7.397  1.00 0.00 ? 86  ARG A NH2  4  
ATOM 8316  H H    . ARG A 1 86  ? 127.531 9.385   -10.530 1.00 0.00 ? 86  ARG A H    4  
ATOM 8317  H HA   . ARG A 1 86  ? 128.300 7.349   -8.530  1.00 0.00 ? 86  ARG A HA   4  
ATOM 8318  H HB2  . ARG A 1 86  ? 129.891 8.386   -10.891 1.00 0.00 ? 86  ARG A HB2  4  
ATOM 8319  H HB3  . ARG A 1 86  ? 130.506 7.270   -9.680  1.00 0.00 ? 86  ARG A HB3  4  
ATOM 8320  H HG2  . ARG A 1 86  ? 128.117 6.659   -11.413 1.00 0.00 ? 86  ARG A HG2  4  
ATOM 8321  H HG3  . ARG A 1 86  ? 129.770 6.256   -11.871 1.00 0.00 ? 86  ARG A HG3  4  
ATOM 8322  H HD2  . ARG A 1 86  ? 128.761 4.311   -10.908 1.00 0.00 ? 86  ARG A HD2  4  
ATOM 8323  H HD3  . ARG A 1 86  ? 129.964 4.922   -9.776  1.00 0.00 ? 86  ARG A HD3  4  
ATOM 8324  H HE   . ARG A 1 86  ? 127.493 6.009   -9.062  1.00 0.00 ? 86  ARG A HE   4  
ATOM 8325  H HH11 . ARG A 1 86  ? 128.957 2.837   -9.277  1.00 0.00 ? 86  ARG A HH11 4  
ATOM 8326  H HH12 . ARG A 1 86  ? 128.099 2.209   -7.905  1.00 0.00 ? 86  ARG A HH12 4  
ATOM 8327  H HH21 . ARG A 1 86  ? 126.340 5.180   -7.278  1.00 0.00 ? 86  ARG A HH21 4  
ATOM 8328  H HH22 . ARG A 1 86  ? 126.588 3.535   -6.788  1.00 0.00 ? 86  ARG A HH22 4  
ATOM 8329  N N    . LEU A 1 87  ? 129.642 8.907   -7.133  1.00 0.00 ? 87  LEU A N    4  
ATOM 8330  C CA   . LEU A 1 87  ? 130.307 9.846   -6.234  1.00 0.00 ? 87  LEU A CA   4  
ATOM 8331  C C    . LEU A 1 87  ? 131.809 9.580   -6.211  1.00 0.00 ? 87  LEU A C    4  
ATOM 8332  O O    . LEU A 1 87  ? 132.243 8.424   -6.168  1.00 0.00 ? 87  LEU A O    4  
ATOM 8333  C CB   . LEU A 1 87  ? 129.726 9.740   -4.811  1.00 0.00 ? 87  LEU A CB   4  
ATOM 8334  C CG   . LEU A 1 87  ? 128.369 10.435  -4.584  1.00 0.00 ? 87  LEU A CG   4  
ATOM 8335  C CD1  . LEU A 1 87  ? 127.286 9.841   -5.479  1.00 0.00 ? 87  LEU A CD1  4  
ATOM 8336  C CD2  . LEU A 1 87  ? 127.962 10.347  -3.114  1.00 0.00 ? 87  LEU A CD2  4  
ATOM 8337  H H    . LEU A 1 87  ? 129.479 7.990   -6.822  1.00 0.00 ? 87  LEU A H    4  
ATOM 8338  H HA   . LEU A 1 87  ? 130.136 10.847  -6.609  1.00 0.00 ? 87  LEU A HA   4  
ATOM 8339  H HB2  . LEU A 1 87  ? 129.610 8.692   -4.577  1.00 0.00 ? 87  LEU A HB2  4  
ATOM 8340  H HB3  . LEU A 1 87  ? 130.441 10.161  -4.117  1.00 0.00 ? 87  LEU A HB3  4  
ATOM 8341  H HG   . LEU A 1 87  ? 128.466 11.481  -4.838  1.00 0.00 ? 87  LEU A HG   4  
ATOM 8342  H HD11 . LEU A 1 87  ? 127.551 9.991   -6.516  1.00 0.00 ? 87  LEU A HD11 4  
ATOM 8343  H HD12 . LEU A 1 87  ? 126.345 10.329  -5.276  1.00 0.00 ? 87  LEU A HD12 4  
ATOM 8344  H HD13 . LEU A 1 87  ? 127.192 8.782   -5.281  1.00 0.00 ? 87  LEU A HD13 4  
ATOM 8345  H HD21 . LEU A 1 87  ? 128.717 10.818  -2.502  1.00 0.00 ? 87  LEU A HD21 4  
ATOM 8346  H HD22 . LEU A 1 87  ? 127.861 9.310   -2.826  1.00 0.00 ? 87  LEU A HD22 4  
ATOM 8347  H HD23 . LEU A 1 87  ? 127.018 10.853  -2.970  1.00 0.00 ? 87  LEU A HD23 4  
ATOM 8348  N N    . ASN A 1 88  ? 132.592 10.651  -6.267  1.00 0.00 ? 88  ASN A N    4  
ATOM 8349  C CA   . ASN A 1 88  ? 134.049 10.556  -6.186  1.00 0.00 ? 88  ASN A CA   4  
ATOM 8350  C C    . ASN A 1 88  ? 134.475 10.494  -4.722  1.00 0.00 ? 88  ASN A C    4  
ATOM 8351  O O    . ASN A 1 88  ? 133.848 11.119  -3.871  1.00 0.00 ? 88  ASN A O    4  
ATOM 8352  C CB   . ASN A 1 88  ? 134.708 11.767  -6.871  1.00 0.00 ? 88  ASN A CB   4  
ATOM 8353  C CG   . ASN A 1 88  ? 134.429 11.841  -8.367  1.00 0.00 ? 88  ASN A CG   4  
ATOM 8354  O OD1  . ASN A 1 88  ? 133.404 11.357  -8.853  1.00 0.00 ? 88  ASN A OD1  4  
ATOM 8355  N ND2  . ASN A 1 88  ? 135.333 12.465  -9.107  1.00 0.00 ? 88  ASN A ND2  4  
ATOM 8356  H H    . ASN A 1 88  ? 132.178 11.536  -6.363  1.00 0.00 ? 88  ASN A H    4  
ATOM 8357  H HA   . ASN A 1 88  ? 134.360 9.648   -6.685  1.00 0.00 ? 88  ASN A HA   4  
ATOM 8358  H HB2  . ASN A 1 88  ? 134.339 12.674  -6.416  1.00 0.00 ? 88  ASN A HB2  4  
ATOM 8359  H HB3  . ASN A 1 88  ? 135.779 11.711  -6.727  1.00 0.00 ? 88  ASN A HB3  4  
ATOM 8360  H HD21 . ASN A 1 88  ? 136.122 12.839  -8.659  1.00 0.00 ? 88  ASN A HD21 4  
ATOM 8361  H HD22 . ASN A 1 88  ? 135.175 12.534  -10.072 1.00 0.00 ? 88  ASN A HD22 4  
ATOM 8362  N N    . GLU A 1 89  ? 135.546 9.757   -4.435  1.00 0.00 ? 89  GLU A N    4  
ATOM 8363  C CA   . GLU A 1 89  ? 136.032 9.579   -3.057  1.00 0.00 ? 89  GLU A CA   4  
ATOM 8364  C C    . GLU A 1 89  ? 136.077 10.910  -2.297  1.00 0.00 ? 89  GLU A C    4  
ATOM 8365  O O    . GLU A 1 89  ? 135.767 10.969  -1.105  1.00 0.00 ? 89  GLU A O    4  
ATOM 8366  C CB   . GLU A 1 89  ? 137.435 8.941   -3.045  1.00 0.00 ? 89  GLU A CB   4  
ATOM 8367  C CG   . GLU A 1 89  ? 137.491 7.499   -3.554  1.00 0.00 ? 89  GLU A CG   4  
ATOM 8368  C CD   . GLU A 1 89  ? 137.201 7.373   -5.042  1.00 0.00 ? 89  GLU A CD   4  
ATOM 8369  O OE1  . GLU A 1 89  ? 138.118 7.603   -5.856  1.00 0.00 ? 89  GLU A OE1  4  
ATOM 8370  O OE2  . GLU A 1 89  ? 136.051 7.059   -5.408  1.00 0.00 ? 89  GLU A OE2  4  
ATOM 8371  H H    . GLU A 1 89  ? 136.015 9.302   -5.165  1.00 0.00 ? 89  GLU A H    4  
ATOM 8372  H HA   . GLU A 1 89  ? 135.345 8.917   -2.551  1.00 0.00 ? 89  GLU A HA   4  
ATOM 8373  H HB2  . GLU A 1 89  ? 138.092 9.539   -3.661  1.00 0.00 ? 89  GLU A HB2  4  
ATOM 8374  H HB3  . GLU A 1 89  ? 137.810 8.951   -2.030  1.00 0.00 ? 89  GLU A HB3  4  
ATOM 8375  H HG2  . GLU A 1 89  ? 138.479 7.105   -3.363  1.00 0.00 ? 89  GLU A HG2  4  
ATOM 8376  H HG3  . GLU A 1 89  ? 136.765 6.913   -3.008  1.00 0.00 ? 89  GLU A HG3  4  
ATOM 8377  N N    . LYS A 1 90  ? 136.428 11.977  -3.007  1.00 0.00 ? 90  LYS A N    4  
ATOM 8378  C CA   . LYS A 1 90  ? 136.642 13.281  -2.383  1.00 0.00 ? 90  LYS A CA   4  
ATOM 8379  C C    . LYS A 1 90  ? 135.338 13.975  -1.996  1.00 0.00 ? 90  LYS A C    4  
ATOM 8380  O O    . LYS A 1 90  ? 135.336 14.812  -1.096  1.00 0.00 ? 90  LYS A O    4  
ATOM 8381  C CB   . LYS A 1 90  ? 137.509 14.209  -3.258  1.00 0.00 ? 90  LYS A CB   4  
ATOM 8382  C CG   . LYS A 1 90  ? 137.296 14.098  -4.771  1.00 0.00 ? 90  LYS A CG   4  
ATOM 8383  C CD   . LYS A 1 90  ? 138.078 12.932  -5.386  1.00 0.00 ? 90  LYS A CD   4  
ATOM 8384  C CE   . LYS A 1 90  ? 139.553 12.942  -4.979  1.00 0.00 ? 90  LYS A CE   4  
ATOM 8385  N NZ   . LYS A 1 90  ? 140.228 14.236  -5.284  1.00 0.00 ? 90  LYS A NZ   4  
ATOM 8386  H H    . LYS A 1 90  ? 136.538 11.885  -3.971  1.00 0.00 ? 90  LYS A H    4  
ATOM 8387  H HA   . LYS A 1 90  ? 137.187 13.093  -1.466  1.00 0.00 ? 90  LYS A HA   4  
ATOM 8388  H HB2  . LYS A 1 90  ? 137.308 15.232  -2.973  1.00 0.00 ? 90  LYS A HB2  4  
ATOM 8389  H HB3  . LYS A 1 90  ? 138.548 13.998  -3.049  1.00 0.00 ? 90  LYS A HB3  4  
ATOM 8390  H HG2  . LYS A 1 90  ? 136.244 13.950  -4.966  1.00 0.00 ? 90  LYS A HG2  4  
ATOM 8391  H HG3  . LYS A 1 90  ? 137.620 15.019  -5.237  1.00 0.00 ? 90  LYS A HG3  4  
ATOM 8392  H HD2  . LYS A 1 90  ? 137.634 12.003  -5.058  1.00 0.00 ? 90  LYS A HD2  4  
ATOM 8393  H HD3  . LYS A 1 90  ? 138.011 12.999  -6.464  1.00 0.00 ? 90  LYS A HD3  4  
ATOM 8394  H HE2  . LYS A 1 90  ? 139.620 12.757  -3.918  1.00 0.00 ? 90  LYS A HE2  4  
ATOM 8395  H HE3  . LYS A 1 90  ? 140.061 12.149  -5.510  1.00 0.00 ? 90  LYS A HE3  4  
ATOM 8396  H HZ1  . LYS A 1 90  ? 141.232 14.190  -5.008  1.00 0.00 ? 90  LYS A HZ1  4  
ATOM 8397  H HZ2  . LYS A 1 90  ? 139.776 15.010  -4.758  1.00 0.00 ? 90  LYS A HZ2  4  
ATOM 8398  H HZ3  . LYS A 1 90  ? 140.170 14.443  -6.300  1.00 0.00 ? 90  LYS A HZ3  4  
ATOM 8399  N N    . ILE A 1 91  ? 134.224 13.637  -2.644  1.00 0.00 ? 91  ILE A N    4  
ATOM 8400  C CA   . ILE A 1 91  ? 132.950 14.251  -2.271  1.00 0.00 ? 91  ILE A CA   4  
ATOM 8401  C C    . ILE A 1 91  ? 132.478 13.669  -0.936  1.00 0.00 ? 91  ILE A C    4  
ATOM 8402  O O    . ILE A 1 91  ? 131.714 14.297  -0.204  1.00 0.00 ? 91  ILE A O    4  
ATOM 8403  C CB   . ILE A 1 91  ? 131.850 14.093  -3.362  1.00 0.00 ? 91  ILE A CB   4  
ATOM 8404  C CG1  . ILE A 1 91  ? 130.687 15.060  -3.085  1.00 0.00 ? 91  ILE A CG1  4  
ATOM 8405  C CG2  . ILE A 1 91  ? 131.338 12.659  -3.434  1.00 0.00 ? 91  ILE A CG2  4  
ATOM 8406  C CD1  . ILE A 1 91  ? 129.575 15.002  -4.115  1.00 0.00 ? 91  ILE A CD1  4  
ATOM 8407  H H    . ILE A 1 91  ? 134.257 12.970  -3.362  1.00 0.00 ? 91  ILE A H    4  
ATOM 8408  H HA   . ILE A 1 91  ? 133.135 15.311  -2.132  1.00 0.00 ? 91  ILE A HA   4  
ATOM 8409  H HB   . ILE A 1 91  ? 132.289 14.339  -4.319  1.00 0.00 ? 91  ILE A HB   4  
ATOM 8410  H HG12 . ILE A 1 91  ? 130.256 14.826  -2.122  1.00 0.00 ? 91  ILE A HG12 4  
ATOM 8411  H HG13 . ILE A 1 91  ? 131.067 16.072  -3.065  1.00 0.00 ? 91  ILE A HG13 4  
ATOM 8412  H HG21 . ILE A 1 91  ? 130.884 12.388  -2.491  1.00 0.00 ? 91  ILE A HG21 4  
ATOM 8413  H HG22 . ILE A 1 91  ? 132.159 11.993  -3.640  1.00 0.00 ? 91  ILE A HG22 4  
ATOM 8414  H HG23 . ILE A 1 91  ? 130.604 12.576  -4.223  1.00 0.00 ? 91  ILE A HG23 4  
ATOM 8415  H HD11 . ILE A 1 91  ? 128.805 15.711  -3.851  1.00 0.00 ? 91  ILE A HD11 4  
ATOM 8416  H HD12 . ILE A 1 91  ? 129.154 14.007  -4.138  1.00 0.00 ? 91  ILE A HD12 4  
ATOM 8417  H HD13 . ILE A 1 91  ? 129.972 15.248  -5.089  1.00 0.00 ? 91  ILE A HD13 4  
ATOM 8418  N N    . LEU A 1 92  ? 132.966 12.466  -0.618  1.00 0.00 ? 92  LEU A N    4  
ATOM 8419  C CA   . LEU A 1 92  ? 132.732 11.854  0.693   1.00 0.00 ? 92  LEU A CA   4  
ATOM 8420  C C    . LEU A 1 92  ? 133.696 12.441  1.727   1.00 0.00 ? 92  LEU A C    4  
ATOM 8421  O O    . LEU A 1 92  ? 133.494 12.295  2.934   1.00 0.00 ? 92  LEU A O    4  
ATOM 8422  C CB   . LEU A 1 92  ? 132.896 10.320  0.646   1.00 0.00 ? 92  LEU A CB   4  
ATOM 8423  C CG   . LEU A 1 92  ? 131.823 9.536   -0.138  1.00 0.00 ? 92  LEU A CG   4  
ATOM 8424  C CD1  . LEU A 1 92  ? 130.418 9.940   0.301   1.00 0.00 ? 92  LEU A CD1  4  
ATOM 8425  C CD2  . LEU A 1 92  ? 132.001 9.710   -1.643  1.00 0.00 ? 92  LEU A CD2  4  
ATOM 8426  H H    . LEU A 1 92  ? 133.495 11.979  -1.284  1.00 0.00 ? 92  LEU A H    4  
ATOM 8427  H HA   . LEU A 1 92  ? 131.720 12.090  0.993   1.00 0.00 ? 92  LEU A HA   4  
ATOM 8428  H HB2  . LEU A 1 92  ? 133.860 10.099  0.207   1.00 0.00 ? 92  LEU A HB2  4  
ATOM 8429  H HB3  . LEU A 1 92  ? 132.899 9.953   1.663   1.00 0.00 ? 92  LEU A HB3  4  
ATOM 8430  H HG   . LEU A 1 92  ? 131.938 8.483   0.084   1.00 0.00 ? 92  LEU A HG   4  
ATOM 8431  H HD11 . LEU A 1 92  ? 130.305 9.763   1.361   1.00 0.00 ? 92  LEU A HD11 4  
ATOM 8432  H HD12 . LEU A 1 92  ? 129.689 9.354   -0.239  1.00 0.00 ? 92  LEU A HD12 4  
ATOM 8433  H HD13 . LEU A 1 92  ? 130.260 10.989  0.093   1.00 0.00 ? 92  LEU A HD13 4  
ATOM 8434  H HD21 . LEU A 1 92  ? 131.931 10.758  -1.896  1.00 0.00 ? 92  LEU A HD21 4  
ATOM 8435  H HD22 . LEU A 1 92  ? 131.230 9.161   -2.165  1.00 0.00 ? 92  LEU A HD22 4  
ATOM 8436  H HD23 . LEU A 1 92  ? 132.970 9.334   -1.938  1.00 0.00 ? 92  LEU A HD23 4  
ATOM 8437  N N    . GLU A 1 93  ? 134.753 13.094  1.243   1.00 0.00 ? 93  GLU A N    4  
ATOM 8438  C CA   . GLU A 1 93  ? 135.725 13.758  2.114   1.00 0.00 ? 93  GLU A CA   4  
ATOM 8439  C C    . GLU A 1 93  ? 135.243 15.166  2.472   1.00 0.00 ? 93  GLU A C    4  
ATOM 8440  O O    . GLU A 1 93  ? 135.815 15.830  3.341   1.00 0.00 ? 93  GLU A O    4  
ATOM 8441  C CB   . GLU A 1 93  ? 137.104 13.817  1.436   1.00 0.00 ? 93  GLU A CB   4  
ATOM 8442  C CG   . GLU A 1 93  ? 137.709 12.443  1.148   1.00 0.00 ? 93  GLU A CG   4  
ATOM 8443  C CD   . GLU A 1 93  ? 139.075 12.524  0.479   1.00 0.00 ? 93  GLU A CD   4  
ATOM 8444  O OE1  . GLU A 1 93  ? 140.075 12.771  1.184   1.00 0.00 ? 93  GLU A OE1  4  
ATOM 8445  O OE2  . GLU A 1 93  ? 139.159 12.338  -0.752  1.00 0.00 ? 93  GLU A OE2  4  
ATOM 8446  H H    . GLU A 1 93  ? 134.886 13.128  0.275   1.00 0.00 ? 93  GLU A H    4  
ATOM 8447  H HA   . GLU A 1 93  ? 135.806 13.180  3.025   1.00 0.00 ? 93  GLU A HA   4  
ATOM 8448  H HB2  . GLU A 1 93  ? 137.009 14.348  0.499   1.00 0.00 ? 93  GLU A HB2  4  
ATOM 8449  H HB3  . GLU A 1 93  ? 137.786 14.358  2.077   1.00 0.00 ? 93  GLU A HB3  4  
ATOM 8450  H HG2  . GLU A 1 93  ? 137.813 11.907  2.082   1.00 0.00 ? 93  GLU A HG2  4  
ATOM 8451  H HG3  . GLU A 1 93  ? 137.036 11.897  0.499   1.00 0.00 ? 93  GLU A HG3  4  
ATOM 8452  N N    . GLU A 1 94  ? 134.180 15.608  1.799   1.00 0.00 ? 94  GLU A N    4  
ATOM 8453  C CA   . GLU A 1 94  ? 133.551 16.901  2.077   1.00 0.00 ? 94  GLU A CA   4  
ATOM 8454  C C    . GLU A 1 94  ? 132.027 16.796  1.913   1.00 0.00 ? 94  GLU A C    4  
ATOM 8455  O O    . GLU A 1 94  ? 131.421 17.551  1.149   1.00 0.00 ? 94  GLU A O    4  
ATOM 8456  C CB   . GLU A 1 94  ? 134.115 17.981  1.141   1.00 0.00 ? 94  GLU A CB   4  
ATOM 8457  C CG   . GLU A 1 94  ? 133.966 17.654  -0.343  1.00 0.00 ? 94  GLU A CG   4  
ATOM 8458  C CD   . GLU A 1 94  ? 134.320 18.827  -1.239  1.00 0.00 ? 94  GLU A CD   4  
ATOM 8459  O OE1  . GLU A 1 94  ? 135.522 19.021  -1.527  1.00 0.00 ? 94  GLU A OE1  4  
ATOM 8460  O OE2  . GLU A 1 94  ? 133.399 19.573  -1.644  1.00 0.00 ? 94  GLU A OE2  4  
ATOM 8461  H H    . GLU A 1 94  ? 133.804 15.046  1.089   1.00 0.00 ? 94  GLU A H    4  
ATOM 8462  H HA   . GLU A 1 94  ? 133.774 17.168  3.102   1.00 0.00 ? 94  GLU A HA   4  
ATOM 8463  H HB2  . GLU A 1 94  ? 133.602 18.913  1.336   1.00 0.00 ? 94  GLU A HB2  4  
ATOM 8464  H HB3  . GLU A 1 94  ? 135.168 18.112  1.354   1.00 0.00 ? 94  GLU A HB3  4  
ATOM 8465  H HG2  . GLU A 1 94  ? 134.617 16.825  -0.584  1.00 0.00 ? 94  GLU A HG2  4  
ATOM 8466  H HG3  . GLU A 1 94  ? 132.940 17.367  -0.534  1.00 0.00 ? 94  GLU A HG3  4  
ATOM 8467  N N    . PRO A 1 95  ? 131.381 15.874  2.657   1.00 0.00 ? 95  PRO A N    4  
ATOM 8468  C CA   . PRO A 1 95  ? 129.954 15.556  2.477   1.00 0.00 ? 95  PRO A CA   4  
ATOM 8469  C C    . PRO A 1 95  ? 129.041 16.782  2.546   1.00 0.00 ? 95  PRO A C    4  
ATOM 8470  O O    . PRO A 1 95  ? 129.226 17.674  3.383   1.00 0.00 ? 95  PRO A O    4  
ATOM 8471  C CB   . PRO A 1 95  ? 129.654 14.593  3.632   1.00 0.00 ? 95  PRO A CB   4  
ATOM 8472  C CG   . PRO A 1 95  ? 130.975 13.984  3.955   1.00 0.00 ? 95  PRO A CG   4  
ATOM 8473  C CD   . PRO A 1 95  ? 131.979 15.082  3.750   1.00 0.00 ? 95  PRO A CD   4  
ATOM 8474  H HA   . PRO A 1 95  ? 129.788 15.047  1.537   1.00 0.00 ? 95  PRO A HA   4  
ATOM 8475  H HB2  . PRO A 1 95  ? 129.252 15.143  4.473   1.00 0.00 ? 95  PRO A HB2  4  
ATOM 8476  H HB3  . PRO A 1 95  ? 128.942 13.848  3.311   1.00 0.00 ? 95  PRO A HB3  4  
ATOM 8477  H HG2  . PRO A 1 95  ? 130.987 13.648  4.982   1.00 0.00 ? 95  PRO A HG2  4  
ATOM 8478  H HG3  . PRO A 1 95  ? 131.177 13.159  3.286   1.00 0.00 ? 95  PRO A HG3  4  
ATOM 8479  H HD2  . PRO A 1 95  ? 132.082 15.677  4.648   1.00 0.00 ? 95  PRO A HD2  4  
ATOM 8480  H HD3  . PRO A 1 95  ? 132.934 14.673  3.454   1.00 0.00 ? 95  PRO A HD3  4  
ATOM 8481  N N    . HIS A 1 96  ? 128.049 16.802  1.662   1.00 0.00 ? 96  HIS A N    4  
ATOM 8482  C CA   . HIS A 1 96  ? 127.090 17.902  1.565   1.00 0.00 ? 96  HIS A CA   4  
ATOM 8483  C C    . HIS A 1 96  ? 125.694 17.389  1.934   1.00 0.00 ? 96  HIS A C    4  
ATOM 8484  O O    . HIS A 1 96  ? 125.353 16.254  1.612   1.00 0.00 ? 96  HIS A O    4  
ATOM 8485  C CB   . HIS A 1 96  ? 127.090 18.487  0.140   1.00 0.00 ? 96  HIS A CB   4  
ATOM 8486  C CG   . HIS A 1 96  ? 128.425 19.025  -0.300  1.00 0.00 ? 96  HIS A CG   4  
ATOM 8487  N ND1  . HIS A 1 96  ? 128.782 20.348  -0.171  1.00 0.00 ? 96  HIS A ND1  4  
ATOM 8488  C CD2  . HIS A 1 96  ? 129.491 18.408  -0.870  1.00 0.00 ? 96  HIS A CD2  4  
ATOM 8489  C CE1  . HIS A 1 96  ? 130.005 20.524  -0.636  1.00 0.00 ? 96  HIS A CE1  4  
ATOM 8490  N NE2  . HIS A 1 96  ? 130.460 19.363  -1.067  1.00 0.00 ? 96  HIS A NE2  4  
ATOM 8491  H H    . HIS A 1 96  ? 127.939 16.029  1.067   1.00 0.00 ? 96  HIS A H    4  
ATOM 8492  H HA   . HIS A 1 96  ? 127.382 18.671  2.269   1.00 0.00 ? 96  HIS A HA   4  
ATOM 8493  H HB2  . HIS A 1 96  ? 126.797 17.717  -0.559  1.00 0.00 ? 96  HIS A HB2  4  
ATOM 8494  H HB3  . HIS A 1 96  ? 126.374 19.296  0.092   1.00 0.00 ? 96  HIS A HB3  4  
ATOM 8495  H HD1  . HIS A 1 96  ? 128.215 21.062  0.198   1.00 0.00 ? 96  HIS A HD1  4  
ATOM 8496  H HD2  . HIS A 1 96  ? 129.565 17.359  -1.123  1.00 0.00 ? 96  HIS A HD2  4  
ATOM 8497  H HE1  . HIS A 1 96  ? 130.542 21.461  -0.659  1.00 0.00 ? 96  HIS A HE1  4  
ATOM 8498  H HE2  . HIS A 1 96  ? 131.403 19.178  -1.287  1.00 0.00 ? 96  HIS A HE2  4  
ATOM 8499  N N    . PRO A 1 97  ? 124.863 18.214  2.599   1.00 0.00 ? 97  PRO A N    4  
ATOM 8500  C CA   . PRO A 1 97  ? 123.556 17.778  3.126   1.00 0.00 ? 97  PRO A CA   4  
ATOM 8501  C C    . PRO A 1 97  ? 122.649 17.151  2.061   1.00 0.00 ? 97  PRO A C    4  
ATOM 8502  O O    . PRO A 1 97  ? 121.919 16.197  2.340   1.00 0.00 ? 97  PRO A O    4  
ATOM 8503  C CB   . PRO A 1 97  ? 122.932 19.073  3.683   1.00 0.00 ? 97  PRO A CB   4  
ATOM 8504  C CG   . PRO A 1 97  ? 123.730 20.183  3.082   1.00 0.00 ? 97  PRO A CG   4  
ATOM 8505  C CD   . PRO A 1 97  ? 125.115 19.635  2.890   1.00 0.00 ? 97  PRO A CD   4  
ATOM 8506  H HA   . PRO A 1 97  ? 123.685 17.069  3.933   1.00 0.00 ? 97  PRO A HA   4  
ATOM 8507  H HB2  . PRO A 1 97  ? 121.891 19.134  3.395   1.00 0.00 ? 97  PRO A HB2  4  
ATOM 8508  H HB3  . PRO A 1 97  ? 123.008 19.076  4.763   1.00 0.00 ? 97  PRO A HB3  4  
ATOM 8509  H HG2  . PRO A 1 97  ? 123.303 20.470  2.130   1.00 0.00 ? 97  PRO A HG2  4  
ATOM 8510  H HG3  . PRO A 1 97  ? 123.750 21.030  3.753   1.00 0.00 ? 97  PRO A HG3  4  
ATOM 8511  H HD2  . PRO A 1 97  ? 125.604 20.121  2.057   1.00 0.00 ? 97  PRO A HD2  4  
ATOM 8512  H HD3  . PRO A 1 97  ? 125.700 19.746  3.793   1.00 0.00 ? 97  PRO A HD3  4  
ATOM 8513  N N    . LEU A 1 98  ? 122.699 17.678  0.840   1.00 0.00 ? 98  LEU A N    4  
ATOM 8514  C CA   . LEU A 1 98  ? 121.817 17.209  -0.230  1.00 0.00 ? 98  LEU A CA   4  
ATOM 8515  C C    . LEU A 1 98  ? 122.597 16.451  -1.306  1.00 0.00 ? 98  LEU A C    4  
ATOM 8516  O O    . LEU A 1 98  ? 122.096 16.245  -2.411  1.00 0.00 ? 98  LEU A O    4  
ATOM 8517  C CB   . LEU A 1 98  ? 121.064 18.393  -0.860  1.00 0.00 ? 98  LEU A CB   4  
ATOM 8518  C CG   . LEU A 1 98  ? 120.205 19.227  0.108   1.00 0.00 ? 98  LEU A CG   4  
ATOM 8519  C CD1  . LEU A 1 98  ? 119.441 20.314  -0.644  1.00 0.00 ? 98  LEU A CD1  4  
ATOM 8520  C CD2  . LEU A 1 98  ? 119.241 18.336  0.890   1.00 0.00 ? 98  LEU A CD2  4  
ATOM 8521  H H    . LEU A 1 98  ? 123.343 18.396  0.652   1.00 0.00 ? 98  LEU A H    4  
ATOM 8522  H HA   . LEU A 1 98  ? 121.094 16.533  0.206   1.00 0.00 ? 98  LEU A HA   4  
ATOM 8523  H HB2  . LEU A 1 98  ? 121.792 19.051  -1.317  1.00 0.00 ? 98  LEU A HB2  4  
ATOM 8524  H HB3  . LEU A 1 98  ? 120.419 18.009  -1.638  1.00 0.00 ? 98  LEU A HB3  4  
ATOM 8525  H HG   . LEU A 1 98  ? 120.855 19.716  0.820   1.00 0.00 ? 98  LEU A HG   4  
ATOM 8526  H HD11 . LEU A 1 98  ? 120.140 20.955  -1.160  1.00 0.00 ? 98  LEU A HD11 4  
ATOM 8527  H HD12 . LEU A 1 98  ? 118.867 20.902  0.058   1.00 0.00 ? 98  LEU A HD12 4  
ATOM 8528  H HD13 . LEU A 1 98  ? 118.773 19.858  -1.362  1.00 0.00 ? 98  LEU A HD13 4  
ATOM 8529  H HD21 . LEU A 1 98  ? 118.649 18.945  1.559   1.00 0.00 ? 98  LEU A HD21 4  
ATOM 8530  H HD22 . LEU A 1 98  ? 119.801 17.614  1.465   1.00 0.00 ? 98  LEU A HD22 4  
ATOM 8531  H HD23 . LEU A 1 98  ? 118.587 17.818  0.202   1.00 0.00 ? 98  LEU A HD23 4  
ATOM 8532  N N    . MET A 1 99  ? 123.805 15.999  -0.970  1.00 0.00 ? 99  MET A N    4  
ATOM 8533  C CA   . MET A 1 99  ? 124.664 15.308  -1.939  1.00 0.00 ? 99  MET A CA   4  
ATOM 8534  C C    . MET A 1 99  ? 124.029 14.000  -2.420  1.00 0.00 ? 99  MET A C    4  
ATOM 8535  O O    . MET A 1 99  ? 124.348 13.508  -3.502  1.00 0.00 ? 99  MET A O    4  
ATOM 8536  C CB   . MET A 1 99  ? 126.054 15.032  -1.341  1.00 0.00 ? 99  MET A CB   4  
ATOM 8537  C CG   . MET A 1 99  ? 126.049 14.059  -0.169  1.00 0.00 ? 99  MET A CG   4  
ATOM 8538  S SD   . MET A 1 99  ? 127.667 13.899  0.615   1.00 0.00 ? 99  MET A SD   4  
ATOM 8539  C CE   . MET A 1 99  ? 128.616 13.140  -0.700  1.00 0.00 ? 99  MET A CE   4  
ATOM 8540  H H    . MET A 1 99  ? 124.129 16.137  -0.053  1.00 0.00 ? 99  MET A H    4  
ATOM 8541  H HA   . MET A 1 99  ? 124.780 15.962  -2.792  1.00 0.00 ? 99  MET A HA   4  
ATOM 8542  H HB2  . MET A 1 99  ? 126.692 14.627  -2.113  1.00 0.00 ? 99  MET A HB2  4  
ATOM 8543  H HB3  . MET A 1 99  ? 126.473 15.967  -0.999  1.00 0.00 ? 99  MET A HB3  4  
ATOM 8544  H HG2  . MET A 1 99  ? 125.343 14.407  0.570   1.00 0.00 ? 99  MET A HG2  4  
ATOM 8545  H HG3  . MET A 1 99  ? 125.741 13.086  -0.525  1.00 0.00 ? 99  MET A HG3  4  
ATOM 8546  H HE1  . MET A 1 99  ? 128.615 13.786  -1.565  1.00 0.00 ? 99  MET A HE1  4  
ATOM 8547  H HE2  . MET A 1 99  ? 128.174 12.189  -0.960  1.00 0.00 ? 99  MET A HE2  4  
ATOM 8548  H HE3  . MET A 1 99  ? 129.632 12.985  -0.367  1.00 0.00 ? 99  MET A HE3  4  
ATOM 8549  N N    . PHE A 1 100 ? 123.128 13.440  -1.615  1.00 0.00 ? 100 PHE A N    4  
ATOM 8550  C CA   . PHE A 1 100 ? 122.452 12.190  -1.971  1.00 0.00 ? 100 PHE A CA   4  
ATOM 8551  C C    . PHE A 1 100 ? 121.077 12.449  -2.578  1.00 0.00 ? 100 PHE A C    4  
ATOM 8552  O O    . PHE A 1 100 ? 120.390 11.510  -2.995  1.00 0.00 ? 100 PHE A O    4  
ATOM 8553  C CB   . PHE A 1 100 ? 122.335 11.267  -0.751  1.00 0.00 ? 100 PHE A CB   4  
ATOM 8554  C CG   . PHE A 1 100 ? 123.657 10.682  -0.328  1.00 0.00 ? 100 PHE A CG   4  
ATOM 8555  C CD1  . PHE A 1 100 ? 124.197 9.599   -1.007  1.00 0.00 ? 100 PHE A CD1  4  
ATOM 8556  C CD2  . PHE A 1 100 ? 124.365 11.219  0.734   1.00 0.00 ? 100 PHE A CD2  4  
ATOM 8557  C CE1  . PHE A 1 100 ? 125.414 9.067   -0.633  1.00 0.00 ? 100 PHE A CE1  4  
ATOM 8558  C CE2  . PHE A 1 100 ? 125.584 10.691  1.110   1.00 0.00 ? 100 PHE A CE2  4  
ATOM 8559  C CZ   . PHE A 1 100 ? 126.109 9.614   0.426   1.00 0.00 ? 100 PHE A CZ   4  
ATOM 8560  H H    . PHE A 1 100 ? 122.916 13.872  -0.763  1.00 0.00 ? 100 PHE A H    4  
ATOM 8561  H HA   . PHE A 1 100 ? 123.059 11.694  -2.717  1.00 0.00 ? 100 PHE A HA   4  
ATOM 8562  H HB2  . PHE A 1 100 ? 121.931 11.826  0.082   1.00 0.00 ? 100 PHE A HB2  4  
ATOM 8563  H HB3  . PHE A 1 100 ? 121.668 10.449  -0.987  1.00 0.00 ? 100 PHE A HB3  4  
ATOM 8564  H HD1  . PHE A 1 100 ? 123.655 9.169   -1.837  1.00 0.00 ? 100 PHE A HD1  4  
ATOM 8565  H HD2  . PHE A 1 100 ? 123.956 12.062  1.271   1.00 0.00 ? 100 PHE A HD2  4  
ATOM 8566  H HE1  . PHE A 1 100 ? 125.822 8.222   -1.171  1.00 0.00 ? 100 PHE A HE1  4  
ATOM 8567  H HE2  . PHE A 1 100 ? 126.126 11.121  1.939   1.00 0.00 ? 100 PHE A HE2  4  
ATOM 8568  H HZ   . PHE A 1 100 ? 127.063 9.200   0.719   1.00 0.00 ? 100 PHE A HZ   4  
ATOM 8569  N N    . GLN A 1 101 ? 120.675 13.718  -2.644  1.00 0.00 ? 101 GLN A N    4  
ATOM 8570  C CA   . GLN A 1 101 ? 119.413 14.082  -3.280  1.00 0.00 ? 101 GLN A CA   4  
ATOM 8571  C C    . GLN A 1 101 ? 119.580 14.005  -4.794  1.00 0.00 ? 101 GLN A C    4  
ATOM 8572  O O    . GLN A 1 101 ? 119.787 15.009  -5.479  1.00 0.00 ? 101 GLN A O    4  
ATOM 8573  C CB   . GLN A 1 101 ? 118.944 15.468  -2.822  1.00 0.00 ? 101 GLN A CB   4  
ATOM 8574  C CG   . GLN A 1 101 ? 118.673 15.544  -1.321  1.00 0.00 ? 101 GLN A CG   4  
ATOM 8575  C CD   . GLN A 1 101 ? 117.597 14.570  -0.863  1.00 0.00 ? 101 GLN A CD   4  
ATOM 8576  O OE1  . GLN A 1 101 ? 116.415 14.907  -0.811  1.00 0.00 ? 101 GLN A OE1  4  
ATOM 8577  N NE2  . GLN A 1 101 ? 117.996 13.351  -0.533  1.00 0.00 ? 101 GLN A NE2  4  
ATOM 8578  H H    . GLN A 1 101 ? 121.251 14.425  -2.281  1.00 0.00 ? 101 GLN A H    4  
ATOM 8579  H HA   . GLN A 1 101 ? 118.675 13.348  -2.982  1.00 0.00 ? 101 GLN A HA   4  
ATOM 8580  H HB2  . GLN A 1 101 ? 119.705 16.196  -3.069  1.00 0.00 ? 101 GLN A HB2  4  
ATOM 8581  H HB3  . GLN A 1 101 ? 118.032 15.721  -3.345  1.00 0.00 ? 101 GLN A HB3  4  
ATOM 8582  H HG2  . GLN A 1 101 ? 119.588 15.321  -0.791  1.00 0.00 ? 101 GLN A HG2  4  
ATOM 8583  H HG3  . GLN A 1 101 ? 118.356 16.548  -1.077  1.00 0.00 ? 101 GLN A HG3  4  
ATOM 8584  H HE21 . GLN A 1 101 ? 118.950 13.141  -0.598  1.00 0.00 ? 101 GLN A HE21 4  
ATOM 8585  H HE22 . GLN A 1 101 ? 117.314 12.700  -0.250  1.00 0.00 ? 101 GLN A HE22 4  
ATOM 8586  N N    . LYS A 1 102 ? 119.520 12.767  -5.269  1.00 0.00 ? 102 LYS A N    4  
ATOM 8587  C CA   . LYS A 1 102 ? 119.822 12.386  -6.643  1.00 0.00 ? 102 LYS A CA   4  
ATOM 8588  C C    . LYS A 1 102 ? 119.954 10.871  -6.662  1.00 0.00 ? 102 LYS A C    4  
ATOM 8589  O O    . LYS A 1 102 ? 119.409 10.181  -7.526  1.00 0.00 ? 102 LYS A O    4  
ATOM 8590  C CB   . LYS A 1 102 ? 121.135 13.030  -7.123  1.00 0.00 ? 102 LYS A CB   4  
ATOM 8591  C CG   . LYS A 1 102 ? 121.567 12.607  -8.524  1.00 0.00 ? 102 LYS A CG   4  
ATOM 8592  C CD   . LYS A 1 102 ? 122.870 13.290  -8.938  1.00 0.00 ? 102 LYS A CD   4  
ATOM 8593  C CE   . LYS A 1 102 ? 123.372 12.800  -10.292 1.00 0.00 ? 102 LYS A CE   4  
ATOM 8594  N NZ   . LYS A 1 102 ? 122.384 13.032  -11.379 1.00 0.00 ? 102 LYS A NZ   4  
ATOM 8595  H H    . LYS A 1 102 ? 119.238 12.059  -4.652  1.00 0.00 ? 102 LYS A H    4  
ATOM 8596  H HA   . LYS A 1 102 ? 119.001 12.690  -7.277  1.00 0.00 ? 102 LYS A HA   4  
ATOM 8597  H HB2  . LYS A 1 102 ? 121.014 14.103  -7.117  1.00 0.00 ? 102 LYS A HB2  4  
ATOM 8598  H HB3  . LYS A 1 102 ? 121.924 12.767  -6.431  1.00 0.00 ? 102 LYS A HB3  4  
ATOM 8599  H HG2  . LYS A 1 102 ? 121.713 11.536  -8.537  1.00 0.00 ? 102 LYS A HG2  4  
ATOM 8600  H HG3  . LYS A 1 102 ? 120.789 12.875  -9.227  1.00 0.00 ? 102 LYS A HG3  4  
ATOM 8601  H HD2  . LYS A 1 102 ? 122.702 14.357  -8.995  1.00 0.00 ? 102 LYS A HD2  4  
ATOM 8602  H HD3  . LYS A 1 102 ? 123.624 13.086  -8.190  1.00 0.00 ? 102 LYS A HD3  4  
ATOM 8603  H HE2  . LYS A 1 102 ? 124.284 13.324  -10.534 1.00 0.00 ? 102 LYS A HE2  4  
ATOM 8604  H HE3  . LYS A 1 102 ? 123.576 11.742  -10.224 1.00 0.00 ? 102 LYS A HE3  4  
ATOM 8605  H HZ1  . LYS A 1 102 ? 122.132 14.040  -11.426 1.00 0.00 ? 102 LYS A HZ1  4  
ATOM 8606  H HZ2  . LYS A 1 102 ? 121.523 12.476  -11.211 1.00 0.00 ? 102 LYS A HZ2  4  
ATOM 8607  H HZ3  . LYS A 1 102 ? 122.789 12.749  -12.293 1.00 0.00 ? 102 LYS A HZ3  4  
ATOM 8608  N N    . LEU A 1 103 ? 120.671 10.372  -5.658  1.00 0.00 ? 103 LEU A N    4  
ATOM 8609  C CA   . LEU A 1 103 ? 120.853 8.940   -5.450  1.00 0.00 ? 103 LEU A CA   4  
ATOM 8610  C C    . LEU A 1 103 ? 119.568 8.332   -4.900  1.00 0.00 ? 103 LEU A C    4  
ATOM 8611  O O    . LEU A 1 103 ? 119.170 7.236   -5.292  1.00 0.00 ? 103 LEU A O    4  
ATOM 8612  C CB   . LEU A 1 103 ? 122.018 8.680   -4.475  1.00 0.00 ? 103 LEU A CB   4  
ATOM 8613  C CG   . LEU A 1 103 ? 123.434 8.947   -5.020  1.00 0.00 ? 103 LEU A CG   4  
ATOM 8614  C CD1  . LEU A 1 103 ? 123.744 8.019   -6.190  1.00 0.00 ? 103 LEU A CD1  4  
ATOM 8615  C CD2  . LEU A 1 103 ? 123.605 10.411  -5.424  1.00 0.00 ? 103 LEU A CD2  4  
ATOM 8616  H H    . LEU A 1 103 ? 121.093 10.996  -5.030  1.00 0.00 ? 103 LEU A H    4  
ATOM 8617  H HA   . LEU A 1 103 ? 121.079 8.487   -6.406  1.00 0.00 ? 103 LEU A HA   4  
ATOM 8618  H HB2  . LEU A 1 103 ? 121.871 9.303   -3.604  1.00 0.00 ? 103 LEU A HB2  4  
ATOM 8619  H HB3  . LEU A 1 103 ? 121.970 7.646   -4.161  1.00 0.00 ? 103 LEU A HB3  4  
ATOM 8620  H HG   . LEU A 1 103 ? 124.152 8.734   -4.238  1.00 0.00 ? 103 LEU A HG   4  
ATOM 8621  H HD11 . LEU A 1 103 ? 123.675 6.991   -5.863  1.00 0.00 ? 103 LEU A HD11 4  
ATOM 8622  H HD12 . LEU A 1 103 ? 124.744 8.213   -6.550  1.00 0.00 ? 103 LEU A HD12 4  
ATOM 8623  H HD13 . LEU A 1 103 ? 123.035 8.191   -6.987  1.00 0.00 ? 103 LEU A HD13 4  
ATOM 8624  H HD21 . LEU A 1 103 ? 123.485 11.041  -4.554  1.00 0.00 ? 103 LEU A HD21 4  
ATOM 8625  H HD22 . LEU A 1 103 ? 122.860 10.673  -6.161  1.00 0.00 ? 103 LEU A HD22 4  
ATOM 8626  H HD23 . LEU A 1 103 ? 124.590 10.559  -5.842  1.00 0.00 ? 103 LEU A HD23 4  
ATOM 8627  N N    . GLN A 1 104 ? 118.924 9.061   -3.989  1.00 0.00 ? 104 GLN A N    4  
ATOM 8628  C CA   . GLN A 1 104 ? 117.667 8.633   -3.398  1.00 0.00 ? 104 GLN A CA   4  
ATOM 8629  C C    . GLN A 1 104 ? 116.596 8.487   -4.478  1.00 0.00 ? 104 GLN A C    4  
ATOM 8630  O O    . GLN A 1 104 ? 115.839 7.516   -4.493  1.00 0.00 ? 104 GLN A O    4  
ATOM 8631  C CB   . GLN A 1 104 ? 117.232 9.644   -2.331  1.00 0.00 ? 104 GLN A CB   4  
ATOM 8632  C CG   . GLN A 1 104 ? 115.931 9.282   -1.638  1.00 0.00 ? 104 GLN A CG   4  
ATOM 8633  C CD   . GLN A 1 104 ? 115.554 10.251  -0.529  1.00 0.00 ? 104 GLN A CD   4  
ATOM 8634  O OE1  . GLN A 1 104 ? 115.904 11.432  -0.570  1.00 0.00 ? 104 GLN A OE1  4  
ATOM 8635  N NE2  . GLN A 1 104 ? 114.838 9.760   0.470   1.00 0.00 ? 104 GLN A NE2  4  
ATOM 8636  H H    . GLN A 1 104 ? 119.308 9.912   -3.700  1.00 0.00 ? 104 GLN A H    4  
ATOM 8637  H HA   . GLN A 1 104 ? 117.828 7.672   -2.930  1.00 0.00 ? 104 GLN A HA   4  
ATOM 8638  H HB2  . GLN A 1 104 ? 118.007 9.711   -1.581  1.00 0.00 ? 104 GLN A HB2  4  
ATOM 8639  H HB3  . GLN A 1 104 ? 117.112 10.613  -2.796  1.00 0.00 ? 104 GLN A HB3  4  
ATOM 8640  H HG2  . GLN A 1 104 ? 115.142 9.278   -2.373  1.00 0.00 ? 104 GLN A HG2  4  
ATOM 8641  H HG3  . GLN A 1 104 ? 116.034 8.293   -1.217  1.00 0.00 ? 104 GLN A HG3  4  
ATOM 8642  H HE21 . GLN A 1 104 ? 114.594 8.810   0.444   1.00 0.00 ? 104 GLN A HE21 4  
ATOM 8643  H HE22 . GLN A 1 104 ? 114.575 10.369  1.194   1.00 0.00 ? 104 GLN A HE22 4  
ATOM 8644  N N    . ASP A 1 105 ? 116.550 9.456   -5.387  1.00 0.00 ? 105 ASP A N    4  
ATOM 8645  C CA   . ASP A 1 105 ? 115.631 9.407   -6.522  1.00 0.00 ? 105 ASP A CA   4  
ATOM 8646  C C    . ASP A 1 105 ? 115.948 8.205   -7.405  1.00 0.00 ? 105 ASP A C    4  
ATOM 8647  O O    . ASP A 1 105 ? 115.058 7.429   -7.762  1.00 0.00 ? 105 ASP A O    4  
ATOM 8648  C CB   . ASP A 1 105 ? 115.723 10.697  -7.347  1.00 0.00 ? 105 ASP A CB   4  
ATOM 8649  C CG   . ASP A 1 105 ? 114.722 10.730  -8.493  1.00 0.00 ? 105 ASP A CG   4  
ATOM 8650  O OD1  . ASP A 1 105 ? 113.590 11.214  -8.284  1.00 0.00 ? 105 ASP A OD1  4  
ATOM 8651  O OD2  . ASP A 1 105 ? 115.060 10.281  -9.607  1.00 0.00 ? 105 ASP A OD2  4  
ATOM 8652  H H    . ASP A 1 105 ? 117.141 10.233  -5.285  1.00 0.00 ? 105 ASP A H    4  
ATOM 8653  H HA   . ASP A 1 105 ? 114.626 9.305   -6.134  1.00 0.00 ? 105 ASP A HA   4  
ATOM 8654  H HB2  . ASP A 1 105 ? 115.534 11.544  -6.702  1.00 0.00 ? 105 ASP A HB2  4  
ATOM 8655  H HB3  . ASP A 1 105 ? 116.720 10.784  -7.758  1.00 0.00 ? 105 ASP A HB3  4  
ATOM 8656  N N    . GLN A 1 106 ? 117.229 8.052   -7.740  1.00 0.00 ? 106 GLN A N    4  
ATOM 8657  C CA   . GLN A 1 106 ? 117.683 6.948   -8.582  1.00 0.00 ? 106 GLN A CA   4  
ATOM 8658  C C    . GLN A 1 106 ? 117.248 5.608   -7.997  1.00 0.00 ? 106 GLN A C    4  
ATOM 8659  O O    . GLN A 1 106 ? 116.593 4.806   -8.671  1.00 0.00 ? 106 GLN A O    4  
ATOM 8660  C CB   . GLN A 1 106 ? 119.198 6.969   -8.738  1.00 0.00 ? 106 GLN A CB   4  
ATOM 8661  C CG   . GLN A 1 106 ? 119.654 6.112   -9.903  1.00 0.00 ? 106 GLN A CG   4  
ATOM 8662  C CD   . GLN A 1 106 ? 121.148 5.976   -9.995  1.00 0.00 ? 106 GLN A CD   4  
ATOM 8663  O OE1  . GLN A 1 106 ? 121.902 6.857   -9.586  1.00 0.00 ? 106 GLN A OE1  4  
ATOM 8664  N NE2  . GLN A 1 106 ? 121.585 4.874   -10.558 1.00 0.00 ? 106 GLN A NE2  4  
ATOM 8665  H H    . GLN A 1 106 ? 117.887 8.703   -7.415  1.00 0.00 ? 106 GLN A H    4  
ATOM 8666  H HA   . GLN A 1 106 ? 117.246 7.058   -9.562  1.00 0.00 ? 106 GLN A HA   4  
ATOM 8667  H HB2  . GLN A 1 106 ? 119.522 7.987   -8.909  1.00 0.00 ? 106 GLN A HB2  4  
ATOM 8668  H HB3  . GLN A 1 106 ? 119.657 6.596   -7.833  1.00 0.00 ? 106 GLN A HB3  4  
ATOM 8669  H HG2  . GLN A 1 106 ? 119.228 5.124   -9.793  1.00 0.00 ? 106 GLN A HG2  4  
ATOM 8670  H HG3  . GLN A 1 106 ? 119.292 6.555   -10.820 1.00 0.00 ? 106 GLN A HG3  4  
ATOM 8671  H HE21 . GLN A 1 106 ? 120.924 4.223   -10.878 1.00 0.00 ? 106 GLN A HE21 4  
ATOM 8672  H HE22 . GLN A 1 106 ? 122.535 4.753   -10.632 1.00 0.00 ? 106 GLN A HE22 4  
ATOM 8673  N N    . ILE A 1 107 ? 117.594 5.383   -6.731  1.00 0.00 ? 107 ILE A N    4  
ATOM 8674  C CA   . ILE A 1 107 ? 117.300 4.118   -6.072  1.00 0.00 ? 107 ILE A CA   4  
ATOM 8675  C C    . ILE A 1 107 ? 115.794 3.934   -5.916  1.00 0.00 ? 107 ILE A C    4  
ATOM 8676  O O    . ILE A 1 107 ? 115.314 2.815   -5.866  1.00 0.00 ? 107 ILE A O    4  
ATOM 8677  C CB   . ILE A 1 107 ? 117.987 4.000   -4.680  1.00 0.00 ? 107 ILE A CB   4  
ATOM 8678  C CG1  . ILE A 1 107 ? 118.057 2.528   -4.236  1.00 0.00 ? 107 ILE A CG1  4  
ATOM 8679  C CG2  . ILE A 1 107 ? 117.247 4.825   -3.627  1.00 0.00 ? 107 ILE A CG2  4  
ATOM 8680  C CD1  . ILE A 1 107 ? 118.844 1.636   -5.175  1.00 0.00 ? 107 ILE A CD1  4  
ATOM 8681  H H    . ILE A 1 107 ? 118.056 6.086   -6.229  1.00 0.00 ? 107 ILE A H    4  
ATOM 8682  H HA   . ILE A 1 107 ? 117.680 3.326   -6.705  1.00 0.00 ? 107 ILE A HA   4  
ATOM 8683  H HB   . ILE A 1 107 ? 118.992 4.390   -4.765  1.00 0.00 ? 107 ILE A HB   4  
ATOM 8684  H HG12 . ILE A 1 107 ? 118.526 2.474   -3.264  1.00 0.00 ? 107 ILE A HG12 4  
ATOM 8685  H HG13 . ILE A 1 107 ? 117.051 2.129   -4.166  1.00 0.00 ? 107 ILE A HG13 4  
ATOM 8686  H HG21 . ILE A 1 107 ? 116.252 4.420   -3.485  1.00 0.00 ? 107 ILE A HG21 4  
ATOM 8687  H HG22 . ILE A 1 107 ? 117.173 5.851   -3.957  1.00 0.00 ? 107 ILE A HG22 4  
ATOM 8688  H HG23 . ILE A 1 107 ? 117.786 4.786   -2.691  1.00 0.00 ? 107 ILE A HG23 4  
ATOM 8689  H HD11 . ILE A 1 107 ? 118.861 0.630   -4.783  1.00 0.00 ? 107 ILE A HD11 4  
ATOM 8690  H HD12 . ILE A 1 107 ? 119.856 2.005   -5.261  1.00 0.00 ? 107 ILE A HD12 4  
ATOM 8691  H HD13 . ILE A 1 107 ? 118.377 1.634   -6.149  1.00 0.00 ? 107 ILE A HD13 4  
ATOM 8692  N N    . PHE A 1 108 ? 115.057 5.043   -5.850  1.00 0.00 ? 108 PHE A N    4  
ATOM 8693  C CA   . PHE A 1 108 ? 113.601 4.993   -5.730  1.00 0.00 ? 108 PHE A CA   4  
ATOM 8694  C C    . PHE A 1 108 ? 112.985 4.438   -7.014  1.00 0.00 ? 108 PHE A C    4  
ATOM 8695  O O    . PHE A 1 108 ? 112.159 3.521   -6.976  1.00 0.00 ? 108 PHE A O    4  
ATOM 8696  C CB   . PHE A 1 108 ? 113.037 6.389   -5.425  1.00 0.00 ? 108 PHE A CB   4  
ATOM 8697  C CG   . PHE A 1 108 ? 111.542 6.412   -5.202  1.00 0.00 ? 108 PHE A CG   4  
ATOM 8698  C CD1  . PHE A 1 108 ? 111.009 6.132   -3.950  1.00 0.00 ? 108 PHE A CD1  4  
ATOM 8699  C CD2  . PHE A 1 108 ? 110.672 6.712   -6.242  1.00 0.00 ? 108 PHE A CD2  4  
ATOM 8700  C CE1  . PHE A 1 108 ? 109.642 6.152   -3.742  1.00 0.00 ? 108 PHE A CE1  4  
ATOM 8701  C CE2  . PHE A 1 108 ? 109.305 6.732   -6.037  1.00 0.00 ? 108 PHE A CE2  4  
ATOM 8702  C CZ   . PHE A 1 108 ? 108.790 6.452   -4.787  1.00 0.00 ? 108 PHE A CZ   4  
ATOM 8703  H H    . PHE A 1 108 ? 115.504 5.916   -5.876  1.00 0.00 ? 108 PHE A H    4  
ATOM 8704  H HA   . PHE A 1 108 ? 113.359 4.328   -4.911  1.00 0.00 ? 108 PHE A HA   4  
ATOM 8705  H HB2  . PHE A 1 108 ? 113.510 6.772   -4.532  1.00 0.00 ? 108 PHE A HB2  4  
ATOM 8706  H HB3  . PHE A 1 108 ? 113.263 7.049   -6.252  1.00 0.00 ? 108 PHE A HB3  4  
ATOM 8707  H HD1  . PHE A 1 108 ? 111.673 5.896   -3.131  1.00 0.00 ? 108 PHE A HD1  4  
ATOM 8708  H HD2  . PHE A 1 108 ? 111.071 6.932   -7.222  1.00 0.00 ? 108 PHE A HD2  4  
ATOM 8709  H HE1  . PHE A 1 108 ? 109.240 5.932   -2.764  1.00 0.00 ? 108 PHE A HE1  4  
ATOM 8710  H HE2  . PHE A 1 108 ? 108.641 6.966   -6.856  1.00 0.00 ? 108 PHE A HE2  4  
ATOM 8711  H HZ   . PHE A 1 108 ? 107.721 6.468   -4.626  1.00 0.00 ? 108 PHE A HZ   4  
ATOM 8712  N N    . ASN A 1 109 ? 113.401 4.991   -8.152  1.00 0.00 ? 109 ASN A N    4  
ATOM 8713  C CA   . ASN A 1 109 ? 112.908 4.539   -9.453  1.00 0.00 ? 109 ASN A CA   4  
ATOM 8714  C C    . ASN A 1 109 ? 113.311 3.086   -9.698  1.00 0.00 ? 109 ASN A C    4  
ATOM 8715  O O    . ASN A 1 109 ? 112.527 2.289   -10.225 1.00 0.00 ? 109 ASN A O    4  
ATOM 8716  C CB   . ASN A 1 109 ? 113.435 5.432   -10.591 1.00 0.00 ? 109 ASN A CB   4  
ATOM 8717  C CG   . ASN A 1 109 ? 112.831 6.828   -10.578 1.00 0.00 ? 109 ASN A CG   4  
ATOM 8718  O OD1  . ASN A 1 109 ? 111.759 7.060   -11.140 1.00 0.00 ? 109 ASN A OD1  4  
ATOM 8719  N ND2  . ASN A 1 109 ? 113.519 7.772   -9.958  1.00 0.00 ? 109 ASN A ND2  4  
ATOM 8720  H H    . ASN A 1 109 ? 114.058 5.720   -8.114  1.00 0.00 ? 109 ASN A H    4  
ATOM 8721  H HA   . ASN A 1 109 ? 111.827 4.598   -9.433  1.00 0.00 ? 109 ASN A HA   4  
ATOM 8722  H HB2  . ASN A 1 109 ? 114.508 5.525   -10.500 1.00 0.00 ? 109 ASN A HB2  4  
ATOM 8723  H HB3  . ASN A 1 109 ? 113.202 4.970   -11.541 1.00 0.00 ? 109 ASN A HB3  4  
ATOM 8724  H HD21 . ASN A 1 109 ? 114.374 7.530   -9.544  1.00 0.00 ? 109 ASN A HD21 4  
ATOM 8725  H HD22 . ASN A 1 109 ? 113.150 8.681   -9.938  1.00 0.00 ? 109 ASN A HD22 4  
ATOM 8726  N N    . LEU A 1 110 ? 114.537 2.751   -9.304  1.00 0.00 ? 110 LEU A N    4  
ATOM 8727  C CA   . LEU A 1 110 ? 115.049 1.391   -9.416  1.00 0.00 ? 110 LEU A CA   4  
ATOM 8728  C C    . LEU A 1 110 ? 114.293 0.472   -8.455  1.00 0.00 ? 110 LEU A C    4  
ATOM 8729  O O    . LEU A 1 110 ? 113.964 -0.666  -8.793  1.00 0.00 ? 110 LEU A O    4  
ATOM 8730  C CB   . LEU A 1 110 ? 116.563 1.398   -9.116  1.00 0.00 ? 110 LEU A CB   4  
ATOM 8731  C CG   . LEU A 1 110 ? 117.340 0.087   -9.364  1.00 0.00 ? 110 LEU A CG   4  
ATOM 8732  C CD1  . LEU A 1 110 ? 117.124 -0.927  -8.240  1.00 0.00 ? 110 LEU A CD1  4  
ATOM 8733  C CD2  . LEU A 1 110 ? 116.966 -0.519  -10.717 1.00 0.00 ? 110 LEU A CD2  4  
ATOM 8734  H H    . LEU A 1 110 ? 115.123 3.443   -8.929  1.00 0.00 ? 110 LEU A H    4  
ATOM 8735  H HA   . LEU A 1 110 ? 114.888 1.053   -10.431 1.00 0.00 ? 110 LEU A HA   4  
ATOM 8736  H HB2  . LEU A 1 110 ? 117.016 2.169   -9.723  1.00 0.00 ? 110 LEU A HB2  4  
ATOM 8737  H HB3  . LEU A 1 110 ? 116.694 1.673   -8.077  1.00 0.00 ? 110 LEU A HB3  4  
ATOM 8738  H HG   . LEU A 1 110 ? 118.394 0.319   -9.391  1.00 0.00 ? 110 LEU A HG   4  
ATOM 8739  H HD11 . LEU A 1 110 ? 116.080 -1.203  -8.195  1.00 0.00 ? 110 LEU A HD11 4  
ATOM 8740  H HD12 . LEU A 1 110 ? 117.420 -0.490  -7.297  1.00 0.00 ? 110 LEU A HD12 4  
ATOM 8741  H HD13 . LEU A 1 110 ? 117.720 -1.808  -8.428  1.00 0.00 ? 110 LEU A HD13 4  
ATOM 8742  H HD21 . LEU A 1 110 ? 117.180 0.191   -11.502 1.00 0.00 ? 110 LEU A HD21 4  
ATOM 8743  H HD22 . LEU A 1 110 ? 115.912 -0.760  -10.728 1.00 0.00 ? 110 LEU A HD22 4  
ATOM 8744  H HD23 . LEU A 1 110 ? 117.542 -1.418  -10.880 1.00 0.00 ? 110 LEU A HD23 4  
ATOM 8745  N N    . MET A 1 111 ? 114.005 0.992   -7.266  1.00 0.00 ? 111 MET A N    4  
ATOM 8746  C CA   . MET A 1 111 ? 113.333 0.229   -6.218  1.00 0.00 ? 111 MET A CA   4  
ATOM 8747  C C    . MET A 1 111 ? 111.950 -0.193  -6.690  1.00 0.00 ? 111 MET A C    4  
ATOM 8748  O O    . MET A 1 111 ? 111.535 -1.336  -6.495  1.00 0.00 ? 111 MET A O    4  
ATOM 8749  C CB   . MET A 1 111 ? 113.210 1.063   -4.934  1.00 0.00 ? 111 MET A CB   4  
ATOM 8750  C CG   . MET A 1 111 ? 112.960 0.239   -3.683  1.00 0.00 ? 111 MET A CG   4  
ATOM 8751  S SD   . MET A 1 111 ? 112.551 1.255   -2.253  1.00 0.00 ? 111 MET A SD   4  
ATOM 8752  C CE   . MET A 1 111 ? 114.042 2.233   -2.110  1.00 0.00 ? 111 MET A CE   4  
ATOM 8753  H H    . MET A 1 111 ? 114.254 1.922   -7.085  1.00 0.00 ? 111 MET A H    4  
ATOM 8754  H HA   . MET A 1 111 ? 113.923 -0.655  -6.016  1.00 0.00 ? 111 MET A HA   4  
ATOM 8755  H HB2  . MET A 1 111 ? 114.126 1.617   -4.791  1.00 0.00 ? 111 MET A HB2  4  
ATOM 8756  H HB3  . MET A 1 111 ? 112.395 1.764   -5.047  1.00 0.00 ? 111 MET A HB3  4  
ATOM 8757  H HG2  . MET A 1 111 ? 112.146 -0.446  -3.867  1.00 0.00 ? 111 MET A HG2  4  
ATOM 8758  H HG3  . MET A 1 111 ? 113.860 -0.318  -3.459  1.00 0.00 ? 111 MET A HG3  4  
ATOM 8759  H HE1  . MET A 1 111 ? 114.887 1.581   -1.943  1.00 0.00 ? 111 MET A HE1  4  
ATOM 8760  H HE2  . MET A 1 111 ? 113.945 2.916   -1.280  1.00 0.00 ? 111 MET A HE2  4  
ATOM 8761  H HE3  . MET A 1 111 ? 114.196 2.794   -3.021  1.00 0.00 ? 111 MET A HE3  4  
ATOM 8762  N N    . LYS A 1 112 ? 111.240 0.743   -7.315  1.00 0.00 ? 112 LYS A N    4  
ATOM 8763  C CA   . LYS A 1 112 ? 109.933 0.450   -7.885  1.00 0.00 ? 112 LYS A CA   4  
ATOM 8764  C C    . LYS A 1 112 ? 110.057 -0.699  -8.879  1.00 0.00 ? 112 LYS A C    4  
ATOM 8765  O O    . LYS A 1 112 ? 109.465 -1.759  -8.692  1.00 0.00 ? 112 LYS A O    4  
ATOM 8766  C CB   . LYS A 1 112 ? 109.337 1.692   -8.569  1.00 0.00 ? 112 LYS A CB   4  
ATOM 8767  C CG   . LYS A 1 112 ? 107.965 1.440   -9.194  1.00 0.00 ? 112 LYS A CG   4  
ATOM 8768  C CD   . LYS A 1 112 ? 107.386 2.692   -9.852  1.00 0.00 ? 112 LYS A CD   4  
ATOM 8769  C CE   . LYS A 1 112 ? 106.049 2.400   -10.528 1.00 0.00 ? 112 LYS A CE   4  
ATOM 8770  N NZ   . LYS A 1 112 ? 105.460 3.610   -11.161 1.00 0.00 ? 112 LYS A NZ   4  
ATOM 8771  H H    . LYS A 1 112 ? 111.605 1.651   -7.390  1.00 0.00 ? 112 LYS A H    4  
ATOM 8772  H HA   . LYS A 1 112 ? 109.282 0.145   -7.077  1.00 0.00 ? 112 LYS A HA   4  
ATOM 8773  H HB2  . LYS A 1 112 ? 109.238 2.480   -7.835  1.00 0.00 ? 112 LYS A HB2  4  
ATOM 8774  H HB3  . LYS A 1 112 ? 110.011 2.021   -9.348  1.00 0.00 ? 112 LYS A HB3  4  
ATOM 8775  H HG2  . LYS A 1 112 ? 108.060 0.668   -9.944  1.00 0.00 ? 112 LYS A HG2  4  
ATOM 8776  H HG3  . LYS A 1 112 ? 107.287 1.105   -8.420  1.00 0.00 ? 112 LYS A HG3  4  
ATOM 8777  H HD2  . LYS A 1 112 ? 107.238 3.451   -9.096  1.00 0.00 ? 112 LYS A HD2  4  
ATOM 8778  H HD3  . LYS A 1 112 ? 108.084 3.053   -10.595 1.00 0.00 ? 112 LYS A HD3  4  
ATOM 8779  H HE2  . LYS A 1 112 ? 106.200 1.650   -11.290 1.00 0.00 ? 112 LYS A HE2  4  
ATOM 8780  H HE3  . LYS A 1 112 ? 105.359 2.022   -9.787  1.00 0.00 ? 112 LYS A HE3  4  
ATOM 8781  H HZ1  . LYS A 1 112 ? 105.204 4.307   -10.434 1.00 0.00 ? 112 LYS A HZ1  4  
ATOM 8782  H HZ2  . LYS A 1 112 ? 104.607 3.353   -11.695 1.00 0.00 ? 112 LYS A HZ2  4  
ATOM 8783  H HZ3  . LYS A 1 112 ? 106.143 4.040   -11.814 1.00 0.00 ? 112 LYS A HZ3  4  
ATOM 8784  N N    . TYR A 1 113 ? 110.861 -0.494  -9.914  1.00 0.00 ? 113 TYR A N    4  
ATOM 8785  C CA   . TYR A 1 113 ? 111.082 -1.517  -10.929 1.00 0.00 ? 113 TYR A CA   4  
ATOM 8786  C C    . TYR A 1 113 ? 111.466 -2.850  -10.274 1.00 0.00 ? 113 TYR A C    4  
ATOM 8787  O O    . TYR A 1 113 ? 110.648 -3.771  -10.172 1.00 0.00 ? 113 TYR A O    4  
ATOM 8788  C CB   . TYR A 1 113 ? 112.177 -1.054  -11.909 1.00 0.00 ? 113 TYR A CB   4  
ATOM 8789  C CG   . TYR A 1 113 ? 112.601 -2.110  -12.917 1.00 0.00 ? 113 TYR A CG   4  
ATOM 8790  C CD1  . TYR A 1 113 ? 111.833 -2.375  -14.046 1.00 0.00 ? 113 TYR A CD1  4  
ATOM 8791  C CD2  . TYR A 1 113 ? 113.767 -2.850  -12.731 1.00 0.00 ? 113 TYR A CD2  4  
ATOM 8792  C CE1  . TYR A 1 113 ? 112.215 -3.343  -14.956 1.00 0.00 ? 113 TYR A CE1  4  
ATOM 8793  C CE2  . TYR A 1 113 ? 114.150 -3.819  -13.635 1.00 0.00 ? 113 TYR A CE2  4  
ATOM 8794  C CZ   . TYR A 1 113 ? 113.372 -4.062  -14.745 1.00 0.00 ? 113 TYR A CZ   4  
ATOM 8795  O OH   . TYR A 1 113 ? 113.749 -5.037  -15.642 1.00 0.00 ? 113 TYR A OH   4  
ATOM 8796  H H    . TYR A 1 113 ? 111.329 0.365   -9.992  1.00 0.00 ? 113 TYR A H    4  
ATOM 8797  H HA   . TYR A 1 113 ? 110.156 -1.649  -11.471 1.00 0.00 ? 113 TYR A HA   4  
ATOM 8798  H HB2  . TYR A 1 113 ? 111.814 -0.199  -12.462 1.00 0.00 ? 113 TYR A HB2  4  
ATOM 8799  H HB3  . TYR A 1 113 ? 113.052 -0.760  -11.345 1.00 0.00 ? 113 TYR A HB3  4  
ATOM 8800  H HD1  . TYR A 1 113 ? 110.927 -1.810  -14.210 1.00 0.00 ? 113 TYR A HD1  4  
ATOM 8801  H HD2  . TYR A 1 113 ? 114.377 -2.659  -11.859 1.00 0.00 ? 113 TYR A HD2  4  
ATOM 8802  H HE1  . TYR A 1 113 ? 111.604 -3.534  -15.828 1.00 0.00 ? 113 TYR A HE1  4  
ATOM 8803  H HE2  . TYR A 1 113 ? 115.059 -4.381  -13.472 1.00 0.00 ? 113 TYR A HE2  4  
ATOM 8804  H HH   . TYR A 1 113 ? 113.998 -5.836  -15.154 1.00 0.00 ? 113 TYR A HH   4  
ATOM 8805  N N    . ASP A 1 114 ? 112.693 -2.916  -9.783  1.00 0.00 ? 114 ASP A N    4  
ATOM 8806  C CA   . ASP A 1 114 ? 113.256 -4.150  -9.252  1.00 0.00 ? 114 ASP A CA   4  
ATOM 8807  C C    . ASP A 1 114 ? 112.508 -4.634  -8.007  1.00 0.00 ? 114 ASP A C    4  
ATOM 8808  O O    . ASP A 1 114 ? 111.806 -5.648  -8.043  1.00 0.00 ? 114 ASP A O    4  
ATOM 8809  C CB   . ASP A 1 114 ? 114.742 -3.939  -8.924  1.00 0.00 ? 114 ASP A CB   4  
ATOM 8810  C CG   . ASP A 1 114 ? 115.351 -5.115  -8.177  1.00 0.00 ? 114 ASP A CG   4  
ATOM 8811  O OD1  . ASP A 1 114 ? 115.804 -6.079  -8.834  1.00 0.00 ? 114 ASP A OD1  4  
ATOM 8812  O OD2  . ASP A 1 114 ? 115.371 -5.086  -6.930  1.00 0.00 ? 114 ASP A OD2  4  
ATOM 8813  H H    . ASP A 1 114 ? 113.240 -2.102  -9.768  1.00 0.00 ? 114 ASP A H    4  
ATOM 8814  H HA   . ASP A 1 114 ? 113.176 -4.906  -10.021 1.00 0.00 ? 114 ASP A HA   4  
ATOM 8815  H HB2  . ASP A 1 114 ? 115.290 -3.798  -9.845  1.00 0.00 ? 114 ASP A HB2  4  
ATOM 8816  H HB3  . ASP A 1 114 ? 114.846 -3.052  -8.314  1.00 0.00 ? 114 ASP A HB3  4  
ATOM 8817  N N    . SER A 1 115 ? 112.641 -3.886  -6.922  1.00 0.00 ? 115 SER A N    4  
ATOM 8818  C CA   . SER A 1 115 ? 112.208 -4.345  -5.608  1.00 0.00 ? 115 SER A CA   4  
ATOM 8819  C C    . SER A 1 115 ? 110.686 -4.502  -5.508  1.00 0.00 ? 115 SER A C    4  
ATOM 8820  O O    . SER A 1 115 ? 110.208 -5.451  -4.882  1.00 0.00 ? 115 SER A O    4  
ATOM 8821  C CB   . SER A 1 115 ? 112.732 -3.390  -4.535  1.00 0.00 ? 115 SER A CB   4  
ATOM 8822  O OG   . SER A 1 115 ? 114.141 -3.247  -4.640  1.00 0.00 ? 115 SER A OG   4  
ATOM 8823  H H    . SER A 1 115 ? 113.040 -2.994  -7.005  1.00 0.00 ? 115 SER A H    4  
ATOM 8824  H HA   . SER A 1 115 ? 112.657 -5.314  -5.445  1.00 0.00 ? 115 SER A HA   4  
ATOM 8825  H HB2  . SER A 1 115 ? 112.274 -2.419  -4.659  1.00 0.00 ? 115 SER A HB2  4  
ATOM 8826  H HB3  . SER A 1 115 ? 112.494 -3.780  -3.556  1.00 0.00 ? 115 SER A HB3  4  
ATOM 8827  H HG   . SER A 1 115 ? 114.475 -3.839  -5.333  1.00 0.00 ? 115 SER A HG   4  
ATOM 8828  N N    . TYR A 1 116 ? 109.919 -3.604  -6.133  1.00 0.00 ? 116 TYR A N    4  
ATOM 8829  C CA   . TYR A 1 116 ? 108.462 -3.675  -6.035  1.00 0.00 ? 116 TYR A CA   4  
ATOM 8830  C C    . TYR A 1 116 ? 107.947 -4.867  -6.842  1.00 0.00 ? 116 TYR A C    4  
ATOM 8831  O O    . TYR A 1 116 ? 106.950 -5.491  -6.470  1.00 0.00 ? 116 TYR A O    4  
ATOM 8832  C CB   . TYR A 1 116 ? 107.818 -2.358  -6.496  1.00 0.00 ? 116 TYR A CB   4  
ATOM 8833  C CG   . TYR A 1 116 ? 106.308 -2.289  -6.348  1.00 0.00 ? 116 TYR A CG   4  
ATOM 8834  C CD1  . TYR A 1 116 ? 105.713 -2.106  -5.102  1.00 0.00 ? 116 TYR A CD1  4  
ATOM 8835  C CD2  . TYR A 1 116 ? 105.477 -2.391  -7.460  1.00 0.00 ? 116 TYR A CD2  4  
ATOM 8836  C CE1  . TYR A 1 116 ? 104.338 -2.032  -4.972  1.00 0.00 ? 116 TYR A CE1  4  
ATOM 8837  C CE2  . TYR A 1 116 ? 104.104 -2.315  -7.336  1.00 0.00 ? 116 TYR A CE2  4  
ATOM 8838  C CZ   . TYR A 1 116 ? 103.539 -2.136  -6.092  1.00 0.00 ? 116 TYR A CZ   4  
ATOM 8839  O OH   . TYR A 1 116 ? 102.168 -2.065  -5.971  1.00 0.00 ? 116 TYR A OH   4  
ATOM 8840  H H    . TYR A 1 116 ? 110.335 -2.894  -6.680  1.00 0.00 ? 116 TYR A H    4  
ATOM 8841  H HA   . TYR A 1 116 ? 108.215 -3.838  -4.993  1.00 0.00 ? 116 TYR A HA   4  
ATOM 8842  H HB2  . TYR A 1 116 ? 108.238 -1.545  -5.922  1.00 0.00 ? 116 TYR A HB2  4  
ATOM 8843  H HB3  . TYR A 1 116 ? 108.053 -2.204  -7.537  1.00 0.00 ? 116 TYR A HB3  4  
ATOM 8844  H HD1  . TYR A 1 116 ? 106.340 -2.024  -4.226  1.00 0.00 ? 116 TYR A HD1  4  
ATOM 8845  H HD2  . TYR A 1 116 ? 105.920 -2.534  -8.436  1.00 0.00 ? 116 TYR A HD2  4  
ATOM 8846  H HE1  . TYR A 1 116 ? 103.895 -1.891  -3.996  1.00 0.00 ? 116 TYR A HE1  4  
ATOM 8847  H HE2  . TYR A 1 116 ? 103.478 -2.397  -8.214  1.00 0.00 ? 116 TYR A HE2  4  
ATOM 8848  H HH   . TYR A 1 116 ? 101.773 -2.837  -6.391  1.00 0.00 ? 116 TYR A HH   4  
ATOM 8849  N N    . SER A 1 117 ? 108.642 -5.203  -7.936  1.00 0.00 ? 117 SER A N    4  
ATOM 8850  C CA   . SER A 1 117 ? 108.309 -6.407  -8.694  1.00 0.00 ? 117 SER A CA   4  
ATOM 8851  C C    . SER A 1 117 ? 108.660 -7.668  -7.899  1.00 0.00 ? 117 SER A C    4  
ATOM 8852  O O    . SER A 1 117 ? 107.949 -8.672  -7.976  1.00 0.00 ? 117 SER A O    4  
ATOM 8853  C CB   . SER A 1 117 ? 109.022 -6.415  -10.048 1.00 0.00 ? 117 SER A CB   4  
ATOM 8854  O OG   . SER A 1 117 ? 108.539 -5.371  -10.877 1.00 0.00 ? 117 SER A OG   4  
ATOM 8855  H H    . SER A 1 117 ? 109.382 -4.626  -8.245  1.00 0.00 ? 117 SER A H    4  
ATOM 8856  H HA   . SER A 1 117 ? 107.241 -6.399  -8.866  1.00 0.00 ? 117 SER A HA   4  
ATOM 8857  H HB2  . SER A 1 117 ? 110.083 -6.276  -9.897  1.00 0.00 ? 117 SER A HB2  4  
ATOM 8858  H HB3  . SER A 1 117 ? 108.849 -7.360  -10.543 1.00 0.00 ? 117 SER A HB3  4  
ATOM 8859  H HG   . SER A 1 117 ? 108.369 -4.588  -10.338 1.00 0.00 ? 117 SER A HG   4  
ATOM 8860  N N    . ARG A 1 118 ? 109.758 -7.622  -7.139  1.00 0.00 ? 118 ARG A N    4  
ATOM 8861  C CA   . ARG A 1 118 ? 110.136 -8.747  -6.278  1.00 0.00 ? 118 ARG A CA   4  
ATOM 8862  C C    . ARG A 1 118 ? 109.063 -8.969  -5.218  1.00 0.00 ? 118 ARG A C    4  
ATOM 8863  O O    . ARG A 1 118 ? 108.579 -10.087 -5.022  1.00 0.00 ? 118 ARG A O    4  
ATOM 8864  C CB   . ARG A 1 118 ? 111.482 -8.500  -5.573  1.00 0.00 ? 118 ARG A CB   4  
ATOM 8865  C CG   . ARG A 1 118 ? 112.670 -8.301  -6.505  1.00 0.00 ? 118 ARG A CG   4  
ATOM 8866  C CD   . ARG A 1 118 ? 113.987 -8.296  -5.731  1.00 0.00 ? 118 ARG A CD   4  
ATOM 8867  N NE   . ARG A 1 118 ? 115.118 -7.896  -6.567  1.00 0.00 ? 118 ARG A NE   4  
ATOM 8868  C CZ   . ARG A 1 118 ? 116.294 -8.523  -6.614  1.00 0.00 ? 118 ARG A CZ   4  
ATOM 8869  N NH1  . ARG A 1 118 ? 116.491 -9.656  -5.950  1.00 0.00 ? 118 ARG A NH1  4  
ATOM 8870  N NH2  . ARG A 1 118 ? 117.269 -8.017  -7.351  1.00 0.00 ? 118 ARG A NH2  4  
ATOM 8871  H H    . ARG A 1 118 ? 110.324 -6.819  -7.161  1.00 0.00 ? 118 ARG A H    4  
ATOM 8872  H HA   . ARG A 1 118 ? 110.213 -9.632  -6.895  1.00 0.00 ? 118 ARG A HA   4  
ATOM 8873  H HB2  . ARG A 1 118 ? 111.390 -7.616  -4.958  1.00 0.00 ? 118 ARG A HB2  4  
ATOM 8874  H HB3  . ARG A 1 118 ? 111.694 -9.346  -4.932  1.00 0.00 ? 118 ARG A HB3  4  
ATOM 8875  H HG2  . ARG A 1 118 ? 112.690 -9.105  -7.227  1.00 0.00 ? 118 ARG A HG2  4  
ATOM 8876  H HG3  . ARG A 1 118 ? 112.560 -7.357  -7.019  1.00 0.00 ? 118 ARG A HG3  4  
ATOM 8877  H HD2  . ARG A 1 118 ? 113.904 -7.602  -4.906  1.00 0.00 ? 118 ARG A HD2  4  
ATOM 8878  H HD3  . ARG A 1 118 ? 114.166 -9.289  -5.346  1.00 0.00 ? 118 ARG A HD3  4  
ATOM 8879  H HE   . ARG A 1 118 ? 115.006 -7.077  -7.103  1.00 0.00 ? 118 ARG A HE   4  
ATOM 8880  H HH11 . ARG A 1 118 ? 115.751 -10.060 -5.401  1.00 0.00 ? 118 ARG A HH11 4  
ATOM 8881  H HH12 . ARG A 1 118 ? 117.383 -10.112 -5.991  1.00 0.00 ? 118 ARG A HH12 4  
ATOM 8882  H HH21 . ARG A 1 118 ? 117.118 -7.166  -7.866  1.00 0.00 ? 118 ARG A HH21 4  
ATOM 8883  H HH22 . ARG A 1 118 ? 118.160 -8.477  -7.400  1.00 0.00 ? 118 ARG A HH22 4  
ATOM 8884  N N    . PHE A 1 119 ? 108.695 -7.876  -4.557  1.00 0.00 ? 119 PHE A N    4  
ATOM 8885  C CA   . PHE A 1 119 ? 107.740 -7.898  -3.455  1.00 0.00 ? 119 PHE A CA   4  
ATOM 8886  C C    . PHE A 1 119 ? 106.427 -8.557  -3.888  1.00 0.00 ? 119 PHE A C    4  
ATOM 8887  O O    . PHE A 1 119 ? 105.933 -9.476  -3.235  1.00 0.00 ? 119 PHE A O    4  
ATOM 8888  C CB   . PHE A 1 119 ? 107.496 -6.458  -2.971  1.00 0.00 ? 119 PHE A CB   4  
ATOM 8889  C CG   . PHE A 1 119 ? 106.774 -6.348  -1.649  1.00 0.00 ? 119 PHE A CG   4  
ATOM 8890  C CD1  . PHE A 1 119 ? 107.476 -6.428  -0.452  1.00 0.00 ? 119 PHE A CD1  4  
ATOM 8891  C CD2  . PHE A 1 119 ? 105.401 -6.150  -1.601  1.00 0.00 ? 119 PHE A CD2  4  
ATOM 8892  C CE1  . PHE A 1 119 ? 106.822 -6.316  0.761   1.00 0.00 ? 119 PHE A CE1  4  
ATOM 8893  C CE2  . PHE A 1 119 ? 104.745 -6.036  -0.390  1.00 0.00 ? 119 PHE A CE2  4  
ATOM 8894  C CZ   . PHE A 1 119 ? 105.456 -6.120  0.792   1.00 0.00 ? 119 PHE A CZ   4  
ATOM 8895  H H    . PHE A 1 119 ? 109.085 -7.016  -4.821  1.00 0.00 ? 119 PHE A H    4  
ATOM 8896  H HA   . PHE A 1 119 ? 108.175 -8.473  -2.649  1.00 0.00 ? 119 PHE A HA   4  
ATOM 8897  H HB2  . PHE A 1 119 ? 108.449 -5.959  -2.866  1.00 0.00 ? 119 PHE A HB2  4  
ATOM 8898  H HB3  . PHE A 1 119 ? 106.910 -5.934  -3.716  1.00 0.00 ? 119 PHE A HB3  4  
ATOM 8899  H HD1  . PHE A 1 119 ? 108.550 -6.580  -0.473  1.00 0.00 ? 119 PHE A HD1  4  
ATOM 8900  H HD2  . PHE A 1 119 ? 104.841 -6.086  -2.523  1.00 0.00 ? 119 PHE A HD2  4  
ATOM 8901  H HE1  . PHE A 1 119 ? 107.379 -6.381  1.684   1.00 0.00 ? 119 PHE A HE1  4  
ATOM 8902  H HE2  . PHE A 1 119 ? 103.675 -5.882  -0.367  1.00 0.00 ? 119 PHE A HE2  4  
ATOM 8903  H HZ   . PHE A 1 119 ? 104.943 -6.031  1.739   1.00 0.00 ? 119 PHE A HZ   4  
ATOM 8904  N N    . LEU A 1 120 ? 105.881 -8.109  -5.014  1.00 0.00 ? 120 LEU A N    4  
ATOM 8905  C CA   . LEU A 1 120 ? 104.600 -8.624  -5.493  1.00 0.00 ? 120 LEU A CA   4  
ATOM 8906  C C    . LEU A 1 120 ? 104.750 -9.989  -6.164  1.00 0.00 ? 120 LEU A C    4  
ATOM 8907  O O    . LEU A 1 120 ? 103.751 -10.662 -6.431  1.00 0.00 ? 120 LEU A O    4  
ATOM 8908  C CB   . LEU A 1 120 ? 103.942 -7.635  -6.461  1.00 0.00 ? 120 LEU A CB   4  
ATOM 8909  C CG   . LEU A 1 120 ? 103.571 -6.271  -5.858  1.00 0.00 ? 120 LEU A CG   4  
ATOM 8910  C CD1  . LEU A 1 120 ? 102.795 -5.436  -6.869  1.00 0.00 ? 120 LEU A CD1  4  
ATOM 8911  C CD2  . LEU A 1 120 ? 102.769 -6.443  -4.568  1.00 0.00 ? 120 LEU A CD2  4  
ATOM 8912  H H    . LEU A 1 120 ? 106.344 -7.413  -5.529  1.00 0.00 ? 120 LEU A H    4  
ATOM 8913  H HA   . LEU A 1 120 ? 103.955 -8.741  -4.632  1.00 0.00 ? 120 LEU A HA   4  
ATOM 8914  H HB2  . LEU A 1 120 ? 104.620 -7.469  -7.287  1.00 0.00 ? 120 LEU A HB2  4  
ATOM 8915  H HB3  . LEU A 1 120 ? 103.039 -8.090  -6.847  1.00 0.00 ? 120 LEU A HB3  4  
ATOM 8916  H HG   . LEU A 1 120 ? 104.479 -5.736  -5.618  1.00 0.00 ? 120 LEU A HG   4  
ATOM 8917  H HD11 . LEU A 1 120 ? 101.887 -5.953  -7.146  1.00 0.00 ? 120 LEU A HD11 4  
ATOM 8918  H HD12 . LEU A 1 120 ? 103.401 -5.279  -7.749  1.00 0.00 ? 120 LEU A HD12 4  
ATOM 8919  H HD13 . LEU A 1 120 ? 102.544 -4.480  -6.432  1.00 0.00 ? 120 LEU A HD13 4  
ATOM 8920  H HD21 . LEU A 1 120 ? 103.364 -6.977  -3.842  1.00 0.00 ? 120 LEU A HD21 4  
ATOM 8921  H HD22 . LEU A 1 120 ? 101.866 -7.000  -4.773  1.00 0.00 ? 120 LEU A HD22 4  
ATOM 8922  H HD23 . LEU A 1 120 ? 102.510 -5.471  -4.173  1.00 0.00 ? 120 LEU A HD23 4  
ATOM 8923  N N    . LYS A 1 121 ? 105.984 -10.400 -6.442  1.00 0.00 ? 121 LYS A N    4  
ATOM 8924  C CA   . LYS A 1 121 ? 106.226 -11.698 -7.069  1.00 0.00 ? 121 LYS A CA   4  
ATOM 8925  C C    . LYS A 1 121 ? 105.869 -12.821 -6.107  1.00 0.00 ? 121 LYS A C    4  
ATOM 8926  O O    . LYS A 1 121 ? 105.035 -13.675 -6.418  1.00 0.00 ? 121 LYS A O    4  
ATOM 8927  C CB   . LYS A 1 121 ? 107.678 -11.836 -7.529  1.00 0.00 ? 121 LYS A CB   4  
ATOM 8928  C CG   . LYS A 1 121 ? 107.945 -13.115 -8.323  1.00 0.00 ? 121 LYS A CG   4  
ATOM 8929  C CD   . LYS A 1 121 ? 109.427 -13.290 -8.629  1.00 0.00 ? 121 LYS A CD   4  
ATOM 8930  C CE   . LYS A 1 121 ? 110.247 -13.279 -7.351  1.00 0.00 ? 121 LYS A CE   4  
ATOM 8931  N NZ   . LYS A 1 121 ? 111.701 -13.442 -7.610  1.00 0.00 ? 121 LYS A NZ   4  
ATOM 8932  H H    . LYS A 1 121 ? 106.746 -9.823  -6.220  1.00 0.00 ? 121 LYS A H    4  
ATOM 8933  H HA   . LYS A 1 121 ? 105.586 -11.774 -7.926  1.00 0.00 ? 121 LYS A HA   4  
ATOM 8934  H HB2  . LYS A 1 121 ? 107.929 -10.988 -8.153  1.00 0.00 ? 121 LYS A HB2  4  
ATOM 8935  H HB3  . LYS A 1 121 ? 108.320 -11.833 -6.659  1.00 0.00 ? 121 LYS A HB3  4  
ATOM 8936  H HG2  . LYS A 1 121 ? 107.605 -13.964 -7.746  1.00 0.00 ? 121 LYS A HG2  4  
ATOM 8937  H HG3  . LYS A 1 121 ? 107.397 -13.071 -9.254  1.00 0.00 ? 121 LYS A HG3  4  
ATOM 8938  H HD2  . LYS A 1 121 ? 109.574 -14.233 -9.136  1.00 0.00 ? 121 LYS A HD2  4  
ATOM 8939  H HD3  . LYS A 1 121 ? 109.754 -12.480 -9.266  1.00 0.00 ? 121 LYS A HD3  4  
ATOM 8940  H HE2  . LYS A 1 121 ? 110.082 -12.337 -6.847  1.00 0.00 ? 121 LYS A HE2  4  
ATOM 8941  H HE3  . LYS A 1 121 ? 109.908 -14.086 -6.717  1.00 0.00 ? 121 LYS A HE3  4  
ATOM 8942  H HZ1  . LYS A 1 121 ? 111.893 -14.386 -7.999  1.00 0.00 ? 121 LYS A HZ1  4  
ATOM 8943  H HZ2  . LYS A 1 121 ? 112.238 -13.327 -6.725  1.00 0.00 ? 121 LYS A HZ2  4  
ATOM 8944  H HZ3  . LYS A 1 121 ? 112.028 -12.727 -8.293  1.00 0.00 ? 121 LYS A HZ3  4  
ATOM 8945  N N    . SER A 1 122 ? 106.484 -12.810 -4.932  1.00 0.00 ? 122 SER A N    4  
ATOM 8946  C CA   . SER A 1 122 ? 106.198 -13.815 -3.922  1.00 0.00 ? 122 SER A CA   4  
ATOM 8947  C C    . SER A 1 122 ? 106.776 -13.399 -2.570  1.00 0.00 ? 122 SER A C    4  
ATOM 8948  O O    . SER A 1 122 ? 107.740 -13.996 -2.086  1.00 0.00 ? 122 SER A O    4  
ATOM 8949  C CB   . SER A 1 122 ? 106.751 -15.187 -4.349  1.00 0.00 ? 122 SER A CB   4  
ATOM 8950  O OG   . SER A 1 122 ? 106.401 -16.201 -3.418  1.00 0.00 ? 122 SER A OG   4  
ATOM 8951  H H    . SER A 1 122 ? 107.140 -12.104 -4.737  1.00 0.00 ? 122 SER A H    4  
ATOM 8952  H HA   . SER A 1 122 ? 105.123 -13.883 -3.835  1.00 0.00 ? 122 SER A HA   4  
ATOM 8953  H HB2  . SER A 1 122 ? 106.346 -15.451 -5.315  1.00 0.00 ? 122 SER A HB2  4  
ATOM 8954  H HB3  . SER A 1 122 ? 107.829 -15.134 -4.416  1.00 0.00 ? 122 SER A HB3  4  
ATOM 8955  H HG   . SER A 1 122 ? 106.857 -16.034 -2.583  1.00 0.00 ? 122 SER A HG   4  
ATOM 8956  N N    . ASP A 1 123 ? 106.195 -12.356 -1.981  1.00 0.00 ? 123 ASP A N    4  
ATOM 8957  C CA   . ASP A 1 123 ? 106.604 -11.888 -0.655  1.00 0.00 ? 123 ASP A CA   4  
ATOM 8958  C C    . ASP A 1 123 ? 106.168 -12.892 0.421   1.00 0.00 ? 123 ASP A C    4  
ATOM 8959  O O    . ASP A 1 123 ? 105.561 -13.923 0.119   1.00 0.00 ? 123 ASP A O    4  
ATOM 8960  C CB   . ASP A 1 123 ? 106.008 -10.495 -0.377  1.00 0.00 ? 123 ASP A CB   4  
ATOM 8961  C CG   . ASP A 1 123 ? 106.469 -9.904  0.949   1.00 0.00 ? 123 ASP A CG   4  
ATOM 8962  O OD1  . ASP A 1 123 ? 107.612 -9.418  1.018   1.00 0.00 ? 123 ASP A OD1  4  
ATOM 8963  O OD2  . ASP A 1 123 ? 105.699 -9.968  1.934   1.00 0.00 ? 123 ASP A OD2  4  
ATOM 8964  H H    . ASP A 1 123 ? 105.478 -11.881 -2.451  1.00 0.00 ? 123 ASP A H    4  
ATOM 8965  H HA   . ASP A 1 123 ? 107.683 -11.817 -0.647  1.00 0.00 ? 123 ASP A HA   4  
ATOM 8966  H HB2  . ASP A 1 123 ? 106.304 -9.822  -1.170  1.00 0.00 ? 123 ASP A HB2  4  
ATOM 8967  H HB3  . ASP A 1 123 ? 104.929 -10.568 -0.366  1.00 0.00 ? 123 ASP A HB3  4  
ATOM 8968  N N    . LEU A 1 124 ? 106.484 -12.593 1.672   1.00 0.00 ? 124 LEU A N    4  
ATOM 8969  C CA   . LEU A 1 124 ? 106.166 -13.469 2.785   1.00 0.00 ? 124 LEU A CA   4  
ATOM 8970  C C    . LEU A 1 124 ? 104.717 -13.271 3.262   1.00 0.00 ? 124 LEU A C    4  
ATOM 8971  O O    . LEU A 1 124 ? 104.234 -14.018 4.114   1.00 0.00 ? 124 LEU A O    4  
ATOM 8972  C CB   . LEU A 1 124 ? 107.146 -13.198 3.935   1.00 0.00 ? 124 LEU A CB   4  
ATOM 8973  C CG   . LEU A 1 124 ? 108.633 -13.162 3.529   1.00 0.00 ? 124 LEU A CG   4  
ATOM 8974  C CD1  . LEU A 1 124 ? 109.518 -12.828 4.728   1.00 0.00 ? 124 LEU A CD1  4  
ATOM 8975  C CD2  . LEU A 1 124 ? 109.059 -14.485 2.894   1.00 0.00 ? 124 LEU A CD2  4  
ATOM 8976  H H    . LEU A 1 124 ? 106.956 -11.753 1.857   1.00 0.00 ? 124 LEU A H    4  
ATOM 8977  H HA   . LEU A 1 124 ? 106.290 -14.493 2.448   1.00 0.00 ? 124 LEU A HA   4  
ATOM 8978  H HB2  . LEU A 1 124 ? 106.891 -12.245 4.381   1.00 0.00 ? 124 LEU A HB2  4  
ATOM 8979  H HB3  . LEU A 1 124 ? 107.017 -13.970 4.681   1.00 0.00 ? 124 LEU A HB3  4  
ATOM 8980  H HG   . LEU A 1 124 ? 108.774 -12.382 2.794   1.00 0.00 ? 124 LEU A HG   4  
ATOM 8981  H HD11 . LEU A 1 124 ? 109.241 -11.861 5.122   1.00 0.00 ? 124 LEU A HD11 4  
ATOM 8982  H HD12 . LEU A 1 124 ? 110.553 -12.804 4.417   1.00 0.00 ? 124 LEU A HD12 4  
ATOM 8983  H HD13 . LEU A 1 124 ? 109.390 -13.579 5.494   1.00 0.00 ? 124 LEU A HD13 4  
ATOM 8984  H HD21 . LEU A 1 124 ? 108.915 -15.290 3.600   1.00 0.00 ? 124 LEU A HD21 4  
ATOM 8985  H HD22 . LEU A 1 124 ? 110.102 -14.433 2.617   1.00 0.00 ? 124 LEU A HD22 4  
ATOM 8986  H HD23 . LEU A 1 124 ? 108.464 -14.670 2.011   1.00 0.00 ? 124 LEU A HD23 4  
ATOM 8987  N N    . PHE A 1 125 ? 104.020 -12.265 2.720   1.00 0.00 ? 125 PHE A N    4  
ATOM 8988  C CA   . PHE A 1 125 ? 102.628 -12.004 3.115   1.00 0.00 ? 125 PHE A CA   4  
ATOM 8989  C C    . PHE A 1 125 ? 101.653 -12.951 2.408   1.00 0.00 ? 125 PHE A C    4  
ATOM 8990  O O    . PHE A 1 125 ? 100.434 -12.855 2.591   1.00 0.00 ? 125 PHE A O    4  
ATOM 8991  C CB   . PHE A 1 125 ? 102.234 -10.530 2.864   1.00 0.00 ? 125 PHE A CB   4  
ATOM 8992  C CG   . PHE A 1 125 ? 102.053 -10.117 1.410   1.00 0.00 ? 125 PHE A CG   4  
ATOM 8993  C CD1  . PHE A 1 125 ? 100.981 -10.588 0.656   1.00 0.00 ? 125 PHE A CD1  4  
ATOM 8994  C CD2  . PHE A 1 125 ? 102.933 -9.228  0.809   1.00 0.00 ? 125 PHE A CD2  4  
ATOM 8995  C CE1  . PHE A 1 125 ? 100.799 -10.189 -0.652  1.00 0.00 ? 125 PHE A CE1  4  
ATOM 8996  C CE2  . PHE A 1 125 ? 102.748 -8.821  -0.500  1.00 0.00 ? 125 PHE A CE2  4  
ATOM 8997  C CZ   . PHE A 1 125 ? 101.681 -9.304  -1.229  1.00 0.00 ? 125 PHE A CZ   4  
ATOM 8998  H H    . PHE A 1 125 ? 104.456 -11.674 2.064   1.00 0.00 ? 125 PHE A H    4  
ATOM 8999  H HA   . PHE A 1 125 ? 102.560 -12.195 4.179   1.00 0.00 ? 125 PHE A HA   4  
ATOM 9000  H HB2  . PHE A 1 125 ? 101.301 -10.333 3.370   1.00 0.00 ? 125 PHE A HB2  4  
ATOM 9001  H HB3  . PHE A 1 125 ? 102.997 -9.895  3.294   1.00 0.00 ? 125 PHE A HB3  4  
ATOM 9002  H HD1  . PHE A 1 125 ? 100.285 -11.282 1.104   1.00 0.00 ? 125 PHE A HD1  4  
ATOM 9003  H HD2  . PHE A 1 125 ? 103.772 -8.850  1.374   1.00 0.00 ? 125 PHE A HD2  4  
ATOM 9004  H HE1  . PHE A 1 125 ? 99.963  -10.567 -1.222  1.00 0.00 ? 125 PHE A HE1  4  
ATOM 9005  H HE2  . PHE A 1 125 ? 103.442 -8.128  -0.952  1.00 0.00 ? 125 PHE A HE2  4  
ATOM 9006  H HZ   . PHE A 1 125 ? 101.532 -8.982  -2.248  1.00 0.00 ? 125 PHE A HZ   4  
ATOM 9007  N N    . LEU A 1 126 ? 102.191 -13.869 1.615   1.00 0.00 ? 126 LEU A N    4  
ATOM 9008  C CA   . LEU A 1 126 ? 101.381 -14.802 0.850   1.00 0.00 ? 126 LEU A CA   4  
ATOM 9009  C C    . LEU A 1 126 ? 101.067 -16.012 1.709   1.00 0.00 ? 126 LEU A C    4  
ATOM 9010  O O    . LEU A 1 126 ? 101.630 -16.173 2.797   1.00 0.00 ? 126 LEU A O    4  
ATOM 9011  C CB   . LEU A 1 126 ? 102.118 -15.241 -0.430  1.00 0.00 ? 126 LEU A CB   4  
ATOM 9012  C CG   . LEU A 1 126 ? 102.137 -14.221 -1.587  1.00 0.00 ? 126 LEU A CG   4  
ATOM 9013  C CD1  . LEU A 1 126 ? 100.720 -13.824 -1.988  1.00 0.00 ? 126 LEU A CD1  4  
ATOM 9014  C CD2  . LEU A 1 126 ? 102.959 -12.988 -1.226  1.00 0.00 ? 126 LEU A CD2  4  
ATOM 9015  H H    . LEU A 1 126 ? 103.158 -13.955 1.576   1.00 0.00 ? 126 LEU A H    4  
ATOM 9016  H HA   . LEU A 1 126 ? 100.457 -14.310 0.581   1.00 0.00 ? 126 LEU A HA   4  
ATOM 9017  H HB2  . LEU A 1 126 ? 103.144 -15.465 -0.164  1.00 0.00 ? 126 LEU A HB2  4  
ATOM 9018  H HB3  . LEU A 1 126 ? 101.657 -16.150 -0.792  1.00 0.00 ? 126 LEU A HB3  4  
ATOM 9019  H HG   . LEU A 1 126 ? 102.599 -14.683 -2.449  1.00 0.00 ? 126 LEU A HG   4  
ATOM 9020  H HD11 . LEU A 1 126 ? 100.165 -14.706 -2.276  1.00 0.00 ? 126 LEU A HD11 4  
ATOM 9021  H HD12 . LEU A 1 126 ? 100.760 -13.139 -2.823  1.00 0.00 ? 126 LEU A HD12 4  
ATOM 9022  H HD13 . LEU A 1 126 ? 100.226 -13.345 -1.154  1.00 0.00 ? 126 LEU A HD13 4  
ATOM 9023  H HD21 . LEU A 1 126 ? 103.975 -13.283 -1.013  1.00 0.00 ? 126 LEU A HD21 4  
ATOM 9024  H HD22 . LEU A 1 126 ? 102.533 -12.509 -0.356  1.00 0.00 ? 126 LEU A HD22 4  
ATOM 9025  H HD23 . LEU A 1 126 ? 102.953 -12.295 -2.056  1.00 0.00 ? 126 LEU A HD23 4  
ATOM 9026  N N    . LYS A 1 127 ? 100.173 -16.861 1.232   1.00 0.00 ? 127 LYS A N    4  
ATOM 9027  C CA   . LYS A 1 127 ? 99.862  -18.084 1.943   1.00 0.00 ? 127 LYS A CA   4  
ATOM 9028  C C    . LYS A 1 127 ? 100.863 -19.145 1.520   1.00 0.00 ? 127 LYS A C    4  
ATOM 9029  O O    . LYS A 1 127 ? 101.466 -19.824 2.354   1.00 0.00 ? 127 LYS A O    4  
ATOM 9030  C CB   . LYS A 1 127 ? 98.425  -18.536 1.658   1.00 0.00 ? 127 LYS A CB   4  
ATOM 9031  C CG   . LYS A 1 127 ? 97.984  -19.745 2.479   1.00 0.00 ? 127 LYS A CG   4  
ATOM 9032  C CD   . LYS A 1 127 ? 96.534  -20.124 2.190   1.00 0.00 ? 127 LYS A CD   4  
ATOM 9033  C CE   . LYS A 1 127 ? 96.083  -21.324 3.015   1.00 0.00 ? 127 LYS A CE   4  
ATOM 9034  N NZ   . LYS A 1 127 ? 96.929  -22.525 2.770   1.00 0.00 ? 127 LYS A NZ   4  
ATOM 9035  H H    . LYS A 1 127 ? 99.733  -16.674 0.376   1.00 0.00 ? 127 LYS A H    4  
ATOM 9036  H HA   . LYS A 1 127 ? 99.984  -17.883 2.999   1.00 0.00 ? 127 LYS A HA   4  
ATOM 9037  H HB2  . LYS A 1 127 ? 97.754  -17.717 1.873   1.00 0.00 ? 127 LYS A HB2  4  
ATOM 9038  H HB3  . LYS A 1 127 ? 98.343  -18.790 0.609   1.00 0.00 ? 127 LYS A HB3  4  
ATOM 9039  H HG2  . LYS A 1 127 ? 98.620  -20.585 2.236   1.00 0.00 ? 127 LYS A HG2  4  
ATOM 9040  H HG3  . LYS A 1 127 ? 98.083  -19.509 3.530   1.00 0.00 ? 127 LYS A HG3  4  
ATOM 9041  H HD2  . LYS A 1 127 ? 95.898  -19.282 2.425   1.00 0.00 ? 127 LYS A HD2  4  
ATOM 9042  H HD3  . LYS A 1 127 ? 96.438  -20.365 1.140   1.00 0.00 ? 127 LYS A HD3  4  
ATOM 9043  H HE2  . LYS A 1 127 ? 96.138  -21.067 4.063   1.00 0.00 ? 127 LYS A HE2  4  
ATOM 9044  H HE3  . LYS A 1 127 ? 95.059  -21.558 2.759   1.00 0.00 ? 127 LYS A HE3  4  
ATOM 9045  H HZ1  . LYS A 1 127 ? 97.016  -22.701 1.749   1.00 0.00 ? 127 LYS A HZ1  4  
ATOM 9046  H HZ2  . LYS A 1 127 ? 96.499  -23.361 3.214   1.00 0.00 ? 127 LYS A HZ2  4  
ATOM 9047  H HZ3  . LYS A 1 127 ? 97.878  -22.386 3.169   1.00 0.00 ? 127 LYS A HZ3  4  
ATOM 9048  N N    . HIS A 1 128 ? 101.037 -19.274 0.209   1.00 0.00 ? 128 HIS A N    4  
ATOM 9049  C CA   . HIS A 1 128 ? 102.155 -20.020 -0.338  1.00 0.00 ? 128 HIS A CA   4  
ATOM 9050  C C    . HIS A 1 128 ? 103.324 -19.061 -0.495  1.00 0.00 ? 128 HIS A C    4  
ATOM 9051  O O    . HIS A 1 128 ? 103.488 -18.424 -1.537  1.00 0.00 ? 128 HIS A O    4  
ATOM 9052  C CB   . HIS A 1 128 ? 101.814 -20.670 -1.685  1.00 0.00 ? 128 HIS A CB   4  
ATOM 9053  C CG   . HIS A 1 128 ? 103.005 -21.304 -2.345  1.00 0.00 ? 128 HIS A CG   4  
ATOM 9054  N ND1  . HIS A 1 128 ? 103.782 -20.650 -3.276  1.00 0.00 ? 128 HIS A ND1  4  
ATOM 9055  C CD2  . HIS A 1 128 ? 103.570 -22.525 -2.182  1.00 0.00 ? 128 HIS A CD2  4  
ATOM 9056  C CE1  . HIS A 1 128 ? 104.770 -21.436 -3.654  1.00 0.00 ? 128 HIS A CE1  4  
ATOM 9057  N NE2  . HIS A 1 128 ? 104.669 -22.581 -3.005  1.00 0.00 ? 128 HIS A NE2  4  
ATOM 9058  H H    . HIS A 1 128 ? 100.404 -18.843 -0.405  1.00 0.00 ? 128 HIS A H    4  
ATOM 9059  H HA   . HIS A 1 128 ? 102.423 -20.789 0.374   1.00 0.00 ? 128 HIS A HA   4  
ATOM 9060  H HB2  . HIS A 1 128 ? 101.068 -21.437 -1.532  1.00 0.00 ? 128 HIS A HB2  4  
ATOM 9061  H HB3  . HIS A 1 128 ? 101.420 -19.918 -2.354  1.00 0.00 ? 128 HIS A HB3  4  
ATOM 9062  H HD1  . HIS A 1 128 ? 103.633 -19.735 -3.608  1.00 0.00 ? 128 HIS A HD1  4  
ATOM 9063  H HD2  . HIS A 1 128 ? 103.221 -23.309 -1.524  1.00 0.00 ? 128 HIS A HD2  4  
ATOM 9064  H HE1  . HIS A 1 128 ? 105.536 -21.184 -4.373  1.00 0.00 ? 128 HIS A HE1  4  
ATOM 9065  H HE2  . HIS A 1 128 ? 105.401 -23.235 -2.919  1.00 0.00 ? 128 HIS A HE2  4  
ATOM 9066  N N    . LYS A 1 129 ? 104.101 -18.927 0.563   1.00 0.00 ? 129 LYS A N    4  
ATOM 9067  C CA   . LYS A 1 129 ? 105.177 -17.950 0.613   1.00 0.00 ? 129 LYS A CA   4  
ATOM 9068  C C    . LYS A 1 129 ? 106.528 -18.642 0.606   1.00 0.00 ? 129 LYS A C    4  
ATOM 9069  O O    . LYS A 1 129 ? 106.610 -19.872 0.549   1.00 0.00 ? 129 LYS A O    4  
ATOM 9070  C CB   . LYS A 1 129 ? 105.025 -17.082 1.870   1.00 0.00 ? 129 LYS A CB   4  
ATOM 9071  C CG   . LYS A 1 129 ? 104.936 -17.890 3.164   1.00 0.00 ? 129 LYS A CG   4  
ATOM 9072  C CD   . LYS A 1 129 ? 104.625 -17.006 4.367   1.00 0.00 ? 129 LYS A CD   4  
ATOM 9073  C CE   . LYS A 1 129 ? 104.376 -17.824 5.628   1.00 0.00 ? 129 LYS A CE   4  
ATOM 9074  N NZ   . LYS A 1 129 ? 103.961 -16.965 6.769   1.00 0.00 ? 129 LYS A NZ   4  
ATOM 9075  H H    . LYS A 1 129 ? 103.957 -19.515 1.337   1.00 0.00 ? 129 LYS A H    4  
ATOM 9076  H HA   . LYS A 1 129 ? 105.104 -17.318 -0.262  1.00 0.00 ? 129 LYS A HA   4  
ATOM 9077  H HB2  . LYS A 1 129 ? 105.874 -16.415 1.940   1.00 0.00 ? 129 LYS A HB2  4  
ATOM 9078  H HB3  . LYS A 1 129 ? 104.124 -16.490 1.777   1.00 0.00 ? 129 LYS A HB3  4  
ATOM 9079  H HG2  . LYS A 1 129 ? 104.153 -18.627 3.061   1.00 0.00 ? 129 LYS A HG2  4  
ATOM 9080  H HG3  . LYS A 1 129 ? 105.881 -18.390 3.329   1.00 0.00 ? 129 LYS A HG3  4  
ATOM 9081  H HD2  . LYS A 1 129 ? 105.461 -16.344 4.541   1.00 0.00 ? 129 LYS A HD2  4  
ATOM 9082  H HD3  . LYS A 1 129 ? 103.742 -16.420 4.151   1.00 0.00 ? 129 LYS A HD3  4  
ATOM 9083  H HE2  . LYS A 1 129 ? 103.595 -18.544 5.430   1.00 0.00 ? 129 LYS A HE2  4  
ATOM 9084  H HE3  . LYS A 1 129 ? 105.286 -18.344 5.893   1.00 0.00 ? 129 LYS A HE3  4  
ATOM 9085  H HZ1  . LYS A 1 129 ? 103.824 -17.544 7.621   1.00 0.00 ? 129 LYS A HZ1  4  
ATOM 9086  H HZ2  . LYS A 1 129 ? 103.069 -16.478 6.547   1.00 0.00 ? 129 LYS A HZ2  4  
ATOM 9087  H HZ3  . LYS A 1 129 ? 104.693 -16.251 6.965   1.00 0.00 ? 129 LYS A HZ3  4  
ATOM 9088  N N    . ARG A 1 130 ? 107.582 -17.843 0.647   1.00 0.00 ? 130 ARG A N    4  
ATOM 9089  C CA   . ARG A 1 130 ? 108.936 -18.362 0.724   1.00 0.00 ? 130 ARG A CA   4  
ATOM 9090  C C    . ARG A 1 130 ? 109.342 -18.467 2.191   1.00 0.00 ? 130 ARG A C    4  
ATOM 9091  O O    . ARG A 1 130 ? 108.834 -17.714 3.025   1.00 0.00 ? 130 ARG A O    4  
ATOM 9092  C CB   . ARG A 1 130 ? 109.894 -17.443 -0.050  1.00 0.00 ? 130 ARG A CB   4  
ATOM 9093  C CG   . ARG A 1 130 ? 111.259 -18.072 -0.318  1.00 0.00 ? 130 ARG A CG   4  
ATOM 9094  C CD   . ARG A 1 130 ? 112.097 -17.244 -1.289  1.00 0.00 ? 130 ARG A CD   4  
ATOM 9095  N NE   . ARG A 1 130 ? 112.564 -15.988 -0.696  1.00 0.00 ? 130 ARG A NE   4  
ATOM 9096  C CZ   . ARG A 1 130 ? 113.049 -14.964 -1.402  1.00 0.00 ? 130 ARG A CZ   4  
ATOM 9097  N NH1  . ARG A 1 130 ? 113.082 -15.018 -2.727  1.00 0.00 ? 130 ARG A NH1  4  
ATOM 9098  N NH2  . ARG A 1 130 ? 113.500 -13.880 -0.784  1.00 0.00 ? 130 ARG A NH2  4  
ATOM 9099  H H    . ARG A 1 130 ? 107.446 -16.874 0.637   1.00 0.00 ? 130 ARG A H    4  
ATOM 9100  H HA   . ARG A 1 130 ? 108.949 -19.349 0.280   1.00 0.00 ? 130 ARG A HA   4  
ATOM 9101  H HB2  . ARG A 1 130 ? 109.441 -17.193 -1.000  1.00 0.00 ? 130 ARG A HB2  4  
ATOM 9102  H HB3  . ARG A 1 130 ? 110.040 -16.533 0.518   1.00 0.00 ? 130 ARG A HB3  4  
ATOM 9103  H HG2  . ARG A 1 130 ? 111.795 -18.158 0.617   1.00 0.00 ? 130 ARG A HG2  4  
ATOM 9104  H HG3  . ARG A 1 130 ? 111.112 -19.058 -0.738  1.00 0.00 ? 130 ARG A HG3  4  
ATOM 9105  H HD2  . ARG A 1 130 ? 112.956 -17.827 -1.588  1.00 0.00 ? 130 ARG A HD2  4  
ATOM 9106  H HD3  . ARG A 1 130 ? 111.497 -17.019 -2.161  1.00 0.00 ? 130 ARG A HD3  4  
ATOM 9107  H HE   . ARG A 1 130 ? 112.542 -15.923 0.286   1.00 0.00 ? 130 ARG A HE   4  
ATOM 9108  H HH11 . ARG A 1 130 ? 112.743 -15.825 -3.210  1.00 0.00 ? 130 ARG A HH11 4  
ATOM 9109  H HH12 . ARG A 1 130 ? 113.458 -14.245 -3.254  1.00 0.00 ? 130 ARG A HH12 4  
ATOM 9110  H HH21 . ARG A 1 130 ? 113.478 -13.820 0.214   1.00 0.00 ? 130 ARG A HH21 4  
ATOM 9111  H HH22 . ARG A 1 130 ? 113.878 -13.118 -1.323  1.00 0.00 ? 130 ARG A HH22 4  
ATOM 9112  N N    . THR A 1 131 ? 110.228 -19.406 2.504   1.00 0.00 ? 131 THR A N    4  
ATOM 9113  C CA   . THR A 1 131 ? 110.663 -19.627 3.878   1.00 0.00 ? 131 THR A CA   4  
ATOM 9114  C C    . THR A 1 131 ? 111.162 -18.325 4.511   1.00 0.00 ? 131 THR A C    4  
ATOM 9115  O O    . THR A 1 131 ? 112.221 -17.811 4.147   1.00 0.00 ? 131 THR A O    4  
ATOM 9116  C CB   . THR A 1 131 ? 111.774 -20.699 3.934   1.00 0.00 ? 131 THR A CB   4  
ATOM 9117  O OG1  . THR A 1 131 ? 111.352 -21.863 3.209   1.00 0.00 ? 131 THR A OG1  4  
ATOM 9118  C CG2  . THR A 1 131 ? 112.097 -21.090 5.375   1.00 0.00 ? 131 THR A CG2  4  
ATOM 9119  H H    . THR A 1 131 ? 110.600 -19.970 1.795   1.00 0.00 ? 131 THR A H    4  
ATOM 9120  H HA   . THR A 1 131 ? 109.812 -19.990 4.441   1.00 0.00 ? 131 THR A HA   4  
ATOM 9121  H HB   . THR A 1 131 ? 112.667 -20.300 3.472   1.00 0.00 ? 131 THR A HB   4  
ATOM 9122  H HG1  . THR A 1 131 ? 110.833 -22.429 3.792   1.00 0.00 ? 131 THR A HG1  4  
ATOM 9123  H HG21 . THR A 1 131 ? 112.432 -20.219 5.921   1.00 0.00 ? 131 THR A HG21 4  
ATOM 9124  H HG22 . THR A 1 131 ? 112.878 -21.838 5.380   1.00 0.00 ? 131 THR A HG22 4  
ATOM 9125  H HG23 . THR A 1 131 ? 111.213 -21.493 5.849   1.00 0.00 ? 131 THR A HG23 4  
ATOM 9126  N N    . GLU A 1 132 ? 110.369 -17.782 5.436   1.00 0.00 ? 132 GLU A N    4  
ATOM 9127  C CA   . GLU A 1 132 ? 110.722 -16.547 6.129   1.00 0.00 ? 132 GLU A CA   4  
ATOM 9128  C C    . GLU A 1 132 ? 111.979 -16.752 6.965   1.00 0.00 ? 132 GLU A C    4  
ATOM 9129  O O    . GLU A 1 132 ? 112.761 -15.822 7.177   1.00 0.00 ? 132 GLU A O    4  
ATOM 9130  C CB   . GLU A 1 132 ? 109.571 -16.089 7.028   1.00 0.00 ? 132 GLU A CB   4  
ATOM 9131  C CG   . GLU A 1 132 ? 108.249 -15.903 6.298   1.00 0.00 ? 132 GLU A CG   4  
ATOM 9132  C CD   . GLU A 1 132 ? 107.156 -15.384 7.213   1.00 0.00 ? 132 GLU A CD   4  
ATOM 9133  O OE1  . GLU A 1 132 ? 107.109 -14.160 7.459   1.00 0.00 ? 132 GLU A OE1  4  
ATOM 9134  O OE2  . GLU A 1 132 ? 106.341 -16.193 7.695   1.00 0.00 ? 132 GLU A OE2  4  
ATOM 9135  H H    . GLU A 1 132 ? 109.521 -18.224 5.652   1.00 0.00 ? 132 GLU A H    4  
ATOM 9136  H HA   . GLU A 1 132 ? 110.915 -15.787 5.384   1.00 0.00 ? 132 GLU A HA   4  
ATOM 9137  H HB2  . GLU A 1 132 ? 109.425 -16.823 7.808   1.00 0.00 ? 132 GLU A HB2  4  
ATOM 9138  H HB3  . GLU A 1 132 ? 109.840 -15.146 7.483   1.00 0.00 ? 132 GLU A HB3  4  
ATOM 9139  H HG2  . GLU A 1 132 ? 108.392 -15.198 5.491   1.00 0.00 ? 132 GLU A HG2  4  
ATOM 9140  H HG3  . GLU A 1 132 ? 107.939 -16.855 5.888   1.00 0.00 ? 132 GLU A HG3  4  
ATOM 9141  N N    . GLU A 1 133 ? 112.147 -17.973 7.454   1.00 0.00 ? 133 GLU A N    4  
ATOM 9142  C CA   . GLU A 1 133 ? 113.346 -18.358 8.181   1.00 0.00 ? 133 GLU A CA   4  
ATOM 9143  C C    . GLU A 1 133 ? 114.415 -18.813 7.188   1.00 0.00 ? 133 GLU A C    4  
ATOM 9144  O O    . GLU A 1 133 ? 114.200 -18.772 5.974   1.00 0.00 ? 133 GLU A O    4  
ATOM 9145  C CB   . GLU A 1 133 ? 113.042 -19.492 9.178   1.00 0.00 ? 133 GLU A CB   4  
ATOM 9146  C CG   . GLU A 1 133 ? 111.818 -19.253 10.064  1.00 0.00 ? 133 GLU A CG   4  
ATOM 9147  C CD   . GLU A 1 133 ? 110.507 -19.647 9.393   1.00 0.00 ? 133 GLU A CD   4  
ATOM 9148  O OE1  . GLU A 1 133 ? 110.127 -20.830 9.475   1.00 0.00 ? 133 GLU A OE1  4  
ATOM 9149  O OE2  . GLU A 1 133 ? 109.843 -18.780 8.790   1.00 0.00 ? 133 GLU A OE2  4  
ATOM 9150  H H    . GLU A 1 133 ? 111.439 -18.635 7.323   1.00 0.00 ? 133 GLU A H    4  
ATOM 9151  H HA   . GLU A 1 133 ? 113.710 -17.494 8.722   1.00 0.00 ? 133 GLU A HA   4  
ATOM 9152  H HB2  . GLU A 1 133 ? 112.883 -20.407 8.624   1.00 0.00 ? 133 GLU A HB2  4  
ATOM 9153  H HB3  . GLU A 1 133 ? 113.902 -19.624 9.821   1.00 0.00 ? 133 GLU A HB3  4  
ATOM 9154  H HG2  . GLU A 1 133 ? 111.928 -19.832 10.970  1.00 0.00 ? 133 GLU A HG2  4  
ATOM 9155  H HG3  . GLU A 1 133 ? 111.775 -18.202 10.319  1.00 0.00 ? 133 GLU A HG3  4  
ATOM 9156  N N    . GLU A 1 134 ? 115.562 -19.242 7.694   1.00 0.00 ? 134 GLU A N    4  
ATOM 9157  C CA   . GLU A 1 134 ? 116.597 -19.807 6.841   1.00 0.00 ? 134 GLU A CA   4  
ATOM 9158  C C    . GLU A 1 134 ? 116.200 -21.223 6.428   1.00 0.00 ? 134 GLU A C    4  
ATOM 9159  O O    . GLU A 1 134 ? 115.683 -21.988 7.247   1.00 0.00 ? 134 GLU A O    4  
ATOM 9160  C CB   . GLU A 1 134 ? 117.959 -19.817 7.556   1.00 0.00 ? 134 GLU A CB   4  
ATOM 9161  C CG   . GLU A 1 134 ? 117.981 -20.614 8.858   1.00 0.00 ? 134 GLU A CG   4  
ATOM 9162  C CD   . GLU A 1 134 ? 119.383 -20.749 9.432   1.00 0.00 ? 134 GLU A CD   4  
ATOM 9163  O OE1  . GLU A 1 134 ? 120.113 -21.671 9.008   1.00 0.00 ? 134 GLU A OE1  4  
ATOM 9164  O OE2  . GLU A 1 134 ? 119.770 -19.931 10.293  1.00 0.00 ? 134 GLU A OE2  4  
ATOM 9165  H H    . GLU A 1 134 ? 115.716 -19.178 8.660   1.00 0.00 ? 134 GLU A H    4  
ATOM 9166  H HA   . GLU A 1 134 ? 116.669 -19.191 5.953   1.00 0.00 ? 134 GLU A HA   4  
ATOM 9167  H HB2  . GLU A 1 134 ? 118.696 -20.241 6.889   1.00 0.00 ? 134 GLU A HB2  4  
ATOM 9168  H HB3  . GLU A 1 134 ? 118.240 -18.797 7.779   1.00 0.00 ? 134 GLU A HB3  4  
ATOM 9169  H HG2  . GLU A 1 134 ? 117.354 -20.113 9.584   1.00 0.00 ? 134 GLU A HG2  4  
ATOM 9170  H HG3  . GLU A 1 134 ? 117.586 -21.603 8.669   1.00 0.00 ? 134 GLU A HG3  4  
ATOM 9171  N N    . GLU A 1 135 ? 116.410 -21.560 5.159   1.00 0.00 ? 135 GLU A N    4  
ATOM 9172  C CA   . GLU A 1 135 ? 116.106 -22.899 4.665   1.00 0.00 ? 135 GLU A CA   4  
ATOM 9173  C C    . GLU A 1 135 ? 116.941 -23.933 5.425   1.00 0.00 ? 135 GLU A C    4  
ATOM 9174  O O    . GLU A 1 135 ? 118.146 -24.075 5.198   1.00 0.00 ? 135 GLU A O    4  
ATOM 9175  C CB   . GLU A 1 135 ? 116.343 -22.985 3.147   1.00 0.00 ? 135 GLU A CB   4  
ATOM 9176  C CG   . GLU A 1 135 ? 117.732 -22.539 2.702   1.00 0.00 ? 135 GLU A CG   4  
ATOM 9177  C CD   . GLU A 1 135 ? 117.909 -22.596 1.195   1.00 0.00 ? 135 GLU A CD   4  
ATOM 9178  O OE1  . GLU A 1 135 ? 118.179 -23.694 0.665   1.00 0.00 ? 135 GLU A OE1  4  
ATOM 9179  O OE2  . GLU A 1 135 ? 117.780 -21.542 0.533   1.00 0.00 ? 135 GLU A OE2  4  
ATOM 9180  H H    . GLU A 1 135 ? 116.777 -20.894 4.541   1.00 0.00 ? 135 GLU A H    4  
ATOM 9181  H HA   . GLU A 1 135 ? 115.058 -23.089 4.865   1.00 0.00 ? 135 GLU A HA   4  
ATOM 9182  H HB2  . GLU A 1 135 ? 116.200 -24.009 2.830   1.00 0.00 ? 135 GLU A HB2  4  
ATOM 9183  H HB3  . GLU A 1 135 ? 115.613 -22.363 2.647   1.00 0.00 ? 135 GLU A HB3  4  
ATOM 9184  H HG2  . GLU A 1 135 ? 117.895 -21.523 3.034   1.00 0.00 ? 135 GLU A HG2  4  
ATOM 9185  H HG3  . GLU A 1 135 ? 118.469 -23.185 3.163   1.00 0.00 ? 135 GLU A HG3  4  
ATOM 9186  N N    . GLU A 1 136 ? 116.297 -24.625 6.354   1.00 0.00 ? 136 GLU A N    4  
ATOM 9187  C CA   . GLU A 1 136 ? 116.984 -25.538 7.258   1.00 0.00 ? 136 GLU A CA   4  
ATOM 9188  C C    . GLU A 1 136 ? 117.016 -26.949 6.676   1.00 0.00 ? 136 GLU A C    4  
ATOM 9189  O O    . GLU A 1 136 ? 116.050 -27.399 6.054   1.00 0.00 ? 136 GLU A O    4  
ATOM 9190  C CB   . GLU A 1 136 ? 116.288 -25.531 8.626   1.00 0.00 ? 136 GLU A CB   4  
ATOM 9191  C CG   . GLU A 1 136 ? 117.011 -26.338 9.699   1.00 0.00 ? 136 GLU A CG   4  
ATOM 9192  C CD   . GLU A 1 136 ? 116.303 -26.287 11.043  1.00 0.00 ? 136 GLU A CD   4  
ATOM 9193  O OE1  . GLU A 1 136 ? 115.395 -27.112 11.274  1.00 0.00 ? 136 GLU A OE1  4  
ATOM 9194  O OE2  . GLU A 1 136 ? 116.646 -25.419 11.875  1.00 0.00 ? 136 GLU A OE2  4  
ATOM 9195  H H    . GLU A 1 136 ? 115.323 -24.528 6.428   1.00 0.00 ? 136 GLU A H    4  
ATOM 9196  H HA   . GLU A 1 136 ? 118.000 -25.186 7.380   1.00 0.00 ? 136 GLU A HA   4  
ATOM 9197  H HB2  . GLU A 1 136 ? 116.209 -24.509 8.969   1.00 0.00 ? 136 GLU A HB2  4  
ATOM 9198  H HB3  . GLU A 1 136 ? 115.292 -25.937 8.512   1.00 0.00 ? 136 GLU A HB3  4  
ATOM 9199  H HG2  . GLU A 1 136 ? 117.072 -27.368 9.377   1.00 0.00 ? 136 GLU A HG2  4  
ATOM 9200  H HG3  . GLU A 1 136 ? 118.011 -25.942 9.817   1.00 0.00 ? 136 GLU A HG3  4  
ATOM 9201  N N    . ASP A 1 137 ? 118.135 -27.634 6.869   1.00 0.00 ? 137 ASP A N    4  
ATOM 9202  C CA   . ASP A 1 137 ? 118.308 -29.000 6.380   1.00 0.00 ? 137 ASP A CA   4  
ATOM 9203  C C    . ASP A 1 137 ? 118.876 -29.887 7.483   1.00 0.00 ? 137 ASP A C    4  
ATOM 9204  O O    . ASP A 1 137 ? 118.501 -31.057 7.615   1.00 0.00 ? 137 ASP A O    4  
ATOM 9205  C CB   . ASP A 1 137 ? 119.235 -29.019 5.158   1.00 0.00 ? 137 ASP A CB   4  
ATOM 9206  C CG   . ASP A 1 137 ? 119.460 -30.423 4.615   1.00 0.00 ? 137 ASP A CG   4  
ATOM 9207  O OD1  . ASP A 1 137 ? 118.603 -30.917 3.853   1.00 0.00 ? 137 ASP A OD1  4  
ATOM 9208  O OD2  . ASP A 1 137 ? 120.491 -31.043 4.953   1.00 0.00 ? 137 ASP A OD2  4  
ATOM 9209  H H    . ASP A 1 137 ? 118.872 -27.208 7.357   1.00 0.00 ? 137 ASP A H    4  
ATOM 9210  H HA   . ASP A 1 137 ? 117.337 -29.382 6.093   1.00 0.00 ? 137 ASP A HA   4  
ATOM 9211  H HB2  . ASP A 1 137 ? 118.799 -28.416 4.373   1.00 0.00 ? 137 ASP A HB2  4  
ATOM 9212  H HB3  . ASP A 1 137 ? 120.193 -28.599 5.433   1.00 0.00 ? 137 ASP A HB3  4  
ATOM 9213  N N    . LEU A 1 138 ? 119.778 -29.320 8.277   1.00 0.00 ? 138 LEU A N    4  
ATOM 9214  C CA   . LEU A 1 138 ? 120.412 -30.040 9.374   1.00 0.00 ? 138 LEU A CA   4  
ATOM 9215  C C    . LEU A 1 138 ? 119.463 -30.111 10.573  1.00 0.00 ? 138 LEU A C    4  
ATOM 9216  O O    . LEU A 1 138 ? 119.111 -29.045 11.120  1.00 0.00 ? 138 LEU A O    4  
ATOM 9217  C CB   . LEU A 1 138 ? 121.731 -29.356 9.772   1.00 0.00 ? 138 LEU A CB   4  
ATOM 9218  C CG   . LEU A 1 138 ? 122.744 -29.150 8.631   1.00 0.00 ? 138 LEU A CG   4  
ATOM 9219  C CD1  . LEU A 1 138 ? 124.004 -28.460 9.149   1.00 0.00 ? 138 LEU A CD1  4  
ATOM 9220  C CD2  . LEU A 1 138 ? 123.088 -30.479 7.960   1.00 0.00 ? 138 LEU A CD2  4  
ATOM 9221  O OXT  . LEU A 1 138 ? 119.066 -31.230 10.962  1.00 0.00 ? 138 LEU A OXT  4  
ATOM 9222  H H    . LEU A 1 138 ? 120.018 -28.382 8.128   1.00 0.00 ? 138 LEU A H    4  
ATOM 9223  H HA   . LEU A 1 138 ? 120.627 -31.045 9.034   1.00 0.00 ? 138 LEU A HA   4  
ATOM 9224  H HB2  . LEU A 1 138 ? 121.496 -28.388 10.192  1.00 0.00 ? 138 LEU A HB2  4  
ATOM 9225  H HB3  . LEU A 1 138 ? 122.205 -29.953 10.539  1.00 0.00 ? 138 LEU A HB3  4  
ATOM 9226  H HG   . LEU A 1 138 ? 122.301 -28.506 7.883   1.00 0.00 ? 138 LEU A HG   4  
ATOM 9227  H HD11 . LEU A 1 138 ? 123.742 -27.497 9.563   1.00 0.00 ? 138 LEU A HD11 4  
ATOM 9228  H HD12 . LEU A 1 138 ? 124.701 -28.321 8.335   1.00 0.00 ? 138 LEU A HD12 4  
ATOM 9229  H HD13 . LEU A 1 138 ? 124.463 -29.068 9.915   1.00 0.00 ? 138 LEU A HD13 4  
ATOM 9230  H HD21 . LEU A 1 138 ? 123.507 -31.158 8.689   1.00 0.00 ? 138 LEU A HD21 4  
ATOM 9231  H HD22 . LEU A 1 138 ? 123.809 -30.309 7.173   1.00 0.00 ? 138 LEU A HD22 4  
ATOM 9232  H HD23 . LEU A 1 138 ? 122.193 -30.912 7.537   1.00 0.00 ? 138 LEU A HD23 4  
ATOM 9233  N N    . SER A 1 1   ? 90.912  -9.989  9.341   1.00 0.00 ? 1   SER A N    5  
ATOM 9234  C CA   . SER A 1 1   ? 92.355  -9.691  9.440   1.00 0.00 ? 1   SER A CA   5  
ATOM 9235  C C    . SER A 1 1   ? 92.796  -8.875  8.229   1.00 0.00 ? 1   SER A C    5  
ATOM 9236  O O    . SER A 1 1   ? 92.484  -9.228  7.089   1.00 0.00 ? 1   SER A O    5  
ATOM 9237  C CB   . SER A 1 1   ? 93.160  -10.996 9.531   1.00 0.00 ? 1   SER A CB   5  
ATOM 9238  O OG   . SER A 1 1   ? 94.535  -10.742 9.769   1.00 0.00 ? 1   SER A OG   5  
ATOM 9239  H H1   . SER A 1 1   ? 90.596  -10.508 10.181  1.00 0.00 ? 1   SER A H1   5  
ATOM 9240  H H2   . SER A 1 1   ? 90.728  -10.570 8.499   1.00 0.00 ? 1   SER A H2   5  
ATOM 9241  H H3   . SER A 1 1   ? 90.368  -9.104  9.264   1.00 0.00 ? 1   SER A H3   5  
ATOM 9242  H HA   . SER A 1 1   ? 92.518  -9.107  10.336  1.00 0.00 ? 1   SER A HA   5  
ATOM 9243  H HB2  . SER A 1 1   ? 92.777  -11.596 10.342  1.00 0.00 ? 1   SER A HB2  5  
ATOM 9244  H HB3  . SER A 1 1   ? 93.064  -11.542 8.604   1.00 0.00 ? 1   SER A HB3  5  
ATOM 9245  H HG   . SER A 1 1   ? 94.638  -10.322 10.631  1.00 0.00 ? 1   SER A HG   5  
ATOM 9246  N N    . MET A 1 2   ? 93.504  -7.775  8.478   1.00 0.00 ? 2   MET A N    5  
ATOM 9247  C CA   . MET A 1 2   ? 93.955  -6.894  7.405   1.00 0.00 ? 2   MET A CA   5  
ATOM 9248  C C    . MET A 1 2   ? 95.308  -7.349  6.864   1.00 0.00 ? 2   MET A C    5  
ATOM 9249  O O    . MET A 1 2   ? 95.564  -7.253  5.660   1.00 0.00 ? 2   MET A O    5  
ATOM 9250  C CB   . MET A 1 2   ? 94.035  -5.440  7.896   1.00 0.00 ? 2   MET A CB   5  
ATOM 9251  C CG   . MET A 1 2   ? 92.697  -4.879  8.366   1.00 0.00 ? 2   MET A CG   5  
ATOM 9252  S SD   . MET A 1 2   ? 92.793  -3.141  8.840   1.00 0.00 ? 2   MET A SD   5  
ATOM 9253  C CE   . MET A 1 2   ? 91.099  -2.839  9.340   1.00 0.00 ? 2   MET A CE   5  
ATOM 9254  H H    . MET A 1 2   ? 93.730  -7.553  9.407   1.00 0.00 ? 2   MET A H    5  
ATOM 9255  H HA   . MET A 1 2   ? 93.230  -6.952  6.605   1.00 0.00 ? 2   MET A HA   5  
ATOM 9256  H HB2  . MET A 1 2   ? 94.732  -5.386  8.720   1.00 0.00 ? 2   MET A HB2  5  
ATOM 9257  H HB3  . MET A 1 2   ? 94.397  -4.818  7.090   1.00 0.00 ? 2   MET A HB3  5  
ATOM 9258  H HG2  . MET A 1 2   ? 91.979  -4.977  7.564   1.00 0.00 ? 2   MET A HG2  5  
ATOM 9259  H HG3  . MET A 1 2   ? 92.360  -5.452  9.219   1.00 0.00 ? 2   MET A HG3  5  
ATOM 9260  H HE1  . MET A 1 2   ? 90.993  -1.812  9.653   1.00 0.00 ? 2   MET A HE1  5  
ATOM 9261  H HE2  . MET A 1 2   ? 90.843  -3.493  10.160  1.00 0.00 ? 2   MET A HE2  5  
ATOM 9262  H HE3  . MET A 1 2   ? 90.438  -3.030  8.507   1.00 0.00 ? 2   MET A HE3  5  
ATOM 9263  N N    . GLN A 1 3   ? 96.163  -7.852  7.753   1.00 0.00 ? 3   GLN A N    5  
ATOM 9264  C CA   . GLN A 1 3   ? 97.492  -8.325  7.368   1.00 0.00 ? 3   GLN A CA   5  
ATOM 9265  C C    . GLN A 1 3   ? 97.396  -9.376  6.259   1.00 0.00 ? 3   GLN A C    5  
ATOM 9266  O O    . GLN A 1 3   ? 96.597  -10.310 6.341   1.00 0.00 ? 3   GLN A O    5  
ATOM 9267  C CB   . GLN A 1 3   ? 98.242  -8.895  8.581   1.00 0.00 ? 3   GLN A CB   5  
ATOM 9268  C CG   . GLN A 1 3   ? 97.496  -10.006 9.310   1.00 0.00 ? 3   GLN A CG   5  
ATOM 9269  C CD   . GLN A 1 3   ? 98.288  -10.575 10.473  1.00 0.00 ? 3   GLN A CD   5  
ATOM 9270  O OE1  . GLN A 1 3   ? 98.208  -10.075 11.595  1.00 0.00 ? 3   GLN A OE1  5  
ATOM 9271  N NE2  . GLN A 1 3   ? 99.054  -11.624 10.215  1.00 0.00 ? 3   GLN A NE2  5  
ATOM 9272  H H    . GLN A 1 3   ? 95.893  -7.908  8.694   1.00 0.00 ? 3   GLN A H    5  
ATOM 9273  H HA   . GLN A 1 3   ? 98.043  -7.474  6.989   1.00 0.00 ? 3   GLN A HA   5  
ATOM 9274  H HB2  . GLN A 1 3   ? 99.193  -9.288  8.248   1.00 0.00 ? 3   GLN A HB2  5  
ATOM 9275  H HB3  . GLN A 1 3   ? 98.425  -8.093  9.283   1.00 0.00 ? 3   GLN A HB3  5  
ATOM 9276  H HG2  . GLN A 1 3   ? 96.563  -9.610  9.687   1.00 0.00 ? 3   GLN A HG2  5  
ATOM 9277  H HG3  . GLN A 1 3   ? 97.288  -10.803 8.610   1.00 0.00 ? 3   GLN A HG3  5  
ATOM 9278  H HE21 . GLN A 1 3   ? 99.069  -11.974 9.297   1.00 0.00 ? 3   GLN A HE21 5  
ATOM 9279  H HE22 . GLN A 1 3   ? 99.569  -12.016 10.952  1.00 0.00 ? 3   GLN A HE22 5  
ATOM 9280  N N    . SER A 1 4   ? 98.199  -9.183  5.212   1.00 0.00 ? 4   SER A N    5  
ATOM 9281  C CA   . SER A 1 4   ? 98.244  -10.089 4.061   1.00 0.00 ? 4   SER A CA   5  
ATOM 9282  C C    . SER A 1 4   ? 96.937  -10.055 3.254   1.00 0.00 ? 4   SER A C    5  
ATOM 9283  O O    . SER A 1 4   ? 96.742  -10.859 2.340   1.00 0.00 ? 4   SER A O    5  
ATOM 9284  C CB   . SER A 1 4   ? 98.564  -11.518 4.517   1.00 0.00 ? 4   SER A CB   5  
ATOM 9285  O OG   . SER A 1 4   ? 99.752  -11.547 5.294   1.00 0.00 ? 4   SER A OG   5  
ATOM 9286  H H    . SER A 1 4   ? 98.792  -8.407  5.218   1.00 0.00 ? 4   SER A H    5  
ATOM 9287  H HA   . SER A 1 4   ? 99.044  -9.747  3.418   1.00 0.00 ? 4   SER A HA   5  
ATOM 9288  H HB2  . SER A 1 4   ? 97.749  -11.896 5.115   1.00 0.00 ? 4   SER A HB2  5  
ATOM 9289  H HB3  . SER A 1 4   ? 98.700  -12.152 3.651   1.00 0.00 ? 4   SER A HB3  5  
ATOM 9290  H HG   . SER A 1 4   ? 99.600  -12.076 6.085   1.00 0.00 ? 4   SER A HG   5  
ATOM 9291  N N    . LEU A 1 5   ? 96.059  -9.106  3.582   1.00 0.00 ? 5   LEU A N    5  
ATOM 9292  C CA   . LEU A 1 5   ? 94.810  -8.911  2.846   1.00 0.00 ? 5   LEU A CA   5  
ATOM 9293  C C    . LEU A 1 5   ? 94.656  -7.432  2.497   1.00 0.00 ? 5   LEU A C    5  
ATOM 9294  O O    . LEU A 1 5   ? 95.166  -6.962  1.474   1.00 0.00 ? 5   LEU A O    5  
ATOM 9295  C CB   . LEU A 1 5   ? 93.614  -9.456  3.668   1.00 0.00 ? 5   LEU A CB   5  
ATOM 9296  C CG   . LEU A 1 5   ? 92.326  -9.788  2.878   1.00 0.00 ? 5   LEU A CG   5  
ATOM 9297  C CD1  . LEU A 1 5   ? 91.310  -10.483 3.783   1.00 0.00 ? 5   LEU A CD1  5  
ATOM 9298  C CD2  . LEU A 1 5   ? 91.706  -8.539  2.250   1.00 0.00 ? 5   LEU A CD2  5  
ATOM 9299  H H    . LEU A 1 5   ? 96.250  -8.529  4.349   1.00 0.00 ? 5   LEU A H    5  
ATOM 9300  H HA   . LEU A 1 5   ? 94.873  -9.455  1.931   1.00 0.00 ? 5   LEU A HA   5  
ATOM 9301  H HB2  . LEU A 1 5   ? 93.941  -10.361 4.161   1.00 0.00 ? 5   LEU A HB2  5  
ATOM 9302  H HB3  . LEU A 1 5   ? 93.365  -8.734  4.429   1.00 0.00 ? 5   LEU A HB3  5  
ATOM 9303  H HG   . LEU A 1 5   ? 92.575  -10.474 2.079   1.00 0.00 ? 5   LEU A HG   5  
ATOM 9304  H HD11 . LEU A 1 5   ? 91.052  -9.833  4.607   1.00 0.00 ? 5   LEU A HD11 5  
ATOM 9305  H HD12 . LEU A 1 5   ? 91.738  -11.398 4.168   1.00 0.00 ? 5   LEU A HD12 5  
ATOM 9306  H HD13 . LEU A 1 5   ? 90.420  -10.716 3.216   1.00 0.00 ? 5   LEU A HD13 5  
ATOM 9307  H HD21 . LEU A 1 5   ? 92.405  -8.102  1.552   1.00 0.00 ? 5   LEU A HD21 5  
ATOM 9308  H HD22 . LEU A 1 5   ? 91.474  -7.820  3.023   1.00 0.00 ? 5   LEU A HD22 5  
ATOM 9309  H HD23 . LEU A 1 5   ? 90.800  -8.809  1.727   1.00 0.00 ? 5   LEU A HD23 5  
ATOM 9310  N N    . LYS A 1 6   ? 94.007  -6.693  3.368   1.00 0.00 ? 6   LYS A N    5  
ATOM 9311  C CA   . LYS A 1 6   ? 93.815  -5.263  3.170   1.00 0.00 ? 6   LYS A CA   5  
ATOM 9312  C C    . LYS A 1 6   ? 95.175  -4.572  3.111   1.00 0.00 ? 6   LYS A C    5  
ATOM 9313  O O    . LYS A 1 6   ? 95.366  -3.595  2.386   1.00 0.00 ? 6   LYS A O    5  
ATOM 9314  C CB   . LYS A 1 6   ? 92.955  -4.670  4.294   1.00 0.00 ? 6   LYS A CB   5  
ATOM 9315  C CG   . LYS A 1 6   ? 92.651  -3.185  4.117   1.00 0.00 ? 6   LYS A CG   5  
ATOM 9316  C CD   . LYS A 1 6   ? 91.770  -2.644  5.240   1.00 0.00 ? 6   LYS A CD   5  
ATOM 9317  C CE   . LYS A 1 6   ? 91.447  -1.167  5.041   1.00 0.00 ? 6   LYS A CE   5  
ATOM 9318  N NZ   . LYS A 1 6   ? 90.561  -0.641  6.113   1.00 0.00 ? 6   LYS A NZ   5  
ATOM 9319  H H    . LYS A 1 6   ? 93.651  -7.120  4.162   1.00 0.00 ? 6   LYS A H    5  
ATOM 9320  H HA   . LYS A 1 6   ? 93.310  -5.126  2.224   1.00 0.00 ? 6   LYS A HA   5  
ATOM 9321  H HB2  . LYS A 1 6   ? 92.016  -5.206  4.333   1.00 0.00 ? 6   LYS A HB2  5  
ATOM 9322  H HB3  . LYS A 1 6   ? 93.471  -4.801  5.234   1.00 0.00 ? 6   LYS A HB3  5  
ATOM 9323  H HG2  . LYS A 1 6   ? 93.583  -2.636  4.108   1.00 0.00 ? 6   LYS A HG2  5  
ATOM 9324  H HG3  . LYS A 1 6   ? 92.143  -3.043  3.171   1.00 0.00 ? 6   LYS A HG3  5  
ATOM 9325  H HD2  . LYS A 1 6   ? 90.845  -3.203  5.261   1.00 0.00 ? 6   LYS A HD2  5  
ATOM 9326  H HD3  . LYS A 1 6   ? 92.287  -2.766  6.182   1.00 0.00 ? 6   LYS A HD3  5  
ATOM 9327  H HE2  . LYS A 1 6   ? 92.370  -0.604  5.043   1.00 0.00 ? 6   LYS A HE2  5  
ATOM 9328  H HE3  . LYS A 1 6   ? 90.954  -1.043  4.087   1.00 0.00 ? 6   LYS A HE3  5  
ATOM 9329  H HZ1  . LYS A 1 6   ? 89.686  -1.200  6.162   1.00 0.00 ? 6   LYS A HZ1  5  
ATOM 9330  H HZ2  . LYS A 1 6   ? 90.313  0.350   5.918   1.00 0.00 ? 6   LYS A HZ2  5  
ATOM 9331  H HZ3  . LYS A 1 6   ? 91.043  -0.690  7.033   1.00 0.00 ? 6   LYS A HZ3  5  
ATOM 9332  N N    . SER A 1 7   ? 96.122  -5.117  3.868   1.00 0.00 ? 7   SER A N    5  
ATOM 9333  C CA   . SER A 1 7   ? 97.484  -4.616  3.886   1.00 0.00 ? 7   SER A CA   5  
ATOM 9334  C C    . SER A 1 7   ? 98.111  -4.672  2.491   1.00 0.00 ? 7   SER A C    5  
ATOM 9335  O O    . SER A 1 7   ? 98.828  -3.755  2.094   1.00 0.00 ? 7   SER A O    5  
ATOM 9336  C CB   . SER A 1 7   ? 98.324  -5.418  4.884   1.00 0.00 ? 7   SER A CB   5  
ATOM 9337  O OG   . SER A 1 7   ? 97.737  -5.398  6.172   1.00 0.00 ? 7   SER A OG   5  
ATOM 9338  H H    . SER A 1 7   ? 95.892  -5.873  4.445   1.00 0.00 ? 7   SER A H    5  
ATOM 9339  H HA   . SER A 1 7   ? 97.450  -3.586  4.208   1.00 0.00 ? 7   SER A HA   5  
ATOM 9340  H HB2  . SER A 1 7   ? 98.397  -6.444  4.553   1.00 0.00 ? 7   SER A HB2  5  
ATOM 9341  H HB3  . SER A 1 7   ? 99.313  -4.989  4.947   1.00 0.00 ? 7   SER A HB3  5  
ATOM 9342  H HG   . SER A 1 7   ? 98.402  -5.147  6.828   1.00 0.00 ? 7   SER A HG   5  
ATOM 9343  N N    . THR A 1 8   ? 97.822  -5.734  1.736   1.00 0.00 ? 8   THR A N    5  
ATOM 9344  C CA   . THR A 1 8   ? 98.386  -5.881  0.398   1.00 0.00 ? 8   THR A CA   5  
ATOM 9345  C C    . THR A 1 8   ? 97.836  -4.788  -0.507  1.00 0.00 ? 8   THR A C    5  
ATOM 9346  O O    . THR A 1 8   ? 98.564  -4.198  -1.306  1.00 0.00 ? 8   THR A O    5  
ATOM 9347  C CB   . THR A 1 8   ? 98.083  -7.267  -0.221  1.00 0.00 ? 8   THR A CB   5  
ATOM 9348  O OG1  . THR A 1 8   ? 96.686  -7.392  -0.510  1.00 0.00 ? 8   THR A OG1  5  
ATOM 9349  C CG2  . THR A 1 8   ? 98.500  -8.384  0.724   1.00 0.00 ? 8   THR A CG2  5  
ATOM 9350  H H    . THR A 1 8   ? 97.205  -6.414  2.075   1.00 0.00 ? 8   THR A H    5  
ATOM 9351  H HA   . THR A 1 8   ? 99.460  -5.766  0.474   1.00 0.00 ? 8   THR A HA   5  
ATOM 9352  H HB   . THR A 1 8   ? 98.643  -7.366  -1.141  1.00 0.00 ? 8   THR A HB   5  
ATOM 9353  H HG1  . THR A 1 8   ? 96.239  -7.817  0.232   1.00 0.00 ? 8   THR A HG1  5  
ATOM 9354  H HG21 . THR A 1 8   ? 98.289  -9.340  0.266   1.00 0.00 ? 8   THR A HG21 5  
ATOM 9355  H HG22 . THR A 1 8   ? 97.949  -8.299  1.649   1.00 0.00 ? 8   THR A HG22 5  
ATOM 9356  H HG23 . THR A 1 8   ? 99.559  -8.310  0.929   1.00 0.00 ? 8   THR A HG23 5  
ATOM 9357  N N    . ALA A 1 9   ? 96.542  -4.510  -0.349  1.00 0.00 ? 9   ALA A N    5  
ATOM 9358  C CA   . ALA A 1 9   ? 95.890  -3.434  -1.089  1.00 0.00 ? 9   ALA A CA   5  
ATOM 9359  C C    . ALA A 1 9   ? 96.586  -2.099  -0.821  1.00 0.00 ? 9   ALA A C    5  
ATOM 9360  O O    . ALA A 1 9   ? 96.766  -1.290  -1.732  1.00 0.00 ? 9   ALA A O    5  
ATOM 9361  C CB   . ALA A 1 9   ? 94.412  -3.357  -0.720  1.00 0.00 ? 9   ALA A CB   5  
ATOM 9362  H H    . ALA A 1 9   ? 96.009  -5.054  0.276   1.00 0.00 ? 9   ALA A H    5  
ATOM 9363  H HA   . ALA A 1 9   ? 95.963  -3.663  -2.144  1.00 0.00 ? 9   ALA A HA   5  
ATOM 9364  H HB1  . ALA A 1 9   ? 93.943  -4.311  -0.912  1.00 0.00 ? 9   ALA A HB1  5  
ATOM 9365  H HB2  . ALA A 1 9   ? 93.930  -2.593  -1.314  1.00 0.00 ? 9   ALA A HB2  5  
ATOM 9366  H HB3  . ALA A 1 9   ? 94.313  -3.112  0.328   1.00 0.00 ? 9   ALA A HB3  5  
ATOM 9367  N N    . LYS A 1 10  ? 96.985  -1.892  0.436   1.00 0.00 ? 10  LYS A N    5  
ATOM 9368  C CA   . LYS A 1 10  ? 97.691  -0.676  0.851   1.00 0.00 ? 10  LYS A CA   5  
ATOM 9369  C C    . LYS A 1 10  ? 98.938  -0.443  0.003   1.00 0.00 ? 10  LYS A C    5  
ATOM 9370  O O    . LYS A 1 10  ? 99.067  0.567   -0.701  1.00 0.00 ? 10  LYS A O    5  
ATOM 9371  C CB   . LYS A 1 10  ? 98.118  -0.784  2.326   1.00 0.00 ? 10  LYS A CB   5  
ATOM 9372  C CG   . LYS A 1 10  ? 96.954  -0.918  3.305   1.00 0.00 ? 10  LYS A CG   5  
ATOM 9373  C CD   . LYS A 1 10  ? 97.376  -0.632  4.748   1.00 0.00 ? 10  LYS A CD   5  
ATOM 9374  C CE   . LYS A 1 10  ? 98.561  -1.486  5.194   1.00 0.00 ? 10  LYS A CE   5  
ATOM 9375  N NZ   . LYS A 1 10  ? 98.905  -1.251  6.621   1.00 0.00 ? 10  LYS A NZ   5  
ATOM 9376  H H    . LYS A 1 10  ? 96.793  -2.579  1.108   1.00 0.00 ? 10  LYS A H    5  
ATOM 9377  H HA   . LYS A 1 10  ? 97.020  0.162   0.737   1.00 0.00 ? 10  LYS A HA   5  
ATOM 9378  H HB2  . LYS A 1 10  ? 98.757  -1.660  2.434   1.00 0.00 ? 10  LYS A HB2  5  
ATOM 9379  H HB3  . LYS A 1 10  ? 98.689  0.094   2.593   1.00 0.00 ? 10  LYS A HB3  5  
ATOM 9380  H HG2  . LYS A 1 10  ? 96.180  -0.217  3.025   1.00 0.00 ? 10  LYS A HG2  5  
ATOM 9381  H HG3  . LYS A 1 10  ? 96.563  -1.925  3.246   1.00 0.00 ? 10  LYS A HG3  5  
ATOM 9382  H HD2  . LYS A 1 10  ? 97.650  0.409   4.830   1.00 0.00 ? 10  LYS A HD2  5  
ATOM 9383  H HD3  . LYS A 1 10  ? 96.536  -0.832  5.400   1.00 0.00 ? 10  LYS A HD3  5  
ATOM 9384  H HE2  . LYS A 1 10  ? 98.311  -2.528  5.063   1.00 0.00 ? 10  LYS A HE2  5  
ATOM 9385  H HE3  . LYS A 1 10  ? 99.418  -1.242  4.581   1.00 0.00 ? 10  LYS A HE3  5  
ATOM 9386  H HZ1  . LYS A 1 10  ? 98.124  -1.560  7.236   1.00 0.00 ? 10  LYS A HZ1  5  
ATOM 9387  H HZ2  . LYS A 1 10  ? 99.079  -0.239  6.787   1.00 0.00 ? 10  LYS A HZ2  5  
ATOM 9388  H HZ3  . LYS A 1 10  ? 99.765  -1.778  6.878   1.00 0.00 ? 10  LYS A HZ3  5  
ATOM 9389  N N    . TRP A 1 11  ? 99.846  -1.400  0.075   1.00 0.00 ? 11  TRP A N    5  
ATOM 9390  C CA   . TRP A 1 11  ? 101.154 -1.275  -0.546  1.00 0.00 ? 11  TRP A CA   5  
ATOM 9391  C C    . TRP A 1 11  ? 101.039 -1.319  -2.063  1.00 0.00 ? 11  TRP A C    5  
ATOM 9392  O O    . TRP A 1 11  ? 101.732 -0.586  -2.766  1.00 0.00 ? 11  TRP A O    5  
ATOM 9393  C CB   . TRP A 1 11  ? 102.071 -2.388  -0.040  1.00 0.00 ? 11  TRP A CB   5  
ATOM 9394  C CG   . TRP A 1 11  ? 102.029 -2.546  1.451   1.00 0.00 ? 11  TRP A CG   5  
ATOM 9395  C CD1  . TRP A 1 11  ? 102.144 -1.563  2.392   1.00 0.00 ? 11  TRP A CD1  5  
ATOM 9396  C CD2  . TRP A 1 11  ? 101.851 -3.765  2.169   1.00 0.00 ? 11  TRP A CD2  5  
ATOM 9397  N NE1  . TRP A 1 11  ? 102.061 -2.104  3.650   1.00 0.00 ? 11  TRP A NE1  5  
ATOM 9398  C CE2  . TRP A 1 11  ? 101.882 -3.456  3.537   1.00 0.00 ? 11  TRP A CE2  5  
ATOM 9399  C CE3  . TRP A 1 11  ? 101.674 -5.087  1.781   1.00 0.00 ? 11  TRP A CE3  5  
ATOM 9400  C CZ2  . TRP A 1 11  ? 101.745 -4.427  4.520   1.00 0.00 ? 11  TRP A CZ2  5  
ATOM 9401  C CZ3  . TRP A 1 11  ? 101.534 -6.056  2.754   1.00 0.00 ? 11  TRP A CZ3  5  
ATOM 9402  C CH2  . TRP A 1 11  ? 101.573 -5.722  4.112   1.00 0.00 ? 11  TRP A CH2  5  
ATOM 9403  H H    . TRP A 1 11  ? 99.629  -2.223  0.563   1.00 0.00 ? 11  TRP A H    5  
ATOM 9404  H HA   . TRP A 1 11  ? 101.570 -0.320  -0.256  1.00 0.00 ? 11  TRP A HA   5  
ATOM 9405  H HB2  . TRP A 1 11  ? 101.770 -3.326  -0.483  1.00 0.00 ? 11  TRP A HB2  5  
ATOM 9406  H HB3  . TRP A 1 11  ? 103.090 -2.169  -0.325  1.00 0.00 ? 11  TRP A HB3  5  
ATOM 9407  H HD1  . TRP A 1 11  ? 102.282 -0.517  2.165   1.00 0.00 ? 11  TRP A HD1  5  
ATOM 9408  H HE1  . TRP A 1 11  ? 102.123 -1.604  4.494   1.00 0.00 ? 11  TRP A HE1  5  
ATOM 9409  H HE3  . TRP A 1 11  ? 101.629 -5.352  0.739   1.00 0.00 ? 11  TRP A HE3  5  
ATOM 9410  H HZ2  . TRP A 1 11  ? 101.769 -4.180  5.568   1.00 0.00 ? 11  TRP A HZ2  5  
ATOM 9411  H HZ3  . TRP A 1 11  ? 101.397 -7.090  2.470   1.00 0.00 ? 11  TRP A HZ3  5  
ATOM 9412  H HH2  . TRP A 1 11  ? 101.461 -6.511  4.843   1.00 0.00 ? 11  TRP A HH2  5  
ATOM 9413  N N    . ALA A 1 12  ? 100.142 -2.165  -2.564  1.00 0.00 ? 12  ALA A N    5  
ATOM 9414  C CA   . ALA A 1 12  ? 99.916  -2.264  -4.000  1.00 0.00 ? 12  ALA A CA   5  
ATOM 9415  C C    . ALA A 1 12  ? 99.013  -1.121  -4.487  1.00 0.00 ? 12  ALA A C    5  
ATOM 9416  O O    . ALA A 1 12  ? 98.677  -1.047  -5.671  1.00 0.00 ? 12  ALA A O    5  
ATOM 9417  C CB   . ALA A 1 12  ? 99.367  -3.648  -4.374  1.00 0.00 ? 12  ALA A CB   5  
ATOM 9418  H H    . ALA A 1 12  ? 99.625  -2.735  -1.957  1.00 0.00 ? 12  ALA A H    5  
ATOM 9419  H HA   . ALA A 1 12  ? 100.878 -2.154  -4.483  1.00 0.00 ? 12  ALA A HA   5  
ATOM 9420  H HB1  . ALA A 1 12  ? 100.074 -4.408  -4.065  1.00 0.00 ? 12  ALA A HB1  5  
ATOM 9421  H HB2  . ALA A 1 12  ? 99.230  -3.709  -5.446  1.00 0.00 ? 12  ALA A HB2  5  
ATOM 9422  H HB3  . ALA A 1 12  ? 98.422  -3.822  -3.882  1.00 0.00 ? 12  ALA A HB3  5  
ATOM 9423  N N    . ALA A 1 13  ? 98.617  -0.230  -3.564  1.00 0.00 ? 13  ALA A N    5  
ATOM 9424  C CA   . ALA A 1 13  ? 97.995  1.045   -3.940  1.00 0.00 ? 13  ALA A CA   5  
ATOM 9425  C C    . ALA A 1 13  ? 99.087  2.053   -4.279  1.00 0.00 ? 13  ALA A C    5  
ATOM 9426  O O    . ALA A 1 13  ? 99.014  2.754   -5.292  1.00 0.00 ? 13  ALA A O    5  
ATOM 9427  C CB   . ALA A 1 13  ? 97.103  1.613   -2.827  1.00 0.00 ? 13  ALA A CB   5  
ATOM 9428  H H    . ALA A 1 13  ? 98.739  -0.442  -2.616  1.00 0.00 ? 13  ALA A H    5  
ATOM 9429  H HA   . ALA A 1 13  ? 97.384  0.877   -4.818  1.00 0.00 ? 13  ALA A HA   5  
ATOM 9430  H HB1  . ALA A 1 13  ? 96.693  2.564   -3.146  1.00 0.00 ? 13  ALA A HB1  5  
ATOM 9431  H HB2  . ALA A 1 13  ? 97.687  1.764   -1.930  1.00 0.00 ? 13  ALA A HB2  5  
ATOM 9432  H HB3  . ALA A 1 13  ? 96.291  0.932   -2.617  1.00 0.00 ? 13  ALA A HB3  5  
ATOM 9433  N N    . SER A 1 14  ? 100.106 2.117   -3.421  1.00 0.00 ? 14  SER A N    5  
ATOM 9434  C CA   . SER A 1 14  ? 101.211 3.041   -3.606  1.00 0.00 ? 14  SER A CA   5  
ATOM 9435  C C    . SER A 1 14  ? 102.426 2.583   -2.807  1.00 0.00 ? 14  SER A C    5  
ATOM 9436  O O    . SER A 1 14  ? 102.304 2.200   -1.636  1.00 0.00 ? 14  SER A O    5  
ATOM 9437  C CB   . SER A 1 14  ? 100.795 4.454   -3.173  1.00 0.00 ? 14  SER A CB   5  
ATOM 9438  O OG   . SER A 1 14  ? 101.912 5.322   -3.109  1.00 0.00 ? 14  SER A OG   5  
ATOM 9439  H H    . SER A 1 14  ? 100.116 1.522   -2.634  1.00 0.00 ? 14  SER A H    5  
ATOM 9440  H HA   . SER A 1 14  ? 101.467 3.054   -4.656  1.00 0.00 ? 14  SER A HA   5  
ATOM 9441  H HB2  . SER A 1 14  ? 100.086 4.853   -3.883  1.00 0.00 ? 14  SER A HB2  5  
ATOM 9442  H HB3  . SER A 1 14  ? 100.336 4.408   -2.195  1.00 0.00 ? 14  SER A HB3  5  
ATOM 9443  H HG   . SER A 1 14  ? 101.891 5.937   -3.853  1.00 0.00 ? 14  SER A HG   5  
ATOM 9444  N N    . LEU A 1 15  ? 103.594 2.628   -3.443  1.00 0.00 ? 15  LEU A N    5  
ATOM 9445  C CA   . LEU A 1 15  ? 104.849 2.307   -2.777  1.00 0.00 ? 15  LEU A CA   5  
ATOM 9446  C C    . LEU A 1 15  ? 105.070 3.256   -1.605  1.00 0.00 ? 15  LEU A C    5  
ATOM 9447  O O    . LEU A 1 15  ? 105.703 2.895   -0.615  1.00 0.00 ? 15  LEU A O    5  
ATOM 9448  C CB   . LEU A 1 15  ? 106.029 2.399   -3.761  1.00 0.00 ? 15  LEU A CB   5  
ATOM 9449  C CG   . LEU A 1 15  ? 107.414 2.098   -3.156  1.00 0.00 ? 15  LEU A CG   5  
ATOM 9450  C CD1  . LEU A 1 15  ? 107.498 0.648   -2.680  1.00 0.00 ? 15  LEU A CD1  5  
ATOM 9451  C CD2  . LEU A 1 15  ? 108.524 2.410   -4.157  1.00 0.00 ? 15  LEU A CD2  5  
ATOM 9452  H H    . LEU A 1 15  ? 103.611 2.888   -4.388  1.00 0.00 ? 15  LEU A H    5  
ATOM 9453  H HA   . LEU A 1 15  ? 104.779 1.295   -2.401  1.00 0.00 ? 15  LEU A HA   5  
ATOM 9454  H HB2  . LEU A 1 15  ? 105.850 1.702   -4.569  1.00 0.00 ? 15  LEU A HB2  5  
ATOM 9455  H HB3  . LEU A 1 15  ? 106.049 3.399   -4.172  1.00 0.00 ? 15  LEU A HB3  5  
ATOM 9456  H HG   . LEU A 1 15  ? 107.561 2.732   -2.293  1.00 0.00 ? 15  LEU A HG   5  
ATOM 9457  H HD11 . LEU A 1 15  ? 107.338 -0.019  -3.515  1.00 0.00 ? 15  LEU A HD11 5  
ATOM 9458  H HD12 . LEU A 1 15  ? 106.742 0.472   -1.928  1.00 0.00 ? 15  LEU A HD12 5  
ATOM 9459  H HD13 . LEU A 1 15  ? 108.474 0.464   -2.254  1.00 0.00 ? 15  LEU A HD13 5  
ATOM 9460  H HD21 . LEU A 1 15  ? 108.400 1.800   -5.040  1.00 0.00 ? 15  LEU A HD21 5  
ATOM 9461  H HD22 . LEU A 1 15  ? 109.484 2.202   -3.708  1.00 0.00 ? 15  LEU A HD22 5  
ATOM 9462  H HD23 . LEU A 1 15  ? 108.477 3.455   -4.432  1.00 0.00 ? 15  LEU A HD23 5  
ATOM 9463  N N    . GLU A 1 16  ? 104.521 4.465   -1.715  1.00 0.00 ? 16  GLU A N    5  
ATOM 9464  C CA   . GLU A 1 16  ? 104.650 5.456   -0.655  1.00 0.00 ? 16  GLU A CA   5  
ATOM 9465  C C    . GLU A 1 16  ? 103.969 4.943   0.607   1.00 0.00 ? 16  GLU A C    5  
ATOM 9466  O O    . GLU A 1 16  ? 104.510 5.056   1.707   1.00 0.00 ? 16  GLU A O    5  
ATOM 9467  C CB   . GLU A 1 16  ? 104.055 6.813   -1.065  1.00 0.00 ? 16  GLU A CB   5  
ATOM 9468  C CG   . GLU A 1 16  ? 104.766 7.487   -2.240  1.00 0.00 ? 16  GLU A CG   5  
ATOM 9469  C CD   . GLU A 1 16  ? 104.350 6.934   -3.596  1.00 0.00 ? 16  GLU A CD   5  
ATOM 9470  O OE1  . GLU A 1 16  ? 103.372 7.453   -4.176  1.00 0.00 ? 16  GLU A OE1  5  
ATOM 9471  O OE2  . GLU A 1 16  ? 104.989 5.980   -4.087  1.00 0.00 ? 16  GLU A OE2  5  
ATOM 9472  H H    . GLU A 1 16  ? 104.009 4.688   -2.525  1.00 0.00 ? 16  GLU A H    5  
ATOM 9473  H HA   . GLU A 1 16  ? 105.706 5.582   -0.450  1.00 0.00 ? 16  GLU A HA   5  
ATOM 9474  H HB2  . GLU A 1 16  ? 103.018 6.670   -1.335  1.00 0.00 ? 16  GLU A HB2  5  
ATOM 9475  H HB3  . GLU A 1 16  ? 104.103 7.482   -0.216  1.00 0.00 ? 16  GLU A HB3  5  
ATOM 9476  H HG2  . GLU A 1 16  ? 104.542 8.544   -2.218  1.00 0.00 ? 16  GLU A HG2  5  
ATOM 9477  H HG3  . GLU A 1 16  ? 105.833 7.350   -2.123  1.00 0.00 ? 16  GLU A HG3  5  
ATOM 9478  N N    . ASN A 1 17  ? 102.786 4.353   0.431   1.00 0.00 ? 17  ASN A N    5  
ATOM 9479  C CA   . ASN A 1 17  ? 102.059 3.740   1.533   1.00 0.00 ? 17  ASN A CA   5  
ATOM 9480  C C    . ASN A 1 17  ? 102.931 2.696   2.207   1.00 0.00 ? 17  ASN A C    5  
ATOM 9481  O O    . ASN A 1 17  ? 103.042 2.649   3.432   1.00 0.00 ? 17  ASN A O    5  
ATOM 9482  C CB   . ASN A 1 17  ? 100.778 3.070   1.028   1.00 0.00 ? 17  ASN A CB   5  
ATOM 9483  C CG   . ASN A 1 17  ? 99.803  4.037   0.385   1.00 0.00 ? 17  ASN A CG   5  
ATOM 9484  O OD1  . ASN A 1 17  ? 99.790  5.232   0.687   1.00 0.00 ? 17  ASN A OD1  5  
ATOM 9485  N ND2  . ASN A 1 17  ? 98.966  3.517   -0.497  1.00 0.00 ? 17  ASN A ND2  5  
ATOM 9486  H H    . ASN A 1 17  ? 102.394 4.326   -0.466  1.00 0.00 ? 17  ASN A H    5  
ATOM 9487  H HA   . ASN A 1 17  ? 101.805 4.511   2.246   1.00 0.00 ? 17  ASN A HA   5  
ATOM 9488  H HB2  . ASN A 1 17  ? 101.041 2.321   0.294   1.00 0.00 ? 17  ASN A HB2  5  
ATOM 9489  H HB3  . ASN A 1 17  ? 100.290 2.591   1.854   1.00 0.00 ? 17  ASN A HB3  5  
ATOM 9490  H HD21 . ASN A 1 17  ? 99.028  2.553   -0.680  1.00 0.00 ? 17  ASN A HD21 5  
ATOM 9491  H HD22 . ASN A 1 17  ? 98.316  4.112   -0.929  1.00 0.00 ? 17  ASN A HD22 5  
ATOM 9492  N N    . LEU A 1 18  ? 103.539 1.859   1.376   1.00 0.00 ? 18  LEU A N    5  
ATOM 9493  C CA   . LEU A 1 18  ? 104.463 0.822   1.828   1.00 0.00 ? 18  LEU A CA   5  
ATOM 9494  C C    . LEU A 1 18  ? 105.596 1.437   2.646   1.00 0.00 ? 18  LEU A C    5  
ATOM 9495  O O    . LEU A 1 18  ? 105.880 0.998   3.760   1.00 0.00 ? 18  LEU A O    5  
ATOM 9496  C CB   . LEU A 1 18  ? 105.010 0.059   0.601   1.00 0.00 ? 18  LEU A CB   5  
ATOM 9497  C CG   . LEU A 1 18  ? 105.891 -1.181  0.878   1.00 0.00 ? 18  LEU A CG   5  
ATOM 9498  C CD1  . LEU A 1 18  ? 105.963 -2.066  -0.364  1.00 0.00 ? 18  LEU A CD1  5  
ATOM 9499  C CD2  . LEU A 1 18  ? 107.303 -0.780  1.307   1.00 0.00 ? 18  LEU A CD2  5  
ATOM 9500  H H    . LEU A 1 18  ? 103.351 1.942   0.415   1.00 0.00 ? 18  LEU A H    5  
ATOM 9501  H HA   . LEU A 1 18  ? 103.913 0.135   2.454   1.00 0.00 ? 18  LEU A HA   5  
ATOM 9502  H HB2  . LEU A 1 18  ? 104.164 -0.261  0.009   1.00 0.00 ? 18  LEU A HB2  5  
ATOM 9503  H HB3  . LEU A 1 18  ? 105.589 0.754   0.008   1.00 0.00 ? 18  LEU A HB3  5  
ATOM 9504  H HG   . LEU A 1 18  ? 105.448 -1.761  1.677   1.00 0.00 ? 18  LEU A HG   5  
ATOM 9505  H HD11 . LEU A 1 18  ? 106.384 -1.503  -1.185  1.00 0.00 ? 18  LEU A HD11 5  
ATOM 9506  H HD12 . LEU A 1 18  ? 104.969 -2.398  -0.628  1.00 0.00 ? 18  LEU A HD12 5  
ATOM 9507  H HD13 . LEU A 1 18  ? 106.586 -2.925  -0.160  1.00 0.00 ? 18  LEU A HD13 5  
ATOM 9508  H HD21 . LEU A 1 18  ? 107.255 -0.223  2.230   1.00 0.00 ? 18  LEU A HD21 5  
ATOM 9509  H HD22 . LEU A 1 18  ? 107.753 -0.166  0.541   1.00 0.00 ? 18  LEU A HD22 5  
ATOM 9510  H HD23 . LEU A 1 18  ? 107.901 -1.667  1.454   1.00 0.00 ? 18  LEU A HD23 5  
ATOM 9511  N N    . LEU A 1 19  ? 106.214 2.471   2.090   1.00 0.00 ? 19  LEU A N    5  
ATOM 9512  C CA   . LEU A 1 19  ? 107.374 3.113   2.706   1.00 0.00 ? 19  LEU A CA   5  
ATOM 9513  C C    . LEU A 1 19  ? 106.999 3.872   3.980   1.00 0.00 ? 19  LEU A C    5  
ATOM 9514  O O    . LEU A 1 19  ? 107.877 4.286   4.739   1.00 0.00 ? 19  LEU A O    5  
ATOM 9515  C CB   . LEU A 1 19  ? 108.045 4.060   1.700   1.00 0.00 ? 19  LEU A CB   5  
ATOM 9516  C CG   . LEU A 1 19  ? 108.629 3.378   0.449   1.00 0.00 ? 19  LEU A CG   5  
ATOM 9517  C CD1  . LEU A 1 19  ? 109.195 4.414   -0.521  1.00 0.00 ? 19  LEU A CD1  5  
ATOM 9518  C CD2  . LEU A 1 19  ? 109.700 2.358   0.838   1.00 0.00 ? 19  LEU A CD2  5  
ATOM 9519  H H    . LEU A 1 19  ? 105.885 2.812   1.233   1.00 0.00 ? 19  LEU A H    5  
ATOM 9520  H HA   . LEU A 1 19  ? 108.077 2.334   2.967   1.00 0.00 ? 19  LEU A HA   5  
ATOM 9521  H HB2  . LEU A 1 19  ? 107.310 4.787   1.380   1.00 0.00 ? 19  LEU A HB2  5  
ATOM 9522  H HB3  . LEU A 1 19  ? 108.846 4.582   2.205   1.00 0.00 ? 19  LEU A HB3  5  
ATOM 9523  H HG   . LEU A 1 19  ? 107.838 2.848   -0.063  1.00 0.00 ? 19  LEU A HG   5  
ATOM 9524  H HD11 . LEU A 1 19  ? 109.992 4.963   -0.041  1.00 0.00 ? 19  LEU A HD11 5  
ATOM 9525  H HD12 . LEU A 1 19  ? 108.412 5.099   -0.813  1.00 0.00 ? 19  LEU A HD12 5  
ATOM 9526  H HD13 . LEU A 1 19  ? 109.579 3.915   -1.398  1.00 0.00 ? 19  LEU A HD13 5  
ATOM 9527  H HD21 . LEU A 1 19  ? 109.264 1.602   1.474   1.00 0.00 ? 19  LEU A HD21 5  
ATOM 9528  H HD22 . LEU A 1 19  ? 110.501 2.855   1.367   1.00 0.00 ? 19  LEU A HD22 5  
ATOM 9529  H HD23 . LEU A 1 19  ? 110.094 1.892   -0.054  1.00 0.00 ? 19  LEU A HD23 5  
ATOM 9530  N N    . GLU A 1 20  ? 105.703 4.067   4.211   1.00 0.00 ? 20  GLU A N    5  
ATOM 9531  C CA   . GLU A 1 20  ? 105.239 4.743   5.427   1.00 0.00 ? 20  GLU A CA   5  
ATOM 9532  C C    . GLU A 1 20  ? 104.644 3.744   6.418   1.00 0.00 ? 20  GLU A C    5  
ATOM 9533  O O    . GLU A 1 20  ? 104.583 4.009   7.622   1.00 0.00 ? 20  GLU A O    5  
ATOM 9534  C CB   . GLU A 1 20  ? 104.201 5.824   5.091   1.00 0.00 ? 20  GLU A CB   5  
ATOM 9535  C CG   . GLU A 1 20  ? 104.734 6.927   4.184   1.00 0.00 ? 20  GLU A CG   5  
ATOM 9536  C CD   . GLU A 1 20  ? 103.748 8.071   4.007   1.00 0.00 ? 20  GLU A CD   5  
ATOM 9537  O OE1  . GLU A 1 20  ? 102.607 7.817   3.560   1.00 0.00 ? 20  GLU A OE1  5  
ATOM 9538  O OE2  . GLU A 1 20  ? 104.111 9.232   4.308   1.00 0.00 ? 20  GLU A OE2  5  
ATOM 9539  H H    . GLU A 1 20  ? 105.046 3.758   3.548   1.00 0.00 ? 20  GLU A H    5  
ATOM 9540  H HA   . GLU A 1 20  ? 106.093 5.216   5.891   1.00 0.00 ? 20  GLU A HA   5  
ATOM 9541  H HB2  . GLU A 1 20  ? 103.359 5.358   4.599   1.00 0.00 ? 20  GLU A HB2  5  
ATOM 9542  H HB3  . GLU A 1 20  ? 103.861 6.278   6.012   1.00 0.00 ? 20  GLU A HB3  5  
ATOM 9543  H HG2  . GLU A 1 20  ? 105.647 7.316   4.613   1.00 0.00 ? 20  GLU A HG2  5  
ATOM 9544  H HG3  . GLU A 1 20  ? 104.950 6.504   3.213   1.00 0.00 ? 20  GLU A HG3  5  
ATOM 9545  N N    . ASP A 1 21  ? 104.219 2.594   5.910   1.00 0.00 ? 21  ASP A N    5  
ATOM 9546  C CA   . ASP A 1 21  ? 103.548 1.585   6.729   1.00 0.00 ? 21  ASP A CA   5  
ATOM 9547  C C    . ASP A 1 21  ? 104.564 0.628   7.354   1.00 0.00 ? 21  ASP A C    5  
ATOM 9548  O O    . ASP A 1 21  ? 105.436 0.113   6.656   1.00 0.00 ? 21  ASP A O    5  
ATOM 9549  C CB   . ASP A 1 21  ? 102.543 0.798   5.877   1.00 0.00 ? 21  ASP A CB   5  
ATOM 9550  C CG   . ASP A 1 21  ? 101.776 -0.236  6.683   1.00 0.00 ? 21  ASP A CG   5  
ATOM 9551  O OD1  . ASP A 1 21  ? 100.932 0.160   7.512   1.00 0.00 ? 21  ASP A OD1  5  
ATOM 9552  O OD2  . ASP A 1 21  ? 101.991 -1.448  6.472   1.00 0.00 ? 21  ASP A OD2  5  
ATOM 9553  H H    . ASP A 1 21  ? 104.370 2.411   4.959   1.00 0.00 ? 21  ASP A H    5  
ATOM 9554  H HA   . ASP A 1 21  ? 103.014 2.097   7.517   1.00 0.00 ? 21  ASP A HA   5  
ATOM 9555  H HB2  . ASP A 1 21  ? 101.832 1.488   5.444   1.00 0.00 ? 21  ASP A HB2  5  
ATOM 9556  H HB3  . ASP A 1 21  ? 103.074 0.293   5.081   1.00 0.00 ? 21  ASP A HB3  5  
ATOM 9557  N N    . PRO A 1 22  ? 104.471 0.384   8.679   1.00 0.00 ? 22  PRO A N    5  
ATOM 9558  C CA   . PRO A 1 22  ? 105.390 -0.523  9.385   1.00 0.00 ? 22  PRO A CA   5  
ATOM 9559  C C    . PRO A 1 22  ? 105.456 -1.909  8.737   1.00 0.00 ? 22  PRO A C    5  
ATOM 9560  O O    . PRO A 1 22  ? 106.534 -2.380  8.370   1.00 0.00 ? 22  PRO A O    5  
ATOM 9561  C CB   . PRO A 1 22  ? 104.797 -0.606  10.799  1.00 0.00 ? 22  PRO A CB   5  
ATOM 9562  C CG   . PRO A 1 22  ? 104.031 0.664   10.960  1.00 0.00 ? 22  PRO A CG   5  
ATOM 9563  C CD   . PRO A 1 22  ? 103.477 0.982   9.596   1.00 0.00 ? 22  PRO A CD   5  
ATOM 9564  H HA   . PRO A 1 22  ? 106.388 -0.106  9.434   1.00 0.00 ? 22  PRO A HA   5  
ATOM 9565  H HB2  . PRO A 1 22  ? 104.151 -1.472  10.876  1.00 0.00 ? 22  PRO A HB2  5  
ATOM 9566  H HB3  . PRO A 1 22  ? 105.595 -0.682  11.525  1.00 0.00 ? 22  PRO A HB3  5  
ATOM 9567  H HG2  . PRO A 1 22  ? 103.228 0.523   11.671  1.00 0.00 ? 22  PRO A HG2  5  
ATOM 9568  H HG3  . PRO A 1 22  ? 104.691 1.453   11.290  1.00 0.00 ? 22  PRO A HG3  5  
ATOM 9569  H HD2  . PRO A 1 22  ? 102.506 0.524   9.465   1.00 0.00 ? 22  PRO A HD2  5  
ATOM 9570  H HD3  . PRO A 1 22  ? 103.414 2.051   9.453   1.00 0.00 ? 22  PRO A HD3  5  
ATOM 9571  N N    . GLU A 1 23  ? 104.298 -2.546  8.572   1.00 0.00 ? 23  GLU A N    5  
ATOM 9572  C CA   . GLU A 1 23  ? 104.237 -3.876  7.971   1.00 0.00 ? 23  GLU A CA   5  
ATOM 9573  C C    . GLU A 1 23  ? 104.844 -3.834  6.577   1.00 0.00 ? 23  GLU A C    5  
ATOM 9574  O O    . GLU A 1 23  ? 105.573 -4.739  6.177   1.00 0.00 ? 23  GLU A O    5  
ATOM 9575  C CB   . GLU A 1 23  ? 102.794 -4.400  7.884   1.00 0.00 ? 23  GLU A CB   5  
ATOM 9576  C CG   . GLU A 1 23  ? 102.096 -4.603  9.227   1.00 0.00 ? 23  GLU A CG   5  
ATOM 9577  C CD   . GLU A 1 23  ? 100.860 -5.494  9.113   1.00 0.00 ? 23  GLU A CD   5  
ATOM 9578  O OE1  . GLU A 1 23  ? 100.089 -5.343  8.134   1.00 0.00 ? 23  GLU A OE1  5  
ATOM 9579  O OE2  . GLU A 1 23  ? 100.678 -6.386  9.971   1.00 0.00 ? 23  GLU A OE2  5  
ATOM 9580  H H    . GLU A 1 23  ? 103.473 -2.106  8.838   1.00 0.00 ? 23  GLU A H    5  
ATOM 9581  H HA   . GLU A 1 23  ? 104.822 -4.546  8.587   1.00 0.00 ? 23  GLU A HA   5  
ATOM 9582  H HB2  . GLU A 1 23  ? 102.207 -3.700  7.306   1.00 0.00 ? 23  GLU A HB2  5  
ATOM 9583  H HB3  . GLU A 1 23  ? 102.806 -5.350  7.365   1.00 0.00 ? 23  GLU A HB3  5  
ATOM 9584  H HG2  . GLU A 1 23  ? 102.793 -5.061  9.915   1.00 0.00 ? 23  GLU A HG2  5  
ATOM 9585  H HG3  . GLU A 1 23  ? 101.793 -3.639  9.612   1.00 0.00 ? 23  GLU A HG3  5  
ATOM 9586  N N    . GLY A 1 24  ? 104.539 -2.763  5.852   1.00 0.00 ? 24  GLY A N    5  
ATOM 9587  C CA   . GLY A 1 24  ? 105.074 -2.579  4.519   1.00 0.00 ? 24  GLY A CA   5  
ATOM 9588  C C    . GLY A 1 24  ? 106.585 -2.577  4.506   1.00 0.00 ? 24  GLY A C    5  
ATOM 9589  O O    . GLY A 1 24  ? 107.202 -3.457  3.916   1.00 0.00 ? 24  GLY A O    5  
ATOM 9590  H H    . GLY A 1 24  ? 103.938 -2.086  6.232   1.00 0.00 ? 24  GLY A H    5  
ATOM 9591  H HA2  . GLY A 1 24  ? 104.715 -3.377  3.884   1.00 0.00 ? 24  GLY A HA2  5  
ATOM 9592  H HA3  . GLY A 1 24  ? 104.719 -1.637  4.128   1.00 0.00 ? 24  GLY A HA3  5  
ATOM 9593  N N    . VAL A 1 25  ? 107.178 -1.601  5.186   1.00 0.00 ? 25  VAL A N    5  
ATOM 9594  C CA   . VAL A 1 25  ? 108.629 -1.448  5.218   1.00 0.00 ? 25  VAL A CA   5  
ATOM 9595  C C    . VAL A 1 25  ? 109.328 -2.713  5.721   1.00 0.00 ? 25  VAL A C    5  
ATOM 9596  O O    . VAL A 1 25  ? 110.368 -3.108  5.191   1.00 0.00 ? 25  VAL A O    5  
ATOM 9597  C CB   . VAL A 1 25  ? 109.056 -0.251  6.102   1.00 0.00 ? 25  VAL A CB   5  
ATOM 9598  C CG1  . VAL A 1 25  ? 110.574 -0.083  6.090   1.00 0.00 ? 25  VAL A CG1  5  
ATOM 9599  C CG2  . VAL A 1 25  ? 108.370 1.032   5.645   1.00 0.00 ? 25  VAL A CG2  5  
ATOM 9600  H H    . VAL A 1 25  ? 106.621 -0.957  5.674   1.00 0.00 ? 25  VAL A H    5  
ATOM 9601  H HA   . VAL A 1 25  ? 108.962 -1.250  4.213   1.00 0.00 ? 25  VAL A HA   5  
ATOM 9602  H HB   . VAL A 1 25  ? 108.747 -0.454  7.119   1.00 0.00 ? 25  VAL A HB   5  
ATOM 9603  H HG11 . VAL A 1 25  ? 110.848 0.770   6.695   1.00 0.00 ? 25  VAL A HG11 5  
ATOM 9604  H HG12 . VAL A 1 25  ? 110.914 0.072   5.075   1.00 0.00 ? 25  VAL A HG12 5  
ATOM 9605  H HG13 . VAL A 1 25  ? 111.039 -0.972  6.492   1.00 0.00 ? 25  VAL A HG13 5  
ATOM 9606  H HG21 . VAL A 1 25  ? 107.298 0.911   5.707   1.00 0.00 ? 25  VAL A HG21 5  
ATOM 9607  H HG22 . VAL A 1 25  ? 108.648 1.247   4.622   1.00 0.00 ? 25  VAL A HG22 5  
ATOM 9608  H HG23 . VAL A 1 25  ? 108.675 1.852   6.280   1.00 0.00 ? 25  VAL A HG23 5  
ATOM 9609  N N    . LYS A 1 26  ? 108.754 -3.357  6.735   1.00 0.00 ? 26  LYS A N    5  
ATOM 9610  C CA   . LYS A 1 26  ? 109.435 -4.470  7.400   1.00 0.00 ? 26  LYS A CA   5  
ATOM 9611  C C    . LYS A 1 26  ? 109.267 -5.785  6.638   1.00 0.00 ? 26  LYS A C    5  
ATOM 9612  O O    . LYS A 1 26  ? 110.174 -6.621  6.639   1.00 0.00 ? 26  LYS A O    5  
ATOM 9613  C CB   . LYS A 1 26  ? 108.983 -4.589  8.867   1.00 0.00 ? 26  LYS A CB   5  
ATOM 9614  C CG   . LYS A 1 26  ? 109.618 -3.527  9.774   1.00 0.00 ? 26  LYS A CG   5  
ATOM 9615  C CD   . LYS A 1 26  ? 109.277 -2.106  9.318   1.00 0.00 ? 26  LYS A CD   5  
ATOM 9616  C CE   . LYS A 1 26  ? 110.255 -1.065  9.842   1.00 0.00 ? 26  LYS A CE   5  
ATOM 9617  N NZ   . LYS A 1 26  ? 110.202 -0.925  11.322  1.00 0.00 ? 26  LYS A NZ   5  
ATOM 9618  H H    . LYS A 1 26  ? 107.854 -3.080  7.043   1.00 0.00 ? 26  LYS A H    5  
ATOM 9619  H HA   . LYS A 1 26  ? 110.492 -4.232  7.398   1.00 0.00 ? 26  LYS A HA   5  
ATOM 9620  H HB2  . LYS A 1 26  ? 107.908 -4.483  8.915   1.00 0.00 ? 26  LYS A HB2  5  
ATOM 9621  H HB3  . LYS A 1 26  ? 109.259 -5.564  9.244   1.00 0.00 ? 26  LYS A HB3  5  
ATOM 9622  H HG2  . LYS A 1 26  ? 109.257 -3.666  10.784  1.00 0.00 ? 26  LYS A HG2  5  
ATOM 9623  H HG3  . LYS A 1 26  ? 110.693 -3.654  9.758   1.00 0.00 ? 26  LYS A HG3  5  
ATOM 9624  H HD2  . LYS A 1 26  ? 109.291 -2.073  8.239   1.00 0.00 ? 26  LYS A HD2  5  
ATOM 9625  H HD3  . LYS A 1 26  ? 108.284 -1.859  9.668   1.00 0.00 ? 26  LYS A HD3  5  
ATOM 9626  H HE2  . LYS A 1 26  ? 111.254 -1.355  9.552   1.00 0.00 ? 26  LYS A HE2  5  
ATOM 9627  H HE3  . LYS A 1 26  ? 110.015 -0.113  9.387   1.00 0.00 ? 26  LYS A HE3  5  
ATOM 9628  H HZ1  . LYS A 1 26  ? 110.424 -1.832  11.778  1.00 0.00 ? 26  LYS A HZ1  5  
ATOM 9629  H HZ2  . LYS A 1 26  ? 109.253 -0.622  11.622  1.00 0.00 ? 26  LYS A HZ2  5  
ATOM 9630  H HZ3  . LYS A 1 26  ? 110.892 -0.215  11.637  1.00 0.00 ? 26  LYS A HZ3  5  
ATOM 9631  N N    . ARG A 1 27  ? 108.134 -5.962  5.965   1.00 0.00 ? 27  ARG A N    5  
ATOM 9632  C CA   . ARG A 1 27  ? 107.948 -7.131  5.105   1.00 0.00 ? 27  ARG A CA   5  
ATOM 9633  C C    . ARG A 1 27  ? 108.692 -6.923  3.789   1.00 0.00 ? 27  ARG A C    5  
ATOM 9634  O O    . ARG A 1 27  ? 109.187 -7.868  3.178   1.00 0.00 ? 27  ARG A O    5  
ATOM 9635  C CB   . ARG A 1 27  ? 106.460 -7.418  4.865   1.00 0.00 ? 27  ARG A CB   5  
ATOM 9636  C CG   . ARG A 1 27  ? 105.741 -7.870  6.132   1.00 0.00 ? 27  ARG A CG   5  
ATOM 9637  C CD   . ARG A 1 27  ? 104.287 -8.249  5.884   1.00 0.00 ? 27  ARG A CD   5  
ATOM 9638  N NE   . ARG A 1 27  ? 103.647 -8.706  7.123   1.00 0.00 ? 27  ARG A NE   5  
ATOM 9639  C CZ   . ARG A 1 27  ? 102.536 -8.175  7.636   1.00 0.00 ? 27  ARG A CZ   5  
ATOM 9640  N NH1  . ARG A 1 27  ? 101.862 -7.255  6.953   1.00 0.00 ? 27  ARG A NH1  5  
ATOM 9641  N NH2  . ARG A 1 27  ? 102.089 -8.573  8.822   1.00 0.00 ? 27  ARG A NH2  5  
ATOM 9642  H H    . ARG A 1 27  ? 107.414 -5.300  6.043   1.00 0.00 ? 27  ARG A H    5  
ATOM 9643  H HA   . ARG A 1 27  ? 108.386 -7.979  5.614   1.00 0.00 ? 27  ARG A HA   5  
ATOM 9644  H HB2  . ARG A 1 27  ? 105.982 -6.519  4.499   1.00 0.00 ? 27  ARG A HB2  5  
ATOM 9645  H HB3  . ARG A 1 27  ? 106.365 -8.198  4.122   1.00 0.00 ? 27  ARG A HB3  5  
ATOM 9646  H HG2  . ARG A 1 27  ? 106.257 -8.729  6.536   1.00 0.00 ? 27  ARG A HG2  5  
ATOM 9647  H HG3  . ARG A 1 27  ? 105.773 -7.064  6.853   1.00 0.00 ? 27  ARG A HG3  5  
ATOM 9648  H HD2  . ARG A 1 27  ? 103.757 -7.385  5.505   1.00 0.00 ? 27  ARG A HD2  5  
ATOM 9649  H HD3  . ARG A 1 27  ? 104.250 -9.045  5.153   1.00 0.00 ? 27  ARG A HD3  5  
ATOM 9650  H HE   . ARG A 1 27  ? 104.105 -9.427  7.618   1.00 0.00 ? 27  ARG A HE   5  
ATOM 9651  H HH11 . ARG A 1 27  ? 102.184 -6.963  6.053   1.00 0.00 ? 27  ARG A HH11 5  
ATOM 9652  H HH12 . ARG A 1 27  ? 101.032 -6.839  7.345   1.00 0.00 ? 27  ARG A HH12 5  
ATOM 9653  H HH21 . ARG A 1 27  ? 102.579 -9.282  9.334   1.00 0.00 ? 27  ARG A HH21 5  
ATOM 9654  H HH22 . ARG A 1 27  ? 101.273 -8.143  9.225   1.00 0.00 ? 27  ARG A HH22 5  
ATOM 9655  N N    . PHE A 1 28  ? 108.793 -5.664  3.388   1.00 0.00 ? 28  PHE A N    5  
ATOM 9656  C CA   . PHE A 1 28  ? 109.596 -5.265  2.238   1.00 0.00 ? 28  PHE A CA   5  
ATOM 9657  C C    . PHE A 1 28  ? 111.070 -5.528  2.544   1.00 0.00 ? 28  PHE A C    5  
ATOM 9658  O O    . PHE A 1 28  ? 111.857 -5.884  1.664   1.00 0.00 ? 28  PHE A O    5  
ATOM 9659  C CB   . PHE A 1 28  ? 109.342 -3.778  1.953   1.00 0.00 ? 28  PHE A CB   5  
ATOM 9660  C CG   . PHE A 1 28  ? 110.033 -3.214  0.739   1.00 0.00 ? 28  PHE A CG   5  
ATOM 9661  C CD1  . PHE A 1 28  ? 109.809 -3.745  -0.522  1.00 0.00 ? 28  PHE A CD1  5  
ATOM 9662  C CD2  . PHE A 1 28  ? 110.878 -2.121  0.859   1.00 0.00 ? 28  PHE A CD2  5  
ATOM 9663  C CE1  . PHE A 1 28  ? 110.416 -3.200  -1.637  1.00 0.00 ? 28  PHE A CE1  5  
ATOM 9664  C CE2  . PHE A 1 28  ? 111.492 -1.575  -0.249  1.00 0.00 ? 28  PHE A CE2  5  
ATOM 9665  C CZ   . PHE A 1 28  ? 111.260 -2.113  -1.500  1.00 0.00 ? 28  PHE A CZ   5  
ATOM 9666  H H    . PHE A 1 28  ? 108.306 -4.975  3.882   1.00 0.00 ? 28  PHE A H    5  
ATOM 9667  H HA   . PHE A 1 28  ? 109.293 -5.856  1.385   1.00 0.00 ? 28  PHE A HA   5  
ATOM 9668  H HB2  . PHE A 1 28  ? 108.281 -3.630  1.815   1.00 0.00 ? 28  PHE A HB2  5  
ATOM 9669  H HB3  . PHE A 1 28  ? 109.660 -3.203  2.814   1.00 0.00 ? 28  PHE A HB3  5  
ATOM 9670  H HD1  . PHE A 1 28  ? 109.153 -4.597  -0.630  1.00 0.00 ? 28  PHE A HD1  5  
ATOM 9671  H HD2  . PHE A 1 28  ? 111.061 -1.699  1.837   1.00 0.00 ? 28  PHE A HD2  5  
ATOM 9672  H HE1  . PHE A 1 28  ? 110.235 -3.623  -2.615  1.00 0.00 ? 28  PHE A HE1  5  
ATOM 9673  H HE2  . PHE A 1 28  ? 112.149 -0.725  -0.136  1.00 0.00 ? 28  PHE A HE2  5  
ATOM 9674  H HZ   . PHE A 1 28  ? 111.736 -1.684  -2.370  1.00 0.00 ? 28  PHE A HZ   5  
ATOM 9675  N N    . ARG A 1 29  ? 111.420 -5.363  3.819   1.00 0.00 ? 29  ARG A N    5  
ATOM 9676  C CA   . ARG A 1 29  ? 112.762 -5.641  4.304   1.00 0.00 ? 29  ARG A CA   5  
ATOM 9677  C C    . ARG A 1 29  ? 113.074 -7.134  4.219   1.00 0.00 ? 29  ARG A C    5  
ATOM 9678  O O    . ARG A 1 29  ? 114.091 -7.522  3.649   1.00 0.00 ? 29  ARG A O    5  
ATOM 9679  C CB   . ARG A 1 29  ? 112.902 -5.164  5.752   1.00 0.00 ? 29  ARG A CB   5  
ATOM 9680  C CG   . ARG A 1 29  ? 114.277 -5.412  6.361   1.00 0.00 ? 29  ARG A CG   5  
ATOM 9681  C CD   . ARG A 1 29  ? 114.288 -5.076  7.845   1.00 0.00 ? 29  ARG A CD   5  
ATOM 9682  N NE   . ARG A 1 29  ? 113.446 -6.001  8.616   1.00 0.00 ? 29  ARG A NE   5  
ATOM 9683  C CZ   . ARG A 1 29  ? 112.827 -5.690  9.759   1.00 0.00 ? 29  ARG A CZ   5  
ATOM 9684  N NH1  . ARG A 1 29  ? 112.982 -4.489  10.306  1.00 0.00 ? 29  ARG A NH1  5  
ATOM 9685  N NH2  . ARG A 1 29  ? 112.060 -6.591  10.358  1.00 0.00 ? 29  ARG A NH2  5  
ATOM 9686  H H    . ARG A 1 29  ? 110.751 -5.032  4.455   1.00 0.00 ? 29  ARG A H    5  
ATOM 9687  H HA   . ARG A 1 29  ? 113.462 -5.099  3.684   1.00 0.00 ? 29  ARG A HA   5  
ATOM 9688  H HB2  . ARG A 1 29  ? 112.704 -4.101  5.786   1.00 0.00 ? 29  ARG A HB2  5  
ATOM 9689  H HB3  . ARG A 1 29  ? 112.166 -5.674  6.358   1.00 0.00 ? 29  ARG A HB3  5  
ATOM 9690  H HG2  . ARG A 1 29  ? 114.535 -6.455  6.235   1.00 0.00 ? 29  ARG A HG2  5  
ATOM 9691  H HG3  . ARG A 1 29  ? 115.006 -4.797  5.850   1.00 0.00 ? 29  ARG A HG3  5  
ATOM 9692  H HD2  . ARG A 1 29  ? 115.304 -5.132  8.208   1.00 0.00 ? 29  ARG A HD2  5  
ATOM 9693  H HD3  . ARG A 1 29  ? 113.915 -4.070  7.973   1.00 0.00 ? 29  ARG A HD3  5  
ATOM 9694  H HE   . ARG A 1 29  ? 113.329 -6.910  8.253   1.00 0.00 ? 29  ARG A HE   5  
ATOM 9695  H HH11 . ARG A 1 29  ? 113.572 -3.803  9.868   1.00 0.00 ? 29  ARG A HH11 5  
ATOM 9696  H HH12 . ARG A 1 29  ? 112.511 -4.259  11.162  1.00 0.00 ? 29  ARG A HH12 5  
ATOM 9697  H HH21 . ARG A 1 29  ? 111.944 -7.506  9.954   1.00 0.00 ? 29  ARG A HH21 5  
ATOM 9698  H HH22 . ARG A 1 29  ? 111.592 -6.367  11.218  1.00 0.00 ? 29  ARG A HH22 5  
ATOM 9699  N N    . GLU A 1 30  ? 112.196 -7.969  4.787   1.00 0.00 ? 30  GLU A N    5  
ATOM 9700  C CA   . GLU A 1 30  ? 112.424 -9.418  4.804   1.00 0.00 ? 30  GLU A CA   5  
ATOM 9701  C C    . GLU A 1 30  ? 112.418 -9.963  3.378   1.00 0.00 ? 30  GLU A C    5  
ATOM 9702  O O    . GLU A 1 30  ? 113.204 -10.855 3.038   1.00 0.00 ? 30  GLU A O    5  
ATOM 9703  C CB   . GLU A 1 30  ? 111.379 -10.145 5.672   1.00 0.00 ? 30  GLU A CB   5  
ATOM 9704  C CG   . GLU A 1 30  ? 109.954 -10.069 5.137   1.00 0.00 ? 30  GLU A CG   5  
ATOM 9705  C CD   . GLU A 1 30  ? 108.931 -10.726 6.054   1.00 0.00 ? 30  GLU A CD   5  
ATOM 9706  O OE1  . GLU A 1 30  ? 108.607 -10.139 7.111   1.00 0.00 ? 30  GLU A OE1  5  
ATOM 9707  O OE2  . GLU A 1 30  ? 108.453 -11.834 5.725   1.00 0.00 ? 30  GLU A OE2  5  
ATOM 9708  H H    . GLU A 1 30  ? 111.375 -7.605  5.192   1.00 0.00 ? 30  GLU A H    5  
ATOM 9709  H HA   . GLU A 1 30  ? 113.406 -9.585  5.229   1.00 0.00 ? 30  GLU A HA   5  
ATOM 9710  H HB2  . GLU A 1 30  ? 111.655 -11.187 5.747   1.00 0.00 ? 30  GLU A HB2  5  
ATOM 9711  H HB3  . GLU A 1 30  ? 111.392 -9.711  6.663   1.00 0.00 ? 30  GLU A HB3  5  
ATOM 9712  H HG2  . GLU A 1 30  ? 109.690 -9.030  5.014   1.00 0.00 ? 30  GLU A HG2  5  
ATOM 9713  H HG3  . GLU A 1 30  ? 109.921 -10.558 4.172   1.00 0.00 ? 30  GLU A HG3  5  
ATOM 9714  N N    . PHE A 1 31  ? 111.542 -9.402  2.545   1.00 0.00 ? 31  PHE A N    5  
ATOM 9715  C CA   . PHE A 1 31  ? 111.490 -9.746  1.132   1.00 0.00 ? 31  PHE A CA   5  
ATOM 9716  C C    . PHE A 1 31  ? 112.845 -9.494  0.489   1.00 0.00 ? 31  PHE A C    5  
ATOM 9717  O O    . PHE A 1 31  ? 113.523 -10.424 0.053   1.00 0.00 ? 31  PHE A O    5  
ATOM 9718  C CB   . PHE A 1 31  ? 110.409 -8.924  0.410   1.00 0.00 ? 31  PHE A CB   5  
ATOM 9719  C CG   . PHE A 1 31  ? 110.352 -9.183  -1.074  1.00 0.00 ? 31  PHE A CG   5  
ATOM 9720  C CD1  . PHE A 1 31  ? 109.859 -10.385 -1.564  1.00 0.00 ? 31  PHE A CD1  5  
ATOM 9721  C CD2  . PHE A 1 31  ? 110.803 -8.232  -1.979  1.00 0.00 ? 31  PHE A CD2  5  
ATOM 9722  C CE1  . PHE A 1 31  ? 109.819 -10.631 -2.921  1.00 0.00 ? 31  PHE A CE1  5  
ATOM 9723  C CE2  . PHE A 1 31  ? 110.762 -8.474  -3.337  1.00 0.00 ? 31  PHE A CE2  5  
ATOM 9724  C CZ   . PHE A 1 31  ? 110.270 -9.675  -3.808  1.00 0.00 ? 31  PHE A CZ   5  
ATOM 9725  H H    . PHE A 1 31  ? 110.904 -8.742  2.897   1.00 0.00 ? 31  PHE A H    5  
ATOM 9726  H HA   . PHE A 1 31  ? 111.250 -10.798 1.051   1.00 0.00 ? 31  PHE A HA   5  
ATOM 9727  H HB2  . PHE A 1 31  ? 109.442 -9.165  0.828   1.00 0.00 ? 31  PHE A HB2  5  
ATOM 9728  H HB3  . PHE A 1 31  ? 110.606 -7.871  0.561   1.00 0.00 ? 31  PHE A HB3  5  
ATOM 9729  H HD1  . PHE A 1 31  ? 109.504 -11.134 -0.871  1.00 0.00 ? 31  PHE A HD1  5  
ATOM 9730  H HD2  . PHE A 1 31  ? 111.189 -7.291  -1.612  1.00 0.00 ? 31  PHE A HD2  5  
ATOM 9731  H HE1  . PHE A 1 31  ? 109.434 -11.570 -3.288  1.00 0.00 ? 31  PHE A HE1  5  
ATOM 9732  H HE2  . PHE A 1 31  ? 111.116 -7.725  -4.031  1.00 0.00 ? 31  PHE A HE2  5  
ATOM 9733  H HZ   . PHE A 1 31  ? 110.239 -9.866  -4.871  1.00 0.00 ? 31  PHE A HZ   5  
ATOM 9734  N N    . LEU A 1 32  ? 113.246 -8.229  0.468   1.00 0.00 ? 32  LEU A N    5  
ATOM 9735  C CA   . LEU A 1 32  ? 114.502 -7.833  -0.151  1.00 0.00 ? 32  LEU A CA   5  
ATOM 9736  C C    . LEU A 1 32  ? 115.698 -8.487  0.543   1.00 0.00 ? 32  LEU A C    5  
ATOM 9737  O O    . LEU A 1 32  ? 116.745 -8.662  -0.067  1.00 0.00 ? 32  LEU A O    5  
ATOM 9738  C CB   . LEU A 1 32  ? 114.650 -6.304  -0.151  1.00 0.00 ? 32  LEU A CB   5  
ATOM 9739  C CG   . LEU A 1 32  ? 113.701 -5.539  -1.091  1.00 0.00 ? 32  LEU A CG   5  
ATOM 9740  C CD1  . LEU A 1 32  ? 114.089 -4.064  -1.156  1.00 0.00 ? 32  LEU A CD1  5  
ATOM 9741  C CD2  . LEU A 1 32  ? 113.692 -6.160  -2.488  1.00 0.00 ? 32  LEU A CD2  5  
ATOM 9742  H H    . LEU A 1 32  ? 112.679 -7.541  0.882   1.00 0.00 ? 32  LEU A H    5  
ATOM 9743  H HA   . LEU A 1 32  ? 114.477 -8.177  -1.176  1.00 0.00 ? 32  LEU A HA   5  
ATOM 9744  H HB2  . LEU A 1 32  ? 114.477 -5.950  0.855   1.00 0.00 ? 32  LEU A HB2  5  
ATOM 9745  H HB3  . LEU A 1 32  ? 115.664 -6.061  -0.430  1.00 0.00 ? 32  LEU A HB3  5  
ATOM 9746  H HG   . LEU A 1 32  ? 112.697 -5.593  -0.698  1.00 0.00 ? 32  LEU A HG   5  
ATOM 9747  H HD11 . LEU A 1 32  ? 114.030 -3.633  -0.168  1.00 0.00 ? 32  LEU A HD11 5  
ATOM 9748  H HD12 . LEU A 1 32  ? 113.411 -3.541  -1.816  1.00 0.00 ? 32  LEU A HD12 5  
ATOM 9749  H HD13 . LEU A 1 32  ? 115.099 -3.970  -1.531  1.00 0.00 ? 32  LEU A HD13 5  
ATOM 9750  H HD21 . LEU A 1 32  ? 113.369 -7.189  -2.423  1.00 0.00 ? 32  LEU A HD21 5  
ATOM 9751  H HD22 . LEU A 1 32  ? 114.686 -6.122  -2.910  1.00 0.00 ? 32  LEU A HD22 5  
ATOM 9752  H HD23 . LEU A 1 32  ? 113.011 -5.610  -3.122  1.00 0.00 ? 32  LEU A HD23 5  
ATOM 9753  N N    . LYS A 1 33  ? 115.540 -8.861  1.810   1.00 0.00 ? 33  LYS A N    5  
ATOM 9754  C CA   . LYS A 1 33  ? 116.621 -9.503  2.555   1.00 0.00 ? 33  LYS A CA   5  
ATOM 9755  C C    . LYS A 1 33  ? 117.013 -10.824 1.897   1.00 0.00 ? 33  LYS A C    5  
ATOM 9756  O O    . LYS A 1 33  ? 118.192 -11.086 1.663   1.00 0.00 ? 33  LYS A O    5  
ATOM 9757  C CB   . LYS A 1 33  ? 116.212 -9.728  4.019   1.00 0.00 ? 33  LYS A CB   5  
ATOM 9758  C CG   . LYS A 1 33  ? 117.287 -10.406 4.868   1.00 0.00 ? 33  LYS A CG   5  
ATOM 9759  C CD   . LYS A 1 33  ? 116.859 -10.535 6.329   1.00 0.00 ? 33  LYS A CD   5  
ATOM 9760  C CE   . LYS A 1 33  ? 116.772 -9.178  7.025   1.00 0.00 ? 33  LYS A CE   5  
ATOM 9761  N NZ   . LYS A 1 33  ? 118.100 -8.512  7.123   1.00 0.00 ? 33  LYS A NZ   5  
ATOM 9762  H H    . LYS A 1 33  ? 114.679 -8.704  2.253   1.00 0.00 ? 33  LYS A H    5  
ATOM 9763  H HA   . LYS A 1 33  ? 117.473 -8.840  2.529   1.00 0.00 ? 33  LYS A HA   5  
ATOM 9764  H HB2  . LYS A 1 33  ? 115.983 -8.770  4.465   1.00 0.00 ? 33  LYS A HB2  5  
ATOM 9765  H HB3  . LYS A 1 33  ? 115.324 -10.344 4.042   1.00 0.00 ? 33  LYS A HB3  5  
ATOM 9766  H HG2  . LYS A 1 33  ? 117.475 -11.394 4.471   1.00 0.00 ? 33  LYS A HG2  5  
ATOM 9767  H HG3  . LYS A 1 33  ? 118.194 -9.820  4.817   1.00 0.00 ? 33  LYS A HG3  5  
ATOM 9768  H HD2  . LYS A 1 33  ? 115.889 -11.008 6.367   1.00 0.00 ? 33  LYS A HD2  5  
ATOM 9769  H HD3  . LYS A 1 33  ? 117.580 -11.151 6.850   1.00 0.00 ? 33  LYS A HD3  5  
ATOM 9770  H HE2  . LYS A 1 33  ? 116.102 -8.541  6.467   1.00 0.00 ? 33  LYS A HE2  5  
ATOM 9771  H HE3  . LYS A 1 33  ? 116.380 -9.323  8.022   1.00 0.00 ? 33  LYS A HE3  5  
ATOM 9772  H HZ1  . LYS A 1 33  ? 118.005 -7.587  7.588   1.00 0.00 ? 33  LYS A HZ1  5  
ATOM 9773  H HZ2  . LYS A 1 33  ? 118.505 -8.370  6.176   1.00 0.00 ? 33  LYS A HZ2  5  
ATOM 9774  H HZ3  . LYS A 1 33  ? 118.755 -9.098  7.676   1.00 0.00 ? 33  LYS A HZ3  5  
ATOM 9775  N N    . LYS A 1 34  ? 116.016 -11.639 1.579   1.00 0.00 ? 34  LYS A N    5  
ATOM 9776  C CA   . LYS A 1 34  ? 116.258 -12.939 0.951   1.00 0.00 ? 34  LYS A CA   5  
ATOM 9777  C C    . LYS A 1 34  ? 116.339 -12.802 -0.566  1.00 0.00 ? 34  LYS A C    5  
ATOM 9778  O O    . LYS A 1 34  ? 116.943 -13.626 -1.256  1.00 0.00 ? 34  LYS A O    5  
ATOM 9779  C CB   . LYS A 1 34  ? 115.151 -13.919 1.336   1.00 0.00 ? 34  LYS A CB   5  
ATOM 9780  C CG   . LYS A 1 34  ? 113.760 -13.542 0.830   1.00 0.00 ? 34  LYS A CG   5  
ATOM 9781  C CD   . LYS A 1 34  ? 112.701 -14.525 1.326   1.00 0.00 ? 34  LYS A CD   5  
ATOM 9782  C CE   . LYS A 1 34  ? 113.062 -15.967 0.978   1.00 0.00 ? 34  LYS A CE   5  
ATOM 9783  N NZ   . LYS A 1 34  ? 112.032 -16.929 1.452   1.00 0.00 ? 34  LYS A NZ   5  
ATOM 9784  H H    . LYS A 1 34  ? 115.092 -11.362 1.773   1.00 0.00 ? 34  LYS A H    5  
ATOM 9785  H HA   . LYS A 1 34  ? 117.204 -13.317 1.317   1.00 0.00 ? 34  LYS A HA   5  
ATOM 9786  H HB2  . LYS A 1 34  ? 115.400 -14.888 0.941   1.00 0.00 ? 34  LYS A HB2  5  
ATOM 9787  H HB3  . LYS A 1 34  ? 115.111 -13.977 2.411   1.00 0.00 ? 34  LYS A HB3  5  
ATOM 9788  H HG2  . LYS A 1 34  ? 113.513 -12.551 1.186   1.00 0.00 ? 34  LYS A HG2  5  
ATOM 9789  H HG3  . LYS A 1 34  ? 113.767 -13.546 -0.251  1.00 0.00 ? 34  LYS A HG3  5  
ATOM 9790  H HD2  . LYS A 1 34  ? 112.614 -14.435 2.399   1.00 0.00 ? 34  LYS A HD2  5  
ATOM 9791  H HD3  . LYS A 1 34  ? 111.753 -14.279 0.866   1.00 0.00 ? 34  LYS A HD3  5  
ATOM 9792  H HE2  . LYS A 1 34  ? 113.152 -16.055 -0.094  1.00 0.00 ? 34  LYS A HE2  5  
ATOM 9793  H HE3  . LYS A 1 34  ? 114.008 -16.212 1.439   1.00 0.00 ? 34  LYS A HE3  5  
ATOM 9794  H HZ1  . LYS A 1 34  ? 112.320 -17.902 1.224   1.00 0.00 ? 34  LYS A HZ1  5  
ATOM 9795  H HZ2  . LYS A 1 34  ? 111.123 -16.735 0.989   1.00 0.00 ? 34  LYS A HZ2  5  
ATOM 9796  H HZ3  . LYS A 1 34  ? 111.911 -16.848 2.484   1.00 0.00 ? 34  LYS A HZ3  5  
ATOM 9797  N N    . GLU A 1 35  ? 115.708 -11.755 -1.067  1.00 0.00 ? 35  GLU A N    5  
ATOM 9798  C CA   . GLU A 1 35  ? 115.724 -11.424 -2.496  1.00 0.00 ? 35  GLU A CA   5  
ATOM 9799  C C    . GLU A 1 35  ? 117.011 -10.652 -2.854  1.00 0.00 ? 35  GLU A C    5  
ATOM 9800  O O    . GLU A 1 35  ? 117.179 -10.182 -3.984  1.00 0.00 ? 35  GLU A O    5  
ATOM 9801  C CB   . GLU A 1 35  ? 114.475 -10.590 -2.837  1.00 0.00 ? 35  GLU A CB   5  
ATOM 9802  C CG   . GLU A 1 35  ? 114.072 -10.619 -4.307  1.00 0.00 ? 35  GLU A CG   5  
ATOM 9803  C CD   . GLU A 1 35  ? 113.680 -12.009 -4.785  1.00 0.00 ? 35  GLU A CD   5  
ATOM 9804  O OE1  . GLU A 1 35  ? 112.602 -12.499 -4.388  1.00 0.00 ? 35  GLU A OE1  5  
ATOM 9805  O OE2  . GLU A 1 35  ? 114.448 -12.618 -5.560  1.00 0.00 ? 35  GLU A OE2  5  
ATOM 9806  H H    . GLU A 1 35  ? 115.186 -11.199 -0.455  1.00 0.00 ? 35  GLU A H    5  
ATOM 9807  H HA   . GLU A 1 35  ? 115.700 -12.349 -3.057  1.00 0.00 ? 35  GLU A HA   5  
ATOM 9808  H HB2  . GLU A 1 35  ? 113.642 -10.961 -2.257  1.00 0.00 ? 35  GLU A HB2  5  
ATOM 9809  H HB3  . GLU A 1 35  ? 114.658 -9.561  -2.559  1.00 0.00 ? 35  GLU A HB3  5  
ATOM 9810  H HG2  . GLU A 1 35  ? 113.231 -9.956  -4.450  1.00 0.00 ? 35  GLU A HG2  5  
ATOM 9811  H HG3  . GLU A 1 35  ? 114.906 -10.268 -4.900  1.00 0.00 ? 35  GLU A HG3  5  
ATOM 9812  N N    . PHE A 1 36  ? 117.903 -10.538 -1.864  1.00 0.00 ? 36  PHE A N    5  
ATOM 9813  C CA   . PHE A 1 36  ? 119.191 -9.845  -1.989  1.00 0.00 ? 36  PHE A CA   5  
ATOM 9814  C C    . PHE A 1 36  ? 119.024 -8.419  -2.509  1.00 0.00 ? 36  PHE A C    5  
ATOM 9815  O O    . PHE A 1 36  ? 119.287 -8.120  -3.679  1.00 0.00 ? 36  PHE A O    5  
ATOM 9816  C CB   . PHE A 1 36  ? 120.179 -10.630 -2.855  1.00 0.00 ? 36  PHE A CB   5  
ATOM 9817  C CG   . PHE A 1 36  ? 121.583 -10.067 -2.812  1.00 0.00 ? 36  PHE A CG   5  
ATOM 9818  C CD1  . PHE A 1 36  ? 122.415 -10.334 -1.732  1.00 0.00 ? 36  PHE A CD1  5  
ATOM 9819  C CD2  . PHE A 1 36  ? 122.065 -9.262  -3.836  1.00 0.00 ? 36  PHE A CD2  5  
ATOM 9820  C CE1  . PHE A 1 36  ? 123.692 -9.813  -1.676  1.00 0.00 ? 36  PHE A CE1  5  
ATOM 9821  C CE2  . PHE A 1 36  ? 123.344 -8.740  -3.783  1.00 0.00 ? 36  PHE A CE2  5  
ATOM 9822  C CZ   . PHE A 1 36  ? 124.158 -9.015  -2.702  1.00 0.00 ? 36  PHE A CZ   5  
ATOM 9823  H H    . PHE A 1 36  ? 117.682 -10.936 -0.999  1.00 0.00 ? 36  PHE A H    5  
ATOM 9824  H HA   . PHE A 1 36  ? 119.601 -9.781  -0.989  1.00 0.00 ? 36  PHE A HA   5  
ATOM 9825  H HB2  . PHE A 1 36  ? 120.214 -11.646 -2.502  1.00 0.00 ? 36  PHE A HB2  5  
ATOM 9826  H HB3  . PHE A 1 36  ? 119.840 -10.619 -3.882  1.00 0.00 ? 36  PHE A HB3  5  
ATOM 9827  H HD1  . PHE A 1 36  ? 122.054 -10.959 -0.927  1.00 0.00 ? 36  PHE A HD1  5  
ATOM 9828  H HD2  . PHE A 1 36  ? 121.430 -9.045  -4.683  1.00 0.00 ? 36  PHE A HD2  5  
ATOM 9829  H HE1  . PHE A 1 36  ? 124.328 -10.029 -0.829  1.00 0.00 ? 36  PHE A HE1  5  
ATOM 9830  H HE2  . PHE A 1 36  ? 123.706 -8.116  -4.588  1.00 0.00 ? 36  PHE A HE2  5  
ATOM 9831  H HZ   . PHE A 1 36  ? 125.157 -8.606  -2.660  1.00 0.00 ? 36  PHE A HZ   5  
ATOM 9832  N N    . SER A 1 37  ? 118.561 -7.568  -1.612  1.00 0.00 ? 37  SER A N    5  
ATOM 9833  C CA   . SER A 1 37  ? 118.384 -6.138  -1.849  1.00 0.00 ? 37  SER A CA   5  
ATOM 9834  C C    . SER A 1 37  ? 118.072 -5.441  -0.523  1.00 0.00 ? 37  SER A C    5  
ATOM 9835  O O    . SER A 1 37  ? 117.456 -4.372  -0.494  1.00 0.00 ? 37  SER A O    5  
ATOM 9836  C CB   . SER A 1 37  ? 117.254 -5.876  -2.861  1.00 0.00 ? 37  SER A CB   5  
ATOM 9837  O OG   . SER A 1 37  ? 117.582 -6.363  -4.152  1.00 0.00 ? 37  SER A OG   5  
ATOM 9838  H H    . SER A 1 37  ? 118.317 -7.926  -0.737  1.00 0.00 ? 37  SER A H    5  
ATOM 9839  H HA   . SER A 1 37  ? 119.313 -5.746  -2.239  1.00 0.00 ? 37  SER A HA   5  
ATOM 9840  H HB2  . SER A 1 37  ? 116.355 -6.372  -2.527  1.00 0.00 ? 37  SER A HB2  5  
ATOM 9841  H HB3  . SER A 1 37  ? 117.072 -4.812  -2.928  1.00 0.00 ? 37  SER A HB3  5  
ATOM 9842  H HG   . SER A 1 37  ? 118.543 -6.400  -4.243  1.00 0.00 ? 37  SER A HG   5  
ATOM 9843  N N    . GLU A 1 38  ? 118.513 -6.044  0.581   1.00 0.00 ? 38  GLU A N    5  
ATOM 9844  C CA   . GLU A 1 38  ? 118.265 -5.482  1.905   1.00 0.00 ? 38  GLU A CA   5  
ATOM 9845  C C    . GLU A 1 38  ? 119.073 -4.200  2.065   1.00 0.00 ? 38  GLU A C    5  
ATOM 9846  O O    . GLU A 1 38  ? 118.703 -3.299  2.819   1.00 0.00 ? 38  GLU A O    5  
ATOM 9847  C CB   . GLU A 1 38  ? 118.616 -6.495  3.003   1.00 0.00 ? 38  GLU A CB   5  
ATOM 9848  C CG   . GLU A 1 38  ? 120.074 -6.948  2.999   1.00 0.00 ? 38  GLU A CG   5  
ATOM 9849  C CD   . GLU A 1 38  ? 120.354 -8.048  4.012   1.00 0.00 ? 38  GLU A CD   5  
ATOM 9850  O OE1  . GLU A 1 38  ? 119.822 -7.972  5.139   1.00 0.00 ? 38  GLU A OE1  5  
ATOM 9851  O OE2  . GLU A 1 38  ? 121.101 -8.997  3.680   1.00 0.00 ? 38  GLU A OE2  5  
ATOM 9852  H H    . GLU A 1 38  ? 119.051 -6.861  0.499   1.00 0.00 ? 38  GLU A H    5  
ATOM 9853  H HA   . GLU A 1 38  ? 117.212 -5.239  1.970   1.00 0.00 ? 38  GLU A HA   5  
ATOM 9854  H HB2  . GLU A 1 38  ? 118.403 -6.052  3.966   1.00 0.00 ? 38  GLU A HB2  5  
ATOM 9855  H HB3  . GLU A 1 38  ? 117.992 -7.368  2.878   1.00 0.00 ? 38  GLU A HB3  5  
ATOM 9856  H HG2  . GLU A 1 38  ? 120.320 -7.315  2.012   1.00 0.00 ? 38  GLU A HG2  5  
ATOM 9857  H HG3  . GLU A 1 38  ? 120.702 -6.098  3.230   1.00 0.00 ? 38  GLU A HG3  5  
ATOM 9858  N N    . GLU A 1 39  ? 120.170 -4.136  1.318   1.00 0.00 ? 39  GLU A N    5  
ATOM 9859  C CA   . GLU A 1 39  ? 120.998 -2.939  1.235   1.00 0.00 ? 39  GLU A CA   5  
ATOM 9860  C C    . GLU A 1 39  ? 120.144 -1.784  0.718   1.00 0.00 ? 39  GLU A C    5  
ATOM 9861  O O    . GLU A 1 39  ? 120.239 -0.652  1.189   1.00 0.00 ? 39  GLU A O    5  
ATOM 9862  C CB   . GLU A 1 39  ? 122.197 -3.152  0.280   1.00 0.00 ? 39  GLU A CB   5  
ATOM 9863  C CG   . GLU A 1 39  ? 122.778 -4.571  0.259   1.00 0.00 ? 39  GLU A CG   5  
ATOM 9864  C CD   . GLU A 1 39  ? 121.964 -5.536  -0.601  1.00 0.00 ? 39  GLU A CD   5  
ATOM 9865  O OE1  . GLU A 1 39  ? 121.963 -5.377  -1.839  1.00 0.00 ? 39  GLU A OE1  5  
ATOM 9866  O OE2  . GLU A 1 39  ? 121.298 -6.432  -0.038  1.00 0.00 ? 39  GLU A OE2  5  
ATOM 9867  H H    . GLU A 1 39  ? 120.429 -4.928  0.809   1.00 0.00 ? 39  GLU A H    5  
ATOM 9868  H HA   . GLU A 1 39  ? 121.360 -2.704  2.226   1.00 0.00 ? 39  GLU A HA   5  
ATOM 9869  H HB2  . GLU A 1 39  ? 121.886 -2.910  -0.727  1.00 0.00 ? 39  GLU A HB2  5  
ATOM 9870  H HB3  . GLU A 1 39  ? 122.988 -2.471  0.567   1.00 0.00 ? 39  GLU A HB3  5  
ATOM 9871  H HG2  . GLU A 1 39  ? 123.784 -4.527  -0.134  1.00 0.00 ? 39  GLU A HG2  5  
ATOM 9872  H HG3  . GLU A 1 39  ? 122.809 -4.948  1.272   1.00 0.00 ? 39  GLU A HG3  5  
ATOM 9873  N N    . ASN A 1 40  ? 119.293 -2.118  -0.247  1.00 0.00 ? 40  ASN A N    5  
ATOM 9874  C CA   . ASN A 1 40  ? 118.422 -1.158  -0.916  1.00 0.00 ? 40  ASN A CA   5  
ATOM 9875  C C    . ASN A 1 40  ? 117.414 -0.551  0.061   1.00 0.00 ? 40  ASN A C    5  
ATOM 9876  O O    . ASN A 1 40  ? 117.396 0.664   0.274   1.00 0.00 ? 40  ASN A O    5  
ATOM 9877  C CB   . ASN A 1 40  ? 117.701 -1.864  -2.076  1.00 0.00 ? 40  ASN A CB   5  
ATOM 9878  C CG   . ASN A 1 40  ? 116.721 -0.979  -2.820  1.00 0.00 ? 40  ASN A CG   5  
ATOM 9879  O OD1  . ASN A 1 40  ? 116.888 0.232   -2.896  1.00 0.00 ? 40  ASN A OD1  5  
ATOM 9880  N ND2  . ASN A 1 40  ? 115.692 -1.589  -3.386  1.00 0.00 ? 40  ASN A ND2  5  
ATOM 9881  H H    . ASN A 1 40  ? 119.245 -3.058  -0.518  1.00 0.00 ? 40  ASN A H    5  
ATOM 9882  H HA   . ASN A 1 40  ? 119.042 -0.369  -1.318  1.00 0.00 ? 40  ASN A HA   5  
ATOM 9883  H HB2  . ASN A 1 40  ? 118.436 -2.214  -2.784  1.00 0.00 ? 40  ASN A HB2  5  
ATOM 9884  H HB3  . ASN A 1 40  ? 117.162 -2.716  -1.683  1.00 0.00 ? 40  ASN A HB3  5  
ATOM 9885  H HD21 . ASN A 1 40  ? 115.616 -2.564  -3.294  1.00 0.00 ? 40  ASN A HD21 5  
ATOM 9886  H HD22 . ASN A 1 40  ? 115.051 -1.047  -3.879  1.00 0.00 ? 40  ASN A HD22 5  
ATOM 9887  N N    . VAL A 1 41  ? 116.593 -1.407  0.674   1.00 0.00 ? 41  VAL A N    5  
ATOM 9888  C CA   . VAL A 1 41  ? 115.557 -0.941  1.602   1.00 0.00 ? 41  VAL A CA   5  
ATOM 9889  C C    . VAL A 1 41  ? 116.173 -0.177  2.780   1.00 0.00 ? 41  VAL A C    5  
ATOM 9890  O O    . VAL A 1 41  ? 115.659 0.867   3.195   1.00 0.00 ? 41  VAL A O    5  
ATOM 9891  C CB   . VAL A 1 41  ? 114.679 -2.112  2.131   1.00 0.00 ? 41  VAL A CB   5  
ATOM 9892  C CG1  . VAL A 1 41  ? 115.526 -3.184  2.813   1.00 0.00 ? 41  VAL A CG1  5  
ATOM 9893  C CG2  . VAL A 1 41  ? 113.594 -1.595  3.079   1.00 0.00 ? 41  VAL A CG2  5  
ATOM 9894  H H    . VAL A 1 41  ? 116.686 -2.369  0.496   1.00 0.00 ? 41  VAL A H    5  
ATOM 9895  H HA   . VAL A 1 41  ? 114.913 -0.263  1.053   1.00 0.00 ? 41  VAL A HA   5  
ATOM 9896  H HB   . VAL A 1 41  ? 114.187 -2.570  1.283   1.00 0.00 ? 41  VAL A HB   5  
ATOM 9897  H HG11 . VAL A 1 41  ? 114.887 -3.980  3.168   1.00 0.00 ? 41  VAL A HG11 5  
ATOM 9898  H HG12 . VAL A 1 41  ? 116.056 -2.749  3.650   1.00 0.00 ? 41  VAL A HG12 5  
ATOM 9899  H HG13 . VAL A 1 41  ? 116.239 -3.585  2.107   1.00 0.00 ? 41  VAL A HG13 5  
ATOM 9900  H HG21 . VAL A 1 41  ? 114.055 -1.124  3.935   1.00 0.00 ? 41  VAL A HG21 5  
ATOM 9901  H HG22 . VAL A 1 41  ? 112.980 -2.420  3.410   1.00 0.00 ? 41  VAL A HG22 5  
ATOM 9902  H HG23 . VAL A 1 41  ? 112.976 -0.874  2.562   1.00 0.00 ? 41  VAL A HG23 5  
ATOM 9903  N N    . LEU A 1 42  ? 117.287 -0.688  3.301   1.00 0.00 ? 42  LEU A N    5  
ATOM 9904  C CA   . LEU A 1 42  ? 117.969 -0.051  4.423   1.00 0.00 ? 42  LEU A CA   5  
ATOM 9905  C C    . LEU A 1 42  ? 118.584 1.282   4.005   1.00 0.00 ? 42  LEU A C    5  
ATOM 9906  O O    . LEU A 1 42  ? 118.640 2.217   4.803   1.00 0.00 ? 42  LEU A O    5  
ATOM 9907  C CB   . LEU A 1 42  ? 119.045 -0.979  5.005   1.00 0.00 ? 42  LEU A CB   5  
ATOM 9908  C CG   . LEU A 1 42  ? 118.523 -2.084  5.941   1.00 0.00 ? 42  LEU A CG   5  
ATOM 9909  C CD1  . LEU A 1 42  ? 119.665 -2.997  6.385   1.00 0.00 ? 42  LEU A CD1  5  
ATOM 9910  C CD2  . LEU A 1 42  ? 117.822 -1.465  7.151   1.00 0.00 ? 42  LEU A CD2  5  
ATOM 9911  H H    . LEU A 1 42  ? 117.661 -1.510  2.918   1.00 0.00 ? 42  LEU A H    5  
ATOM 9912  H HA   . LEU A 1 42  ? 117.227 0.141   5.186   1.00 0.00 ? 42  LEU A HA   5  
ATOM 9913  H HB2  . LEU A 1 42  ? 119.567 -1.449  4.182   1.00 0.00 ? 42  LEU A HB2  5  
ATOM 9914  H HB3  . LEU A 1 42  ? 119.752 -0.377  5.558   1.00 0.00 ? 42  LEU A HB3  5  
ATOM 9915  H HG   . LEU A 1 42  ? 117.801 -2.692  5.411   1.00 0.00 ? 42  LEU A HG   5  
ATOM 9916  H HD11 . LEU A 1 42  ? 119.279 -3.763  7.043   1.00 0.00 ? 42  LEU A HD11 5  
ATOM 9917  H HD12 . LEU A 1 42  ? 120.411 -2.415  6.908   1.00 0.00 ? 42  LEU A HD12 5  
ATOM 9918  H HD13 . LEU A 1 42  ? 120.113 -3.461  5.519   1.00 0.00 ? 42  LEU A HD13 5  
ATOM 9919  H HD21 . LEU A 1 42  ? 116.965 -0.896  6.819   1.00 0.00 ? 42  LEU A HD21 5  
ATOM 9920  H HD22 . LEU A 1 42  ? 118.508 -0.808  7.670   1.00 0.00 ? 42  LEU A HD22 5  
ATOM 9921  H HD23 . LEU A 1 42  ? 117.496 -2.247  7.821   1.00 0.00 ? 42  LEU A HD23 5  
ATOM 9922  N N    . PHE A 1 43  ? 119.038 1.365   2.756   1.00 0.00 ? 43  PHE A N    5  
ATOM 9923  C CA   . PHE A 1 43  ? 119.614 2.601   2.234   1.00 0.00 ? 43  PHE A CA   5  
ATOM 9924  C C    . PHE A 1 43  ? 118.583 3.724   2.260   1.00 0.00 ? 43  PHE A C    5  
ATOM 9925  O O    . PHE A 1 43  ? 118.865 4.822   2.742   1.00 0.00 ? 43  PHE A O    5  
ATOM 9926  C CB   . PHE A 1 43  ? 120.142 2.404   0.804   1.00 0.00 ? 43  PHE A CB   5  
ATOM 9927  C CG   . PHE A 1 43  ? 120.594 3.686   0.144   1.00 0.00 ? 43  PHE A CG   5  
ATOM 9928  C CD1  . PHE A 1 43  ? 121.685 4.391   0.636   1.00 0.00 ? 43  PHE A CD1  5  
ATOM 9929  C CD2  . PHE A 1 43  ? 119.922 4.191   -0.963  1.00 0.00 ? 43  PHE A CD2  5  
ATOM 9930  C CE1  . PHE A 1 43  ? 122.094 5.569   0.039   1.00 0.00 ? 43  PHE A CE1  5  
ATOM 9931  C CE2  . PHE A 1 43  ? 120.330 5.367   -1.563  1.00 0.00 ? 43  PHE A CE2  5  
ATOM 9932  C CZ   . PHE A 1 43  ? 121.417 6.057   -1.062  1.00 0.00 ? 43  PHE A CZ   5  
ATOM 9933  H H    . PHE A 1 43  ? 118.987 0.577   2.173   1.00 0.00 ? 43  PHE A H    5  
ATOM 9934  H HA   . PHE A 1 43  ? 120.441 2.874   2.877   1.00 0.00 ? 43  PHE A HA   5  
ATOM 9935  H HB2  . PHE A 1 43  ? 120.985 1.727   0.828   1.00 0.00 ? 43  PHE A HB2  5  
ATOM 9936  H HB3  . PHE A 1 43  ? 119.359 1.971   0.196   1.00 0.00 ? 43  PHE A HB3  5  
ATOM 9937  H HD1  . PHE A 1 43  ? 122.218 4.011   1.497   1.00 0.00 ? 43  PHE A HD1  5  
ATOM 9938  H HD2  . PHE A 1 43  ? 119.072 3.653   -1.358  1.00 0.00 ? 43  PHE A HD2  5  
ATOM 9939  H HE1  . PHE A 1 43  ? 122.945 6.107   0.432   1.00 0.00 ? 43  PHE A HE1  5  
ATOM 9940  H HE2  . PHE A 1 43  ? 119.798 5.748   -2.423  1.00 0.00 ? 43  PHE A HE2  5  
ATOM 9941  H HZ   . PHE A 1 43  ? 121.736 6.978   -1.529  1.00 0.00 ? 43  PHE A HZ   5  
ATOM 9942  N N    . TRP A 1 44  ? 117.385 3.438   1.754   1.00 0.00 ? 44  TRP A N    5  
ATOM 9943  C CA   . TRP A 1 44  ? 116.330 4.444   1.677   1.00 0.00 ? 44  TRP A CA   5  
ATOM 9944  C C    . TRP A 1 44  ? 115.948 4.925   3.078   1.00 0.00 ? 44  TRP A C    5  
ATOM 9945  O O    . TRP A 1 44  ? 115.873 6.130   3.329   1.00 0.00 ? 44  TRP A O    5  
ATOM 9946  C CB   . TRP A 1 44  ? 115.100 3.896   0.938   1.00 0.00 ? 44  TRP A CB   5  
ATOM 9947  C CG   . TRP A 1 44  ? 114.112 4.965   0.567   1.00 0.00 ? 44  TRP A CG   5  
ATOM 9948  C CD1  . TRP A 1 44  ? 114.142 5.756   -0.546  1.00 0.00 ? 44  TRP A CD1  5  
ATOM 9949  C CD2  . TRP A 1 44  ? 112.959 5.369   1.313   1.00 0.00 ? 44  TRP A CD2  5  
ATOM 9950  N NE1  . TRP A 1 44  ? 113.079 6.624   -0.538  1.00 0.00 ? 44  TRP A NE1  5  
ATOM 9951  C CE2  . TRP A 1 44  ? 112.339 6.407   0.593   1.00 0.00 ? 44  TRP A CE2  5  
ATOM 9952  C CE3  . TRP A 1 44  ? 112.391 4.952   2.520   1.00 0.00 ? 44  TRP A CE3  5  
ATOM 9953  C CZ2  . TRP A 1 44  ? 111.181 7.032   1.041   1.00 0.00 ? 44  TRP A CZ2  5  
ATOM 9954  C CZ3  . TRP A 1 44  ? 111.241 5.574   2.963   1.00 0.00 ? 44  TRP A CZ3  5  
ATOM 9955  C CH2  . TRP A 1 44  ? 110.648 6.605   2.226   1.00 0.00 ? 44  TRP A CH2  5  
ATOM 9956  H H    . TRP A 1 44  ? 117.209 2.531   1.420   1.00 0.00 ? 44  TRP A H    5  
ATOM 9957  H HA   . TRP A 1 44  ? 116.725 5.285   1.121   1.00 0.00 ? 44  TRP A HA   5  
ATOM 9958  H HB2  . TRP A 1 44  ? 115.419 3.407   0.028   1.00 0.00 ? 44  TRP A HB2  5  
ATOM 9959  H HB3  . TRP A 1 44  ? 114.596 3.177   1.569   1.00 0.00 ? 44  TRP A HB3  5  
ATOM 9960  H HD1  . TRP A 1 44  ? 114.899 5.697   -1.314  1.00 0.00 ? 44  TRP A HD1  5  
ATOM 9961  H HE1  . TRP A 1 44  ? 112.883 7.292   -1.232  1.00 0.00 ? 44  TRP A HE1  5  
ATOM 9962  H HE3  . TRP A 1 44  ? 112.835 4.158   3.101   1.00 0.00 ? 44  TRP A HE3  5  
ATOM 9963  H HZ2  . TRP A 1 44  ? 110.710 7.829   0.484   1.00 0.00 ? 44  TRP A HZ2  5  
ATOM 9964  H HZ3  . TRP A 1 44  ? 110.788 5.266   3.895   1.00 0.00 ? 44  TRP A HZ3  5  
ATOM 9965  H HH2  . TRP A 1 44  ? 109.748 7.065   2.611   1.00 0.00 ? 44  TRP A HH2  5  
ATOM 9966  N N    . LEU A 1 45  ? 115.730 3.978   3.997   1.00 0.00 ? 45  LEU A N    5  
ATOM 9967  C CA   . LEU A 1 45  ? 115.406 4.321   5.384   1.00 0.00 ? 45  LEU A CA   5  
ATOM 9968  C C    . LEU A 1 45  ? 116.522 5.158   5.998   1.00 0.00 ? 45  LEU A C    5  
ATOM 9969  O O    . LEU A 1 45  ? 116.272 6.190   6.631   1.00 0.00 ? 45  LEU A O    5  
ATOM 9970  C CB   . LEU A 1 45  ? 115.197 3.065   6.247   1.00 0.00 ? 45  LEU A CB   5  
ATOM 9971  C CG   . LEU A 1 45  ? 113.989 2.183   5.892   1.00 0.00 ? 45  LEU A CG   5  
ATOM 9972  C CD1  . LEU A 1 45  ? 113.755 1.156   6.995   1.00 0.00 ? 45  LEU A CD1  5  
ATOM 9973  C CD2  . LEU A 1 45  ? 112.736 3.030   5.664   1.00 0.00 ? 45  LEU A CD2  5  
ATOM 9974  H H    . LEU A 1 45  ? 115.787 3.033   3.734   1.00 0.00 ? 45  LEU A H    5  
ATOM 9975  H HA   . LEU A 1 45  ? 114.495 4.902   5.379   1.00 0.00 ? 45  LEU A HA   5  
ATOM 9976  H HB2  . LEU A 1 45  ? 116.088 2.456   6.174   1.00 0.00 ? 45  LEU A HB2  5  
ATOM 9977  H HB3  . LEU A 1 45  ? 115.089 3.381   7.276   1.00 0.00 ? 45  LEU A HB3  5  
ATOM 9978  H HG   . LEU A 1 45  ? 114.201 1.638   4.979   1.00 0.00 ? 45  LEU A HG   5  
ATOM 9979  H HD11 . LEU A 1 45  ? 113.513 1.664   7.918   1.00 0.00 ? 45  LEU A HD11 5  
ATOM 9980  H HD12 . LEU A 1 45  ? 114.649 0.568   7.135   1.00 0.00 ? 45  LEU A HD12 5  
ATOM 9981  H HD13 . LEU A 1 45  ? 112.938 0.508   6.717   1.00 0.00 ? 45  LEU A HD13 5  
ATOM 9982  H HD21 . LEU A 1 45  ? 112.500 3.580   6.564   1.00 0.00 ? 45  LEU A HD21 5  
ATOM 9983  H HD22 . LEU A 1 45  ? 111.906 2.387   5.408   1.00 0.00 ? 45  LEU A HD22 5  
ATOM 9984  H HD23 . LEU A 1 45  ? 112.912 3.724   4.855   1.00 0.00 ? 45  LEU A HD23 5  
ATOM 9985  N N    . ALA A 1 46  ? 117.753 4.702   5.804   1.00 0.00 ? 46  ALA A N    5  
ATOM 9986  C CA   . ALA A 1 46  ? 118.922 5.373   6.352   1.00 0.00 ? 46  ALA A CA   5  
ATOM 9987  C C    . ALA A 1 46  ? 119.092 6.755   5.729   1.00 0.00 ? 46  ALA A C    5  
ATOM 9988  O O    . ALA A 1 46  ? 119.607 7.670   6.371   1.00 0.00 ? 46  ALA A O    5  
ATOM 9989  C CB   . ALA A 1 46  ? 120.170 4.522   6.137   1.00 0.00 ? 46  ALA A CB   5  
ATOM 9990  H H    . ALA A 1 46  ? 117.880 3.887   5.271   1.00 0.00 ? 46  ALA A H    5  
ATOM 9991  H HA   . ALA A 1 46  ? 118.772 5.486   7.418   1.00 0.00 ? 46  ALA A HA   5  
ATOM 9992  H HB1  . ALA A 1 46  ? 120.017 3.541   6.568   1.00 0.00 ? 46  ALA A HB1  5  
ATOM 9993  H HB2  . ALA A 1 46  ? 121.018 4.995   6.612   1.00 0.00 ? 46  ALA A HB2  5  
ATOM 9994  H HB3  . ALA A 1 46  ? 120.362 4.422   5.078   1.00 0.00 ? 46  ALA A HB3  5  
ATOM 9995  N N    . CYS A 1 47  ? 118.640 6.900   4.482   1.00 0.00 ? 47  CYS A N    5  
ATOM 9996  C CA   . CYS A 1 47  ? 118.733 8.170   3.765   1.00 0.00 ? 47  CYS A CA   5  
ATOM 9997  C C    . CYS A 1 47  ? 117.684 9.158   4.284   1.00 0.00 ? 47  CYS A C    5  
ATOM 9998  O O    . CYS A 1 47  ? 117.931 10.366  4.344   1.00 0.00 ? 47  CYS A O    5  
ATOM 9999  C CB   . CYS A 1 47  ? 118.570 7.951   2.256   1.00 0.00 ? 47  CYS A CB   5  
ATOM 10000 S SG   . CYS A 1 47  ? 118.915 9.418   1.259   1.00 0.00 ? 47  CYS A SG   5  
ATOM 10001 H H    . CYS A 1 47  ? 118.239 6.128   4.030   1.00 0.00 ? 47  CYS A H    5  
ATOM 10002 H HA   . CYS A 1 47  ? 119.716 8.581   3.952   1.00 0.00 ? 47  CYS A HA   5  
ATOM 10003 H HB2  . CYS A 1 47  ? 119.248 7.173   1.936   1.00 0.00 ? 47  CYS A HB2  5  
ATOM 10004 H HB3  . CYS A 1 47  ? 117.554 7.643   2.049   1.00 0.00 ? 47  CYS A HB3  5  
ATOM 10005 H HG   . CYS A 1 47  ? 118.100 10.384  1.664   1.00 0.00 ? 47  CYS A HG   5  
ATOM 10006 N N    . GLU A 1 48  ? 116.513 8.643   4.662   1.00 0.00 ? 48  GLU A N    5  
ATOM 10007 C CA   . GLU A 1 48  ? 115.497 9.463   5.320   1.00 0.00 ? 48  GLU A CA   5  
ATOM 10008 C C    . GLU A 1 48  ? 116.067 10.036  6.614   1.00 0.00 ? 48  GLU A C    5  
ATOM 10009 O O    . GLU A 1 48  ? 116.105 11.252  6.807   1.00 0.00 ? 48  GLU A O    5  
ATOM 10010 C CB   . GLU A 1 48  ? 114.232 8.637   5.612   1.00 0.00 ? 48  GLU A CB   5  
ATOM 10011 C CG   . GLU A 1 48  ? 113.362 8.373   4.385   1.00 0.00 ? 48  GLU A CG   5  
ATOM 10012 C CD   . GLU A 1 48  ? 112.597 9.610   3.924   1.00 0.00 ? 48  GLU A CD   5  
ATOM 10013 O OE1  . GLU A 1 48  ? 113.194 10.474  3.248   1.00 0.00 ? 48  GLU A OE1  5  
ATOM 10014 O OE2  . GLU A 1 48  ? 111.390 9.724   4.238   1.00 0.00 ? 48  GLU A OE2  5  
ATOM 10015 H H    . GLU A 1 48  ? 116.327 7.695   4.489   1.00 0.00 ? 48  GLU A H    5  
ATOM 10016 H HA   . GLU A 1 48  ? 115.245 10.279  4.656   1.00 0.00 ? 48  GLU A HA   5  
ATOM 10017 H HB2  . GLU A 1 48  ? 114.529 7.684   6.026   1.00 0.00 ? 48  GLU A HB2  5  
ATOM 10018 H HB3  . GLU A 1 48  ? 113.633 9.162   6.344   1.00 0.00 ? 48  GLU A HB3  5  
ATOM 10019 H HG2  . GLU A 1 48  ? 113.994 8.036   3.575   1.00 0.00 ? 48  GLU A HG2  5  
ATOM 10020 H HG3  . GLU A 1 48  ? 112.650 7.595   4.626   1.00 0.00 ? 48  GLU A HG3  5  
ATOM 10021 N N    . ASP A 1 49  ? 116.538 9.143   7.481   1.00 0.00 ? 49  ASP A N    5  
ATOM 10022 C CA   . ASP A 1 49  ? 117.164 9.529   8.748   1.00 0.00 ? 49  ASP A CA   5  
ATOM 10023 C C    . ASP A 1 49  ? 118.358 10.453  8.497   1.00 0.00 ? 49  ASP A C    5  
ATOM 10024 O O    . ASP A 1 49  ? 118.603 11.398  9.252   1.00 0.00 ? 49  ASP A O    5  
ATOM 10025 C CB   . ASP A 1 49  ? 117.602 8.268   9.508   1.00 0.00 ? 49  ASP A CB   5  
ATOM 10026 C CG   . ASP A 1 49  ? 118.365 8.569   10.791  1.00 0.00 ? 49  ASP A CG   5  
ATOM 10027 O OD1  . ASP A 1 49  ? 117.803 9.237   11.686  1.00 0.00 ? 49  ASP A OD1  5  
ATOM 10028 O OD2  . ASP A 1 49  ? 119.523 8.116   10.918  1.00 0.00 ? 49  ASP A OD2  5  
ATOM 10029 H H    . ASP A 1 49  ? 116.464 8.190   7.261   1.00 0.00 ? 49  ASP A H    5  
ATOM 10030 H HA   . ASP A 1 49  ? 116.427 10.059  9.336   1.00 0.00 ? 49  ASP A HA   5  
ATOM 10031 H HB2  . ASP A 1 49  ? 116.725 7.691   9.766   1.00 0.00 ? 49  ASP A HB2  5  
ATOM 10032 H HB3  . ASP A 1 49  ? 118.235 7.673   8.863   1.00 0.00 ? 49  ASP A HB3  5  
ATOM 10033 N N    . PHE A 1 50  ? 119.071 10.174  7.407   1.00 0.00 ? 50  PHE A N    5  
ATOM 10034 C CA   . PHE A 1 50  ? 120.208 10.981  6.962   1.00 0.00 ? 50  PHE A CA   5  
ATOM 10035 C C    . PHE A 1 50  ? 119.793 12.441  6.788   1.00 0.00 ? 50  PHE A C    5  
ATOM 10036 O O    . PHE A 1 50  ? 120.569 13.348  7.061   1.00 0.00 ? 50  PHE A O    5  
ATOM 10037 C CB   . PHE A 1 50  ? 120.727 10.421  5.626   1.00 0.00 ? 50  PHE A CB   5  
ATOM 10038 C CG   . PHE A 1 50  ? 122.019 11.019  5.109   1.00 0.00 ? 50  PHE A CG   5  
ATOM 10039 C CD1  . PHE A 1 50  ? 122.065 12.303  4.574   1.00 0.00 ? 50  PHE A CD1  5  
ATOM 10040 C CD2  . PHE A 1 50  ? 123.186 10.271  5.124   1.00 0.00 ? 50  PHE A CD2  5  
ATOM 10041 C CE1  . PHE A 1 50  ? 123.242 12.818  4.074   1.00 0.00 ? 50  PHE A CE1  5  
ATOM 10042 C CE2  . PHE A 1 50  ? 124.366 10.788  4.629   1.00 0.00 ? 50  PHE A CE2  5  
ATOM 10043 C CZ   . PHE A 1 50  ? 124.395 12.060  4.103   1.00 0.00 ? 50  PHE A CZ   5  
ATOM 10044 H H    . PHE A 1 50  ? 118.825 9.387   6.878   1.00 0.00 ? 50  PHE A H    5  
ATOM 10045 H HA   . PHE A 1 50  ? 120.987 10.915  7.706   1.00 0.00 ? 50  PHE A HA   5  
ATOM 10046 H HB2  . PHE A 1 50  ? 120.884 9.359   5.737   1.00 0.00 ? 50  PHE A HB2  5  
ATOM 10047 H HB3  . PHE A 1 50  ? 119.969 10.577  4.869   1.00 0.00 ? 50  PHE A HB3  5  
ATOM 10048 H HD1  . PHE A 1 50  ? 121.171 12.907  4.558   1.00 0.00 ? 50  PHE A HD1  5  
ATOM 10049 H HD2  . PHE A 1 50  ? 123.171 9.271   5.535   1.00 0.00 ? 50  PHE A HD2  5  
ATOM 10050 H HE1  . PHE A 1 50  ? 123.263 13.817  3.661   1.00 0.00 ? 50  PHE A HE1  5  
ATOM 10051 H HE2  . PHE A 1 50  ? 125.267 10.193  4.652   1.00 0.00 ? 50  PHE A HE2  5  
ATOM 10052 H HZ   . PHE A 1 50  ? 125.319 12.463  3.712   1.00 0.00 ? 50  PHE A HZ   5  
ATOM 10053 N N    . LYS A 1 51  ? 118.569 12.653  6.314   1.00 0.00 ? 51  LYS A N    5  
ATOM 10054 C CA   . LYS A 1 51  ? 118.062 13.994  6.045   1.00 0.00 ? 51  LYS A CA   5  
ATOM 10055 C C    . LYS A 1 51  ? 117.388 14.589  7.288   1.00 0.00 ? 51  LYS A C    5  
ATOM 10056 O O    . LYS A 1 51  ? 117.404 15.805  7.491   1.00 0.00 ? 51  LYS A O    5  
ATOM 10057 C CB   . LYS A 1 51  ? 117.081 13.927  4.858   1.00 0.00 ? 51  LYS A CB   5  
ATOM 10058 C CG   . LYS A 1 51  ? 116.682 15.279  4.262   1.00 0.00 ? 51  LYS A CG   5  
ATOM 10059 C CD   . LYS A 1 51  ? 115.558 15.962  5.043   1.00 0.00 ? 51  LYS A CD   5  
ATOM 10060 C CE   . LYS A 1 51  ? 115.169 17.298  4.420   1.00 0.00 ? 51  LYS A CE   5  
ATOM 10061 N NZ   . LYS A 1 51  ? 114.080 17.968  5.176   1.00 0.00 ? 51  LYS A NZ   5  
ATOM 10062 H H    . LYS A 1 51  ? 117.992 11.882  6.121   1.00 0.00 ? 51  LYS A H    5  
ATOM 10063 H HA   . LYS A 1 51  ? 118.900 14.620  5.772   1.00 0.00 ? 51  LYS A HA   5  
ATOM 10064 H HB2  . LYS A 1 51  ? 117.537 13.341  4.073   1.00 0.00 ? 51  LYS A HB2  5  
ATOM 10065 H HB3  . LYS A 1 51  ? 116.181 13.423  5.184   1.00 0.00 ? 51  LYS A HB3  5  
ATOM 10066 H HG2  . LYS A 1 51  ? 117.547 15.926  4.262   1.00 0.00 ? 51  LYS A HG2  5  
ATOM 10067 H HG3  . LYS A 1 51  ? 116.355 15.122  3.244   1.00 0.00 ? 51  LYS A HG3  5  
ATOM 10068 H HD2  . LYS A 1 51  ? 114.692 15.316  5.049   1.00 0.00 ? 51  LYS A HD2  5  
ATOM 10069 H HD3  . LYS A 1 51  ? 115.887 16.132  6.058   1.00 0.00 ? 51  LYS A HD3  5  
ATOM 10070 H HE2  . LYS A 1 51  ? 116.034 17.944  4.409   1.00 0.00 ? 51  LYS A HE2  5  
ATOM 10071 H HE3  . LYS A 1 51  ? 114.837 17.126  3.406   1.00 0.00 ? 51  LYS A HE3  5  
ATOM 10072 H HZ1  . LYS A 1 51  ? 113.236 17.359  5.207   1.00 0.00 ? 51  LYS A HZ1  5  
ATOM 10073 H HZ2  . LYS A 1 51  ? 113.827 18.868  4.716   1.00 0.00 ? 51  LYS A HZ2  5  
ATOM 10074 H HZ3  . LYS A 1 51  ? 114.387 18.168  6.148   1.00 0.00 ? 51  LYS A HZ3  5  
ATOM 10075 N N    . LYS A 1 52  ? 116.809 13.729  8.122   1.00 0.00 ? 52  LYS A N    5  
ATOM 10076 C CA   . LYS A 1 52  ? 116.036 14.177  9.285   1.00 0.00 ? 52  LYS A CA   5  
ATOM 10077 C C    . LYS A 1 52  ? 116.907 14.884  10.318  1.00 0.00 ? 52  LYS A C    5  
ATOM 10078 O O    . LYS A 1 52  ? 116.719 16.072  10.596  1.00 0.00 ? 52  LYS A O    5  
ATOM 10079 C CB   . LYS A 1 52  ? 115.306 12.995  9.946   1.00 0.00 ? 52  LYS A CB   5  
ATOM 10080 C CG   . LYS A 1 52  ? 114.315 12.281  9.035   1.00 0.00 ? 52  LYS A CG   5  
ATOM 10081 C CD   . LYS A 1 52  ? 113.248 13.228  8.495   1.00 0.00 ? 52  LYS A CD   5  
ATOM 10082 C CE   . LYS A 1 52  ? 112.260 12.500  7.594   1.00 0.00 ? 52  LYS A CE   5  
ATOM 10083 N NZ   . LYS A 1 52  ? 111.221 13.414  7.054   1.00 0.00 ? 52  LYS A NZ   5  
ATOM 10084 H H    . LYS A 1 52  ? 116.901 12.767  7.951   1.00 0.00 ? 52  LYS A H    5  
ATOM 10085 H HA   . LYS A 1 52  ? 115.300 14.882  8.936   1.00 0.00 ? 52  LYS A HA   5  
ATOM 10086 H HB2  . LYS A 1 52  ? 116.039 12.272  10.273  1.00 0.00 ? 52  LYS A HB2  5  
ATOM 10087 H HB3  . LYS A 1 52  ? 114.765 13.358  10.810  1.00 0.00 ? 52  LYS A HB3  5  
ATOM 10088 H HG2  . LYS A 1 52  ? 114.853 11.853  8.203   1.00 0.00 ? 52  LYS A HG2  5  
ATOM 10089 H HG3  . LYS A 1 52  ? 113.833 11.491  9.595   1.00 0.00 ? 52  LYS A HG3  5  
ATOM 10090 H HD2  . LYS A 1 52  ? 112.709 13.662  9.327   1.00 0.00 ? 52  LYS A HD2  5  
ATOM 10091 H HD3  . LYS A 1 52  ? 113.727 14.014  7.928   1.00 0.00 ? 52  LYS A HD3  5  
ATOM 10092 H HE2  . LYS A 1 52  ? 112.802 12.060  6.770   1.00 0.00 ? 52  LYS A HE2  5  
ATOM 10093 H HE3  . LYS A 1 52  ? 111.779 11.720  8.166   1.00 0.00 ? 52  LYS A HE3  5  
ATOM 10094 H HZ1  . LYS A 1 52  ? 111.665 14.183  6.514   1.00 0.00 ? 52  LYS A HZ1  5  
ATOM 10095 H HZ2  . LYS A 1 52  ? 110.666 13.825  7.830   1.00 0.00 ? 52  LYS A HZ2  5  
ATOM 10096 H HZ3  . LYS A 1 52  ? 110.576 12.892  6.425   1.00 0.00 ? 52  LYS A HZ3  5  
ATOM 10097 N N    . MET A 1 53  ? 117.869 14.164  10.874  1.00 0.00 ? 53  MET A N    5  
ATOM 10098 C CA   . MET A 1 53  ? 118.626 14.659  12.025  1.00 0.00 ? 53  MET A CA   5  
ATOM 10099 C C    . MET A 1 53  ? 120.018 15.146  11.627  1.00 0.00 ? 53  MET A C    5  
ATOM 10100 O O    . MET A 1 53  ? 120.915 15.242  12.468  1.00 0.00 ? 53  MET A O    5  
ATOM 10101 C CB   . MET A 1 53  ? 118.734 13.554  13.089  1.00 0.00 ? 53  MET A CB   5  
ATOM 10102 C CG   . MET A 1 53  ? 119.330 12.244  12.577  1.00 0.00 ? 53  MET A CG   5  
ATOM 10103 S SD   . MET A 1 53  ? 121.045 12.406  12.030  1.00 0.00 ? 53  MET A SD   5  
ATOM 10104 C CE   . MET A 1 53  ? 121.381 10.750  11.438  1.00 0.00 ? 53  MET A CE   5  
ATOM 10105 H H    . MET A 1 53  ? 118.086 13.281  10.499  1.00 0.00 ? 53  MET A H    5  
ATOM 10106 H HA   . MET A 1 53  ? 118.075 15.488  12.440  1.00 0.00 ? 53  MET A HA   5  
ATOM 10107 H HB2  . MET A 1 53  ? 119.352 13.911  13.901  1.00 0.00 ? 53  MET A HB2  5  
ATOM 10108 H HB3  . MET A 1 53  ? 117.744 13.346  13.472  1.00 0.00 ? 53  MET A HB3  5  
ATOM 10109 H HG2  . MET A 1 53  ? 119.292 11.516  13.373  1.00 0.00 ? 53  MET A HG2  5  
ATOM 10110 H HG3  . MET A 1 53  ? 118.735 11.894  11.745  1.00 0.00 ? 53  MET A HG3  5  
ATOM 10111 H HE1  . MET A 1 53  ? 120.698 10.508  10.637  1.00 0.00 ? 53  MET A HE1  5  
ATOM 10112 H HE2  . MET A 1 53  ? 121.253 10.045  12.247  1.00 0.00 ? 53  MET A HE2  5  
ATOM 10113 H HE3  . MET A 1 53  ? 122.396 10.698  11.073  1.00 0.00 ? 53  MET A HE3  5  
ATOM 10114 N N    . GLN A 1 54  ? 120.185 15.497  10.360  1.00 0.00 ? 54  GLN A N    5  
ATOM 10115 C CA   . GLN A 1 54  ? 121.510 15.788  9.823   1.00 0.00 ? 54  GLN A CA   5  
ATOM 10116 C C    . GLN A 1 54  ? 122.126 17.075  10.373  1.00 0.00 ? 54  GLN A C    5  
ATOM 10117 O O    . GLN A 1 54  ? 121.792 18.183  9.951   1.00 0.00 ? 54  GLN A O    5  
ATOM 10118 C CB   . GLN A 1 54  ? 121.493 15.837  8.292   1.00 0.00 ? 54  GLN A CB   5  
ATOM 10119 C CG   . GLN A 1 54  ? 120.478 16.806  7.691   1.00 0.00 ? 54  GLN A CG   5  
ATOM 10120 C CD   . GLN A 1 54  ? 120.546 16.870  6.172   1.00 0.00 ? 54  GLN A CD   5  
ATOM 10121 O OE1  . GLN A 1 54  ? 120.263 17.905  5.569   1.00 0.00 ? 54  GLN A OE1  5  
ATOM 10122 N NE2  . GLN A 1 54  ? 120.902 15.761  5.540   1.00 0.00 ? 54  GLN A NE2  5  
ATOM 10123 H H    . GLN A 1 54  ? 119.404 15.565  9.775   1.00 0.00 ? 54  GLN A H    5  
ATOM 10124 H HA   . GLN A 1 54  ? 122.150 14.966  10.117  1.00 0.00 ? 54  GLN A HA   5  
ATOM 10125 H HB2  . GLN A 1 54  ? 122.476 16.123  7.947   1.00 0.00 ? 54  GLN A HB2  5  
ATOM 10126 H HB3  . GLN A 1 54  ? 121.275 14.848  7.922   1.00 0.00 ? 54  GLN A HB3  5  
ATOM 10127 H HG2  . GLN A 1 54  ? 119.484 16.490  7.976   1.00 0.00 ? 54  GLN A HG2  5  
ATOM 10128 H HG3  . GLN A 1 54  ? 120.665 17.794  8.087   1.00 0.00 ? 54  GLN A HG3  5  
ATOM 10129 H HE21 . GLN A 1 54  ? 121.094 14.960  6.073   1.00 0.00 ? 54  GLN A HE21 5  
ATOM 10130 H HE22 . GLN A 1 54  ? 120.975 15.791  4.562   1.00 0.00 ? 54  GLN A HE22 5  
ATOM 10131 N N    . ASP A 1 55  ? 123.003 16.908  11.351  1.00 0.00 ? 55  ASP A N    5  
ATOM 10132 C CA   . ASP A 1 55  ? 124.025 17.905  11.648  1.00 0.00 ? 55  ASP A CA   5  
ATOM 10133 C C    . ASP A 1 55  ? 125.293 17.448  10.948  1.00 0.00 ? 55  ASP A C    5  
ATOM 10134 O O    . ASP A 1 55  ? 125.489 16.245  10.803  1.00 0.00 ? 55  ASP A O    5  
ATOM 10135 C CB   . ASP A 1 55  ? 124.271 18.037  13.155  1.00 0.00 ? 55  ASP A CB   5  
ATOM 10136 C CG   . ASP A 1 55  ? 125.413 18.994  13.465  1.00 0.00 ? 55  ASP A CG   5  
ATOM 10137 O OD1  . ASP A 1 55  ? 125.173 20.216  13.510  1.00 0.00 ? 55  ASP A OD1  5  
ATOM 10138 O OD2  . ASP A 1 55  ? 126.560 18.529  13.649  1.00 0.00 ? 55  ASP A OD2  5  
ATOM 10139 H H    . ASP A 1 55  ? 122.965 16.089  11.889  1.00 0.00 ? 55  ASP A H    5  
ATOM 10140 H HA   . ASP A 1 55  ? 123.711 18.858  11.239  1.00 0.00 ? 55  ASP A HA   5  
ATOM 10141 H HB2  . ASP A 1 55  ? 123.372 18.407  13.628  1.00 0.00 ? 55  ASP A HB2  5  
ATOM 10142 H HB3  . ASP A 1 55  ? 124.512 17.065  13.564  1.00 0.00 ? 55  ASP A HB3  5  
ATOM 10143 N N    . LYS A 1 56  ? 126.143 18.372  10.511  1.00 0.00 ? 56  LYS A N    5  
ATOM 10144 C CA   . LYS A 1 56  ? 127.312 18.005  9.708   1.00 0.00 ? 56  LYS A CA   5  
ATOM 10145 C C    . LYS A 1 56  ? 128.076 16.821  10.297  1.00 0.00 ? 56  LYS A C    5  
ATOM 10146 O O    . LYS A 1 56  ? 128.434 15.904  9.569   1.00 0.00 ? 56  LYS A O    5  
ATOM 10147 C CB   . LYS A 1 56  ? 128.254 19.186  9.505   1.00 0.00 ? 56  LYS A CB   5  
ATOM 10148 C CG   . LYS A 1 56  ? 127.725 20.209  8.509   1.00 0.00 ? 56  LYS A CG   5  
ATOM 10149 C CD   . LYS A 1 56  ? 128.851 21.029  7.897   1.00 0.00 ? 56  LYS A CD   5  
ATOM 10150 C CE   . LYS A 1 56  ? 129.791 20.172  7.052   1.00 0.00 ? 56  LYS A CE   5  
ATOM 10151 N NZ   . LYS A 1 56  ? 130.854 20.988  6.409   1.00 0.00 ? 56  LYS A NZ   5  
ATOM 10152 H H    . LYS A 1 56  ? 125.984 19.316  10.731  1.00 0.00 ? 56  LYS A H    5  
ATOM 10153 H HA   . LYS A 1 56  ? 126.941 17.712  8.735   1.00 0.00 ? 56  LYS A HA   5  
ATOM 10154 H HB2  . LYS A 1 56  ? 128.405 19.680  10.455  1.00 0.00 ? 56  LYS A HB2  5  
ATOM 10155 H HB3  . LYS A 1 56  ? 129.205 18.818  9.145   1.00 0.00 ? 56  LYS A HB3  5  
ATOM 10156 H HG2  . LYS A 1 56  ? 127.200 19.693  7.718   1.00 0.00 ? 56  LYS A HG2  5  
ATOM 10157 H HG3  . LYS A 1 56  ? 127.042 20.875  9.019   1.00 0.00 ? 56  LYS A HG3  5  
ATOM 10158 H HD2  . LYS A 1 56  ? 128.421 21.791  7.271   1.00 0.00 ? 56  LYS A HD2  5  
ATOM 10159 H HD3  . LYS A 1 56  ? 129.416 21.486  8.693   1.00 0.00 ? 56  LYS A HD3  5  
ATOM 10160 H HE2  . LYS A 1 56  ? 130.256 19.432  7.687   1.00 0.00 ? 56  LYS A HE2  5  
ATOM 10161 H HE3  . LYS A 1 56  ? 129.216 19.676  6.283   1.00 0.00 ? 56  LYS A HE3  5  
ATOM 10162 H HZ1  . LYS A 1 56  ? 131.483 20.381  5.843   1.00 0.00 ? 56  LYS A HZ1  5  
ATOM 10163 H HZ2  . LYS A 1 56  ? 131.422 21.472  7.130   1.00 0.00 ? 56  LYS A HZ2  5  
ATOM 10164 H HZ3  . LYS A 1 56  ? 130.428 21.701  5.783   1.00 0.00 ? 56  LYS A HZ3  5  
ATOM 10165 N N    . THR A 1 57  ? 128.298 16.823  11.606  1.00 0.00 ? 57  THR A N    5  
ATOM 10166 C CA   . THR A 1 57  ? 129.025 15.728  12.251  1.00 0.00 ? 57  THR A CA   5  
ATOM 10167 C C    . THR A 1 57  ? 128.347 14.384  11.956  1.00 0.00 ? 57  THR A C    5  
ATOM 10168 O O    . THR A 1 57  ? 128.988 13.423  11.520  1.00 0.00 ? 57  THR A O    5  
ATOM 10169 C CB   . THR A 1 57  ? 129.114 15.941  13.779  1.00 0.00 ? 57  THR A CB   5  
ATOM 10170 O OG1  . THR A 1 57  ? 127.793 16.031  14.338  1.00 0.00 ? 57  THR A OG1  5  
ATOM 10171 C CG2  . THR A 1 57  ? 129.901 17.207  14.113  1.00 0.00 ? 57  THR A CG2  5  
ATOM 10172 H H    . THR A 1 57  ? 127.964 17.568  12.153  1.00 0.00 ? 57  THR A H    5  
ATOM 10173 H HA   . THR A 1 57  ? 130.030 15.711  11.848  1.00 0.00 ? 57  THR A HA   5  
ATOM 10174 H HB   . THR A 1 57  ? 129.623 15.093  14.217  1.00 0.00 ? 57  THR A HB   5  
ATOM 10175 H HG1  . THR A 1 57  ? 127.516 16.957  14.361  1.00 0.00 ? 57  THR A HG1  5  
ATOM 10176 H HG21 . THR A 1 57  ? 129.955 17.326  15.185  1.00 0.00 ? 57  THR A HG21 5  
ATOM 10177 H HG22 . THR A 1 57  ? 129.406 18.065  13.681  1.00 0.00 ? 57  THR A HG22 5  
ATOM 10178 H HG23 . THR A 1 57  ? 130.901 17.128  13.709  1.00 0.00 ? 57  THR A HG23 5  
ATOM 10179 N N    . GLN A 1 58  ? 127.036 14.352  12.168  1.00 0.00 ? 58  GLN A N    5  
ATOM 10180 C CA   . GLN A 1 58  ? 126.224 13.162  11.934  1.00 0.00 ? 58  GLN A CA   5  
ATOM 10181 C C    . GLN A 1 58  ? 126.199 12.800  10.450  1.00 0.00 ? 58  GLN A C    5  
ATOM 10182 O O    . GLN A 1 58  ? 126.503 11.671  10.065  1.00 0.00 ? 58  GLN A O    5  
ATOM 10183 C CB   . GLN A 1 58  ? 124.793 13.418  12.427  1.00 0.00 ? 58  GLN A CB   5  
ATOM 10184 C CG   . GLN A 1 58  ? 124.699 13.645  13.932  1.00 0.00 ? 58  GLN A CG   5  
ATOM 10185 C CD   . GLN A 1 58  ? 123.317 14.089  14.378  1.00 0.00 ? 58  GLN A CD   5  
ATOM 10186 O OE1  . GLN A 1 58  ? 123.034 15.286  14.453  1.00 0.00 ? 58  GLN A OE1  5  
ATOM 10187 N NE2  . GLN A 1 58  ? 122.450 13.133  14.673  1.00 0.00 ? 58  GLN A NE2  5  
ATOM 10188 H H    . GLN A 1 58  ? 126.597 15.166  12.492  1.00 0.00 ? 58  GLN A H    5  
ATOM 10189 H HA   . GLN A 1 58  ? 126.652 12.342  12.494  1.00 0.00 ? 58  GLN A HA   5  
ATOM 10190 H HB2  . GLN A 1 58  ? 124.404 14.295  11.924  1.00 0.00 ? 58  GLN A HB2  5  
ATOM 10191 H HB3  . GLN A 1 58  ? 124.178 12.569  12.170  1.00 0.00 ? 58  GLN A HB3  5  
ATOM 10192 H HG2  . GLN A 1 58  ? 124.945 12.723  14.439  1.00 0.00 ? 58  GLN A HG2  5  
ATOM 10193 H HG3  . GLN A 1 58  ? 125.413 14.407  14.212  1.00 0.00 ? 58  GLN A HG3  5  
ATOM 10194 H HE21 . GLN A 1 58  ? 122.742 12.201  14.586  1.00 0.00 ? 58  GLN A HE21 5  
ATOM 10195 H HE22 . GLN A 1 58  ? 121.552 13.396  14.961  1.00 0.00 ? 58  GLN A HE22 5  
ATOM 10196 N N    . MET A 1 59  ? 125.844 13.784  9.634   1.00 0.00 ? 59  MET A N    5  
ATOM 10197 C CA   . MET A 1 59  ? 125.659 13.601  8.196   1.00 0.00 ? 59  MET A CA   5  
ATOM 10198 C C    . MET A 1 59  ? 126.946 13.158  7.507   1.00 0.00 ? 59  MET A C    5  
ATOM 10199 O O    . MET A 1 59  ? 126.919 12.324  6.601   1.00 0.00 ? 59  MET A O    5  
ATOM 10200 C CB   . MET A 1 59  ? 125.110 14.898  7.575   1.00 0.00 ? 59  MET A CB   5  
ATOM 10201 C CG   . MET A 1 59  ? 124.970 14.860  6.056   1.00 0.00 ? 59  MET A CG   5  
ATOM 10202 S SD   . MET A 1 59  ? 126.486 15.333  5.196   1.00 0.00 ? 59  MET A SD   5  
ATOM 10203 C CE   . MET A 1 59  ? 126.685 17.028  5.745   1.00 0.00 ? 59  MET A CE   5  
ATOM 10204 H H    . MET A 1 59  ? 125.696 14.667  10.014  1.00 0.00 ? 59  MET A H    5  
ATOM 10205 H HA   . MET A 1 59  ? 124.931 12.826  8.067   1.00 0.00 ? 59  MET A HA   5  
ATOM 10206 H HB2  . MET A 1 59  ? 124.136 15.098  7.997   1.00 0.00 ? 59  MET A HB2  5  
ATOM 10207 H HB3  . MET A 1 59  ? 125.773 15.712  7.832   1.00 0.00 ? 59  MET A HB3  5  
ATOM 10208 H HG2  . MET A 1 59  ? 124.714 13.853  5.761   1.00 0.00 ? 59  MET A HG2  5  
ATOM 10209 H HG3  . MET A 1 59  ? 124.173 15.527  5.756   1.00 0.00 ? 59  MET A HG3  5  
ATOM 10210 H HE1  . MET A 1 59  ? 127.568 17.452  5.289   1.00 0.00 ? 59  MET A HE1  5  
ATOM 10211 H HE2  . MET A 1 59  ? 126.790 17.049  6.820   1.00 0.00 ? 59  MET A HE2  5  
ATOM 10212 H HE3  . MET A 1 59  ? 125.818 17.604  5.456   1.00 0.00 ? 59  MET A HE3  5  
ATOM 10213 N N    . GLN A 1 60  ? 128.065 13.696  7.957   1.00 0.00 ? 60  GLN A N    5  
ATOM 10214 C CA   . GLN A 1 60  ? 129.371 13.323  7.412   1.00 0.00 ? 60  GLN A CA   5  
ATOM 10215 C C    . GLN A 1 60  ? 129.670 11.862  7.743   1.00 0.00 ? 60  GLN A C    5  
ATOM 10216 O O    . GLN A 1 60  ? 130.044 11.080  6.865   1.00 0.00 ? 60  GLN A O    5  
ATOM 10217 C CB   . GLN A 1 60  ? 130.482 14.240  7.953   1.00 0.00 ? 60  GLN A CB   5  
ATOM 10218 C CG   . GLN A 1 60  ? 130.395 15.686  7.458   1.00 0.00 ? 60  GLN A CG   5  
ATOM 10219 C CD   . GLN A 1 60  ? 131.438 16.601  8.086   1.00 0.00 ? 60  GLN A CD   5  
ATOM 10220 O OE1  . GLN A 1 60  ? 131.883 17.571  7.470   1.00 0.00 ? 60  GLN A OE1  5  
ATOM 10221 N NE2  . GLN A 1 60  ? 131.822 16.317  9.324   1.00 0.00 ? 60  GLN A NE2  5  
ATOM 10222 H H    . GLN A 1 60  ? 128.012 14.349  8.679   1.00 0.00 ? 60  GLN A H    5  
ATOM 10223 H HA   . GLN A 1 60  ? 129.320 13.430  6.336   1.00 0.00 ? 60  GLN A HA   5  
ATOM 10224 H HB2  . GLN A 1 60  ? 130.429 14.249  9.033   1.00 0.00 ? 60  GLN A HB2  5  
ATOM 10225 H HB3  . GLN A 1 60  ? 131.441 13.839  7.655   1.00 0.00 ? 60  GLN A HB3  5  
ATOM 10226 H HG2  . GLN A 1 60  ? 130.535 15.695  6.387   1.00 0.00 ? 60  GLN A HG2  5  
ATOM 10227 H HG3  . GLN A 1 60  ? 129.414 16.077  7.691   1.00 0.00 ? 60  GLN A HG3  5  
ATOM 10228 H HE21 . GLN A 1 60  ? 131.420 15.541  9.771   1.00 0.00 ? 60  GLN A HE21 5  
ATOM 10229 H HE22 . GLN A 1 60  ? 132.496 16.891  9.743   1.00 0.00 ? 60  GLN A HE22 5  
ATOM 10230 N N    . GLU A 1 61  ? 129.471 11.495  9.011   1.00 0.00 ? 61  GLU A N    5  
ATOM 10231 C CA   . GLU A 1 61  ? 129.642 10.110  9.450   1.00 0.00 ? 61  GLU A CA   5  
ATOM 10232 C C    . GLU A 1 61  ? 128.649 9.186   8.745   1.00 0.00 ? 61  GLU A C    5  
ATOM 10233 O O    . GLU A 1 61  ? 128.941 8.015   8.498   1.00 0.00 ? 61  GLU A O    5  
ATOM 10234 C CB   . GLU A 1 61  ? 129.481 9.994   10.973  1.00 0.00 ? 61  GLU A CB   5  
ATOM 10235 C CG   . GLU A 1 61  ? 130.681 10.506  11.765  1.00 0.00 ? 61  GLU A CG   5  
ATOM 10236 C CD   . GLU A 1 61  ? 131.958 9.733   11.456  1.00 0.00 ? 61  GLU A CD   5  
ATOM 10237 O OE1  . GLU A 1 61  ? 132.011 8.517   11.749  1.00 0.00 ? 61  GLU A OE1  5  
ATOM 10238 O OE2  . GLU A 1 61  ? 132.913 10.333  10.923  1.00 0.00 ? 61  GLU A OE2  5  
ATOM 10239 H H    . GLU A 1 61  ? 129.208 12.175  9.669   1.00 0.00 ? 61  GLU A H    5  
ATOM 10240 H HA   . GLU A 1 61  ? 130.644 9.804   9.181   1.00 0.00 ? 61  GLU A HA   5  
ATOM 10241 H HB2  . GLU A 1 61  ? 128.611 10.559  11.275  1.00 0.00 ? 61  GLU A HB2  5  
ATOM 10242 H HB3  . GLU A 1 61  ? 129.327 8.954   11.231  1.00 0.00 ? 61  GLU A HB3  5  
ATOM 10243 H HG2  . GLU A 1 61  ? 130.837 11.549  11.526  1.00 0.00 ? 61  GLU A HG2  5  
ATOM 10244 H HG3  . GLU A 1 61  ? 130.467 10.411  12.821  1.00 0.00 ? 61  GLU A HG3  5  
ATOM 10245 N N    . LYS A 1 62  ? 127.477 9.717   8.422   1.00 0.00 ? 62  LYS A N    5  
ATOM 10246 C CA   . LYS A 1 62  ? 126.448 8.949   7.730   1.00 0.00 ? 62  LYS A CA   5  
ATOM 10247 C C    . LYS A 1 62  ? 126.773 8.805   6.246   1.00 0.00 ? 62  LYS A C    5  
ATOM 10248 O O    . LYS A 1 62  ? 126.438 7.792   5.631   1.00 0.00 ? 62  LYS A O    5  
ATOM 10249 C CB   . LYS A 1 62  ? 125.067 9.595   7.930   1.00 0.00 ? 62  LYS A CB   5  
ATOM 10250 C CG   . LYS A 1 62  ? 124.413 9.229   9.257   1.00 0.00 ? 62  LYS A CG   5  
ATOM 10251 C CD   . LYS A 1 62  ? 124.131 7.731   9.325   1.00 0.00 ? 62  LYS A CD   5  
ATOM 10252 C CE   . LYS A 1 62  ? 123.592 7.297   10.681  1.00 0.00 ? 62  LYS A CE   5  
ATOM 10253 N NZ   . LYS A 1 62  ? 123.291 5.841   10.701  1.00 0.00 ? 62  LYS A NZ   5  
ATOM 10254 H H    . LYS A 1 62  ? 127.298 10.652  8.656   1.00 0.00 ? 62  LYS A H    5  
ATOM 10255 H HA   . LYS A 1 62  ? 126.433 7.960   8.169   1.00 0.00 ? 62  LYS A HA   5  
ATOM 10256 H HB2  . LYS A 1 62  ? 125.175 10.670  7.889   1.00 0.00 ? 62  LYS A HB2  5  
ATOM 10257 H HB3  . LYS A 1 62  ? 124.411 9.279   7.131   1.00 0.00 ? 62  LYS A HB3  5  
ATOM 10258 H HG2  . LYS A 1 62  ? 125.076 9.502   10.067  1.00 0.00 ? 62  LYS A HG2  5  
ATOM 10259 H HG3  . LYS A 1 62  ? 123.481 9.769   9.353   1.00 0.00 ? 62  LYS A HG3  5  
ATOM 10260 H HD2  . LYS A 1 62  ? 123.401 7.479   8.569   1.00 0.00 ? 62  LYS A HD2  5  
ATOM 10261 H HD3  . LYS A 1 62  ? 125.050 7.193   9.127   1.00 0.00 ? 62  LYS A HD3  5  
ATOM 10262 H HE2  . LYS A 1 62  ? 124.332 7.513   11.438  1.00 0.00 ? 62  LYS A HE2  5  
ATOM 10263 H HE3  . LYS A 1 62  ? 122.686 7.847   10.892  1.00 0.00 ? 62  LYS A HE3  5  
ATOM 10264 H HZ1  . LYS A 1 62  ? 124.125 5.299   10.389  1.00 0.00 ? 62  LYS A HZ1  5  
ATOM 10265 H HZ2  . LYS A 1 62  ? 122.498 5.629   10.060  1.00 0.00 ? 62  LYS A HZ2  5  
ATOM 10266 H HZ3  . LYS A 1 62  ? 123.037 5.541   11.661  1.00 0.00 ? 62  LYS A HZ3  5  
ATOM 10267 N N    . ALA A 1 63  ? 127.442 9.807   5.681   1.00 0.00 ? 63  ALA A N    5  
ATOM 10268 C CA   . ALA A 1 63  ? 127.815 9.777   4.270   1.00 0.00 ? 63  ALA A CA   5  
ATOM 10269 C C    . ALA A 1 63  ? 128.775 8.624   4.010   1.00 0.00 ? 63  ALA A C    5  
ATOM 10270 O O    . ALA A 1 63  ? 128.523 7.761   3.166   1.00 0.00 ? 63  ALA A O    5  
ATOM 10271 C CB   . ALA A 1 63  ? 128.441 11.105  3.852   1.00 0.00 ? 63  ALA A CB   5  
ATOM 10272 H H    . ALA A 1 63  ? 127.697 10.581  6.227   1.00 0.00 ? 63  ALA A H    5  
ATOM 10273 H HA   . ALA A 1 63  ? 126.915 9.627   3.688   1.00 0.00 ? 63  ALA A HA   5  
ATOM 10274 H HB1  . ALA A 1 63  ? 127.739 11.907  4.033   1.00 0.00 ? 63  ALA A HB1  5  
ATOM 10275 H HB2  . ALA A 1 63  ? 128.687 11.074  2.800   1.00 0.00 ? 63  ALA A HB2  5  
ATOM 10276 H HB3  . ALA A 1 63  ? 129.340 11.278  4.426   1.00 0.00 ? 63  ALA A HB3  5  
ATOM 10277 N N    . LYS A 1 64  ? 129.866 8.615   4.766   1.00 0.00 ? 64  LYS A N    5  
ATOM 10278 C CA   . LYS A 1 64  ? 130.858 7.547   4.695   1.00 0.00 ? 64  LYS A CA   5  
ATOM 10279 C C    . LYS A 1 64  ? 130.234 6.200   5.066   1.00 0.00 ? 64  LYS A C    5  
ATOM 10280 O O    . LYS A 1 64  ? 130.600 5.165   4.507   1.00 0.00 ? 64  LYS A O    5  
ATOM 10281 C CB   . LYS A 1 64  ? 132.049 7.880   5.614   1.00 0.00 ? 64  LYS A CB   5  
ATOM 10282 C CG   . LYS A 1 64  ? 131.636 8.331   7.014   1.00 0.00 ? 64  LYS A CG   5  
ATOM 10283 C CD   . LYS A 1 64  ? 132.786 8.977   7.785   1.00 0.00 ? 64  LYS A CD   5  
ATOM 10284 C CE   . LYS A 1 64  ? 133.741 7.948   8.377   1.00 0.00 ? 64  LYS A CE   5  
ATOM 10285 N NZ   . LYS A 1 64  ? 133.100 7.155   9.459   1.00 0.00 ? 64  LYS A NZ   5  
ATOM 10286 H H    . LYS A 1 64  ? 130.008 9.356   5.393   1.00 0.00 ? 64  LYS A H    5  
ATOM 10287 H HA   . LYS A 1 64  ? 131.210 7.494   3.673   1.00 0.00 ? 64  LYS A HA   5  
ATOM 10288 H HB2  . LYS A 1 64  ? 132.674 7.003   5.709   1.00 0.00 ? 64  LYS A HB2  5  
ATOM 10289 H HB3  . LYS A 1 64  ? 132.626 8.673   5.159   1.00 0.00 ? 64  LYS A HB3  5  
ATOM 10290 H HG2  . LYS A 1 64  ? 130.835 9.049   6.926   1.00 0.00 ? 64  LYS A HG2  5  
ATOM 10291 H HG3  . LYS A 1 64  ? 131.282 7.471   7.566   1.00 0.00 ? 64  LYS A HG3  5  
ATOM 10292 H HD2  . LYS A 1 64  ? 133.338 9.621   7.115   1.00 0.00 ? 64  LYS A HD2  5  
ATOM 10293 H HD3  . LYS A 1 64  ? 132.370 9.572   8.588   1.00 0.00 ? 64  LYS A HD3  5  
ATOM 10294 H HE2  . LYS A 1 64  ? 134.061 7.276   7.594   1.00 0.00 ? 64  LYS A HE2  5  
ATOM 10295 H HE3  . LYS A 1 64  ? 134.600 8.463   8.781   1.00 0.00 ? 64  LYS A HE3  5  
ATOM 10296 H HZ1  . LYS A 1 64  ? 133.774 6.463   9.845   1.00 0.00 ? 64  LYS A HZ1  5  
ATOM 10297 H HZ2  . LYS A 1 64  ? 132.277 6.640   9.090   1.00 0.00 ? 64  LYS A HZ2  5  
ATOM 10298 H HZ3  . LYS A 1 64  ? 132.787 7.781   10.229  1.00 0.00 ? 64  LYS A HZ3  5  
ATOM 10299 N N    . GLU A 1 65  ? 129.271 6.228   5.990   1.00 0.00 ? 65  GLU A N    5  
ATOM 10300 C CA   . GLU A 1 65  ? 128.584 5.013   6.426   1.00 0.00 ? 65  GLU A CA   5  
ATOM 10301 C C    . GLU A 1 65  ? 127.827 4.365   5.265   1.00 0.00 ? 65  GLU A C    5  
ATOM 10302 O O    . GLU A 1 65  ? 128.266 3.353   4.714   1.00 0.00 ? 65  GLU A O    5  
ATOM 10303 C CB   . GLU A 1 65  ? 127.601 5.313   7.570   1.00 0.00 ? 65  GLU A CB   5  
ATOM 10304 C CG   . GLU A 1 65  ? 126.841 4.081   8.063   1.00 0.00 ? 65  GLU A CG   5  
ATOM 10305 C CD   . GLU A 1 65  ? 125.664 4.425   8.964   1.00 0.00 ? 65  GLU A CD   5  
ATOM 10306 O OE1  . GLU A 1 65  ? 124.547 4.621   8.445   1.00 0.00 ? 65  GLU A OE1  5  
ATOM 10307 O OE2  . GLU A 1 65  ? 125.842 4.493   10.199  1.00 0.00 ? 65  GLU A OE2  5  
ATOM 10308 H H    . GLU A 1 65  ? 129.020 7.086   6.390   1.00 0.00 ? 65  GLU A H    5  
ATOM 10309 H HA   . GLU A 1 65  ? 129.334 4.320   6.782   1.00 0.00 ? 65  GLU A HA   5  
ATOM 10310 H HB2  . GLU A 1 65  ? 128.150 5.730   8.403   1.00 0.00 ? 65  GLU A HB2  5  
ATOM 10311 H HB3  . GLU A 1 65  ? 126.879 6.043   7.228   1.00 0.00 ? 65  GLU A HB3  5  
ATOM 10312 H HG2  . GLU A 1 65  ? 126.469 3.537   7.206   1.00 0.00 ? 65  GLU A HG2  5  
ATOM 10313 H HG3  . GLU A 1 65  ? 127.525 3.449   8.613   1.00 0.00 ? 65  GLU A HG3  5  
ATOM 10314 N N    . ILE A 1 66  ? 126.703 4.972   4.882   1.00 0.00 ? 66  ILE A N    5  
ATOM 10315 C CA   . ILE A 1 66  ? 125.789 4.367   3.916   1.00 0.00 ? 66  ILE A CA   5  
ATOM 10316 C C    . ILE A 1 66  ? 126.463 4.134   2.566   1.00 0.00 ? 66  ILE A C    5  
ATOM 10317 O O    . ILE A 1 66  ? 126.149 3.167   1.869   1.00 0.00 ? 66  ILE A O    5  
ATOM 10318 C CB   . ILE A 1 66  ? 124.502 5.210   3.724   1.00 0.00 ? 66  ILE A CB   5  
ATOM 10319 C CG1  . ILE A 1 66  ? 124.828 6.618   3.202   1.00 0.00 ? 66  ILE A CG1  5  
ATOM 10320 C CG2  . ILE A 1 66  ? 123.722 5.291   5.036   1.00 0.00 ? 66  ILE A CG2  5  
ATOM 10321 C CD1  . ILE A 1 66  ? 123.604 7.484   2.981   1.00 0.00 ? 66  ILE A CD1  5  
ATOM 10322 H H    . ILE A 1 66  ? 126.483 5.852   5.259   1.00 0.00 ? 66  ILE A H    5  
ATOM 10323 H HA   . ILE A 1 66  ? 125.495 3.404   4.315   1.00 0.00 ? 66  ILE A HA   5  
ATOM 10324 H HB   . ILE A 1 66  ? 123.879 4.704   2.999   1.00 0.00 ? 66  ILE A HB   5  
ATOM 10325 H HG12 . ILE A 1 66  ? 125.463 7.123   3.913   1.00 0.00 ? 66  ILE A HG12 5  
ATOM 10326 H HG13 . ILE A 1 66  ? 125.349 6.535   2.258   1.00 0.00 ? 66  ILE A HG13 5  
ATOM 10327 H HG21 . ILE A 1 66  ? 123.467 4.294   5.367   1.00 0.00 ? 66  ILE A HG21 5  
ATOM 10328 H HG22 . ILE A 1 66  ? 122.816 5.859   4.883   1.00 0.00 ? 66  ILE A HG22 5  
ATOM 10329 H HG23 . ILE A 1 66  ? 124.327 5.776   5.788   1.00 0.00 ? 66  ILE A HG23 5  
ATOM 10330 H HD11 . ILE A 1 66  ? 123.910 8.455   2.623   1.00 0.00 ? 66  ILE A HD11 5  
ATOM 10331 H HD12 . ILE A 1 66  ? 123.067 7.598   3.912   1.00 0.00 ? 66  ILE A HD12 5  
ATOM 10332 H HD13 . ILE A 1 66  ? 122.960 7.018   2.249   1.00 0.00 ? 66  ILE A HD13 5  
ATOM 10333 N N    . TYR A 1 67  ? 127.397 5.006   2.203   1.00 0.00 ? 67  TYR A N    5  
ATOM 10334 C CA   . TYR A 1 67  ? 128.144 4.838   0.960   1.00 0.00 ? 67  TYR A CA   5  
ATOM 10335 C C    . TYR A 1 67  ? 128.975 3.557   1.012   1.00 0.00 ? 67  TYR A C    5  
ATOM 10336 O O    . TYR A 1 67  ? 128.804 2.663   0.184   1.00 0.00 ? 67  TYR A O    5  
ATOM 10337 C CB   . TYR A 1 67  ? 129.057 6.043   0.693   1.00 0.00 ? 67  TYR A CB   5  
ATOM 10338 C CG   . TYR A 1 67  ? 129.833 5.930   -0.608  1.00 0.00 ? 67  TYR A CG   5  
ATOM 10339 C CD1  . TYR A 1 67  ? 129.237 6.247   -1.826  1.00 0.00 ? 67  TYR A CD1  5  
ATOM 10340 C CD2  . TYR A 1 67  ? 131.154 5.489   -0.622  1.00 0.00 ? 67  TYR A CD2  5  
ATOM 10341 C CE1  . TYR A 1 67  ? 129.933 6.129   -3.011  1.00 0.00 ? 67  TYR A CE1  5  
ATOM 10342 C CE2  . TYR A 1 67  ? 131.854 5.369   -1.807  1.00 0.00 ? 67  TYR A CE2  5  
ATOM 10343 C CZ   . TYR A 1 67  ? 131.239 5.690   -2.999  1.00 0.00 ? 67  TYR A CZ   5  
ATOM 10344 O OH   . TYR A 1 67  ? 131.932 5.571   -4.181  1.00 0.00 ? 67  TYR A OH   5  
ATOM 10345 H H    . TYR A 1 67  ? 127.583 5.779   2.779   1.00 0.00 ? 67  TYR A H    5  
ATOM 10346 H HA   . TYR A 1 67  ? 127.429 4.756   0.152   1.00 0.00 ? 67  TYR A HA   5  
ATOM 10347 H HB2  . TYR A 1 67  ? 128.456 6.940   0.648   1.00 0.00 ? 67  TYR A HB2  5  
ATOM 10348 H HB3  . TYR A 1 67  ? 129.770 6.134   1.502   1.00 0.00 ? 67  TYR A HB3  5  
ATOM 10349 H HD1  . TYR A 1 67  ? 128.215 6.597   -1.839  1.00 0.00 ? 67  TYR A HD1  5  
ATOM 10350 H HD2  . TYR A 1 67  ? 131.634 5.238   0.313   1.00 0.00 ? 67  TYR A HD2  5  
ATOM 10351 H HE1  . TYR A 1 67  ? 129.449 6.378   -3.943  1.00 0.00 ? 67  TYR A HE1  5  
ATOM 10352 H HE2  . TYR A 1 67  ? 132.878 5.025   -1.795  1.00 0.00 ? 67  TYR A HE2  5  
ATOM 10353 H HH   . TYR A 1 67  ? 131.815 6.372   -4.707  1.00 0.00 ? 67  TYR A HH   5  
ATOM 10354 N N    . MET A 1 68  ? 129.851 3.471   2.009   1.00 0.00 ? 68  MET A N    5  
ATOM 10355 C CA   . MET A 1 68  ? 130.808 2.370   2.122   1.00 0.00 ? 68  MET A CA   5  
ATOM 10356 C C    . MET A 1 68  ? 130.119 1.065   2.530   1.00 0.00 ? 68  MET A C    5  
ATOM 10357 O O    . MET A 1 68  ? 130.671 -0.022  2.344   1.00 0.00 ? 68  MET A O    5  
ATOM 10358 C CB   . MET A 1 68  ? 131.899 2.741   3.137   1.00 0.00 ? 68  MET A CB   5  
ATOM 10359 C CG   . MET A 1 68  ? 132.965 1.672   3.342   1.00 0.00 ? 68  MET A CG   5  
ATOM 10360 S SD   . MET A 1 68  ? 134.235 2.186   4.517   1.00 0.00 ? 68  MET A SD   5  
ATOM 10361 C CE   . MET A 1 68  ? 135.235 0.702   4.612   1.00 0.00 ? 68  MET A CE   5  
ATOM 10362 H H    . MET A 1 68  ? 129.851 4.169   2.702   1.00 0.00 ? 68  MET A H    5  
ATOM 10363 H HA   . MET A 1 68  ? 131.268 2.230   1.152   1.00 0.00 ? 68  MET A HA   5  
ATOM 10364 H HB2  . MET A 1 68  ? 132.391 3.643   2.802   1.00 0.00 ? 68  MET A HB2  5  
ATOM 10365 H HB3  . MET A 1 68  ? 131.431 2.937   4.092   1.00 0.00 ? 68  MET A HB3  5  
ATOM 10366 H HG2  . MET A 1 68  ? 132.492 0.774   3.713   1.00 0.00 ? 68  MET A HG2  5  
ATOM 10367 H HG3  . MET A 1 68  ? 133.436 1.463   2.392   1.00 0.00 ? 68  MET A HG3  5  
ATOM 10368 H HE1  . MET A 1 68  ? 135.621 0.463   3.632   1.00 0.00 ? 68  MET A HE1  5  
ATOM 10369 H HE2  . MET A 1 68  ? 134.630 -0.118  4.971   1.00 0.00 ? 68  MET A HE2  5  
ATOM 10370 H HE3  . MET A 1 68  ? 136.058 0.866   5.292   1.00 0.00 ? 68  MET A HE3  5  
ATOM 10371 N N    . THR A 1 69  ? 128.918 1.174   3.087   1.00 0.00 ? 69  THR A N    5  
ATOM 10372 C CA   . THR A 1 69  ? 128.176 0.003   3.544   1.00 0.00 ? 69  THR A CA   5  
ATOM 10373 C C    . THR A 1 69  ? 127.230 -0.527  2.460   1.00 0.00 ? 69  THR A C    5  
ATOM 10374 O O    . THR A 1 69  ? 127.256 -1.715  2.134   1.00 0.00 ? 69  THR A O    5  
ATOM 10375 C CB   . THR A 1 69  ? 127.372 0.328   4.824   1.00 0.00 ? 69  THR A CB   5  
ATOM 10376 O OG1  . THR A 1 69  ? 128.264 0.813   5.839   1.00 0.00 ? 69  THR A OG1  5  
ATOM 10377 C CG2  . THR A 1 69  ? 126.626 -0.899  5.342   1.00 0.00 ? 69  THR A CG2  5  
ATOM 10378 H H    . THR A 1 69  ? 128.524 2.064   3.201   1.00 0.00 ? 69  THR A H    5  
ATOM 10379 H HA   . THR A 1 69  ? 128.893 -0.770  3.788   1.00 0.00 ? 69  THR A HA   5  
ATOM 10380 H HB   . THR A 1 69  ? 126.651 1.101   4.593   1.00 0.00 ? 69  THR A HB   5  
ATOM 10381 H HG1  . THR A 1 69  ? 128.451 1.745   5.678   1.00 0.00 ? 69  THR A HG1  5  
ATOM 10382 H HG21 . THR A 1 69  ? 126.085 -0.640  6.241   1.00 0.00 ? 69  THR A HG21 5  
ATOM 10383 H HG22 . THR A 1 69  ? 127.334 -1.685  5.563   1.00 0.00 ? 69  THR A HG22 5  
ATOM 10384 H HG23 . THR A 1 69  ? 125.930 -1.244  4.591   1.00 0.00 ? 69  THR A HG23 5  
ATOM 10385 N N    . PHE A 1 70  ? 126.410 0.359   1.893   1.00 0.00 ? 70  PHE A N    5  
ATOM 10386 C CA   . PHE A 1 70  ? 125.359 -0.054  0.960   1.00 0.00 ? 70  PHE A CA   5  
ATOM 10387 C C    . PHE A 1 70  ? 125.792 0.105   -0.497  1.00 0.00 ? 70  PHE A C    5  
ATOM 10388 O O    . PHE A 1 70  ? 125.578 -0.791  -1.310  1.00 0.00 ? 70  PHE A O    5  
ATOM 10389 C CB   . PHE A 1 70  ? 124.069 0.742   1.213   1.00 0.00 ? 70  PHE A CB   5  
ATOM 10390 C CG   . PHE A 1 70  ? 123.525 0.582   2.612   1.00 0.00 ? 70  PHE A CG   5  
ATOM 10391 C CD1  . PHE A 1 70  ? 123.158 -0.669  3.089   1.00 0.00 ? 70  PHE A CD1  5  
ATOM 10392 C CD2  . PHE A 1 70  ? 123.377 1.680   3.447   1.00 0.00 ? 70  PHE A CD2  5  
ATOM 10393 C CE1  . PHE A 1 70  ? 122.656 -0.819  4.367   1.00 0.00 ? 70  PHE A CE1  5  
ATOM 10394 C CE2  . PHE A 1 70  ? 122.876 1.534   4.726   1.00 0.00 ? 70  PHE A CE2  5  
ATOM 10395 C CZ   . PHE A 1 70  ? 122.516 0.284   5.187   1.00 0.00 ? 70  PHE A CZ   5  
ATOM 10396 H H    . PHE A 1 70  ? 126.518 1.310   2.098   1.00 0.00 ? 70  PHE A H    5  
ATOM 10397 H HA   . PHE A 1 70  ? 125.154 -1.101  1.141   1.00 0.00 ? 70  PHE A HA   5  
ATOM 10398 H HB2  . PHE A 1 70  ? 124.263 1.793   1.047   1.00 0.00 ? 70  PHE A HB2  5  
ATOM 10399 H HB3  . PHE A 1 70  ? 123.308 0.411   0.520   1.00 0.00 ? 70  PHE A HB3  5  
ATOM 10400 H HD1  . PHE A 1 70  ? 123.268 -1.533  2.450   1.00 0.00 ? 70  PHE A HD1  5  
ATOM 10401 H HD2  . PHE A 1 70  ? 123.658 2.660   3.089   1.00 0.00 ? 70  PHE A HD2  5  
ATOM 10402 H HE1  . PHE A 1 70  ? 122.374 -1.799  4.726   1.00 0.00 ? 70  PHE A HE1  5  
ATOM 10403 H HE2  . PHE A 1 70  ? 122.766 2.399   5.365   1.00 0.00 ? 70  PHE A HE2  5  
ATOM 10404 H HZ   . PHE A 1 70  ? 122.124 0.168   6.187   1.00 0.00 ? 70  PHE A HZ   5  
ATOM 10405 N N    . LEU A 1 71  ? 126.397 1.244   -0.835  1.00 0.00 ? 71  LEU A N    5  
ATOM 10406 C CA   . LEU A 1 71  ? 126.796 1.500   -2.220  1.00 0.00 ? 71  LEU A CA   5  
ATOM 10407 C C    . LEU A 1 71  ? 128.137 0.834   -2.507  1.00 0.00 ? 71  LEU A C    5  
ATOM 10408 O O    . LEU A 1 71  ? 128.165 -0.285  -2.999  1.00 0.00 ? 71  LEU A O    5  
ATOM 10409 C CB   . LEU A 1 71  ? 126.853 3.009   -2.528  1.00 0.00 ? 71  LEU A CB   5  
ATOM 10410 C CG   . LEU A 1 71  ? 125.497 3.740   -2.511  1.00 0.00 ? 71  LEU A CG   5  
ATOM 10411 C CD1  . LEU A 1 71  ? 124.936 3.841   -1.096  1.00 0.00 ? 71  LEU A CD1  5  
ATOM 10412 C CD2  . LEU A 1 71  ? 125.623 5.124   -3.140  1.00 0.00 ? 71  LEU A CD2  5  
ATOM 10413 H H    . LEU A 1 71  ? 126.596 1.912   -0.143  1.00 0.00 ? 71  LEU A H    5  
ATOM 10414 H HA   . LEU A 1 71  ? 126.050 1.046   -2.861  1.00 0.00 ? 71  LEU A HA   5  
ATOM 10415 H HB2  . LEU A 1 71  ? 127.505 3.481   -1.804  1.00 0.00 ? 71  LEU A HB2  5  
ATOM 10416 H HB3  . LEU A 1 71  ? 127.289 3.135   -3.509  1.00 0.00 ? 71  LEU A HB3  5  
ATOM 10417 H HG   . LEU A 1 71  ? 124.789 3.175   -3.101  1.00 0.00 ? 71  LEU A HG   5  
ATOM 10418 H HD11 . LEU A 1 71  ? 125.622 4.395   -0.471  1.00 0.00 ? 71  LEU A HD11 5  
ATOM 10419 H HD12 . LEU A 1 71  ? 124.802 2.849   -0.689  1.00 0.00 ? 71  LEU A HD12 5  
ATOM 10420 H HD13 . LEU A 1 71  ? 123.983 4.349   -1.121  1.00 0.00 ? 71  LEU A HD13 5  
ATOM 10421 H HD21 . LEU A 1 71  ? 126.330 5.716   -2.576  1.00 0.00 ? 71  LEU A HD21 5  
ATOM 10422 H HD22 . LEU A 1 71  ? 124.660 5.613   -3.136  1.00 0.00 ? 71  LEU A HD22 5  
ATOM 10423 H HD23 . LEU A 1 71  ? 125.970 5.025   -4.159  1.00 0.00 ? 71  LEU A HD23 5  
ATOM 10424 N N    . SER A 1 72  ? 129.224 1.522   -2.144  1.00 0.00 ? 72  SER A N    5  
ATOM 10425 C CA   . SER A 1 72  ? 130.599 1.035   -2.261  1.00 0.00 ? 72  SER A CA   5  
ATOM 10426 C C    . SER A 1 72  ? 130.977 0.527   -3.666  1.00 0.00 ? 72  SER A C    5  
ATOM 10427 O O    . SER A 1 72  ? 131.783 1.163   -4.350  1.00 0.00 ? 72  SER A O    5  
ATOM 10428 C CB   . SER A 1 72  ? 130.851 -0.049  -1.214  1.00 0.00 ? 72  SER A CB   5  
ATOM 10429 O OG   . SER A 1 72  ? 130.119 -1.232  -1.497  1.00 0.00 ? 72  SER A OG   5  
ATOM 10430 H H    . SER A 1 72  ? 129.098 2.396   -1.741  1.00 0.00 ? 72  SER A H    5  
ATOM 10431 H HA   . SER A 1 72  ? 131.242 1.872   -2.031  1.00 0.00 ? 72  SER A HA   5  
ATOM 10432 H HB2  . SER A 1 72  ? 131.896 -0.281  -1.200  1.00 0.00 ? 72  SER A HB2  5  
ATOM 10433 H HB3  . SER A 1 72  ? 130.555 0.317   -0.241  1.00 0.00 ? 72  SER A HB3  5  
ATOM 10434 H HG   . SER A 1 72  ? 129.184 -1.083  -1.310  1.00 0.00 ? 72  SER A HG   5  
ATOM 10435 N N    . SER A 1 73  ? 130.380 -0.609  -4.060  1.00 0.00 ? 73  SER A N    5  
ATOM 10436 C CA   . SER A 1 73  ? 130.737 -1.389  -5.254  1.00 0.00 ? 73  SER A CA   5  
ATOM 10437 C C    . SER A 1 73  ? 131.699 -2.500  -4.840  1.00 0.00 ? 73  SER A C    5  
ATOM 10438 O O    . SER A 1 73  ? 132.301 -3.174  -5.680  1.00 0.00 ? 73  SER A O    5  
ATOM 10439 C CB   . SER A 1 73  ? 131.338 -0.531  -6.384  1.00 0.00 ? 73  SER A CB   5  
ATOM 10440 O OG   . SER A 1 73  ? 130.478 0.551   -6.717  1.00 0.00 ? 73  SER A OG   5  
ATOM 10441 H H    . SER A 1 73  ? 129.666 -0.960  -3.499  1.00 0.00 ? 73  SER A H    5  
ATOM 10442 H HA   . SER A 1 73  ? 129.827 -1.853  -5.614  1.00 0.00 ? 73  SER A HA   5  
ATOM 10443 H HB2  . SER A 1 73  ? 132.289 -0.131  -6.065  1.00 0.00 ? 73  SER A HB2  5  
ATOM 10444 H HB3  . SER A 1 73  ? 131.482 -1.143  -7.263  1.00 0.00 ? 73  SER A HB3  5  
ATOM 10445 H HG   . SER A 1 73  ? 130.657 1.287   -6.121  1.00 0.00 ? 73  SER A HG   5  
ATOM 10446 N N    . LYS A 1 74  ? 131.803 -2.698  -3.519  1.00 0.00 ? 74  LYS A N    5  
ATOM 10447 C CA   . LYS A 1 74  ? 132.718 -3.668  -2.925  1.00 0.00 ? 74  LYS A CA   5  
ATOM 10448 C C    . LYS A 1 74  ? 132.130 -4.135  -1.590  1.00 0.00 ? 74  LYS A C    5  
ATOM 10449 O O    . LYS A 1 74  ? 131.353 -5.089  -1.556  1.00 0.00 ? 74  LYS A O    5  
ATOM 10450 C CB   . LYS A 1 74  ? 134.119 -3.047  -2.717  1.00 0.00 ? 74  LYS A CB   5  
ATOM 10451 C CG   . LYS A 1 74  ? 134.768 -2.528  -4.001  1.00 0.00 ? 74  LYS A CG   5  
ATOM 10452 C CD   . LYS A 1 74  ? 136.051 -1.743  -3.733  1.00 0.00 ? 74  LYS A CD   5  
ATOM 10453 C CE   . LYS A 1 74  ? 136.636 -1.167  -5.022  1.00 0.00 ? 74  LYS A CE   5  
ATOM 10454 N NZ   . LYS A 1 74  ? 137.852 -0.347  -4.771  1.00 0.00 ? 74  LYS A NZ   5  
ATOM 10455 H H    . LYS A 1 74  ? 131.213 -2.190  -2.917  1.00 0.00 ? 74  LYS A H    5  
ATOM 10456 H HA   . LYS A 1 74  ? 132.795 -4.517  -3.593  1.00 0.00 ? 74  LYS A HA   5  
ATOM 10457 H HB2  . LYS A 1 74  ? 134.032 -2.221  -2.025  1.00 0.00 ? 74  LYS A HB2  5  
ATOM 10458 H HB3  . LYS A 1 74  ? 134.771 -3.795  -2.286  1.00 0.00 ? 74  LYS A HB3  5  
ATOM 10459 H HG2  . LYS A 1 74  ? 135.003 -3.369  -4.637  1.00 0.00 ? 74  LYS A HG2  5  
ATOM 10460 H HG3  . LYS A 1 74  ? 134.064 -1.883  -4.508  1.00 0.00 ? 74  LYS A HG3  5  
ATOM 10461 H HD2  . LYS A 1 74  ? 135.830 -0.930  -3.056  1.00 0.00 ? 74  LYS A HD2  5  
ATOM 10462 H HD3  . LYS A 1 74  ? 136.779 -2.403  -3.280  1.00 0.00 ? 74  LYS A HD3  5  
ATOM 10463 H HE2  . LYS A 1 74  ? 136.897 -1.982  -5.681  1.00 0.00 ? 74  LYS A HE2  5  
ATOM 10464 H HE3  . LYS A 1 74  ? 135.889 -0.548  -5.498  1.00 0.00 ? 74  LYS A HE3  5  
ATOM 10465 H HZ1  . LYS A 1 74  ? 138.262 -0.029  -5.671  1.00 0.00 ? 74  LYS A HZ1  5  
ATOM 10466 H HZ2  . LYS A 1 74  ? 138.563 -0.904  -4.258  1.00 0.00 ? 74  LYS A HZ2  5  
ATOM 10467 H HZ3  . LYS A 1 74  ? 137.610 0.491   -4.201  1.00 0.00 ? 74  LYS A HZ3  5  
ATOM 10468 N N    . ALA A 1 75  ? 132.480 -3.419  -0.511  1.00 0.00 ? 75  ALA A N    5  
ATOM 10469 C CA   . ALA A 1 75  ? 131.927 -3.640  0.833   1.00 0.00 ? 75  ALA A CA   5  
ATOM 10470 C C    . ALA A 1 75  ? 131.740 -5.120  1.169   1.00 0.00 ? 75  ALA A C    5  
ATOM 10471 O O    . ALA A 1 75  ? 132.627 -5.766  1.733   1.00 0.00 ? 75  ALA A O    5  
ATOM 10472 C CB   . ALA A 1 75  ? 130.604 -2.888  0.990   1.00 0.00 ? 75  ALA A CB   5  
ATOM 10473 H H    . ALA A 1 75  ? 133.143 -2.708  -0.621  1.00 0.00 ? 75  ALA A H    5  
ATOM 10474 H HA   . ALA A 1 75  ? 132.627 -3.217  1.540   1.00 0.00 ? 75  ALA A HA   5  
ATOM 10475 H HB1  . ALA A 1 75  ? 130.764 -1.835  0.807   1.00 0.00 ? 75  ALA A HB1  5  
ATOM 10476 H HB2  . ALA A 1 75  ? 130.226 -3.025  1.992   1.00 0.00 ? 75  ALA A HB2  5  
ATOM 10477 H HB3  . ALA A 1 75  ? 129.882 -3.269  0.276   1.00 0.00 ? 75  ALA A HB3  5  
ATOM 10478 N N    . SER A 1 76  ? 130.578 -5.637  0.793   1.00 0.00 ? 76  SER A N    5  
ATOM 10479 C CA   . SER A 1 76  ? 130.154 -6.995  1.111   1.00 0.00 ? 76  SER A CA   5  
ATOM 10480 C C    . SER A 1 76  ? 128.912 -7.317  0.295   1.00 0.00 ? 76  SER A C    5  
ATOM 10481 O O    . SER A 1 76  ? 128.727 -8.440  -0.173  1.00 0.00 ? 76  SER A O    5  
ATOM 10482 C CB   . SER A 1 76  ? 129.836 -7.141  2.610   1.00 0.00 ? 76  SER A CB   5  
ATOM 10483 O OG   . SER A 1 76  ? 130.935 -6.754  3.420   1.00 0.00 ? 76  SER A OG   5  
ATOM 10484 H H    . SER A 1 76  ? 129.989 -5.088  0.239   1.00 0.00 ? 76  SER A H    5  
ATOM 10485 H HA   . SER A 1 76  ? 130.944 -7.676  0.835   1.00 0.00 ? 76  SER A HA   5  
ATOM 10486 H HB2  . SER A 1 76  ? 128.990 -6.516  2.859   1.00 0.00 ? 76  SER A HB2  5  
ATOM 10487 H HB3  . SER A 1 76  ? 129.594 -8.172  2.825   1.00 0.00 ? 76  SER A HB3  5  
ATOM 10488 H HG   . SER A 1 76  ? 131.754 -7.069  3.014   1.00 0.00 ? 76  SER A HG   5  
ATOM 10489 N N    . SER A 1 77  ? 128.070 -6.305  0.124   1.00 0.00 ? 77  SER A N    5  
ATOM 10490 C CA   . SER A 1 77  ? 126.833 -6.437  -0.621  1.00 0.00 ? 77  SER A CA   5  
ATOM 10491 C C    . SER A 1 77  ? 126.424 -5.060  -1.135  1.00 0.00 ? 77  SER A C    5  
ATOM 10492 O O    . SER A 1 77  ? 125.933 -4.230  -0.372  1.00 0.00 ? 77  SER A O    5  
ATOM 10493 C CB   . SER A 1 77  ? 125.726 -7.025  0.272   1.00 0.00 ? 77  SER A CB   5  
ATOM 10494 O OG   . SER A 1 77  ? 126.179 -8.182  0.963   1.00 0.00 ? 77  SER A OG   5  
ATOM 10495 H H    . SER A 1 77  ? 128.293 -5.429  0.502   1.00 0.00 ? 77  SER A H    5  
ATOM 10496 H HA   . SER A 1 77  ? 127.012 -7.096  -1.459  1.00 0.00 ? 77  SER A HA   5  
ATOM 10497 H HB2  . SER A 1 77  ? 125.420 -6.287  1.001   1.00 0.00 ? 77  SER A HB2  5  
ATOM 10498 H HB3  . SER A 1 77  ? 124.877 -7.297  -0.340  1.00 0.00 ? 77  SER A HB3  5  
ATOM 10499 H HG   . SER A 1 77  ? 126.434 -8.860  0.323   1.00 0.00 ? 77  SER A HG   5  
ATOM 10500 N N    . GLN A 1 78  ? 126.681 -4.801  -2.409  1.00 0.00 ? 78  GLN A N    5  
ATOM 10501 C CA   . GLN A 1 78  ? 126.367 -3.512  -3.003  1.00 0.00 ? 78  GLN A CA   5  
ATOM 10502 C C    . GLN A 1 78  ? 124.924 -3.500  -3.500  1.00 0.00 ? 78  GLN A C    5  
ATOM 10503 O O    . GLN A 1 78  ? 124.466 -4.462  -4.123  1.00 0.00 ? 78  GLN A O    5  
ATOM 10504 C CB   . GLN A 1 78  ? 127.328 -3.207  -4.161  1.00 0.00 ? 78  GLN A CB   5  
ATOM 10505 C CG   . GLN A 1 78  ? 127.280 -4.231  -5.289  1.00 0.00 ? 78  GLN A CG   5  
ATOM 10506 C CD   . GLN A 1 78  ? 128.271 -3.931  -6.397  1.00 0.00 ? 78  GLN A CD   5  
ATOM 10507 O OE1  . GLN A 1 78  ? 127.954 -3.235  -7.364  1.00 0.00 ? 78  GLN A OE1  5  
ATOM 10508 N NE2  . GLN A 1 78  ? 129.478 -4.456  -6.270  1.00 0.00 ? 78  GLN A NE2  5  
ATOM 10509 H H    . GLN A 1 78  ? 127.081 -5.495  -2.967  1.00 0.00 ? 78  GLN A H    5  
ATOM 10510 H HA   . GLN A 1 78  ? 126.488 -2.754  -2.237  1.00 0.00 ? 78  GLN A HA   5  
ATOM 10511 H HB2  . GLN A 1 78  ? 127.083 -2.237  -4.572  1.00 0.00 ? 78  GLN A HB2  5  
ATOM 10512 H HB3  . GLN A 1 78  ? 128.338 -3.176  -3.774  1.00 0.00 ? 78  GLN A HB3  5  
ATOM 10513 H HG2  . GLN A 1 78  ? 127.502 -5.207  -4.882  1.00 0.00 ? 78  GLN A HG2  5  
ATOM 10514 H HG3  . GLN A 1 78  ? 126.284 -4.237  -5.709  1.00 0.00 ? 78  GLN A HG3  5  
ATOM 10515 H HE21 . GLN A 1 78  ? 129.664 -5.006  -5.476  1.00 0.00 ? 78  GLN A HE21 5  
ATOM 10516 H HE22 . GLN A 1 78  ? 130.141 -4.271  -6.970  1.00 0.00 ? 78  GLN A HE22 5  
ATOM 10517 N N    . VAL A 1 79  ? 124.210 -2.422  -3.208  1.00 0.00 ? 79  VAL A N    5  
ATOM 10518 C CA   . VAL A 1 79  ? 122.845 -2.249  -3.696  1.00 0.00 ? 79  VAL A CA   5  
ATOM 10519 C C    . VAL A 1 79  ? 122.841 -2.143  -5.217  1.00 0.00 ? 79  VAL A C    5  
ATOM 10520 O O    . VAL A 1 79  ? 123.778 -1.609  -5.816  1.00 0.00 ? 79  VAL A O    5  
ATOM 10521 C CB   . VAL A 1 79  ? 122.157 -0.998  -3.079  1.00 0.00 ? 79  VAL A CB   5  
ATOM 10522 C CG1  . VAL A 1 79  ? 123.041 0.241   -3.215  1.00 0.00 ? 79  VAL A CG1  5  
ATOM 10523 C CG2  . VAL A 1 79  ? 120.785 -0.755  -3.711  1.00 0.00 ? 79  VAL A CG2  5  
ATOM 10524 H H    . VAL A 1 79  ? 124.612 -1.727  -2.651  1.00 0.00 ? 79  VAL A H    5  
ATOM 10525 H HA   . VAL A 1 79  ? 122.278 -3.125  -3.405  1.00 0.00 ? 79  VAL A HA   5  
ATOM 10526 H HB   . VAL A 1 79  ? 122.005 -1.186  -2.030  1.00 0.00 ? 79  VAL A HB   5  
ATOM 10527 H HG11 . VAL A 1 79  ? 123.246 0.427   -4.258  1.00 0.00 ? 79  VAL A HG11 5  
ATOM 10528 H HG12 . VAL A 1 79  ? 123.972 0.080   -2.690  1.00 0.00 ? 79  VAL A HG12 5  
ATOM 10529 H HG13 . VAL A 1 79  ? 122.534 1.096   -2.789  1.00 0.00 ? 79  VAL A HG13 5  
ATOM 10530 H HG21 . VAL A 1 79  ? 120.152 -1.616  -3.543  1.00 0.00 ? 79  VAL A HG21 5  
ATOM 10531 H HG22 . VAL A 1 79  ? 120.897 -0.597  -4.774  1.00 0.00 ? 79  VAL A HG22 5  
ATOM 10532 H HG23 . VAL A 1 79  ? 120.329 0.117   -3.264  1.00 0.00 ? 79  VAL A HG23 5  
ATOM 10533 N N    . ASN A 1 80  ? 121.789 -2.667  -5.833  1.00 0.00 ? 80  ASN A N    5  
ATOM 10534 C CA   . ASN A 1 80  ? 121.657 -2.653  -7.288  1.00 0.00 ? 80  ASN A CA   5  
ATOM 10535 C C    . ASN A 1 80  ? 121.445 -1.225  -7.795  1.00 0.00 ? 80  ASN A C    5  
ATOM 10536 O O    . ASN A 1 80  ? 120.320 -0.808  -8.070  1.00 0.00 ? 80  ASN A O    5  
ATOM 10537 C CB   . ASN A 1 80  ? 120.501 -3.567  -7.735  1.00 0.00 ? 80  ASN A CB   5  
ATOM 10538 C CG   . ASN A 1 80  ? 120.352 -3.651  -9.250  1.00 0.00 ? 80  ASN A CG   5  
ATOM 10539 O OD1  . ASN A 1 80  ? 121.325 -3.518  -9.996  1.00 0.00 ? 80  ASN A OD1  5  
ATOM 10540 N ND2  . ASN A 1 80  ? 119.132 -3.893  -9.716  1.00 0.00 ? 80  ASN A ND2  5  
ATOM 10541 H H    . ASN A 1 80  ? 121.080 -3.073  -5.291  1.00 0.00 ? 80  ASN A H    5  
ATOM 10542 H HA   . ASN A 1 80  ? 122.581 -3.032  -7.705  1.00 0.00 ? 80  ASN A HA   5  
ATOM 10543 H HB2  . ASN A 1 80  ? 120.674 -4.564  -7.357  1.00 0.00 ? 80  ASN A HB2  5  
ATOM 10544 H HB3  . ASN A 1 80  ? 119.576 -3.189  -7.321  1.00 0.00 ? 80  ASN A HB3  5  
ATOM 10545 H HD21 . ASN A 1 80  ? 118.402 -4.006  -9.068  1.00 0.00 ? 80  ASN A HD21 5  
ATOM 10546 H HD22 . ASN A 1 80  ? 119.008 -3.942  -10.686 1.00 0.00 ? 80  ASN A HD22 5  
ATOM 10547 N N    . VAL A 1 81  ? 122.535 -0.466  -7.869  1.00 0.00 ? 81  VAL A N    5  
ATOM 10548 C CA   . VAL A 1 81  ? 122.503 0.896   -8.381  1.00 0.00 ? 81  VAL A CA   5  
ATOM 10549 C C    . VAL A 1 81  ? 123.411 1.024   -9.596  1.00 0.00 ? 81  VAL A C    5  
ATOM 10550 O O    . VAL A 1 81  ? 124.527 0.493   -9.620  1.00 0.00 ? 81  VAL A O    5  
ATOM 10551 C CB   . VAL A 1 81  ? 122.924 1.941   -7.312  1.00 0.00 ? 81  VAL A CB   5  
ATOM 10552 C CG1  . VAL A 1 81  ? 121.882 2.032   -6.200  1.00 0.00 ? 81  VAL A CG1  5  
ATOM 10553 C CG2  . VAL A 1 81  ? 124.305 1.614   -6.740  1.00 0.00 ? 81  VAL A CG2  5  
ATOM 10554 H H    . VAL A 1 81  ? 123.391 -0.837  -7.569  1.00 0.00 ? 81  VAL A H    5  
ATOM 10555 H HA   . VAL A 1 81  ? 121.487 1.115   -8.686  1.00 0.00 ? 81  VAL A HA   5  
ATOM 10556 H HB   . VAL A 1 81  ? 122.981 2.910   -7.793  1.00 0.00 ? 81  VAL A HB   5  
ATOM 10557 H HG11 . VAL A 1 81  ? 121.761 1.064   -5.738  1.00 0.00 ? 81  VAL A HG11 5  
ATOM 10558 H HG12 . VAL A 1 81  ? 120.937 2.351   -6.615  1.00 0.00 ? 81  VAL A HG12 5  
ATOM 10559 H HG13 . VAL A 1 81  ? 122.207 2.747   -5.457  1.00 0.00 ? 81  VAL A HG13 5  
ATOM 10560 H HG21 . VAL A 1 81  ? 124.562 2.339   -5.980  1.00 0.00 ? 81  VAL A HG21 5  
ATOM 10561 H HG22 . VAL A 1 81  ? 125.041 1.648   -7.530  1.00 0.00 ? 81  VAL A HG22 5  
ATOM 10562 H HG23 . VAL A 1 81  ? 124.292 0.626   -6.304  1.00 0.00 ? 81  VAL A HG23 5  
ATOM 10563 N N    . GLU A 1 82  ? 122.915 1.728   -10.599 1.00 0.00 ? 82  GLU A N    5  
ATOM 10564 C CA   . GLU A 1 82  ? 123.643 1.943   -11.837 1.00 0.00 ? 82  GLU A CA   5  
ATOM 10565 C C    . GLU A 1 82  ? 124.908 2.759   -11.581 1.00 0.00 ? 82  GLU A C    5  
ATOM 10566 O O    . GLU A 1 82  ? 125.003 3.480   -10.584 1.00 0.00 ? 82  GLU A O    5  
ATOM 10567 C CB   . GLU A 1 82  ? 122.745 2.669   -12.844 1.00 0.00 ? 82  GLU A CB   5  
ATOM 10568 C CG   . GLU A 1 82  ? 121.396 1.991   -13.062 1.00 0.00 ? 82  GLU A CG   5  
ATOM 10569 C CD   . GLU A 1 82  ? 120.532 2.726   -14.071 1.00 0.00 ? 82  GLU A CD   5  
ATOM 10570 O OE1  . GLU A 1 82  ? 119.973 3.786   -13.725 1.00 0.00 ? 82  GLU A OE1  5  
ATOM 10571 O OE2  . GLU A 1 82  ? 120.425 2.257   -15.224 1.00 0.00 ? 82  GLU A OE2  5  
ATOM 10572 H H    . GLU A 1 82  ? 122.028 2.114   -10.506 1.00 0.00 ? 82  GLU A H    5  
ATOM 10573 H HA   . GLU A 1 82  ? 123.918 0.978   -12.239 1.00 0.00 ? 82  GLU A HA   5  
ATOM 10574 H HB2  . GLU A 1 82  ? 122.566 3.676   -12.491 1.00 0.00 ? 82  GLU A HB2  5  
ATOM 10575 H HB3  . GLU A 1 82  ? 123.257 2.718   -13.795 1.00 0.00 ? 82  GLU A HB3  5  
ATOM 10576 H HG2  . GLU A 1 82  ? 121.566 0.984   -13.416 1.00 0.00 ? 82  GLU A HG2  5  
ATOM 10577 H HG3  . GLU A 1 82  ? 120.869 1.953   -12.118 1.00 0.00 ? 82  GLU A HG3  5  
ATOM 10578 N N    . GLY A 1 83  ? 125.867 2.643   -12.488 1.00 0.00 ? 83  GLY A N    5  
ATOM 10579 C CA   . GLY A 1 83  ? 127.115 3.382   -12.372 1.00 0.00 ? 83  GLY A CA   5  
ATOM 10580 C C    . GLY A 1 83  ? 126.892 4.880   -12.267 1.00 0.00 ? 83  GLY A C    5  
ATOM 10581 O O    . GLY A 1 83  ? 127.588 5.568   -11.520 1.00 0.00 ? 83  GLY A O    5  
ATOM 10582 H H    . GLY A 1 83  ? 125.728 2.041   -13.248 1.00 0.00 ? 83  GLY A H    5  
ATOM 10583 H HA2  . GLY A 1 83  ? 127.643 3.043   -11.492 1.00 0.00 ? 83  GLY A HA2  5  
ATOM 10584 H HA3  . GLY A 1 83  ? 127.722 3.179   -13.242 1.00 0.00 ? 83  GLY A HA3  5  
ATOM 10585 N N    . GLN A 1 84  ? 125.898 5.377   -12.999 1.00 0.00 ? 84  GLN A N    5  
ATOM 10586 C CA   . GLN A 1 84  ? 125.568 6.805   -13.004 1.00 0.00 ? 84  GLN A CA   5  
ATOM 10587 C C    . GLN A 1 84  ? 124.975 7.244   -11.660 1.00 0.00 ? 84  GLN A C    5  
ATOM 10588 O O    . GLN A 1 84  ? 124.869 8.438   -11.378 1.00 0.00 ? 84  GLN A O    5  
ATOM 10589 C CB   . GLN A 1 84  ? 124.581 7.112   -14.142 1.00 0.00 ? 84  GLN A CB   5  
ATOM 10590 C CG   . GLN A 1 84  ? 123.201 6.481   -13.958 1.00 0.00 ? 84  GLN A CG   5  
ATOM 10591 C CD   . GLN A 1 84  ? 122.292 6.685   -15.161 1.00 0.00 ? 84  GLN A CD   5  
ATOM 10592 O OE1  . GLN A 1 84  ? 122.419 7.666   -15.897 1.00 0.00 ? 84  GLN A OE1  5  
ATOM 10593 N NE2  . GLN A 1 84  ? 121.358 5.769   -15.360 1.00 0.00 ? 84  GLN A NE2  5  
ATOM 10594 H H    . GLN A 1 84  ? 125.374 4.767   -13.562 1.00 0.00 ? 84  GLN A H    5  
ATOM 10595 H HA   . GLN A 1 84  ? 126.483 7.356   -13.177 1.00 0.00 ? 84  GLN A HA   5  
ATOM 10596 H HB2  . GLN A 1 84  ? 124.457 8.183   -14.215 1.00 0.00 ? 84  GLN A HB2  5  
ATOM 10597 H HB3  . GLN A 1 84  ? 124.999 6.746   -15.070 1.00 0.00 ? 84  GLN A HB3  5  
ATOM 10598 H HG2  . GLN A 1 84  ? 123.323 5.420   -13.795 1.00 0.00 ? 84  GLN A HG2  5  
ATOM 10599 H HG3  . GLN A 1 84  ? 122.729 6.924   -13.092 1.00 0.00 ? 84  GLN A HG3  5  
ATOM 10600 H HE21 . GLN A 1 84  ? 121.298 5.021   -14.727 1.00 0.00 ? 84  GLN A HE21 5  
ATOM 10601 H HE22 . GLN A 1 84  ? 120.767 5.867   -16.139 1.00 0.00 ? 84  GLN A HE22 5  
ATOM 10602 N N    . SER A 1 85  ? 124.589 6.268   -10.841 1.00 0.00 ? 85  SER A N    5  
ATOM 10603 C CA   . SER A 1 85  ? 123.974 6.535   -9.543  1.00 0.00 ? 85  SER A CA   5  
ATOM 10604 C C    . SER A 1 85  ? 124.979 6.348   -8.404  1.00 0.00 ? 85  SER A C    5  
ATOM 10605 O O    . SER A 1 85  ? 124.655 6.566   -7.237  1.00 0.00 ? 85  SER A O    5  
ATOM 10606 C CB   . SER A 1 85  ? 122.782 5.596   -9.342  1.00 0.00 ? 85  SER A CB   5  
ATOM 10607 O OG   . SER A 1 85  ? 121.901 5.645   -10.453 1.00 0.00 ? 85  SER A OG   5  
ATOM 10608 H H    . SER A 1 85  ? 124.715 5.338   -11.120 1.00 0.00 ? 85  SER A H    5  
ATOM 10609 H HA   . SER A 1 85  ? 123.622 7.557   -9.537  1.00 0.00 ? 85  SER A HA   5  
ATOM 10610 H HB2  . SER A 1 85  ? 123.137 4.582   -9.229  1.00 0.00 ? 85  SER A HB2  5  
ATOM 10611 H HB3  . SER A 1 85  ? 122.239 5.889   -8.455  1.00 0.00 ? 85  SER A HB3  5  
ATOM 10612 H HG   . SER A 1 85  ? 121.930 6.527   -10.851 1.00 0.00 ? 85  SER A HG   5  
ATOM 10613 N N    . ARG A 1 86  ? 126.196 5.935   -8.744  1.00 0.00 ? 86  ARG A N    5  
ATOM 10614 C CA   . ARG A 1 86  ? 127.233 5.702   -7.743  1.00 0.00 ? 86  ARG A CA   5  
ATOM 10615 C C    . ARG A 1 86  ? 128.072 6.966   -7.562  1.00 0.00 ? 86  ARG A C    5  
ATOM 10616 O O    . ARG A 1 86  ? 128.525 7.563   -8.540  1.00 0.00 ? 86  ARG A O    5  
ATOM 10617 C CB   . ARG A 1 86  ? 128.103 4.500   -8.149  1.00 0.00 ? 86  ARG A CB   5  
ATOM 10618 C CG   . ARG A 1 86  ? 127.286 3.223   -8.352  1.00 0.00 ? 86  ARG A CG   5  
ATOM 10619 C CD   . ARG A 1 86  ? 128.142 2.015   -8.725  1.00 0.00 ? 86  ARG A CD   5  
ATOM 10620 N NE   . ARG A 1 86  ? 127.303 0.850   -9.034  1.00 0.00 ? 86  ARG A NE   5  
ATOM 10621 C CZ   . ARG A 1 86  ? 127.653 -0.424  -8.828  1.00 0.00 ? 86  ARG A CZ   5  
ATOM 10622 N NH1  . ARG A 1 86  ? 128.831 -0.729  -8.301  1.00 0.00 ? 86  ARG A NH1  5  
ATOM 10623 N NH2  . ARG A 1 86  ? 126.812 -1.397  -9.148  1.00 0.00 ? 86  ARG A NH2  5  
ATOM 10624 H H    . ARG A 1 86  ? 126.408 5.797   -9.692  1.00 0.00 ? 86  ARG A H    5  
ATOM 10625 H HA   . ARG A 1 86  ? 126.741 5.476   -6.804  1.00 0.00 ? 86  ARG A HA   5  
ATOM 10626 H HB2  . ARG A 1 86  ? 128.614 4.731   -9.074  1.00 0.00 ? 86  ARG A HB2  5  
ATOM 10627 H HB3  . ARG A 1 86  ? 128.836 4.316   -7.377  1.00 0.00 ? 86  ARG A HB3  5  
ATOM 10628 H HG2  . ARG A 1 86  ? 126.759 3.000   -7.436  1.00 0.00 ? 86  ARG A HG2  5  
ATOM 10629 H HG3  . ARG A 1 86  ? 126.567 3.396   -9.141  1.00 0.00 ? 86  ARG A HG3  5  
ATOM 10630 H HD2  . ARG A 1 86  ? 128.738 2.260   -9.593  1.00 0.00 ? 86  ARG A HD2  5  
ATOM 10631 H HD3  . ARG A 1 86  ? 128.792 1.775   -7.895  1.00 0.00 ? 86  ARG A HD3  5  
ATOM 10632 H HE   . ARG A 1 86  ? 126.417 1.030   -9.422  1.00 0.00 ? 86  ARG A HE   5  
ATOM 10633 H HH11 . ARG A 1 86  ? 129.477 -0.004  -8.045  1.00 0.00 ? 86  ARG A HH11 5  
ATOM 10634 H HH12 . ARG A 1 86  ? 129.086 -1.693  -8.159  1.00 0.00 ? 86  ARG A HH12 5  
ATOM 10635 H HH21 . ARG A 1 86  ? 125.915 -1.180  -9.551  1.00 0.00 ? 86  ARG A HH21 5  
ATOM 10636 H HH22 . ARG A 1 86  ? 127.062 -2.353  -8.980  1.00 0.00 ? 86  ARG A HH22 5  
ATOM 10637 N N    . LEU A 1 87  ? 128.249 7.384   -6.310  1.00 0.00 ? 87  LEU A N    5  
ATOM 10638 C CA   . LEU A 1 87  ? 128.955 8.626   -6.002  1.00 0.00 ? 87  LEU A CA   5  
ATOM 10639 C C    . LEU A 1 87  ? 130.448 8.486   -6.277  1.00 0.00 ? 87  LEU A C    5  
ATOM 10640 O O    . LEU A 1 87  ? 131.231 8.125   -5.396  1.00 0.00 ? 87  LEU A O    5  
ATOM 10641 C CB   . LEU A 1 87  ? 128.732 9.053   -4.545  1.00 0.00 ? 87  LEU A CB   5  
ATOM 10642 C CG   . LEU A 1 87  ? 127.300 9.486   -4.175  1.00 0.00 ? 87  LEU A CG   5  
ATOM 10643 C CD1  . LEU A 1 87  ? 126.340 8.303   -4.211  1.00 0.00 ? 87  LEU A CD1  5  
ATOM 10644 C CD2  . LEU A 1 87  ? 127.278 10.161  -2.804  1.00 0.00 ? 87  LEU A CD2  5  
ATOM 10645 H H    . LEU A 1 87  ? 127.901 6.841   -5.574  1.00 0.00 ? 87  LEU A H    5  
ATOM 10646 H HA   . LEU A 1 87  ? 128.558 9.395   -6.651  1.00 0.00 ? 87  LEU A HA   5  
ATOM 10647 H HB2  . LEU A 1 87  ? 129.008 8.222   -3.923  1.00 0.00 ? 87  LEU A HB2  5  
ATOM 10648 H HB3  . LEU A 1 87  ? 129.399 9.874   -4.325  1.00 0.00 ? 87  LEU A HB3  5  
ATOM 10649 H HG   . LEU A 1 87  ? 126.955 10.208  -4.903  1.00 0.00 ? 87  LEU A HG   5  
ATOM 10650 H HD11 . LEU A 1 87  ? 126.674 7.545   -3.516  1.00 0.00 ? 87  LEU A HD11 5  
ATOM 10651 H HD12 . LEU A 1 87  ? 126.315 7.889   -5.209  1.00 0.00 ? 87  LEU A HD12 5  
ATOM 10652 H HD13 . LEU A 1 87  ? 125.349 8.632   -3.935  1.00 0.00 ? 87  LEU A HD13 5  
ATOM 10653 H HD21 . LEU A 1 87  ? 126.268 10.465  -2.567  1.00 0.00 ? 87  LEU A HD21 5  
ATOM 10654 H HD22 . LEU A 1 87  ? 127.919 11.031  -2.820  1.00 0.00 ? 87  LEU A HD22 5  
ATOM 10655 H HD23 . LEU A 1 87  ? 127.631 9.468   -2.052  1.00 0.00 ? 87  LEU A HD23 5  
ATOM 10656 N N    . ASN A 1 88  ? 130.810 8.738   -7.519  1.00 0.00 ? 88  ASN A N    5  
ATOM 10657 C CA   . ASN A 1 88  ? 132.210 8.779   -7.946  1.00 0.00 ? 88  ASN A CA   5  
ATOM 10658 C C    . ASN A 1 88  ? 132.726 10.216  -7.888  1.00 0.00 ? 88  ASN A C    5  
ATOM 10659 O O    . ASN A 1 88  ? 133.898 10.488  -8.171  1.00 0.00 ? 88  ASN A O    5  
ATOM 10660 C CB   . ASN A 1 88  ? 132.355 8.228   -9.375  1.00 0.00 ? 88  ASN A CB   5  
ATOM 10661 C CG   . ASN A 1 88  ? 132.046 6.742   -9.482  1.00 0.00 ? 88  ASN A CG   5  
ATOM 10662 O OD1  . ASN A 1 88  ? 131.222 6.205   -8.742  1.00 0.00 ? 88  ASN A OD1  5  
ATOM 10663 N ND2  . ASN A 1 88  ? 132.706 6.066   -10.412 1.00 0.00 ? 88  ASN A ND2  5  
ATOM 10664 H H    . ASN A 1 88  ? 130.107 8.884   -8.180  1.00 0.00 ? 88  ASN A H    5  
ATOM 10665 H HA   . ASN A 1 88  ? 132.791 8.169   -7.267  1.00 0.00 ? 88  ASN A HA   5  
ATOM 10666 H HB2  . ASN A 1 88  ? 131.679 8.760   -10.028 1.00 0.00 ? 88  ASN A HB2  5  
ATOM 10667 H HB3  . ASN A 1 88  ? 133.371 8.390   -9.713  1.00 0.00 ? 88  ASN A HB3  5  
ATOM 10668 H HD21 . ASN A 1 88  ? 133.348 6.553   -10.973 1.00 0.00 ? 88  ASN A HD21 5  
ATOM 10669 H HD22 . ASN A 1 88  ? 132.533 5.104   -10.497 1.00 0.00 ? 88  ASN A HD22 5  
ATOM 10670 N N    . GLU A 1 89  ? 131.836 11.126  -7.506  1.00 0.00 ? 89  GLU A N    5  
ATOM 10671 C CA   . GLU A 1 89  ? 132.130 12.529  -7.422  1.00 0.00 ? 89  GLU A CA   5  
ATOM 10672 C C    . GLU A 1 89  ? 132.861 12.822  -6.122  1.00 0.00 ? 89  GLU A C    5  
ATOM 10673 O O    . GLU A 1 89  ? 132.796 12.057  -5.158  1.00 0.00 ? 89  GLU A O    5  
ATOM 10674 C CB   . GLU A 1 89  ? 130.815 13.329  -7.495  1.00 0.00 ? 89  GLU A CB   5  
ATOM 10675 C CG   . GLU A 1 89  ? 130.981 14.846  -7.444  1.00 0.00 ? 89  GLU A CG   5  
ATOM 10676 C CD   . GLU A 1 89  ? 131.752 15.404  -8.630  1.00 0.00 ? 89  GLU A CD   5  
ATOM 10677 O OE1  . GLU A 1 89  ? 133.000 15.451  -8.570  1.00 0.00 ? 89  GLU A OE1  5  
ATOM 10678 O OE2  . GLU A 1 89  ? 131.111 15.801  -9.629  1.00 0.00 ? 89  GLU A OE2  5  
ATOM 10679 H H    . GLU A 1 89  ? 130.958 10.839  -7.248  1.00 0.00 ? 89  GLU A H    5  
ATOM 10680 H HA   . GLU A 1 89  ? 132.759 12.799  -8.259  1.00 0.00 ? 89  GLU A HA   5  
ATOM 10681 H HB2  . GLU A 1 89  ? 130.310 13.079  -8.417  1.00 0.00 ? 89  GLU A HB2  5  
ATOM 10682 H HB3  . GLU A 1 89  ? 130.186 13.032  -6.666  1.00 0.00 ? 89  GLU A HB3  5  
ATOM 10683 H HG2  . GLU A 1 89  ? 130.000 15.300  -7.425  1.00 0.00 ? 89  GLU A HG2  5  
ATOM 10684 H HG3  . GLU A 1 89  ? 131.508 15.106  -6.536  1.00 0.00 ? 89  GLU A HG3  5  
ATOM 10685 N N    . LYS A 1 90  ? 133.518 13.953  -6.110  1.00 0.00 ? 90  LYS A N    5  
ATOM 10686 C CA   . LYS A 1 90  ? 134.282 14.428  -4.956  1.00 0.00 ? 90  LYS A CA   5  
ATOM 10687 C C    . LYS A 1 90  ? 133.352 14.990  -3.874  1.00 0.00 ? 90  LYS A C    5  
ATOM 10688 O O    . LYS A 1 90  ? 133.795 15.685  -2.960  1.00 0.00 ? 90  LYS A O    5  
ATOM 10689 C CB   . LYS A 1 90  ? 135.277 15.506  -5.404  1.00 0.00 ? 90  LYS A CB   5  
ATOM 10690 C CG   . LYS A 1 90  ? 136.204 15.052  -6.527  1.00 0.00 ? 90  LYS A CG   5  
ATOM 10691 C CD   . LYS A 1 90  ? 137.152 16.165  -6.961  1.00 0.00 ? 90  LYS A CD   5  
ATOM 10692 C CE   . LYS A 1 90  ? 138.003 15.753  -8.156  1.00 0.00 ? 90  LYS A CE   5  
ATOM 10693 N NZ   . LYS A 1 90  ? 138.937 16.832  -8.567  1.00 0.00 ? 90  LYS A NZ   5  
ATOM 10694 H H    . LYS A 1 90  ? 133.487 14.494  -6.918  1.00 0.00 ? 90  LYS A H    5  
ATOM 10695 H HA   . LYS A 1 90  ? 134.829 13.590  -4.547  1.00 0.00 ? 90  LYS A HA   5  
ATOM 10696 H HB2  . LYS A 1 90  ? 134.725 16.369  -5.748  1.00 0.00 ? 90  LYS A HB2  5  
ATOM 10697 H HB3  . LYS A 1 90  ? 135.886 15.794  -4.557  1.00 0.00 ? 90  LYS A HB3  5  
ATOM 10698 H HG2  . LYS A 1 90  ? 136.787 14.210  -6.182  1.00 0.00 ? 90  LYS A HG2  5  
ATOM 10699 H HG3  . LYS A 1 90  ? 135.604 14.751  -7.375  1.00 0.00 ? 90  LYS A HG3  5  
ATOM 10700 H HD2  . LYS A 1 90  ? 136.571 17.035  -7.232  1.00 0.00 ? 90  LYS A HD2  5  
ATOM 10701 H HD3  . LYS A 1 90  ? 137.805 16.412  -6.134  1.00 0.00 ? 90  LYS A HD3  5  
ATOM 10702 H HE2  . LYS A 1 90  ? 138.575 14.876  -7.892  1.00 0.00 ? 90  LYS A HE2  5  
ATOM 10703 H HE3  . LYS A 1 90  ? 137.349 15.519  -8.985  1.00 0.00 ? 90  LYS A HE3  5  
ATOM 10704 H HZ1  . LYS A 1 90  ? 139.634 17.007  -7.815  1.00 0.00 ? 90  LYS A HZ1  5  
ATOM 10705 H HZ2  . LYS A 1 90  ? 138.414 17.711  -8.748  1.00 0.00 ? 90  LYS A HZ2  5  
ATOM 10706 H HZ3  . LYS A 1 90  ? 139.443 16.560  -9.434  1.00 0.00 ? 90  LYS A HZ3  5  
ATOM 10707 N N    . ILE A 1 91  ? 132.064 14.667  -3.975  1.00 0.00 ? 91  ILE A N    5  
ATOM 10708 C CA   . ILE A 1 91  ? 131.063 15.135  -3.020  1.00 0.00 ? 91  ILE A CA   5  
ATOM 10709 C C    . ILE A 1 91  ? 131.363 14.607  -1.609  1.00 0.00 ? 91  ILE A C    5  
ATOM 10710 O O    . ILE A 1 91  ? 130.957 15.201  -0.612  1.00 0.00 ? 91  ILE A O    5  
ATOM 10711 C CB   . ILE A 1 91  ? 129.635 14.719  -3.475  1.00 0.00 ? 91  ILE A CB   5  
ATOM 10712 C CG1  . ILE A 1 91  ? 128.566 15.235  -2.497  1.00 0.00 ? 91  ILE A CG1  5  
ATOM 10713 C CG2  . ILE A 1 91  ? 129.533 13.203  -3.638  1.00 0.00 ? 91  ILE A CG2  5  
ATOM 10714 C CD1  . ILE A 1 91  ? 127.151 14.847  -2.881  1.00 0.00 ? 91  ILE A CD1  5  
ATOM 10715 H H    . ILE A 1 91  ? 131.777 14.102  -4.716  1.00 0.00 ? 91  ILE A H    5  
ATOM 10716 H HA   . ILE A 1 91  ? 131.109 16.216  -3.001  1.00 0.00 ? 91  ILE A HA   5  
ATOM 10717 H HB   . ILE A 1 91  ? 129.459 15.163  -4.447  1.00 0.00 ? 91  ILE A HB   5  
ATOM 10718 H HG12 . ILE A 1 91  ? 128.761 14.835  -1.513  1.00 0.00 ? 91  ILE A HG12 5  
ATOM 10719 H HG13 . ILE A 1 91  ? 128.613 16.314  -2.457  1.00 0.00 ? 91  ILE A HG13 5  
ATOM 10720 H HG21 . ILE A 1 91  ? 129.621 12.730  -2.672  1.00 0.00 ? 91  ILE A HG21 5  
ATOM 10721 H HG22 . ILE A 1 91  ? 130.328 12.855  -4.281  1.00 0.00 ? 91  ILE A HG22 5  
ATOM 10722 H HG23 . ILE A 1 91  ? 128.579 12.949  -4.078  1.00 0.00 ? 91  ILE A HG23 5  
ATOM 10723 H HD11 . ILE A 1 91  ? 126.919 15.248  -3.856  1.00 0.00 ? 91  ILE A HD11 5  
ATOM 10724 H HD12 . ILE A 1 91  ? 126.459 15.245  -2.154  1.00 0.00 ? 91  ILE A HD12 5  
ATOM 10725 H HD13 . ILE A 1 91  ? 127.066 13.769  -2.905  1.00 0.00 ? 91  ILE A HD13 5  
ATOM 10726 N N    . LEU A 1 92  ? 132.096 13.492  -1.531  1.00 0.00 ? 92  LEU A N    5  
ATOM 10727 C CA   . LEU A 1 92  ? 132.532 12.945  -0.242  1.00 0.00 ? 92  LEU A CA   5  
ATOM 10728 C C    . LEU A 1 92  ? 133.656 13.798  0.351   1.00 0.00 ? 92  LEU A C    5  
ATOM 10729 O O    . LEU A 1 92  ? 133.851 13.824  1.570   1.00 0.00 ? 92  LEU A O    5  
ATOM 10730 C CB   . LEU A 1 92  ? 133.006 11.484  -0.379  1.00 0.00 ? 92  LEU A CB   5  
ATOM 10731 C CG   . LEU A 1 92  ? 131.897 10.427  -0.560  1.00 0.00 ? 92  LEU A CG   5  
ATOM 10732 C CD1  . LEU A 1 92  ? 131.231 10.550  -1.925  1.00 0.00 ? 92  LEU A CD1  5  
ATOM 10733 C CD2  . LEU A 1 92  ? 132.457 9.020   -0.357  1.00 0.00 ? 92  LEU A CD2  5  
ATOM 10734 H H    . LEU A 1 92  ? 132.345 13.029  -2.357  1.00 0.00 ? 92  LEU A H    5  
ATOM 10735 H HA   . LEU A 1 92  ? 131.686 12.977  0.431   1.00 0.00 ? 92  LEU A HA   5  
ATOM 10736 H HB2  . LEU A 1 92  ? 133.673 11.423  -1.228  1.00 0.00 ? 92  LEU A HB2  5  
ATOM 10737 H HB3  . LEU A 1 92  ? 133.568 11.229  0.510   1.00 0.00 ? 92  LEU A HB3  5  
ATOM 10738 H HG   . LEU A 1 92  ? 131.136 10.590  0.191   1.00 0.00 ? 92  LEU A HG   5  
ATOM 10739 H HD11 . LEU A 1 92  ? 130.438 9.820   -2.007  1.00 0.00 ? 92  LEU A HD11 5  
ATOM 10740 H HD12 . LEU A 1 92  ? 131.961 10.376  -2.703  1.00 0.00 ? 92  LEU A HD12 5  
ATOM 10741 H HD13 . LEU A 1 92  ? 130.819 11.540  -2.034  1.00 0.00 ? 92  LEU A HD13 5  
ATOM 10742 H HD21 . LEU A 1 92  ? 133.226 8.826   -1.091  1.00 0.00 ? 92  LEU A HD21 5  
ATOM 10743 H HD22 . LEU A 1 92  ? 131.662 8.296   -0.468  1.00 0.00 ? 92  LEU A HD22 5  
ATOM 10744 H HD23 . LEU A 1 92  ? 132.878 8.939   0.635   1.00 0.00 ? 92  LEU A HD23 5  
ATOM 10745 N N    . GLU A 1 93  ? 134.394 14.487  -0.518  1.00 0.00 ? 93  GLU A N    5  
ATOM 10746 C CA   . GLU A 1 93  ? 135.507 15.332  -0.091  1.00 0.00 ? 93  GLU A CA   5  
ATOM 10747 C C    . GLU A 1 93  ? 134.981 16.592  0.584   1.00 0.00 ? 93  GLU A C    5  
ATOM 10748 O O    . GLU A 1 93  ? 135.473 16.997  1.640   1.00 0.00 ? 93  GLU A O    5  
ATOM 10749 C CB   . GLU A 1 93  ? 136.398 15.705  -1.286  1.00 0.00 ? 93  GLU A CB   5  
ATOM 10750 C CG   . GLU A 1 93  ? 136.966 14.501  -2.029  1.00 0.00 ? 93  GLU A CG   5  
ATOM 10751 C CD   . GLU A 1 93  ? 137.721 13.555  -1.112  1.00 0.00 ? 93  GLU A CD   5  
ATOM 10752 O OE1  . GLU A 1 93  ? 138.868 13.877  -0.729  1.00 0.00 ? 93  GLU A OE1  5  
ATOM 10753 O OE2  . GLU A 1 93  ? 137.171 12.494  -0.753  1.00 0.00 ? 93  GLU A OE2  5  
ATOM 10754 H H    . GLU A 1 93  ? 134.179 14.433  -1.472  1.00 0.00 ? 93  GLU A H    5  
ATOM 10755 H HA   . GLU A 1 93  ? 136.094 14.772  0.625   1.00 0.00 ? 93  GLU A HA   5  
ATOM 10756 H HB2  . GLU A 1 93  ? 135.818 16.291  -1.985  1.00 0.00 ? 93  GLU A HB2  5  
ATOM 10757 H HB3  . GLU A 1 93  ? 137.225 16.303  -0.930  1.00 0.00 ? 93  GLU A HB3  5  
ATOM 10758 H HG2  . GLU A 1 93  ? 136.151 13.962  -2.493  1.00 0.00 ? 93  GLU A HG2  5  
ATOM 10759 H HG3  . GLU A 1 93  ? 137.641 14.854  -2.796  1.00 0.00 ? 93  GLU A HG3  5  
ATOM 10760 N N    . GLU A 1 94  ? 133.975 17.203  -0.032  1.00 0.00 ? 94  GLU A N    5  
ATOM 10761 C CA   . GLU A 1 94  ? 133.329 18.390  0.519   1.00 0.00 ? 94  GLU A CA   5  
ATOM 10762 C C    . GLU A 1 94  ? 131.835 18.121  0.704   1.00 0.00 ? 94  GLU A C    5  
ATOM 10763 O O    . GLU A 1 94  ? 131.030 18.402  -0.187  1.00 0.00 ? 94  GLU A O    5  
ATOM 10764 C CB   . GLU A 1 94  ? 133.555 19.600  -0.399  1.00 0.00 ? 94  GLU A CB   5  
ATOM 10765 C CG   . GLU A 1 94  ? 135.028 19.877  -0.688  1.00 0.00 ? 94  GLU A CG   5  
ATOM 10766 C CD   . GLU A 1 94  ? 135.243 21.136  -1.511  1.00 0.00 ? 94  GLU A CD   5  
ATOM 10767 O OE1  . GLU A 1 94  ? 135.183 21.063  -2.756  1.00 0.00 ? 94  GLU A OE1  5  
ATOM 10768 O OE2  . GLU A 1 94  ? 135.478 22.207  -0.911  1.00 0.00 ? 94  GLU A OE2  5  
ATOM 10769 H H    . GLU A 1 94  ? 133.650 16.840  -0.885  1.00 0.00 ? 94  GLU A H    5  
ATOM 10770 H HA   . GLU A 1 94  ? 133.769 18.595  1.487   1.00 0.00 ? 94  GLU A HA   5  
ATOM 10771 H HB2  . GLU A 1 94  ? 133.051 19.426  -1.340  1.00 0.00 ? 94  GLU A HB2  5  
ATOM 10772 H HB3  . GLU A 1 94  ? 133.131 20.478  0.069   1.00 0.00 ? 94  GLU A HB3  5  
ATOM 10773 H HG2  . GLU A 1 94  ? 135.551 19.985  0.252   1.00 0.00 ? 94  GLU A HG2  5  
ATOM 10774 H HG3  . GLU A 1 94  ? 135.440 19.035  -1.228  1.00 0.00 ? 94  GLU A HG3  5  
ATOM 10775 N N    . PRO A 1 95  ? 131.453 17.542  1.860   1.00 0.00 ? 95  PRO A N    5  
ATOM 10776 C CA   . PRO A 1 95  ? 130.069 17.139  2.128   1.00 0.00 ? 95  PRO A CA   5  
ATOM 10777 C C    . PRO A 1 95  ? 129.104 18.322  2.119   1.00 0.00 ? 95  PRO A C    5  
ATOM 10778 O O    . PRO A 1 95  ? 129.415 19.401  2.632   1.00 0.00 ? 95  PRO A O    5  
ATOM 10779 C CB   . PRO A 1 95  ? 130.129 16.501  3.528   1.00 0.00 ? 95  PRO A CB   5  
ATOM 10780 C CG   . PRO A 1 95  ? 131.570 16.181  3.746   1.00 0.00 ? 95  PRO A CG   5  
ATOM 10781 C CD   . PRO A 1 95  ? 132.338 17.235  2.999   1.00 0.00 ? 95  PRO A CD   5  
ATOM 10782 H HA   . PRO A 1 95  ? 129.734 16.403  1.410   1.00 0.00 ? 95  PRO A HA   5  
ATOM 10783 H HB2  . PRO A 1 95  ? 129.764 17.203  4.267   1.00 0.00 ? 95  PRO A HB2  5  
ATOM 10784 H HB3  . PRO A 1 95  ? 129.520 15.608  3.547   1.00 0.00 ? 95  PRO A HB3  5  
ATOM 10785 H HG2  . PRO A 1 95  ? 131.802 16.223  4.802   1.00 0.00 ? 95  PRO A HG2  5  
ATOM 10786 H HG3  . PRO A 1 95  ? 131.795 15.201  3.351   1.00 0.00 ? 95  PRO A HG3  5  
ATOM 10787 H HD2  . PRO A 1 95  ? 132.488 18.109  3.619   1.00 0.00 ? 95  PRO A HD2  5  
ATOM 10788 H HD3  . PRO A 1 95  ? 133.286 16.844  2.659   1.00 0.00 ? 95  PRO A HD3  5  
ATOM 10789 N N    . HIS A 1 96  ? 127.938 18.109  1.530   1.00 0.00 ? 96  HIS A N    5  
ATOM 10790 C CA   . HIS A 1 96  ? 126.882 19.114  1.488   1.00 0.00 ? 96  HIS A CA   5  
ATOM 10791 C C    . HIS A 1 96  ? 125.618 18.510  2.092   1.00 0.00 ? 96  HIS A C    5  
ATOM 10792 O O    . HIS A 1 96  ? 125.345 17.342  1.860   1.00 0.00 ? 96  HIS A O    5  
ATOM 10793 C CB   . HIS A 1 96  ? 126.627 19.564  0.041   1.00 0.00 ? 96  HIS A CB   5  
ATOM 10794 C CG   . HIS A 1 96  ? 127.856 20.065  -0.658  1.00 0.00 ? 96  HIS A CG   5  
ATOM 10795 N ND1  . HIS A 1 96  ? 128.281 19.578  -1.876  1.00 0.00 ? 96  HIS A ND1  5  
ATOM 10796 C CD2  . HIS A 1 96  ? 128.749 21.019  -0.306  1.00 0.00 ? 96  HIS A CD2  5  
ATOM 10797 C CE1  . HIS A 1 96  ? 129.382 20.209  -2.241  1.00 0.00 ? 96  HIS A CE1  5  
ATOM 10798 N NE2  . HIS A 1 96  ? 129.686 21.090  -1.307  1.00 0.00 ? 96  HIS A NE2  5  
ATOM 10799 H H    . HIS A 1 96  ? 127.773 17.234  1.118   1.00 0.00 ? 96  HIS A H    5  
ATOM 10800 H HA   . HIS A 1 96  ? 127.191 19.964  2.082   1.00 0.00 ? 96  HIS A HA   5  
ATOM 10801 H HB2  . HIS A 1 96  ? 126.240 18.730  -0.526  1.00 0.00 ? 96  HIS A HB2  5  
ATOM 10802 H HB3  . HIS A 1 96  ? 125.897 20.361  0.041   1.00 0.00 ? 96  HIS A HB3  5  
ATOM 10803 H HD1  . HIS A 1 96  ? 127.840 18.872  -2.397  1.00 0.00 ? 96  HIS A HD1  5  
ATOM 10804 H HD2  . HIS A 1 96  ? 128.728 21.613  0.597   1.00 0.00 ? 96  HIS A HD2  5  
ATOM 10805 H HE1  . HIS A 1 96  ? 129.937 20.035  -3.151  1.00 0.00 ? 96  HIS A HE1  5  
ATOM 10806 H HE2  . HIS A 1 96  ? 130.528 21.595  -1.263  1.00 0.00 ? 96  HIS A HE2  5  
ATOM 10807 N N    . PRO A 1 97  ? 124.823 19.294  2.851   1.00 0.00 ? 97  PRO A N    5  
ATOM 10808 C CA   . PRO A 1 97  ? 123.685 18.783  3.640   1.00 0.00 ? 97  PRO A CA   5  
ATOM 10809 C C    . PRO A 1 97  ? 122.849 17.727  2.905   1.00 0.00 ? 97  PRO A C    5  
ATOM 10810 O O    . PRO A 1 97  ? 122.367 16.770  3.512   1.00 0.00 ? 97  PRO A O    5  
ATOM 10811 C CB   . PRO A 1 97  ? 122.842 20.046  3.927   1.00 0.00 ? 97  PRO A CB   5  
ATOM 10812 C CG   . PRO A 1 97  ? 123.497 21.152  3.155   1.00 0.00 ? 97  PRO A CG   5  
ATOM 10813 C CD   . PRO A 1 97  ? 124.935 20.749  2.991   1.00 0.00 ? 97  PRO A CD   5  
ATOM 10814 H HA   . PRO A 1 97  ? 124.026 18.364  4.578   1.00 0.00 ? 97  PRO A HA   5  
ATOM 10815 H HB2  . PRO A 1 97  ? 121.823 19.889  3.599   1.00 0.00 ? 97  PRO A HB2  5  
ATOM 10816 H HB3  . PRO A 1 97  ? 122.849 20.252  4.988   1.00 0.00 ? 97  PRO A HB3  5  
ATOM 10817 H HG2  . PRO A 1 97  ? 123.024 21.253  2.188   1.00 0.00 ? 97  PRO A HG2  5  
ATOM 10818 H HG3  . PRO A 1 97  ? 123.426 22.078  3.706   1.00 0.00 ? 97  PRO A HG3  5  
ATOM 10819 H HD2  . PRO A 1 97  ? 125.358 21.199  2.103   1.00 0.00 ? 97  PRO A HD2  5  
ATOM 10820 H HD3  . PRO A 1 97  ? 125.512 21.013  3.866   1.00 0.00 ? 97  PRO A HD3  5  
ATOM 10821 N N    . LEU A 1 98  ? 122.685 17.904  1.597   1.00 0.00 ? 98  LEU A N    5  
ATOM 10822 C CA   . LEU A 1 98  ? 121.895 16.976  0.792   1.00 0.00 ? 98  LEU A CA   5  
ATOM 10823 C C    . LEU A 1 98  ? 122.625 15.638  0.600   1.00 0.00 ? 98  LEU A C    5  
ATOM 10824 O O    . LEU A 1 98  ? 122.033 14.573  0.781   1.00 0.00 ? 98  LEU A O    5  
ATOM 10825 C CB   . LEU A 1 98  ? 121.563 17.607  -0.570  1.00 0.00 ? 98  LEU A CB   5  
ATOM 10826 C CG   . LEU A 1 98  ? 120.743 18.911  -0.511  1.00 0.00 ? 98  LEU A CG   5  
ATOM 10827 C CD1  . LEU A 1 98  ? 120.428 19.420  -1.916  1.00 0.00 ? 98  LEU A CD1  5  
ATOM 10828 C CD2  . LEU A 1 98  ? 119.457 18.714  0.292   1.00 0.00 ? 98  LEU A CD2  5  
ATOM 10829 H H    . LEU A 1 98  ? 123.104 18.678  1.165   1.00 0.00 ? 98  LEU A H    5  
ATOM 10830 H HA   . LEU A 1 98  ? 120.971 16.788  1.321   1.00 0.00 ? 98  LEU A HA   5  
ATOM 10831 H HB2  . LEU A 1 98  ? 122.493 17.814  -1.082  1.00 0.00 ? 98  LEU A HB2  5  
ATOM 10832 H HB3  . LEU A 1 98  ? 121.007 16.886  -1.152  1.00 0.00 ? 98  LEU A HB3  5  
ATOM 10833 H HG   . LEU A 1 98  ? 121.331 19.670  -0.013  1.00 0.00 ? 98  LEU A HG   5  
ATOM 10834 H HD11 . LEU A 1 98  ? 119.869 20.342  -1.849  1.00 0.00 ? 98  LEU A HD11 5  
ATOM 10835 H HD12 . LEU A 1 98  ? 119.842 18.683  -2.446  1.00 0.00 ? 98  LEU A HD12 5  
ATOM 10836 H HD13 . LEU A 1 98  ? 121.350 19.597  -2.451  1.00 0.00 ? 98  LEU A HD13 5  
ATOM 10837 H HD21 . LEU A 1 98  ? 119.704 18.424  1.304   1.00 0.00 ? 98  LEU A HD21 5  
ATOM 10838 H HD22 . LEU A 1 98  ? 118.858 17.941  -0.167  1.00 0.00 ? 98  LEU A HD22 5  
ATOM 10839 H HD23 . LEU A 1 98  ? 118.898 19.639  0.311   1.00 0.00 ? 98  LEU A HD23 5  
ATOM 10840 N N    . MET A 1 99  ? 123.909 15.718  0.241   1.00 0.00 ? 99  MET A N    5  
ATOM 10841 C CA   . MET A 1 99  ? 124.758 14.545  -0.041  1.00 0.00 ? 99  MET A CA   5  
ATOM 10842 C C    . MET A 1 99  ? 124.065 13.526  -0.947  1.00 0.00 ? 99  MET A C    5  
ATOM 10843 O O    . MET A 1 99  ? 124.263 13.522  -2.163  1.00 0.00 ? 99  MET A O    5  
ATOM 10844 C CB   . MET A 1 99  ? 125.226 13.848  1.249   1.00 0.00 ? 99  MET A CB   5  
ATOM 10845 C CG   . MET A 1 99  ? 126.272 14.618  2.044   1.00 0.00 ? 99  MET A CG   5  
ATOM 10846 S SD   . MET A 1 99  ? 127.755 14.986  1.083   1.00 0.00 ? 99  MET A SD   5  
ATOM 10847 C CE   . MET A 1 99  ? 128.375 13.337  0.750   1.00 0.00 ? 99  MET A CE   5  
ATOM 10848 H H    . MET A 1 99  ? 124.311 16.603  0.174   1.00 0.00 ? 99  MET A H    5  
ATOM 10849 H HA   . MET A 1 99  ? 125.631 14.912  -0.562  1.00 0.00 ? 99  MET A HA   5  
ATOM 10850 H HB2  . MET A 1 99  ? 124.369 13.690  1.888   1.00 0.00 ? 99  MET A HB2  5  
ATOM 10851 H HB3  . MET A 1 99  ? 125.645 12.884  0.989   1.00 0.00 ? 99  MET A HB3  5  
ATOM 10852 H HG2  . MET A 1 99  ? 125.840 15.547  2.380   1.00 0.00 ? 99  MET A HG2  5  
ATOM 10853 H HG3  . MET A 1 99  ? 126.557 14.028  2.904   1.00 0.00 ? 99  MET A HG3  5  
ATOM 10854 H HE1  . MET A 1 99  ? 127.637 12.781  0.190   1.00 0.00 ? 99  MET A HE1  5  
ATOM 10855 H HE2  . MET A 1 99  ? 128.573 12.832  1.684   1.00 0.00 ? 99  MET A HE2  5  
ATOM 10856 H HE3  . MET A 1 99  ? 129.288 13.404  0.177   1.00 0.00 ? 99  MET A HE3  5  
ATOM 10857 N N    . PHE A 1 100 ? 123.235 12.681  -0.344  1.00 0.00 ? 100 PHE A N    5  
ATOM 10858 C CA   . PHE A 1 100 ? 122.634 11.547  -1.041  1.00 0.00 ? 100 PHE A CA   5  
ATOM 10859 C C    . PHE A 1 100 ? 121.250 11.884  -1.582  1.00 0.00 ? 100 PHE A C    5  
ATOM 10860 O O    . PHE A 1 100 ? 120.515 10.999  -2.023  1.00 0.00 ? 100 PHE A O    5  
ATOM 10861 C CB   . PHE A 1 100 ? 122.580 10.321  -0.121  1.00 0.00 ? 100 PHE A CB   5  
ATOM 10862 C CG   . PHE A 1 100 ? 123.932 9.684   0.090   1.00 0.00 ? 100 PHE A CG   5  
ATOM 10863 C CD1  . PHE A 1 100 ? 124.863 10.261  0.940   1.00 0.00 ? 100 PHE A CD1  5  
ATOM 10864 C CD2  . PHE A 1 100 ? 124.276 8.515   -0.578  1.00 0.00 ? 100 PHE A CD2  5  
ATOM 10865 C CE1  . PHE A 1 100 ? 126.105 9.686   1.124   1.00 0.00 ? 100 PHE A CE1  5  
ATOM 10866 C CE2  . PHE A 1 100 ? 125.518 7.937   -0.398  1.00 0.00 ? 100 PHE A CE2  5  
ATOM 10867 C CZ   . PHE A 1 100 ? 126.434 8.524   0.455   1.00 0.00 ? 100 PHE A CZ   5  
ATOM 10868 H H    . PHE A 1 100 ? 123.003 12.840  0.595   1.00 0.00 ? 100 PHE A H    5  
ATOM 10869 H HA   . PHE A 1 100 ? 123.270 11.311  -1.884  1.00 0.00 ? 100 PHE A HA   5  
ATOM 10870 H HB2  . PHE A 1 100 ? 122.194 10.617  0.845   1.00 0.00 ? 100 PHE A HB2  5  
ATOM 10871 H HB3  . PHE A 1 100 ? 121.922 9.578   -0.553  1.00 0.00 ? 100 PHE A HB3  5  
ATOM 10872 H HD1  . PHE A 1 100 ? 124.610 11.170  1.466   1.00 0.00 ? 100 PHE A HD1  5  
ATOM 10873 H HD2  . PHE A 1 100 ? 123.561 8.055   -1.245  1.00 0.00 ? 100 PHE A HD2  5  
ATOM 10874 H HE1  . PHE A 1 100 ? 126.821 10.146  1.791   1.00 0.00 ? 100 PHE A HE1  5  
ATOM 10875 H HE2  . PHE A 1 100 ? 125.773 7.027   -0.923  1.00 0.00 ? 100 PHE A HE2  5  
ATOM 10876 H HZ   . PHE A 1 100 ? 127.406 8.074   0.598   1.00 0.00 ? 100 PHE A HZ   5  
ATOM 10877 N N    . GLN A 1 101 ? 120.892 13.162  -1.564  1.00 0.00 ? 101 GLN A N    5  
ATOM 10878 C CA   . GLN A 1 101 ? 119.718 13.611  -2.280  1.00 0.00 ? 101 GLN A CA   5  
ATOM 10879 C C    . GLN A 1 101 ? 120.027 13.517  -3.764  1.00 0.00 ? 101 GLN A C    5  
ATOM 10880 O O    . GLN A 1 101 ? 121.197 13.546  -4.151  1.00 0.00 ? 101 GLN A O    5  
ATOM 10881 C CB   . GLN A 1 101 ? 119.328 15.035  -1.868  1.00 0.00 ? 101 GLN A CB   5  
ATOM 10882 C CG   . GLN A 1 101 ? 118.954 15.151  -0.392  1.00 0.00 ? 101 GLN A CG   5  
ATOM 10883 C CD   . GLN A 1 101 ? 117.762 14.289  -0.017  1.00 0.00 ? 101 GLN A CD   5  
ATOM 10884 O OE1  . GLN A 1 101 ? 116.618 14.739  -0.067  1.00 0.00 ? 101 GLN A OE1  5  
ATOM 10885 N NE2  . GLN A 1 101 ? 118.022 13.045  0.360   1.00 0.00 ? 101 GLN A NE2  5  
ATOM 10886 H H    . GLN A 1 101 ? 121.432 13.812  -1.081  1.00 0.00 ? 101 GLN A H    5  
ATOM 10887 H HA   . GLN A 1 101 ? 118.904 12.934  -2.048  1.00 0.00 ? 101 GLN A HA   5  
ATOM 10888 H HB2  . GLN A 1 101 ? 120.162 15.696  -2.062  1.00 0.00 ? 101 GLN A HB2  5  
ATOM 10889 H HB3  . GLN A 1 101 ? 118.481 15.354  -2.460  1.00 0.00 ? 101 GLN A HB3  5  
ATOM 10890 H HG2  . GLN A 1 101 ? 119.801 14.845  0.206   1.00 0.00 ? 101 GLN A HG2  5  
ATOM 10891 H HG3  . GLN A 1 101 ? 118.718 16.182  -0.174  1.00 0.00 ? 101 GLN A HG3  5  
ATOM 10892 H HE21 . GLN A 1 101 ? 118.956 12.752  0.377   1.00 0.00 ? 101 GLN A HE21 5  
ATOM 10893 H HE22 . GLN A 1 101 ? 117.266 12.463  0.595   1.00 0.00 ? 101 GLN A HE22 5  
ATOM 10894 N N    . LYS A 1 102 ? 118.987 13.394  -4.571  1.00 0.00 ? 102 LYS A N    5  
ATOM 10895 C CA   . LYS A 1 102 ? 119.095 12.991  -5.980  1.00 0.00 ? 102 LYS A CA   5  
ATOM 10896 C C    . LYS A 1 102 ? 119.308 11.479  -6.051  1.00 0.00 ? 102 LYS A C    5  
ATOM 10897 O O    . LYS A 1 102 ? 118.637 10.780  -6.808  1.00 0.00 ? 102 LYS A O    5  
ATOM 10898 C CB   . LYS A 1 102 ? 120.237 13.703  -6.725  1.00 0.00 ? 102 LYS A CB   5  
ATOM 10899 C CG   . LYS A 1 102 ? 120.149 15.228  -6.743  1.00 0.00 ? 102 LYS A CG   5  
ATOM 10900 C CD   . LYS A 1 102 ? 121.359 15.844  -7.449  1.00 0.00 ? 102 LYS A CD   5  
ATOM 10901 C CE   . LYS A 1 102 ? 122.670 15.395  -6.808  1.00 0.00 ? 102 LYS A CE   5  
ATOM 10902 N NZ   . LYS A 1 102 ? 123.863 15.937  -7.513  1.00 0.00 ? 102 LYS A NZ   5  
ATOM 10903 H H    . LYS A 1 102 ? 118.104 13.578  -4.206  1.00 0.00 ? 102 LYS A H    5  
ATOM 10904 H HA   . LYS A 1 102 ? 118.155 13.230  -6.460  1.00 0.00 ? 102 LYS A HA   5  
ATOM 10905 H HB2  . LYS A 1 102 ? 121.168 13.429  -6.254  1.00 0.00 ? 102 LYS A HB2  5  
ATOM 10906 H HB3  . LYS A 1 102 ? 120.250 13.354  -7.747  1.00 0.00 ? 102 LYS A HB3  5  
ATOM 10907 H HG2  . LYS A 1 102 ? 119.251 15.522  -7.266  1.00 0.00 ? 102 LYS A HG2  5  
ATOM 10908 H HG3  . LYS A 1 102 ? 120.112 15.592  -5.726  1.00 0.00 ? 102 LYS A HG3  5  
ATOM 10909 H HD2  . LYS A 1 102 ? 121.353 15.538  -8.486  1.00 0.00 ? 102 LYS A HD2  5  
ATOM 10910 H HD3  . LYS A 1 102 ? 121.289 16.922  -7.390  1.00 0.00 ? 102 LYS A HD3  5  
ATOM 10911 H HE2  . LYS A 1 102 ? 122.690 15.733  -5.783  1.00 0.00 ? 102 LYS A HE2  5  
ATOM 10912 H HE3  . LYS A 1 102 ? 122.715 14.314  -6.828  1.00 0.00 ? 102 LYS A HE3  5  
ATOM 10913 H HZ1  . LYS A 1 102 ? 123.852 15.653  -8.514  1.00 0.00 ? 102 LYS A HZ1  5  
ATOM 10914 H HZ2  . LYS A 1 102 ? 124.731 15.570  -7.072  1.00 0.00 ? 102 LYS A HZ2  5  
ATOM 10915 H HZ3  . LYS A 1 102 ? 123.874 16.974  -7.458  1.00 0.00 ? 102 LYS A HZ3  5  
ATOM 10916 N N    . LEU A 1 103 ? 120.245 10.982  -5.239  1.00 0.00 ? 103 LEU A N    5  
ATOM 10917 C CA   . LEU A 1 103 ? 120.510 9.549   -5.143  1.00 0.00 ? 103 LEU A CA   5  
ATOM 10918 C C    . LEU A 1 103 ? 119.309 8.832   -4.535  1.00 0.00 ? 103 LEU A C    5  
ATOM 10919 O O    . LEU A 1 103 ? 118.923 7.757   -4.993  1.00 0.00 ? 103 LEU A O    5  
ATOM 10920 C CB   . LEU A 1 103 ? 121.772 9.268   -4.306  1.00 0.00 ? 103 LEU A CB   5  
ATOM 10921 C CG   . LEU A 1 103 ? 123.109 9.732   -4.916  1.00 0.00 ? 103 LEU A CG   5  
ATOM 10922 C CD1  . LEU A 1 103 ? 123.262 9.210   -6.342  1.00 0.00 ? 103 LEU A CD1  5  
ATOM 10923 C CD2  . LEU A 1 103 ? 123.250 11.254  -4.869  1.00 0.00 ? 103 LEU A CD2  5  
ATOM 10924 H H    . LEU A 1 103 ? 120.777 11.599  -4.698  1.00 0.00 ? 103 LEU A H    5  
ATOM 10925 H HA   . LEU A 1 103 ? 120.664 9.175   -6.146  1.00 0.00 ? 103 LEU A HA   5  
ATOM 10926 H HB2  . LEU A 1 103 ? 121.655 9.752   -3.346  1.00 0.00 ? 103 LEU A HB2  5  
ATOM 10927 H HB3  . LEU A 1 103 ? 121.834 8.201   -4.140  1.00 0.00 ? 103 LEU A HB3  5  
ATOM 10928 H HG   . LEU A 1 103 ? 123.917 9.311   -4.332  1.00 0.00 ? 103 LEU A HG   5  
ATOM 10929 H HD11 . LEU A 1 103 ? 123.198 8.132   -6.340  1.00 0.00 ? 103 LEU A HD11 5  
ATOM 10930 H HD12 . LEU A 1 103 ? 124.224 9.509   -6.733  1.00 0.00 ? 103 LEU A HD12 5  
ATOM 10931 H HD13 . LEU A 1 103 ? 122.478 9.617   -6.964  1.00 0.00 ? 103 LEU A HD13 5  
ATOM 10932 H HD21 . LEU A 1 103 ? 124.207 11.541  -5.280  1.00 0.00 ? 103 LEU A HD21 5  
ATOM 10933 H HD22 . LEU A 1 103 ? 123.187 11.590  -3.843  1.00 0.00 ? 103 LEU A HD22 5  
ATOM 10934 H HD23 . LEU A 1 103 ? 122.459 11.710  -5.447  1.00 0.00 ? 103 LEU A HD23 5  
ATOM 10935 N N    . GLN A 1 104 ? 118.719 9.430   -3.501  1.00 0.00 ? 104 GLN A N    5  
ATOM 10936 C CA   . GLN A 1 104 ? 117.516 8.889   -2.891  1.00 0.00 ? 104 GLN A CA   5  
ATOM 10937 C C    . GLN A 1 104 ? 116.366 8.923   -3.896  1.00 0.00 ? 104 GLN A C    5  
ATOM 10938 O O    . GLN A 1 104 ? 115.553 8.003   -3.963  1.00 0.00 ? 104 GLN A O    5  
ATOM 10939 C CB   . GLN A 1 104 ? 117.143 9.682   -1.635  1.00 0.00 ? 104 GLN A CB   5  
ATOM 10940 C CG   . GLN A 1 104 ? 116.057 9.007   -0.812  1.00 0.00 ? 104 GLN A CG   5  
ATOM 10941 C CD   . GLN A 1 104 ? 115.568 9.844   0.359   1.00 0.00 ? 104 GLN A CD   5  
ATOM 10942 O OE1  . GLN A 1 104 ? 116.308 10.656  0.921   1.00 0.00 ? 104 GLN A OE1  5  
ATOM 10943 N NE2  . GLN A 1 104 ? 114.319 9.638   0.743   1.00 0.00 ? 104 GLN A NE2  5  
ATOM 10944 H H    . GLN A 1 104 ? 119.111 10.244  -3.126  1.00 0.00 ? 104 GLN A H    5  
ATOM 10945 H HA   . GLN A 1 104 ? 117.714 7.861   -2.618  1.00 0.00 ? 104 GLN A HA   5  
ATOM 10946 H HB2  . GLN A 1 104 ? 118.023 9.794   -1.016  1.00 0.00 ? 104 GLN A HB2  5  
ATOM 10947 H HB3  . GLN A 1 104 ? 116.792 10.662  -1.928  1.00 0.00 ? 104 GLN A HB3  5  
ATOM 10948 H HG2  . GLN A 1 104 ? 115.219 8.800   -1.460  1.00 0.00 ? 104 GLN A HG2  5  
ATOM 10949 H HG3  . GLN A 1 104 ? 116.450 8.077   -0.432  1.00 0.00 ? 104 GLN A HG3  5  
ATOM 10950 H HE21 . GLN A 1 104 ? 113.789 8.970   0.258   1.00 0.00 ? 104 GLN A HE21 5  
ATOM 10951 H HE22 . GLN A 1 104 ? 113.973 10.158  1.499   1.00 0.00 ? 104 GLN A HE22 5  
ATOM 10952 N N    . ASP A 1 105 ? 116.313 9.996   -4.682  1.00 0.00 ? 105 ASP A N    5  
ATOM 10953 C CA   . ASP A 1 105 ? 115.322 10.128  -5.750  1.00 0.00 ? 105 ASP A CA   5  
ATOM 10954 C C    . ASP A 1 105 ? 115.529 9.026   -6.782  1.00 0.00 ? 105 ASP A C    5  
ATOM 10955 O O    . ASP A 1 105 ? 114.572 8.428   -7.283  1.00 0.00 ? 105 ASP A O    5  
ATOM 10956 C CB   . ASP A 1 105 ? 115.436 11.499  -6.429  1.00 0.00 ? 105 ASP A CB   5  
ATOM 10957 C CG   . ASP A 1 105 ? 115.152 12.653  -5.483  1.00 0.00 ? 105 ASP A CG   5  
ATOM 10958 O OD1  . ASP A 1 105 ? 116.055 13.020  -4.697  1.00 0.00 ? 105 ASP A OD1  5  
ATOM 10959 O OD2  . ASP A 1 105 ? 114.031 13.206  -5.524  1.00 0.00 ? 105 ASP A OD2  5  
ATOM 10960 H H    . ASP A 1 105 ? 116.954 10.722  -4.538  1.00 0.00 ? 105 ASP A H    5  
ATOM 10961 H HA   . ASP A 1 105 ? 114.338 10.025  -5.313  1.00 0.00 ? 105 ASP A HA   5  
ATOM 10962 H HB2  . ASP A 1 105 ? 116.438 11.618  -6.819  1.00 0.00 ? 105 ASP A HB2  5  
ATOM 10963 H HB3  . ASP A 1 105 ? 114.732 11.546  -7.250  1.00 0.00 ? 105 ASP A HB3  5  
ATOM 10964 N N    . GLN A 1 106 ? 116.794 8.755   -7.086  1.00 0.00 ? 106 GLN A N    5  
ATOM 10965 C CA   . GLN A 1 106 ? 117.150 7.700   -8.021  1.00 0.00 ? 106 GLN A CA   5  
ATOM 10966 C C    . GLN A 1 106 ? 116.675 6.362   -7.464  1.00 0.00 ? 106 GLN A C    5  
ATOM 10967 O O    . GLN A 1 106 ? 115.923 5.644   -8.119  1.00 0.00 ? 106 GLN A O    5  
ATOM 10968 C CB   . GLN A 1 106 ? 118.672 7.683   -8.268  1.00 0.00 ? 106 GLN A CB   5  
ATOM 10969 C CG   . GLN A 1 106 ? 119.094 7.094   -9.620  1.00 0.00 ? 106 GLN A CG   5  
ATOM 10970 C CD   . GLN A 1 106 ? 118.652 5.653   -9.829  1.00 0.00 ? 106 GLN A CD   5  
ATOM 10971 O OE1  . GLN A 1 106 ? 117.574 5.390   -10.361 1.00 0.00 ? 106 GLN A OE1  5  
ATOM 10972 N NE2  . GLN A 1 106 ? 119.485 4.709   -9.423  1.00 0.00 ? 106 GLN A NE2  5  
ATOM 10973 H H    . GLN A 1 106 ? 117.507 9.283   -6.669  1.00 0.00 ? 106 GLN A H    5  
ATOM 10974 H HA   . GLN A 1 106 ? 116.638 7.894   -8.955  1.00 0.00 ? 106 GLN A HA   5  
ATOM 10975 H HB2  . GLN A 1 106 ? 119.042 8.697   -8.217  1.00 0.00 ? 106 GLN A HB2  5  
ATOM 10976 H HB3  . GLN A 1 106 ? 119.145 7.104   -7.486  1.00 0.00 ? 106 GLN A HB3  5  
ATOM 10977 H HG2  . GLN A 1 106 ? 118.664 7.698   -10.406 1.00 0.00 ? 106 GLN A HG2  5  
ATOM 10978 H HG3  . GLN A 1 106 ? 120.172 7.139   -9.692  1.00 0.00 ? 106 GLN A HG3  5  
ATOM 10979 H HE21 . GLN A 1 106 ? 120.333 4.985   -9.017  1.00 0.00 ? 106 GLN A HE21 5  
ATOM 10980 H HE22 . GLN A 1 106 ? 119.221 3.776   -9.547  1.00 0.00 ? 106 GLN A HE22 5  
ATOM 10981 N N    . ILE A 1 107 ? 117.081 6.051   -6.230  1.00 0.00 ? 107 ILE A N    5  
ATOM 10982 C CA   . ILE A 1 107 ? 116.710 4.787   -5.607  1.00 0.00 ? 107 ILE A CA   5  
ATOM 10983 C C    . ILE A 1 107 ? 115.200 4.719   -5.412  1.00 0.00 ? 107 ILE A C    5  
ATOM 10984 O O    . ILE A 1 107 ? 114.646 3.647   -5.331  1.00 0.00 ? 107 ILE A O    5  
ATOM 10985 C CB   . ILE A 1 107 ? 117.419 4.543   -4.239  1.00 0.00 ? 107 ILE A CB   5  
ATOM 10986 C CG1  . ILE A 1 107 ? 117.512 3.034   -3.932  1.00 0.00 ? 107 ILE A CG1  5  
ATOM 10987 C CG2  . ILE A 1 107 ? 116.682 5.248   -3.100  1.00 0.00 ? 107 ILE A CG2  5  
ATOM 10988 C CD1  . ILE A 1 107 ? 118.453 2.272   -4.847  1.00 0.00 ? 107 ILE A CD1  5  
ATOM 10989 H H    . ILE A 1 107 ? 117.637 6.685   -5.733  1.00 0.00 ? 107 ILE A H    5  
ATOM 10990 H HA   . ILE A 1 107 ? 117.004 3.995   -6.284  1.00 0.00 ? 107 ILE A HA   5  
ATOM 10991 H HB   . ILE A 1 107 ? 118.418 4.953   -4.296  1.00 0.00 ? 107 ILE A HB   5  
ATOM 10992 H HG12 . ILE A 1 107 ? 117.863 2.899   -2.920  1.00 0.00 ? 107 ILE A HG12 5  
ATOM 10993 H HG13 . ILE A 1 107 ? 116.527 2.588   -4.025  1.00 0.00 ? 107 ILE A HG13 5  
ATOM 10994 H HG21 . ILE A 1 107 ? 116.586 6.299   -3.326  1.00 0.00 ? 107 ILE A HG21 5  
ATOM 10995 H HG22 . ILE A 1 107 ? 117.236 5.126   -2.181  1.00 0.00 ? 107 ILE A HG22 5  
ATOM 10996 H HG23 . ILE A 1 107 ? 115.696 4.810   -2.984  1.00 0.00 ? 107 ILE A HG23 5  
ATOM 10997 H HD11 . ILE A 1 107 ? 118.085 2.313   -5.861  1.00 0.00 ? 107 ILE A HD11 5  
ATOM 10998 H HD12 . ILE A 1 107 ? 118.512 1.241   -4.525  1.00 0.00 ? 107 ILE A HD12 5  
ATOM 10999 H HD13 . ILE A 1 107 ? 119.437 2.716   -4.803  1.00 0.00 ? 107 ILE A HD13 5  
ATOM 11000 N N    . PHE A 1 108 ? 114.531 5.865   -5.338  1.00 0.00 ? 108 PHE A N    5  
ATOM 11001 C CA   . PHE A 1 108 ? 113.075 5.871   -5.218  1.00 0.00 ? 108 PHE A CA   5  
ATOM 11002 C C    . PHE A 1 108 ? 112.453 5.236   -6.462  1.00 0.00 ? 108 PHE A C    5  
ATOM 11003 O O    . PHE A 1 108 ? 111.570 4.382   -6.367  1.00 0.00 ? 108 PHE A O    5  
ATOM 11004 C CB   . PHE A 1 108 ? 112.542 7.299   -5.020  1.00 0.00 ? 108 PHE A CB   5  
ATOM 11005 C CG   . PHE A 1 108 ? 111.050 7.362   -4.783  1.00 0.00 ? 108 PHE A CG   5  
ATOM 11006 C CD1  . PHE A 1 108 ? 110.521 7.077   -3.530  1.00 0.00 ? 108 PHE A CD1  5  
ATOM 11007 C CD2  . PHE A 1 108 ? 110.179 7.699   -5.811  1.00 0.00 ? 108 PHE A CD2  5  
ATOM 11008 C CE1  . PHE A 1 108 ? 109.157 7.129   -3.309  1.00 0.00 ? 108 PHE A CE1  5  
ATOM 11009 C CE2  . PHE A 1 108 ? 108.814 7.751   -5.593  1.00 0.00 ? 108 PHE A CE2  5  
ATOM 11010 C CZ   . PHE A 1 108 ? 108.303 7.466   -4.341  1.00 0.00 ? 108 PHE A CZ   5  
ATOM 11011 H H    . PHE A 1 108 ? 115.020 6.714   -5.352  1.00 0.00 ? 108 PHE A H    5  
ATOM 11012 H HA   . PHE A 1 108 ? 112.813 5.273   -4.355  1.00 0.00 ? 108 PHE A HA   5  
ATOM 11013 H HB2  . PHE A 1 108 ? 113.034 7.742   -4.165  1.00 0.00 ? 108 PHE A HB2  5  
ATOM 11014 H HB3  . PHE A 1 108 ? 112.768 7.886   -5.899  1.00 0.00 ? 108 PHE A HB3  5  
ATOM 11015 H HD1  . PHE A 1 108 ? 111.186 6.814   -2.720  1.00 0.00 ? 108 PHE A HD1  5  
ATOM 11016 H HD2  . PHE A 1 108 ? 110.575 7.923   -6.791  1.00 0.00 ? 108 PHE A HD2  5  
ATOM 11017 H HE1  . PHE A 1 108 ? 108.759 6.905   -2.329  1.00 0.00 ? 108 PHE A HE1  5  
ATOM 11018 H HE2  . PHE A 1 108 ? 108.147 8.015   -6.401  1.00 0.00 ? 108 PHE A HE2  5  
ATOM 11019 H HZ   . PHE A 1 108 ? 107.237 7.506   -4.170  1.00 0.00 ? 108 PHE A HZ   5  
ATOM 11020 N N    . ASN A 1 109 ? 112.949 5.640   -7.628  1.00 0.00 ? 109 ASN A N    5  
ATOM 11021 C CA   . ASN A 1 109 ? 112.447 5.125   -8.902  1.00 0.00 ? 109 ASN A CA   5  
ATOM 11022 C C    . ASN A 1 109 ? 113.017 3.736   -9.192  1.00 0.00 ? 109 ASN A C    5  
ATOM 11023 O O    . ASN A 1 109 ? 112.322 2.870   -9.728  1.00 0.00 ? 109 ASN A O    5  
ATOM 11024 C CB   . ASN A 1 109 ? 112.786 6.092   -10.047 1.00 0.00 ? 109 ASN A CB   5  
ATOM 11025 C CG   . ASN A 1 109 ? 112.040 7.415   -9.936  1.00 0.00 ? 109 ASN A CG   5  
ATOM 11026 O OD1  . ASN A 1 109 ? 110.925 7.557   -10.444 1.00 0.00 ? 109 ASN A OD1  5  
ATOM 11027 N ND2  . ASN A 1 109 ? 112.644 8.393   -9.277  1.00 0.00 ? 109 ASN A ND2  5  
ATOM 11028 H H    . ASN A 1 109 ? 113.675 6.302   -7.632  1.00 0.00 ? 109 ASN A H    5  
ATOM 11029 H HA   . ASN A 1 109 ? 111.370 5.045   -8.822  1.00 0.00 ? 109 ASN A HA   5  
ATOM 11030 H HB2  . ASN A 1 109 ? 113.847 6.295   -10.036 1.00 0.00 ? 109 ASN A HB2  5  
ATOM 11031 H HB3  . ASN A 1 109 ? 112.524 5.631   -10.990 1.00 0.00 ? 109 ASN A HB3  5  
ATOM 11032 H HD21 . ASN A 1 109 ? 113.532 8.221   -8.899  1.00 0.00 ? 109 ASN A HD21 5  
ATOM 11033 H HD22 . ASN A 1 109 ? 112.177 9.251   -9.190  1.00 0.00 ? 109 ASN A HD22 5  
ATOM 11034 N N    . LEU A 1 110 ? 114.281 3.530   -8.831  1.00 0.00 ? 110 LEU A N    5  
ATOM 11035 C CA   . LEU A 1 110 ? 114.955 2.253   -9.042  1.00 0.00 ? 110 LEU A CA   5  
ATOM 11036 C C    . LEU A 1 110 ? 114.339 1.185   -8.137  1.00 0.00 ? 110 LEU A C    5  
ATOM 11037 O O    . LEU A 1 110 ? 113.955 0.114   -8.596  1.00 0.00 ? 110 LEU A O    5  
ATOM 11038 C CB   . LEU A 1 110 ? 116.462 2.420   -8.761  1.00 0.00 ? 110 LEU A CB   5  
ATOM 11039 C CG   . LEU A 1 110 ? 117.398 1.302   -9.269  1.00 0.00 ? 110 LEU A CG   5  
ATOM 11040 C CD1  . LEU A 1 110 ? 117.247 0.015   -8.458  1.00 0.00 ? 110 LEU A CD1  5  
ATOM 11041 C CD2  . LEU A 1 110 ? 117.167 1.037   -10.757 1.00 0.00 ? 110 LEU A CD2  5  
ATOM 11042 H H    . LEU A 1 110 ? 114.780 4.261   -8.416  1.00 0.00 ? 110 LEU A H    5  
ATOM 11043 H HA   . LEU A 1 110 ? 114.815 1.966   -10.074 1.00 0.00 ? 110 LEU A HA   5  
ATOM 11044 H HB2  . LEU A 1 110 ? 116.781 3.350   -9.213  1.00 0.00 ? 110 LEU A HB2  5  
ATOM 11045 H HB3  . LEU A 1 110 ? 116.595 2.508   -7.691  1.00 0.00 ? 110 LEU A HB3  5  
ATOM 11046 H HG   . LEU A 1 110 ? 118.417 1.638   -9.153  1.00 0.00 ? 110 LEU A HG   5  
ATOM 11047 H HD11 . LEU A 1 110 ? 117.446 0.220   -7.416  1.00 0.00 ? 110 LEU A HD11 5  
ATOM 11048 H HD12 . LEU A 1 110 ? 117.951 -0.722  -8.817  1.00 0.00 ? 110 LEU A HD12 5  
ATOM 11049 H HD13 . LEU A 1 110 ? 116.242 -0.368  -8.564  1.00 0.00 ? 110 LEU A HD13 5  
ATOM 11050 H HD21 . LEU A 1 110 ? 117.858 0.280   -11.100 1.00 0.00 ? 110 LEU A HD21 5  
ATOM 11051 H HD22 . LEU A 1 110 ? 117.329 1.948   -11.315 1.00 0.00 ? 110 LEU A HD22 5  
ATOM 11052 H HD23 . LEU A 1 110 ? 116.154 0.696   -10.913 1.00 0.00 ? 110 LEU A HD23 5  
ATOM 11053 N N    . MET A 1 111 ? 114.245 1.501   -6.852  1.00 0.00 ? 111 MET A N    5  
ATOM 11054 C CA   . MET A 1 111 ? 113.658 0.606   -5.854  1.00 0.00 ? 111 MET A CA   5  
ATOM 11055 C C    . MET A 1 111 ? 112.217 0.272   -6.227  1.00 0.00 ? 111 MET A C    5  
ATOM 11056 O O    . MET A 1 111 ? 111.764 -0.857  -6.041  1.00 0.00 ? 111 MET A O    5  
ATOM 11057 C CB   . MET A 1 111 ? 113.718 1.259   -4.462  1.00 0.00 ? 111 MET A CB   5  
ATOM 11058 C CG   . MET A 1 111 ? 113.185 0.406   -3.326  1.00 0.00 ? 111 MET A CG   5  
ATOM 11059 S SD   . MET A 1 111 ? 113.342 1.205   -1.715  1.00 0.00 ? 111 MET A SD   5  
ATOM 11060 C CE   . MET A 1 111 ? 112.499 2.756   -2.012  1.00 0.00 ? 111 MET A CE   5  
ATOM 11061 H H    . MET A 1 111 ? 114.586 2.367   -6.559  1.00 0.00 ? 111 MET A H    5  
ATOM 11062 H HA   . MET A 1 111 ? 114.238 -0.307  -5.842  1.00 0.00 ? 111 MET A HA   5  
ATOM 11063 H HB2  . MET A 1 111 ? 114.747 1.501   -4.240  1.00 0.00 ? 111 MET A HB2  5  
ATOM 11064 H HB3  . MET A 1 111 ? 113.148 2.178   -4.489  1.00 0.00 ? 111 MET A HB3  5  
ATOM 11065 H HG2  . MET A 1 111 ? 112.145 0.195   -3.507  1.00 0.00 ? 111 MET A HG2  5  
ATOM 11066 H HG3  . MET A 1 111 ? 113.744 -0.515  -3.305  1.00 0.00 ? 111 MET A HG3  5  
ATOM 11067 H HE1  . MET A 1 111 ? 112.498 3.343   -1.105  1.00 0.00 ? 111 MET A HE1  5  
ATOM 11068 H HE2  . MET A 1 111 ? 111.482 2.561   -2.317  1.00 0.00 ? 111 MET A HE2  5  
ATOM 11069 H HE3  . MET A 1 111 ? 113.012 3.301   -2.792  1.00 0.00 ? 111 MET A HE3  5  
ATOM 11070 N N    . LYS A 1 112 ? 111.501 1.255   -6.766  1.00 0.00 ? 112 LYS A N    5  
ATOM 11071 C CA   . LYS A 1 112 ? 110.137 1.031   -7.228  1.00 0.00 ? 112 LYS A CA   5  
ATOM 11072 C C    . LYS A 1 112 ? 110.140 0.033   -8.387  1.00 0.00 ? 112 LYS A C    5  
ATOM 11073 O O    . LYS A 1 112 ? 109.533 -1.033  -8.303  1.00 0.00 ? 112 LYS A O    5  
ATOM 11074 C CB   . LYS A 1 112 ? 109.476 2.356   -7.645  1.00 0.00 ? 112 LYS A CB   5  
ATOM 11075 C CG   . LYS A 1 112 ? 107.986 2.228   -7.963  1.00 0.00 ? 112 LYS A CG   5  
ATOM 11076 C CD   . LYS A 1 112 ? 107.319 3.593   -8.133  1.00 0.00 ? 112 LYS A CD   5  
ATOM 11077 C CE   . LYS A 1 112 ? 105.822 3.463   -8.397  1.00 0.00 ? 112 LYS A CE   5  
ATOM 11078 N NZ   . LYS A 1 112 ? 105.152 4.789   -8.486  1.00 0.00 ? 112 LYS A NZ   5  
ATOM 11079 H H    . LYS A 1 112 ? 111.896 2.150   -6.846  1.00 0.00 ? 112 LYS A H    5  
ATOM 11080 H HA   . LYS A 1 112 ? 109.578 0.605   -6.404  1.00 0.00 ? 112 LYS A HA   5  
ATOM 11081 H HB2  . LYS A 1 112 ? 109.591 3.069   -6.840  1.00 0.00 ? 112 LYS A HB2  5  
ATOM 11082 H HB3  . LYS A 1 112 ? 109.980 2.736   -8.523  1.00 0.00 ? 112 LYS A HB3  5  
ATOM 11083 H HG2  . LYS A 1 112 ? 107.871 1.666   -8.879  1.00 0.00 ? 112 LYS A HG2  5  
ATOM 11084 H HG3  . LYS A 1 112 ? 107.499 1.698   -7.154  1.00 0.00 ? 112 LYS A HG3  5  
ATOM 11085 H HD2  . LYS A 1 112 ? 107.463 4.169   -7.231  1.00 0.00 ? 112 LYS A HD2  5  
ATOM 11086 H HD3  . LYS A 1 112 ? 107.779 4.107   -8.966  1.00 0.00 ? 112 LYS A HD3  5  
ATOM 11087 H HE2  . LYS A 1 112 ? 105.676 2.935   -9.329  1.00 0.00 ? 112 LYS A HE2  5  
ATOM 11088 H HE3  . LYS A 1 112 ? 105.375 2.897   -7.592  1.00 0.00 ? 112 LYS A HE3  5  
ATOM 11089 H HZ1  . LYS A 1 112 ? 105.620 5.383   -9.201  1.00 0.00 ? 112 LYS A HZ1  5  
ATOM 11090 H HZ2  . LYS A 1 112 ? 105.193 5.276   -7.568  1.00 0.00 ? 112 LYS A HZ2  5  
ATOM 11091 H HZ3  . LYS A 1 112 ? 104.152 4.668   -8.756  1.00 0.00 ? 112 LYS A HZ3  5  
ATOM 11092 N N    . TYR A 1 113 ? 110.861 0.366   -9.451  1.00 0.00 ? 113 TYR A N    5  
ATOM 11093 C CA   . TYR A 1 113 ? 110.976 -0.517  -10.608 1.00 0.00 ? 113 TYR A CA   5  
ATOM 11094 C C    . TYR A 1 113 ? 111.449 -1.908  -10.175 1.00 0.00 ? 113 TYR A C    5  
ATOM 11095 O O    . TYR A 1 113 ? 110.698 -2.878  -10.226 1.00 0.00 ? 113 TYR A O    5  
ATOM 11096 C CB   . TYR A 1 113 ? 111.950 0.087   -11.632 1.00 0.00 ? 113 TYR A CB   5  
ATOM 11097 C CG   . TYR A 1 113 ? 112.256 -0.817  -12.817 1.00 0.00 ? 113 TYR A CG   5  
ATOM 11098 C CD1  . TYR A 1 113 ? 111.358 -0.947  -13.873 1.00 0.00 ? 113 TYR A CD1  5  
ATOM 11099 C CD2  . TYR A 1 113 ? 113.446 -1.538  -12.877 1.00 0.00 ? 113 TYR A CD2  5  
ATOM 11100 C CE1  . TYR A 1 113 ? 111.638 -1.768  -14.949 1.00 0.00 ? 113 TYR A CE1  5  
ATOM 11101 C CE2  . TYR A 1 113 ? 113.730 -2.359  -13.949 1.00 0.00 ? 113 TYR A CE2  5  
ATOM 11102 C CZ   . TYR A 1 113 ? 112.825 -2.471  -14.982 1.00 0.00 ? 113 TYR A CZ   5  
ATOM 11103 O OH   . TYR A 1 113 ? 113.108 -3.293  -16.052 1.00 0.00 ? 113 TYR A OH   5  
ATOM 11104 H H    . TYR A 1 113 ? 111.335 1.225   -9.457  1.00 0.00 ? 113 TYR A H    5  
ATOM 11105 H HA   . TYR A 1 113 ? 109.998 -0.604  -11.059 1.00 0.00 ? 113 TYR A HA   5  
ATOM 11106 H HB2  . TYR A 1 113 ? 111.528 1.004   -12.018 1.00 0.00 ? 113 TYR A HB2  5  
ATOM 11107 H HB3  . TYR A 1 113 ? 112.884 0.314   -11.136 1.00 0.00 ? 113 TYR A HB3  5  
ATOM 11108 H HD1  . TYR A 1 113 ? 110.429 -0.396  -13.845 1.00 0.00 ? 113 TYR A HD1  5  
ATOM 11109 H HD2  . TYR A 1 113 ? 114.154 -1.450  -12.066 1.00 0.00 ? 113 TYR A HD2  5  
ATOM 11110 H HE1  . TYR A 1 113 ? 110.929 -1.856  -15.760 1.00 0.00 ? 113 TYR A HE1  5  
ATOM 11111 H HE2  . TYR A 1 113 ? 114.659 -2.909  -13.976 1.00 0.00 ? 113 TYR A HE2  5  
ATOM 11112 H HH   . TYR A 1 113 ? 113.035 -2.785  -16.870 1.00 0.00 ? 113 TYR A HH   5  
ATOM 11113 N N    . ASP A 1 114 ? 112.686 -1.979  -9.715  1.00 0.00 ? 114 ASP A N    5  
ATOM 11114 C CA   . ASP A 1 114 ? 113.312 -3.241  -9.334  1.00 0.00 ? 114 ASP A CA   5  
ATOM 11115 C C    . ASP A 1 114 ? 112.560 -3.944  -8.200  1.00 0.00 ? 114 ASP A C    5  
ATOM 11116 O O    . ASP A 1 114 ? 111.948 -4.995  -8.402  1.00 0.00 ? 114 ASP A O    5  
ATOM 11117 C CB   . ASP A 1 114 ? 114.771 -2.993  -8.921  1.00 0.00 ? 114 ASP A CB   5  
ATOM 11118 C CG   . ASP A 1 114 ? 115.404 -4.202  -8.251  1.00 0.00 ? 114 ASP A CG   5  
ATOM 11119 O OD1  . ASP A 1 114 ? 115.867 -5.112  -8.969  1.00 0.00 ? 114 ASP A OD1  5  
ATOM 11120 O OD2  . ASP A 1 114 ? 115.420 -4.251  -7.003  1.00 0.00 ? 114 ASP A OD2  5  
ATOM 11121 H H    . ASP A 1 114 ? 113.202 -1.153  -9.627  1.00 0.00 ? 114 ASP A H    5  
ATOM 11122 H HA   . ASP A 1 114 ? 113.305 -3.884  -10.202 1.00 0.00 ? 114 ASP A HA   5  
ATOM 11123 H HB2  . ASP A 1 114 ? 115.350 -2.747  -9.800  1.00 0.00 ? 114 ASP A HB2  5  
ATOM 11124 H HB3  . ASP A 1 114 ? 114.806 -2.160  -8.231  1.00 0.00 ? 114 ASP A HB3  5  
ATOM 11125 N N    . SER A 1 115 ? 112.596 -3.351  -7.013  1.00 0.00 ? 115 SER A N    5  
ATOM 11126 C CA   . SER A 1 115 ? 112.123 -4.022  -5.808  1.00 0.00 ? 115 SER A CA   5  
ATOM 11127 C C    . SER A 1 115 ? 110.597 -4.114  -5.751  1.00 0.00 ? 115 SER A C    5  
ATOM 11128 O O    . SER A 1 115 ? 110.059 -5.169  -5.423  1.00 0.00 ? 115 SER A O    5  
ATOM 11129 C CB   . SER A 1 115 ? 112.664 -3.304  -4.570  1.00 0.00 ? 115 SER A CB   5  
ATOM 11130 O OG   . SER A 1 115 ? 114.081 -3.228  -4.606  1.00 0.00 ? 115 SER A OG   5  
ATOM 11131 H H    . SER A 1 115 ? 112.946 -2.438  -6.945  1.00 0.00 ? 115 SER A H    5  
ATOM 11132 H HA   . SER A 1 115 ? 112.524 -5.026  -5.819  1.00 0.00 ? 115 SER A HA   5  
ATOM 11133 H HB2  . SER A 1 115 ? 112.263 -2.302  -4.529  1.00 0.00 ? 115 SER A HB2  5  
ATOM 11134 H HB3  . SER A 1 115 ? 112.369 -3.846  -3.682  1.00 0.00 ? 115 SER A HB3  5  
ATOM 11135 H HG   . SER A 1 115 ? 114.400 -3.529  -5.468  1.00 0.00 ? 115 SER A HG   5  
ATOM 11136 N N    . TYR A 1 116 ? 109.897 -3.028  -6.081  1.00 0.00 ? 116 TYR A N    5  
ATOM 11137 C CA   . TYR A 1 116 ? 108.438 -3.005  -5.954  1.00 0.00 ? 116 TYR A CA   5  
ATOM 11138 C C    . TYR A 1 116 ? 107.784 -3.886  -7.021  1.00 0.00 ? 116 TYR A C    5  
ATOM 11139 O O    . TYR A 1 116 ? 106.733 -4.480  -6.777  1.00 0.00 ? 116 TYR A O    5  
ATOM 11140 C CB   . TYR A 1 116 ? 107.901 -1.564  -6.006  1.00 0.00 ? 116 TYR A CB   5  
ATOM 11141 C CG   . TYR A 1 116 ? 106.385 -1.445  -5.978  1.00 0.00 ? 116 TYR A CG   5  
ATOM 11142 C CD1  . TYR A 1 116 ? 105.650 -1.818  -4.855  1.00 0.00 ? 116 TYR A CD1  5  
ATOM 11143 C CD2  . TYR A 1 116 ? 105.689 -0.946  -7.076  1.00 0.00 ? 116 TYR A CD2  5  
ATOM 11144 C CE1  . TYR A 1 116 ? 104.271 -1.699  -4.831  1.00 0.00 ? 116 TYR A CE1  5  
ATOM 11145 C CE2  . TYR A 1 116 ? 104.314 -0.825  -7.058  1.00 0.00 ? 116 TYR A CE2  5  
ATOM 11146 C CZ   . TYR A 1 116 ? 103.609 -1.203  -5.935  1.00 0.00 ? 116 TYR A CZ   5  
ATOM 11147 O OH   . TYR A 1 116 ? 102.238 -1.081  -5.919  1.00 0.00 ? 116 TYR A OH   5  
ATOM 11148 H H    . TYR A 1 116 ? 110.364 -2.233  -6.427  1.00 0.00 ? 116 TYR A H    5  
ATOM 11149 H HA   . TYR A 1 116 ? 108.198 -3.423  -4.984  1.00 0.00 ? 116 TYR A HA   5  
ATOM 11150 H HB2  . TYR A 1 116 ? 108.287 -1.017  -5.157  1.00 0.00 ? 116 TYR A HB2  5  
ATOM 11151 H HB3  . TYR A 1 116 ? 108.253 -1.093  -6.910  1.00 0.00 ? 116 TYR A HB3  5  
ATOM 11152 H HD1  . TYR A 1 116 ? 106.171 -2.208  -3.991  1.00 0.00 ? 116 TYR A HD1  5  
ATOM 11153 H HD2  . TYR A 1 116 ? 106.241 -0.650  -7.957  1.00 0.00 ? 116 TYR A HD2  5  
ATOM 11154 H HE1  . TYR A 1 116 ? 103.719 -1.994  -3.950  1.00 0.00 ? 116 TYR A HE1  5  
ATOM 11155 H HE2  . TYR A 1 116 ? 103.795 -0.436  -7.922  1.00 0.00 ? 116 TYR A HE2  5  
ATOM 11156 H HH   . TYR A 1 116 ? 101.883 -1.362  -6.768  1.00 0.00 ? 116 TYR A HH   5  
ATOM 11157 N N    . SER A 1 117 ? 108.406 -3.995  -8.197  1.00 0.00 ? 117 SER A N    5  
ATOM 11158 C CA   . SER A 1 117 ? 107.909 -4.915  -9.216  1.00 0.00 ? 117 SER A CA   5  
ATOM 11159 C C    . SER A 1 117 ? 108.111 -6.359  -8.756  1.00 0.00 ? 117 SER A C    5  
ATOM 11160 O O    . SER A 1 117 ? 107.213 -7.192  -8.891  1.00 0.00 ? 117 SER A O    5  
ATOM 11161 C CB   . SER A 1 117 ? 108.602 -4.680  -10.560 1.00 0.00 ? 117 SER A CB   5  
ATOM 11162 O OG   . SER A 1 117 ? 108.072 -5.518  -11.575 1.00 0.00 ? 117 SER A OG   5  
ATOM 11163 H H    . SER A 1 117 ? 109.201 -3.440  -8.389  1.00 0.00 ? 117 SER A H    5  
ATOM 11164 H HA   . SER A 1 117 ? 106.848 -4.734  -9.332  1.00 0.00 ? 117 SER A HA   5  
ATOM 11165 H HB2  . SER A 1 117 ? 108.466 -3.651  -10.857 1.00 0.00 ? 117 SER A HB2  5  
ATOM 11166 H HB3  . SER A 1 117 ? 109.658 -4.886  -10.457 1.00 0.00 ? 117 SER A HB3  5  
ATOM 11167 H HG   . SER A 1 117 ? 107.107 -5.539  -11.502 1.00 0.00 ? 117 SER A HG   5  
ATOM 11168 N N    . ARG A 1 118 ? 109.292 -6.650  -8.199  1.00 0.00 ? 118 ARG A N    5  
ATOM 11169 C CA   . ARG A 1 118 ? 109.575 -7.982  -7.662  1.00 0.00 ? 118 ARG A CA   5  
ATOM 11170 C C    . ARG A 1 118 ? 108.677 -8.273  -6.458  1.00 0.00 ? 118 ARG A C    5  
ATOM 11171 O O    . ARG A 1 118 ? 108.308 -9.422  -6.205  1.00 0.00 ? 118 ARG A O    5  
ATOM 11172 C CB   . ARG A 1 118 ? 111.060 -8.131  -7.288  1.00 0.00 ? 118 ARG A CB   5  
ATOM 11173 C CG   . ARG A 1 118 ? 111.990 -8.198  -8.501  1.00 0.00 ? 118 ARG A CG   5  
ATOM 11174 C CD   . ARG A 1 118 ? 113.425 -8.548  -8.113  1.00 0.00 ? 118 ARG A CD   5  
ATOM 11175 N NE   . ARG A 1 118 ? 114.080 -7.480  -7.352  1.00 0.00 ? 118 ARG A NE   5  
ATOM 11176 C CZ   . ARG A 1 118 ? 115.105 -7.674  -6.516  1.00 0.00 ? 118 ARG A CZ   5  
ATOM 11177 N NH1  . ARG A 1 118 ? 115.588 -8.893  -6.313  1.00 0.00 ? 118 ARG A NH1  5  
ATOM 11178 N NH2  . ARG A 1 118 ? 115.660 -6.645  -5.900  1.00 0.00 ? 118 ARG A NH2  5  
ATOM 11179 H H    . ARG A 1 118 ? 109.984 -5.955  -8.151  1.00 0.00 ? 118 ARG A H    5  
ATOM 11180 H HA   . ARG A 1 118 ? 109.342 -8.696  -8.440  1.00 0.00 ? 118 ARG A HA   5  
ATOM 11181 H HB2  . ARG A 1 118 ? 111.354 -7.287  -6.680  1.00 0.00 ? 118 ARG A HB2  5  
ATOM 11182 H HB3  . ARG A 1 118 ? 111.188 -9.038  -6.713  1.00 0.00 ? 118 ARG A HB3  5  
ATOM 11183 H HG2  . ARG A 1 118 ? 111.621 -8.953  -9.181  1.00 0.00 ? 118 ARG A HG2  5  
ATOM 11184 H HG3  . ARG A 1 118 ? 111.985 -7.237  -8.998  1.00 0.00 ? 118 ARG A HG3  5  
ATOM 11185 H HD2  . ARG A 1 118 ? 113.413 -9.448  -7.514  1.00 0.00 ? 118 ARG A HD2  5  
ATOM 11186 H HD3  . ARG A 1 118 ? 113.991 -8.730  -9.016  1.00 0.00 ? 118 ARG A HD3  5  
ATOM 11187 H HE   . ARG A 1 118 ? 113.749 -6.565  -7.489  1.00 0.00 ? 118 ARG A HE   5  
ATOM 11188 H HH11 . ARG A 1 118 ? 115.189 -9.681  -6.787  1.00 0.00 ? 118 ARG A HH11 5  
ATOM 11189 H HH12 . ARG A 1 118 ? 116.360 -9.034  -5.684  1.00 0.00 ? 118 ARG A HH12 5  
ATOM 11190 H HH21 . ARG A 1 118 ? 115.319 -5.714  -6.062  1.00 0.00 ? 118 ARG A HH21 5  
ATOM 11191 H HH22 . ARG A 1 118 ? 116.430 -6.785  -5.270  1.00 0.00 ? 118 ARG A HH22 5  
ATOM 11192 N N    . PHE A 1 119 ? 108.316 -7.216  -5.740  1.00 0.00 ? 119 PHE A N    5  
ATOM 11193 C CA   . PHE A 1 119 ? 107.384 -7.300  -4.617  1.00 0.00 ? 119 PHE A CA   5  
ATOM 11194 C C    . PHE A 1 119 ? 106.031 -7.818  -5.119  1.00 0.00 ? 119 PHE A C    5  
ATOM 11195 O O    . PHE A 1 119 ? 105.446 -8.740  -4.548  1.00 0.00 ? 119 PHE A O    5  
ATOM 11196 C CB   . PHE A 1 119 ? 107.244 -5.903  -3.984  1.00 0.00 ? 119 PHE A CB   5  
ATOM 11197 C CG   . PHE A 1 119 ? 106.517 -5.854  -2.660  1.00 0.00 ? 119 PHE A CG   5  
ATOM 11198 C CD1  . PHE A 1 119 ? 105.130 -5.789  -2.611  1.00 0.00 ? 119 PHE A CD1  5  
ATOM 11199 C CD2  . PHE A 1 119 ? 107.225 -5.845  -1.463  1.00 0.00 ? 119 PHE A CD2  5  
ATOM 11200 C CE1  . PHE A 1 119 ? 104.466 -5.719  -1.400  1.00 0.00 ? 119 PHE A CE1  5  
ATOM 11201 C CE2  . PHE A 1 119 ? 106.563 -5.777  -0.250  1.00 0.00 ? 119 PHE A CE2  5  
ATOM 11202 C CZ   . PHE A 1 119 ? 105.183 -5.714  -0.219  1.00 0.00 ? 119 PHE A CZ   5  
ATOM 11203 H H    . PHE A 1 119 ? 108.695 -6.344  -5.970  1.00 0.00 ? 119 PHE A H    5  
ATOM 11204 H HA   . PHE A 1 119 ? 107.787 -7.990  -3.889  1.00 0.00 ? 119 PHE A HA   5  
ATOM 11205 H HB2  . PHE A 1 119 ? 108.232 -5.496  -3.827  1.00 0.00 ? 119 PHE A HB2  5  
ATOM 11206 H HB3  . PHE A 1 119 ? 106.715 -5.262  -4.676  1.00 0.00 ? 119 PHE A HB3  5  
ATOM 11207 H HD1  . PHE A 1 119 ? 104.565 -5.795  -3.533  1.00 0.00 ? 119 PHE A HD1  5  
ATOM 11208 H HD2  . PHE A 1 119 ? 108.309 -5.893  -1.482  1.00 0.00 ? 119 PHE A HD2  5  
ATOM 11209 H HE1  . PHE A 1 119 ? 103.387 -5.668  -1.377  1.00 0.00 ? 119 PHE A HE1  5  
ATOM 11210 H HE2  . PHE A 1 119 ? 107.125 -5.773  0.673   1.00 0.00 ? 119 PHE A HE2  5  
ATOM 11211 H HZ   . PHE A 1 119 ? 104.666 -5.660  0.729   1.00 0.00 ? 119 PHE A HZ   5  
ATOM 11212 N N    . LEU A 1 120 ? 105.558 -7.228  -6.217  1.00 0.00 ? 120 LEU A N    5  
ATOM 11213 C CA   . LEU A 1 120 ? 104.306 -7.647  -6.853  1.00 0.00 ? 120 LEU A CA   5  
ATOM 11214 C C    . LEU A 1 120 ? 104.491 -8.977  -7.593  1.00 0.00 ? 120 LEU A C    5  
ATOM 11215 O O    . LEU A 1 120 ? 103.522 -9.687  -7.873  1.00 0.00 ? 120 LEU A O    5  
ATOM 11216 C CB   . LEU A 1 120 ? 103.824 -6.565  -7.830  1.00 0.00 ? 120 LEU A CB   5  
ATOM 11217 C CG   . LEU A 1 120 ? 103.589 -5.176  -7.211  1.00 0.00 ? 120 LEU A CG   5  
ATOM 11218 C CD1  . LEU A 1 120 ? 103.209 -4.163  -8.288  1.00 0.00 ? 120 LEU A CD1  5  
ATOM 11219 C CD2  . LEU A 1 120 ? 102.517 -5.239  -6.122  1.00 0.00 ? 120 LEU A CD2  5  
ATOM 11220 H H    . LEU A 1 120 ? 106.063 -6.483  -6.607  1.00 0.00 ? 120 LEU A H    5  
ATOM 11221 H HA   . LEU A 1 120 ? 103.564 -7.778  -6.077  1.00 0.00 ? 120 LEU A HA   5  
ATOM 11222 H HB2  . LEU A 1 120 ? 104.563 -6.466  -8.615  1.00 0.00 ? 120 LEU A HB2  5  
ATOM 11223 H HB3  . LEU A 1 120 ? 102.896 -6.898  -8.275  1.00 0.00 ? 120 LEU A HB3  5  
ATOM 11224 H HG   . LEU A 1 120 ? 104.508 -4.838  -6.753  1.00 0.00 ? 120 LEU A HG   5  
ATOM 11225 H HD11 . LEU A 1 120 ? 104.003 -4.099  -9.018  1.00 0.00 ? 120 LEU A HD11 5  
ATOM 11226 H HD12 . LEU A 1 120 ? 103.059 -3.194  -7.835  1.00 0.00 ? 120 LEU A HD12 5  
ATOM 11227 H HD13 . LEU A 1 120 ? 102.297 -4.476  -8.777  1.00 0.00 ? 120 LEU A HD13 5  
ATOM 11228 H HD21 . LEU A 1 120 ? 102.373 -4.254  -5.701  1.00 0.00 ? 120 LEU A HD21 5  
ATOM 11229 H HD22 . LEU A 1 120 ? 102.833 -5.917  -5.343  1.00 0.00 ? 120 LEU A HD22 5  
ATOM 11230 H HD23 . LEU A 1 120 ? 101.587 -5.589  -6.547  1.00 0.00 ? 120 LEU A HD23 5  
ATOM 11231 N N    . LYS A 1 121 ? 105.743 -9.288  -7.920  1.00 0.00 ? 121 LYS A N    5  
ATOM 11232 C CA   . LYS A 1 121 ? 106.100 -10.536 -8.593  1.00 0.00 ? 121 LYS A CA   5  
ATOM 11233 C C    . LYS A 1 121 ? 105.834 -11.738 -7.696  1.00 0.00 ? 121 LYS A C    5  
ATOM 11234 O O    . LYS A 1 121 ? 105.233 -12.717 -8.141  1.00 0.00 ? 121 LYS A O    5  
ATOM 11235 C CB   . LYS A 1 121 ? 107.562 -10.465 -9.065  1.00 0.00 ? 121 LYS A CB   5  
ATOM 11236 C CG   . LYS A 1 121 ? 108.165 -11.801 -9.474  1.00 0.00 ? 121 LYS A CG   5  
ATOM 11237 C CD   . LYS A 1 121 ? 108.990 -12.407 -8.344  1.00 0.00 ? 121 LYS A CD   5  
ATOM 11238 C CE   . LYS A 1 121 ? 109.151 -13.899 -8.516  1.00 0.00 ? 121 LYS A CE   5  
ATOM 11239 N NZ   . LYS A 1 121 ? 110.029 -14.480 -7.464  1.00 0.00 ? 121 LYS A NZ   5  
ATOM 11240 H H    . LYS A 1 121 ? 106.455 -8.651  -7.702  1.00 0.00 ? 121 LYS A H    5  
ATOM 11241 H HA   . LYS A 1 121 ? 105.472 -10.641 -9.458  1.00 0.00 ? 121 LYS A HA   5  
ATOM 11242 H HB2  . LYS A 1 121 ? 107.616 -9.799  -9.915  1.00 0.00 ? 121 LYS A HB2  5  
ATOM 11243 H HB3  . LYS A 1 121 ? 108.160 -10.052 -8.267  1.00 0.00 ? 121 LYS A HB3  5  
ATOM 11244 H HG2  . LYS A 1 121 ? 107.368 -12.483 -9.735  1.00 0.00 ? 121 LYS A HG2  5  
ATOM 11245 H HG3  . LYS A 1 121 ? 108.805 -11.650 -10.334 1.00 0.00 ? 121 LYS A HG3  5  
ATOM 11246 H HD2  . LYS A 1 121 ? 109.968 -11.947 -8.335  1.00 0.00 ? 121 LYS A HD2  5  
ATOM 11247 H HD3  . LYS A 1 121 ? 108.493 -12.215 -7.401  1.00 0.00 ? 121 LYS A HD3  5  
ATOM 11248 H HE2  . LYS A 1 121 ? 108.170 -14.352 -8.458  1.00 0.00 ? 121 LYS A HE2  5  
ATOM 11249 H HE3  . LYS A 1 121 ? 109.580 -14.093 -9.488  1.00 0.00 ? 121 LYS A HE3  5  
ATOM 11250 H HZ1  . LYS A 1 121 ? 109.632 -14.297 -6.520  1.00 0.00 ? 121 LYS A HZ1  5  
ATOM 11251 H HZ2  . LYS A 1 121 ? 110.976 -14.053 -7.513  1.00 0.00 ? 121 LYS A HZ2  5  
ATOM 11252 H HZ3  . LYS A 1 121 ? 110.121 -15.507 -7.597  1.00 0.00 ? 121 LYS A HZ3  5  
ATOM 11253 N N    . SER A 1 122 ? 106.263 -11.665 -6.442  1.00 0.00 ? 122 SER A N    5  
ATOM 11254 C CA   . SER A 1 122 ? 105.946 -12.706 -5.473  1.00 0.00 ? 122 SER A CA   5  
ATOM 11255 C C    . SER A 1 122 ? 106.459 -12.331 -4.085  1.00 0.00 ? 122 SER A C    5  
ATOM 11256 O O    . SER A 1 122 ? 107.574 -12.700 -3.702  1.00 0.00 ? 122 SER A O    5  
ATOM 11257 C CB   . SER A 1 122 ? 106.524 -14.067 -5.905  1.00 0.00 ? 122 SER A CB   5  
ATOM 11258 O OG   . SER A 1 122 ? 106.065 -15.114 -5.064  1.00 0.00 ? 122 SER A OG   5  
ATOM 11259 H H    . SER A 1 122 ? 106.804 -10.894 -6.160  1.00 0.00 ? 122 SER A H    5  
ATOM 11260 H HA   . SER A 1 122 ? 104.869 -12.785 -5.434  1.00 0.00 ? 122 SER A HA   5  
ATOM 11261 H HB2  . SER A 1 122 ? 106.218 -14.282 -6.919  1.00 0.00 ? 122 SER A HB2  5  
ATOM 11262 H HB3  . SER A 1 122 ? 107.604 -14.031 -5.857  1.00 0.00 ? 122 SER A HB3  5  
ATOM 11263 H HG   . SER A 1 122 ? 105.264 -15.500 -5.444  1.00 0.00 ? 122 SER A HG   5  
ATOM 11264 N N    . ASP A 1 123 ? 105.652 -11.579 -3.347  1.00 0.00 ? 123 ASP A N    5  
ATOM 11265 C CA   . ASP A 1 123 ? 105.990 -11.192 -1.978  1.00 0.00 ? 123 ASP A CA   5  
ATOM 11266 C C    . ASP A 1 123 ? 105.740 -12.367 -1.019  1.00 0.00 ? 123 ASP A C    5  
ATOM 11267 O O    . ASP A 1 123 ? 105.422 -13.478 -1.454  1.00 0.00 ? 123 ASP A O    5  
ATOM 11268 C CB   . ASP A 1 123 ? 105.172 -9.955  -1.565  1.00 0.00 ? 123 ASP A CB   5  
ATOM 11269 C CG   . ASP A 1 123 ? 105.573 -9.414  -0.201  1.00 0.00 ? 123 ASP A CG   5  
ATOM 11270 O OD1  . ASP A 1 123 ? 106.649 -8.802  -0.099  1.00 0.00 ? 123 ASP A OD1  5  
ATOM 11271 O OD2  . ASP A 1 123 ? 104.832 -9.653  0.779   1.00 0.00 ? 123 ASP A OD2  5  
ATOM 11272 H H    . ASP A 1 123 ? 104.808 -11.265 -3.732  1.00 0.00 ? 123 ASP A H    5  
ATOM 11273 H HA   . ASP A 1 123 ? 107.042 -10.943 -1.955  1.00 0.00 ? 123 ASP A HA   5  
ATOM 11274 H HB2  . ASP A 1 123 ? 105.319 -9.173  -2.298  1.00 0.00 ? 123 ASP A HB2  5  
ATOM 11275 H HB3  . ASP A 1 123 ? 104.123 -10.217 -1.537  1.00 0.00 ? 123 ASP A HB3  5  
ATOM 11276 N N    . LEU A 1 124 ? 105.908 -12.127 0.276   1.00 0.00 ? 124 LEU A N    5  
ATOM 11277 C CA   . LEU A 1 124 ? 105.705 -13.136 1.302   1.00 0.00 ? 124 LEU A CA   5  
ATOM 11278 C C    . LEU A 1 124 ? 104.221 -13.298 1.643   1.00 0.00 ? 124 LEU A C    5  
ATOM 11279 O O    . LEU A 1 124 ? 103.788 -14.388 2.029   1.00 0.00 ? 124 LEU A O    5  
ATOM 11280 C CB   . LEU A 1 124 ? 106.481 -12.754 2.573   1.00 0.00 ? 124 LEU A CB   5  
ATOM 11281 C CG   . LEU A 1 124 ? 108.014 -12.639 2.445   1.00 0.00 ? 124 LEU A CG   5  
ATOM 11282 C CD1  . LEU A 1 124 ? 108.613 -13.874 1.781   1.00 0.00 ? 124 LEU A CD1  5  
ATOM 11283 C CD2  . LEU A 1 124 ? 108.410 -11.373 1.698   1.00 0.00 ? 124 LEU A CD2  5  
ATOM 11284 H H    . LEU A 1 124 ? 106.189 -11.234 0.558   1.00 0.00 ? 124 LEU A H    5  
ATOM 11285 H HA   . LEU A 1 124 ? 106.081 -14.078 0.930   1.00 0.00 ? 124 LEU A HA   5  
ATOM 11286 H HB2  . LEU A 1 124 ? 106.103 -11.803 2.922   1.00 0.00 ? 124 LEU A HB2  5  
ATOM 11287 H HB3  . LEU A 1 124 ? 106.266 -13.493 3.325   1.00 0.00 ? 124 LEU A HB3  5  
ATOM 11288 H HG   . LEU A 1 124 ? 108.437 -12.574 3.440   1.00 0.00 ? 124 LEU A HG   5  
ATOM 11289 H HD11 . LEU A 1 124 ? 108.349 -14.754 2.350   1.00 0.00 ? 124 LEU A HD11 5  
ATOM 11290 H HD12 . LEU A 1 124 ? 109.689 -13.780 1.748   1.00 0.00 ? 124 LEU A HD12 5  
ATOM 11291 H HD13 . LEU A 1 124 ? 108.230 -13.967 0.774   1.00 0.00 ? 124 LEU A HD13 5  
ATOM 11292 H HD21 . LEU A 1 124 ? 108.022 -11.409 0.690   1.00 0.00 ? 124 LEU A HD21 5  
ATOM 11293 H HD22 . LEU A 1 124 ? 109.486 -11.296 1.666   1.00 0.00 ? 124 LEU A HD22 5  
ATOM 11294 H HD23 . LEU A 1 124 ? 108.005 -10.511 2.209   1.00 0.00 ? 124 LEU A HD23 5  
ATOM 11295 N N    . PHE A 1 125 ? 103.438 -12.225 1.476   1.00 0.00 ? 125 PHE A N    5  
ATOM 11296 C CA   . PHE A 1 125 ? 102.031 -12.215 1.911   1.00 0.00 ? 125 PHE A CA   5  
ATOM 11297 C C    . PHE A 1 125 ? 101.147 -13.192 1.121   1.00 0.00 ? 125 PHE A C    5  
ATOM 11298 O O    . PHE A 1 125 ? 99.926  -13.227 1.316   1.00 0.00 ? 125 PHE A O    5  
ATOM 11299 C CB   . PHE A 1 125 ? 101.436 -10.789 1.856   1.00 0.00 ? 125 PHE A CB   5  
ATOM 11300 C CG   . PHE A 1 125 ? 101.471 -10.099 0.501   1.00 0.00 ? 125 PHE A CG   5  
ATOM 11301 C CD1  . PHE A 1 125 ? 100.928 -10.694 -0.633  1.00 0.00 ? 125 PHE A CD1  5  
ATOM 11302 C CD2  . PHE A 1 125 ? 102.036 -8.836  0.372   1.00 0.00 ? 125 PHE A CD2  5  
ATOM 11303 C CE1  . PHE A 1 125 ? 100.954 -10.048 -1.857  1.00 0.00 ? 125 PHE A CE1  5  
ATOM 11304 C CE2  . PHE A 1 125 ? 102.061 -8.188  -0.849  1.00 0.00 ? 125 PHE A CE2  5  
ATOM 11305 C CZ   . PHE A 1 125 ? 101.521 -8.795  -1.964  1.00 0.00 ? 125 PHE A CZ   5  
ATOM 11306 H H    . PHE A 1 125 ? 103.820 -11.415 1.063   1.00 0.00 ? 125 PHE A H    5  
ATOM 11307 H HA   . PHE A 1 125 ? 102.025 -12.536 2.944   1.00 0.00 ? 125 PHE A HA   5  
ATOM 11308 H HB2  . PHE A 1 125 ? 100.403 -10.834 2.165   1.00 0.00 ? 125 PHE A HB2  5  
ATOM 11309 H HB3  . PHE A 1 125 ? 101.977 -10.167 2.556   1.00 0.00 ? 125 PHE A HB3  5  
ATOM 11310 H HD1  . PHE A 1 125 ? 100.482 -11.673 -0.556  1.00 0.00 ? 125 PHE A HD1  5  
ATOM 11311 H HD2  . PHE A 1 125 ? 102.464 -8.356  1.241   1.00 0.00 ? 125 PHE A HD2  5  
ATOM 11312 H HE1  . PHE A 1 125 ? 100.531 -10.526 -2.729  1.00 0.00 ? 125 PHE A HE1  5  
ATOM 11313 H HE2  . PHE A 1 125 ? 102.503 -7.205  -0.930  1.00 0.00 ? 125 PHE A HE2  5  
ATOM 11314 H HZ   . PHE A 1 125 ? 101.541 -8.290  -2.920  1.00 0.00 ? 125 PHE A HZ   5  
ATOM 11315 N N    . LEU A 1 126 ? 101.754 -13.983 0.243   1.00 0.00 ? 126 LEU A N    5  
ATOM 11316 C CA   . LEU A 1 126 ? 101.019 -14.948 -0.565  1.00 0.00 ? 126 LEU A CA   5  
ATOM 11317 C C    . LEU A 1 126 ? 100.574 -16.132 0.291   1.00 0.00 ? 126 LEU A C    5  
ATOM 11318 O O    . LEU A 1 126 ? 99.406  -16.521 0.270   1.00 0.00 ? 126 LEU A O    5  
ATOM 11319 C CB   . LEU A 1 126 ? 101.882 -15.438 -1.746  1.00 0.00 ? 126 LEU A CB   5  
ATOM 11320 C CG   . LEU A 1 126 ? 101.916 -14.519 -2.984  1.00 0.00 ? 126 LEU A CG   5  
ATOM 11321 C CD1  . LEU A 1 126 ? 100.514 -14.333 -3.560  1.00 0.00 ? 126 LEU A CD1  5  
ATOM 11322 C CD2  . LEU A 1 126 ? 102.544 -13.168 -2.652  1.00 0.00 ? 126 LEU A CD2  5  
ATOM 11323 H H    . LEU A 1 126 ? 102.722 -13.930 0.147   1.00 0.00 ? 126 LEU A H    5  
ATOM 11324 H HA   . LEU A 1 126 ? 100.140 -14.453 -0.955  1.00 0.00 ? 126 LEU A HA   5  
ATOM 11325 H HB2  . LEU A 1 126 ? 102.899 -15.560 -1.390  1.00 0.00 ? 126 LEU A HB2  5  
ATOM 11326 H HB3  . LEU A 1 126 ? 101.514 -16.406 -2.058  1.00 0.00 ? 126 LEU A HB3  5  
ATOM 11327 H HG   . LEU A 1 126 ? 102.522 -14.986 -3.748  1.00 0.00 ? 126 LEU A HG   5  
ATOM 11328 H HD11 . LEU A 1 126 ? 99.873  -13.877 -2.819  1.00 0.00 ? 126 LEU A HD11 5  
ATOM 11329 H HD12 . LEU A 1 126 ? 100.109 -15.294 -3.842  1.00 0.00 ? 126 LEU A HD12 5  
ATOM 11330 H HD13 . LEU A 1 126 ? 100.563 -13.697 -4.432  1.00 0.00 ? 126 LEU A HD13 5  
ATOM 11331 H HD21 . LEU A 1 126 ? 101.964 -12.676 -1.885  1.00 0.00 ? 126 LEU A HD21 5  
ATOM 11332 H HD22 . LEU A 1 126 ? 102.564 -12.552 -3.539  1.00 0.00 ? 126 LEU A HD22 5  
ATOM 11333 H HD23 . LEU A 1 126 ? 103.553 -13.318 -2.299  1.00 0.00 ? 126 LEU A HD23 5  
ATOM 11334 N N    . LYS A 1 127 ? 101.507 -16.683 1.063   1.00 0.00 ? 127 LYS A N    5  
ATOM 11335 C CA   . LYS A 1 127 ? 101.260 -17.890 1.842   1.00 0.00 ? 127 LYS A CA   5  
ATOM 11336 C C    . LYS A 1 127 ? 102.050 -17.826 3.145   1.00 0.00 ? 127 LYS A C    5  
ATOM 11337 O O    . LYS A 1 127 ? 102.452 -16.746 3.582   1.00 0.00 ? 127 LYS A O    5  
ATOM 11338 C CB   . LYS A 1 127 ? 101.685 -19.137 1.042   1.00 0.00 ? 127 LYS A CB   5  
ATOM 11339 C CG   . LYS A 1 127 ? 100.921 -19.354 -0.261  1.00 0.00 ? 127 LYS A CG   5  
ATOM 11340 C CD   . LYS A 1 127 ? 101.385 -20.620 -0.976  1.00 0.00 ? 127 LYS A CD   5  
ATOM 11341 C CE   . LYS A 1 127 ? 100.642 -20.842 -2.288  1.00 0.00 ? 127 LYS A CE   5  
ATOM 11342 N NZ   . LYS A 1 127 ? 100.879 -19.737 -3.255  1.00 0.00 ? 127 LYS A NZ   5  
ATOM 11343 H H    . LYS A 1 127 ? 102.383 -16.250 1.142   1.00 0.00 ? 127 LYS A H    5  
ATOM 11344 H HA   . LYS A 1 127 ? 100.207 -17.941 2.066   1.00 0.00 ? 127 LYS A HA   5  
ATOM 11345 H HB2  . LYS A 1 127 ? 102.736 -19.051 0.801   1.00 0.00 ? 127 LYS A HB2  5  
ATOM 11346 H HB3  . LYS A 1 127 ? 101.544 -20.011 1.664   1.00 0.00 ? 127 LYS A HB3  5  
ATOM 11347 H HG2  . LYS A 1 127 ? 99.867  -19.441 -0.040  1.00 0.00 ? 127 LYS A HG2  5  
ATOM 11348 H HG3  . LYS A 1 127 ? 101.085 -18.504 -0.910  1.00 0.00 ? 127 LYS A HG3  5  
ATOM 11349 H HD2  . LYS A 1 127 ? 102.443 -20.537 -1.184  1.00 0.00 ? 127 LYS A HD2  5  
ATOM 11350 H HD3  . LYS A 1 127 ? 101.213 -21.467 -0.328  1.00 0.00 ? 127 LYS A HD3  5  
ATOM 11351 H HE2  . LYS A 1 127 ? 100.983 -21.768 -2.728  1.00 0.00 ? 127 LYS A HE2  5  
ATOM 11352 H HE3  . LYS A 1 127 ? 99.583  -20.910 -2.084  1.00 0.00 ? 127 LYS A HE3  5  
ATOM 11353 H HZ1  . LYS A 1 127 ? 101.897 -19.635 -3.442  1.00 0.00 ? 127 LYS A HZ1  5  
ATOM 11354 H HZ2  . LYS A 1 127 ? 100.517 -18.842 -2.875  1.00 0.00 ? 127 LYS A HZ2  5  
ATOM 11355 H HZ3  . LYS A 1 127 ? 100.394 -19.938 -4.153  1.00 0.00 ? 127 LYS A HZ3  5  
ATOM 11356 N N    . HIS A 1 128 ? 102.296 -18.989 3.748   1.00 0.00 ? 128 HIS A N    5  
ATOM 11357 C CA   . HIS A 1 128 ? 103.174 -19.090 4.914   1.00 0.00 ? 128 HIS A CA   5  
ATOM 11358 C C    . HIS A 1 128 ? 104.605 -18.693 4.534   1.00 0.00 ? 128 HIS A C    5  
ATOM 11359 O O    . HIS A 1 128 ? 105.490 -18.618 5.383   1.00 0.00 ? 128 HIS A O    5  
ATOM 11360 C CB   . HIS A 1 128 ? 103.134 -20.517 5.493   1.00 0.00 ? 128 HIS A CB   5  
ATOM 11361 C CG   . HIS A 1 128 ? 104.088 -20.755 6.631   1.00 0.00 ? 128 HIS A CG   5  
ATOM 11362 N ND1  . HIS A 1 128 ? 103.811 -20.411 7.935   1.00 0.00 ? 128 HIS A ND1  5  
ATOM 11363 C CD2  . HIS A 1 128 ? 105.325 -21.308 6.650   1.00 0.00 ? 128 HIS A CD2  5  
ATOM 11364 C CE1  . HIS A 1 128 ? 104.834 -20.736 8.701   1.00 0.00 ? 128 HIS A CE1  5  
ATOM 11365 N NE2  . HIS A 1 128 ? 105.767 -21.281 7.947   1.00 0.00 ? 128 HIS A NE2  5  
ATOM 11366 H H    . HIS A 1 128 ? 101.865 -19.803 3.407   1.00 0.00 ? 128 HIS A H    5  
ATOM 11367 H HA   . HIS A 1 128 ? 102.809 -18.393 5.653   1.00 0.00 ? 128 HIS A HA   5  
ATOM 11368 H HB2  . HIS A 1 128 ? 102.137 -20.720 5.856   1.00 0.00 ? 128 HIS A HB2  5  
ATOM 11369 H HB3  . HIS A 1 128 ? 103.371 -21.221 4.708   1.00 0.00 ? 128 HIS A HB3  5  
ATOM 11370 H HD1  . HIS A 1 128 ? 102.981 -19.994 8.255   1.00 0.00 ? 128 HIS A HD1  5  
ATOM 11371 H HD2  . HIS A 1 128 ? 105.863 -21.702 5.799   1.00 0.00 ? 128 HIS A HD2  5  
ATOM 11372 H HE1  . HIS A 1 128 ? 104.895 -20.586 9.769   1.00 0.00 ? 128 HIS A HE1  5  
ATOM 11373 H HE2  . HIS A 1 128 ? 106.697 -21.428 8.227   1.00 0.00 ? 128 HIS A HE2  5  
ATOM 11374 N N    . LYS A 1 129 ? 104.800 -18.436 3.241   1.00 0.00 ? 129 LYS A N    5  
ATOM 11375 C CA   . LYS A 1 129 ? 106.051 -17.908 2.702   1.00 0.00 ? 129 LYS A CA   5  
ATOM 11376 C C    . LYS A 1 129 ? 106.580 -16.743 3.551   1.00 0.00 ? 129 LYS A C    5  
ATOM 11377 O O    . LYS A 1 129 ? 107.786 -16.487 3.582   1.00 0.00 ? 129 LYS A O    5  
ATOM 11378 C CB   . LYS A 1 129 ? 105.805 -17.443 1.258   1.00 0.00 ? 129 LYS A CB   5  
ATOM 11379 C CG   . LYS A 1 129 ? 107.031 -16.879 0.546   1.00 0.00 ? 129 LYS A CG   5  
ATOM 11380 C CD   . LYS A 1 129 ? 106.676 -16.354 -0.845  1.00 0.00 ? 129 LYS A CD   5  
ATOM 11381 C CE   . LYS A 1 129 ? 107.887 -15.768 -1.564  1.00 0.00 ? 129 LYS A CE   5  
ATOM 11382 N NZ   . LYS A 1 129 ? 107.544 -15.283 -2.926  1.00 0.00 ? 129 LYS A NZ   5  
ATOM 11383 H H    . LYS A 1 129 ? 104.073 -18.623 2.618   1.00 0.00 ? 129 LYS A H    5  
ATOM 11384 H HA   . LYS A 1 129 ? 106.780 -18.705 2.699   1.00 0.00 ? 129 LYS A HA   5  
ATOM 11385 H HB2  . LYS A 1 129 ? 105.443 -18.284 0.683   1.00 0.00 ? 129 LYS A HB2  5  
ATOM 11386 H HB3  . LYS A 1 129 ? 105.040 -16.678 1.269   1.00 0.00 ? 129 LYS A HB3  5  
ATOM 11387 H HG2  . LYS A 1 129 ? 107.436 -16.068 1.136   1.00 0.00 ? 129 LYS A HG2  5  
ATOM 11388 H HG3  . LYS A 1 129 ? 107.772 -17.660 0.450   1.00 0.00 ? 129 LYS A HG3  5  
ATOM 11389 H HD2  . LYS A 1 129 ? 106.281 -17.168 -1.436  1.00 0.00 ? 129 LYS A HD2  5  
ATOM 11390 H HD3  . LYS A 1 129 ? 105.922 -15.585 -0.746  1.00 0.00 ? 129 LYS A HD3  5  
ATOM 11391 H HE2  . LYS A 1 129 ? 108.270 -14.941 -0.985  1.00 0.00 ? 129 LYS A HE2  5  
ATOM 11392 H HE3  . LYS A 1 129 ? 108.647 -16.532 -1.644  1.00 0.00 ? 129 LYS A HE3  5  
ATOM 11393 H HZ1  . LYS A 1 129 ? 108.406 -14.986 -3.429  1.00 0.00 ? 129 LYS A HZ1  5  
ATOM 11394 H HZ2  . LYS A 1 129 ? 106.897 -14.473 -2.868  1.00 0.00 ? 129 LYS A HZ2  5  
ATOM 11395 H HZ3  . LYS A 1 129 ? 107.084 -16.041 -3.475  1.00 0.00 ? 129 LYS A HZ3  5  
ATOM 11396 N N    . ARG A 1 130 ? 105.665 -16.037 4.227   1.00 0.00 ? 130 ARG A N    5  
ATOM 11397 C CA   . ARG A 1 130 ? 106.036 -14.926 5.104   1.00 0.00 ? 130 ARG A CA   5  
ATOM 11398 C C    . ARG A 1 130 ? 107.094 -15.339 6.130   1.00 0.00 ? 130 ARG A C    5  
ATOM 11399 O O    . ARG A 1 130 ? 106.915 -16.288 6.895   1.00 0.00 ? 130 ARG A O    5  
ATOM 11400 C CB   . ARG A 1 130 ? 104.792 -14.286 5.756   1.00 0.00 ? 130 ARG A CB   5  
ATOM 11401 C CG   . ARG A 1 130 ? 103.690 -15.267 6.138   1.00 0.00 ? 130 ARG A CG   5  
ATOM 11402 C CD   . ARG A 1 130 ? 104.026 -16.071 7.382   1.00 0.00 ? 130 ARG A CD   5  
ATOM 11403 N NE   . ARG A 1 130 ? 103.987 -15.253 8.600   1.00 0.00 ? 130 ARG A NE   5  
ATOM 11404 C CZ   . ARG A 1 130 ? 102.886 -15.040 9.328   1.00 0.00 ? 130 ARG A CZ   5  
ATOM 11405 N NH1  . ARG A 1 130 ? 101.724 -15.568 8.958   1.00 0.00 ? 130 ARG A NH1  5  
ATOM 11406 N NH2  . ARG A 1 130 ? 102.949 -14.311 10.433  1.00 0.00 ? 130 ARG A NH2  5  
ATOM 11407 H H    . ARG A 1 130 ? 104.719 -16.269 4.124   1.00 0.00 ? 130 ARG A H    5  
ATOM 11408 H HA   . ARG A 1 130 ? 106.484 -14.188 4.472   1.00 0.00 ? 130 ARG A HA   5  
ATOM 11409 H HB2  . ARG A 1 130 ? 105.098 -13.758 6.649   1.00 0.00 ? 130 ARG A HB2  5  
ATOM 11410 H HB3  . ARG A 1 130 ? 104.376 -13.570 5.059   1.00 0.00 ? 130 ARG A HB3  5  
ATOM 11411 H HG2  . ARG A 1 130 ? 102.780 -14.713 6.321   1.00 0.00 ? 130 ARG A HG2  5  
ATOM 11412 H HG3  . ARG A 1 130 ? 103.532 -15.949 5.313   1.00 0.00 ? 130 ARG A HG3  5  
ATOM 11413 H HD2  . ARG A 1 130 ? 103.320 -16.872 7.469   1.00 0.00 ? 130 ARG A HD2  5  
ATOM 11414 H HD3  . ARG A 1 130 ? 105.017 -16.485 7.272   1.00 0.00 ? 130 ARG A HD3  5  
ATOM 11415 H HE   . ARG A 1 130 ? 104.834 -14.852 8.896   1.00 0.00 ? 130 ARG A HE   5  
ATOM 11416 H HH11 . ARG A 1 130 ? 101.667 -16.131 8.132   1.00 0.00 ? 130 ARG A HH11 5  
ATOM 11417 H HH12 . ARG A 1 130 ? 100.900 -15.410 9.511   1.00 0.00 ? 130 ARG A HH12 5  
ATOM 11418 H HH21 . ARG A 1 130 ? 103.824 -13.920 10.737  1.00 0.00 ? 130 ARG A HH21 5  
ATOM 11419 H HH22 . ARG A 1 130 ? 102.120 -14.146 10.975  1.00 0.00 ? 130 ARG A HH22 5  
ATOM 11420 N N    . THR A 1 131 ? 108.204 -14.613 6.119   1.00 0.00 ? 131 THR A N    5  
ATOM 11421 C CA   . THR A 1 131 ? 109.370 -14.960 6.910   1.00 0.00 ? 131 THR A CA   5  
ATOM 11422 C C    . THR A 1 131 ? 109.163 -14.582 8.375   1.00 0.00 ? 131 THR A C    5  
ATOM 11423 O O    . THR A 1 131 ? 109.509 -13.474 8.799   1.00 0.00 ? 131 THR A O    5  
ATOM 11424 C CB   . THR A 1 131 ? 110.629 -14.253 6.357   1.00 0.00 ? 131 THR A CB   5  
ATOM 11425 O OG1  . THR A 1 131 ? 110.653 -14.363 4.924   1.00 0.00 ? 131 THR A OG1  5  
ATOM 11426 C CG2  . THR A 1 131 ? 111.908 -14.854 6.935   1.00 0.00 ? 131 THR A CG2  5  
ATOM 11427 H H    . THR A 1 131 ? 108.235 -13.799 5.570   1.00 0.00 ? 131 THR A H    5  
ATOM 11428 H HA   . THR A 1 131 ? 109.520 -16.030 6.838   1.00 0.00 ? 131 THR A HA   5  
ATOM 11429 H HB   . THR A 1 131 ? 110.585 -13.206 6.626   1.00 0.00 ? 131 THR A HB   5  
ATOM 11430 H HG1  . THR A 1 131 ? 110.281 -13.558 4.543   1.00 0.00 ? 131 THR A HG1  5  
ATOM 11431 H HG21 . THR A 1 131 ? 111.967 -15.900 6.672   1.00 0.00 ? 131 THR A HG21 5  
ATOM 11432 H HG22 . THR A 1 131 ? 111.900 -14.754 8.011   1.00 0.00 ? 131 THR A HG22 5  
ATOM 11433 H HG23 . THR A 1 131 ? 112.765 -14.334 6.533   1.00 0.00 ? 131 THR A HG23 5  
ATOM 11434 N N    . GLU A 1 132 ? 108.556 -15.494 9.132   1.00 0.00 ? 132 GLU A N    5  
ATOM 11435 C CA   . GLU A 1 132 ? 108.369 -15.293 10.561  1.00 0.00 ? 132 GLU A CA   5  
ATOM 11436 C C    . GLU A 1 132 ? 109.727 -15.164 11.241  1.00 0.00 ? 132 GLU A C    5  
ATOM 11437 O O    . GLU A 1 132 ? 110.495 -16.128 11.317  1.00 0.00 ? 132 GLU A O    5  
ATOM 11438 C CB   . GLU A 1 132 ? 107.559 -16.442 11.177  1.00 0.00 ? 132 GLU A CB   5  
ATOM 11439 C CG   . GLU A 1 132 ? 106.181 -16.616 10.549  1.00 0.00 ? 132 GLU A CG   5  
ATOM 11440 C CD   . GLU A 1 132 ? 105.277 -17.539 11.348  1.00 0.00 ? 132 GLU A CD   5  
ATOM 11441 O OE1  . GLU A 1 132 ? 105.332 -18.768 11.139  1.00 0.00 ? 132 GLU A OE1  5  
ATOM 11442 O OE2  . GLU A 1 132 ? 104.502 -17.035 12.190  1.00 0.00 ? 132 GLU A OE2  5  
ATOM 11443 H H    . GLU A 1 132 ? 108.224 -16.316 8.715   1.00 0.00 ? 132 GLU A H    5  
ATOM 11444 H HA   . GLU A 1 132 ? 107.823 -14.368 10.695  1.00 0.00 ? 132 GLU A HA   5  
ATOM 11445 H HB2  . GLU A 1 132 ? 108.110 -17.365 11.051  1.00 0.00 ? 132 GLU A HB2  5  
ATOM 11446 H HB3  . GLU A 1 132 ? 107.430 -16.252 12.234  1.00 0.00 ? 132 GLU A HB3  5  
ATOM 11447 H HG2  . GLU A 1 132 ? 105.707 -15.646 10.478  1.00 0.00 ? 132 GLU A HG2  5  
ATOM 11448 H HG3  . GLU A 1 132 ? 106.301 -17.024 9.554   1.00 0.00 ? 132 GLU A HG3  5  
ATOM 11449 N N    . GLU A 1 133 ? 110.025 -13.957 11.697  1.00 0.00 ? 133 GLU A N    5  
ATOM 11450 C CA   . GLU A 1 133 ? 111.314 -13.645 12.291  1.00 0.00 ? 133 GLU A CA   5  
ATOM 11451 C C    . GLU A 1 133 ? 111.494 -14.379 13.617  1.00 0.00 ? 133 GLU A C    5  
ATOM 11452 O O    . GLU A 1 133 ? 110.936 -13.982 14.641  1.00 0.00 ? 133 GLU A O    5  
ATOM 11453 C CB   . GLU A 1 133 ? 111.436 -12.134 12.493  1.00 0.00 ? 133 GLU A CB   5  
ATOM 11454 C CG   . GLU A 1 133 ? 112.761 -11.691 13.093  1.00 0.00 ? 133 GLU A CG   5  
ATOM 11455 C CD   . GLU A 1 133 ? 112.827 -10.188 13.277  1.00 0.00 ? 133 GLU A CD   5  
ATOM 11456 O OE1  . GLU A 1 133 ? 112.363 -9.693  14.318  1.00 0.00 ? 133 GLU A OE1  5  
ATOM 11457 O OE2  . GLU A 1 133 ? 113.336 -9.491  12.373  1.00 0.00 ? 133 GLU A OE2  5  
ATOM 11458 H H    . GLU A 1 133 ? 109.347 -13.249 11.637  1.00 0.00 ? 133 GLU A H    5  
ATOM 11459 H HA   . GLU A 1 133 ? 112.084 -13.970 11.603  1.00 0.00 ? 133 GLU A HA   5  
ATOM 11460 H HB2  . GLU A 1 133 ? 111.319 -11.645 11.536  1.00 0.00 ? 133 GLU A HB2  5  
ATOM 11461 H HB3  . GLU A 1 133 ? 110.641 -11.807 13.150  1.00 0.00 ? 133 GLU A HB3  5  
ATOM 11462 H HG2  . GLU A 1 133 ? 112.885 -12.165 14.058  1.00 0.00 ? 133 GLU A HG2  5  
ATOM 11463 H HG3  . GLU A 1 133 ? 113.564 -11.998 12.437  1.00 0.00 ? 133 GLU A HG3  5  
ATOM 11464 N N    . GLU A 1 134 ? 112.260 -15.461 13.584  1.00 0.00 ? 134 GLU A N    5  
ATOM 11465 C CA   . GLU A 1 134 ? 112.535 -16.251 14.777  1.00 0.00 ? 134 GLU A CA   5  
ATOM 11466 C C    . GLU A 1 134 ? 113.786 -15.731 15.490  1.00 0.00 ? 134 GLU A C    5  
ATOM 11467 O O    . GLU A 1 134 ? 114.222 -16.302 16.491  1.00 0.00 ? 134 GLU A O    5  
ATOM 11468 C CB   . GLU A 1 134 ? 112.684 -17.736 14.410  1.00 0.00 ? 134 GLU A CB   5  
ATOM 11469 C CG   . GLU A 1 134 ? 111.444 -18.317 13.729  1.00 0.00 ? 134 GLU A CG   5  
ATOM 11470 C CD   . GLU A 1 134 ? 111.549 -19.812 13.462  1.00 0.00 ? 134 GLU A CD   5  
ATOM 11471 O OE1  . GLU A 1 134 ? 112.245 -20.203 12.499  1.00 0.00 ? 134 GLU A OE1  5  
ATOM 11472 O OE2  . GLU A 1 134 ? 110.939 -20.603 14.216  1.00 0.00 ? 134 GLU A OE2  5  
ATOM 11473 H H    . GLU A 1 134 ? 112.649 -15.741 12.729  1.00 0.00 ? 134 GLU A H    5  
ATOM 11474 H HA   . GLU A 1 134 ? 111.691 -16.142 15.447  1.00 0.00 ? 134 GLU A HA   5  
ATOM 11475 H HB2  . GLU A 1 134 ? 113.525 -17.848 13.739  1.00 0.00 ? 134 GLU A HB2  5  
ATOM 11476 H HB3  . GLU A 1 134 ? 112.875 -18.303 15.310  1.00 0.00 ? 134 GLU A HB3  5  
ATOM 11477 H HG2  . GLU A 1 134 ? 110.586 -18.138 14.363  1.00 0.00 ? 134 GLU A HG2  5  
ATOM 11478 H HG3  . GLU A 1 134 ? 111.298 -17.807 12.786  1.00 0.00 ? 134 GLU A HG3  5  
ATOM 11479 N N    . GLU A 1 135 ? 114.363 -14.649 14.960  1.00 0.00 ? 135 GLU A N    5  
ATOM 11480 C CA   . GLU A 1 135 ? 115.454 -13.947 15.637  1.00 0.00 ? 135 GLU A CA   5  
ATOM 11481 C C    . GLU A 1 135 ? 114.923 -13.330 16.931  1.00 0.00 ? 135 GLU A C    5  
ATOM 11482 O O    . GLU A 1 135 ? 115.392 -13.642 18.029  1.00 0.00 ? 135 GLU A O    5  
ATOM 11483 C CB   . GLU A 1 135 ? 116.044 -12.857 14.727  1.00 0.00 ? 135 GLU A CB   5  
ATOM 11484 C CG   . GLU A 1 135 ? 116.654 -13.396 13.436  1.00 0.00 ? 135 GLU A CG   5  
ATOM 11485 C CD   . GLU A 1 135 ? 117.246 -12.303 12.558  1.00 0.00 ? 135 GLU A CD   5  
ATOM 11486 O OE1  . GLU A 1 135 ? 118.308 -11.753 12.922  1.00 0.00 ? 135 GLU A OE1  5  
ATOM 11487 O OE2  . GLU A 1 135 ? 116.656 -11.993 11.497  1.00 0.00 ? 135 GLU A OE2  5  
ATOM 11488 H H    . GLU A 1 135 ? 114.051 -14.322 14.092  1.00 0.00 ? 135 GLU A H    5  
ATOM 11489 H HA   . GLU A 1 135 ? 116.223 -14.669 15.878  1.00 0.00 ? 135 GLU A HA   5  
ATOM 11490 H HB2  . GLU A 1 135 ? 115.260 -12.159 14.465  1.00 0.00 ? 135 GLU A HB2  5  
ATOM 11491 H HB3  . GLU A 1 135 ? 116.815 -12.328 15.271  1.00 0.00 ? 135 GLU A HB3  5  
ATOM 11492 H HG2  . GLU A 1 135 ? 117.440 -14.095 13.690  1.00 0.00 ? 135 GLU A HG2  5  
ATOM 11493 H HG3  . GLU A 1 135 ? 115.885 -13.914 12.878  1.00 0.00 ? 135 GLU A HG3  5  
ATOM 11494 N N    . GLU A 1 136 ? 113.928 -12.460 16.786  1.00 0.00 ? 136 GLU A N    5  
ATOM 11495 C CA   . GLU A 1 136 ? 113.192 -11.922 17.924  1.00 0.00 ? 136 GLU A CA   5  
ATOM 11496 C C    . GLU A 1 136 ? 111.995 -12.832 18.206  1.00 0.00 ? 136 GLU A C    5  
ATOM 11497 O O    . GLU A 1 136 ? 110.835 -12.437 18.062  1.00 0.00 ? 136 GLU A O    5  
ATOM 11498 C CB   . GLU A 1 136 ? 112.741 -10.480 17.639  1.00 0.00 ? 136 GLU A CB   5  
ATOM 11499 C CG   . GLU A 1 136 ? 113.899 -9.507  17.411  1.00 0.00 ? 136 GLU A CG   5  
ATOM 11500 C CD   . GLU A 1 136 ? 113.435 -8.086  17.115  1.00 0.00 ? 136 GLU A CD   5  
ATOM 11501 O OE1  . GLU A 1 136 ? 112.659 -7.530  17.922  1.00 0.00 ? 136 GLU A OE1  5  
ATOM 11502 O OE2  . GLU A 1 136 ? 113.853 -7.510  16.084  1.00 0.00 ? 136 GLU A OE2  5  
ATOM 11503 H H    . GLU A 1 136 ? 113.676 -12.174 15.884  1.00 0.00 ? 136 GLU A H    5  
ATOM 11504 H HA   . GLU A 1 136 ? 113.847 -11.929 18.786  1.00 0.00 ? 136 GLU A HA   5  
ATOM 11505 H HB2  . GLU A 1 136 ? 112.117 -10.478 16.755  1.00 0.00 ? 136 GLU A HB2  5  
ATOM 11506 H HB3  . GLU A 1 136 ? 112.159 -10.123 18.479  1.00 0.00 ? 136 GLU A HB3  5  
ATOM 11507 H HG2  . GLU A 1 136 ? 114.516 -9.488  18.299  1.00 0.00 ? 136 GLU A HG2  5  
ATOM 11508 H HG3  . GLU A 1 136 ? 114.488 -9.862  16.576  1.00 0.00 ? 136 GLU A HG3  5  
ATOM 11509 N N    . ASP A 1 137 ? 112.305 -14.071 18.581  1.00 0.00 ? 137 ASP A N    5  
ATOM 11510 C CA   . ASP A 1 137 ? 111.301 -15.123 18.755  1.00 0.00 ? 137 ASP A CA   5  
ATOM 11511 C C    . ASP A 1 137 ? 110.577 -14.985 20.091  1.00 0.00 ? 137 ASP A C    5  
ATOM 11512 O O    . ASP A 1 137 ? 109.357 -15.163 20.172  1.00 0.00 ? 137 ASP A O    5  
ATOM 11513 C CB   . ASP A 1 137 ? 111.975 -16.499 18.661  1.00 0.00 ? 137 ASP A CB   5  
ATOM 11514 C CG   . ASP A 1 137 ? 110.994 -17.655 18.775  1.00 0.00 ? 137 ASP A CG   5  
ATOM 11515 O OD1  . ASP A 1 137 ? 110.375 -18.022 17.755  1.00 0.00 ? 137 ASP A OD1  5  
ATOM 11516 O OD2  . ASP A 1 137 ? 110.854 -18.221 19.879  1.00 0.00 ? 137 ASP A OD2  5  
ATOM 11517 H H    . ASP A 1 137 ? 113.247 -14.285 18.749  1.00 0.00 ? 137 ASP A H    5  
ATOM 11518 H HA   . ASP A 1 137 ? 110.580 -15.030 17.954  1.00 0.00 ? 137 ASP A HA   5  
ATOM 11519 H HB2  . ASP A 1 137 ? 112.481 -16.578 17.710  1.00 0.00 ? 137 ASP A HB2  5  
ATOM 11520 H HB3  . ASP A 1 137 ? 112.705 -16.588 19.455  1.00 0.00 ? 137 ASP A HB3  5  
ATOM 11521 N N    . LEU A 1 138 ? 111.332 -14.669 21.135  1.00 0.00 ? 138 LEU A N    5  
ATOM 11522 C CA   . LEU A 1 138 ? 110.777 -14.521 22.477  1.00 0.00 ? 138 LEU A CA   5  
ATOM 11523 C C    . LEU A 1 138 ? 110.349 -13.070 22.707  1.00 0.00 ? 138 LEU A C    5  
ATOM 11524 O O    . LEU A 1 138 ? 111.219 -12.232 23.031  1.00 0.00 ? 138 LEU A O    5  
ATOM 11525 C CB   . LEU A 1 138 ? 111.793 -14.961 23.551  1.00 0.00 ? 138 LEU A CB   5  
ATOM 11526 C CG   . LEU A 1 138 ? 112.159 -16.462 23.565  1.00 0.00 ? 138 LEU A CG   5  
ATOM 11527 C CD1  . LEU A 1 138 ? 112.999 -16.845 22.348  1.00 0.00 ? 138 LEU A CD1  5  
ATOM 11528 C CD2  . LEU A 1 138 ? 112.887 -16.827 24.859  1.00 0.00 ? 138 LEU A CD2  5  
ATOM 11529 O OXT  . LEU A 1 138 ? 109.146 -12.770 22.544  1.00 0.00 ? 138 LEU A OXT  5  
ATOM 11530 H H    . LEU A 1 138 ? 112.291 -14.514 20.998  1.00 0.00 ? 138 LEU A H    5  
ATOM 11531 H HA   . LEU A 1 138 ? 109.902 -15.156 22.544  1.00 0.00 ? 138 LEU A HA   5  
ATOM 11532 H HB2  . LEU A 1 138 ? 112.703 -14.393 23.406  1.00 0.00 ? 138 LEU A HB2  5  
ATOM 11533 H HB3  . LEU A 1 138 ? 111.387 -14.706 24.521  1.00 0.00 ? 138 LEU A HB3  5  
ATOM 11534 H HG   . LEU A 1 138 ? 111.248 -17.042 23.527  1.00 0.00 ? 138 LEU A HG   5  
ATOM 11535 H HD11 . LEU A 1 138 ? 112.443 -16.637 21.446  1.00 0.00 ? 138 LEU A HD11 5  
ATOM 11536 H HD12 . LEU A 1 138 ? 113.234 -17.899 22.389  1.00 0.00 ? 138 LEU A HD12 5  
ATOM 11537 H HD13 . LEU A 1 138 ? 113.916 -16.273 22.346  1.00 0.00 ? 138 LEU A HD13 5  
ATOM 11538 H HD21 . LEU A 1 138 ? 113.795 -16.247 24.941  1.00 0.00 ? 138 LEU A HD21 5  
ATOM 11539 H HD22 . LEU A 1 138 ? 113.132 -17.879 24.851  1.00 0.00 ? 138 LEU A HD22 5  
ATOM 11540 H HD23 . LEU A 1 138 ? 112.247 -16.615 25.704  1.00 0.00 ? 138 LEU A HD23 5  
ATOM 11541 N N    . SER A 1 1   ? 99.971  -4.256  12.984  1.00 0.00 ? 1   SER A N    6  
ATOM 11542 C CA   . SER A 1 1   ? 98.747  -4.276  12.157  1.00 0.00 ? 1   SER A CA   6  
ATOM 11543 C C    . SER A 1 1   ? 98.722  -5.528  11.282  1.00 0.00 ? 1   SER A C    6  
ATOM 11544 O O    . SER A 1 1   ? 99.711  -6.264  11.211  1.00 0.00 ? 1   SER A O    6  
ATOM 11545 C CB   . SER A 1 1   ? 98.693  -3.015  11.286  1.00 0.00 ? 1   SER A CB   6  
ATOM 11546 O OG   . SER A 1 1   ? 98.838  -1.842  12.073  1.00 0.00 ? 1   SER A OG   6  
ATOM 11547 H H1   . SER A 1 1   ? 100.814 -4.288  12.374  1.00 0.00 ? 1   SER A H1   6  
ATOM 11548 H H2   . SER A 1 1   ? 99.986  -5.079  13.620  1.00 0.00 ? 1   SER A H2   6  
ATOM 11549 H H3   . SER A 1 1   ? 100.001 -3.390  13.555  1.00 0.00 ? 1   SER A H3   6  
ATOM 11550 H HA   . SER A 1 1   ? 97.891  -4.293  12.817  1.00 0.00 ? 1   SER A HA   6  
ATOM 11551 H HB2  . SER A 1 1   ? 99.492  -3.044  10.560  1.00 0.00 ? 1   SER A HB2  6  
ATOM 11552 H HB3  . SER A 1 1   ? 97.742  -2.973  10.773  1.00 0.00 ? 1   SER A HB3  6  
ATOM 11553 H HG   . SER A 1 1   ? 98.190  -1.851  12.790  1.00 0.00 ? 1   SER A HG   6  
ATOM 11554 N N    . MET A 1 2   ? 97.586  -5.776  10.631  1.00 0.00 ? 2   MET A N    6  
ATOM 11555 C CA   . MET A 1 2   ? 97.468  -6.885  9.692   1.00 0.00 ? 2   MET A CA   6  
ATOM 11556 C C    . MET A 1 2   ? 98.340  -6.619  8.473   1.00 0.00 ? 2   MET A C    6  
ATOM 11557 O O    . MET A 1 2   ? 98.266  -5.549  7.870   1.00 0.00 ? 2   MET A O    6  
ATOM 11558 C CB   . MET A 1 2   ? 96.007  -7.103  9.276   1.00 0.00 ? 2   MET A CB   6  
ATOM 11559 C CG   . MET A 1 2   ? 95.141  -7.674  10.391