data_2IDW
# 
_entry.id   2IDW 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.286 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2IDW         
RCSB  RCSB039461   
WWPDB D_1000039461 
# 
_pdbx_database_PDB_obs_spr.id               SPRSDE 
_pdbx_database_PDB_obs_spr.date             2006-10-03 
_pdbx_database_PDB_obs_spr.pdb_id           2IDW 
_pdbx_database_PDB_obs_spr.replace_pdb_id   1S65 
_pdbx_database_PDB_obs_spr.details          ? 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 2IEN . unspecified 
PDB 2IEO . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2IDW 
_pdbx_database_status.recvd_initial_deposition_date   2006-09-15 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Tie, Y.'        1  
'Boross, P.I.'   2  
'Wang, Y.F.'     3  
'Gaddis, L.'     4  
'Manna, D.'      5  
'Hussain, A.K.'  6  
'Leshchenko, S.' 7  
'Ghosh, A.K.'    8  
'Louis, J.M.'    9  
'Harrison, R.W.' 10 
'Weber, I.T.'    11 
# 
_citation.id                        primary 
_citation.title                     
;High Resolution Crystal Structures of HIV-1 Protease with a Potent Non-Peptide Inhibitor (Uic-94017) Active Against Multi-Drug-Resistant Clinical Strains.
;
_citation.journal_abbrev            J.Mol.Biol. 
_citation.journal_volume            338 
_citation.page_first                341 
_citation.page_last                 352 
_citation.year                      2004 
_citation.journal_id_ASTM           JMOBAK 
_citation.country                   UK 
_citation.journal_id_ISSN           0022-2836 
_citation.journal_id_CSD            0070 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   15066436 
_citation.pdbx_database_id_DOI      10.1016/j.jmb.2004.02.052 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Tie, Y.'        1  
primary 'Boross, P.I.'   2  
primary 'Wang, Y.F.'     3  
primary 'Gaddis, L.'     4  
primary 'Hussain, A.K.'  5  
primary 'Leshchenko, S.' 6  
primary 'Ghosh, A.K.'    7  
primary 'Louis, J.M.'    8  
primary 'Harrison, R.W.' 9  
primary 'Weber, I.T.'    10 
# 
_cell.entry_id           2IDW 
_cell.length_a           50.790 
_cell.length_b           57.874 
_cell.length_c           61.939 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         2IDW 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man Protease 10712.623 2   3.4.23.16 'Q7K, L33I, L63I, C67A, V82A, C95A, Q107K, L133I, L163I, C167A, V182A, C195A' 
'residues 500-598' ? 
2 non-polymer syn 'CHLORIDE ION' 35.453    1   ?         ? ?                  ? 
3 non-polymer syn 'PHOSPHATE ION' 94.971    4   ?         ? ?                  ? 
4 non-polymer syn 'DIMETHYL SULFOXIDE' 78.133    1   ?         ? ?                  ? 
5 non-polymer syn 'ACETIC ACID' 60.052    6   ?         ? ?                  ? 
6 non-polymer syn GLYCEROL 92.094    1   ?         ?                                                                             ? 
? 
7 non-polymer syn 
'(3R,3AS,6AR)-HEXAHYDROFURO[2,3-B]FURAN-3-YL(1S,2R)-3-[[(4-AMINOPHENYL)SULFONYL](ISOBUTYL)AMINO]-1-BENZYL-2-HYDROXYPROPYLCARBAMATE' 
547.664   1   ?         ?                                                                             ?                  ? 
8 water       nat water 18.015    257 ?         ?                                                                             ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        RETROPEPSIN 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;PQITLWKRPLVTIKIGGQLKEALLDTGADDTVIEEMSLPGRWKPKMIGGIGGFIKVRQYDQIIIEIAGHKAIGTVLVGPT
PANIIGRNLLTQIGATLNF
;
_entity_poly.pdbx_seq_one_letter_code_can   
;PQITLWKRPLVTIKIGGQLKEALLDTGADDTVIEEMSLPGRWKPKMIGGIGGFIKVRQYDQIIIEIAGHKAIGTVLVGPT
PANIIGRNLLTQIGATLNF
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  PRO n 
1 2  GLN n 
1 3  ILE n 
1 4  THR n 
1 5  LEU n 
1 6  TRP n 
1 7  LYS n 
1 8  ARG n 
1 9  PRO n 
1 10 LEU n 
1 11 VAL n 
1 12 THR n 
1 13 ILE n 
1 14 LYS n 
1 15 ILE n 
1 16 GLY n 
1 17 GLY n 
1 18 GLN n 
1 19 LEU n 
1 20 LYS n 
1 21 GLU n 
1 22 ALA n 
1 23 LEU n 
1 24 LEU n 
1 25 ASP n 
1 26 THR n 
1 27 GLY n 
1 28 ALA n 
1 29 ASP n 
1 30 ASP n 
1 31 THR n 
1 32 VAL n 
1 33 ILE n 
1 34 GLU n 
1 35 GLU n 
1 36 MET n 
1 37 SER n 
1 38 LEU n 
1 39 PRO n 
1 40 GLY n 
1 41 ARG n 
1 42 TRP n 
1 43 LYS n 
1 44 PRO n 
1 45 LYS n 
1 46 MET n 
1 47 ILE n 
1 48 GLY n 
1 49 GLY n 
1 50 ILE n 
1 51 GLY n 
1 52 GLY n 
1 53 PHE n 
1 54 ILE n 
1 55 LYS n 
1 56 VAL n 
1 57 ARG n 
1 58 GLN n 
1 59 TYR n 
1 60 ASP n 
1 61 GLN n 
1 62 ILE n 
1 63 ILE n 
1 64 ILE n 
1 65 GLU n 
1 66 ILE n 
1 67 ALA n 
1 68 GLY n 
1 69 HIS n 
1 70 LYS n 
1 71 ALA n 
1 72 ILE n 
1 73 GLY n 
1 74 THR n 
1 75 VAL n 
1 76 LEU n 
1 77 VAL n 
1 78 GLY n 
1 79 PRO n 
1 80 THR n 
1 81 PRO n 
1 82 ALA n 
1 83 ASN n 
1 84 ILE n 
1 85 ILE n 
1 86 GLY n 
1 87 ARG n 
1 88 ASN n 
1 89 LEU n 
1 90 LEU n 
1 91 THR n 
1 92 GLN n 
1 93 ILE n 
1 94 GLY n 
1 95 ALA n 
1 96 THR n 
1 97 LEU n 
1 98 ASN n 
1 99 PHE n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Lentivirus 
_entity_src_gen.pdbx_gene_src_gene                 'gag, pol' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Human immunodeficiency virus 1' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     11676 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PET11A 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    POL_HV1PV 
_struct_ref.pdbx_db_accession          P03368 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_align_begin           500 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.pdbx_seq_one_letter_code   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2IDW A 1 ? 99 ? P03368 500 ? 598 ? 1   99  
2 1 2IDW B 1 ? 99 ? P03368 500 ? 598 ? 101 199 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2IDW LYS A 7  ? UNP P03368 GLN 506 ENGINEERED 7   1  
1 2IDW ILE A 33 ? UNP P03368 LEU 532 ENGINEERED 33  2  
1 2IDW ILE A 63 ? UNP P03368 LEU 562 ENGINEERED 63  3  
1 2IDW ALA A 67 ? UNP P03368 CYS 566 ENGINEERED 67  4  
1 2IDW ALA A 82 ? UNP P03368 VAL 581 ENGINEERED 82  5  
1 2IDW ALA A 95 ? UNP P03368 CYS 594 ENGINEERED 95  6  
2 2IDW LYS B 7  ? UNP P03368 GLN 506 ENGINEERED 107 7  
2 2IDW ILE B 33 ? UNP P03368 LEU 532 ENGINEERED 133 8  
2 2IDW ILE B 63 ? UNP P03368 LEU 562 ENGINEERED 163 9  
2 2IDW ALA B 67 ? UNP P03368 CYS 566 ENGINEERED 167 10 
2 2IDW ALA B 82 ? UNP P03368 VAL 581 ENGINEERED 182 11 
2 2IDW ALA B 95 ? UNP P03368 CYS 594 ENGINEERED 195 12 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
017 non-polymer         . 
'(3R,3AS,6AR)-HEXAHYDROFURO[2,3-B]FURAN-3-YL(1S,2R)-3-[[(4-AMINOPHENYL)SULFONYL](ISOBUTYL)AMINO]-1-BENZYL-2-HYDROXYPROPYLCARBAMATE' 
'Darunavir, TMC114, UIC-94017'  'C27 H37 N3 O7 S' 547.664 
ACY non-polymer         . 'ACETIC ACID' ?                               'C2 H4 O2'        60.052  
ALA 'L-peptide linking' y ALANINE ?                               'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE ?                               'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE ?                               'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ?                               'C4 H7 N O4'      133.103 
CL  non-polymer         . 'CHLORIDE ION' ?                               'Cl -1'           35.453  
CYS 'L-peptide linking' y CYSTEINE ?                               'C3 H7 N O2 S'    121.158 
DMS non-polymer         . 'DIMETHYL SULFOXIDE' ?                               'C2 H6 O S'       78.133  
GLN 'L-peptide linking' y GLUTAMINE ?                               'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ?                               'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE ?                               'C2 H5 N O2'      75.067  
GOL non-polymer         . GLYCEROL 'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'        92.094  
HIS 'L-peptide linking' y HISTIDINE ?                               'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER ?                               'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE ?                               'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE ?                               'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE ?                               'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE ?                               'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE ?                               'C9 H11 N O2'     165.189 
PO4 non-polymer         . 'PHOSPHATE ION' ?                               'O4 P -3'         94.971  
PRO 'L-peptide linking' y PROLINE ?                               'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE ?                               'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE ?                               'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN ?                               'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE ?                               'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE ?                               'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          2IDW 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.07 
_exptl_crystal.density_percent_sol   40.08 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              5.00 
_exptl_crystal_grow.pdbx_details    
'AMMONIUM SULFATE, CITRIC PHOSPHATE, DMSO, pH 5.00, VAPOR DIFFUSION, HANGING DROP, temperature 298K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           90.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   2002-12-10 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0000 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 22-ID' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   22-ID 
_diffrn_source.pdbx_wavelength             1.0000 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     2IDW 
_reflns.observed_criterion_sigma_I   3.000 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50.000 
_reflns.d_resolution_high            1.100 
_reflns.number_obs                   74707 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.7 
_reflns.pdbx_Rmerge_I_obs            0.052 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        18.4000 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              5.400 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             1.10 
_reflns_shell.d_res_low              1.14 
_reflns_shell.percent_possible_all   97.6 
_reflns_shell.Rmerge_I_obs           0.196 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        2.40 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 2IDW 
_refine.ls_number_reflns_obs                     74373 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             10.00 
_refine.ls_d_res_high                            1.10 
_refine.ls_percent_reflns_obs                    99.7 
_refine.ls_R_factor_obs                          0.117 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.116 
_refine.ls_R_factor_R_free                       0.145 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.000 
_refine.ls_number_reflns_R_free                  3715 
_refine.ls_number_parameters                     25871 
_refine.ls_number_restraints                     24400 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 1DAZ' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        2IDW 
_refine_analyze.Luzzati_coordinate_error_obs    ? 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      43 
_refine_analyze.occupancy_sum_hydrogen          1624.00 
_refine_analyze.occupancy_sum_non_hydrogen      1768.00 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1508 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         93 
_refine_hist.number_atoms_solvent             257 
_refine_hist.number_atoms_total               1858 
_refine_hist.d_res_high                       1.10 
_refine_hist.d_res_low                        10.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
s_bond_d               0.014 ? ? ? 'X-RAY DIFFRACTION' ? 
s_angle_d              0.034 ? ? ? 'X-RAY DIFFRACTION' ? 
s_similar_dist         0.000 ? ? ? 'X-RAY DIFFRACTION' ? 
s_from_restr_planes    0.030 ? ? ? 'X-RAY DIFFRACTION' ? 
s_zero_chiral_vol      0.085 ? ? ? 'X-RAY DIFFRACTION' ? 
s_non_zero_chiral_vol  0.086 ? ? ? 'X-RAY DIFFRACTION' ? 
s_anti_bump_dis_restr  0.144 ? ? ? 'X-RAY DIFFRACTION' ? 
s_rigid_bond_adp_cmpnt 0.005 ? ? ? 'X-RAY DIFFRACTION' ? 
s_similar_adp_cmpnt    0.051 ? ? ? 'X-RAY DIFFRACTION' ? 
s_approx_iso_adps      0.073 ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_pdbx_refine.entry_id                                    2IDW 
_pdbx_refine.R_factor_all_no_cutoff                      0.117 
_pdbx_refine.R_factor_obs_no_cutoff                      0.116 
_pdbx_refine.free_R_factor_no_cutoff                     0.145 
_pdbx_refine.free_R_val_test_set_size_perc_no_cutoff     5.000 
_pdbx_refine.free_R_val_test_set_ct_no_cutoff            3715 
_pdbx_refine.R_factor_all_4sig_cutoff                    0.104 
_pdbx_refine.R_factor_obs_4sig_cutoff                    0.102 
_pdbx_refine.free_R_factor_4sig_cutoff                   0.144 
_pdbx_refine.free_R_val_test_set_size_perc_4sig_cutoff   5.000 
_pdbx_refine.free_R_val_test_set_ct_4sig_cutoff          3351 
_pdbx_refine.number_reflns_obs_4sig_cutoff               66823 
_pdbx_refine.pdbx_refine_id                              'X-RAY DIFFRACTION' 
_pdbx_refine.free_R_error_no_cutoff                      ? 
# 
_struct.entry_id                  2IDW 
_struct.title                     
'Crystal structure analysis of HIV-1 protease mutant V82A with a potent non-peptide inhibitor (UIC-94017)' 
_struct.pdbx_descriptor           'Protease (E.C.3.4.23.16)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2IDW 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            'HIV-1 PROTEASE, MUTANT, DIMER, INHIBITOR, UIC-94017, HYDROLASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 3 ? 
F N N 3 ? 
G N N 4 ? 
H N N 5 ? 
I N N 5 ? 
J N N 6 ? 
K N N 3 ? 
L N N 7 ? 
M N N 5 ? 
N N N 5 ? 
O N N 5 ? 
P N N 5 ? 
Q N N 8 ? 
R N N 8 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 GLY A 86 ? THR A 91 ? GLY A 86  THR A 91  1 ? 6 
HELX_P HELX_P2 2 GLN A 92 ? GLY A 94 ? GLN A 92  GLY A 94  5 ? 3 
HELX_P HELX_P3 3 GLY B 86 ? THR B 91 ? GLY B 186 THR B 191 1 ? 6 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 8 ? 
C ? 8 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? parallel      
B 4 5 ? anti-parallel 
B 5 6 ? parallel      
B 6 7 ? anti-parallel 
B 7 8 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? parallel      
C 4 5 ? anti-parallel 
C 5 6 ? parallel      
C 6 7 ? anti-parallel 
C 7 8 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLN A 2  ? ILE A 3  ? GLN A 2   ILE A 3   
A 2 THR B 96 ? ASN B 98 ? THR B 196 ASN B 198 
A 3 THR A 96 ? ASN A 98 ? THR A 96  ASN A 98  
A 4 GLN B 2  ? ILE B 3  ? GLN B 102 ILE B 103 
B 1 LYS A 43 ? GLY A 49 ? LYS A 43  GLY A 49  
B 2 GLY A 52 ? ILE A 66 ? GLY A 52  ILE A 66  
B 3 HIS A 69 ? GLY A 78 ? HIS A 69  GLY A 78  
B 4 THR A 31 ? GLU A 34 ? THR A 31  GLU A 34  
B 5 ILE A 84 ? ILE A 85 ? ILE A 84  ILE A 85  
B 6 GLN A 18 ? LEU A 24 ? GLN A 18  LEU A 24  
B 7 LEU A 10 ? ILE A 15 ? LEU A 10  ILE A 15  
B 8 GLY A 52 ? ILE A 66 ? GLY A 52  ILE A 66  
C 1 LYS B 43 ? GLY B 49 ? LYS B 143 GLY B 149 
C 2 GLY B 52 ? ILE B 66 ? GLY B 152 ILE B 166 
C 3 HIS B 69 ? VAL B 77 ? HIS B 169 VAL B 177 
C 4 VAL B 32 ? ILE B 33 ? VAL B 132 ILE B 133 
C 5 ILE B 84 ? ILE B 85 ? ILE B 184 ILE B 185 
C 6 GLN B 18 ? LEU B 24 ? GLN B 118 LEU B 124 
C 7 LEU B 10 ? ILE B 15 ? LEU B 110 ILE B 115 
C 8 GLY B 52 ? ILE B 66 ? GLY B 152 ILE B 166 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ILE A 3  ? N ILE A 3   O LEU B 97 ? O LEU B 197 
A 2 3 O THR B 96 ? O THR B 196 N ASN A 98 ? N ASN A 98  
A 3 4 N LEU A 97 ? N LEU A 97  O ILE B 3  ? O ILE B 103 
B 1 2 N LYS A 45 ? N LYS A 45  O VAL A 56 ? O VAL A 56  
B 2 3 N ILE A 66 ? N ILE A 66  O HIS A 69 ? O HIS A 69  
B 3 4 O LEU A 76 ? O LEU A 76  N ILE A 33 ? N ILE A 33  
B 4 5 N VAL A 32 ? N VAL A 32  O ILE A 84 ? O ILE A 84  
B 5 6 O ILE A 85 ? O ILE A 85  N LEU A 23 ? N LEU A 23  
B 6 7 O LYS A 20 ? O LYS A 20  N ILE A 13 ? N ILE A 13  
B 7 8 N LYS A 14 ? N LYS A 14  O GLU A 65 ? O GLU A 65  
C 1 2 N LYS B 43 ? N LYS B 143 O GLN B 58 ? O GLN B 158 
C 2 3 N ILE B 66 ? N ILE B 166 O HIS B 69 ? O HIS B 169 
C 3 4 O LEU B 76 ? O LEU B 176 N ILE B 33 ? N ILE B 133 
C 4 5 N VAL B 32 ? N VAL B 132 O ILE B 84 ? O ILE B 184 
C 5 6 O ILE B 85 ? O ILE B 185 N LEU B 23 ? N LEU B 123 
C 6 7 O LYS B 20 ? O LYS B 120 N ILE B 13 ? N ILE B 113 
C 7 8 N LYS B 14 ? N LYS B 114 O GLU B 65 ? O GLU B 165 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE CL A 501'  
AC2 Software ? ? ? ? 13 'BINDING SITE FOR RESIDUE PO4 A 701' 
AC3 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE PO4 A 702' 
AC4 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE PO4 B 703' 
AC5 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE PO4 A 704' 
AC6 Software ? ? ? ? 20 'BINDING SITE FOR RESIDUE 017 B 401' 
AC7 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE DMS A 901' 
AC8 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE ACY A 601' 
AC9 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE ACY B 602' 
BC1 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE ACY B 603' 
BC2 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ACY B 604' 
BC3 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE ACY A 605' 
BC4 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE ACY B 606' 
BC5 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE GOL A 801' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 5  GLY A 73 ? GLY A 73   . ? 1_555 ? 
2   AC1 5  THR A 74 ? THR A 74   . ? 1_555 ? 
3   AC1 5  ASN A 88 ? ASN A 88   . ? 1_555 ? 
4   AC1 5  HOH Q .  ? HOH A 1163 . ? 1_555 ? 
5   AC1 5  HOH Q .  ? HOH A 1237 . ? 1_555 ? 
6   AC2 13 LYS A 14 ? LYS A 14   . ? 1_555 ? 
7   AC2 13 ILE A 15 ? ILE A 15   . ? 1_555 ? 
8   AC2 13 GLY A 16 ? GLY A 16   . ? 1_555 ? 
9   AC2 13 GLY A 17 ? GLY A 17   . ? 1_555 ? 
10  AC2 13 HOH Q .  ? HOH A 1013 . ? 1_555 ? 
11  AC2 13 HOH Q .  ? HOH A 1057 . ? 1_555 ? 
12  AC2 13 HOH Q .  ? HOH A 1063 . ? 1_555 ? 
13  AC2 13 HOH Q .  ? HOH A 1247 . ? 1_555 ? 
14  AC2 13 HOH Q .  ? HOH A 1262 . ? 1_555 ? 
15  AC2 13 LYS B 14 ? LYS B 114  . ? 1_455 ? 
16  AC2 13 GLY B 17 ? GLY B 117  . ? 1_455 ? 
17  AC2 13 ACY P .  ? ACY B 606  . ? 1_455 ? 
18  AC2 13 HOH R .  ? HOH B 1154 . ? 1_455 ? 
19  AC3 6  PRO A 39 ? PRO A 39   . ? 1_555 ? 
20  AC3 6  GLY A 40 ? GLY A 40   . ? 1_555 ? 
21  AC3 6  HOH Q .  ? HOH A 1115 . ? 1_555 ? 
22  AC3 6  HOH Q .  ? HOH A 1270 . ? 1_555 ? 
23  AC3 6  MET B 36 ? MET B 136  . ? 1_455 ? 
24  AC3 6  SER B 37 ? SER B 137  . ? 1_455 ? 
25  AC4 6  PRO B 1  ? PRO B 101  . ? 1_555 ? 
26  AC4 6  ARG B 57 ? ARG B 157  . ? 2_665 ? 
27  AC4 6  HIS B 69 ? HIS B 169  . ? 1_555 ? 
28  AC4 6  HOH R .  ? HOH B 1049 . ? 1_555 ? 
29  AC4 6  HOH R .  ? HOH B 1133 . ? 1_555 ? 
30  AC4 6  HOH R .  ? HOH B 1210 . ? 1_555 ? 
31  AC5 8  LYS A 20 ? LYS A 20   . ? 1_555 ? 
32  AC5 8  GLU A 21 ? GLU A 21   . ? 1_555 ? 
33  AC5 8  GLU A 34 ? GLU A 34   . ? 1_555 ? 
34  AC5 8  ARG A 41 ? ARG A 41   . ? 3_545 ? 
35  AC5 8  ASN A 83 ? ASN A 83   . ? 1_555 ? 
36  AC5 8  HOH Q .  ? HOH A 1136 . ? 1_555 ? 
37  AC5 8  HOH Q .  ? HOH A 1164 . ? 1_555 ? 
38  AC5 8  HOH Q .  ? HOH A 1266 . ? 1_555 ? 
39  AC6 20 ASP A 25 ? ASP A 25   . ? 1_555 ? 
40  AC6 20 GLY A 27 ? GLY A 27   . ? 1_555 ? 
41  AC6 20 ALA A 28 ? ALA A 28   . ? 1_555 ? 
42  AC6 20 ASP A 30 ? ASP A 30   . ? 1_555 ? 
43  AC6 20 VAL A 32 ? VAL A 32   . ? 1_555 ? 
44  AC6 20 ILE A 47 ? ILE A 47   . ? 1_555 ? 
45  AC6 20 GLY A 48 ? GLY A 48   . ? 1_555 ? 
46  AC6 20 GLY A 49 ? GLY A 49   . ? 1_555 ? 
47  AC6 20 PRO A 81 ? PRO A 81   . ? 1_555 ? 
48  AC6 20 ILE A 84 ? ILE A 84   . ? 1_555 ? 
49  AC6 20 ASP B 25 ? ASP B 125  . ? 1_555 ? 
50  AC6 20 GLY B 27 ? GLY B 127  . ? 1_555 ? 
51  AC6 20 ALA B 28 ? ALA B 128  . ? 1_555 ? 
52  AC6 20 ASP B 29 ? ASP B 129  . ? 1_555 ? 
53  AC6 20 ASP B 30 ? ASP B 130  . ? 1_555 ? 
54  AC6 20 GLY B 48 ? GLY B 148  . ? 1_555 ? 
55  AC6 20 GLY B 49 ? GLY B 149  . ? 1_555 ? 
56  AC6 20 ILE B 50 ? ILE B 150  . ? 1_555 ? 
57  AC6 20 HOH R .  ? HOH B 1001 . ? 1_555 ? 
58  AC6 20 HOH R .  ? HOH B 1138 . ? 1_555 ? 
59  AC7 9  PRO A 1  ? PRO A 1    . ? 1_555 ? 
60  AC7 9  LYS A 55 ? LYS A 55   . ? 2_565 ? 
61  AC7 9  ACY I .  ? ACY A 605  . ? 2_565 ? 
62  AC7 9  HOH Q .  ? HOH A 1248 . ? 1_555 ? 
63  AC7 9  GLY B 68 ? GLY B 168  . ? 4_456 ? 
64  AC7 9  HIS B 69 ? HIS B 169  . ? 4_456 ? 
65  AC7 9  LYS B 70 ? LYS B 170  . ? 4_456 ? 
66  AC7 9  HOH R .  ? HOH B 1121 . ? 4_456 ? 
67  AC7 9  HOH R .  ? HOH B 1225 . ? 4_456 ? 
68  AC8 3  MET A 36 ? MET A 36   . ? 1_555 ? 
69  AC8 3  SER A 37 ? SER A 37   . ? 1_555 ? 
70  AC8 3  PRO B 39 ? PRO B 139  . ? 1_455 ? 
71  AC9 3  GLN A 92 ? GLN A 92   . ? 2_564 ? 
72  AC9 3  GLY B 49 ? GLY B 149  . ? 1_555 ? 
73  AC9 3  HOH R .  ? HOH B 1214 . ? 1_555 ? 
74  BC1 6  TRP A 6  ? TRP A 6    . ? 1_555 ? 
75  BC1 6  THR B 91 ? THR B 191  . ? 1_555 ? 
76  BC1 6  GLY B 94 ? GLY B 194  . ? 1_555 ? 
77  BC1 6  HOH R .  ? HOH B 1025 . ? 1_555 ? 
78  BC1 6  HOH R .  ? HOH B 1205 . ? 1_555 ? 
79  BC1 6  HOH R .  ? HOH B 1230 . ? 1_555 ? 
80  BC2 4  LEU B 10 ? LEU B 110  . ? 1_555 ? 
81  BC2 4  VAL B 11 ? VAL B 111  . ? 1_555 ? 
82  BC2 4  THR B 12 ? THR B 112  . ? 1_555 ? 
83  BC2 4  GLU B 21 ? GLU B 121  . ? 1_555 ? 
84  BC3 7  MET A 46 ? MET A 46   . ? 1_555 ? 
85  BC3 7  PHE A 53 ? PHE A 53   . ? 1_555 ? 
86  BC3 7  LYS A 55 ? LYS A 55   . ? 1_555 ? 
87  BC3 7  DMS G .  ? DMS A 901  . ? 2_564 ? 
88  BC3 7  HOH Q .  ? HOH A 1012 . ? 1_555 ? 
89  BC3 7  HOH R .  ? HOH B 1121 . ? 3_655 ? 
90  BC3 7  HOH R .  ? HOH B 1225 . ? 3_655 ? 
91  BC4 8  LYS A 14 ? LYS A 14   . ? 1_655 ? 
92  BC4 8  LYS A 70 ? LYS A 70   . ? 1_655 ? 
93  BC4 8  PO4 D .  ? PO4 A 701  . ? 1_655 ? 
94  BC4 8  HOH Q .  ? HOH A 1247 . ? 1_655 ? 
95  BC4 8  LYS B 14 ? LYS B 114  . ? 1_555 ? 
96  BC4 8  LYS B 55 ? LYS B 155  . ? 2_665 ? 
97  BC4 8  GLU B 65 ? GLU B 165  . ? 1_555 ? 
98  BC4 8  HOH R .  ? HOH B 1154 . ? 1_555 ? 
99  BC5 6  TRP A 42 ? TRP A 42   . ? 1_555 ? 
100 BC5 6  PRO A 44 ? PRO A 44   . ? 1_555 ? 
101 BC5 6  VAL A 56 ? VAL A 56   . ? 1_555 ? 
102 BC5 6  HOH Q .  ? HOH A 1032 . ? 1_555 ? 
103 BC5 6  HOH Q .  ? HOH A 1058 . ? 1_555 ? 
104 BC5 6  HOH R .  ? HOH B 1052 . ? 2_564 ? 
# 
_database_PDB_matrix.entry_id          2IDW 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2IDW 
_atom_sites.fract_transf_matrix[1][1]   0.019689 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.017279 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.016145 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CL 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . PRO A 1 1  ? 12.684 14.550 30.833 1.00 14.63 ? 1    PRO A N   1 
ATOM   2    C  CA  . PRO A 1 1  ? 13.446 13.772 29.839 1.00 13.12 ? 1    PRO A CA  1 
ATOM   3    C  C   . PRO A 1 1  ? 14.836 14.371 29.635 1.00 10.94 ? 1    PRO A C   1 
ATOM   4    O  O   . PRO A 1 1  ? 15.146 15.498 30.014 1.00 11.64 ? 1    PRO A O   1 
ATOM   5    C  CB  . PRO A 1 1  ? 12.626 13.832 28.545 1.00 20.27 ? 1    PRO A CB  1 
ATOM   6    C  CG  . PRO A 1 1  ? 11.232 14.072 29.058 1.00 24.10 ? 1    PRO A CG  1 
ATOM   7    C  CD  . PRO A 1 1  ? 11.475 15.111 30.139 1.00 23.15 ? 1    PRO A CD  1 
ATOM   8    N  N   . GLN A 1 2  ? 15.676 13.528 29.040 1.00 10.73 ? 2    GLN A N   1 
ATOM   9    C  CA  . GLN A 1 2  ? 16.993 13.942 28.586 1.00 10.72 ? 2    GLN A CA  1 
ATOM   10   C  C   . GLN A 1 2  ? 17.042 13.794 27.086 1.00 12.10 ? 2    GLN A C   1 
ATOM   11   O  O   . GLN A 1 2  ? 16.656 12.764 26.494 1.00 15.12 ? 2    GLN A O   1 
ATOM   12   C  CB  . GLN A 1 2  ? 18.057 13.058 29.219 1.00 12.60 ? 2    GLN A CB  1 
ATOM   13   C  CG  . GLN A 1 2  ? 19.408 13.415 28.659 1.00 13.83 ? 2    GLN A CG  1 
ATOM   14   C  CD  . GLN A 1 2  ? 20.503 12.710 29.408 1.00 18.85 ? 2    GLN A CD  1 
ATOM   15   O  OE1 . GLN A 1 2  ? 21.008 11.728 28.879 1.00 24.57 ? 2    GLN A OE1 1 
ATOM   16   N  NE2 . GLN A 1 2  ? 20.817 13.282 30.558 1.00 18.23 ? 2    GLN A NE2 1 
ATOM   17   N  N   . ILE A 1 3  ? 17.482 14.862 26.422 1.00 11.21 ? 3    ILE A N   1 
ATOM   18   C  CA  . ILE A 1 3  ? 17.652 14.859 25.008 1.00 12.31 ? 3    ILE A CA  1 
ATOM   19   C  C   . ILE A 1 3  ? 19.113 15.011 24.612 1.00 10.90 ? 3    ILE A C   1 
ATOM   20   O  O   . ILE A 1 3  ? 19.740 15.979 24.926 1.00 9.64  ? 3    ILE A O   1 
ATOM   21   C  CB  . ILE A 1 3  ? 16.785 15.989 24.417 1.00 14.27 ? 3    ILE A CB  1 
ATOM   22   C  CG1 . ILE A 1 3  ? 15.339 15.822 24.879 1.00 22.08 ? 3    ILE A CG1 1 
ATOM   23   C  CG2 . ILE A 1 3  ? 16.951 16.043 22.928 1.00 17.71 ? 3    ILE A CG2 1 
ATOM   24   C  CD1 . ILE A 1 3  ? 14.417 16.769 24.160 1.00 29.13 ? 3    ILE A CD1 1 
ATOM   25   N  N   A THR A 1 4  ? 19.790 14.000 24.015 0.62 11.78 ? 4    THR A N   1 
ATOM   26   N  N   B THR A 1 4  ? 19.366 14.002 23.778 0.38 15.41 ? 4    THR A N   1 
ATOM   27   C  CA  A THR A 1 4  ? 21.156 14.045 23.586 0.62 7.61  ? 4    THR A CA  1 
ATOM   28   C  CA  B THR A 1 4  ? 20.486 13.889 22.918 0.38 9.82  ? 4    THR A CA  1 
ATOM   29   C  C   A THR A 1 4  ? 21.191 14.823 22.270 0.62 7.10  ? 4    THR A C   1 
ATOM   30   C  C   B THR A 1 4  ? 20.605 14.998 21.875 0.38 8.82  ? 4    THR A C   1 
ATOM   31   O  O   A THR A 1 4  ? 20.111 15.089 21.777 0.62 7.87  ? 4    THR A O   1 
ATOM   32   O  O   B THR A 1 4  ? 19.636 15.509 21.337 0.38 7.93  ? 4    THR A O   1 
ATOM   33   C  CB  A THR A 1 4  ? 21.829 12.681 23.313 0.62 7.99  ? 4    THR A CB  1 
ATOM   34   C  CB  B THR A 1 4  ? 20.511 12.548 22.132 0.38 10.29 ? 4    THR A CB  1 
ATOM   35   O  OG1 A THR A 1 4  ? 21.141 12.063 22.211 0.62 9.32  ? 4    THR A OG1 1 
ATOM   36   O  OG1 B THR A 1 4  ? 21.850 12.100 22.170 0.38 19.19 ? 4    THR A OG1 1 
ATOM   37   C  CG2 A THR A 1 4  ? 21.912 11.783 24.518 0.62 14.02 ? 4    THR A CG2 1 
ATOM   38   C  CG2 B THR A 1 4  ? 20.087 12.599 20.674 0.38 20.96 ? 4    THR A CG2 1 
ATOM   39   N  N   A LEU A 1 5  ? 22.391 15.166 21.822 0.62 6.17  ? 5    LEU A N   1 
ATOM   40   N  N   B LEU A 1 5  ? 21.886 15.292 21.648 0.38 7.12  ? 5    LEU A N   1 
ATOM   41   C  CA  A LEU A 1 5  ? 22.367 16.134 20.710 0.62 5.74  ? 5    LEU A CA  1 
ATOM   42   C  CA  B LEU A 1 5  ? 22.255 16.244 20.610 0.38 5.75  ? 5    LEU A CA  1 
ATOM   43   C  C   . LEU A 1 5  ? 22.950 15.564 19.429 1.00 5.27  ? 5    LEU A C   1 
ATOM   44   O  O   . LEU A 1 5  ? 23.389 16.263 18.542 1.00 5.27  ? 5    LEU A O   1 
ATOM   45   C  CB  . LEU A 1 5  ? 23.113 17.393 21.190 1.00 5.97  ? 5    LEU A CB  1 
ATOM   46   C  CG  . LEU A 1 5  ? 22.381 18.195 22.279 1.00 6.09  ? 5    LEU A CG  1 
ATOM   47   C  CD1 . LEU A 1 5  ? 23.296 19.269 22.872 1.00 7.31  ? 5    LEU A CD1 1 
ATOM   48   C  CD2 . LEU A 1 5  ? 21.098 18.806 21.757 1.00 7.08  ? 5    LEU A CD2 1 
ATOM   49   N  N   . TRP A 1 6  ? 22.952 14.230 19.333 1.00 6.28  ? 6    TRP A N   1 
ATOM   50   C  CA  . TRP A 1 6  ? 23.373 13.584 18.119 1.00 7.14  ? 6    TRP A CA  1 
ATOM   51   C  C   . TRP A 1 6  ? 22.529 13.989 16.929 1.00 7.78  ? 6    TRP A C   1 
ATOM   52   O  O   . TRP A 1 6  ? 23.029 14.040 15.814 1.00 11.87 ? 6    TRP A O   1 
ATOM   53   C  CB  . TRP A 1 6  ? 23.287 12.081 18.287 1.00 8.34  ? 6    TRP A CB  1 
ATOM   54   C  CG  . TRP A 1 6  ? 24.194 11.418 19.252 1.00 7.41  ? 6    TRP A CG  1 
ATOM   55   C  CD1 . TRP A 1 6  ? 23.806 10.675 20.319 1.00 10.43 ? 6    TRP A CD1 1 
ATOM   56   C  CD2 . TRP A 1 6  ? 25.622 11.363 19.198 1.00 7.43  ? 6    TRP A CD2 1 
ATOM   57   N  NE1 . TRP A 1 6  ? 24.943 10.184 20.944 1.00 11.59 ? 6    TRP A NE1 1 
ATOM   58   C  CE2 . TRP A 1 6  ? 26.037 10.585 20.287 1.00 8.89  ? 6    TRP A CE2 1 
ATOM   59   C  CE3 . TRP A 1 6  ? 26.589 11.891 18.368 1.00 8.55  ? 6    TRP A CE3 1 
ATOM   60   C  CZ2 . TRP A 1 6  ? 27.405 10.333 20.543 1.00 11.41 ? 6    TRP A CZ2 1 
ATOM   61   C  CZ3 . TRP A 1 6  ? 27.909 11.641 18.620 1.00 10.26 ? 6    TRP A CZ3 1 
ATOM   62   C  CH2 . TRP A 1 6  ? 28.303 10.864 19.705 1.00 11.03 ? 6    TRP A CH2 1 
ATOM   63   N  N   . LYS A 1 7  ? 21.246 14.219 17.187 1.00 6.71  ? 7    LYS A N   1 
ATOM   64   C  CA  . LYS A 1 7  ? 20.276 14.618 16.194 1.00 6.81  ? 7    LYS A CA  1 
ATOM   65   C  C   . LYS A 1 7  ? 19.701 15.958 16.646 1.00 5.94  ? 7    LYS A C   1 
ATOM   66   O  O   . LYS A 1 7  ? 19.848 16.375 17.767 1.00 6.29  ? 7    LYS A O   1 
ATOM   67   C  CB  A LYS A 1 7  ? 19.185 13.548 16.015 0.61 8.48  ? 7    LYS A CB  1 
ATOM   68   C  CB  B LYS A 1 7  ? 19.141 13.616 16.005 0.39 11.51 ? 7    LYS A CB  1 
ATOM   69   C  CG  A LYS A 1 7  ? 18.195 13.287 17.133 0.61 10.66 ? 7    LYS A CG  1 
ATOM   70   C  CG  B LYS A 1 7  ? 19.592 12.190 15.766 0.39 12.94 ? 7    LYS A CG  1 
ATOM   71   C  CD  A LYS A 1 7  ? 17.368 12.039 16.902 0.61 15.09 ? 7    LYS A CD  1 
ATOM   72   C  CD  B LYS A 1 7  ? 18.478 11.218 16.157 0.39 16.20 ? 7    LYS A CD  1 
ATOM   73   C  CE  A LYS A 1 7  ? 16.274 12.175 15.870 0.61 24.20 ? 7    LYS A CE  1 
ATOM   74   C  CE  B LYS A 1 7  ? 17.102 11.841 16.055 0.39 20.14 ? 7    LYS A CE  1 
ATOM   75   N  NZ  A LYS A 1 7  ? 16.451 11.298 14.683 0.61 34.98 ? 7    LYS A NZ  1 
ATOM   76   N  NZ  B LYS A 1 7  ? 16.559 12.314 17.357 0.39 27.93 ? 7    LYS A NZ  1 
ATOM   77   N  N   . ARG A 1 8  ? 18.971 16.611 15.738 1.00 6.08  ? 8    ARG A N   1 
ATOM   78   C  CA  . ARG A 1 8  ? 18.287 17.840 16.097 1.00 5.84  ? 8    ARG A CA  1 
ATOM   79   C  C   . ARG A 1 8  ? 17.340 17.605 17.241 1.00 5.38  ? 8    ARG A C   1 
ATOM   80   O  O   . ARG A 1 8  ? 16.620 16.573 17.245 1.00 6.41  ? 8    ARG A O   1 
ATOM   81   C  CB  . ARG A 1 8  ? 17.517 18.444 14.930 1.00 7.06  ? 8    ARG A CB  1 
ATOM   82   C  CG  . ARG A 1 8  ? 18.390 18.960 13.838 1.00 7.98  ? 8    ARG A CG  1 
ATOM   83   C  CD  A ARG A 1 8  ? 17.568 19.185 12.576 0.45 11.62 ? 8    ARG A CD  1 
ATOM   84   C  CD  B ARG A 1 8  ? 17.719 19.587 12.662 0.55 11.58 ? 8    ARG A CD  1 
ATOM   85   N  NE  A ARG A 1 8  ? 16.847 18.076 12.024 0.45 16.86 ? 8    ARG A NE  1 
ATOM   86   N  NE  B ARG A 1 8  ? 18.698 20.023 11.674 0.55 11.88 ? 8    ARG A NE  1 
ATOM   87   C  CZ  A ARG A 1 8  ? 15.720 17.892 11.345 0.45 23.99 ? 8    ARG A CZ  1 
ATOM   88   C  CZ  B ARG A 1 8  ? 18.445 20.032 10.375 0.55 17.79 ? 8    ARG A CZ  1 
ATOM   89   N  NH1 A ARG A 1 8  ? 14.865 18.834 10.969 0.45 22.19 ? 8    ARG A NH1 1 
ATOM   90   N  NH1 B ARG A 1 8  ? 17.284 19.643 9.862  0.55 29.41 ? 8    ARG A NH1 1 
ATOM   91   N  NH2 A ARG A 1 8  ? 15.369 16.652 10.983 0.45 29.81 ? 8    ARG A NH2 1 
ATOM   92   N  NH2 B ARG A 1 8  ? 19.408 20.448 9.573  0.55 24.24 ? 8    ARG A NH2 1 
ATOM   93   N  N   . PRO A 1 9  ? 17.284 18.470 18.250 1.00 5.13  ? 9    PRO A N   1 
ATOM   94   C  CA  . PRO A 1 9  ? 16.424 18.281 19.437 1.00 5.66  ? 9    PRO A CA  1 
ATOM   95   C  C   . PRO A 1 9  ? 14.983 18.704 19.159 1.00 5.43  ? 9    PRO A C   1 
ATOM   96   O  O   . PRO A 1 9  ? 14.479 19.718 19.646 1.00 6.48  ? 9    PRO A O   1 
ATOM   97   C  CB  . PRO A 1 9  ? 17.100 19.155 20.500 1.00 6.96  ? 9    PRO A CB  1 
ATOM   98   C  CG  . PRO A 1 9  ? 17.706 20.234 19.702 1.00 7.23  ? 9    PRO A CG  1 
ATOM   99   C  CD  . PRO A 1 9  ? 18.204 19.591 18.442 1.00 6.49  ? 9    PRO A CD  1 
ATOM   100  N  N   . LEU A 1 10 ? 14.313 17.917 18.328 1.00 6.33  ? 10   LEU A N   1 
ATOM   101  C  CA  . LEU A 1 10 ? 12.963 18.179 17.922 1.00 6.21  ? 10   LEU A CA  1 
ATOM   102  C  C   . LEU A 1 10 ? 11.973 17.534 18.861 1.00 7.28  ? 10   LEU A C   1 
ATOM   103  O  O   . LEU A 1 10 ? 12.136 16.368 19.236 1.00 9.21  ? 10   LEU A O   1 
ATOM   104  C  CB  . LEU A 1 10 ? 12.719 17.596 16.508 1.00 8.37  ? 10   LEU A CB  1 
ATOM   105  C  CG  . LEU A 1 10 ? 13.491 18.295 15.388 1.00 9.99  ? 10   LEU A CG  1 
ATOM   106  C  CD1 . LEU A 1 10 ? 13.363 17.519 14.096 1.00 14.64 ? 10   LEU A CD1 1 
ATOM   107  C  CD2 . LEU A 1 10 ? 12.934 19.702 15.182 1.00 14.38 ? 10   LEU A CD2 1 
ATOM   108  N  N   . VAL A 1 11 ? 10.945 18.278 19.231 1.00 6.06  ? 11   VAL A N   1 
ATOM   109  C  CA  . VAL A 1 11 ? 9.852  17.830 20.043 1.00 6.50  ? 11   VAL A CA  1 
ATOM   110  C  C   . VAL A 1 11 ? 8.541  18.238 19.389 1.00 6.23  ? 11   VAL A C   1 
ATOM   111  O  O   . VAL A 1 11 ? 8.504  19.143 18.569 1.00 7.02  ? 11   VAL A O   1 
ATOM   112  C  CB  . VAL A 1 11 ? 9.920  18.326 21.476 1.00 8.46  ? 11   VAL A CB  1 
ATOM   113  C  CG1 . VAL A 1 11 ? 11.220 17.877 22.144 1.00 11.03 ? 11   VAL A CG1 1 
ATOM   114  C  CG2 . VAL A 1 11 ? 9.764  19.831 21.551 1.00 10.10 ? 11   VAL A CG2 1 
ATOM   115  N  N   . THR A 1 12 ? 7.463  17.604 19.790 1.00 6.12  ? 12   THR A N   1 
ATOM   116  C  CA  . THR A 1 12 ? 6.132  17.996 19.344 1.00 6.07  ? 12   THR A CA  1 
ATOM   117  C  C   . THR A 1 12 ? 5.637  19.158 20.218 1.00 5.84  ? 12   THR A C   1 
ATOM   118  O  O   . THR A 1 12 ? 5.729  19.104 21.431 1.00 7.03  ? 12   THR A O   1 
ATOM   119  C  CB  . THR A 1 12 ? 5.158  16.822 19.419 1.00 8.45  ? 12   THR A CB  1 
ATOM   120  O  OG1 . THR A 1 12 ? 5.684  15.739 18.626 1.00 11.26 ? 12   THR A OG1 1 
ATOM   121  C  CG2 . THR A 1 12 ? 3.795  17.191 18.909 1.00 10.69 ? 12   THR A CG2 1 
ATOM   122  N  N   . ILE A 1 13 ? 5.091  20.157 19.554 1.00 5.83  ? 13   ILE A N   1 
ATOM   123  C  CA  . ILE A 1 13 ? 4.463  21.298 20.199 1.00 5.49  ? 13   ILE A CA  1 
ATOM   124  C  C   . ILE A 1 13 ? 3.024  21.405 19.724 1.00 5.50  ? 13   ILE A C   1 
ATOM   125  O  O   . ILE A 1 13 ? 2.650  20.897 18.680 1.00 6.14  ? 13   ILE A O   1 
ATOM   126  C  CB  . ILE A 1 13 ? 5.212  22.612 19.939 1.00 6.10  ? 13   ILE A CB  1 
ATOM   127  C  CG1 . ILE A 1 13 ? 5.138  23.078 18.501 1.00 6.65  ? 13   ILE A CG1 1 
ATOM   128  C  CG2 . ILE A 1 13 ? 6.661  22.477 20.395 1.00 6.68  ? 13   ILE A CG2 1 
ATOM   129  C  CD1 . ILE A 1 13 ? 5.568  24.492 18.262 1.00 6.90  ? 13   ILE A CD1 1 
ATOM   130  N  N   . LYS A 1 14 ? 2.231  22.110 20.521 1.00 5.55  ? 14   LYS A N   1 
ATOM   131  C  CA  . LYS A 1 14 ? 0.863  22.458 20.185 1.00 5.43  ? 14   LYS A CA  1 
ATOM   132  C  C   . LYS A 1 14 ? 0.717  23.959 20.297 1.00 5.43  ? 14   LYS A C   1 
ATOM   133  O  O   . LYS A 1 14 ? 0.957  24.502 21.362 1.00 6.62  ? 14   LYS A O   1 
ATOM   134  C  CB  . LYS A 1 14 ? -0.179 21.723 21.059 1.00 7.70  ? 14   LYS A CB  1 
ATOM   135  C  CG  . LYS A 1 14 ? -1.602 22.039 20.669 1.00 8.92  ? 14   LYS A CG  1 
ATOM   136  C  CD  . LYS A 1 14 ? -2.621 21.218 21.459 1.00 14.19 ? 14   LYS A CD  1 
ATOM   137  C  CE  A LYS A 1 14 ? -2.368 21.237 22.957 0.60 16.98 ? 14   LYS A CE  1 
ATOM   138  C  CE  B LYS A 1 14 ? -2.712 21.749 22.897 0.40 17.22 ? 14   LYS A CE  1 
ATOM   139  N  NZ  A LYS A 1 14 ? -2.331 22.599 23.551 0.60 31.21 ? 14   LYS A NZ  1 
ATOM   140  N  NZ  B LYS A 1 14 ? -3.680 20.974 23.736 0.40 24.12 ? 14   LYS A NZ  1 
ATOM   141  N  N   . ILE A 1 15 ? 0.291  24.610 19.231 1.00 5.14  ? 15   ILE A N   1 
ATOM   142  C  CA  . ILE A 1 15 ? 0.129  26.053 19.200 1.00 5.72  ? 15   ILE A CA  1 
ATOM   143  C  C   . ILE A 1 15 ? -1.022 26.365 18.227 1.00 5.41  ? 15   ILE A C   1 
ATOM   144  O  O   . ILE A 1 15 ? -1.104 25.815 17.148 1.00 6.05  ? 15   ILE A O   1 
ATOM   145  C  CB  . ILE A 1 15 ? 1.405  26.764 18.769 1.00 7.00  ? 15   ILE A CB  1 
ATOM   146  C  CG1 . ILE A 1 15 ? 1.193  28.299 18.694 1.00 8.78  ? 15   ILE A CG1 1 
ATOM   147  C  CG2 . ILE A 1 15 ? 1.965  26.238 17.439 1.00 7.90  ? 15   ILE A CG2 1 
ATOM   148  C  CD1 . ILE A 1 15 ? 2.420  29.114 18.400 1.00 10.54 ? 15   ILE A CD1 1 
ATOM   149  N  N   . GLY A 1 16 ? -1.917 27.271 18.664 1.00 6.41  ? 16   GLY A N   1 
ATOM   150  C  CA  . GLY A 1 16 ? -3.043 27.635 17.809 1.00 6.98  ? 16   GLY A CA  1 
ATOM   151  C  C   . GLY A 1 16 ? -3.901 26.475 17.402 1.00 6.10  ? 16   GLY A C   1 
ATOM   152  O  O   . GLY A 1 16 ? -4.550 26.541 16.346 1.00 7.95  ? 16   GLY A O   1 
ATOM   153  N  N   . GLY A 1 17 ? -3.951 25.407 18.217 1.00 6.46  ? 17   GLY A N   1 
ATOM   154  C  CA  . GLY A 1 17 ? -4.711 24.222 17.910 1.00 7.27  ? 17   GLY A CA  1 
ATOM   155  C  C   . GLY A 1 17 ? -4.050 23.271 16.948 1.00 6.83  ? 17   GLY A C   1 
ATOM   156  O  O   . GLY A 1 17 ? -4.721 22.328 16.507 1.00 8.88  ? 17   GLY A O   1 
ATOM   157  N  N   . GLN A 1 18 ? -2.803 23.466 16.584 1.00 6.46  ? 18   GLN A N   1 
ATOM   158  C  CA  . GLN A 1 18 ? -2.087 22.642 15.647 1.00 7.43  ? 18   GLN A CA  1 
ATOM   159  C  C   . GLN A 1 18 ? -0.867 22.010 16.288 1.00 7.02  ? 18   GLN A C   1 
ATOM   160  O  O   . GLN A 1 18 ? -0.187 22.655 17.076 1.00 7.60  ? 18   GLN A O   1 
ATOM   161  C  CB  . GLN A 1 18 ? -1.571 23.480 14.456 1.00 9.53  ? 18   GLN A CB  1 
ATOM   162  C  CG  A GLN A 1 18 ? -2.771 24.181 13.819 0.37 13.16 ? 18   GLN A CG  1 
ATOM   163  C  CG  B GLN A 1 18 ? -2.677 24.063 13.610 0.63 10.79 ? 18   GLN A CG  1 
ATOM   164  C  CD  A GLN A 1 18 ? -3.773 23.204 13.224 0.37 13.45 ? 18   GLN A CD  1 
ATOM   165  C  CD  B GLN A 1 18 ? -2.091 24.690 12.342 0.63 10.65 ? 18   GLN A CD  1 
ATOM   166  O  OE1 A GLN A 1 18 ? -3.419 22.040 12.997 0.37 29.84 ? 18   GLN A OE1 1 
ATOM   167  O  OE1 B GLN A 1 18 ? -1.106 25.444 12.425 0.63 12.30 ? 18   GLN A OE1 1 
ATOM   168  N  NE2 A GLN A 1 18 ? -4.978 23.674 12.954 0.37 23.18 ? 18   GLN A NE2 1 
ATOM   169  N  NE2 B GLN A 1 18 ? -2.673 24.351 11.221 0.63 17.00 ? 18   GLN A NE2 1 
ATOM   170  N  N   . LEU A 1 19 ? -0.587 20.780 15.891 1.00 7.17  ? 19   LEU A N   1 
ATOM   171  C  CA  . LEU A 1 19 ? 0.646  20.128 16.314 1.00 6.71  ? 19   LEU A CA  1 
ATOM   172  C  C   . LEU A 1 19 ? 1.730  20.344 15.276 1.00 7.69  ? 19   LEU A C   1 
ATOM   173  O  O   . LEU A 1 19 ? 1.489  20.270 14.049 1.00 11.00 ? 19   LEU A O   1 
ATOM   174  C  CB  . LEU A 1 19 ? 0.446  18.616 16.489 1.00 7.50  ? 19   LEU A CB  1 
ATOM   175  C  CG  . LEU A 1 19 ? -0.513 18.193 17.582 1.00 8.79  ? 19   LEU A CG  1 
ATOM   176  C  CD1 . LEU A 1 19 ? -0.406 16.668 17.797 1.00 11.33 ? 19   LEU A CD1 1 
ATOM   177  C  CD2 . LEU A 1 19 ? -0.293 18.884 18.899 1.00 12.24 ? 19   LEU A CD2 1 
ATOM   178  N  N   . LYS A 1 20 ? 2.935  20.645 15.736 1.00 7.73  ? 20   LYS A N   1 
ATOM   179  C  CA  . LYS A 1 20 ? 4.087  20.910 14.928 1.00 8.03  ? 20   LYS A CA  1 
ATOM   180  C  C   . LYS A 1 20 ? 5.293  20.263 15.595 1.00 6.92  ? 20   LYS A C   1 
ATOM   181  O  O   . LYS A 1 20 ? 5.283  19.947 16.762 1.00 8.13  ? 20   LYS A O   1 
ATOM   182  C  CB  . LYS A 1 20 ? 4.332  22.428 14.817 1.00 9.03  ? 20   LYS A CB  1 
ATOM   183  C  CG  . LYS A 1 20 ? 3.158  23.166 14.215 1.00 11.74 ? 20   LYS A CG  1 
ATOM   184  C  CD  A LYS A 1 20 ? 3.505  24.629 14.031 0.59 13.05 ? 20   LYS A CD  1 
ATOM   185  C  CD  B LYS A 1 20 ? 3.234  24.660 14.451 0.41 14.13 ? 20   LYS A CD  1 
ATOM   186  C  CE  A LYS A 1 20 ? 2.180  25.403 14.017 0.59 13.28 ? 20   LYS A CE  1 
ATOM   187  C  CE  B LYS A 1 20 ? 3.576  25.318 13.120 0.41 16.73 ? 20   LYS A CE  1 
ATOM   188  N  NZ  A LYS A 1 20 ? 1.566  25.080 12.699 0.59 13.86 ? 20   LYS A NZ  1 
ATOM   189  N  NZ  B LYS A 1 20 ? 2.476  25.143 12.123 0.41 22.53 ? 20   LYS A NZ  1 
ATOM   190  N  N   . GLU A 1 21 ? 6.370  20.119 14.816 1.00 7.58  ? 21   GLU A N   1 
ATOM   191  C  CA  . GLU A 1 21 ? 7.669  19.761 15.364 1.00 7.26  ? 21   GLU A CA  1 
ATOM   192  C  C   . GLU A 1 21 ? 8.550  21.002 15.510 1.00 6.01  ? 21   GLU A C   1 
ATOM   193  O  O   . GLU A 1 21 ? 8.567  21.821 14.585 1.00 8.03  ? 21   GLU A O   1 
ATOM   194  C  CB  . GLU A 1 21 ? 8.362  18.727 14.486 1.00 9.17  ? 21   GLU A CB  1 
ATOM   195  C  CG  . GLU A 1 21 ? 7.601  17.393 14.437 1.00 13.41 ? 21   GLU A CG  1 
ATOM   196  C  CD  . GLU A 1 21 ? 7.509  16.718 15.782 1.00 16.42 ? 21   GLU A CD  1 
ATOM   197  O  OE1 . GLU A 1 21 ? 6.331  16.493 16.172 1.00 21.76 ? 21   GLU A OE1 1 
ATOM   198  O  OE2 . GLU A 1 21 ? 8.551  16.389 16.426 1.00 24.60 ? 21   GLU A OE2 1 
ATOM   199  N  N   . ALA A 1 22 ? 9.288  21.136 16.592 1.00 5.58  ? 22   ALA A N   1 
ATOM   200  C  CA  . ALA A 1 22 ? 10.088 22.324 16.846 1.00 5.05  ? 22   ALA A CA  1 
ATOM   201  C  C   . ALA A 1 22 ? 11.375 21.960 17.546 1.00 5.14  ? 22   ALA A C   1 
ATOM   202  O  O   . ALA A 1 22 ? 11.449 21.019 18.321 1.00 6.46  ? 22   ALA A O   1 
ATOM   203  C  CB  . ALA A 1 22 ? 9.327  23.344 17.671 1.00 5.59  ? 22   ALA A CB  1 
ATOM   204  N  N   . LEU A 1 23 ? 12.379 22.788 17.319 1.00 4.51  ? 23   LEU A N   1 
ATOM   205  C  CA  . LEU A 1 23 ? 13.677 22.657 17.942 1.00 5.19  ? 23   LEU A CA  1 
ATOM   206  C  C   . LEU A 1 23 ? 13.736 23.266 19.320 1.00 5.77  ? 23   LEU A C   1 
ATOM   207  O  O   . LEU A 1 23 ? 13.323 24.418 19.506 1.00 8.08  ? 23   LEU A O   1 
ATOM   208  C  CB  . LEU A 1 23 ? 14.740 23.459 17.176 1.00 6.85  ? 23   LEU A CB  1 
ATOM   209  C  CG  . LEU A 1 23 ? 15.092 22.961 15.822 1.00 8.38  ? 23   LEU A CG  1 
ATOM   210  C  CD1 . LEU A 1 23 ? 15.860 24.032 15.059 1.00 9.96  ? 23   LEU A CD1 1 
ATOM   211  C  CD2 . LEU A 1 23 ? 15.967 21.693 15.926 1.00 11.83 ? 23   LEU A CD2 1 
ATOM   212  N  N   . LEU A 1 24 ? 14.261 22.574 20.316 1.00 5.18  ? 24   LEU A N   1 
ATOM   213  C  CA  . LEU A 1 24 ? 14.603 23.163 21.615 1.00 5.63  ? 24   LEU A CA  1 
ATOM   214  C  C   . LEU A 1 24 ? 15.936 23.889 21.421 1.00 5.74  ? 24   LEU A C   1 
ATOM   215  O  O   . LEU A 1 24 ? 16.959 23.219 21.279 1.00 7.13  ? 24   LEU A O   1 
ATOM   216  C  CB  . LEU A 1 24 ? 14.673 22.079 22.664 1.00 7.26  ? 24   LEU A CB  1 
ATOM   217  C  CG  . LEU A 1 24 ? 13.378 21.287 22.917 1.00 7.73  ? 24   LEU A CG  1 
ATOM   218  C  CD1 . LEU A 1 24 ? 13.640 20.260 24.021 1.00 13.76 ? 24   LEU A CD1 1 
ATOM   219  C  CD2 . LEU A 1 24 ? 12.200 22.195 23.229 1.00 10.28 ? 24   LEU A CD2 1 
ATOM   220  N  N   . ASP A 1 25 ? 15.920 25.221 21.387 1.00 5.18  ? 25   ASP A N   1 
ATOM   221  C  CA  . ASP A 1 25 ? 17.067 25.992 20.910 1.00 5.15  ? 25   ASP A CA  1 
ATOM   222  C  C   . ASP A 1 25 ? 17.602 26.965 21.956 1.00 5.08  ? 25   ASP A C   1 
ATOM   223  O  O   . ASP A 1 25 ? 17.087 28.080 22.132 1.00 5.20  ? 25   ASP A O   1 
ATOM   224  C  CB  . ASP A 1 25 ? 16.655 26.766 19.664 1.00 5.64  ? 25   ASP A CB  1 
ATOM   225  C  CG  . ASP A 1 25 ? 17.851 27.355 19.004 1.00 6.35  ? 25   ASP A CG  1 
ATOM   226  O  OD1 . ASP A 1 25 ? 18.989 27.267 19.563 1.00 6.78  ? 25   ASP A OD1 1 
ATOM   227  O  OD2 . ASP A 1 25 ? 17.670 27.886 17.874 1.00 7.71  ? 25   ASP A OD2 1 
ATOM   228  N  N   . THR A 1 26 ? 18.664 26.569 22.634 1.00 4.77  ? 26   THR A N   1 
ATOM   229  C  CA  . THR A 1 26 ? 19.310 27.422 23.596 1.00 4.63  ? 26   THR A CA  1 
ATOM   230  C  C   . THR A 1 26 ? 19.951 28.660 23.000 1.00 4.72  ? 26   THR A C   1 
ATOM   231  O  O   . THR A 1 26 ? 20.224 29.589 23.750 1.00 5.54  ? 26   THR A O   1 
ATOM   232  C  CB  . THR A 1 26 ? 20.379 26.622 24.345 1.00 4.65  ? 26   THR A CB  1 
ATOM   233  O  OG1 . THR A 1 26 ? 21.405 26.181 23.453 1.00 4.64  ? 26   THR A OG1 1 
ATOM   234  C  CG2 . THR A 1 26 ? 19.777 25.386 25.056 1.00 5.70  ? 26   THR A CG2 1 
ATOM   235  N  N   . GLY A 1 27 ? 20.188 28.662 21.701 1.00 4.87  ? 27   GLY A N   1 
ATOM   236  C  CA  . GLY A 1 27 ? 20.793 29.812 21.032 1.00 5.42  ? 27   GLY A CA  1 
ATOM   237  C  C   . GLY A 1 27 ? 19.790 30.885 20.629 1.00 5.16  ? 27   GLY A C   1 
ATOM   238  O  O   . GLY A 1 27 ? 20.207 31.897 20.058 1.00 7.30  ? 27   GLY A O   1 
ATOM   239  N  N   . ALA A 1 28 ? 18.500 30.679 20.853 1.00 5.17  ? 28   ALA A N   1 
ATOM   240  C  CA  . ALA A 1 28 ? 17.474 31.613 20.436 1.00 5.46  ? 28   ALA A CA  1 
ATOM   241  C  C   . ALA A 1 28 ? 16.896 32.318 21.667 1.00 5.30  ? 28   ALA A C   1 
ATOM   242  O  O   . ALA A 1 28 ? 16.441 31.680 22.607 1.00 6.03  ? 28   ALA A O   1 
ATOM   243  C  CB  . ALA A 1 28 ? 16.376 30.873 19.715 1.00 6.04  ? 28   ALA A CB  1 
ATOM   244  N  N   . ASP A 1 29 ? 16.908 33.655 21.651 1.00 5.85  ? 29   ASP A N   1 
ATOM   245  C  CA  . ASP A 1 29 ? 16.300 34.388 22.782 1.00 6.21  ? 29   ASP A CA  1 
ATOM   246  C  C   . ASP A 1 29 ? 14.801 34.171 22.839 1.00 6.34  ? 29   ASP A C   1 
ATOM   247  O  O   . ASP A 1 29 ? 14.201 34.106 23.925 1.00 8.44  ? 29   ASP A O   1 
ATOM   248  C  CB  . ASP A 1 29 ? 16.565 35.895 22.645 1.00 7.99  ? 29   ASP A CB  1 
ATOM   249  C  CG  . ASP A 1 29 ? 17.996 36.336 22.759 1.00 9.37  ? 29   ASP A CG  1 
ATOM   250  O  OD1 . ASP A 1 29 ? 18.889 35.626 23.272 1.00 9.14  ? 29   ASP A OD1 1 
ATOM   251  O  OD2 . ASP A 1 29 ? 18.242 37.507 22.306 1.00 14.19 ? 29   ASP A OD2 1 
ATOM   252  N  N   . ASP A 1 30 ? 14.196 34.131 21.662 1.00 6.55  ? 30   ASP A N   1 
ATOM   253  C  CA  . ASP A 1 30 ? 12.749 34.159 21.458 1.00 7.85  ? 30   ASP A CA  1 
ATOM   254  C  C   . ASP A 1 30 ? 12.318 32.959 20.667 1.00 6.20  ? 30   ASP A C   1 
ATOM   255  O  O   . ASP A 1 30 ? 13.121 32.340 19.964 1.00 12.20 ? 30   ASP A O   1 
ATOM   256  C  CB  A ASP A 1 30 ? 12.410 35.386 20.577 0.57 12.66 ? 30   ASP A CB  1 
ATOM   257  C  CB  B ASP A 1 30 ? 12.361 35.553 20.902 0.43 15.92 ? 30   ASP A CB  1 
ATOM   258  C  CG  A ASP A 1 30 ? 13.042 36.697 20.888 0.57 13.33 ? 30   ASP A CG  1 
ATOM   259  C  CG  B ASP A 1 30 ? 12.790 36.646 21.883 0.43 19.12 ? 30   ASP A CG  1 
ATOM   260  O  OD1 A ASP A 1 30 ? 12.892 37.115 22.085 0.57 16.02 ? 30   ASP A OD1 1 
ATOM   261  O  OD1 B ASP A 1 30 ? 12.770 36.295 23.104 0.43 35.86 ? 30   ASP A OD1 1 
ATOM   262  O  OD2 A ASP A 1 30 ? 13.670 37.404 20.041 0.57 17.19 ? 30   ASP A OD2 1 
ATOM   263  O  OD2 B ASP A 1 30 ? 13.096 37.808 21.526 0.43 27.46 ? 30   ASP A OD2 1 
ATOM   264  N  N   . THR A 1 31 ? 11.075 32.618 20.724 1.00 6.61  ? 31   THR A N   1 
ATOM   265  C  CA  . THR A 1 31 ? 10.448 31.518 20.020 1.00 5.14  ? 31   THR A CA  1 
ATOM   266  C  C   . THR A 1 31 ? 9.918  32.024 18.680 1.00 4.75  ? 31   THR A C   1 
ATOM   267  O  O   . THR A 1 31 ? 9.228  33.066 18.645 1.00 5.74  ? 31   THR A O   1 
ATOM   268  C  CB  . THR A 1 31 ? 9.321  30.978 20.908 1.00 5.61  ? 31   THR A CB  1 
ATOM   269  O  OG1 . THR A 1 31 ? 9.943  30.370 22.062 1.00 6.16  ? 31   THR A OG1 1 
ATOM   270  C  CG2 . THR A 1 31 ? 8.476  29.937 20.207 1.00 5.87  ? 31   THR A CG2 1 
ATOM   271  N  N   . VAL A 1 32 ? 10.223 31.284 17.624 1.00 4.69  ? 32   VAL A N   1 
ATOM   272  C  CA  . VAL A 1 32 ? 9.873  31.646 16.261 1.00 5.22  ? 32   VAL A CA  1 
ATOM   273  C  C   . VAL A 1 32 ? 9.183  30.473 15.614 1.00 4.64  ? 32   VAL A C   1 
ATOM   274  O  O   . VAL A 1 32 ? 9.753  29.382 15.580 1.00 6.51  ? 32   VAL A O   1 
ATOM   275  C  CB  . VAL A 1 32 ? 11.098 32.064 15.443 1.00 7.95  ? 32   VAL A CB  1 
ATOM   276  C  CG1 . VAL A 1 32 ? 10.593 32.779 14.163 1.00 9.23  ? 32   VAL A CG1 1 
ATOM   277  C  CG2 . VAL A 1 32 ? 12.116 32.888 16.234 1.00 10.23 ? 32   VAL A CG2 1 
ATOM   278  N  N   . ILE A 1 33 ? 7.990  30.658 15.093 1.00 4.94  ? 33   ILE A N   1 
ATOM   279  C  CA  . ILE A 1 33 ? 7.183  29.624 14.487 1.00 5.22  ? 33   ILE A CA  1 
ATOM   280  C  C   . ILE A 1 33 ? 6.906  29.966 13.043 1.00 5.51  ? 33   ILE A C   1 
ATOM   281  O  O   . ILE A 1 33 ? 6.688  31.111 12.655 1.00 5.81  ? 33   ILE A O   1 
ATOM   282  C  CB  . ILE A 1 33 ? 5.869  29.435 15.298 1.00 7.09  ? 33   ILE A CB  1 
ATOM   283  C  CG1 . ILE A 1 33 ? 6.156  29.052 16.763 1.00 8.65  ? 33   ILE A CG1 1 
ATOM   284  C  CG2 . ILE A 1 33 ? 4.931  28.437 14.658 1.00 8.65  ? 33   ILE A CG2 1 
ATOM   285  C  CD1 . ILE A 1 33 ? 6.877  27.756 16.949 1.00 10.33 ? 33   ILE A CD1 1 
ATOM   286  N  N   . GLU A 1 34 ? 6.948  28.926 12.207 1.00 5.58  ? 34   GLU A N   1 
ATOM   287  C  CA  . GLU A 1 34 ? 6.670  29.000 10.791 1.00 6.33  ? 34   GLU A CA  1 
ATOM   288  C  C   . GLU A 1 34 ? 5.295  29.600 10.591 1.00 6.10  ? 34   GLU A C   1 
ATOM   289  O  O   . GLU A 1 34 ? 4.371  29.376 11.347 1.00 7.97  ? 34   GLU A O   1 
ATOM   290  C  CB  . GLU A 1 34 ? 6.778  27.592 10.169 1.00 8.65  ? 34   GLU A CB  1 
ATOM   291  C  CG  . GLU A 1 34 ? 8.227  27.008 10.220 1.00 11.23 ? 34   GLU A CG  1 
ATOM   292  C  CD  . GLU A 1 34 ? 8.319  25.562 9.820  1.00 16.77 ? 34   GLU A CD  1 
ATOM   293  O  OE1 . GLU A 1 34 ? 7.368  24.871 9.402  1.00 23.99 ? 34   GLU A OE1 1 
ATOM   294  O  OE2 . GLU A 1 34 ? 9.466  25.012 9.909  1.00 21.70 ? 34   GLU A OE2 1 
ATOM   295  N  N   . GLU A 1 35 ? 5.170  30.320 9.470  1.00 7.09  ? 35   GLU A N   1 
ATOM   296  C  CA  . GLU A 1 35 ? 3.974  31.054 9.104  1.00 6.35  ? 35   GLU A CA  1 
ATOM   297  C  C   . GLU A 1 35 ? 2.714  30.221 9.350  1.00 6.94  ? 35   GLU A C   1 
ATOM   298  O  O   . GLU A 1 35 ? 2.563  29.092 8.874  1.00 8.01  ? 35   GLU A O   1 
ATOM   299  C  CB  . GLU A 1 35 ? 4.044  31.474 7.641  1.00 8.26  ? 35   GLU A CB  1 
ATOM   300  C  CG  . GLU A 1 35 ? 2.764  32.152 7.192  1.00 11.84 ? 35   GLU A CG  1 
ATOM   301  C  CD  . GLU A 1 35 ? 2.417  33.416 7.938  1.00 12.65 ? 35   GLU A CD  1 
ATOM   302  O  OE1 . GLU A 1 35 ? 1.220  33.695 8.272  1.00 16.12 ? 35   GLU A OE1 1 
ATOM   303  O  OE2 . GLU A 1 35 ? 3.378  34.203 8.153  1.00 14.90 ? 35   GLU A OE2 1 
ATOM   304  N  N   . MET A 1 36 ? 1.809  30.821 10.097 1.00 7.13  ? 36   MET A N   1 
ATOM   305  C  CA  . MET A 1 36 ? 0.527  30.219 10.430 1.00 8.48  ? 36   MET A CA  1 
ATOM   306  C  C   . MET A 1 36 ? -0.416 31.350 10.744 1.00 8.93  ? 36   MET A C   1 
ATOM   307  O  O   . MET A 1 36 ? -0.022 32.422 11.197 1.00 9.88  ? 36   MET A O   1 
ATOM   308  C  CB  . MET A 1 36 ? 0.630  29.256 11.598 1.00 9.26  ? 36   MET A CB  1 
ATOM   309  C  CG  . MET A 1 36 ? 1.101  29.820 12.880 1.00 9.94  ? 36   MET A CG  1 
ATOM   310  S  SD  . MET A 1 36 ? 1.158  28.633 14.228 1.00 11.18 ? 36   MET A SD  1 
ATOM   311  C  CE  . MET A 1 36 ? -0.518 28.126 14.366 1.00 10.37 ? 36   MET A CE  1 
ATOM   312  N  N   . SER A 1 37 ? -1.701 31.124 10.527 1.00 11.19 ? 37   SER A N   1 
ATOM   313  C  CA  . SER A 1 37 ? -2.709 32.181 10.743 1.00 11.83 ? 37   SER A CA  1 
ATOM   314  C  C   . SER A 1 37 ? -3.245 32.260 12.165 1.00 12.14 ? 37   SER A C   1 
ATOM   315  O  O   . SER A 1 37 ? -4.411 31.925 12.491 1.00 14.28 ? 37   SER A O   1 
ATOM   316  C  CB  A SER A 1 37 ? -3.927 31.962 9.829  0.62 14.94 ? 37   SER A CB  1 
ATOM   317  C  CB  B SER A 1 37 ? -3.844 31.946 9.735  0.38 15.77 ? 37   SER A CB  1 
ATOM   318  O  OG  A SER A 1 37 ? -3.421 32.156 8.540  0.62 16.78 ? 37   SER A OG  1 
ATOM   319  O  OG  B SER A 1 37 ? -4.622 33.113 9.584  0.38 20.29 ? 37   SER A OG  1 
ATOM   320  N  N   . LEU A 1 38 ? -2.449 32.765 13.094 1.00 13.00 ? 38   LEU A N   1 
ATOM   321  C  CA  . LEU A 1 38 ? -2.852 32.961 14.471 1.00 11.79 ? 38   LEU A CA  1 
ATOM   322  C  C   . LEU A 1 38 ? -3.833 34.138 14.633 1.00 12.17 ? 38   LEU A C   1 
ATOM   323  O  O   . LEU A 1 38 ? -3.559 35.170 14.036 1.00 13.78 ? 38   LEU A O   1 
ATOM   324  C  CB  A LEU A 1 38 ? -1.590 33.187 15.288 0.45 16.00 ? 38   LEU A CB  1 
ATOM   325  C  CB  B LEU A 1 38 ? -1.762 33.254 15.490 0.55 13.27 ? 38   LEU A CB  1 
ATOM   326  C  CG  A LEU A 1 38 ? -1.457 32.502 16.632 0.45 9.85  ? 38   LEU A CG  1 
ATOM   327  C  CG  B LEU A 1 38 ? -0.817 32.141 15.878 0.55 11.63 ? 38   LEU A CG  1 
ATOM   328  C  CD1 A LEU A 1 38 ? -1.639 30.992 16.551 0.45 14.46 ? 38   LEU A CD1 1 
ATOM   329  C  CD1 B LEU A 1 38 ? 0.341  32.641 16.735 0.55 10.48 ? 38   LEU A CD1 1 
ATOM   330  C  CD2 A LEU A 1 38 ? -0.094 32.845 17.260 0.45 9.35  ? 38   LEU A CD2 1 
ATOM   331  C  CD2 B LEU A 1 38 ? -1.586 31.051 16.637 0.55 12.89 ? 38   LEU A CD2 1 
ATOM   332  N  N   . PRO A 1 39 ? -4.884 34.001 15.419 1.00 13.20 ? 39   PRO A N   1 
ATOM   333  C  CA  . PRO A 1 39 ? -5.747 35.135 15.691 1.00 14.74 ? 39   PRO A CA  1 
ATOM   334  C  C   . PRO A 1 39 ? -5.156 36.159 16.661 1.00 14.20 ? 39   PRO A C   1 
ATOM   335  O  O   . PRO A 1 39 ? -4.293 35.847 17.463 1.00 19.14 ? 39   PRO A O   1 
ATOM   336  C  CB  . PRO A 1 39 ? -6.978 34.497 16.329 1.00 15.60 ? 39   PRO A CB  1 
ATOM   337  C  CG  . PRO A 1 39 ? -6.575 33.162 16.836 1.00 14.71 ? 39   PRO A CG  1 
ATOM   338  C  CD  . PRO A 1 39 ? -5.342 32.752 16.083 1.00 15.56 ? 39   PRO A CD  1 
ATOM   339  N  N   . GLY A 1 40 ? -5.716 37.361 16.561 1.00 18.26 ? 40   GLY A N   1 
ATOM   340  C  CA  . GLY A 1 40 ? -5.478 38.414 17.499 1.00 18.92 ? 40   GLY A CA  1 
ATOM   341  C  C   . GLY A 1 40 ? -4.423 39.424 17.044 1.00 16.06 ? 40   GLY A C   1 
ATOM   342  O  O   . GLY A 1 40 ? -3.883 39.407 15.959 1.00 14.38 ? 40   GLY A O   1 
ATOM   343  N  N   . ARG A 1 41 ? -4.188 40.350 17.964 1.00 16.70 ? 41   ARG A N   1 
ATOM   344  C  CA  . ARG A 1 41 ? -3.276 41.442 17.647 1.00 15.48 ? 41   ARG A CA  1 
ATOM   345  C  C   . ARG A 1 41 ? -1.802 41.030 17.794 1.00 12.27 ? 41   ARG A C   1 
ATOM   346  O  O   . ARG A 1 41 ? -1.387 40.140 18.538 1.00 12.71 ? 41   ARG A O   1 
ATOM   347  C  CB  A ARG A 1 41 ? -3.592 42.653 18.516 0.58 16.23 ? 41   ARG A CB  1 
ATOM   348  C  CB  B ARG A 1 41 ? -3.490 42.652 18.555 0.42 18.37 ? 41   ARG A CB  1 
ATOM   349  C  CG  A ARG A 1 41 ? -4.968 43.275 18.206 0.58 17.85 ? 41   ARG A CG  1 
ATOM   350  C  CG  B ARG A 1 41 ? -4.918 43.047 18.899 0.42 23.06 ? 41   ARG A CG  1 
ATOM   351  C  CD  A ARG A 1 41 ? -5.171 44.499 19.083 0.58 16.70 ? 41   ARG A CD  1 
ATOM   352  C  CD  B ARG A 1 41 ? -5.088 43.204 20.409 0.42 30.30 ? 41   ARG A CD  1 
ATOM   353  N  NE  A ARG A 1 41 ? -4.297 45.553 18.575 0.58 19.18 ? 41   ARG A NE  1 
ATOM   354  N  NE  B ARG A 1 41 ? -4.569 42.026 21.129 0.42 37.46 ? 41   ARG A NE  1 
ATOM   355  C  CZ  A ARG A 1 41 ? -3.791 46.553 19.283 0.58 23.90 ? 41   ARG A CZ  1 
ATOM   356  C  CZ  B ARG A 1 41 ? -5.337 41.271 21.911 0.42 43.65 ? 41   ARG A CZ  1 
ATOM   357  N  NH1 A ARG A 1 41 ? -4.059 46.675 20.577 0.58 34.58 ? 41   ARG A NH1 1 
ATOM   358  N  NH1 B ARG A 1 41 ? -6.630 41.571 22.063 0.42 51.40 ? 41   ARG A NH1 1 
ATOM   359  N  NH2 A ARG A 1 41 ? -3.013 47.415 18.636 0.58 28.89 ? 41   ARG A NH2 1 
ATOM   360  N  NH2 B ARG A 1 41 ? -4.829 40.213 22.539 0.42 61.01 ? 41   ARG A NH2 1 
ATOM   361  N  N   . TRP A 1 42 ? -1.000 41.727 17.070 1.00 9.84  ? 42   TRP A N   1 
ATOM   362  C  CA  . TRP A 1 42 ? 0.423  41.477 16.914 1.00 7.50  ? 42   TRP A CA  1 
ATOM   363  C  C   . TRP A 1 42 ? 1.121  42.798 16.627 1.00 7.27  ? 42   TRP A C   1 
ATOM   364  O  O   . TRP A 1 42 ? 0.497  43.783 16.285 1.00 8.97  ? 42   TRP A O   1 
ATOM   365  C  CB  . TRP A 1 42 ? 0.675  40.447 15.828 1.00 8.08  ? 42   TRP A CB  1 
ATOM   366  C  CG  . TRP A 1 42 ? 0.111  40.825 14.500 1.00 10.27 ? 42   TRP A CG  1 
ATOM   367  C  CD1 . TRP A 1 42 ? -1.165 40.600 14.039 1.00 13.69 ? 42   TRP A CD1 1 
ATOM   368  C  CD2 . TRP A 1 42 ? 0.792  41.510 13.450 1.00 9.53  ? 42   TRP A CD2 1 
ATOM   369  N  NE1 . TRP A 1 42 ? -1.280 41.110 12.772 1.00 15.62 ? 42   TRP A NE1 1 
ATOM   370  C  CE2 . TRP A 1 42 ? -0.099 41.672 12.380 1.00 12.08 ? 42   TRP A CE2 1 
ATOM   371  C  CE3 . TRP A 1 42 ? 2.088  42.012 13.304 1.00 8.62  ? 42   TRP A CE3 1 
ATOM   372  C  CZ2 . TRP A 1 42 ? 0.230  42.296 11.183 1.00 13.62 ? 42   TRP A CZ2 1 
ATOM   373  C  CZ3 . TRP A 1 42 ? 2.425  42.627 12.115 1.00 10.89 ? 42   TRP A CZ3 1 
ATOM   374  C  CH2 . TRP A 1 42 ? 1.508  42.770 11.070 1.00 12.72 ? 42   TRP A CH2 1 
ATOM   375  N  N   . LYS A 1 43 ? 2.433  42.754 16.747 1.00 6.71  ? 43   LYS A N   1 
ATOM   376  C  CA  . LYS A 1 43 ? 3.287  43.909 16.473 1.00 8.39  ? 43   LYS A CA  1 
ATOM   377  C  C   . LYS A 1 43 ? 4.411  43.459 15.550 1.00 6.13  ? 43   LYS A C   1 
ATOM   378  O  O   . LYS A 1 43 ? 4.986  42.403 15.741 1.00 6.52  ? 43   LYS A O   1 
ATOM   379  C  CB  . LYS A 1 43 ? 3.892  44.504 17.728 1.00 14.89 ? 43   LYS A CB  1 
ATOM   380  C  CG  . LYS A 1 43 ? 4.906  45.595 17.763 1.00 17.23 ? 43   LYS A CG  1 
ATOM   381  C  CD  A LYS A 1 43 ? 5.247  46.148 19.144 0.40 16.46 ? 43   LYS A CD  1 
ATOM   382  C  CD  B LYS A 1 43 ? 5.326  45.818 19.213 0.60 17.73 ? 43   LYS A CD  1 
ATOM   383  C  CE  A LYS A 1 43 ? 5.909  47.513 19.058 0.40 14.46 ? 43   LYS A CE  1 
ATOM   384  C  CE  B LYS A 1 43 ? 5.959  44.615 19.888 0.60 30.46 ? 43   LYS A CE  1 
ATOM   385  N  NZ  A LYS A 1 43 ? 6.205  48.218 20.352 0.40 21.84 ? 43   LYS A NZ  1 
ATOM   386  N  NZ  B LYS A 1 43 ? 5.775  44.710 21.378 0.60 37.76 ? 43   LYS A NZ  1 
ATOM   387  N  N   . PRO A 1 44 ? 4.774  44.270 14.565 1.00 7.02  ? 44   PRO A N   1 
ATOM   388  C  CA  . PRO A 1 44 ? 5.880  43.910 13.678 1.00 7.68  ? 44   PRO A CA  1 
ATOM   389  C  C   . PRO A 1 44 ? 7.217  43.857 14.422 1.00 6.05  ? 44   PRO A C   1 
ATOM   390  O  O   . PRO A 1 44 ? 7.478  44.660 15.306 1.00 6.69  ? 44   PRO A O   1 
ATOM   391  C  CB  . PRO A 1 44 ? 5.840  45.045 12.648 1.00 13.07 ? 44   PRO A CB  1 
ATOM   392  C  CG  . PRO A 1 44 ? 4.652  45.796 12.847 1.00 13.04 ? 44   PRO A CG  1 
ATOM   393  C  CD  . PRO A 1 44 ? 4.117  45.545 14.175 1.00 9.14  ? 44   PRO A CD  1 
ATOM   394  N  N   . LYS A 1 45 ? 8.075  42.944 14.008 1.00 6.30  ? 45   LYS A N   1 
ATOM   395  C  CA  . LYS A 1 45 ? 9.418  42.802 14.528 1.00 5.79  ? 45   LYS A CA  1 
ATOM   396  C  C   . LYS A 1 45 ? 10.329 42.313 13.412 1.00 5.47  ? 45   LYS A C   1 
ATOM   397  O  O   . LYS A 1 45 ? 9.875  41.649 12.471 1.00 6.97  ? 45   LYS A O   1 
ATOM   398  C  CB  . LYS A 1 45 ? 9.398  41.806 15.700 1.00 6.91  ? 45   LYS A CB  1 
ATOM   399  C  CG  . LYS A 1 45 ? 10.677 41.738 16.561 1.00 7.94  ? 45   LYS A CG  1 
ATOM   400  C  CD  . LYS A 1 45 ? 10.492 40.841 17.771 1.00 10.72 ? 45   LYS A CD  1 
ATOM   401  C  CE  . LYS A 1 45 ? 11.761 40.560 18.494 1.00 14.56 ? 45   LYS A CE  1 
ATOM   402  N  NZ  . LYS A 1 45 ? 12.194 41.653 19.358 1.00 19.64 ? 45   LYS A NZ  1 
ATOM   403  N  N   . MET A 1 46 ? 11.623 42.589 13.509 1.00 4.86  ? 46   MET A N   1 
ATOM   404  C  CA  . MET A 1 46 ? 12.643 41.994 12.676 1.00 5.28  ? 46   MET A CA  1 
ATOM   405  C  C   . MET A 1 46 ? 13.633 41.274 13.565 1.00 5.23  ? 46   MET A C   1 
ATOM   406  O  O   . MET A 1 46 ? 14.070 41.811 14.586 1.00 7.80  ? 46   MET A O   1 
ATOM   407  C  CB  A MET A 1 46 ? 13.485 43.105 11.998 0.47 6.51  ? 46   MET A CB  1 
ATOM   408  C  CB  B MET A 1 46 ? 13.245 43.061 11.719 0.53 5.95  ? 46   MET A CB  1 
ATOM   409  C  CG  A MET A 1 46 ? 12.723 43.782 10.894 0.47 7.71  ? 46   MET A CG  1 
ATOM   410  C  CG  B MET A 1 46 ? 12.256 43.322 10.573 0.53 4.91  ? 46   MET A CG  1 
ATOM   411  S  SD  A MET A 1 46 ? 12.888 42.842 9.374  0.47 9.63  ? 46   MET A SD  1 
ATOM   412  S  SD  B MET A 1 46 ? 12.849 44.611 9.427  0.53 5.49  ? 46   MET A SD  1 
ATOM   413  C  CE  A MET A 1 46 ? 14.412 43.558 8.727  0.47 11.74 ? 46   MET A CE  1 
ATOM   414  C  CE  B MET A 1 46 ? 14.334 43.862 8.780  0.53 7.45  ? 46   MET A CE  1 
ATOM   415  N  N   . ILE A 1 47 ? 13.997 40.046 13.172 1.00 5.14  ? 47   ILE A N   1 
ATOM   416  C  CA  . ILE A 1 47 ? 14.975 39.258 13.916 1.00 5.47  ? 47   ILE A CA  1 
ATOM   417  C  C   . ILE A 1 47 ? 16.056 38.791 12.978 1.00 5.59  ? 47   ILE A C   1 
ATOM   418  O  O   . ILE A 1 47 ? 15.783 38.501 11.812 1.00 6.43  ? 47   ILE A O   1 
ATOM   419  C  CB  . ILE A 1 47 ? 14.332 38.096 14.684 1.00 6.35  ? 47   ILE A CB  1 
ATOM   420  C  CG1 . ILE A 1 47 ? 13.638 37.106 13.756 1.00 6.69  ? 47   ILE A CG1 1 
ATOM   421  C  CG2 . ILE A 1 47 ? 13.462 38.619 15.816 1.00 8.21  ? 47   ILE A CG2 1 
ATOM   422  C  CD1 . ILE A 1 47 ? 13.130 35.826 14.455 1.00 8.31  ? 47   ILE A CD1 1 
ATOM   423  N  N   . GLY A 1 48 ? 17.281 38.757 13.495 1.00 6.52  ? 48   GLY A N   1 
ATOM   424  C  CA  . GLY A 1 48 ? 18.445 38.497 12.685 1.00 7.42  ? 48   GLY A CA  1 
ATOM   425  C  C   . GLY A 1 48 ? 19.226 37.289 13.094 1.00 6.32  ? 48   GLY A C   1 
ATOM   426  O  O   . GLY A 1 48 ? 19.409 37.010 14.283 1.00 8.71  ? 48   GLY A O   1 
ATOM   427  N  N   . GLY A 1 49 ? 19.757 36.581 12.142 1.00 6.27  ? 49   GLY A N   1 
ATOM   428  C  CA  . GLY A 1 49 ? 20.648 35.454 12.378 1.00 6.91  ? 49   GLY A CA  1 
ATOM   429  C  C   . GLY A 1 49 ? 21.581 35.279 11.233 1.00 6.46  ? 49   GLY A C   1 
ATOM   430  O  O   . GLY A 1 49 ? 21.861 36.222 10.457 1.00 6.82  ? 49   GLY A O   1 
ATOM   431  N  N   . ILE A 1 50 ? 22.101 34.069 11.030 1.00 7.08  ? 50   ILE A N   1 
ATOM   432  C  CA  . ILE A 1 50 ? 22.955 33.813 9.891  1.00 7.27  ? 50   ILE A CA  1 
ATOM   433  C  C   . ILE A 1 50 ? 22.162 34.082 8.625  1.00 7.39  ? 50   ILE A C   1 
ATOM   434  O  O   . ILE A 1 50 ? 21.024 33.577 8.469  1.00 8.04  ? 50   ILE A O   1 
ATOM   435  C  CB  . ILE A 1 50 ? 23.541 32.404 9.977  1.00 7.95  ? 50   ILE A CB  1 
ATOM   436  C  CG1 . ILE A 1 50 ? 24.600 32.334 11.092 1.00 8.26  ? 50   ILE A CG1 1 
ATOM   437  C  CG2 . ILE A 1 50 ? 24.095 31.972 8.623  1.00 8.66  ? 50   ILE A CG2 1 
ATOM   438  C  CD1 . ILE A 1 50 ? 25.030 30.941 11.491 1.00 9.92  ? 50   ILE A CD1 1 
ATOM   439  N  N   . GLY A 1 51 ? 22.748 34.888 7.749  1.00 8.48  ? 51   GLY A N   1 
ATOM   440  C  CA  . GLY A 1 51 ? 22.093 35.248 6.539  1.00 8.55  ? 51   GLY A CA  1 
ATOM   441  C  C   . GLY A 1 51 ? 21.325 36.536 6.545  1.00 9.23  ? 51   GLY A C   1 
ATOM   442  O  O   . GLY A 1 51 ? 20.943 37.028 5.483  1.00 15.30 ? 51   GLY A O   1 
ATOM   443  N  N   . GLY A 1 52 ? 21.106 37.120 7.706  1.00 7.08  ? 52   GLY A N   1 
ATOM   444  C  CA  . GLY A 1 52 ? 20.408 38.372 7.835  1.00 8.03  ? 52   GLY A CA  1 
ATOM   445  C  C   . GLY A 1 52 ? 19.083 38.274 8.582  1.00 6.39  ? 52   GLY A C   1 
ATOM   446  O  O   . GLY A 1 52 ? 18.901 37.402 9.430  1.00 7.47  ? 52   GLY A O   1 
ATOM   447  N  N   . PHE A 1 53 ? 18.199 39.200 8.297  1.00 6.70  ? 53   PHE A N   1 
ATOM   448  C  CA  . PHE A 1 53 ? 16.962 39.387 9.061  1.00 6.11  ? 53   PHE A CA  1 
ATOM   449  C  C   . PHE A 1 53 ? 15.753 38.869 8.312  1.00 7.18  ? 53   PHE A C   1 
ATOM   450  O  O   . PHE A 1 53 ? 15.698 38.887 7.107  1.00 9.52  ? 53   PHE A O   1 
ATOM   451  C  CB  . PHE A 1 53 ? 16.778 40.878 9.387  1.00 7.34  ? 53   PHE A CB  1 
ATOM   452  C  CG  . PHE A 1 53 ? 17.693 41.369 10.490 1.00 6.33  ? 53   PHE A CG  1 
ATOM   453  C  CD1 . PHE A 1 53 ? 19.023 41.600 10.264 1.00 6.97  ? 53   PHE A CD1 1 
ATOM   454  C  CD2 . PHE A 1 53 ? 17.196 41.590 11.753 1.00 6.44  ? 53   PHE A CD2 1 
ATOM   455  C  CE1 . PHE A 1 53 ? 19.850 42.042 11.287 1.00 8.79  ? 53   PHE A CE1 1 
ATOM   456  C  CE2 . PHE A 1 53 ? 18.011 42.026 12.791 1.00 7.73  ? 53   PHE A CE2 1 
ATOM   457  C  CZ  . PHE A 1 53 ? 19.359 42.233 12.553 1.00 8.58  ? 53   PHE A CZ  1 
ATOM   458  N  N   . ILE A 1 54 ? 14.737 38.482 9.108  1.00 6.94  ? 54   ILE A N   1 
ATOM   459  C  CA  . ILE A 1 54 ? 13.398 38.228 8.606  1.00 7.24  ? 54   ILE A CA  1 
ATOM   460  C  C   . ILE A 1 54 ? 12.398 39.078 9.406  1.00 6.00  ? 54   ILE A C   1 
ATOM   461  O  O   . ILE A 1 54 ? 12.611 39.416 10.552 1.00 6.75  ? 54   ILE A O   1 
ATOM   462  C  CB  . ILE A 1 54 ? 12.994 36.747 8.632  1.00 7.89  ? 54   ILE A CB  1 
ATOM   463  C  CG1 . ILE A 1 54 ? 12.962 36.171 10.051 1.00 8.31  ? 54   ILE A CG1 1 
ATOM   464  C  CG2 . ILE A 1 54 ? 13.894 35.923 7.733  1.00 11.01 ? 54   ILE A CG2 1 
ATOM   465  C  CD1 . ILE A 1 54 ? 12.245 34.835 10.178 1.00 10.40 ? 54   ILE A CD1 1 
ATOM   466  N  N   . LYS A 1 55 ? 11.325 39.386 8.728  1.00 5.80  ? 55   LYS A N   1 
ATOM   467  C  CA  . LYS A 1 55 ? 10.188 40.087 9.309  1.00 5.64  ? 55   LYS A CA  1 
ATOM   468  C  C   . LYS A 1 55 ? 9.236  39.086 9.919  1.00 5.43  ? 55   LYS A C   1 
ATOM   469  O  O   . LYS A 1 55 ? 8.843  38.120 9.230  1.00 7.04  ? 55   LYS A O   1 
ATOM   470  C  CB  . LYS A 1 55 ? 9.510  40.934 8.231  1.00 7.67  ? 55   LYS A CB  1 
ATOM   471  C  CG  . LYS A 1 55 ? 10.280 42.036 7.529  1.00 15.53 ? 55   LYS A CG  1 
ATOM   472  C  CD  . LYS A 1 55 ? 9.502  42.648 6.344  1.00 23.41 ? 55   LYS A CD  1 
ATOM   473  C  CE  . LYS A 1 55 ? 10.337 43.814 5.807  1.00 27.40 ? 55   LYS A CE  1 
ATOM   474  N  NZ  . LYS A 1 55 ? 10.854 43.528 4.466  1.00 39.83 ? 55   LYS A NZ  1 
ATOM   475  N  N   . VAL A 1 56 ? 8.822  39.328 11.146 1.00 5.27  ? 56   VAL A N   1 
ATOM   476  C  CA  . VAL A 1 56 ? 7.924  38.442 11.859 1.00 5.15  ? 56   VAL A CA  1 
ATOM   477  C  C   . VAL A 1 56 ? 6.822  39.247 12.539 1.00 5.20  ? 56   VAL A C   1 
ATOM   478  O  O   . VAL A 1 56 ? 6.925  40.459 12.739 1.00 7.07  ? 56   VAL A O   1 
ATOM   479  C  CB  . VAL A 1 56 ? 8.678  37.557 12.883 1.00 6.04  ? 56   VAL A CB  1 
ATOM   480  C  CG1 . VAL A 1 56 ? 9.657  36.646 12.173 1.00 7.96  ? 56   VAL A CG1 1 
ATOM   481  C  CG2 . VAL A 1 56 ? 9.376  38.422 13.904 1.00 7.91  ? 56   VAL A CG2 1 
ATOM   482  N  N   . ARG A 1 57 ? 5.772  38.568 12.938 1.00 5.31  ? 57   ARG A N   1 
ATOM   483  C  CA  . ARG A 1 57 ? 4.671  39.094 13.734 1.00 5.59  ? 57   ARG A CA  1 
ATOM   484  C  C   . ARG A 1 57 ? 4.862  38.657 15.165 1.00 5.30  ? 57   ARG A C   1 
ATOM   485  O  O   . ARG A 1 57 ? 4.947  37.442 15.431 1.00 6.25  ? 57   ARG A O   1 
ATOM   486  C  CB  . ARG A 1 57 ? 3.336  38.606 13.206 1.00 6.01  ? 57   ARG A CB  1 
ATOM   487  C  CG  . ARG A 1 57 ? 3.102  38.997 11.752 1.00 7.78  ? 57   ARG A CG  1 
ATOM   488  C  CD  . ARG A 1 57 ? 1.691  38.738 11.322 1.00 9.89  ? 57   ARG A CD  1 
ATOM   489  N  NE  . ARG A 1 57 ? 1.182  37.395 11.444 1.00 10.42 ? 57   ARG A NE  1 
ATOM   490  C  CZ  . ARG A 1 57 ? 1.495  36.393 10.596 1.00 10.62 ? 57   ARG A CZ  1 
ATOM   491  N  NH1 . ARG A 1 57 ? 2.340  36.527 9.613  1.00 12.30 ? 57   ARG A NH1 1 
ATOM   492  N  NH2 . ARG A 1 57 ? 0.905  35.231 10.841 1.00 13.32 ? 57   ARG A NH2 1 
ATOM   493  N  N   . GLN A 1 58 ? 4.920  39.579 16.104 1.00 5.51  ? 58   GLN A N   1 
ATOM   494  C  CA  . GLN A 1 58 ? 5.057  39.279 17.512 1.00 5.97  ? 58   GLN A CA  1 
ATOM   495  C  C   . GLN A 1 58 ? 3.685  39.210 18.173 1.00 5.69  ? 58   GLN A C   1 
ATOM   496  O  O   . GLN A 1 58 ? 2.955  40.210 18.204 1.00 7.40  ? 58   GLN A O   1 
ATOM   497  C  CB  . GLN A 1 58 ? 5.870  40.377 18.210 1.00 6.11  ? 58   GLN A CB  1 
ATOM   498  C  CG  . GLN A 1 58 ? 5.981  40.120 19.695 1.00 7.49  ? 58   GLN A CG  1 
ATOM   499  C  CD  . GLN A 1 58 ? 6.786  41.115 20.450 1.00 12.38 ? 58   GLN A CD  1 
ATOM   500  O  OE1 . GLN A 1 58 ? 7.753  41.675 19.886 1.00 13.79 ? 58   GLN A OE1 1 
ATOM   501  N  NE2 . GLN A 1 58 ? 6.400  41.311 21.722 1.00 17.52 ? 58   GLN A NE2 1 
ATOM   502  N  N   . TYR A 1 59 ? 3.366  38.032 18.699 1.00 6.08  ? 59   TYR A N   1 
ATOM   503  C  CA  . TYR A 1 59 ? 2.146  37.760 19.433 1.00 6.72  ? 59   TYR A CA  1 
ATOM   504  C  C   . TYR A 1 59 ? 2.500  37.548 20.900 1.00 7.73  ? 59   TYR A C   1 
ATOM   505  O  O   . TYR A 1 59 ? 3.382  36.755 21.182 1.00 10.01 ? 59   TYR A O   1 
ATOM   506  C  CB  . TYR A 1 59 ? 1.432  36.524 18.935 1.00 7.72  ? 59   TYR A CB  1 
ATOM   507  C  CG  . TYR A 1 59 ? 0.895  36.605 17.538 1.00 6.76  ? 59   TYR A CG  1 
ATOM   508  C  CD1 . TYR A 1 59 ? 1.670  36.351 16.424 1.00 7.33  ? 59   TYR A CD1 1 
ATOM   509  C  CD2 . TYR A 1 59 ? -0.427 36.924 17.330 1.00 8.13  ? 59   TYR A CD2 1 
ATOM   510  C  CE1 . TYR A 1 59 ? 1.146  36.432 15.168 1.00 8.68  ? 59   TYR A CE1 1 
ATOM   511  C  CE2 . TYR A 1 59 ? -0.971 37.005 16.076 1.00 9.69  ? 59   TYR A CE2 1 
ATOM   512  C  CZ  . TYR A 1 59 ? -0.193 36.754 14.982 1.00 9.62  ? 59   TYR A CZ  1 
ATOM   513  O  OH  . TYR A 1 59 ? -0.663 36.816 13.705 1.00 13.44 ? 59   TYR A OH  1 
ATOM   514  N  N   . ASP A 1 60 ? 1.800  38.188 21.781 1.00 8.66  ? 60   ASP A N   1 
ATOM   515  C  CA  . ASP A 1 60 ? 2.047  38.034 23.204 1.00 9.51  ? 60   ASP A CA  1 
ATOM   516  C  C   . ASP A 1 60 ? 1.007  37.106 23.843 1.00 8.52  ? 60   ASP A C   1 
ATOM   517  O  O   . ASP A 1 60 ? -0.092 36.947 23.366 1.00 9.77  ? 60   ASP A O   1 
ATOM   518  C  CB  . ASP A 1 60 ? 2.059  39.401 23.846 1.00 15.12 ? 60   ASP A CB  1 
ATOM   519  C  CG  . ASP A 1 60 ? 3.282  40.228 23.433 1.00 18.84 ? 60   ASP A CG  1 
ATOM   520  O  OD1 . ASP A 1 60 ? 3.106  41.451 23.604 1.00 28.13 ? 60   ASP A OD1 1 
ATOM   521  O  OD2 . ASP A 1 60 ? 4.350  39.730 23.021 1.00 17.74 ? 60   ASP A OD2 1 
ATOM   522  N  N   . GLN A 1 61 ? 1.446  36.473 24.915 1.00 8.39  ? 61   GLN A N   1 
ATOM   523  C  CA  . GLN A 1 61 ? 0.562  35.640 25.747 1.00 9.92  ? 61   GLN A CA  1 
ATOM   524  C  C   . GLN A 1 61 ? -0.087 34.510 24.932 1.00 8.83  ? 61   GLN A C   1 
ATOM   525  O  O   . GLN A 1 61 ? -1.275 34.216 25.059 1.00 11.33 ? 61   GLN A O   1 
ATOM   526  C  CB  . GLN A 1 61 ? -0.463 36.500 26.498 1.00 15.33 ? 61   GLN A CB  1 
ATOM   527  C  CG  A GLN A 1 61 ? 0.248  37.495 27.417 0.51 21.21 ? 61   GLN A CG  1 
ATOM   528  C  CG  B GLN A 1 61 ? 0.167  37.339 27.608 0.49 21.66 ? 61   GLN A CG  1 
ATOM   529  C  CD  A GLN A 1 61 ? 1.210  36.743 28.317 0.51 25.80 ? 61   GLN A CD  1 
ATOM   530  C  CD  B GLN A 1 61 ? 0.490  36.434 28.788 0.49 23.15 ? 61   GLN A CD  1 
ATOM   531  O  OE1 A GLN A 1 61 ? 2.411  37.029 28.410 0.51 32.32 ? 61   GLN A OE1 1 
ATOM   532  O  OE1 B GLN A 1 61 ? -0.315 36.262 29.693 0.49 37.67 ? 61   GLN A OE1 1 
ATOM   533  N  NE2 A GLN A 1 61 ? 0.661  35.739 29.018 0.51 32.59 ? 61   GLN A NE2 1 
ATOM   534  N  NE2 B GLN A 1 61 ? 1.685  35.822 28.757 0.49 31.28 ? 61   GLN A NE2 1 
ATOM   535  N  N   . ILE A 1 62 ? 0.718  33.867 24.109 1.00 7.24  ? 62   ILE A N   1 
ATOM   536  C  CA  . ILE A 1 62 ? 0.278  32.739 23.309 1.00 7.00  ? 62   ILE A CA  1 
ATOM   537  C  C   . ILE A 1 62 ? 0.530  31.479 24.116 1.00 7.44  ? 62   ILE A C   1 
ATOM   538  O  O   . ILE A 1 62 ? 1.605  31.258 24.670 1.00 8.40  ? 62   ILE A O   1 
ATOM   539  C  CB  . ILE A 1 62 ? 1.010  32.689 21.964 1.00 7.49  ? 62   ILE A CB  1 
ATOM   540  C  CG1 . ILE A 1 62 ? 0.703  33.922 21.109 1.00 8.30  ? 62   ILE A CG1 1 
ATOM   541  C  CG2 . ILE A 1 62 ? 0.709  31.392 21.236 1.00 9.75  ? 62   ILE A CG2 1 
ATOM   542  C  CD1 . ILE A 1 62 ? -0.778 34.114 20.768 1.00 11.20 ? 62   ILE A CD1 1 
ATOM   543  N  N   . ILE A 1 63 ? -0.521 30.655 24.164 1.00 8.70  ? 63   ILE A N   1 
ATOM   544  C  CA  . ILE A 1 63 ? -0.451 29.341 24.848 1.00 10.83 ? 63   ILE A CA  1 
ATOM   545  C  C   . ILE A 1 63 ? 0.238  28.358 23.937 1.00 9.87  ? 63   ILE A C   1 
ATOM   546  O  O   . ILE A 1 63 ? -0.077 28.176 22.754 1.00 10.64 ? 63   ILE A O   1 
ATOM   547  C  CB  A ILE A 1 63 ? -1.867 28.875 25.221 0.52 14.76 ? 63   ILE A CB  1 
ATOM   548  C  CB  B ILE A 1 63 ? -1.887 28.939 25.215 0.48 15.53 ? 63   ILE A CB  1 
ATOM   549  C  CG1 A ILE A 1 63 ? -2.623 29.894 26.084 0.52 16.22 ? 63   ILE A CG1 1 
ATOM   550  C  CG1 B ILE A 1 63 ? -2.440 30.019 26.159 0.48 16.34 ? 63   ILE A CG1 1 
ATOM   551  C  CG2 A ILE A 1 63 ? -1.877 27.505 25.872 0.52 19.51 ? 63   ILE A CG2 1 
ATOM   552  C  CG2 B ILE A 1 63 ? -2.027 27.542 25.769 0.48 17.32 ? 63   ILE A CG2 1 
ATOM   553  C  CD1 A ILE A 1 63 ? -4.114 29.557 26.172 0.52 18.58 ? 63   ILE A CD1 1 
ATOM   554  C  CD1 B ILE A 1 63 ? -2.178 29.688 27.610 0.48 20.93 ? 63   ILE A CD1 1 
ATOM   555  N  N   A ILE A 1 64 ? 1.314  27.718 24.393 0.48 10.55 ? 64   ILE A N   1 
ATOM   556  N  N   B ILE A 1 64 ? 1.182  27.591 24.480 0.52 9.72  ? 64   ILE A N   1 
ATOM   557  C  CA  . ILE A 1 64 ? 1.961  26.641 23.649 1.00 9.87  ? 64   ILE A CA  1 
ATOM   558  C  C   A ILE A 1 64 ? 2.088  25.468 24.629 0.48 8.41  ? 64   ILE A C   1 
ATOM   559  C  C   B ILE A 1 64 ? 2.429  25.480 24.497 0.52 8.94  ? 64   ILE A C   1 
ATOM   560  O  O   A ILE A 1 64 ? 2.171  25.611 25.859 0.48 13.53 ? 64   ILE A O   1 
ATOM   561  O  O   B ILE A 1 64 ? 3.086  25.687 25.521 0.52 7.96  ? 64   ILE A O   1 
ATOM   562  C  CB  A ILE A 1 64 ? 3.343  26.932 23.026 0.48 13.54 ? 64   ILE A CB  1 
ATOM   563  C  CB  B ILE A 1 64 ? 3.093  27.420 22.977 0.52 12.87 ? 64   ILE A CB  1 
ATOM   564  C  CG1 A ILE A 1 64 ? 3.521  28.128 22.052 0.48 12.46 ? 64   ILE A CG1 1 
ATOM   565  C  CG1 B ILE A 1 64 ? 4.051  26.487 22.260 0.52 9.03  ? 64   ILE A CG1 1 
ATOM   566  C  CG2 A ILE A 1 64 ? 3.922  25.744 22.225 0.48 12.25 ? 64   ILE A CG2 1 
ATOM   567  C  CG2 B ILE A 1 64 ? 3.805  28.271 24.005 0.52 13.65 ? 64   ILE A CG2 1 
ATOM   568  C  CD1 A ILE A 1 64 ? 4.771  28.027 21.171 0.48 16.53 ? 64   ILE A CD1 1 
ATOM   569  C  CD1 B ILE A 1 64 ? 4.958  26.996 21.198 0.52 10.55 ? 64   ILE A CD1 1 
ATOM   570  N  N   . GLU A 1 65 ? 2.072  24.270 24.103 1.00 6.51  ? 65   GLU A N   1 
ATOM   571  C  CA  . GLU A 1 65 ? 2.447  23.078 24.859 1.00 7.32  ? 65   GLU A CA  1 
ATOM   572  C  C   . GLU A 1 65 ? 3.690  22.503 24.204 1.00 7.56  ? 65   GLU A C   1 
ATOM   573  O  O   . GLU A 1 65 ? 3.734  22.410 22.974 1.00 10.16 ? 65   GLU A O   1 
ATOM   574  C  CB  . GLU A 1 65 ? 1.305  22.080 24.888 1.00 9.86  ? 65   GLU A CB  1 
ATOM   575  C  CG  A GLU A 1 65 ? 1.479  20.974 25.912 0.41 15.67 ? 65   GLU A CG  1 
ATOM   576  C  CG  B GLU A 1 65 ? 1.584  20.878 25.778 0.60 15.29 ? 65   GLU A CG  1 
ATOM   577  C  CD  A GLU A 1 65 ? 0.232  20.116 26.005 0.41 17.78 ? 65   GLU A CD  1 
ATOM   578  C  CD  B GLU A 1 65 ? 0.378  19.998 26.006 0.60 17.90 ? 65   GLU A CD  1 
ATOM   579  O  OE1 A GLU A 1 65 ? 0.392  18.881 25.887 0.41 18.87 ? 65   GLU A OE1 1 
ATOM   580  O  OE1 B GLU A 1 65 ? 0.147  19.585 27.184 0.60 25.36 ? 65   GLU A OE1 1 
ATOM   581  O  OE2 A GLU A 1 65 ? -0.880 20.650 26.205 0.41 24.56 ? 65   GLU A OE2 1 
ATOM   582  O  OE2 B GLU A 1 65 ? -0.302 19.734 24.987 0.60 23.54 ? 65   GLU A OE2 1 
ATOM   583  N  N   . ILE A 1 66 ? 4.724  22.196 24.984 1.00 6.74  ? 66   ILE A N   1 
ATOM   584  C  CA  . ILE A 1 66 ? 6.040  21.790 24.477 1.00 7.26  ? 66   ILE A CA  1 
ATOM   585  C  C   . ILE A 1 66 ? 6.349  20.441 25.080 1.00 7.46  ? 66   ILE A C   1 
ATOM   586  O  O   . ILE A 1 66 ? 6.576  20.355 26.288 1.00 7.76  ? 66   ILE A O   1 
ATOM   587  C  CB  . ILE A 1 66 ? 7.117  22.819 24.830 1.00 8.44  ? 66   ILE A CB  1 
ATOM   588  C  CG1 . ILE A 1 66 ? 6.779  24.177 24.268 1.00 10.06 ? 66   ILE A CG1 1 
ATOM   589  C  CG2 . ILE A 1 66 ? 8.480  22.324 24.337 1.00 9.75  ? 66   ILE A CG2 1 
ATOM   590  C  CD1 . ILE A 1 66 ? 7.474  25.322 24.933 1.00 12.37 ? 66   ILE A CD1 1 
ATOM   591  N  N   . ALA A 1 67 ? 6.297  19.366 24.275 1.00 9.60  ? 67   ALA A N   1 
ATOM   592  C  CA  . ALA A 1 67 ? 6.558  18.011 24.746 1.00 9.89  ? 67   ALA A CA  1 
ATOM   593  C  C   . ALA A 1 67 ? 5.720  17.736 25.980 1.00 9.91  ? 67   ALA A C   1 
ATOM   594  O  O   . ALA A 1 67 ? 6.183  17.129 26.945 1.00 11.66 ? 67   ALA A O   1 
ATOM   595  C  CB  . ALA A 1 67 ? 8.031  17.844 25.060 1.00 12.70 ? 67   ALA A CB  1 
ATOM   596  N  N   . GLY A 1 68 ? 4.482  18.190 25.984 1.00 10.54 ? 68   GLY A N   1 
ATOM   597  C  CA  . GLY A 1 68 ? 3.526  17.920 27.071 1.00 11.35 ? 68   GLY A CA  1 
ATOM   598  C  C   . GLY A 1 68 ? 3.588  18.897 28.214 1.00 10.39 ? 68   GLY A C   1 
ATOM   599  O  O   . GLY A 1 68 ? 2.788  18.764 29.154 1.00 15.62 ? 68   GLY A O   1 
ATOM   600  N  N   . HIS A 1 69 ? 4.458  19.869 28.173 1.00 7.53  ? 69   HIS A N   1 
ATOM   601  C  CA  . HIS A 1 69 ? 4.624  20.887 29.187 1.00 7.64  ? 69   HIS A CA  1 
ATOM   602  C  C   . HIS A 1 69 ? 3.982  22.179 28.717 1.00 7.07  ? 69   HIS A C   1 
ATOM   603  O  O   . HIS A 1 69 ? 4.300  22.714 27.678 1.00 8.84  ? 69   HIS A O   1 
ATOM   604  C  CB  . HIS A 1 69 ? 6.094  21.126 29.498 1.00 8.07  ? 69   HIS A CB  1 
ATOM   605  C  CG  . HIS A 1 69 ? 6.758  19.956 30.135 1.00 9.04  ? 69   HIS A CG  1 
ATOM   606  N  ND1 . HIS A 1 69 ? 7.237  20.013 31.424 1.00 11.59 ? 69   HIS A ND1 1 
ATOM   607  C  CD2 . HIS A 1 69 ? 7.041  18.736 29.649 1.00 10.50 ? 69   HIS A CD2 1 
ATOM   608  C  CE1 . HIS A 1 69 ? 7.758  18.832 31.693 1.00 14.32 ? 69   HIS A CE1 1 
ATOM   609  N  NE2 . HIS A 1 69 ? 7.648  18.034 30.668 1.00 11.73 ? 69   HIS A NE2 1 
ATOM   610  N  N   . LYS A 1 70 ? 3.068  22.722 29.524 1.00 8.28  ? 70   LYS A N   1 
ATOM   611  C  CA  . LYS A 1 70 ? 2.406  23.963 29.156 1.00 8.06  ? 70   LYS A CA  1 
ATOM   612  C  C   . LYS A 1 70 ? 3.291  25.173 29.352 1.00 8.25  ? 70   LYS A C   1 
ATOM   613  O  O   . LYS A 1 70 ? 4.061  25.287 30.322 1.00 10.70 ? 70   LYS A O   1 
ATOM   614  C  CB  . LYS A 1 70 ? 1.169  24.138 30.010 1.00 10.94 ? 70   LYS A CB  1 
ATOM   615  C  CG  . LYS A 1 70 ? 0.141  23.066 29.708 1.00 15.74 ? 70   LYS A CG  1 
ATOM   616  C  CD  . LYS A 1 70 ? -1.095 23.227 30.608 1.00 25.51 ? 70   LYS A CD  1 
ATOM   617  C  CE  . LYS A 1 70 ? -2.118 22.120 30.359 1.00 31.38 ? 70   LYS A CE  1 
ATOM   618  N  NZ  . LYS A 1 70 ? -2.167 21.805 28.892 1.00 40.56 ? 70   LYS A NZ  1 
ATOM   619  N  N   . ALA A 1 71 ? 3.137  26.152 28.469 1.00 8.47  ? 71   ALA A N   1 
ATOM   620  C  CA  . ALA A 1 71 ? 3.887  27.401 28.524 1.00 8.78  ? 71   ALA A CA  1 
ATOM   621  C  C   . ALA A 1 71 ? 2.955  28.467 27.946 1.00 8.29  ? 71   ALA A C   1 
ATOM   622  O  O   . ALA A 1 71 ? 1.962  28.215 27.273 1.00 9.53  ? 71   ALA A O   1 
ATOM   623  C  CB  . ALA A 1 71 ? 5.193  27.293 27.763 1.00 11.05 ? 71   ALA A CB  1 
ATOM   624  N  N   . ILE A 1 72 ? 3.302  29.713 28.240 1.00 7.83  ? 72   ILE A N   1 
ATOM   625  C  CA  . ILE A 1 72 ? 2.552  30.836 27.724 1.00 7.81  ? 72   ILE A CA  1 
ATOM   626  C  C   . ILE A 1 72 ? 3.500  32.007 27.611 1.00 7.24  ? 72   ILE A C   1 
ATOM   627  O  O   . ILE A 1 72 ? 4.182  32.390 28.548 1.00 9.66  ? 72   ILE A O   1 
ATOM   628  C  CB  . ILE A 1 72 ? 1.340  31.172 28.598 1.00 8.23  ? 72   ILE A CB  1 
ATOM   629  C  CG1 . ILE A 1 72 ? 0.609  32.380 28.012 1.00 9.49  ? 72   ILE A CG1 1 
ATOM   630  C  CG2 . ILE A 1 72 ? 1.746  31.337 30.055 1.00 11.48 ? 72   ILE A CG2 1 
ATOM   631  C  CD1 . ILE A 1 72 ? -0.756 32.623 28.621 1.00 11.82 ? 72   ILE A CD1 1 
ATOM   632  N  N   . GLY A 1 73 ? 3.569  32.628 26.439 1.00 6.60  ? 73   GLY A N   1 
ATOM   633  C  CA  . GLY A 1 73 ? 4.474  33.767 26.308 1.00 7.29  ? 73   GLY A CA  1 
ATOM   634  C  C   . GLY A 1 73 ? 4.472  34.266 24.881 1.00 6.74  ? 73   GLY A C   1 
ATOM   635  O  O   . GLY A 1 73 ? 3.590  34.008 24.084 1.00 8.37  ? 73   GLY A O   1 
ATOM   636  N  N   . THR A 1 74 ? 5.539  34.985 24.574 1.00 7.35  ? 74   THR A N   1 
ATOM   637  C  CA  . THR A 1 74 ? 5.648  35.628 23.283 1.00 7.42  ? 74   THR A CA  1 
ATOM   638  C  C   . THR A 1 74 ? 6.055  34.624 22.218 1.00 6.65  ? 74   THR A C   1 
ATOM   639  O  O   . THR A 1 74 ? 6.973  33.838 22.411 1.00 7.13  ? 74   THR A O   1 
ATOM   640  C  CB  . THR A 1 74 ? 6.649  36.772 23.365 1.00 9.07  ? 74   THR A CB  1 
ATOM   641  O  OG1 . THR A 1 74 ? 6.100  37.709 24.338 1.00 12.27 ? 74   THR A OG1 1 
ATOM   642  C  CG2 . THR A 1 74 ? 6.821  37.460 22.024 1.00 11.51 ? 74   THR A CG2 1 
ATOM   643  N  N   . VAL A 1 75 ? 5.405  34.708 21.063 1.00 6.51  ? 75   VAL A N   1 
ATOM   644  C  CA  . VAL A 1 75 ? 5.705  33.878 19.929 1.00 6.72  ? 75   VAL A CA  1 
ATOM   645  C  C   . VAL A 1 75 ? 5.827  34.769 18.709 1.00 5.84  ? 75   VAL A C   1 
ATOM   646  O  O   . VAL A 1 75 ? 4.968  35.630 18.479 1.00 7.39  ? 75   VAL A O   1 
ATOM   647  C  CB  . VAL A 1 75 ? 4.682  32.758 19.735 1.00 8.43  ? 75   VAL A CB  1 
ATOM   648  C  CG1 . VAL A 1 75 ? 4.943  31.973 18.475 1.00 10.76 ? 75   VAL A CG1 1 
ATOM   649  C  CG2 . VAL A 1 75 ? 4.659  31.818 20.948 1.00 10.96 ? 75   VAL A CG2 1 
ATOM   650  N  N   . LEU A 1 76 ? 6.872  34.607 17.950 1.00 5.80  ? 76   LEU A N   1 
ATOM   651  C  CA  . LEU A 1 76 ? 7.116  35.337 16.709 1.00 5.84  ? 76   LEU A CA  1 
ATOM   652  C  C   . LEU A 1 76 ? 6.725  34.421 15.576 1.00 6.92  ? 76   LEU A C   1 
ATOM   653  O  O   . LEU A 1 76 ? 7.111  33.239 15.574 1.00 10.87 ? 76   LEU A O   1 
ATOM   654  C  CB  . LEU A 1 76 ? 8.583  35.714 16.593 1.00 5.52  ? 76   LEU A CB  1 
ATOM   655  C  CG  . LEU A 1 76 ? 9.177  36.454 17.802 1.00 5.36  ? 76   LEU A CG  1 
ATOM   656  C  CD1 . LEU A 1 76 ? 10.622 36.829 17.608 1.00 6.69  ? 76   LEU A CD1 1 
ATOM   657  C  CD2 . LEU A 1 76 ? 8.359  37.659 18.214 1.00 6.39  ? 76   LEU A CD2 1 
ATOM   658  N  N   . VAL A 1 77 ? 5.962  34.879 14.606 1.00 5.45  ? 77   VAL A N   1 
ATOM   659  C  CA  . VAL A 1 77 ? 5.504  34.078 13.496 1.00 5.55  ? 77   VAL A CA  1 
ATOM   660  C  C   . VAL A 1 77 ? 5.953  34.691 12.192 1.00 5.84  ? 77   VAL A C   1 
ATOM   661  O  O   . VAL A 1 77 ? 5.765  35.912 11.948 1.00 6.71  ? 77   VAL A O   1 
ATOM   662  C  CB  . VAL A 1 77 ? 3.965  33.964 13.496 1.00 5.99  ? 77   VAL A CB  1 
ATOM   663  C  CG1 . VAL A 1 77 ? 3.493  33.178 12.298 1.00 7.89  ? 77   VAL A CG1 1 
ATOM   664  C  CG2 . VAL A 1 77 ? 3.473  33.353 14.783 1.00 7.37  ? 77   VAL A CG2 1 
ATOM   665  N  N   . GLY A 1 78 ? 6.546  33.888 11.290 1.00 6.28  ? 78   GLY A N   1 
ATOM   666  C  CA  . GLY A 1 78 ? 6.947  34.457 10.025 1.00 7.24  ? 78   GLY A CA  1 
ATOM   667  C  C   . GLY A 1 78 ? 7.684  33.379 9.222  1.00 6.52  ? 78   GLY A C   1 
ATOM   668  O  O   . GLY A 1 78 ? 7.589  32.178 9.529  1.00 7.45  ? 78   GLY A O   1 
ATOM   669  N  N   . PRO A 1 79 ? 8.372  33.804 8.177  1.00 6.57  ? 79   PRO A N   1 
ATOM   670  C  CA  . PRO A 1 79 ? 8.971  32.870 7.197  1.00 7.38  ? 79   PRO A CA  1 
ATOM   671  C  C   . PRO A 1 79 ? 10.294 32.297 7.677  1.00 7.82  ? 79   PRO A C   1 
ATOM   672  O  O   . PRO A 1 79 ? 11.331 32.352 7.018  1.00 12.13 ? 79   PRO A O   1 
ATOM   673  C  CB  . PRO A 1 79 ? 9.116  33.729 5.950  1.00 8.61  ? 79   PRO A CB  1 
ATOM   674  C  CG  . PRO A 1 79 ? 9.347  35.100 6.511  1.00 8.21  ? 79   PRO A CG  1 
ATOM   675  C  CD  . PRO A 1 79 ? 8.501  35.219 7.731  1.00 7.08  ? 79   PRO A CD  1 
ATOM   676  N  N   . THR A 1 80 ? 10.273 31.681 8.868  1.00 7.50  ? 80   THR A N   1 
ATOM   677  C  CA  . THR A 1 80 ? 11.422 30.956 9.376  1.00 7.12  ? 80   THR A CA  1 
ATOM   678  C  C   . THR A 1 80 ? 11.503 29.586 8.718  1.00 6.58  ? 80   THR A C   1 
ATOM   679  O  O   . THR A 1 80 ? 10.461 28.959 8.469  1.00 7.19  ? 80   THR A O   1 
ATOM   680  C  CB  . THR A 1 80 ? 11.353 30.836 10.897 1.00 6.62  ? 80   THR A CB  1 
ATOM   681  O  OG1 . THR A 1 80 ? 12.457 30.028 11.303 1.00 6.49  ? 80   THR A OG1 1 
ATOM   682  C  CG2 . THR A 1 80 ? 10.051 30.235 11.424 1.00 7.48  ? 80   THR A CG2 1 
ATOM   683  N  N   . PRO A 1 81 ? 12.700 29.078 8.460  1.00 7.08  ? 81   PRO A N   1 
ATOM   684  C  CA  . PRO A 1 81 ? 12.837 27.717 7.911  1.00 7.70  ? 81   PRO A CA  1 
ATOM   685  C  C   . PRO A 1 81 ? 12.697 26.636 8.954  1.00 7.30  ? 81   PRO A C   1 
ATOM   686  O  O   . PRO A 1 81 ? 12.749 25.459 8.590  1.00 10.66 ? 81   PRO A O   1 
ATOM   687  C  CB  . PRO A 1 81 ? 14.244 27.696 7.325  1.00 9.97  ? 81   PRO A CB  1 
ATOM   688  C  CG  . PRO A 1 81 ? 15.014 28.663 8.184  1.00 9.80  ? 81   PRO A CG  1 
ATOM   689  C  CD  . PRO A 1 81 ? 14.017 29.752 8.537  1.00 8.67  ? 81   PRO A CD  1 
ATOM   690  N  N   . ALA A 1 82 ? 12.547 26.992 10.229 1.00 6.73  ? 82   ALA A N   1 
ATOM   691  C  CA  . ALA A 1 82 ? 12.456 26.055 11.317 1.00 7.50  ? 82   ALA A CA  1 
ATOM   692  C  C   . ALA A 1 82 ? 11.581 26.620 12.408 1.00 6.07  ? 82   ALA A C   1 
ATOM   693  O  O   . ALA A 1 82 ? 11.610 27.811 12.714 1.00 7.33  ? 82   ALA A O   1 
ATOM   694  C  CB  . ALA A 1 82 ? 13.857 25.745 11.923 1.00 10.01 ? 82   ALA A CB  1 
ATOM   695  N  N   . ASN A 1 83 ? 10.822 25.773 13.065 1.00 6.32  ? 83   ASN A N   1 
ATOM   696  C  CA  . ASN A 1 83 ? 10.133 26.109 14.306 1.00 5.73  ? 83   ASN A CA  1 
ATOM   697  C  C   . ASN A 1 83 ? 11.180 26.037 15.442 1.00 5.02  ? 83   ASN A C   1 
ATOM   698  O  O   . ASN A 1 83 ? 11.823 24.999 15.598 1.00 6.04  ? 83   ASN A O   1 
ATOM   699  C  CB  . ASN A 1 83 ? 8.989  25.174 14.591 1.00 6.70  ? 83   ASN A CB  1 
ATOM   700  C  CG  . ASN A 1 83 ? 7.873  25.253 13.588 1.00 7.29  ? 83   ASN A CG  1 
ATOM   701  O  OD1 . ASN A 1 83 ? 7.444  26.328 13.184 1.00 10.38 ? 83   ASN A OD1 1 
ATOM   702  N  ND2 . ASN A 1 83 ? 7.387  24.086 13.141 1.00 8.34  ? 83   ASN A ND2 1 
ATOM   703  N  N   . ILE A 1 84 ? 11.313 27.113 16.181 1.00 4.83  ? 84   ILE A N   1 
ATOM   704  C  CA  . ILE A 1 84 ? 12.367 27.331 17.163 1.00 5.60  ? 84   ILE A CA  1 
ATOM   705  C  C   . ILE A 1 84 ? 11.773 27.699 18.501 1.00 5.47  ? 84   ILE A C   1 
ATOM   706  O  O   . ILE A 1 84 ? 11.097 28.732 18.603 1.00 6.17  ? 84   ILE A O   1 
ATOM   707  C  CB  A ILE A 1 84 ? 13.309 28.464 16.699 0.38 8.32  ? 84   ILE A CB  1 
ATOM   708  C  CB  B ILE A 1 84 ? 13.286 28.466 16.654 0.62 5.31  ? 84   ILE A CB  1 
ATOM   709  C  CG1 A ILE A 1 84 ? 13.832 28.254 15.279 0.38 8.21  ? 84   ILE A CG1 1 
ATOM   710  C  CG1 B ILE A 1 84 ? 14.102 28.024 15.440 0.62 5.66  ? 84   ILE A CG1 1 
ATOM   711  C  CG2 A ILE A 1 84 ? 14.462 28.662 17.688 0.38 11.13 ? 84   ILE A CG2 1 
ATOM   712  C  CG2 B ILE A 1 84 ? 14.193 28.999 17.769 0.62 5.98  ? 84   ILE A CG2 1 
ATOM   713  C  CD1 A ILE A 1 84 ? 14.913 27.200 15.174 0.38 18.21 ? 84   ILE A CD1 1 
ATOM   714  C  CD1 B ILE A 1 84 ? 14.535 29.171 14.550 0.62 5.66  ? 84   ILE A CD1 1 
ATOM   715  N  N   . ILE A 1 85 ? 11.945 26.864 19.526 1.00 5.03  ? 85   ILE A N   1 
ATOM   716  C  CA  . ILE A 1 85 ? 11.552 27.166 20.879 1.00 4.77  ? 85   ILE A CA  1 
ATOM   717  C  C   . ILE A 1 85 ? 12.761 27.785 21.545 1.00 4.52  ? 85   ILE A C   1 
ATOM   718  O  O   . ILE A 1 85 ? 13.769 27.104 21.769 1.00 5.87  ? 85   ILE A O   1 
ATOM   719  C  CB  . ILE A 1 85 ? 11.077 25.912 21.651 1.00 5.34  ? 85   ILE A CB  1 
ATOM   720  C  CG1 . ILE A 1 85 ? 9.968  25.168 20.908 1.00 6.98  ? 85   ILE A CG1 1 
ATOM   721  C  CG2 . ILE A 1 85 ? 10.691 26.300 23.068 1.00 6.32  ? 85   ILE A CG2 1 
ATOM   722  C  CD1 . ILE A 1 85 ? 8.771  26.005 20.547 1.00 9.53  ? 85   ILE A CD1 1 
ATOM   723  N  N   . GLY A 1 86 ? 12.660 29.059 21.848 1.00 4.71  ? 86   GLY A N   1 
ATOM   724  C  CA  . GLY A 1 86 ? 13.743 29.810 22.426 1.00 4.69  ? 86   GLY A CA  1 
ATOM   725  C  C   . GLY A 1 86 ? 13.641 29.906 23.939 1.00 4.53  ? 86   GLY A C   1 
ATOM   726  O  O   . GLY A 1 86 ? 12.756 29.338 24.587 1.00 4.88  ? 86   GLY A O   1 
ATOM   727  N  N   . ARG A 1 87 ? 14.605 30.620 24.510 1.00 4.67  ? 87   ARG A N   1 
ATOM   728  C  CA  . ARG A 1 87 ? 14.777 30.630 25.960 1.00 4.86  ? 87   ARG A CA  1 
ATOM   729  C  C   . ARG A 1 87 ? 13.592 31.178 26.691 1.00 4.95  ? 87   ARG A C   1 
ATOM   730  O  O   . ARG A 1 87 ? 13.356 30.791 27.828 1.00 6.07  ? 87   ARG A O   1 
ATOM   731  C  CB  . ARG A 1 87 ? 16.045 31.421 26.329 1.00 5.18  ? 87   ARG A CB  1 
ATOM   732  C  CG  . ARG A 1 87 ? 17.326 30.755 25.835 1.00 5.10  ? 87   ARG A CG  1 
ATOM   733  C  CD  . ARG A 1 87 ? 18.588 31.432 26.379 1.00 5.71  ? 87   ARG A CD  1 
ATOM   734  N  NE  . ARG A 1 87 ? 18.663 32.809 25.939 1.00 6.08  ? 87   ARG A NE  1 
ATOM   735  C  CZ  . ARG A 1 87 ? 18.306 33.904 26.604 1.00 6.66  ? 87   ARG A CZ  1 
ATOM   736  N  NH1 . ARG A 1 87 ? 17.890 33.832 27.858 1.00 6.79  ? 87   ARG A NH1 1 
ATOM   737  N  NH2 . ARG A 1 87 ? 18.385 35.093 26.014 1.00 8.14  ? 87   ARG A NH2 1 
ATOM   738  N  N   . ASN A 1 88 ? 12.826 32.094 26.068 1.00 4.98  ? 88   ASN A N   1 
ATOM   739  C  CA  . ASN A 1 88 ? 11.658 32.641 26.754 1.00 5.33  ? 88   ASN A CA  1 
ATOM   740  C  C   . ASN A 1 88 ? 10.661 31.553 27.165 1.00 5.48  ? 88   ASN A C   1 
ATOM   741  O  O   . ASN A 1 88 ? 9.988  31.717 28.186 1.00 6.96  ? 88   ASN A O   1 
ATOM   742  C  CB  . ASN A 1 88 ? 10.971 33.714 25.877 1.00 5.69  ? 88   ASN A CB  1 
ATOM   743  C  CG  . ASN A 1 88 ? 10.208 33.140 24.702 1.00 5.61  ? 88   ASN A CG  1 
ATOM   744  O  OD1 . ASN A 1 88 ? 10.758 32.367 23.874 1.00 6.05  ? 88   ASN A OD1 1 
ATOM   745  N  ND2 . ASN A 1 88 ? 8.952  33.512 24.581 1.00 6.38  ? 88   ASN A ND2 1 
ATOM   746  N  N   . LEU A 1 89 ? 10.593 30.463 26.405 1.00 5.02  ? 89   LEU A N   1 
ATOM   747  C  CA  . LEU A 1 89 ? 9.726  29.326 26.795 1.00 5.26  ? 89   LEU A CA  1 
ATOM   748  C  C   . LEU A 1 89 ? 10.492 28.146 27.338 1.00 5.50  ? 89   LEU A C   1 
ATOM   749  O  O   . LEU A 1 89 ? 9.926  27.412 28.158 1.00 6.34  ? 89   LEU A O   1 
ATOM   750  C  CB  . LEU A 1 89 ? 8.867  28.886 25.598 1.00 6.08  ? 89   LEU A CB  1 
ATOM   751  C  CG  . LEU A 1 89 ? 7.954  29.965 24.995 1.00 6.90  ? 89   LEU A CG  1 
ATOM   752  C  CD1 . LEU A 1 89 ? 7.146  29.333 23.876 1.00 9.27  ? 89   LEU A CD1 1 
ATOM   753  C  CD2 . LEU A 1 89 ? 7.065  30.621 26.020 1.00 9.02  ? 89   LEU A CD2 1 
ATOM   754  N  N   . LEU A 1 90 ? 11.763 27.964 26.987 1.00 5.12  ? 90   LEU A N   1 
ATOM   755  C  CA  . LEU A 1 90 ? 12.553 26.894 27.592 1.00 5.71  ? 90   LEU A CA  1 
ATOM   756  C  C   . LEU A 1 90 ? 12.622 27.037 29.101 1.00 5.85  ? 90   LEU A C   1 
ATOM   757  O  O   . LEU A 1 90 ? 12.591 26.043 29.830 1.00 7.17  ? 90   LEU A O   1 
ATOM   758  C  CB  . LEU A 1 90 ? 13.936 26.848 26.989 1.00 5.47  ? 90   LEU A CB  1 
ATOM   759  C  CG  . LEU A 1 90 ? 14.020 26.431 25.517 1.00 5.49  ? 90   LEU A CG  1 
ATOM   760  C  CD1 . LEU A 1 90 ? 15.437 26.633 25.016 1.00 6.91  ? 90   LEU A CD1 1 
ATOM   761  C  CD2 . LEU A 1 90 ? 13.526 25.019 25.295 1.00 7.65  ? 90   LEU A CD2 1 
ATOM   762  N  N   . THR A 1 91 ? 12.733 28.255 29.595 1.00 5.85  ? 91   THR A N   1 
ATOM   763  C  CA  . THR A 1 91 ? 12.801 28.496 31.040 1.00 6.80  ? 91   THR A CA  1 
ATOM   764  C  C   . THR A 1 91 ? 11.497 28.050 31.685 1.00 7.75  ? 91   THR A C   1 
ATOM   765  O  O   . THR A 1 91 ? 11.524 27.627 32.857 1.00 10.38 ? 91   THR A O   1 
ATOM   766  C  CB  . THR A 1 91 ? 13.098 29.963 31.363 1.00 7.91  ? 91   THR A CB  1 
ATOM   767  O  OG1 . THR A 1 91 ? 12.166 30.790 30.706 1.00 9.04  ? 91   THR A OG1 1 
ATOM   768  C  CG2 . THR A 1 91 ? 14.515 30.341 30.955 1.00 7.80  ? 91   THR A CG2 1 
ATOM   769  N  N   . GLN A 1 92 ? 10.368 28.221 31.013 1.00 7.29  ? 92   GLN A N   1 
ATOM   770  C  CA  . GLN A 1 92 ? 9.056  27.911 31.591 1.00 7.91  ? 92   GLN A CA  1 
ATOM   771  C  C   . GLN A 1 92 ? 8.854  26.435 31.754 1.00 9.74  ? 92   GLN A C   1 
ATOM   772  O  O   . GLN A 1 92 ? 8.034  26.022 32.607 1.00 13.32 ? 92   GLN A O   1 
ATOM   773  C  CB  . GLN A 1 92 ? 7.947  28.476 30.714 1.00 8.20  ? 92   GLN A CB  1 
ATOM   774  C  CG  . GLN A 1 92 ? 7.942  29.973 30.647 1.00 9.04  ? 92   GLN A CG  1 
ATOM   775  C  CD  . GLN A 1 92 ? 6.687  30.510 29.990 1.00 8.35  ? 92   GLN A CD  1 
ATOM   776  O  OE1 . GLN A 1 92 ? 5.799  29.784 29.660 1.00 11.95 ? 92   GLN A OE1 1 
ATOM   777  N  NE2 . GLN A 1 92 ? 6.657  31.798 29.778 1.00 17.33 ? 92   GLN A NE2 1 
ATOM   778  N  N   . ILE A 1 93 ? 9.521  25.621 30.950 1.00 9.92  ? 93   ILE A N   1 
ATOM   779  C  CA  . ILE A 1 93 ? 9.370  24.186 31.067 1.00 12.18 ? 93   ILE A CA  1 
ATOM   780  C  C   . ILE A 1 93 ? 10.570 23.617 31.831 1.00 12.20 ? 93   ILE A C   1 
ATOM   781  O  O   . ILE A 1 93 ? 10.664 22.388 31.985 1.00 15.64 ? 93   ILE A O   1 
ATOM   782  C  CB  . ILE A 1 93 ? 9.194  23.504 29.704 1.00 12.33 ? 93   ILE A CB  1 
ATOM   783  C  CG1 . ILE A 1 93 ? 10.495 23.508 28.876 1.00 12.98 ? 93   ILE A CG1 1 
ATOM   784  C  CG2 . ILE A 1 93 ? 8.005  24.089 28.963 1.00 15.08 ? 93   ILE A CG2 1 
ATOM   785  C  CD1 . ILE A 1 93 ? 10.357 22.740 27.565 1.00 16.71 ? 93   ILE A CD1 1 
ATOM   786  N  N   . GLY A 1 94 ? 11.424 24.436 32.408 1.00 12.44 ? 94   GLY A N   1 
ATOM   787  C  CA  . GLY A 1 94 ? 12.456 23.967 33.295 1.00 12.95 ? 94   GLY A CA  1 
ATOM   788  C  C   . GLY A 1 94 ? 13.643 23.304 32.591 1.00 11.68 ? 94   GLY A C   1 
ATOM   789  O  O   . GLY A 1 94 ? 14.346 22.476 33.175 1.00 11.83 ? 94   GLY A O   1 
ATOM   790  N  N   . ALA A 1 95 ? 13.919 23.736 31.359 1.00 9.81  ? 95   ALA A N   1 
ATOM   791  C  CA  . ALA A 1 95 ? 14.998 23.118 30.594 1.00 7.84  ? 95   ALA A CA  1 
ATOM   792  C  C   . ALA A 1 95 ? 16.347 23.692 30.970 1.00 7.34  ? 95   ALA A C   1 
ATOM   793  O  O   . ALA A 1 95 ? 16.522 24.898 31.207 1.00 9.82  ? 95   ALA A O   1 
ATOM   794  C  CB  . ALA A 1 95 ? 14.732 23.350 29.118 1.00 8.84  ? 95   ALA A CB  1 
ATOM   795  N  N   . THR A 1 96 ? 17.334 22.804 31.000 1.00 6.11  ? 96   THR A N   1 
ATOM   796  C  CA  . THR A 1 96 ? 18.715 23.133 31.247 1.00 6.22  ? 96   THR A CA  1 
ATOM   797  C  C   . THR A 1 96 ? 19.596 22.440 30.211 1.00 5.73  ? 96   THR A C   1 
ATOM   798  O  O   . THR A 1 96 ? 19.218 21.431 29.628 1.00 6.66  ? 96   THR A O   1 
ATOM   799  C  CB  . THR A 1 96 ? 19.192 22.739 32.633 1.00 7.31  ? 96   THR A CB  1 
ATOM   800  O  OG1 . THR A 1 96 ? 18.964 21.336 32.841 1.00 8.67  ? 96   THR A OG1 1 
ATOM   801  C  CG2 . THR A 1 96 ? 18.434 23.459 33.735 1.00 11.60 ? 96   THR A CG2 1 
ATOM   802  N  N   . LEU A 1 97 ? 20.760 23.013 30.012 1.00 5.71  ? 97   LEU A N   1 
ATOM   803  C  CA  . LEU A 1 97 ? 21.841 22.381 29.260 1.00 5.93  ? 97   LEU A CA  1 
ATOM   804  C  C   . LEU A 1 97 ? 22.841 21.836 30.250 1.00 7.15  ? 97   LEU A C   1 
ATOM   805  O  O   . LEU A 1 97 ? 23.246 22.609 31.101 1.00 10.43 ? 97   LEU A O   1 
ATOM   806  C  CB  A LEU A 1 97 ? 22.644 23.474 28.556 0.40 9.92  ? 97   LEU A CB  1 
ATOM   807  C  CB  B LEU A 1 97 ? 22.339 23.376 28.191 0.61 6.66  ? 97   LEU A CB  1 
ATOM   808  C  CG  A LEU A 1 97 ? 22.382 23.720 27.092 0.40 12.22 ? 97   LEU A CG  1 
ATOM   809  C  CG  B LEU A 1 97 ? 23.414 22.858 27.243 0.61 5.08  ? 97   LEU A CG  1 
ATOM   810  C  CD1 A LEU A 1 97 ? 23.391 24.747 26.592 0.40 15.38 ? 97   LEU A CD1 1 
ATOM   811  C  CD1 B LEU A 1 97 ? 22.844 21.800 26.316 0.61 5.73  ? 97   LEU A CD1 1 
ATOM   812  C  CD2 A LEU A 1 97 ? 22.454 22.438 26.277 0.40 11.85 ? 97   LEU A CD2 1 
ATOM   813  C  CD2 B LEU A 1 97 ? 24.050 23.988 26.444 0.61 8.04  ? 97   LEU A CD2 1 
ATOM   814  N  N   . ASN A 1 98 ? 23.284 20.616 30.096 1.00 6.84  ? 98   ASN A N   1 
ATOM   815  C  CA  . ASN A 1 98 ? 24.102 19.971 31.103 1.00 7.70  ? 98   ASN A CA  1 
ATOM   816  C  C   . ASN A 1 98 ? 25.304 19.300 30.448 1.00 8.42  ? 98   ASN A C   1 
ATOM   817  O  O   . ASN A 1 98 ? 25.137 18.586 29.466 1.00 8.52  ? 98   ASN A O   1 
ATOM   818  C  CB  . ASN A 1 98 ? 23.309 18.877 31.829 1.00 8.10  ? 98   ASN A CB  1 
ATOM   819  C  CG  . ASN A 1 98 ? 22.107 19.420 32.543 1.00 8.28  ? 98   ASN A CG  1 
ATOM   820  O  OD1 . ASN A 1 98 ? 21.092 19.834 31.988 1.00 10.63 ? 98   ASN A OD1 1 
ATOM   821  N  ND2 . ASN A 1 98 ? 22.174 19.395 33.860 1.00 12.31 ? 98   ASN A ND2 1 
ATOM   822  N  N   . PHE A 1 99 ? 26.485 19.520 31.005 1.00 8.73  ? 99   PHE A N   1 
ATOM   823  C  CA  . PHE A 1 99 ? 27.705 18.827 30.605 1.00 9.94  ? 99   PHE A CA  1 
ATOM   824  C  C   . PHE A 1 99 ? 28.687 18.817 31.769 1.00 12.13 ? 99   PHE A C   1 
ATOM   825  O  O   . PHE A 1 99 ? 29.799 18.233 31.634 1.00 16.50 ? 99   PHE A O   1 
ATOM   826  C  CB  . PHE A 1 99 ? 28.295 19.377 29.329 1.00 10.57 ? 99   PHE A CB  1 
ATOM   827  C  CG  . PHE A 1 99 ? 28.676 20.838 29.329 1.00 10.83 ? 99   PHE A CG  1 
ATOM   828  C  CD1 . PHE A 1 99 ? 27.721 21.821 29.058 1.00 13.48 ? 99   PHE A CD1 1 
ATOM   829  C  CD2 . PHE A 1 99 ? 29.980 21.252 29.587 1.00 13.64 ? 99   PHE A CD2 1 
ATOM   830  C  CE1 . PHE A 1 99 ? 28.077 23.147 29.047 1.00 16.74 ? 99   PHE A CE1 1 
ATOM   831  C  CE2 . PHE A 1 99 ? 30.326 22.581 29.586 1.00 16.38 ? 99   PHE A CE2 1 
ATOM   832  C  CZ  . PHE A 1 99 ? 29.383 23.548 29.344 1.00 17.25 ? 99   PHE A CZ  1 
ATOM   833  O  OXT . PHE A 1 99 ? 28.387 19.377 32.842 1.00 16.77 ? 99   PHE A OXT 1 
ATOM   834  N  N   . PRO B 1 1  ? 28.834 21.642 33.967 1.00 16.84 ? 101  PRO B N   1 
ATOM   835  C  CA  . PRO B 1 1  ? 27.849 22.299 34.795 1.00 14.27 ? 101  PRO B CA  1 
ATOM   836  C  C   . PRO B 1 1  ? 26.410 22.111 34.317 1.00 10.27 ? 101  PRO B C   1 
ATOM   837  O  O   . PRO B 1 1  ? 26.188 21.635 33.218 1.00 11.85 ? 101  PRO B O   1 
ATOM   838  C  CB  . PRO B 1 1  ? 28.294 23.766 34.583 1.00 21.23 ? 101  PRO B CB  1 
ATOM   839  C  CG  . PRO B 1 1  ? 28.902 23.816 33.226 1.00 25.54 ? 101  PRO B CG  1 
ATOM   840  C  CD  . PRO B 1 1  ? 29.518 22.468 32.964 1.00 25.36 ? 101  PRO B CD  1 
ATOM   841  N  N   . GLN B 1 2  ? 25.447 22.496 35.117 1.00 9.75  ? 102  GLN B N   1 
ATOM   842  C  CA  . GLN B 1 2  ? 24.044 22.629 34.758 1.00 7.71  ? 102  GLN B CA  1 
ATOM   843  C  C   . GLN B 1 2  ? 23.760 24.095 34.472 1.00 7.94  ? 102  GLN B C   1 
ATOM   844  O  O   . GLN B 1 2  ? 23.969 24.912 35.375 1.00 12.03 ? 102  GLN B O   1 
ATOM   845  C  CB  . GLN B 1 2  ? 23.136 22.090 35.882 1.00 8.85  ? 102  GLN B CB  1 
ATOM   846  C  CG  . GLN B 1 2  ? 21.668 22.394 35.591 1.00 9.64  ? 102  GLN B CG  1 
ATOM   847  C  CD  . GLN B 1 2  ? 20.772 21.439 36.390 1.00 9.67  ? 102  GLN B CD  1 
ATOM   848  O  OE1 . GLN B 1 2  ? 20.292 20.411 35.876 1.00 16.69 ? 102  GLN B OE1 1 
ATOM   849  N  NE2 . GLN B 1 2  ? 20.515 21.784 37.645 1.00 10.99 ? 102  GLN B NE2 1 
ATOM   850  N  N   . ILE B 1 3  ? 23.335 24.406 33.253 1.00 6.80  ? 103  ILE B N   1 
ATOM   851  C  CA  . ILE B 1 3  ? 23.138 25.798 32.811 1.00 6.85  ? 103  ILE B CA  1 
ATOM   852  C  C   . ILE B 1 3  ? 21.664 26.071 32.597 1.00 6.63  ? 103  ILE B C   1 
ATOM   853  O  O   . ILE B 1 3  ? 20.992 25.407 31.766 1.00 7.43  ? 103  ILE B O   1 
ATOM   854  C  CB  . ILE B 1 3  ? 23.940 26.047 31.519 1.00 7.99  ? 103  ILE B CB  1 
ATOM   855  C  CG1 . ILE B 1 3  ? 25.441 25.762 31.749 1.00 11.19 ? 103  ILE B CG1 1 
ATOM   856  C  CG2 . ILE B 1 3  ? 23.692 27.424 30.956 1.00 10.05 ? 103  ILE B CG2 1 
ATOM   857  C  CD1 . ILE B 1 3  ? 26.311 25.938 30.495 1.00 14.94 ? 103  ILE B CD1 1 
ATOM   858  N  N   . THR B 1 4  ? 21.124 26.972 33.388 1.00 6.47  ? 104  THR B N   1 
ATOM   859  C  CA  . THR B 1 4  ? 19.772 27.425 33.188 1.00 5.95  ? 104  THR B CA  1 
ATOM   860  C  C   . THR B 1 4  ? 19.750 28.505 32.099 1.00 6.04  ? 104  THR B C   1 
ATOM   861  O  O   . THR B 1 4  ? 20.793 28.952 31.656 1.00 7.14  ? 104  THR B O   1 
ATOM   862  C  CB  . THR B 1 4  ? 19.130 27.933 34.513 1.00 7.12  ? 104  THR B CB  1 
ATOM   863  O  OG1 . THR B 1 4  ? 19.945 29.039 34.926 1.00 8.86  ? 104  THR B OG1 1 
ATOM   864  C  CG2 . THR B 1 4  ? 19.126 26.846 35.564 1.00 8.30  ? 104  THR B CG2 1 
ATOM   865  N  N   . LEU B 1 5  ? 18.547 28.872 31.676 1.00 5.88  ? 105  LEU B N   1 
ATOM   866  C  CA  . LEU B 1 5  ? 18.407 29.593 30.409 1.00 5.85  ? 105  LEU B CA  1 
ATOM   867  C  C   . LEU B 1 5  ? 17.762 30.954 30.536 1.00 6.31  ? 105  LEU B C   1 
ATOM   868  O  O   . LEU B 1 5  ? 17.297 31.542 29.530 1.00 6.76  ? 105  LEU B O   1 
ATOM   869  C  CB  . LEU B 1 5  ? 17.677 28.687 29.368 1.00 6.16  ? 105  LEU B CB  1 
ATOM   870  C  CG  . LEU B 1 5  ? 18.524 27.444 29.022 1.00 5.94  ? 105  LEU B CG  1 
ATOM   871  C  CD1 . LEU B 1 5  ? 17.677 26.417 28.260 1.00 7.71  ? 105  LEU B CD1 1 
ATOM   872  C  CD2 . LEU B 1 5  ? 19.796 27.826 28.253 1.00 8.13  ? 105  LEU B CD2 1 
ATOM   873  N  N   . TRP B 1 6  ? 17.747 31.522 31.726 1.00 6.78  ? 106  TRP B N   1 
ATOM   874  C  CA  . TRP B 1 6  ? 17.240 32.886 31.923 1.00 7.60  ? 106  TRP B CA  1 
ATOM   875  C  C   . TRP B 1 6  ? 18.154 33.911 31.272 1.00 7.49  ? 106  TRP B C   1 
ATOM   876  O  O   . TRP B 1 6  ? 17.674 34.985 30.922 1.00 10.49 ? 106  TRP B O   1 
ATOM   877  C  CB  A TRP B 1 6  ? 16.842 33.164 33.380 0.49 9.88  ? 106  TRP B CB  1 
ATOM   878  C  CB  B TRP B 1 6  ? 17.230 33.224 33.438 0.51 8.59  ? 106  TRP B CB  1 
ATOM   879  C  CG  A TRP B 1 6  ? 15.519 32.532 33.776 0.49 10.12 ? 106  TRP B CG  1 
ATOM   880  C  CG  B TRP B 1 6  ? 16.417 32.195 34.173 0.51 7.86  ? 106  TRP B CG  1 
ATOM   881  C  CD1 A TRP B 1 6  ? 14.229 32.945 33.516 0.49 10.27 ? 106  TRP B CD1 1 
ATOM   882  C  CD1 B TRP B 1 6  ? 16.843 31.124 34.896 0.51 11.31 ? 106  TRP B CD1 1 
ATOM   883  C  CD2 A TRP B 1 6  ? 15.390 31.320 34.532 0.49 10.12 ? 106  TRP B CD2 1 
ATOM   884  C  CD2 B TRP B 1 6  ? 14.989 32.163 34.214 0.51 8.17  ? 106  TRP B CD2 1 
ATOM   885  N  NE1 A TRP B 1 6  ? 13.318 32.062 34.067 0.49 11.86 ? 106  TRP B NE1 1 
ATOM   886  N  NE1 B TRP B 1 6  ? 15.766 30.420 35.394 0.51 12.08 ? 106  TRP B NE1 1 
ATOM   887  C  CE2 A TRP B 1 6  ? 14.012 31.063 34.696 0.49 9.51  ? 106  TRP B CE2 1 
ATOM   888  C  CE2 B TRP B 1 6  ? 14.620 31.036 34.996 0.51 11.00 ? 106  TRP B CE2 1 
ATOM   889  C  CE3 A TRP B 1 6  ? 16.273 30.414 35.107 0.49 11.83 ? 106  TRP B CE3 1 
ATOM   890  C  CE3 B TRP B 1 6  ? 13.978 32.985 33.671 0.51 9.77  ? 106  TRP B CE3 1 
ATOM   891  C  CZ2 A TRP B 1 6  ? 13.524 29.966 35.386 0.49 11.16 ? 106  TRP B CZ2 1 
ATOM   892  C  CZ2 B TRP B 1 6  ? 13.301 30.716 35.241 0.51 11.49 ? 106  TRP B CZ2 1 
ATOM   893  C  CZ3 A TRP B 1 6  ? 15.804 29.321 35.796 0.49 11.05 ? 106  TRP B CZ3 1 
ATOM   894  C  CZ3 B TRP B 1 6  ? 12.662 32.650 33.926 0.51 10.99 ? 106  TRP B CZ3 1 
ATOM   895  C  CH2 A TRP B 1 6  ? 14.424 29.103 35.935 0.49 12.65 ? 106  TRP B CH2 1 
ATOM   896  C  CH2 B TRP B 1 6  ? 12.367 31.527 34.707 0.51 11.78 ? 106  TRP B CH2 1 
ATOM   897  N  N   . LYS B 1 7  ? 19.424 33.615 31.096 1.00 7.73  ? 107  LYS B N   1 
ATOM   898  C  CA  . LYS B 1 7  ? 20.390 34.396 30.393 1.00 8.96  ? 107  LYS B CA  1 
ATOM   899  C  C   . LYS B 1 7  ? 20.914 33.600 29.214 1.00 7.02  ? 107  LYS B C   1 
ATOM   900  O  O   . LYS B 1 7  ? 20.812 32.379 29.180 1.00 6.86  ? 107  LYS B O   1 
ATOM   901  C  CB  . LYS B 1 7  ? 21.559 34.723 31.311 1.00 13.56 ? 107  LYS B CB  1 
ATOM   902  C  CG  . LYS B 1 7  ? 21.160 35.362 32.620 1.00 22.68 ? 107  LYS B CG  1 
ATOM   903  C  CD  . LYS B 1 7  ? 22.403 35.729 33.397 1.00 36.50 ? 107  LYS B CD  1 
ATOM   904  C  CE  . LYS B 1 7  ? 22.807 34.737 34.483 1.00 46.66 ? 107  LYS B CE  1 
ATOM   905  N  NZ  . LYS B 1 7  ? 22.783 35.188 35.898 1.00 48.76 ? 107  LYS B NZ  1 
ATOM   906  N  N   . ARG B 1 8  ? 21.515 34.275 28.238 1.00 7.24  ? 108  ARG B N   1 
ATOM   907  C  CA  . ARG B 1 8  ? 22.188 33.562 27.144 1.00 6.92  ? 108  ARG B CA  1 
ATOM   908  C  C   . ARG B 1 8  ? 23.259 32.626 27.691 1.00 5.88  ? 108  ARG B C   1 
ATOM   909  O  O   . ARG B 1 8  ? 24.023 33.039 28.563 1.00 7.23  ? 108  ARG B O   1 
ATOM   910  C  CB  . ARG B 1 8  ? 22.819 34.542 26.171 1.00 7.71  ? 108  ARG B CB  1 
ATOM   911  C  CG  . ARG B 1 8  ? 21.788 35.333 25.371 1.00 9.19  ? 108  ARG B CG  1 
ATOM   912  C  CD  A ARG B 1 8  ? 22.416 36.293 24.397 0.54 9.16  ? 108  ARG B CD  1 
ATOM   913  C  CD  B ARG B 1 8  ? 22.549 36.292 24.454 0.46 12.58 ? 108  ARG B CD  1 
ATOM   914  N  NE  A ARG B 1 8  ? 21.436 37.067 23.674 0.54 8.37  ? 108  ARG B NE  1 
ATOM   915  N  NE  B ARG B 1 8  ? 23.292 37.331 25.158 0.46 17.46 ? 108  ARG B NE  1 
ATOM   916  C  CZ  A ARG B 1 8  ? 21.626 38.221 23.053 0.54 12.22 ? 108  ARG B CZ  1 
ATOM   917  C  CZ  B ARG B 1 8  ? 24.385 38.015 24.856 0.46 24.26 ? 108  ARG B CZ  1 
ATOM   918  N  NH1 A ARG B 1 8  ? 22.835 38.758 23.081 0.54 15.97 ? 108  ARG B NH1 1 
ATOM   919  N  NH1 B ARG B 1 8  ? 25.100 37.872 23.736 0.46 26.95 ? 108  ARG B NH1 1 
ATOM   920  N  NH2 A ARG B 1 8  ? 20.581 38.762 22.448 0.54 13.66 ? 108  ARG B NH2 1 
ATOM   921  N  NH2 B ARG B 1 8  ? 24.876 38.945 25.675 0.46 31.03 ? 108  ARG B NH2 1 
ATOM   922  N  N   . PRO B 1 9  ? 23.364 31.422 27.190 1.00 5.81  ? 109  PRO B N   1 
ATOM   923  C  CA  . PRO B 1 9  ? 24.371 30.449 27.653 1.00 5.92  ? 109  PRO B CA  1 
ATOM   924  C  C   . PRO B 1 9  ? 25.715 30.729 26.973 1.00 5.57  ? 109  PRO B C   1 
ATOM   925  O  O   . PRO B 1 9  ? 26.186 30.026 26.077 1.00 6.43  ? 109  PRO B O   1 
ATOM   926  C  CB  . PRO B 1 9  ? 23.780 29.107 27.303 1.00 7.03  ? 109  PRO B CB  1 
ATOM   927  C  CG  . PRO B 1 9  ? 22.954 29.368 26.102 1.00 7.03  ? 109  PRO B CG  1 
ATOM   928  C  CD  . PRO B 1 9  ? 22.358 30.743 26.338 1.00 7.06  ? 109  PRO B CD  1 
ATOM   929  N  N   . LEU B 1 10 ? 26.351 31.809 27.430 1.00 6.43  ? 110  LEU B N   1 
ATOM   930  C  CA  . LEU B 1 10 ? 27.634 32.258 26.948 1.00 6.50  ? 110  LEU B CA  1 
ATOM   931  C  C   . LEU B 1 10 ? 28.753 31.648 27.731 1.00 6.47  ? 110  LEU B C   1 
ATOM   932  O  O   . LEU B 1 10 ? 28.691 31.574 28.965 1.00 9.53  ? 110  LEU B O   1 
ATOM   933  C  CB  . LEU B 1 10 ? 27.706 33.785 27.031 1.00 8.48  ? 110  LEU B CB  1 
ATOM   934  C  CG  . LEU B 1 10 ? 26.717 34.521 26.141 1.00 10.90 ? 110  LEU B CG  1 
ATOM   935  C  CD1 . LEU B 1 10 ? 26.729 36.002 26.558 1.00 15.06 ? 110  LEU B CD1 1 
ATOM   936  C  CD2 . LEU B 1 10 ? 27.112 34.395 24.700 1.00 12.90 ? 110  LEU B CD2 1 
ATOM   937  N  N   . VAL B 1 11 ? 29.790 31.194 27.037 1.00 6.18  ? 111  VAL B N   1 
ATOM   938  C  CA  . VAL B 1 11 ? 30.958 30.595 27.658 1.00 6.99  ? 111  VAL B CA  1 
ATOM   939  C  C   . VAL B 1 11 ? 32.206 31.158 27.006 1.00 5.80  ? 111  VAL B C   1 
ATOM   940  O  O   . VAL B 1 11 ? 32.154 31.736 25.925 1.00 7.40  ? 111  VAL B O   1 
ATOM   941  C  CB  . VAL B 1 11 ? 30.965 29.078 27.542 1.00 8.86  ? 111  VAL B CB  1 
ATOM   942  C  CG1 . VAL B 1 11 ? 29.767 28.476 28.279 1.00 11.66 ? 111  VAL B CG1 1 
ATOM   943  C  CG2 . VAL B 1 11 ? 31.008 28.603 26.098 1.00 11.73 ? 111  VAL B CG2 1 
ATOM   944  N  N   . THR B 1 12 ? 33.344 30.987 27.643 1.00 6.71  ? 112  THR B N   1 
ATOM   945  C  CA  . THR B 1 12 ? 34.618 31.265 27.045 1.00 6.13  ? 112  THR B CA  1 
ATOM   946  C  C   . THR B 1 12 ? 35.121 30.026 26.325 1.00 6.27  ? 112  THR B C   1 
ATOM   947  O  O   . THR B 1 12 ? 35.126 28.917 26.880 1.00 7.90  ? 112  THR B O   1 
ATOM   948  C  CB  . THR B 1 12 ? 35.626 31.746 28.090 1.00 7.95  ? 112  THR B CB  1 
ATOM   949  O  OG1 . THR B 1 12 ? 35.079 32.883 28.741 1.00 10.49 ? 112  THR B OG1 1 
ATOM   950  C  CG2 . THR B 1 12 ? 36.959 32.133 27.466 1.00 9.13  ? 112  THR B CG2 1 
ATOM   951  N  N   . ILE B 1 13 ? 35.607 30.251 25.111 1.00 5.70  ? 113  ILE B N   1 
ATOM   952  C  CA  . ILE B 1 13 ? 36.253 29.208 24.307 1.00 5.81  ? 113  ILE B CA  1 
ATOM   953  C  C   . ILE B 1 13 ? 37.694 29.624 24.049 1.00 6.22  ? 113  ILE B C   1 
ATOM   954  O  O   . ILE B 1 13 ? 38.050 30.787 24.133 1.00 6.91  ? 113  ILE B O   1 
ATOM   955  C  CB  . ILE B 1 13 ? 35.501 28.983 23.007 1.00 5.83  ? 113  ILE B CB  1 
ATOM   956  C  CG1 . ILE B 1 13 ? 35.573 30.178 22.049 1.00 7.45  ? 113  ILE B CG1 1 
ATOM   957  C  CG2 . ILE B 1 13 ? 34.083 28.540 23.282 1.00 6.85  ? 113  ILE B CG2 1 
ATOM   958  C  CD1 . ILE B 1 13 ? 35.131 29.863 20.612 1.00 8.10  ? 113  ILE B CD1 1 
ATOM   959  N  N   . LYS B 1 14 ? 38.521 28.645 23.671 1.00 6.43  ? 114  LYS B N   1 
ATOM   960  C  CA  . LYS B 1 14 ? 39.861 28.898 23.222 1.00 6.94  ? 114  LYS B CA  1 
ATOM   961  C  C   . LYS B 1 14 ? 39.978 28.241 21.858 1.00 6.85  ? 114  LYS B C   1 
ATOM   962  O  O   . LYS B 1 14 ? 39.736 27.013 21.762 1.00 8.21  ? 114  LYS B O   1 
ATOM   963  C  CB  . LYS B 1 14 ? 40.931 28.341 24.165 1.00 8.48  ? 114  LYS B CB  1 
ATOM   964  C  CG  . LYS B 1 14 ? 42.335 28.690 23.718 1.00 14.44 ? 114  LYS B CG  1 
ATOM   965  C  CD  A LYS B 1 14 ? 43.243 28.619 24.945 0.51 18.61 ? 114  LYS B CD  1 
ATOM   966  C  CD  B LYS B 1 14 ? 43.399 28.317 24.731 0.49 17.67 ? 114  LYS B CD  1 
ATOM   967  C  CE  A LYS B 1 14 ? 44.236 27.481 24.948 0.51 21.77 ? 114  LYS B CE  1 
ATOM   968  C  CE  B LYS B 1 14 ? 43.196 26.961 25.350 0.49 18.93 ? 114  LYS B CE  1 
ATOM   969  N  NZ  A LYS B 1 14 ? 43.571 26.150 24.822 0.51 28.78 ? 114  LYS B NZ  1 
ATOM   970  N  NZ  B LYS B 1 14 ? 43.369 25.860 24.349 0.49 32.30 ? 114  LYS B NZ  1 
ATOM   971  N  N   . ILE B 1 15 ? 40.334 29.003 20.837 1.00 7.19  ? 115  ILE B N   1 
ATOM   972  C  CA  . ILE B 1 15 ? 40.431 28.509 19.471 1.00 7.02  ? 115  ILE B CA  1 
ATOM   973  C  C   . ILE B 1 15 ? 41.635 29.214 18.845 1.00 7.07  ? 115  ILE B C   1 
ATOM   974  O  O   . ILE B 1 15 ? 41.792 30.429 18.979 1.00 7.37  ? 115  ILE B O   1 
ATOM   975  C  CB  . ILE B 1 15 ? 39.146 28.719 18.689 1.00 8.19  ? 115  ILE B CB  1 
ATOM   976  C  CG1 . ILE B 1 15 ? 39.245 28.178 17.259 1.00 10.22 ? 115  ILE B CG1 1 
ATOM   977  C  CG2 . ILE B 1 15 ? 38.675 30.179 18.763 1.00 9.25  ? 115  ILE B CG2 1 
ATOM   978  C  CD1 . ILE B 1 15 ? 37.991 28.244 16.438 1.00 11.90 ? 115  ILE B CD1 1 
ATOM   979  N  N   . GLY B 1 16 ? 42.484 28.460 18.167 1.00 8.15  ? 116  GLY B N   1 
ATOM   980  C  CA  . GLY B 1 16 ? 43.715 29.006 17.622 1.00 8.50  ? 116  GLY B CA  1 
ATOM   981  C  C   . GLY B 1 16 ? 44.613 29.585 18.712 1.00 8.60  ? 116  GLY B C   1 
ATOM   982  O  O   . GLY B 1 16 ? 45.441 30.447 18.411 1.00 10.58 ? 116  GLY B O   1 
ATOM   983  N  N   . GLY B 1 17 ? 44.441 29.140 19.943 1.00 9.29  ? 117  GLY B N   1 
ATOM   984  C  CA  . GLY B 1 17 ? 45.161 29.744 21.057 1.00 11.55 ? 117  GLY B CA  1 
ATOM   985  C  C   . GLY B 1 17 ? 44.583 30.998 21.632 1.00 11.91 ? 117  GLY B C   1 
ATOM   986  O  O   . GLY B 1 17 ? 45.127 31.482 22.644 1.00 13.85 ? 117  GLY B O   1 
ATOM   987  N  N   . GLN B 1 18 ? 43.502 31.505 21.096 1.00 8.98  ? 118  GLN B N   1 
ATOM   988  C  CA  . GLN B 1 18 ? 42.895 32.780 21.492 1.00 9.75  ? 118  GLN B CA  1 
ATOM   989  C  C   . GLN B 1 18 ? 41.589 32.547 22.239 1.00 8.19  ? 118  GLN B C   1 
ATOM   990  O  O   . GLN B 1 18 ? 40.783 31.710 21.856 1.00 9.13  ? 118  GLN B O   1 
ATOM   991  C  CB  . GLN B 1 18 ? 42.628 33.649 20.275 1.00 12.00 ? 118  GLN B CB  1 
ATOM   992  C  CG  . GLN B 1 18 ? 41.992 34.981 20.540 1.00 15.63 ? 118  GLN B CG  1 
ATOM   993  C  CD  . GLN B 1 18 ? 41.720 35.769 19.277 1.00 16.14 ? 118  GLN B CD  1 
ATOM   994  O  OE1 . GLN B 1 18 ? 40.933 35.420 18.407 1.00 25.74 ? 118  GLN B OE1 1 
ATOM   995  N  NE2 . GLN B 1 18 ? 42.424 36.926 19.185 1.00 21.33 ? 118  GLN B NE2 1 
ATOM   996  N  N   . LEU B 1 19 ? 41.348 33.333 23.272 1.00 8.41  ? 119  LEU B N   1 
ATOM   997  C  CA  . LEU B 1 19 ? 40.076 33.270 23.994 1.00 7.93  ? 119  LEU B CA  1 
ATOM   998  C  C   . LEU B 1 19 ? 39.029 34.120 23.305 1.00 7.79  ? 119  LEU B C   1 
ATOM   999  O  O   . LEU B 1 19 ? 39.266 35.239 22.866 1.00 9.88  ? 119  LEU B O   1 
ATOM   1000 C  CB  . LEU B 1 19 ? 40.245 33.774 25.422 1.00 10.53 ? 119  LEU B CB  1 
ATOM   1001 C  CG  . LEU B 1 19 ? 41.267 33.042 26.284 1.00 12.25 ? 119  LEU B CG  1 
ATOM   1002 C  CD1 . LEU B 1 19 ? 41.298 33.656 27.673 1.00 17.94 ? 119  LEU B CD1 1 
ATOM   1003 C  CD2 . LEU B 1 19 ? 40.931 31.558 26.308 1.00 12.97 ? 119  LEU B CD2 1 
ATOM   1004 N  N   . LYS B 1 20 ? 37.819 33.581 23.215 1.00 7.08  ? 120  LYS B N   1 
ATOM   1005 C  CA  . LYS B 1 20 ? 36.669 34.254 22.648 1.00 7.28  ? 120  LYS B CA  1 
ATOM   1006 C  C   . LYS B 1 20 ? 35.440 33.881 23.471 1.00 6.27  ? 120  LYS B C   1 
ATOM   1007 O  O   . LYS B 1 20 ? 35.445 32.904 24.212 1.00 8.59  ? 120  LYS B O   1 
ATOM   1008 C  CB  . LYS B 1 20 ? 36.412 33.829 21.171 1.00 8.86  ? 120  LYS B CB  1 
ATOM   1009 C  CG  . LYS B 1 20 ? 37.545 34.151 20.210 1.00 17.41 ? 120  LYS B CG  1 
ATOM   1010 C  CD  . LYS B 1 20 ? 37.136 33.880 18.775 1.00 20.81 ? 120  LYS B CD  1 
ATOM   1011 C  CE  A LYS B 1 20 ? 37.808 34.815 17.785 0.53 23.61 ? 120  LYS B CE  1 
ATOM   1012 C  CE  B LYS B 1 20 ? 38.081 34.551 17.795 0.47 24.46 ? 120  LYS B CE  1 
ATOM   1013 N  NZ  A LYS B 1 20 ? 38.528 35.959 18.429 0.53 25.67 ? 120  LYS B NZ  1 
ATOM   1014 N  NZ  B LYS B 1 20 ? 37.772 36.002 17.621 0.47 19.74 ? 120  LYS B NZ  1 
ATOM   1015 N  N   . GLU B 1 21 ? 34.372 34.625 23.344 1.00 6.80  ? 121  GLU B N   1 
ATOM   1016 C  CA  . GLU B 1 21 ? 33.084 34.310 23.908 1.00 6.90  ? 121  GLU B CA  1 
ATOM   1017 C  C   . GLU B 1 21 ? 32.233 33.609 22.866 1.00 5.83  ? 121  GLU B C   1 
ATOM   1018 O  O   . GLU B 1 21 ? 32.243 34.019 21.707 1.00 7.90  ? 121  GLU B O   1 
ATOM   1019 C  CB  . GLU B 1 21 ? 32.395 35.585 24.384 1.00 9.40  ? 121  GLU B CB  1 
ATOM   1020 C  CG  A GLU B 1 21 ? 31.024 35.367 25.016 0.57 12.15 ? 121  GLU B CG  1 
ATOM   1021 C  CG  B GLU B 1 21 ? 31.431 35.426 25.558 0.43 18.52 ? 121  GLU B CG  1 
ATOM   1022 C  CD  A GLU B 1 21 ? 30.437 36.732 25.442 0.57 19.67 ? 121  GLU B CD  1 
ATOM   1023 C  CD  B GLU B 1 21 ? 31.429 36.687 26.434 0.43 28.18 ? 121  GLU B CD  1 
ATOM   1024 O  OE1 A GLU B 1 21 ? 30.638 37.084 26.612 0.57 36.22 ? 121  GLU B OE1 1 
ATOM   1025 O  OE1 B GLU B 1 21 ? 32.441 37.436 26.437 0.43 34.65 ? 121  GLU B OE1 1 
ATOM   1026 O  OE2 A GLU B 1 21 ? 29.834 37.413 24.611 0.57 24.61 ? 121  GLU B OE2 1 
ATOM   1027 O  OE2 B GLU B 1 21 ? 30.414 36.941 27.129 0.43 37.10 ? 121  GLU B OE2 1 
ATOM   1028 N  N   . ALA B 1 22 ? 31.467 32.605 23.227 1.00 5.67  ? 122  ALA B N   1 
ATOM   1029 C  CA  . ALA B 1 22 ? 30.593 31.908 22.318 1.00 5.16  ? 122  ALA B CA  1 
ATOM   1030 C  C   . ALA B 1 22 ? 29.312 31.469 23.027 1.00 5.10  ? 122  ALA B C   1 
ATOM   1031 O  O   . ALA B 1 22 ? 29.271 31.317 24.236 1.00 6.97  ? 122  ALA B O   1 
ATOM   1032 C  CB  . ALA B 1 22 ? 31.304 30.725 21.653 1.00 6.71  ? 122  ALA B CB  1 
ATOM   1033 N  N   . LEU B 1 23 ? 28.294 31.268 22.214 1.00 4.74  ? 123  LEU B N   1 
ATOM   1034 C  CA  . LEU B 1 23 ? 26.969 30.897 22.634 1.00 4.92  ? 123  LEU B CA  1 
ATOM   1035 C  C   . LEU B 1 23 ? 26.781 29.398 22.427 1.00 4.71  ? 123  LEU B C   1 
ATOM   1036 O  O   . LEU B 1 23 ? 26.944 28.897 21.318 1.00 6.25  ? 123  LEU B O   1 
ATOM   1037 C  CB  . LEU B 1 23 ? 25.992 31.682 21.739 1.00 6.06  ? 123  LEU B CB  1 
ATOM   1038 C  CG  . LEU B 1 23 ? 24.515 31.508 22.023 1.00 7.12  ? 123  LEU B CG  1 
ATOM   1039 C  CD1 . LEU B 1 23 ? 24.146 32.117 23.368 1.00 9.60  ? 123  LEU B CD1 1 
ATOM   1040 C  CD2 . LEU B 1 23 ? 23.735 32.161 20.896 1.00 9.75  ? 123  LEU B CD2 1 
ATOM   1041 N  N   . LEU B 1 24 ? 26.383 28.659 23.484 1.00 4.87  ? 124  LEU B N   1 
ATOM   1042 C  CA  . LEU B 1 24 ? 26.032 27.238 23.334 1.00 5.31  ? 124  LEU B CA  1 
ATOM   1043 C  C   . LEU B 1 24 ? 24.658 27.140 22.676 1.00 5.10  ? 124  LEU B C   1 
ATOM   1044 O  O   . LEU B 1 24 ? 23.676 27.648 23.221 1.00 6.44  ? 124  LEU B O   1 
ATOM   1045 C  CB  . LEU B 1 24 ? 26.030 26.569 24.691 1.00 6.35  ? 124  LEU B CB  1 
ATOM   1046 C  CG  . LEU B 1 24 ? 27.345 26.677 25.463 1.00 6.72  ? 124  LEU B CG  1 
ATOM   1047 C  CD1 . LEU B 1 24 ? 27.179 25.972 26.836 1.00 11.24 ? 124  LEU B CD1 1 
ATOM   1048 C  CD2 . LEU B 1 24 ? 28.494 26.108 24.664 1.00 9.42  ? 124  LEU B CD2 1 
ATOM   1049 N  N   . ASP B 1 25 ? 24.610 26.549 21.479 1.00 4.88  ? 125  ASP B N   1 
ATOM   1050 C  CA  . ASP B 1 25 ? 23.451 26.717 20.577 1.00 4.75  ? 125  ASP B CA  1 
ATOM   1051 C  C   . ASP B 1 25 ? 22.915 25.358 20.109 1.00 4.64  ? 125  ASP B C   1 
ATOM   1052 O  O   . ASP B 1 25 ? 23.376 24.807 19.094 1.00 4.61  ? 125  ASP B O   1 
ATOM   1053 C  CB  . ASP B 1 25 ? 23.899 27.606 19.422 1.00 6.38  ? 125  ASP B CB  1 
ATOM   1054 C  CG  . ASP B 1 25 ? 22.845 28.060 18.482 1.00 7.01  ? 125  ASP B CG  1 
ATOM   1055 O  OD1 . ASP B 1 25 ? 21.700 27.501 18.655 1.00 7.89  ? 125  ASP B OD1 1 
ATOM   1056 O  OD2 . ASP B 1 25 ? 23.036 28.903 17.610 1.00 9.38  ? 125  ASP B OD2 1 
ATOM   1057 N  N   . THR B 1 26 ? 21.943 24.813 20.822 1.00 4.36  ? 126  THR B N   1 
ATOM   1058 C  CA  . THR B 1 26 ? 21.406 23.513 20.471 1.00 4.15  ? 126  THR B CA  1 
ATOM   1059 C  C   . THR B 1 26 ? 20.631 23.509 19.177 1.00 3.96  ? 126  THR B C   1 
ATOM   1060 O  O   . THR B 1 26 ? 20.437 22.428 18.588 1.00 4.85  ? 126  THR B O   1 
ATOM   1061 C  CB  . THR B 1 26 ? 20.554 22.946 21.587 1.00 3.95  ? 126  THR B CB  1 
ATOM   1062 O  OG1 . THR B 1 26 ? 19.486 23.838 21.890 1.00 4.44  ? 126  THR B OG1 1 
ATOM   1063 C  CG2 . THR B 1 26 ? 21.347 22.697 22.871 1.00 4.71  ? 126  THR B CG2 1 
ATOM   1064 N  N   . GLY B 1 27 ? 20.198 24.659 18.681 1.00 4.39  ? 127  GLY B N   1 
ATOM   1065 C  CA  . GLY B 1 27 ? 19.538 24.816 17.405 1.00 4.36  ? 127  GLY B CA  1 
ATOM   1066 C  C   . GLY B 1 27 ? 20.498 24.904 16.221 1.00 4.24  ? 127  GLY B C   1 
ATOM   1067 O  O   . GLY B 1 27 ? 20.031 25.033 15.082 1.00 5.69  ? 127  GLY B O   1 
ATOM   1068 N  N   . ALA B 1 28 ? 21.798 24.838 16.456 1.00 4.33  ? 128  ALA B N   1 
ATOM   1069 C  CA  . ALA B 1 28 ? 22.789 24.893 15.386 1.00 4.56  ? 128  ALA B CA  1 
ATOM   1070 C  C   . ALA B 1 28 ? 23.356 23.483 15.186 1.00 4.19  ? 128  ALA B C   1 
ATOM   1071 O  O   . ALA B 1 28 ? 23.882 22.868 16.122 1.00 4.89  ? 128  ALA B O   1 
ATOM   1072 C  CB  . ALA B 1 28 ? 23.903 25.835 15.740 1.00 4.77  ? 128  ALA B CB  1 
ATOM   1073 N  N   . ASP B 1 29 ? 23.301 22.996 13.955 1.00 4.33  ? 129  ASP B N   1 
ATOM   1074 C  CA  . ASP B 1 29 ? 23.969 21.741 13.614 1.00 4.86  ? 129  ASP B CA  1 
ATOM   1075 C  C   . ASP B 1 29 ? 25.477 21.891 13.716 1.00 4.97  ? 129  ASP B C   1 
ATOM   1076 O  O   . ASP B 1 29 ? 26.174 20.957 14.111 1.00 6.28  ? 129  ASP B O   1 
ATOM   1077 C  CB  . ASP B 1 29 ? 23.628 21.291 12.179 1.00 6.36  ? 129  ASP B CB  1 
ATOM   1078 C  CG  . ASP B 1 29 ? 22.167 21.063 11.886 1.00 7.17  ? 129  ASP B CG  1 
ATOM   1079 O  OD1 . ASP B 1 29 ? 21.305 20.961 12.779 1.00 7.52  ? 129  ASP B OD1 1 
ATOM   1080 O  OD2 . ASP B 1 29 ? 21.855 21.020 10.654 1.00 11.11 ? 129  ASP B OD2 1 
ATOM   1081 N  N   . ASP B 1 30 ? 25.953 23.045 13.295 1.00 4.79  ? 130  ASP B N   1 
ATOM   1082 C  CA  . ASP B 1 30 ? 27.352 23.365 13.066 1.00 5.26  ? 130  ASP B CA  1 
ATOM   1083 C  C   . ASP B 1 30 ? 27.814 24.515 13.921 1.00 4.80  ? 130  ASP B C   1 
ATOM   1084 O  O   . ASP B 1 30 ? 27.031 25.314 14.408 1.00 7.04  ? 130  ASP B O   1 
ATOM   1085 C  CB  . ASP B 1 30 ? 27.533 23.731 11.592 1.00 7.45  ? 130  ASP B CB  1 
ATOM   1086 C  CG  . ASP B 1 30 ? 27.005 22.655 10.658 1.00 11.37 ? 130  ASP B CG  1 
ATOM   1087 O  OD1 . ASP B 1 30 ? 27.226 21.469 10.846 1.00 16.49 ? 130  ASP B OD1 1 
ATOM   1088 O  OD2 . ASP B 1 30 ? 26.289 23.019 9.708  1.00 24.87 ? 130  ASP B OD2 1 
ATOM   1089 N  N   . THR B 1 31 ? 29.120 24.582 14.104 1.00 5.53  ? 131  THR B N   1 
ATOM   1090 C  CA  . THR B 1 31 ? 29.810 25.640 14.885 1.00 5.38  ? 131  THR B CA  1 
ATOM   1091 C  C   . THR B 1 31 ? 30.268 26.691 13.913 1.00 4.91  ? 131  THR B C   1 
ATOM   1092 O  O   . THR B 1 31 ? 30.952 26.389 12.931 1.00 6.27  ? 131  THR B O   1 
ATOM   1093 C  CB  . THR B 1 31 ? 30.961 25.001 15.662 1.00 5.06  ? 131  THR B CB  1 
ATOM   1094 O  OG1 . THR B 1 31 ? 30.387 24.103 16.640 1.00 5.61  ? 131  THR B OG1 1 
ATOM   1095 C  CG2 . THR B 1 31 ? 31.843 26.006 16.336 1.00 5.88  ? 131  THR B CG2 1 
ATOM   1096 N  N   . VAL B 1 32 ? 29.918 27.942 14.202 1.00 5.10  ? 132  VAL B N   1 
ATOM   1097 C  CA  . VAL B 1 32 ? 30.196 29.077 13.320 1.00 4.94  ? 132  VAL B CA  1 
ATOM   1098 C  C   . VAL B 1 32 ? 30.828 30.165 14.159 1.00 5.30  ? 132  VAL B C   1 
ATOM   1099 O  O   . VAL B 1 32 ? 30.220 30.620 15.156 1.00 6.02  ? 132  VAL B O   1 
ATOM   1100 C  CB  . VAL B 1 32 ? 28.936 29.582 12.574 1.00 5.90  ? 132  VAL B CB  1 
ATOM   1101 C  CG1 . VAL B 1 32 ? 29.382 30.520 11.465 1.00 7.79  ? 132  VAL B CG1 1 
ATOM   1102 C  CG2 . VAL B 1 32 ? 28.116 28.416 12.007 1.00 6.49  ? 132  VAL B CG2 1 
ATOM   1103 N  N   . ILE B 1 33 ? 32.010 30.611 13.771 1.00 5.37  ? 133  ILE B N   1 
ATOM   1104 C  CA  . ILE B 1 33 ? 32.806 31.603 14.495 1.00 6.03  ? 133  ILE B CA  1 
ATOM   1105 C  C   . ILE B 1 33 ? 33.049 32.760 13.566 1.00 5.69  ? 133  ILE B C   1 
ATOM   1106 O  O   . ILE B 1 33 ? 33.224 32.595 12.356 1.00 6.51  ? 133  ILE B O   1 
ATOM   1107 C  CB  . ILE B 1 33 ? 34.141 30.965 14.999 1.00 8.15  ? 133  ILE B CB  1 
ATOM   1108 C  CG1 . ILE B 1 33 ? 33.867 29.743 15.882 1.00 9.59  ? 133  ILE B CG1 1 
ATOM   1109 C  CG2 . ILE B 1 33 ? 35.047 31.980 15.667 1.00 9.54  ? 133  ILE B CG2 1 
ATOM   1110 C  CD1 . ILE B 1 33 ? 33.170 30.024 17.174 1.00 10.90 ? 133  ILE B CD1 1 
ATOM   1111 N  N   . GLU B 1 34 ? 33.060 33.965 14.156 1.00 5.74  ? 134  GLU B N   1 
ATOM   1112 C  CA  . GLU B 1 34 ? 33.352 35.198 13.450 1.00 6.23  ? 134  GLU B CA  1 
ATOM   1113 C  C   . GLU B 1 34 ? 34.727 35.146 12.798 1.00 6.46  ? 134  GLU B C   1 
ATOM   1114 O  O   . GLU B 1 34 ? 35.640 34.410 13.205 1.00 7.80  ? 134  GLU B O   1 
ATOM   1115 C  CB  A GLU B 1 34 ? 33.189 36.348 14.448 0.45 7.87  ? 134  GLU B CB  1 
ATOM   1116 C  CB  B GLU B 1 34 ? 33.315 36.351 14.449 0.55 7.97  ? 134  GLU B CB  1 
ATOM   1117 C  CG  A GLU B 1 34 ? 31.778 36.529 14.966 0.45 9.34  ? 134  GLU B CG  1 
ATOM   1118 C  CG  B GLU B 1 34 ? 34.490 36.339 15.425 0.55 8.70  ? 134  GLU B CG  1 
ATOM   1119 C  CD  A GLU B 1 34 ? 31.566 37.395 16.186 0.45 14.11 ? 134  GLU B CD  1 
ATOM   1120 C  CD  B GLU B 1 34 ? 34.273 37.198 16.657 0.55 10.33 ? 134  GLU B CD  1 
ATOM   1121 O  OE1 A GLU B 1 34 ? 32.512 37.798 16.895 0.45 17.92 ? 134  GLU B OE1 1 
ATOM   1122 O  OE1 B GLU B 1 34 ? 34.805 36.871 17.746 0.55 10.10 ? 134  GLU B OE1 1 
ATOM   1123 O  OE2 A GLU B 1 34 ? 30.375 37.714 16.468 0.45 26.53 ? 134  GLU B OE2 1 
ATOM   1124 O  OE2 B GLU B 1 34 ? 33.547 38.218 16.564 0.55 20.29 ? 134  GLU B OE2 1 
ATOM   1125 N  N   . GLU B 1 35 ? 34.903 35.974 11.758 1.00 7.32  ? 135  GLU B N   1 
ATOM   1126 C  CA  . GLU B 1 35 ? 36.174 36.034 11.024 1.00 7.49  ? 135  GLU B CA  1 
ATOM   1127 C  C   . GLU B 1 35 ? 37.333 36.250 11.968 1.00 7.21  ? 135  GLU B C   1 
ATOM   1128 O  O   . GLU B 1 35 ? 37.297 37.099 12.832 1.00 8.77  ? 135  GLU B O   1 
ATOM   1129 C  CB  A GLU B 1 35 ? 36.206 37.187 10.011 0.44 11.95 ? 135  GLU B CB  1 
ATOM   1130 C  CB  B GLU B 1 35 ? 36.040 37.120 9.938  0.56 8.93  ? 135  GLU B CB  1 
ATOM   1131 C  CG  A GLU B 1 35 ? 37.386 37.043 9.043  0.44 18.72 ? 135  GLU B CG  1 
ATOM   1132 C  CG  B GLU B 1 35 ? 35.052 36.729 8.837  0.56 7.21  ? 135  GLU B CG  1 
ATOM   1133 C  CD  A GLU B 1 35 ? 37.195 35.775 8.229  0.44 25.08 ? 135  GLU B CD  1 
ATOM   1134 C  CD  B GLU B 1 35 ? 34.373 37.852 8.114  0.56 11.83 ? 135  GLU B CD  1 
ATOM   1135 O  OE1 A GLU B 1 35 ? 37.942 34.783 8.428  0.44 17.63 ? 135  GLU B OE1 1 
ATOM   1136 O  OE1 B GLU B 1 35 ? 33.920 38.818 8.782  0.56 13.92 ? 135  GLU B OE1 1 
ATOM   1137 O  OE2 A GLU B 1 35 ? 36.253 35.816 7.389  0.44 38.59 ? 135  GLU B OE2 1 
ATOM   1138 O  OE2 B GLU B 1 35 ? 34.240 37.785 6.879  0.56 13.67 ? 135  GLU B OE2 1 
ATOM   1139 N  N   . MET B 1 36 ? 38.374 35.444 11.772 1.00 8.37  ? 136  MET B N   1 
ATOM   1140 C  CA  . MET B 1 36 ? 39.565 35.450 12.573 1.00 8.69  ? 136  MET B CA  1 
ATOM   1141 C  C   . MET B 1 36 ? 40.650 34.732 11.768 1.00 9.20  ? 136  MET B C   1 
ATOM   1142 O  O   . MET B 1 36 ? 40.330 33.977 10.868 1.00 11.24 ? 136  MET B O   1 
ATOM   1143 C  CB  . MET B 1 36 ? 39.351 34.746 13.917 1.00 8.66  ? 136  MET B CB  1 
ATOM   1144 C  CG  A MET B 1 36 ? 38.945 33.299 13.976 0.42 9.69  ? 136  MET B CG  1 
ATOM   1145 C  CG  B MET B 1 36 ? 39.108 33.255 13.699 0.58 7.83  ? 136  MET B CG  1 
ATOM   1146 S  SD  A MET B 1 36 ? 38.917 32.588 15.647 0.42 11.68 ? 136  MET B SD  1 
ATOM   1147 S  SD  B MET B 1 36 ? 38.984 32.248 15.178 0.58 9.02  ? 136  MET B SD  1 
ATOM   1148 C  CE  A MET B 1 36 ? 40.605 32.875 16.165 0.42 12.38 ? 136  MET B CE  1 
ATOM   1149 C  CE  B MET B 1 36 ? 40.628 32.427 15.879 0.58 8.33  ? 136  MET B CE  1 
ATOM   1150 N  N   . SER B 1 37 ? 41.905 34.951 12.161 1.00 10.11 ? 137  SER B N   1 
ATOM   1151 C  CA  . SER B 1 37 ? 42.996 34.181 11.611 1.00 10.30 ? 137  SER B CA  1 
ATOM   1152 C  C   . SER B 1 37 ? 43.044 32.850 12.334 1.00 10.36 ? 137  SER B C   1 
ATOM   1153 O  O   . SER B 1 37 ? 43.011 32.800 13.564 1.00 13.79 ? 137  SER B O   1 
ATOM   1154 C  CB  . SER B 1 37 ? 44.326 34.934 11.796 1.00 15.31 ? 137  SER B CB  1 
ATOM   1155 O  OG  . SER B 1 37 ? 44.290 36.170 11.104 1.00 18.11 ? 137  SER B OG  1 
ATOM   1156 N  N   . LEU B 1 38 ? 43.086 31.754 11.621 1.00 9.98  ? 138  LEU B N   1 
ATOM   1157 C  CA  . LEU B 1 38 ? 43.107 30.412 12.235 1.00 10.04 ? 138  LEU B CA  1 
ATOM   1158 C  C   . LEU B 1 38 ? 44.103 29.561 11.486 1.00 11.65 ? 138  LEU B C   1 
ATOM   1159 O  O   . LEU B 1 38 ? 44.029 29.486 10.266 1.00 15.25 ? 138  LEU B O   1 
ATOM   1160 C  CB  . LEU B 1 38 ? 41.706 29.835 12.160 1.00 11.86 ? 138  LEU B CB  1 
ATOM   1161 C  CG  A LEU B 1 38 ? 40.691 29.819 13.261 0.41 14.56 ? 138  LEU B CG  1 
ATOM   1162 C  CG  B LEU B 1 38 ? 41.416 28.527 12.867 0.60 7.91  ? 138  LEU B CG  1 
ATOM   1163 C  CD1 A LEU B 1 38 ? 39.785 28.596 13.098 0.41 11.60 ? 138  LEU B CD1 1 
ATOM   1164 C  CD1 B LEU B 1 38 ? 41.672 28.556 14.366 0.60 8.90  ? 138  LEU B CD1 1 
ATOM   1165 C  CD2 A LEU B 1 38 ? 41.341 29.851 14.642 0.41 14.40 ? 138  LEU B CD2 1 
ATOM   1166 C  CD2 B LEU B 1 38 ? 39.970 28.095 12.611 0.60 7.08  ? 138  LEU B CD2 1 
ATOM   1167 N  N   A PRO B 1 39 ? 45.024 28.919 12.177 0.56 11.66 ? 139  PRO B N   1 
ATOM   1168 N  N   B PRO B 1 39 ? 45.116 28.964 12.111 0.44 13.91 ? 139  PRO B N   1 
ATOM   1169 C  CA  A PRO B 1 39 ? 45.906 27.960 11.552 0.56 13.52 ? 139  PRO B CA  1 
ATOM   1170 C  CA  B PRO B 1 39 ? 46.167 28.220 11.388 0.44 15.43 ? 139  PRO B CA  1 
ATOM   1171 C  C   A PRO B 1 39 ? 45.079 26.715 11.253 0.56 9.80  ? 139  PRO B C   1 
ATOM   1172 C  C   B PRO B 1 39 ? 45.751 27.189 10.346 0.44 16.91 ? 139  PRO B C   1 
ATOM   1173 O  O   A PRO B 1 39 ? 44.275 26.212 12.048 0.56 9.41  ? 139  PRO B O   1 
ATOM   1174 O  O   B PRO B 1 39 ? 46.345 27.044 9.243  0.44 16.63 ? 139  PRO B O   1 
ATOM   1175 C  CB  . PRO B 1 39 ? 46.935 27.613 12.618 1.00 14.68 ? 139  PRO B CB  1 
ATOM   1176 C  CG  . PRO B 1 39 ? 46.835 28.693 13.658 1.00 13.37 ? 139  PRO B CG  1 
ATOM   1177 C  CD  . PRO B 1 39 ? 45.371 29.040 13.570 1.00 13.62 ? 139  PRO B CD  1 
ATOM   1178 N  N   A GLY B 1 40 ? 45.355 26.290 10.038 0.56 11.53 ? 140  GLY B N   1 
ATOM   1179 N  N   B GLY B 1 40 ? 44.765 26.302 10.379 0.44 16.72 ? 140  GLY B N   1 
ATOM   1180 C  CA  A GLY B 1 40 ? 44.841 25.087 9.398  0.56 19.17 ? 140  GLY B CA  1 
ATOM   1181 C  CA  B GLY B 1 40 ? 44.766 25.187 9.427  0.44 19.61 ? 140  GLY B CA  1 
ATOM   1182 C  C   . GLY B 1 40 ? 44.416 25.356 7.974  1.00 20.64 ? 140  GLY B C   1 
ATOM   1183 O  O   . GLY B 1 40 ? 44.202 26.494 7.504  1.00 22.67 ? 140  GLY B O   1 
ATOM   1184 N  N   . ARG B 1 41 ? 44.313 24.286 7.183  1.00 22.18 ? 141  ARG B N   1 
ATOM   1185 C  CA  . ARG B 1 41 ? 43.794 24.334 5.822  1.00 17.49 ? 141  ARG B CA  1 
ATOM   1186 C  C   . ARG B 1 41 ? 42.308 24.536 5.916  1.00 12.97 ? 141  ARG B C   1 
ATOM   1187 O  O   . ARG B 1 41 ? 41.743 24.061 6.894  1.00 16.72 ? 141  ARG B O   1 
ATOM   1188 C  CB  A ARG B 1 41 ? 44.114 23.052 5.053  0.51 21.98 ? 141  ARG B CB  1 
ATOM   1189 C  CB  B ARG B 1 41 ? 44.085 23.049 5.052  0.49 21.38 ? 141  ARG B CB  1 
ATOM   1190 C  CG  A ARG B 1 41 ? 45.370 23.052 4.175  0.51 26.83 ? 141  ARG B CG  1 
ATOM   1191 C  CG  B ARG B 1 41 ? 45.561 22.714 4.837  0.49 23.84 ? 141  ARG B CG  1 
ATOM   1192 C  CD  A ARG B 1 41 ? 45.952 21.648 4.075  0.51 27.13 ? 141  ARG B CD  1 
ATOM   1193 C  CD  B ARG B 1 41 ? 45.601 21.491 3.895  0.49 29.71 ? 141  ARG B CD  1 
ATOM   1194 N  NE  A ARG B 1 41 ? 45.921 21.033 2.752  0.51 33.74 ? 141  ARG B NE  1 
ATOM   1195 N  NE  B ARG B 1 41 ? 44.390 20.730 4.099  0.49 39.56 ? 141  ARG B NE  1 
ATOM   1196 C  CZ  A ARG B 1 41 ? 46.489 19.864 2.478  0.51 35.94 ? 141  ARG B CZ  1 
ATOM   1197 C  CZ  B ARG B 1 41 ? 43.600 20.050 3.311  0.49 45.92 ? 141  ARG B CZ  1 
ATOM   1198 N  NH1 A ARG B 1 41 ? 47.122 19.182 3.429  0.51 44.06 ? 141  ARG B NH1 1 
ATOM   1199 N  NH1 B ARG B 1 41 ? 43.856 19.968 1.999  0.49 57.07 ? 141  ARG B NH1 1 
ATOM   1200 N  NH2 A ARG B 1 41 ? 46.447 19.338 1.257  0.51 42.79 ? 141  ARG B NH2 1 
ATOM   1201 N  NH2 B ARG B 1 41 ? 42.527 19.431 3.836  0.49 53.40 ? 141  ARG B NH2 1 
ATOM   1202 N  N   . TRP B 1 42 ? 41.700 25.168 4.912  1.00 10.95 ? 142  TRP B N   1 
ATOM   1203 C  CA  . TRP B 1 42 ? 40.273 25.385 4.896  1.00 8.50  ? 142  TRP B CA  1 
ATOM   1204 C  C   . TRP B 1 42 ? 39.716 25.185 3.493  1.00 8.38  ? 142  TRP B C   1 
ATOM   1205 O  O   . TRP B 1 42 ? 40.463 25.231 2.527  1.00 10.78 ? 142  TRP B O   1 
ATOM   1206 C  CB  . TRP B 1 42 ? 39.901 26.761 5.441  1.00 8.73  ? 142  TRP B CB  1 
ATOM   1207 C  CG  . TRP B 1 42 ? 40.471 27.931 4.714  1.00 8.72  ? 142  TRP B CG  1 
ATOM   1208 C  CD1 . TRP B 1 42 ? 41.665 28.564 4.958  1.00 11.16 ? 142  TRP B CD1 1 
ATOM   1209 C  CD2 . TRP B 1 42 ? 39.899 28.661 3.604  1.00 8.92  ? 142  TRP B CD2 1 
ATOM   1210 N  NE1 . TRP B 1 42 ? 41.842 29.617 4.076  1.00 12.68 ? 142  TRP B NE1 1 
ATOM   1211 C  CE2 . TRP B 1 42 ? 40.777 29.690 3.237  1.00 10.99 ? 142  TRP B CE2 1 
ATOM   1212 C  CE3 . TRP B 1 42 ? 38.703 28.521 2.882  1.00 9.20  ? 142  TRP B CE3 1 
ATOM   1213 C  CZ2 . TRP B 1 42 ? 40.499 30.591 2.175  1.00 12.02 ? 142  TRP B CZ2 1 
ATOM   1214 C  CZ3 . TRP B 1 42 ? 38.424 29.397 1.840  1.00 11.61 ? 142  TRP B CZ3 1 
ATOM   1215 C  CH2 . TRP B 1 42 ? 39.322 30.410 1.502  1.00 12.30 ? 142  TRP B CH2 1 
ATOM   1216 N  N   . LYS B 1 43 ? 38.411 24.939 3.456  1.00 8.42  ? 143  LYS B N   1 
ATOM   1217 C  CA  . LYS B 1 43 ? 37.691 24.756 2.205  1.00 9.62  ? 143  LYS B CA  1 
ATOM   1218 C  C   . LYS B 1 43 ? 36.541 25.731 2.158  1.00 8.64  ? 143  LYS B C   1 
ATOM   1219 O  O   . LYS B 1 43 ? 35.884 25.949 3.149  1.00 9.10  ? 143  LYS B O   1 
ATOM   1220 C  CB  . LYS B 1 43 ? 37.209 23.378 2.005  1.00 15.07 ? 143  LYS B CB  1 
ATOM   1221 C  CG  . LYS B 1 43 ? 36.248 22.638 2.862  1.00 27.00 ? 143  LYS B CG  1 
ATOM   1222 C  CD  A LYS B 1 43 ? 36.224 21.167 2.406  0.60 30.33 ? 143  LYS B CD  1 
ATOM   1223 C  CD  B LYS B 1 43 ? 36.329 21.146 2.491  0.41 30.74 ? 143  LYS B CD  1 
ATOM   1224 C  CE  A LYS B 1 43 ? 35.803 20.279 3.578  0.60 30.48 ? 143  LYS B CE  1 
ATOM   1225 C  CE  B LYS B 1 43 ? 37.430 20.539 3.352  0.41 30.52 ? 143  LYS B CE  1 
ATOM   1226 N  NZ  A LYS B 1 43 ? 36.246 18.865 3.372  0.60 41.65 ? 143  LYS B NZ  1 
ATOM   1227 N  NZ  B LYS B 1 43 ? 37.217 20.915 4.787  0.41 35.77 ? 143  LYS B NZ  1 
ATOM   1228 N  N   . PRO B 1 44 ? 36.248 26.317 0.986  1.00 8.36  ? 144  PRO B N   1 
ATOM   1229 C  CA  . PRO B 1 44 ? 35.073 27.192 0.914  1.00 9.62  ? 144  PRO B CA  1 
ATOM   1230 C  C   . PRO B 1 44 ? 33.771 26.433 1.020  1.00 9.10  ? 144  PRO B C   1 
ATOM   1231 O  O   . PRO B 1 44 ? 33.606 25.441 0.312  1.00 12.02 ? 144  PRO B O   1 
ATOM   1232 C  CB  . PRO B 1 44 ? 35.168 27.805 -0.504 1.00 13.85 ? 144  PRO B CB  1 
ATOM   1233 C  CG  . PRO B 1 44 ? 36.343 27.182 -1.128 1.00 15.57 ? 144  PRO B CG  1 
ATOM   1234 C  CD  . PRO B 1 44 ? 36.980 26.220 -0.258 1.00 10.27 ? 144  PRO B CD  1 
ATOM   1235 N  N   . LYS B 1 45 ? 32.835 26.925 1.813  1.00 8.42  ? 145  LYS B N   1 
ATOM   1236 C  CA  . LYS B 1 45 ? 31.540 26.299 1.989  1.00 8.54  ? 145  LYS B CA  1 
ATOM   1237 C  C   . LYS B 1 45 ? 30.490 27.421 2.118  1.00 7.29  ? 145  LYS B C   1 
ATOM   1238 O  O   . LYS B 1 45 ? 30.815 28.591 2.289  1.00 7.93  ? 145  LYS B O   1 
ATOM   1239 C  CB  . LYS B 1 45 ? 31.544 25.386 3.213  1.00 10.52 ? 145  LYS B CB  1 
ATOM   1240 C  CG  . LYS B 1 45 ? 32.382 24.108 3.099  1.00 13.38 ? 145  LYS B CG  1 
ATOM   1241 C  CD  . LYS B 1 45 ? 31.832 23.114 2.070  1.00 16.48 ? 145  LYS B CD  1 
ATOM   1242 C  CE  . LYS B 1 45 ? 32.595 21.804 2.067  1.00 20.39 ? 145  LYS B CE  1 
ATOM   1243 N  NZ  . LYS B 1 45 ? 31.931 20.774 1.188  1.00 29.41 ? 145  LYS B NZ  1 
ATOM   1244 N  N   . MET B 1 46 ? 29.241 27.032 2.064  1.00 7.36  ? 146  MET B N   1 
ATOM   1245 C  CA  . MET B 1 46 ? 28.112 27.874 2.402  1.00 8.57  ? 146  MET B CA  1 
ATOM   1246 C  C   . MET B 1 46 ? 27.305 27.272 3.517  1.00 10.06 ? 146  MET B C   1 
ATOM   1247 O  O   . MET B 1 46 ? 27.237 26.052 3.607  1.00 14.88 ? 146  MET B O   1 
ATOM   1248 C  CB  A MET B 1 46 ? 27.310 28.127 1.130  0.55 9.10  ? 146  MET B CB  1 
ATOM   1249 C  CB  B MET B 1 46 ? 27.123 27.942 1.236  0.45 13.37 ? 146  MET B CB  1 
ATOM   1250 C  CG  A MET B 1 46 ? 28.057 29.125 0.234  0.55 8.11  ? 146  MET B CG  1 
ATOM   1251 C  CG  B MET B 1 46 ? 27.757 28.271 -0.084 0.45 14.55 ? 146  MET B CG  1 
ATOM   1252 S  SD  A MET B 1 46 ? 27.169 29.226 -1.332 0.55 10.01 ? 146  MET B SD  1 
ATOM   1253 S  SD  B MET B 1 46 ? 28.234 30.006 -0.117 0.45 20.87 ? 146  MET B SD  1 
ATOM   1254 C  CE  A MET B 1 46 ? 25.599 29.903 -0.747 0.55 9.65  ? 146  MET B CE  1 
ATOM   1255 C  CE  B MET B 1 46 ? 26.643 30.782 -0.182 0.45 12.27 ? 146  MET B CE  1 
ATOM   1256 N  N   . ILE B 1 47 ? 26.704 28.113 4.344  1.00 7.84  ? 147  ILE B N   1 
ATOM   1257 C  CA  . ILE B 1 47 ? 25.817 27.633 5.378  1.00 9.74  ? 147  ILE B CA  1 
ATOM   1258 C  C   . ILE B 1 47 ? 24.614 28.572 5.442  1.00 8.22  ? 147  ILE B C   1 
ATOM   1259 O  O   . ILE B 1 47 ? 24.733 29.781 5.268  1.00 8.53  ? 147  ILE B O   1 
ATOM   1260 C  CB  A ILE B 1 47 ? 26.549 27.612 6.734  0.64 12.25 ? 147  ILE B CB  1 
ATOM   1261 C  CB  B ILE B 1 47 ? 26.478 27.464 6.738  0.36 14.15 ? 147  ILE B CB  1 
ATOM   1262 C  CG1 A ILE B 1 47 ? 25.805 26.908 7.904  0.64 14.68 ? 147  ILE B CG1 1 
ATOM   1263 C  CG1 B ILE B 1 47 ? 27.211 28.687 7.276  0.36 14.07 ? 147  ILE B CG1 1 
ATOM   1264 C  CG2 A ILE B 1 47 ? 26.937 28.991 7.236  0.64 11.16 ? 147  ILE B CG2 1 
ATOM   1265 C  CG2 B ILE B 1 47 ? 27.389 26.261 6.647  0.36 16.00 ? 147  ILE B CG2 1 
ATOM   1266 C  CD1 A ILE B 1 47 ? 25.649 25.436 7.621  0.64 17.49 ? 147  ILE B CD1 1 
ATOM   1267 C  CD1 B ILE B 1 47 ? 27.063 28.757 8.777  0.36 14.83 ? 147  ILE B CD1 1 
ATOM   1268 N  N   . GLY B 1 48 ? 23.453 28.007 5.702  1.00 8.23  ? 148  GLY B N   1 
ATOM   1269 C  CA  . GLY B 1 48 ? 22.224 28.759 5.837  1.00 7.68  ? 148  GLY B CA  1 
ATOM   1270 C  C   . GLY B 1 48 ? 21.720 28.807 7.246  1.00 7.51  ? 148  GLY B C   1 
ATOM   1271 O  O   . GLY B 1 48 ? 21.767 27.860 7.998  1.00 11.29 ? 148  GLY B O   1 
ATOM   1272 N  N   . GLY B 1 49 ? 21.093 29.909 7.568  1.00 6.65  ? 149  GLY B N   1 
ATOM   1273 C  CA  . GLY B 1 49 ? 20.480 30.172 8.867  1.00 6.67  ? 149  GLY B CA  1 
ATOM   1274 C  C   . GLY B 1 49 ? 19.093 30.758 8.663  1.00 5.95  ? 149  GLY B C   1 
ATOM   1275 O  O   . GLY B 1 49 ? 18.437 30.521 7.639  1.00 8.05  ? 149  GLY B O   1 
ATOM   1276 N  N   . ILE B 1 50 ? 18.630 31.507 9.661  1.00 5.83  ? 150  ILE B N   1 
ATOM   1277 C  CA  . ILE B 1 50 ? 17.257 31.966 9.634  1.00 5.73  ? 150  ILE B CA  1 
ATOM   1278 C  C   . ILE B 1 50 ? 17.017 32.929 8.485  1.00 6.51  ? 150  ILE B C   1 
ATOM   1279 O  O   . ILE B 1 50 ? 15.896 32.987 7.979  1.00 8.19  ? 150  ILE B O   1 
ATOM   1280 C  CB  . ILE B 1 50 ? 16.853 32.619 10.976 1.00 6.57  ? 150  ILE B CB  1 
ATOM   1281 C  CG1 . ILE B 1 50 ? 15.341 32.572 11.170 1.00 8.66  ? 150  ILE B CG1 1 
ATOM   1282 C  CG2 . ILE B 1 50 ? 17.431 34.001 11.144 1.00 8.12  ? 150  ILE B CG2 1 
ATOM   1283 C  CD1 . ILE B 1 50 ? 14.876 33.025 12.542 1.00 9.64  ? 150  ILE B CD1 1 
ATOM   1284 N  N   . GLY B 1 51 ? 18.039 33.691 8.103  1.00 7.49  ? 151  GLY B N   1 
ATOM   1285 C  CA  . GLY B 1 51 ? 17.895 34.788 7.150  1.00 8.16  ? 151  GLY B CA  1 
ATOM   1286 C  C   . GLY B 1 51 ? 18.423 34.518 5.784  1.00 9.02  ? 151  GLY B C   1 
ATOM   1287 O  O   . GLY B 1 51 ? 18.304 35.381 4.912  1.00 15.90 ? 151  GLY B O   1 
ATOM   1288 N  N   . GLY B 1 52 ? 19.021 33.361 5.508  1.00 8.58  ? 152  GLY B N   1 
ATOM   1289 C  CA  . GLY B 1 52 ? 19.596 33.066 4.220  1.00 8.63  ? 152  GLY B CA  1 
ATOM   1290 C  C   . GLY B 1 52 ? 20.963 32.435 4.409  1.00 6.82  ? 152  GLY B C   1 
ATOM   1291 O  O   . GLY B 1 52 ? 21.250 31.872 5.449  1.00 9.48  ? 152  GLY B O   1 
ATOM   1292 N  N   . PHE B 1 53 ? 21.781 32.487 3.369  1.00 6.09  ? 153  PHE B N   1 
ATOM   1293 C  CA  . PHE B 1 53 ? 23.048 31.814 3.302  1.00 6.81  ? 153  PHE B CA  1 
ATOM   1294 C  C   . PHE B 1 53 ? 24.202 32.789 3.362  1.00 7.31  ? 153  PHE B C   1 
ATOM   1295 O  O   . PHE B 1 53 ? 24.117 33.898 2.848  1.00 8.89  ? 153  PHE B O   1 
ATOM   1296 C  CB  . PHE B 1 53 ? 23.148 31.005 1.998  1.00 8.72  ? 153  PHE B CB  1 
ATOM   1297 C  CG  . PHE B 1 53 ? 22.390 29.723 2.085  1.00 10.06 ? 153  PHE B CG  1 
ATOM   1298 C  CD1 . PHE B 1 53 ? 21.030 29.704 1.905  1.00 13.83 ? 153  PHE B CD1 1 
ATOM   1299 C  CD2 . PHE B 1 53 ? 23.048 28.529 2.376  1.00 12.49 ? 153  PHE B CD2 1 
ATOM   1300 C  CE1 . PHE B 1 53 ? 20.329 28.508 2.002  1.00 19.15 ? 153  PHE B CE1 1 
ATOM   1301 C  CE2 . PHE B 1 53 ? 22.346 27.331 2.494  1.00 14.20 ? 153  PHE B CE2 1 
ATOM   1302 C  CZ  . PHE B 1 53 ? 20.995 27.339 2.332  1.00 15.77 ? 153  PHE B CZ  1 
ATOM   1303 N  N   . ILE B 1 54 ? 25.310 32.324 3.961  1.00 7.00  ? 154  ILE B N   1 
ATOM   1304 C  CA  . ILE B 1 54 ? 26.574 33.011 3.952  1.00 7.39  ? 154  ILE B CA  1 
ATOM   1305 C  C   . ILE B 1 54 ? 27.675 32.065 3.476  1.00 6.52  ? 154  ILE B C   1 
ATOM   1306 O  O   . ILE B 1 54 ? 27.598 30.846 3.582  1.00 7.38  ? 154  ILE B O   1 
ATOM   1307 C  CB  . ILE B 1 54 ? 26.943 33.578 5.319  1.00 7.76  ? 154  ILE B CB  1 
ATOM   1308 C  CG1 . ILE B 1 54 ? 27.137 32.496 6.377  1.00 8.28  ? 154  ILE B CG1 1 
ATOM   1309 C  CG2 . ILE B 1 54 ? 25.871 34.564 5.768  1.00 10.35 ? 154  ILE B CG2 1 
ATOM   1310 C  CD1 . ILE B 1 54 ? 27.735 32.938 7.670  1.00 10.91 ? 154  ILE B CD1 1 
ATOM   1311 N  N   . LYS B 1 55 ? 28.731 32.667 2.994  1.00 6.56  ? 155  LYS B N   1 
ATOM   1312 C  CA  . LYS B 1 55 ? 29.993 32.002 2.674  1.00 6.78  ? 155  LYS B CA  1 
ATOM   1313 C  C   . LYS B 1 55 ? 30.843 31.885 3.950  1.00 6.52  ? 155  LYS B C   1 
ATOM   1314 O  O   . LYS B 1 55 ? 30.990 32.855 4.686  1.00 8.50  ? 155  LYS B O   1 
ATOM   1315 C  CB  . LYS B 1 55 ? 30.762 32.770 1.630  1.00 8.80  ? 155  LYS B CB  1 
ATOM   1316 C  CG  . LYS B 1 55 ? 30.078 32.793 0.276  1.00 11.41 ? 155  LYS B CG  1 
ATOM   1317 C  CD  . LYS B 1 55 ? 30.762 33.756 -0.709 1.00 14.10 ? 155  LYS B CD  1 
ATOM   1318 C  CE  . LYS B 1 55 ? 32.156 33.279 -1.060 1.00 19.07 ? 155  LYS B CE  1 
ATOM   1319 N  NZ  . LYS B 1 55 ? 32.738 34.214 -2.098 1.00 31.16 ? 155  LYS B NZ  1 
ATOM   1320 N  N   . VAL B 1 56 ? 31.441 30.734 4.161  1.00 6.43  ? 156  VAL B N   1 
ATOM   1321 C  CA  . VAL B 1 56 ? 32.318 30.441 5.274  1.00 6.44  ? 156  VAL B CA  1 
ATOM   1322 C  C   . VAL B 1 56 ? 33.559 29.723 4.810  1.00 6.46  ? 156  VAL B C   1 
ATOM   1323 O  O   . VAL B 1 56 ? 33.575 29.086 3.750  1.00 8.24  ? 156  VAL B O   1 
ATOM   1324 C  CB  . VAL B 1 56 ? 31.610 29.604 6.378  1.00 6.94  ? 156  VAL B CB  1 
ATOM   1325 C  CG1 . VAL B 1 56 ? 30.514 30.425 7.039  1.00 8.90  ? 156  VAL B CG1 1 
ATOM   1326 C  CG2 . VAL B 1 56 ? 31.074 28.282 5.866  1.00 8.82  ? 156  VAL B CG2 1 
ATOM   1327 N  N   . ARG B 1 57 ? 34.589 29.786 5.622  1.00 6.34  ? 157  ARG B N   1 
ATOM   1328 C  CA  . ARG B 1 57 ? 35.756 28.914 5.528  1.00 6.40  ? 157  ARG B CA  1 
ATOM   1329 C  C   . ARG B 1 57 ? 35.553 27.724 6.445  1.00 6.64  ? 157  ARG B C   1 
ATOM   1330 O  O   . ARG B 1 57 ? 35.348 27.918 7.658  1.00 7.52  ? 157  ARG B O   1 
ATOM   1331 C  CB  . ARG B 1 57 ? 37.031 29.646 5.924  1.00 7.25  ? 157  ARG B CB  1 
ATOM   1332 C  CG  . ARG B 1 57 ? 37.311 30.897 5.102  1.00 8.85  ? 157  ARG B CG  1 
ATOM   1333 C  CD  A ARG B 1 57 ? 38.684 31.504 5.269  0.38 11.14 ? 157  ARG B CD  1 
ATOM   1334 C  CD  B ARG B 1 57 ? 38.571 31.587 5.652  0.62 9.55  ? 157  ARG B CD  1 
ATOM   1335 N  NE  A ARG B 1 57 ? 38.876 31.705 6.696  0.38 18.63 ? 157  ARG B NE  1 
ATOM   1336 N  NE  B ARG B 1 57 ? 39.003 32.623 4.702  0.62 10.92 ? 157  ARG B NE  1 
ATOM   1337 C  CZ  A ARG B 1 57 ? 39.866 32.332 7.276  0.38 25.39 ? 157  ARG B CZ  1 
ATOM   1338 C  CZ  B ARG B 1 57 ? 40.237 33.118 4.685  0.62 14.54 ? 157  ARG B CZ  1 
ATOM   1339 N  NH1 A ARG B 1 57 ? 40.836 32.845 6.527  0.38 31.08 ? 157  ARG B NH1 1 
ATOM   1340 N  NH1 B ARG B 1 57 ? 41.120 32.670 5.570  0.62 20.88 ? 157  ARG B NH1 1 
ATOM   1341 N  NH2 A ARG B 1 57 ? 39.904 32.430 8.601  0.38 15.51 ? 157  ARG B NH2 1 
ATOM   1342 N  NH2 B ARG B 1 57 ? 40.626 34.046 3.830  0.62 21.30 ? 157  ARG B NH2 1 
ATOM   1343 N  N   . GLN B 1 58 ? 35.575 26.499 5.908  1.00 7.16  ? 158  GLN B N   1 
ATOM   1344 C  CA  . GLN B 1 58 ? 35.430 25.307 6.707  1.00 6.96  ? 158  GLN B CA  1 
ATOM   1345 C  C   . GLN B 1 58 ? 36.791 24.797 7.092  1.00 7.46  ? 158  GLN B C   1 
ATOM   1346 O  O   . GLN B 1 58 ? 37.567 24.403 6.199  1.00 8.02  ? 158  GLN B O   1 
ATOM   1347 C  CB  . GLN B 1 58 ? 34.621 24.241 5.973  1.00 8.46  ? 158  GLN B CB  1 
ATOM   1348 C  CG  . GLN B 1 58 ? 34.578 22.941 6.721  1.00 9.41  ? 158  GLN B CG  1 
ATOM   1349 C  CD  . GLN B 1 58 ? 33.656 21.900 6.143  1.00 13.93 ? 158  GLN B CD  1 
ATOM   1350 O  OE1 . GLN B 1 58 ? 32.575 22.197 5.690  1.00 19.63 ? 158  GLN B OE1 1 
ATOM   1351 N  NE2 . GLN B 1 58 ? 34.054 20.656 6.245  1.00 22.14 ? 158  GLN B NE2 1 
ATOM   1352 N  N   . TYR B 1 59 ? 37.067 24.762 8.391  1.00 6.69  ? 159  TYR B N   1 
ATOM   1353 C  CA  . TYR B 1 59 ? 38.276 24.205 8.962  1.00 7.36  ? 159  TYR B CA  1 
ATOM   1354 C  C   . TYR B 1 59 ? 37.932 22.888 9.627  1.00 8.10  ? 159  TYR B C   1 
ATOM   1355 O  O   . TYR B 1 59 ? 37.144 22.888 10.589 1.00 8.75  ? 159  TYR B O   1 
ATOM   1356 C  CB  . TYR B 1 59 ? 38.905 25.143 9.955  1.00 7.74  ? 159  TYR B CB  1 
ATOM   1357 C  CG  . TYR B 1 59 ? 39.458 26.434 9.432  1.00 7.66  ? 159  TYR B CG  1 
ATOM   1358 C  CD1 . TYR B 1 59 ? 38.654 27.543 9.177  1.00 8.04  ? 159  TYR B CD1 1 
ATOM   1359 C  CD2 . TYR B 1 59 ? 40.850 26.545 9.223  1.00 7.96  ? 159  TYR B CD2 1 
ATOM   1360 C  CE1 . TYR B 1 59 ? 39.193 28.726 8.710  1.00 9.28  ? 159  TYR B CE1 1 
ATOM   1361 C  CE2 . TYR B 1 59 ? 41.390 27.729 8.760  1.00 9.51  ? 159  TYR B CE2 1 
ATOM   1362 C  CZ  . TYR B 1 59 ? 40.543 28.793 8.499  1.00 9.31  ? 159  TYR B CZ  1 
ATOM   1363 O  OH  . TYR B 1 59 ? 41.114 29.982 8.074  1.00 12.79 ? 159  TYR B OH  1 
ATOM   1364 N  N   . ASP B 1 60 ? 38.548 21.806 9.211  1.00 9.86  ? 160  ASP B N   1 
ATOM   1365 C  CA  . ASP B 1 60 ? 38.264 20.512 9.848  1.00 9.82  ? 160  ASP B CA  1 
ATOM   1366 C  C   . ASP B 1 60 ? 39.258 20.264 10.963 1.00 8.50  ? 160  ASP B C   1 
ATOM   1367 O  O   . ASP B 1 60 ? 40.418 20.732 10.951 1.00 9.54  ? 160  ASP B O   1 
ATOM   1368 C  CB  . ASP B 1 60 ? 38.335 19.379 8.821  1.00 13.26 ? 160  ASP B CB  1 
ATOM   1369 C  CG  . ASP B 1 60 ? 37.161 19.418 7.859  1.00 20.76 ? 160  ASP B CG  1 
ATOM   1370 O  OD1 . ASP B 1 60 ? 36.111 20.035 8.210  1.00 21.20 ? 160  ASP B OD1 1 
ATOM   1371 O  OD2 . ASP B 1 60 ? 37.347 18.797 6.774  1.00 27.00 ? 160  ASP B OD2 1 
ATOM   1372 N  N   . GLN B 1 61 ? 38.832 19.509 11.930 1.00 8.64  ? 161  GLN B N   1 
ATOM   1373 C  CA  . GLN B 1 61 ? 39.707 18.935 12.926 1.00 8.42  ? 161  GLN B CA  1 
ATOM   1374 C  C   . GLN B 1 61 ? 40.474 20.003 13.687 1.00 8.04  ? 161  GLN B C   1 
ATOM   1375 O  O   . GLN B 1 61 ? 41.677 19.895 13.933 1.00 9.56  ? 161  GLN B O   1 
ATOM   1376 C  CB  . GLN B 1 61 ? 40.611 17.931 12.230 1.00 11.49 ? 161  GLN B CB  1 
ATOM   1377 C  CG  . GLN B 1 61 ? 41.032 16.758 13.062 1.00 11.65 ? 161  GLN B CG  1 
ATOM   1378 C  CD  . GLN B 1 61 ? 41.682 15.627 12.288 1.00 12.46 ? 161  GLN B CD  1 
ATOM   1379 O  OE1 . GLN B 1 61 ? 42.690 15.116 12.786 1.00 12.65 ? 161  GLN B OE1 1 
ATOM   1380 N  NE2 . GLN B 1 61 ? 41.127 15.276 11.181 1.00 14.60 ? 161  GLN B NE2 1 
ATOM   1381 N  N   . ILE B 1 62 ? 39.739 21.032 14.121 1.00 6.51  ? 162  ILE B N   1 
ATOM   1382 C  CA  . ILE B 1 62 ? 40.272 22.128 14.904 1.00 6.73  ? 162  ILE B CA  1 
ATOM   1383 C  C   . ILE B 1 62 ? 40.081 21.862 16.394 1.00 6.38  ? 162  ILE B C   1 
ATOM   1384 O  O   . ILE B 1 62 ? 38.991 21.490 16.830 1.00 7.29  ? 162  ILE B O   1 
ATOM   1385 C  CB  . ILE B 1 62 ? 39.568 23.454 14.539 1.00 7.41  ? 162  ILE B CB  1 
ATOM   1386 C  CG1 . ILE B 1 62 ? 39.823 23.837 13.086 1.00 8.43  ? 162  ILE B CG1 1 
ATOM   1387 C  CG2 . ILE B 1 62 ? 39.887 24.595 15.494 1.00 8.93  ? 162  ILE B CG2 1 
ATOM   1388 C  CD1 . ILE B 1 62 ? 41.265 24.292 12.867 1.00 10.18 ? 162  ILE B CD1 1 
ATOM   1389 N  N   . ILE B 1 63 ? 41.152 22.064 17.145 1.00 7.11  ? 163  ILE B N   1 
ATOM   1390 C  CA  . ILE B 1 63 ? 41.104 21.920 18.610 1.00 8.01  ? 163  ILE B CA  1 
ATOM   1391 C  C   . ILE B 1 63 ? 40.462 23.162 19.200 1.00 9.06  ? 163  ILE B C   1 
ATOM   1392 O  O   . ILE B 1 63 ? 40.851 24.306 18.933 1.00 11.10 ? 163  ILE B O   1 
ATOM   1393 C  CB  . ILE B 1 63 ? 42.510 21.730 19.207 1.00 9.52  ? 163  ILE B CB  1 
ATOM   1394 C  CG1 . ILE B 1 63 ? 43.214 20.495 18.629 1.00 9.73  ? 163  ILE B CG1 1 
ATOM   1395 C  CG2 . ILE B 1 63 ? 42.510 21.711 20.740 1.00 17.28 ? 163  ILE B CG2 1 
ATOM   1396 C  CD1 . ILE B 1 63 ? 44.697 20.411 19.010 1.00 10.48 ? 163  ILE B CD1 1 
ATOM   1397 N  N   . ILE B 1 64 ? 39.438 22.965 19.992 1.00 9.61  ? 164  ILE B N   1 
ATOM   1398 C  CA  . ILE B 1 64 ? 38.730 24.054 20.632 1.00 9.91  ? 164  ILE B CA  1 
ATOM   1399 C  C   . ILE B 1 64 ? 38.396 23.642 22.043 1.00 10.65 ? 164  ILE B C   1 
ATOM   1400 O  O   . ILE B 1 64 ? 37.847 22.546 22.284 1.00 15.71 ? 164  ILE B O   1 
ATOM   1401 C  CB  . ILE B 1 64 ? 37.491 24.404 19.827 1.00 13.80 ? 164  ILE B CB  1 
ATOM   1402 C  CG1 . ILE B 1 64 ? 36.615 25.486 20.450 1.00 13.68 ? 164  ILE B CG1 1 
ATOM   1403 C  CG2 . ILE B 1 64 ? 36.678 23.181 19.545 1.00 22.23 ? 164  ILE B CG2 1 
ATOM   1404 C  CD1 . ILE B 1 64 ? 35.639 26.052 19.436 1.00 18.01 ? 164  ILE B CD1 1 
ATOM   1405 N  N   . GLU B 1 65 ? 38.663 24.510 22.997 1.00 7.78  ? 165  GLU B N   1 
ATOM   1406 C  CA  . GLU B 1 65 ? 38.258 24.279 24.368 1.00 8.54  ? 165  GLU B CA  1 
ATOM   1407 C  C   . GLU B 1 65 ? 37.009 25.096 24.666 1.00 8.13  ? 165  GLU B C   1 
ATOM   1408 O  O   . GLU B 1 65 ? 36.948 26.279 24.300 1.00 10.86 ? 165  GLU B O   1 
ATOM   1409 C  CB  A GLU B 1 65 ? 39.446 24.573 25.286 0.48 12.10 ? 165  GLU B CB  1 
ATOM   1410 C  CB  B GLU B 1 65 ? 39.369 24.647 25.341 0.52 12.84 ? 165  GLU B CB  1 
ATOM   1411 C  CG  A GLU B 1 65 ? 40.439 23.428 25.432 0.48 20.77 ? 165  GLU B CG  1 
ATOM   1412 C  CG  B GLU B 1 65 ? 39.142 24.080 26.726 0.52 15.04 ? 165  GLU B CG  1 
ATOM   1413 C  CD  A GLU B 1 65 ? 41.920 23.732 25.466 0.48 28.48 ? 165  GLU B CD  1 
ATOM   1414 C  CD  B GLU B 1 65 ? 40.382 23.879 27.560 0.52 18.11 ? 165  GLU B CD  1 
ATOM   1415 O  OE1 A GLU B 1 65 ? 42.669 23.305 24.539 0.48 40.35 ? 165  GLU B OE1 1 
ATOM   1416 O  OE1 B GLU B 1 65 ? 40.307 23.130 28.559 0.52 30.98 ? 165  GLU B OE1 1 
ATOM   1417 O  OE2 A GLU B 1 65 ? 42.435 24.364 26.418 0.48 41.68 ? 165  GLU B OE2 1 
ATOM   1418 O  OE2 B GLU B 1 65 ? 41.453 24.448 27.258 0.52 29.43 ? 165  GLU B OE2 1 
ATOM   1419 N  N   . ILE B 1 66 ? 36.012 24.474 25.253 1.00 6.88  ? 166  ILE B N   1 
ATOM   1420 C  CA  . ILE B 1 66 ? 34.692 25.067 25.493 1.00 6.78  ? 166  ILE B CA  1 
ATOM   1421 C  C   . ILE B 1 66 ? 34.421 24.979 26.971 1.00 6.88  ? 166  ILE B C   1 
ATOM   1422 O  O   . ILE B 1 66 ? 34.180 23.909 27.494 1.00 7.49  ? 166  ILE B O   1 
ATOM   1423 C  CB  . ILE B 1 66 ? 33.615 24.324 24.683 1.00 7.03  ? 166  ILE B CB  1 
ATOM   1424 C  CG1 . ILE B 1 66 ? 33.907 24.320 23.178 1.00 8.10  ? 166  ILE B CG1 1 
ATOM   1425 C  CG2 . ILE B 1 66 ? 32.244 24.907 24.986 1.00 7.59  ? 166  ILE B CG2 1 
ATOM   1426 C  CD1 . ILE B 1 66 ? 33.233 23.240 22.387 1.00 10.13 ? 166  ILE B CD1 1 
ATOM   1427 N  N   . ALA B 1 67 ? 34.450 26.135 27.655 1.00 8.04  ? 167  ALA B N   1 
ATOM   1428 C  CA  . ALA B 1 67 ? 34.229 26.149 29.102 1.00 9.75  ? 167  ALA B CA  1 
ATOM   1429 C  C   . ALA B 1 67 ? 35.068 25.108 29.808 1.00 9.84  ? 167  ALA B C   1 
ATOM   1430 O  O   . ALA B 1 67 ? 34.624 24.416 30.751 1.00 12.03 ? 167  ALA B O   1 
ATOM   1431 C  CB  . ALA B 1 67 ? 32.720 25.991 29.402 1.00 11.39 ? 167  ALA B CB  1 
ATOM   1432 N  N   . GLY B 1 68 ? 36.304 24.940 29.350 1.00 10.56 ? 168  GLY B N   1 
ATOM   1433 C  CA  . GLY B 1 68 ? 37.188 24.004 30.024 1.00 13.09 ? 168  GLY B CA  1 
ATOM   1434 C  C   . GLY B 1 68 ? 37.120 22.568 29.511 1.00 13.44 ? 168  GLY B C   1 
ATOM   1435 O  O   . GLY B 1 68 ? 37.797 21.692 30.089 1.00 19.67 ? 168  GLY B O   1 
ATOM   1436 N  N   . HIS B 1 69 ? 36.314 22.267 28.512 1.00 8.68  ? 169  HIS B N   1 
ATOM   1437 C  CA  . HIS B 1 69 ? 36.148 20.940 27.973 1.00 8.34  ? 169  HIS B CA  1 
ATOM   1438 C  C   . HIS B 1 69 ? 36.708 20.886 26.554 1.00 7.87  ? 169  HIS B C   1 
ATOM   1439 O  O   . HIS B 1 69 ? 36.431 21.766 25.736 1.00 10.16 ? 169  HIS B O   1 
ATOM   1440 C  CB  . HIS B 1 69 ? 34.672 20.526 27.919 1.00 8.76  ? 169  HIS B CB  1 
ATOM   1441 C  CG  . HIS B 1 69 ? 34.094 20.404 29.298 1.00 11.07 ? 169  HIS B CG  1 
ATOM   1442 N  ND1 . HIS B 1 69 ? 33.738 19.172 29.804 1.00 16.30 ? 169  HIS B ND1 1 
ATOM   1443 C  CD2 . HIS B 1 69 ? 33.758 21.314 30.240 1.00 13.69 ? 169  HIS B CD2 1 
ATOM   1444 C  CE1 . HIS B 1 69 ? 33.242 19.353 31.031 1.00 18.48 ? 169  HIS B CE1 1 
ATOM   1445 N  NE2 . HIS B 1 69 ? 33.258 20.645 31.322 1.00 18.18 ? 169  HIS B NE2 1 
ATOM   1446 N  N   . LYS B 1 70 ? 37.423 19.850 26.202 1.00 8.51  ? 170  LYS B N   1 
ATOM   1447 C  CA  . LYS B 1 70 ? 38.074 19.757 24.905 1.00 8.84  ? 170  LYS B CA  1 
ATOM   1448 C  C   . LYS B 1 70 ? 37.191 19.140 23.828 1.00 7.71  ? 170  LYS B C   1 
ATOM   1449 O  O   . LYS B 1 70 ? 36.523 18.132 24.013 1.00 10.43 ? 170  LYS B O   1 
ATOM   1450 C  CB  A LYS B 1 70 ? 39.389 18.949 24.912 0.57 12.22 ? 170  LYS B CB  1 
ATOM   1451 C  CB  B LYS B 1 70 ? 39.341 18.912 25.085 0.43 13.53 ? 170  LYS B CB  1 
ATOM   1452 C  CG  A LYS B 1 70 ? 40.124 18.995 23.569 0.57 18.45 ? 170  LYS B CG  1 
ATOM   1453 C  CG  B LYS B 1 70 ? 40.462 19.749 25.688 0.43 17.48 ? 170  LYS B CG  1 
ATOM   1454 C  CD  A LYS B 1 70 ? 41.517 18.401 23.545 0.57 21.80 ? 170  LYS B CD  1 
ATOM   1455 C  CD  B LYS B 1 70 ? 41.192 20.505 24.578 0.43 24.50 ? 170  LYS B CD  1 
ATOM   1456 C  CE  A LYS B 1 70 ? 42.591 19.482 23.666 0.57 27.16 ? 170  LYS B CE  1 
ATOM   1457 C  CE  B LYS B 1 70 ? 41.178 19.682 23.293 0.43 23.61 ? 170  LYS B CE  1 
ATOM   1458 N  NZ  A LYS B 1 70 ? 43.922 18.932 24.082 0.57 32.73 ? 170  LYS B NZ  1 
ATOM   1459 N  NZ  B LYS B 1 70 ? 40.344 20.277 22.233 0.43 25.61 ? 170  LYS B NZ  1 
ATOM   1460 N  N   . ALA B 1 71 ? 37.229 19.759 22.656 1.00 7.16  ? 171  ALA B N   1 
ATOM   1461 C  CA  . ALA B 1 71 ? 36.607 19.206 21.456 1.00 6.80  ? 171  ALA B CA  1 
ATOM   1462 C  C   . ALA B 1 71 ? 37.603 19.363 20.329 1.00 6.68  ? 171  ALA B C   1 
ATOM   1463 O  O   . ALA B 1 71 ? 38.483 20.247 20.375 1.00 8.18  ? 171  ALA B O   1 
ATOM   1464 C  CB  . ALA B 1 71 ? 35.279 19.923 21.163 1.00 7.55  ? 171  ALA B CB  1 
ATOM   1465 N  N   . ILE B 1 72 ? 37.465 18.525 19.317 1.00 5.98  ? 172  ILE B N   1 
ATOM   1466 C  CA  . ILE B 1 72 ? 38.296 18.642 18.112 1.00 5.76  ? 172  ILE B CA  1 
ATOM   1467 C  C   . ILE B 1 72 ? 37.364 18.378 16.962 1.00 5.72  ? 172  ILE B C   1 
ATOM   1468 O  O   . ILE B 1 72 ? 36.855 17.259 16.820 1.00 6.34  ? 172  ILE B O   1 
ATOM   1469 C  CB  . ILE B 1 72 ? 39.486 17.694 18.070 1.00 6.12  ? 172  ILE B CB  1 
ATOM   1470 C  CG1 . ILE B 1 72 ? 40.318 17.768 19.339 1.00 7.18  ? 172  ILE B CG1 1 
ATOM   1471 C  CG2 . ILE B 1 72 ? 40.314 17.974 16.820 1.00 7.69  ? 172  ILE B CG2 1 
ATOM   1472 C  CD1 . ILE B 1 72 ? 41.504 16.859 19.384 1.00 8.52  ? 172  ILE B CD1 1 
ATOM   1473 N  N   . GLY B 1 73 ? 37.059 19.377 16.123 1.00 6.22  ? 173  GLY B N   1 
ATOM   1474 C  CA  . GLY B 1 73 ? 36.103 19.144 15.061 1.00 6.49  ? 173  GLY B CA  1 
ATOM   1475 C  C   . GLY B 1 73 ? 35.986 20.301 14.121 1.00 6.59  ? 173  GLY B C   1 
ATOM   1476 O  O   . GLY B 1 73 ? 36.852 21.189 14.075 1.00 7.56  ? 173  GLY B O   1 
ATOM   1477 N  N   . THR B 1 74 ? 34.921 20.319 13.351 1.00 6.77  ? 174  THR B N   1 
ATOM   1478 C  CA  . THR B 1 74 ? 34.799 21.266 12.270 1.00 6.76  ? 174  THR B CA  1 
ATOM   1479 C  C   . THR B 1 74 ? 34.313 22.613 12.792 1.00 6.31  ? 174  THR B C   1 
ATOM   1480 O  O   . THR B 1 74 ? 33.347 22.705 13.555 1.00 6.71  ? 174  THR B O   1 
ATOM   1481 C  CB  . THR B 1 74 ? 33.796 20.720 11.236 1.00 8.13  ? 174  THR B CB  1 
ATOM   1482 O  OG1 . THR B 1 74 ? 34.335 19.500 10.741 1.00 10.65 ? 174  THR B OG1 1 
ATOM   1483 C  CG2 . THR B 1 74 ? 33.616 21.688 10.092 1.00 9.81  ? 174  THR B CG2 1 
ATOM   1484 N  N   . VAL B 1 75 ? 34.977 23.685 12.339 1.00 6.05  ? 175  VAL B N   1 
ATOM   1485 C  CA  . VAL B 1 75 ? 34.595 25.048 12.637 1.00 6.37  ? 175  VAL B CA  1 
ATOM   1486 C  C   . VAL B 1 75 ? 34.426 25.799 11.330 1.00 6.35  ? 175  VAL B C   1 
ATOM   1487 O  O   . VAL B 1 75 ? 35.306 25.764 10.473 1.00 7.14  ? 175  VAL B O   1 
ATOM   1488 C  CB  . VAL B 1 75 ? 35.662 25.708 13.535 1.00 7.83  ? 175  VAL B CB  1 
ATOM   1489 C  CG1 . VAL B 1 75 ? 35.345 27.174 13.776 1.00 8.97  ? 175  VAL B CG1 1 
ATOM   1490 C  CG2 . VAL B 1 75 ? 35.771 24.957 14.860 1.00 9.35  ? 175  VAL B CG2 1 
ATOM   1491 N  N   . LEU B 1 76 ? 33.300 26.490 11.196 1.00 5.53  ? 176  LEU B N   1 
ATOM   1492 C  CA  . LEU B 1 76 ? 33.042 27.334 10.053 1.00 5.70  ? 176  LEU B CA  1 
ATOM   1493 C  C   . LEU B 1 76 ? 33.332 28.760 10.468 1.00 5.84  ? 176  LEU B C   1 
ATOM   1494 O  O   . LEU B 1 76 ? 32.799 29.201 11.473 1.00 8.65  ? 176  LEU B O   1 
ATOM   1495 C  CB  . LEU B 1 76 ? 31.572 27.194 9.633  1.00 5.68  ? 176  LEU B CB  1 
ATOM   1496 C  CG  . LEU B 1 76 ? 31.128 25.745 9.370  1.00 6.34  ? 176  LEU B CG  1 
ATOM   1497 C  CD1 . LEU B 1 76 ? 29.660 25.702 8.957  1.00 7.69  ? 176  LEU B CD1 1 
ATOM   1498 C  CD2 . LEU B 1 76 ? 32.004 25.053 8.361  1.00 8.25  ? 176  LEU B CD2 1 
ATOM   1499 N  N   . VAL B 1 77 ? 34.105 29.487 9.706  1.00 5.66  ? 177  VAL B N   1 
ATOM   1500 C  CA  . VAL B 1 77 ? 34.519 30.845 10.020 1.00 5.56  ? 177  VAL B CA  1 
ATOM   1501 C  C   . VAL B 1 77 ? 33.958 31.788 8.981  1.00 5.64  ? 177  VAL B C   1 
ATOM   1502 O  O   . VAL B 1 77 ? 34.191 31.622 7.773  1.00 6.53  ? 177  VAL B O   1 
ATOM   1503 C  CB  . VAL B 1 77 ? 36.061 30.929 10.095 1.00 6.80  ? 177  VAL B CB  1 
ATOM   1504 C  CG1 . VAL B 1 77 ? 36.502 32.355 10.356 1.00 8.38  ? 177  VAL B CG1 1 
ATOM   1505 C  CG2 . VAL B 1 77 ? 36.608 30.004 11.170 1.00 7.90  ? 177  VAL B CG2 1 
ATOM   1506 N  N   . GLY B 1 78 ? 33.208 32.776 9.412  1.00 5.87  ? 178  GLY B N   1 
ATOM   1507 C  CA  . GLY B 1 78 ? 32.608 33.695 8.470  1.00 7.79  ? 178  GLY B CA  1 
ATOM   1508 C  C   . GLY B 1 78 ? 31.774 34.720 9.180  1.00 7.40  ? 178  GLY B C   1 
ATOM   1509 O  O   . GLY B 1 78 ? 31.818 34.845 10.399 1.00 8.15  ? 178  GLY B O   1 
ATOM   1510 N  N   . PRO B 1 79 ? 31.028 35.502 8.385  1.00 8.40  ? 179  PRO B N   1 
ATOM   1511 C  CA  . PRO B 1 79 ? 30.311 36.681 8.938  1.00 9.72  ? 179  PRO B CA  1 
ATOM   1512 C  C   . PRO B 1 79 ? 29.024 36.307 9.612  1.00 8.26  ? 179  PRO B C   1 
ATOM   1513 O  O   . PRO B 1 79 ? 27.935 36.663 9.188  1.00 11.37 ? 179  PRO B O   1 
ATOM   1514 C  CB  . PRO B 1 79 ? 30.135 37.501 7.669  1.00 11.76 ? 179  PRO B CB  1 
ATOM   1515 C  CG  . PRO B 1 79 ? 29.937 36.517 6.569  1.00 11.04 ? 179  PRO B CG  1 
ATOM   1516 C  CD  . PRO B 1 79 ? 30.942 35.433 6.906  1.00 9.60  ? 179  PRO B CD  1 
ATOM   1517 N  N   . THR B 1 80 ? 29.154 35.621 10.736 1.00 10.73 ? 180  THR B N   1 
ATOM   1518 C  CA  . THR B 1 80 ? 28.028 35.286 11.600 1.00 9.07  ? 180  THR B CA  1 
ATOM   1519 C  C   . THR B 1 80 ? 27.713 36.391 12.570 1.00 7.76  ? 180  THR B C   1 
ATOM   1520 O  O   . THR B 1 80 ? 28.600 37.131 13.024 1.00 9.92  ? 180  THR B O   1 
ATOM   1521 C  CB  . THR B 1 80 ? 28.344 33.958 12.374 1.00 9.01  ? 180  THR B CB  1 
ATOM   1522 O  OG1 . THR B 1 80 ? 27.264 33.699 13.263 1.00 9.55  ? 180  THR B OG1 1 
ATOM   1523 C  CG2 . THR B 1 80 ? 29.638 34.038 13.160 1.00 10.17 ? 180  THR B CG2 1 
ATOM   1524 N  N   . PRO B 1 81 ? 26.450 36.570 12.966 1.00 8.44  ? 181  PRO B N   1 
ATOM   1525 C  CA  . PRO B 1 81 ? 26.121 37.565 13.969 1.00 9.38  ? 181  PRO B CA  1 
ATOM   1526 C  C   . PRO B 1 81 ? 26.648 37.248 15.360 1.00 9.77  ? 181  PRO B C   1 
ATOM   1527 O  O   . PRO B 1 81 ? 26.716 38.130 16.230 1.00 12.47 ? 181  PRO B O   1 
ATOM   1528 C  CB  . PRO B 1 81 ? 24.573 37.595 14.020 1.00 12.74 ? 181  PRO B CB  1 
ATOM   1529 C  CG  . PRO B 1 81 ? 24.207 36.240 13.504 1.00 14.36 ? 181  PRO B CG  1 
ATOM   1530 C  CD  . PRO B 1 81 ? 25.246 35.890 12.455 1.00 10.64 ? 181  PRO B CD  1 
ATOM   1531 N  N   . ALA B 1 82 ? 27.008 35.991 15.618 1.00 8.25  ? 182  ALA B N   1 
ATOM   1532 C  CA  . ALA B 1 82 ? 27.409 35.529 16.919 1.00 8.61  ? 182  ALA B CA  1 
ATOM   1533 C  C   . ALA B 1 82 ? 28.289 34.286 16.750 1.00 7.72  ? 182  ALA B C   1 
ATOM   1534 O  O   . ALA B 1 82 ? 28.054 33.469 15.882 1.00 8.09  ? 182  ALA B O   1 
ATOM   1535 C  CB  . ALA B 1 82 ? 26.250 35.146 17.816 1.00 13.75 ? 182  ALA B CB  1 
ATOM   1536 N  N   . ASN B 1 83 ? 29.266 34.161 17.642 1.00 6.12  ? 183  ASN B N   1 
ATOM   1537 C  CA  . ASN B 1 83 ? 30.019 32.906 17.747 1.00 6.07  ? 183  ASN B CA  1 
ATOM   1538 C  C   . ASN B 1 83 ? 29.094 31.841 18.353 1.00 5.36  ? 183  ASN B C   1 
ATOM   1539 O  O   . ASN B 1 83 ? 28.613 32.061 19.484 1.00 6.71  ? 183  ASN B O   1 
ATOM   1540 C  CB  . ASN B 1 83 ? 31.242 33.069 18.634 1.00 6.56  ? 183  ASN B CB  1 
ATOM   1541 C  CG  . ASN B 1 83 ? 32.245 34.055 18.071 1.00 7.49  ? 183  ASN B CG  1 
ATOM   1542 O  OD1 . ASN B 1 83 ? 32.383 34.228 16.856 1.00 9.87  ? 183  ASN B OD1 1 
ATOM   1543 N  ND2 . ASN B 1 83 ? 32.980 34.715 18.974 1.00 8.57  ? 183  ASN B ND2 1 
ATOM   1544 N  N   . ILE B 1 84 ? 28.824 30.776 17.645 1.00 4.92  ? 184  ILE B N   1 
ATOM   1545 C  CA  . ILE B 1 84 ? 27.906 29.740 18.110 1.00 5.04  ? 184  ILE B CA  1 
ATOM   1546 C  C   . ILE B 1 84 ? 28.594 28.400 18.107 1.00 5.11  ? 184  ILE B C   1 
ATOM   1547 O  O   . ILE B 1 84 ? 29.264 27.993 17.160 1.00 6.15  ? 184  ILE B O   1 
ATOM   1548 C  CB  . ILE B 1 84 ? 26.606 29.722 17.293 1.00 5.63  ? 184  ILE B CB  1 
ATOM   1549 C  CG1 . ILE B 1 84 ? 26.794 29.393 15.836 1.00 7.01  ? 184  ILE B CG1 1 
ATOM   1550 C  CG2 . ILE B 1 84 ? 25.847 31.052 17.467 1.00 8.33  ? 184  ILE B CG2 1 
ATOM   1551 C  CD1 . ILE B 1 84 ? 25.494 29.366 15.024 1.00 8.17  ? 184  ILE B CD1 1 
ATOM   1552 N  N   . ILE B 1 85 ? 28.431 27.667 19.208 1.00 4.83  ? 185  ILE B N   1 
ATOM   1553 C  CA  . ILE B 1 85 ? 28.885 26.304 19.365 1.00 5.00  ? 185  ILE B CA  1 
ATOM   1554 C  C   . ILE B 1 85 ? 27.698 25.402 19.087 1.00 4.07  ? 185  ILE B C   1 
ATOM   1555 O  O   . ILE B 1 85 ? 26.704 25.382 19.851 1.00 5.72  ? 185  ILE B O   1 
ATOM   1556 C  CB  . ILE B 1 85 ? 29.453 26.020 20.768 1.00 5.04  ? 185  ILE B CB  1 
ATOM   1557 C  CG1 . ILE B 1 85 ? 30.506 27.057 21.160 1.00 6.24  ? 185  ILE B CG1 1 
ATOM   1558 C  CG2 . ILE B 1 85 ? 29.930 24.594 20.852 1.00 5.83  ? 185  ILE B CG2 1 
ATOM   1559 C  CD1 . ILE B 1 85 ? 31.691 27.132 20.190 1.00 8.53  ? 185  ILE B CD1 1 
ATOM   1560 N  N   . GLY B 1 86 ? 27.741 24.681 17.998 1.00 4.45  ? 186  GLY B N   1 
ATOM   1561 C  CA  . GLY B 1 86 ? 26.664 23.825 17.567 1.00 4.66  ? 186  GLY B CA  1 
ATOM   1562 C  C   . GLY B 1 86 ? 26.839 22.380 17.969 1.00 3.91  ? 186  GLY B C   1 
ATOM   1563 O  O   . GLY B 1 86 ? 27.777 21.997 18.663 1.00 4.41  ? 186  GLY B O   1 
ATOM   1564 N  N   . ARG B 1 87 ? 25.903 21.564 17.538 1.00 4.37  ? 187  ARG B N   1 
ATOM   1565 C  CA  . ARG B 1 87 ? 25.826 20.189 18.046 1.00 3.94  ? 187  ARG B CA  1 
ATOM   1566 C  C   . ARG B 1 87 ? 27.035 19.352 17.687 1.00 4.23  ? 187  ARG B C   1 
ATOM   1567 O  O   . ARG B 1 87 ? 27.347 18.414 18.427 1.00 4.86  ? 187  ARG B O   1 
ATOM   1568 C  CB  . ARG B 1 87 ? 24.542 19.483 17.545 1.00 4.34  ? 187  ARG B CB  1 
ATOM   1569 C  CG  . ARG B 1 87 ? 23.275 20.133 18.074 1.00 4.63  ? 187  ARG B CG  1 
ATOM   1570 C  CD  . ARG B 1 87 ? 22.030 19.315 17.723 1.00 5.14  ? 187  ARG B CD  1 
ATOM   1571 N  NE  . ARG B 1 87 ? 21.781 19.313 16.294 1.00 5.10  ? 187  ARG B NE  1 
ATOM   1572 C  CZ  . ARG B 1 87 ? 22.141 18.318 15.476 1.00 6.15  ? 187  ARG B CZ  1 
ATOM   1573 N  NH1 . ARG B 1 87 ? 22.678 17.210 15.881 1.00 6.47  ? 187  ARG B NH1 1 
ATOM   1574 N  NH2 . ARG B 1 87 ? 21.900 18.497 14.164 1.00 7.99  ? 187  ARG B NH2 1 
ATOM   1575 N  N   . ASN B 1 88 ? 27.716 19.666 16.605 1.00 4.41  ? 188  ASN B N   1 
ATOM   1576 C  CA  . ASN B 1 88 ? 28.909 18.879 16.253 1.00 5.16  ? 188  ASN B CA  1 
ATOM   1577 C  C   . ASN B 1 88 ? 29.938 18.927 17.376 1.00 5.13  ? 188  ASN B C   1 
ATOM   1578 O  O   . ASN B 1 88 ? 30.654 17.915 17.554 1.00 6.74  ? 188  ASN B O   1 
ATOM   1579 C  CB  . ASN B 1 88 ? 29.522 19.355 14.937 1.00 5.57  ? 188  ASN B CB  1 
ATOM   1580 C  CG  . ASN B 1 88 ? 30.199 20.695 15.029 1.00 5.50  ? 188  ASN B CG  1 
ATOM   1581 O  OD1 . ASN B 1 88 ? 29.616 21.693 15.448 1.00 5.69  ? 188  ASN B OD1 1 
ATOM   1582 N  ND2 . ASN B 1 88 ? 31.451 20.699 14.588 1.00 6.25  ? 188  ASN B ND2 1 
ATOM   1583 N  N   . LEU B 1 89 ? 30.040 20.002 18.120 1.00 4.71  ? 189  LEU B N   1 
ATOM   1584 C  CA  . LEU B 1 89 ? 30.951 20.100 19.259 1.00 4.73  ? 189  LEU B CA  1 
ATOM   1585 C  C   . LEU B 1 89 ? 30.254 19.897 20.591 1.00 4.54  ? 189  LEU B C   1 
ATOM   1586 O  O   . LEU B 1 89 ? 30.866 19.408 21.521 1.00 5.22  ? 189  LEU B O   1 
ATOM   1587 C  CB  . LEU B 1 89 ? 31.735 21.412 19.243 1.00 5.21  ? 189  LEU B CB  1 
ATOM   1588 C  CG  . LEU B 1 89 ? 32.530 21.673 17.951 1.00 6.09  ? 189  LEU B CG  1 
ATOM   1589 C  CD1 . LEU B 1 89 ? 33.312 22.977 18.109 1.00 7.88  ? 189  LEU B CD1 1 
ATOM   1590 C  CD2 . LEU B 1 89 ? 33.451 20.531 17.557 1.00 7.52  ? 189  LEU B CD2 1 
ATOM   1591 N  N   . LEU B 1 90 ? 28.981 20.265 20.718 1.00 4.34  ? 190  LEU B N   1 
ATOM   1592 C  CA  . LEU B 1 90 ? 28.270 20.033 21.986 1.00 4.78  ? 190  LEU B CA  1 
ATOM   1593 C  C   . LEU B 1 90 ? 28.220 18.529 22.287 1.00 4.25  ? 190  LEU B C   1 
ATOM   1594 O  O   . LEU B 1 90 ? 28.338 18.143 23.439 1.00 5.41  ? 190  LEU B O   1 
ATOM   1595 C  CB  . LEU B 1 90 ? 26.866 20.584 21.942 1.00 4.80  ? 190  LEU B CB  1 
ATOM   1596 C  CG  . LEU B 1 90 ? 26.729 22.112 21.799 1.00 5.25  ? 190  LEU B CG  1 
ATOM   1597 C  CD1 . LEU B 1 90 ? 25.292 22.505 21.559 1.00 6.28  ? 190  LEU B CD1 1 
ATOM   1598 C  CD2 . LEU B 1 90 ? 27.279 22.829 23.026 1.00 7.46  ? 190  LEU B CD2 1 
ATOM   1599 N  N   . THR B 1 91 ? 28.074 17.698 21.278 1.00 4.76  ? 191  THR B N   1 
ATOM   1600 C  CA  . THR B 1 91 ? 28.089 16.250 21.513 1.00 5.18  ? 191  THR B CA  1 
ATOM   1601 C  C   . THR B 1 91 ? 29.438 15.818 22.039 1.00 5.27  ? 191  THR B C   1 
ATOM   1602 O  O   . THR B 1 91 ? 29.506 14.929 22.894 1.00 6.86  ? 191  THR B O   1 
ATOM   1603 C  CB  . THR B 1 91 ? 27.749 15.453 20.235 1.00 5.94  ? 191  THR B CB  1 
ATOM   1604 O  OG1 . THR B 1 91 ? 28.647 15.819 19.177 1.00 7.15  ? 191  THR B OG1 1 
ATOM   1605 C  CG2 . THR B 1 91 ? 26.310 15.681 19.817 1.00 6.45  ? 191  THR B CG2 1 
ATOM   1606 N  N   . GLN B 1 92 ? 30.528 16.421 21.591 1.00 5.35  ? 192  GLN B N   1 
ATOM   1607 C  CA  . GLN B 1 92 ? 31.871 16.031 22.047 1.00 5.74  ? 192  GLN B CA  1 
ATOM   1608 C  C   . GLN B 1 92 ? 32.091 16.308 23.497 1.00 6.76  ? 192  GLN B C   1 
ATOM   1609 O  O   . GLN B 1 92 ? 32.870 15.601 24.152 1.00 10.43 ? 192  GLN B O   1 
ATOM   1610 C  CB  . GLN B 1 92 ? 32.945 16.730 21.209 1.00 5.78  ? 192  GLN B CB  1 
ATOM   1611 C  CG  . GLN B 1 92 ? 32.923 16.302 19.763 1.00 5.78  ? 192  GLN B CG  1 
ATOM   1612 C  CD  . GLN B 1 92 ? 34.218 16.608 19.047 1.00 5.41  ? 192  GLN B CD  1 
ATOM   1613 O  OE1 . GLN B 1 92 ? 35.248 16.835 19.709 1.00 6.64  ? 192  GLN B OE1 1 
ATOM   1614 N  NE2 . GLN B 1 92 ? 34.225 16.610 17.724 1.00 6.87  ? 192  GLN B NE2 1 
ATOM   1615 N  N   . ILE B 1 93 ? 31.481 17.372 24.029 1.00 6.46  ? 193  ILE B N   1 
ATOM   1616 C  CA  . ILE B 1 93 ? 31.669 17.719 25.436 1.00 7.30  ? 193  ILE B CA  1 
ATOM   1617 C  C   . ILE B 1 93 ? 30.597 17.065 26.299 1.00 7.59  ? 193  ILE B C   1 
ATOM   1618 O  O   . ILE B 1 93 ? 30.542 17.306 27.494 1.00 10.11 ? 193  ILE B O   1 
ATOM   1619 C  CB  . ILE B 1 93 ? 31.760 19.242 25.652 1.00 7.23  ? 193  ILE B CB  1 
ATOM   1620 C  CG1 . ILE B 1 93 ? 30.469 19.980 25.442 1.00 8.02  ? 193  ILE B CG1 1 
ATOM   1621 C  CG2 . ILE B 1 93 ? 32.932 19.800 24.800 1.00 9.89  ? 193  ILE B CG2 1 
ATOM   1622 C  CD1 . ILE B 1 93 ? 30.495 21.475 25.694 1.00 10.76 ? 193  ILE B CD1 1 
ATOM   1623 N  N   . GLY B 1 94 ? 29.736 16.204 25.735 1.00 7.25  ? 194  GLY B N   1 
ATOM   1624 C  CA  . GLY B 1 94 ? 28.771 15.452 26.503 1.00 8.62  ? 194  GLY B CA  1 
ATOM   1625 C  C   . GLY B 1 94 ? 27.543 16.240 26.873 1.00 7.57  ? 194  GLY B C   1 
ATOM   1626 O  O   . GLY B 1 94 ? 26.859 15.855 27.804 1.00 9.78  ? 194  GLY B O   1 
ATOM   1627 N  N   . ALA B 1 95 ? 27.229 17.303 26.159 1.00 6.86  ? 195  ALA B N   1 
ATOM   1628 C  CA  . ALA B 1 95 ? 26.072 18.140 26.508 1.00 6.63  ? 195  ALA B CA  1 
ATOM   1629 C  C   . ALA B 1 95 ? 24.761 17.464 26.132 1.00 6.74  ? 195  ALA B C   1 
ATOM   1630 O  O   . ALA B 1 95 ? 24.602 16.873 25.058 1.00 8.00  ? 195  ALA B O   1 
ATOM   1631 C  CB  . ALA B 1 95 ? 26.190 19.490 25.836 1.00 7.33  ? 195  ALA B CB  1 
ATOM   1632 N  N   . THR B 1 96 ? 23.803 17.590 27.045 1.00 6.68  ? 196  THR B N   1 
ATOM   1633 C  CA  . THR B 1 96 ? 22.441 17.173 26.839 1.00 5.79  ? 196  THR B CA  1 
ATOM   1634 C  C   . THR B 1 96 ? 21.464 18.261 27.283 1.00 5.47  ? 196  THR B C   1 
ATOM   1635 O  O   . THR B 1 96 ? 21.806 19.076 28.118 1.00 6.55  ? 196  THR B O   1 
ATOM   1636 C  CB  . THR B 1 96 ? 22.078 15.869 27.561 1.00 8.31  ? 196  THR B CB  1 
ATOM   1637 O  OG1 . THR B 1 96 ? 22.280 16.044 28.972 1.00 9.45  ? 196  THR B OG1 1 
ATOM   1638 C  CG2 . THR B 1 96 ? 22.976 14.716 27.120 1.00 10.67 ? 196  THR B CG2 1 
ATOM   1639 N  N   . LEU B 1 97 ? 20.272 18.249 26.729 1.00 5.41  ? 197  LEU B N   1 
ATOM   1640 C  CA  . LEU B 1 97 ? 19.163 19.065 27.238 1.00 5.65  ? 197  LEU B CA  1 
ATOM   1641 C  C   . LEU B 1 97 ? 18.355 18.245 28.201 1.00 5.96  ? 197  LEU B C   1 
ATOM   1642 O  O   . LEU B 1 97 ? 18.133 17.037 27.992 1.00 8.43  ? 197  LEU B O   1 
ATOM   1643 C  CB  . LEU B 1 97 ? 18.262 19.481 26.093 1.00 6.91  ? 197  LEU B CB  1 
ATOM   1644 C  CG  . LEU B 1 97 ? 18.812 20.631 25.268 1.00 7.06  ? 197  LEU B CG  1 
ATOM   1645 C  CD1 . LEU B 1 97 ? 18.047 20.743 23.959 1.00 10.06 ? 197  LEU B CD1 1 
ATOM   1646 C  CD2 . LEU B 1 97 ? 18.710 21.951 26.063 1.00 9.27  ? 197  LEU B CD2 1 
ATOM   1647 N  N   . ASN B 1 98 ? 17.899 18.855 29.285 1.00 6.03  ? 198  ASN B N   1 
ATOM   1648 C  CA  . ASN B 1 98 ? 17.168 18.139 30.316 1.00 6.98  ? 198  ASN B CA  1 
ATOM   1649 C  C   . ASN B 1 98 ? 16.002 18.996 30.759 1.00 7.34  ? 198  ASN B C   1 
ATOM   1650 O  O   . ASN B 1 98 ? 16.111 20.199 30.915 1.00 9.29  ? 198  ASN B O   1 
ATOM   1651 C  CB  . ASN B 1 98 ? 18.070 17.794 31.506 1.00 7.53  ? 198  ASN B CB  1 
ATOM   1652 C  CG  . ASN B 1 98 ? 19.158 16.869 31.068 1.00 8.36  ? 198  ASN B CG  1 
ATOM   1653 O  OD1 . ASN B 1 98 ? 18.968 15.621 31.131 1.00 11.31 ? 198  ASN B OD1 1 
ATOM   1654 N  ND2 . ASN B 1 98 ? 20.276 17.399 30.559 1.00 8.42  ? 198  ASN B ND2 1 
ATOM   1655 N  N   . PHE B 1 99 ? 14.843 18.373 30.984 1.00 7.65  ? 199  PHE B N   1 
ATOM   1656 C  CA  . PHE B 1 99 ? 13.680 19.066 31.542 1.00 8.80  ? 199  PHE B CA  1 
ATOM   1657 C  C   . PHE B 1 99 ? 12.796 18.013 32.218 1.00 11.28 ? 199  PHE B C   1 
ATOM   1658 O  O   . PHE B 1 99 ? 11.657 18.378 32.650 1.00 15.38 ? 199  PHE B O   1 
ATOM   1659 C  CB  . PHE B 1 99 ? 12.967 19.932 30.512 1.00 9.86  ? 199  PHE B CB  1 
ATOM   1660 C  CG  . PHE B 1 99 ? 12.359 19.205 29.352 1.00 9.91  ? 199  PHE B CG  1 
ATOM   1661 C  CD1 . PHE B 1 99 ? 13.123 18.865 28.250 1.00 13.56 ? 199  PHE B CD1 1 
ATOM   1662 C  CD2 . PHE B 1 99 ? 11.016 18.857 29.340 1.00 13.50 ? 199  PHE B CD2 1 
ATOM   1663 C  CE1 . PHE B 1 99 ? 12.569 18.212 27.154 1.00 17.27 ? 199  PHE B CE1 1 
ATOM   1664 C  CE2 . PHE B 1 99 ? 10.473 18.209 28.267 1.00 16.49 ? 199  PHE B CE2 1 
ATOM   1665 C  CZ  . PHE B 1 99 ? 11.230 17.850 27.174 1.00 18.43 ? 199  PHE B CZ  1 
ATOM   1666 O  OXT . PHE B 1 99 ? 13.221 16.850 32.301 1.00 13.22 ? 199  PHE B OXT 1 
HETATM 1667 CL CL  A CL  C 2 .  ? 7.966  35.917 27.668 0.50 24.67 ? 501  CL  A CL  1 
HETATM 1668 CL CL  B CL  C 2 .  ? 7.693  35.249 26.480 0.50 11.99 ? 501  CL  A CL  1 
HETATM 1669 P  P   . PO4 D 3 .  ? -4.141 25.536 21.962 0.60 15.47 ? 701  PO4 A P   1 
HETATM 1670 O  O1  . PO4 D 3 .  ? -3.659 24.930 23.291 0.60 24.36 ? 701  PO4 A O1  1 
HETATM 1671 O  O2  . PO4 D 3 .  ? -3.128 25.142 20.869 0.60 13.52 ? 701  PO4 A O2  1 
HETATM 1672 O  O3  . PO4 D 3 .  ? -4.320 27.058 22.067 0.60 30.47 ? 701  PO4 A O3  1 
HETATM 1673 O  O4  . PO4 D 3 .  ? -5.437 24.766 21.622 0.60 20.82 ? 701  PO4 A O4  1 
HETATM 1674 P  P   A PO4 E 3 .  ? -8.155 38.216 13.652 0.53 22.35 ? 702  PO4 A P   1 
HETATM 1675 P  P   B PO4 E 3 .  ? -8.339 38.204 13.829 0.47 22.06 ? 702  PO4 A P   1 
HETATM 1676 O  O1  A PO4 E 3 .  ? -6.950 38.014 12.688 0.53 28.87 ? 702  PO4 A O1  1 
HETATM 1677 O  O1  B PO4 E 3 .  ? -6.981 38.811 14.194 0.47 30.66 ? 702  PO4 A O1  1 
HETATM 1678 O  O2  A PO4 E 3 .  ? -7.705 39.176 14.779 0.53 30.67 ? 702  PO4 A O2  1 
HETATM 1679 O  O2  B PO4 E 3 .  ? -9.482 39.050 14.479 0.47 30.12 ? 702  PO4 A O2  1 
HETATM 1680 O  O3  A PO4 E 3 .  ? -9.379 38.831 12.880 0.53 33.57 ? 702  PO4 A O3  1 
HETATM 1681 O  O3  B PO4 E 3 .  ? -8.667 38.148 12.291 0.47 29.10 ? 702  PO4 A O3  1 
HETATM 1682 O  O4  A PO4 E 3 .  ? -8.520 36.826 14.194 0.53 22.57 ? 702  PO4 A O4  1 
HETATM 1683 O  O4  B PO4 E 3 .  ? -8.416 36.759 14.369 0.47 18.55 ? 702  PO4 A O4  1 
HETATM 1684 P  P   . PO4 F 3 .  ? 5.772  21.083 11.417 0.50 27.01 ? 704  PO4 A P   1 
HETATM 1685 O  O1  . PO4 F 3 .  ? 6.920  21.118 12.434 0.50 33.00 ? 704  PO4 A O1  1 
HETATM 1686 O  O2  . PO4 F 3 .  ? 5.594  19.613 10.992 0.50 37.14 ? 704  PO4 A O2  1 
HETATM 1687 O  O3  . PO4 F 3 .  ? 6.073  21.915 10.148 0.50 40.14 ? 704  PO4 A O3  1 
HETATM 1688 O  O4  . PO4 F 3 .  ? 4.500  21.587 12.150 0.50 39.73 ? 704  PO4 A O4  1 
HETATM 1689 S  S   A DMS G 4 .  ? 11.663 12.003 32.767 0.47 31.38 ? 901  DMS A S   1 
HETATM 1690 S  S   B DMS G 4 .  ? 12.829 11.460 33.131 0.53 28.43 ? 901  DMS A S   1 
HETATM 1691 O  O   A DMS G 4 .  ? 10.868 10.870 33.220 0.47 29.28 ? 901  DMS A O   1 
HETATM 1692 O  O   B DMS G 4 .  ? 12.113 11.580 34.383 0.53 35.27 ? 901  DMS A O   1 
HETATM 1693 C  C1  A DMS G 4 .  ? 13.345 11.895 33.311 0.47 16.20 ? 901  DMS A C1  1 
HETATM 1694 C  C1  B DMS G 4 .  ? 14.037 10.128 33.266 0.53 32.59 ? 901  DMS A C1  1 
HETATM 1695 C  C2  A DMS G 4 .  ? 11.253 13.450 33.792 0.47 35.99 ? 901  DMS A C2  1 
HETATM 1696 C  C2  B DMS G 4 .  ? 14.037 12.780 32.967 0.53 27.54 ? 901  DMS A C2  1 
HETATM 1697 C  C   . ACY H 5 .  ? -2.198 28.481 8.452  0.75 16.69 ? 601  ACY A C   1 
HETATM 1698 O  O   . ACY H 5 .  ? -2.839 29.291 7.712  0.75 37.75 ? 601  ACY A O   1 
HETATM 1699 O  OXT . ACY H 5 .  ? -2.285 28.537 9.654  0.75 21.50 ? 601  ACY A OXT 1 
HETATM 1700 C  CH3 . ACY H 5 .  ? -1.258 27.454 7.766  0.75 35.59 ? 601  ACY A CH3 1 
HETATM 1701 C  C   . ACY I 5 .  ? 14.208 41.765 5.807  0.30 19.10 ? 605  ACY A C   1 
HETATM 1702 O  O   . ACY I 5 .  ? 15.487 41.789 5.873  0.30 25.31 ? 605  ACY A O   1 
HETATM 1703 O  OXT . ACY I 5 .  ? 13.465 40.762 5.869  0.30 19.74 ? 605  ACY A OXT 1 
HETATM 1704 C  CH3 . ACY I 5 .  ? 13.592 43.170 5.632  0.30 14.16 ? 605  ACY A CH3 1 
HETATM 1705 C  C1  . GOL J 6 .  ? 3.656  41.687 8.533  0.50 35.13 ? 801  GOL A C1  1 
HETATM 1706 O  O1  . GOL J 6 .  ? 3.610  40.595 7.673  0.50 36.67 ? 801  GOL A O1  1 
HETATM 1707 C  C2  . GOL J 6 .  ? 5.152  41.874 8.745  0.50 33.09 ? 801  GOL A C2  1 
HETATM 1708 O  O2  . GOL J 6 .  ? 5.699  40.631 8.144  0.50 37.91 ? 801  GOL A O2  1 
HETATM 1709 C  C3  . GOL J 6 .  ? 5.351  41.780 10.266 0.50 31.77 ? 801  GOL A C3  1 
HETATM 1710 O  O3  . GOL J 6 .  ? 6.577  42.494 10.466 0.50 26.27 ? 801  GOL A O3  1 
HETATM 1711 P  P   A PO4 K 3 .  ? 32.746 21.467 34.948 0.53 29.68 ? 703  PO4 B P   1 
HETATM 1712 P  P   B PO4 K 3 .  ? 32.411 21.523 34.809 0.47 20.26 ? 703  PO4 B P   1 
HETATM 1713 O  O1  A PO4 K 3 .  ? 33.250 22.645 35.839 0.53 34.57 ? 703  PO4 B O1  1 
HETATM 1714 O  O1  B PO4 K 3 .  ? 33.159 22.786 34.302 0.47 29.25 ? 703  PO4 B O1  1 
HETATM 1715 O  O2  A PO4 K 3 .  ? 32.479 21.986 33.509 0.53 25.49 ? 703  PO4 B O2  1 
HETATM 1716 O  O2  B PO4 K 3 .  ? 32.237 20.576 33.591 0.47 29.10 ? 703  PO4 B O2  1 
HETATM 1717 O  O3  A PO4 K 3 .  ? 33.848 20.375 34.883 0.53 49.60 ? 703  PO4 B O3  1 
HETATM 1718 O  O3  B PO4 K 3 .  ? 33.252 20.870 35.947 0.47 33.13 ? 703  PO4 B O3  1 
HETATM 1719 O  O4  A PO4 K 3 .  ? 31.430 21.015 35.641 0.53 33.78 ? 703  PO4 B O4  1 
HETATM 1720 O  O4  B PO4 K 3 .  ? 31.041 21.967 35.411 0.47 22.11 ? 703  PO4 B O4  1 
HETATM 1721 N  N1  A 017 L 7 .  ? 15.369 36.522 17.952 0.53 13.37 ? 401  017 B N1  1 
HETATM 1722 N  N1  B 017 L 7 .  ? 14.441 35.126 18.335 0.47 10.76 ? 401  017 B N1  1 
HETATM 1723 C  C2  A 017 L 7 .  ? 15.971 35.518 17.253 0.53 10.86 ? 401  017 B C2  1 
HETATM 1724 C  C2  B 017 L 7 .  ? 15.344 34.546 17.485 0.47 11.20 ? 401  017 B C2  1 
HETATM 1725 C  C3  A 017 L 7 .  ? 15.578 34.164 17.389 0.53 6.43  ? 401  017 B C3  1 
HETATM 1726 C  C3  B 017 L 7 .  ? 15.209 33.175 17.253 0.47 8.48  ? 401  017 B C3  1 
HETATM 1727 C  C4  A 017 L 7 .  ? 16.271 33.173 16.666 0.53 6.77  ? 401  017 B C4  1 
HETATM 1728 C  C4  B 017 L 7 .  ? 16.105 32.503 16.434 0.47 7.36  ? 401  017 B C4  1 
HETATM 1729 C  C5  A 017 L 7 .  ? 17.325 33.576 15.808 0.53 6.46  ? 401  017 B C5  1 
HETATM 1730 C  C5  B 017 L 7 .  ? 17.093 33.319 15.823 0.47 7.86  ? 401  017 B C5  1 
HETATM 1731 C  C6  A 017 L 7 .  ? 17.721 34.892 15.708 0.53 6.46  ? 401  017 B C6  1 
HETATM 1732 C  C6  B 017 L 7 .  ? 17.294 34.658 16.077 0.47 8.17  ? 401  017 B C6  1 
HETATM 1733 C  C7  A 017 L 7 .  ? 17.008 35.880 16.399 0.53 8.60  ? 401  017 B C7  1 
HETATM 1734 C  C7  B 017 L 7 .  ? 16.370 35.332 16.891 0.47 8.39  ? 401  017 B C7  1 
HETATM 1735 S  S8  . 017 L 7 .  ? 18.310 32.342 14.899 1.00 6.96  ? 401  017 B S8  1 
HETATM 1736 O  O9  . 017 L 7 .  ? 17.496 31.213 14.407 1.00 8.64  ? 401  017 B O9  1 
HETATM 1737 O  O10 . 017 L 7 .  ? 19.002 33.184 13.917 1.00 8.04  ? 401  017 B O10 1 
HETATM 1738 N  N11 . 017 L 7 .  ? 19.547 31.705 15.872 1.00 6.97  ? 401  017 B N11 1 
HETATM 1739 C  C12 . 017 L 7 .  ? 20.385 32.719 16.539 1.00 8.50  ? 401  017 B C12 1 
HETATM 1740 C  C13 . 017 L 7 .  ? 21.864 32.326 16.569 1.00 7.79  ? 401  017 B C13 1 
HETATM 1741 C  C14 . 017 L 7 .  ? 22.409 32.281 15.142 1.00 8.84  ? 401  017 B C14 1 
HETATM 1742 C  C15 . 017 L 7 .  ? 22.599 33.350 17.422 1.00 9.92  ? 401  017 B C15 1 
HETATM 1743 C  C16 . 017 L 7 .  ? 19.217 30.448 16.629 1.00 7.34  ? 401  017 B C16 1 
HETATM 1744 C  C17 . 017 L 7 .  ? 20.082 29.311 16.015 1.00 5.65  ? 401  017 B C17 1 
HETATM 1745 O  O18 . 017 L 7 .  ? 19.992 28.199 16.929 1.00 6.93  ? 401  017 B O18 1 
HETATM 1746 C  C19 . 017 L 7 .  ? 19.683 28.868 14.606 1.00 5.36  ? 401  017 B C19 1 
HETATM 1747 N  N20 . 017 L 7 .  ? 20.679 27.940 14.099 1.00 5.44  ? 401  017 B N20 1 
HETATM 1748 C  C21 . 017 L 7 .  ? 21.531 28.287 13.131 1.00 6.13  ? 401  017 B C21 1 
HETATM 1749 O  O22 . 017 L 7 .  ? 21.616 29.343 12.526 1.00 6.25  ? 401  017 B O22 1 
HETATM 1750 O  O23 . 017 L 7 .  ? 22.386 27.235 12.884 1.00 6.37  ? 401  017 B O23 1 
HETATM 1751 C  C24 . 017 L 7 .  ? 23.207 27.316 11.700 1.00 5.95  ? 401  017 B C24 1 
HETATM 1752 C  C25 . 017 L 7 .  ? 24.526 26.625 12.047 1.00 5.59  ? 401  017 B C25 1 
HETATM 1753 O  O26 . 017 L 7 .  ? 24.254 25.237 11.965 1.00 5.71  ? 401  017 B O26 1 
HETATM 1754 C  C27 . 017 L 7 .  ? 23.257 25.046 10.973 1.00 5.63  ? 401  017 B C27 1 
HETATM 1755 O  O28 . 017 L 7 .  ? 22.229 24.229 11.527 1.00 6.11  ? 401  017 B O28 1 
HETATM 1756 C  C29 . 017 L 7 .  ? 20.986 24.964 11.569 1.00 6.45  ? 401  017 B C29 1 
HETATM 1757 C  C30 . 017 L 7 .  ? 21.176 26.163 10.605 1.00 6.81  ? 401  017 B C30 1 
HETATM 1758 C  C31 . 017 L 7 .  ? 22.653 26.378 10.613 1.00 6.03  ? 401  017 B C31 1 
HETATM 1759 C  C32 . 017 L 7 .  ? 18.304 28.178 14.523 1.00 5.70  ? 401  017 B C32 1 
HETATM 1760 C  C33 . 017 L 7 .  ? 17.870 26.361 12.811 1.00 6.10  ? 401  017 B C33 1 
HETATM 1761 C  C34 . 017 L 7 .  ? 17.589 25.958 11.509 1.00 7.10  ? 401  017 B C34 1 
HETATM 1762 C  C35 . 017 L 7 .  ? 17.463 26.881 10.486 1.00 7.55  ? 401  017 B C35 1 
HETATM 1763 C  C36 . 017 L 7 .  ? 17.558 28.244 10.803 1.00 7.61  ? 401  017 B C36 1 
HETATM 1764 C  C37 . 017 L 7 .  ? 17.834 28.682 12.082 1.00 7.06  ? 401  017 B C37 1 
HETATM 1765 C  C38 . 017 L 7 .  ? 17.985 27.731 13.114 1.00 5.74  ? 401  017 B C38 1 
HETATM 1766 C  C   . ACY M 5 .  ? 16.985 28.731 4.634  0.75 11.42 ? 602  ACY B C   1 
HETATM 1767 O  O   . ACY M 5 .  ? 16.475 29.943 4.902  0.75 19.02 ? 602  ACY B O   1 
HETATM 1768 O  OXT . ACY M 5 .  ? 16.534 28.107 3.712  0.75 23.94 ? 602  ACY B OXT 1 
HETATM 1769 C  CH3 . ACY M 5 .  ? 18.158 28.308 5.556  0.75 22.67 ? 602  ACY B CH3 1 
HETATM 1770 C  C   . ACY N 5 .  ? 27.199 12.527 23.858 0.30 10.34 ? 603  ACY B C   1 
HETATM 1771 O  O   . ACY N 5 .  ? 27.114 13.780 23.587 0.30 9.02  ? 603  ACY B O   1 
HETATM 1772 O  OXT . ACY N 5 .  ? 26.401 11.754 23.360 0.30 19.24 ? 603  ACY B OXT 1 
HETATM 1773 C  CH3 . ACY N 5 .  ? 28.265 12.164 24.891 0.30 15.13 ? 603  ACY B CH3 1 
HETATM 1774 C  C   . ACY O 5 .  ? 31.894 34.119 29.798 0.30 21.00 ? 604  ACY B C   1 
HETATM 1775 O  O   . ACY O 5 .  ? 32.627 33.095 30.037 0.30 17.40 ? 604  ACY B O   1 
HETATM 1776 O  OXT . ACY O 5 .  ? 31.669 35.016 30.626 0.30 29.23 ? 604  ACY B OXT 1 
HETATM 1777 C  CH3 . ACY O 5 .  ? 31.288 34.176 28.382 0.30 17.06 ? 604  ACY B CH3 1 
HETATM 1778 C  C   A ACY P 5 .  ? 45.710 23.134 26.219 0.49 28.95 ? 606  ACY B C   1 
HETATM 1779 C  C   B ACY P 5 .  ? 45.803 24.069 26.298 0.51 25.94 ? 606  ACY B C   1 
HETATM 1780 O  O   A ACY P 5 .  ? 44.453 23.123 26.489 0.49 36.43 ? 606  ACY B O   1 
HETATM 1781 O  O   B ACY P 5 .  ? 45.860 25.087 27.107 0.51 35.57 ? 606  ACY B O   1 
HETATM 1782 O  OXT A ACY P 5 .  ? 46.378 22.114 26.007 0.49 33.66 ? 606  ACY B OXT 1 
HETATM 1783 O  OXT B ACY P 5 .  ? 45.927 24.136 25.064 0.51 30.60 ? 606  ACY B OXT 1 
HETATM 1784 C  CH3 A ACY P 5 .  ? 46.357 24.530 26.198 0.49 27.22 ? 606  ACY B CH3 1 
HETATM 1785 C  CH3 B ACY P 5 .  ? 45.541 22.683 26.963 0.51 30.57 ? 606  ACY B CH3 1 
HETATM 1786 O  O   . HOH Q 8 .  ? 20.378 32.399 23.753 1.00 8.06  ? 1003 HOH A O   1 
HETATM 1787 O  O   . HOH Q 8 .  ? 16.275 27.269 32.460 1.00 8.68  ? 1004 HOH A O   1 
HETATM 1788 O  O   . HOH Q 8 .  ? -6.759 25.606 14.967 1.00 9.74  ? 1011 HOH A O   1 
HETATM 1789 O  O   . HOH Q 8 .  ? 11.312 38.691 5.892  1.00 11.54 ? 1012 HOH A O   1 
HETATM 1790 O  O   . HOH Q 8 .  ? -2.162 28.618 21.186 1.00 12.42 ? 1013 HOH A O   1 
HETATM 1791 O  O   . HOH Q 8 .  ? -2.391 19.453 14.072 1.00 12.14 ? 1014 HOH A O   1 
HETATM 1792 O  O   . HOH Q 8 .  ? -4.652 19.744 15.452 1.00 13.10 ? 1016 HOH A O   1 
HETATM 1793 O  O   . HOH Q 8 .  ? -7.301 22.994 15.749 1.00 10.96 ? 1018 HOH A O   1 
HETATM 1794 O  O   . HOH Q 8 .  ? 13.204 21.441 35.452 1.00 13.96 ? 1020 HOH A O   1 
HETATM 1795 O  O   . HOH Q 8 .  ? 16.495 20.765 33.977 1.00 11.89 ? 1022 HOH A O   1 
HETATM 1796 O  O   . HOH Q 8 .  ? 20.847 34.202 21.661 1.00 12.46 ? 1023 HOH A O   1 
HETATM 1797 O  O   . HOH Q 8 .  ? 3.921  37.284 26.105 1.00 13.77 ? 1024 HOH A O   1 
HETATM 1798 O  O   . HOH Q 8 .  ? 20.357 12.524 19.604 0.50 5.80  ? 1027 HOH A O   1 
HETATM 1799 O  O   . HOH Q 8 .  ? 9.320  34.888 21.370 1.00 14.78 ? 1029 HOH A O   1 
HETATM 1800 O  O   . HOH Q 8 .  ? 9.147  39.356 4.322  1.00 12.15 ? 1031 HOH A O   1 
HETATM 1801 O  O   . HOH Q 8 .  ? 6.442  38.174 8.000  1.00 17.19 ? 1032 HOH A O   1 
HETATM 1802 O  O   . HOH Q 8 .  ? 15.602 14.827 15.328 1.00 17.77 ? 1033 HOH A O   1 
HETATM 1803 O  O   . HOH Q 8 .  ? 5.527  24.320 32.131 0.50 9.62  ? 1034 HOH A O   1 
HETATM 1804 O  O   . HOH Q 8 .  ? -2.606 43.978 15.154 0.40 15.85 ? 1038 HOH A O   1 
HETATM 1805 O  O   . HOH Q 8 .  ? 4.559  23.437 32.373 0.50 9.56  ? 1039 HOH A O   1 
HETATM 1806 O  O   . HOH Q 8 .  ? 18.330 15.656 19.877 0.40 8.06  ? 1040 HOH A O   1 
HETATM 1807 O  O   . HOH Q 8 .  ? 16.804 37.808 4.812  1.00 16.71 ? 1041 HOH A O   1 
HETATM 1808 O  O   . HOH Q 8 .  ? 17.742 40.061 16.055 1.00 18.64 ? 1043 HOH A O   1 
HETATM 1809 O  O   . HOH Q 8 .  ? 18.394 34.972 19.656 1.00 19.55 ? 1044 HOH A O   1 
HETATM 1810 O  O   . HOH Q 8 .  ? 3.981  27.266 7.361  1.00 26.01 ? 1054 HOH A O   1 
HETATM 1811 O  O   . HOH Q 8 .  ? -1.382 24.938 23.085 1.00 24.42 ? 1057 HOH A O   1 
HETATM 1812 O  O   . HOH Q 8 .  ? 3.832  38.781 8.511  0.50 13.34 ? 1058 HOH A O   1 
HETATM 1813 O  O   . HOH Q 8 .  ? 10.589 20.514 33.875 1.00 25.06 ? 1062 HOH A O   1 
HETATM 1814 O  O   . HOH Q 8 .  ? -6.784 25.977 20.209 0.50 21.05 ? 1063 HOH A O   1 
HETATM 1815 O  O   . HOH Q 8 .  ? -0.346 39.973 20.873 1.00 24.25 ? 1065 HOH A O   1 
HETATM 1816 O  O   . HOH Q 8 .  ? 2.726  21.748 32.136 1.00 23.32 ? 1066 HOH A O   1 
HETATM 1817 O  O   . HOH Q 8 .  ? 14.569 35.782 26.147 1.00 30.34 ? 1068 HOH A O   1 
HETATM 1818 O  O   . HOH Q 8 .  ? 30.816 16.402 30.036 0.50 16.46 ? 1072 HOH A O   1 
HETATM 1819 O  O   . HOH Q 8 .  ? 15.337 10.243 18.012 1.00 25.04 ? 1074 HOH A O   1 
HETATM 1820 O  O   . HOH Q 8 .  ? 7.014  22.266 32.930 1.00 12.39 ? 1075 HOH A O   1 
HETATM 1821 O  O   . HOH Q 8 .  ? 7.706  15.573 21.854 1.00 20.01 ? 1076 HOH A O   1 
HETATM 1822 O  O   . HOH Q 8 .  ? -3.395 37.729 13.774 1.00 18.03 ? 1077 HOH A O   1 
HETATM 1823 O  O   . HOH Q 8 .  ? 7.707  29.588 7.697  0.50 6.79  ? 1079 HOH A O   1 
HETATM 1824 O  O   . HOH Q 8 .  ? 17.835 14.679 12.409 0.50 13.18 ? 1081 HOH A O   1 
HETATM 1825 O  O   . HOH Q 8 .  ? -0.556 35.284 7.081  1.00 25.67 ? 1088 HOH A O   1 
HETATM 1826 O  O   . HOH Q 8 .  ? 3.769  17.061 15.052 0.30 6.45  ? 1090 HOH A O   1 
HETATM 1827 O  O   . HOH Q 8 .  ? -2.135 35.517 11.519 1.00 22.38 ? 1091 HOH A O   1 
HETATM 1828 O  O   . HOH Q 8 .  ? 9.909  41.565 21.177 0.50 15.73 ? 1092 HOH A O   1 
HETATM 1829 O  O   . HOH Q 8 .  ? 12.461 33.511 5.101  0.50 13.54 ? 1093 HOH A O   1 
HETATM 1830 O  O   . HOH Q 8 .  ? 4.451  25.095 9.219  0.50 21.76 ? 1094 HOH A O   1 
HETATM 1831 O  O   . HOH Q 8 .  ? 10.955 22.907 12.443 1.00 22.76 ? 1095 HOH A O   1 
HETATM 1832 O  O   . HOH Q 8 .  ? -7.277 32.679 8.608  1.00 20.72 ? 1097 HOH A O   1 
HETATM 1833 O  O   . HOH Q 8 .  ? 8.272  15.357 30.438 1.00 28.45 ? 1100 HOH A O   1 
HETATM 1834 O  O   . HOH Q 8 .  ? 13.897 26.654 33.845 0.44 12.41 ? 1104 HOH A O   1 
HETATM 1835 O  O   . HOH Q 8 .  ? 16.226 13.834 19.755 0.50 14.55 ? 1105 HOH A O   1 
HETATM 1836 O  O   . HOH Q 8 .  ? 20.242 10.046 27.221 0.56 19.04 ? 1106 HOH A O   1 
HETATM 1837 O  O   . HOH Q 8 .  ? 0.834  46.271 17.776 0.50 25.65 ? 1110 HOH A O   1 
HETATM 1838 O  O   . HOH Q 8 .  ? 2.345  41.989 20.481 1.00 27.80 ? 1111 HOH A O   1 
HETATM 1839 O  O   . HOH Q 8 .  ? -1.082 45.472 17.782 0.50 17.58 ? 1112 HOH A O   1 
HETATM 1840 O  O   . HOH Q 8 .  ? 24.362 18.327 35.264 1.00 35.26 ? 1113 HOH A O   1 
HETATM 1841 O  O   . HOH Q 8 .  ? -9.996 37.041 16.182 0.50 18.67 ? 1115 HOH A O   1 
HETATM 1842 O  O   . HOH Q 8 .  ? 12.719 27.529 35.556 0.55 13.37 ? 1116 HOH A O   1 
HETATM 1843 O  O   . HOH Q 8 .  ? -5.889 40.608 19.897 0.64 36.12 ? 1117 HOH A O   1 
HETATM 1844 O  O   . HOH Q 8 .  ? 13.222 44.558 20.641 1.00 37.16 ? 1119 HOH A O   1 
HETATM 1845 O  O   . HOH Q 8 .  ? 14.172 15.428 20.771 1.00 29.43 ? 1120 HOH A O   1 
HETATM 1846 O  O   . HOH Q 8 .  ? 8.331  14.557 18.529 1.00 34.58 ? 1122 HOH A O   1 
HETATM 1847 O  O   . HOH Q 8 .  ? -0.657 31.576 7.740  0.50 13.61 ? 1124 HOH A O   1 
HETATM 1848 O  O   . HOH Q 8 .  ? 7.875  15.246 27.708 1.00 39.49 ? 1125 HOH A O   1 
HETATM 1849 O  O   . HOH Q 8 .  ? 21.433 36.536 16.031 0.50 18.12 ? 1126 HOH A O   1 
HETATM 1850 O  O   . HOH Q 8 .  ? 18.641 37.471 27.389 0.30 20.79 ? 1130 HOH A O   1 
HETATM 1851 O  O   . HOH Q 8 .  ? 20.741 43.621 15.839 1.00 36.53 ? 1131 HOH A O   1 
HETATM 1852 O  O   . HOH Q 8 .  ? -2.912 37.879 19.375 0.50 12.39 ? 1132 HOH A O   1 
HETATM 1853 O  O   . HOH Q 8 .  ? 14.477 39.994 20.281 1.00 31.77 ? 1134 HOH A O   1 
HETATM 1854 O  O   . HOH Q 8 .  ? 5.312  24.087 11.079 1.00 26.94 ? 1136 HOH A O   1 
HETATM 1855 O  O   . HOH Q 8 .  ? 19.213 38.291 3.886  1.00 27.10 ? 1137 HOH A O   1 
HETATM 1856 O  O   . HOH Q 8 .  ? 1.526  26.649 9.436  1.00 41.84 ? 1141 HOH A O   1 
HETATM 1857 O  O   . HOH Q 8 .  ? 19.495 41.646 6.772  0.50 16.35 ? 1143 HOH A O   1 
HETATM 1858 O  O   . HOH Q 8 .  ? 4.254  13.631 17.698 1.00 42.91 ? 1150 HOH A O   1 
HETATM 1859 O  O   . HOH Q 8 .  ? 5.254  15.263 23.228 0.50 21.25 ? 1158 HOH A O   1 
HETATM 1860 O  O   . HOH Q 8 .  ? -6.230 21.578 12.515 0.74 43.52 ? 1160 HOH A O   1 
HETATM 1861 O  O   . HOH Q 8 .  ? 14.657 10.858 28.741 0.50 21.57 ? 1162 HOH A O   1 
HETATM 1862 O  O   . HOH Q 8 .  ? 7.507  35.055 28.989 1.00 39.41 ? 1163 HOH A O   1 
HETATM 1863 O  O   . HOH Q 8 .  ? 9.244  21.924 10.560 0.50 28.48 ? 1164 HOH A O   1 
HETATM 1864 O  O   . HOH Q 8 .  ? 8.185  43.673 22.413 0.50 23.80 ? 1165 HOH A O   1 
HETATM 1865 O  O   . HOH Q 8 .  ? -3.645 33.529 26.362 0.50 22.92 ? 1166 HOH A O   1 
HETATM 1866 O  O   . HOH Q 8 .  ? 12.584 33.191 30.112 0.50 25.02 ? 1171 HOH A O   1 
HETATM 1867 O  O   . HOH Q 8 .  ? 25.851 14.878 15.625 0.50 23.69 ? 1172 HOH A O   1 
HETATM 1868 O  O   . HOH Q 8 .  ? -2.172 45.606 8.248  0.50 34.82 ? 1175 HOH A O   1 
HETATM 1869 O  O   . HOH Q 8 .  ? 9.356  25.292 6.970  1.00 44.65 ? 1178 HOH A O   1 
HETATM 1870 O  O   . HOH Q 8 .  ? 10.042 14.086 25.792 0.50 38.26 ? 1179 HOH A O   1 
HETATM 1871 O  O   . HOH Q 8 .  ? 1.123  16.013 29.471 0.50 38.42 ? 1181 HOH A O   1 
HETATM 1872 O  O   . HOH Q 8 .  ? 10.573 18.757 11.307 0.50 24.82 ? 1182 HOH A O   1 
HETATM 1873 O  O   . HOH Q 8 .  ? 4.620  46.590 9.350  0.30 20.77 ? 1184 HOH A O   1 
HETATM 1874 O  O   . HOH Q 8 .  ? 17.102 14.976 19.916 0.30 8.43  ? 1186 HOH A O   1 
HETATM 1875 O  O   . HOH Q 8 .  ? 14.173 11.819 25.266 0.50 29.23 ? 1187 HOH A O   1 
HETATM 1876 O  O   . HOH Q 8 .  ? 3.348  19.063 23.388 0.50 10.17 ? 1195 HOH A O   1 
HETATM 1877 O  O   . HOH Q 8 .  ? 13.641 43.561 17.926 0.50 15.19 ? 1196 HOH A O   1 
HETATM 1878 O  O   . HOH Q 8 .  ? -7.734 26.884 21.152 0.50 22.82 ? 1197 HOH A O   1 
HETATM 1879 O  O   . HOH Q 8 .  ? 11.345 44.784 21.940 0.50 21.79 ? 1201 HOH A O   1 
HETATM 1880 O  O   . HOH Q 8 .  ? 16.299 42.240 16.035 0.50 23.15 ? 1202 HOH A O   1 
HETATM 1881 O  O   . HOH Q 8 .  ? -4.583 35.041 21.191 0.30 16.73 ? 1206 HOH A O   1 
HETATM 1882 O  O   . HOH Q 8 .  ? -0.012 21.161 12.075 0.50 19.40 ? 1207 HOH A O   1 
HETATM 1883 O  O   . HOH Q 8 .  ? 6.273  46.643 8.959  0.30 14.87 ? 1208 HOH A O   1 
HETATM 1884 O  O   . HOH Q 8 .  ? -2.203 43.760 14.914 0.30 7.60  ? 1211 HOH A O   1 
HETATM 1885 O  O   . HOH Q 8 .  ? 13.862 14.374 18.314 0.50 23.49 ? 1213 HOH A O   1 
HETATM 1886 O  O   . HOH Q 8 .  ? 2.256  46.030 8.949  0.40 32.47 ? 1216 HOH A O   1 
HETATM 1887 O  O   . HOH Q 8 .  ? 2.331  18.559 22.448 0.50 17.34 ? 1219 HOH A O   1 
HETATM 1888 O  O   . HOH Q 8 .  ? 18.764 15.625 13.092 0.50 11.48 ? 1220 HOH A O   1 
HETATM 1889 O  O   . HOH Q 8 .  ? 17.224 22.412 11.728 1.00 20.68 ? 1221 HOH A O   1 
HETATM 1890 O  O   . HOH Q 8 .  ? 19.038 21.817 10.135 0.44 15.86 ? 1222 HOH A O   1 
HETATM 1891 O  O   . HOH Q 8 .  ? 10.582 36.394 23.535 0.70 27.91 ? 1223 HOH A O   1 
HETATM 1892 O  O   . HOH Q 8 .  ? 13.793 11.085 15.203 0.50 23.42 ? 1224 HOH A O   1 
HETATM 1893 O  O   . HOH Q 8 .  ? -4.560 32.615 29.369 0.50 33.77 ? 1226 HOH A O   1 
HETATM 1894 O  O   . HOH Q 8 .  ? 9.721  14.606 23.344 0.50 23.36 ? 1227 HOH A O   1 
HETATM 1895 O  O   . HOH Q 8 .  ? 14.572 34.157 29.290 0.50 24.92 ? 1229 HOH A O   1 
HETATM 1896 O  O   . HOH Q 8 .  ? 9.194  33.513 29.879 0.50 20.75 ? 1231 HOH A O   1 
HETATM 1897 O  O   . HOH Q 8 .  ? 9.943  39.770 21.602 0.50 27.00 ? 1232 HOH A O   1 
HETATM 1898 O  O   . HOH Q 8 .  ? 27.480 19.171 35.023 0.50 33.63 ? 1233 HOH A O   1 
HETATM 1899 O  O   . HOH Q 8 .  ? 4.246  34.600 30.097 0.50 22.62 ? 1234 HOH A O   1 
HETATM 1900 O  O   . HOH Q 8 .  ? 17.619 23.657 8.412  0.50 41.86 ? 1235 HOH A O   1 
HETATM 1901 O  O   . HOH Q 8 .  ? 9.676  37.402 25.620 0.50 19.41 ? 1237 HOH A O   1 
HETATM 1902 O  O   . HOH Q 8 .  ? 14.394 38.675 23.701 0.50 28.88 ? 1238 HOH A O   1 
HETATM 1903 O  O   . HOH Q 8 .  ? 8.153  33.693 32.024 0.50 31.52 ? 1241 HOH A O   1 
HETATM 1904 O  O   . HOH Q 8 .  ? 16.201 23.704 8.117  0.50 42.21 ? 1242 HOH A O   1 
HETATM 1905 O  O   . HOH Q 8 .  ? 20.487 40.535 15.488 0.50 26.02 ? 1244 HOH A O   1 
HETATM 1906 O  O   . HOH Q 8 .  ? -6.138 24.240 12.668 0.50 30.08 ? 1245 HOH A O   1 
HETATM 1907 O  O   . HOH Q 8 .  ? -1.684 24.207 25.239 0.50 22.54 ? 1247 HOH A O   1 
HETATM 1908 O  O   . HOH Q 8 .  ? 9.213  11.971 33.733 0.50 21.01 ? 1248 HOH A O   1 
HETATM 1909 O  O   . HOH Q 8 .  ? 8.195  38.022 6.455  0.50 28.68 ? 1260 HOH A O   1 
HETATM 1910 O  O   . HOH Q 8 .  ? -7.686 26.314 20.664 0.50 18.68 ? 1262 HOH A O   1 
HETATM 1911 O  O   . HOH Q 8 .  ? 18.600 40.811 5.989  0.50 19.25 ? 1263 HOH A O   1 
HETATM 1912 O  O   . HOH Q 8 .  ? 15.281 42.537 17.422 0.50 14.81 ? 1264 HOH A O   1 
HETATM 1913 O  O   . HOH Q 8 .  ? 6.279  21.001 12.138 0.50 13.01 ? 1266 HOH A O   1 
HETATM 1914 O  O   . HOH Q 8 .  ? 15.522 20.195 10.831 0.56 35.82 ? 1267 HOH A O   1 
HETATM 1915 O  O   . HOH Q 8 .  ? 14.243 21.627 12.085 0.56 30.27 ? 1268 HOH A O   1 
HETATM 1916 O  O   . HOH Q 8 .  ? 3.399  26.553 11.080 0.54 13.43 ? 1269 HOH A O   1 
HETATM 1917 O  O   . HOH Q 8 .  ? -6.581 41.420 15.137 0.50 30.20 ? 1270 HOH A O   1 
HETATM 1918 O  O   . HOH Q 8 .  ? -2.597 37.498 22.064 0.50 24.01 ? 1271 HOH A O   1 
HETATM 1919 O  O   . HOH Q 8 .  ? -4.318 34.328 19.795 0.50 21.65 ? 1272 HOH A O   1 
HETATM 1920 O  O   . HOH Q 8 .  ? 20.758 11.287 26.136 0.25 13.52 ? 1273 HOH A O   1 
HETATM 1921 O  O   . HOH Q 8 .  ? 16.002 43.636 16.440 0.29 16.84 ? 1274 HOH A O   1 
HETATM 1922 O  O   . HOH Q 8 .  ? -6.161 37.412 21.268 0.50 36.09 ? 1275 HOH A O   1 
HETATM 1923 O  O   . HOH R 8 .  ? 20.442 31.798 11.977 1.00 6.14  ? 1001 HOH B O   1 
HETATM 1924 O  O   . HOH R 8 .  ? 19.933 21.339 16.088 1.00 6.19  ? 1002 HOH B O   1 
HETATM 1925 O  O   . HOH R 8 .  ? 42.696 25.711 17.673 1.00 9.70  ? 1005 HOH B O   1 
HETATM 1926 O  O   . HOH R 8 .  ? 32.875 18.272 13.794 1.00 9.34  ? 1006 HOH B O   1 
HETATM 1927 O  O   . HOH R 8 .  ? 43.757 18.531 15.313 1.00 10.98 ? 1007 HOH B O   1 
HETATM 1928 O  O   . HOH R 8 .  ? 30.858 23.156 12.238 1.00 10.08 ? 1008 HOH B O   1 
HETATM 1929 O  O   . HOH R 8 .  ? 38.368 15.503 15.313 1.00 8.29  ? 1009 HOH B O   1 
HETATM 1930 O  O   . HOH R 8 .  ? 22.525 30.537 30.347 1.00 10.90 ? 1010 HOH B O   1 
HETATM 1931 O  O   . HOH R 8 .  ? 33.179 38.265 11.291 1.00 11.20 ? 1015 HOH B O   1 
HETATM 1932 O  O   . HOH R 8 .  ? 36.456 17.969 11.852 1.00 12.38 ? 1017 HOH B O   1 
HETATM 1933 O  O   . HOH R 8 .  ? 19.069 30.145 37.276 1.00 11.69 ? 1019 HOH B O   1 
HETATM 1934 O  O   . HOH R 8 .  ? 24.897 15.536 29.834 1.00 15.10 ? 1021 HOH B O   1 
HETATM 1935 O  O   . HOH R 8 .  ? 24.576 14.907 23.330 1.00 12.61 ? 1025 HOH B O   1 
HETATM 1936 O  O   . HOH R 8 .  ? 30.673 38.723 12.217 1.00 13.97 ? 1026 HOH B O   1 
HETATM 1937 O  O   . HOH R 8 .  ? 15.399 16.264 33.787 1.00 16.72 ? 1028 HOH B O   1 
HETATM 1938 O  O   . HOH R 8 .  ? 20.268 31.510 33.554 1.00 14.35 ? 1030 HOH B O   1 
HETATM 1939 O  O   . HOH R 8 .  ? 31.949 16.350 15.886 1.00 12.44 ? 1035 HOH B O   1 
HETATM 1940 O  O   . HOH R 8 .  ? 24.919 35.302 29.871 1.00 17.97 ? 1036 HOH B O   1 
HETATM 1941 O  O   . HOH R 8 .  ? 47.971 31.280 22.353 1.00 16.67 ? 1037 HOH B O   1 
HETATM 1942 O  O   . HOH R 8 .  ? 25.093 36.537 8.492  1.00 16.78 ? 1042 HOH B O   1 
HETATM 1943 O  O   . HOH R 8 .  ? 22.916 35.832 20.739 1.00 20.09 ? 1045 HOH B O   1 
HETATM 1944 O  O   . HOH R 8 .  ? 43.291 35.314 24.045 1.00 20.55 ? 1046 HOH B O   1 
HETATM 1945 O  O   . HOH R 8 .  ? 23.155 25.102 5.473  1.00 21.09 ? 1047 HOH B O   1 
HETATM 1946 O  O   . HOH R 8 .  ? 40.287 27.233 0.259  1.00 20.06 ? 1048 HOH B O   1 
HETATM 1947 O  O   . HOH R 8 .  ? 32.564 24.409 32.553 1.00 19.13 ? 1049 HOH B O   1 
HETATM 1948 O  O   . HOH R 8 .  ? 29.649 36.192 19.580 0.50 10.70 ? 1050 HOH B O   1 
HETATM 1949 O  O   . HOH R 8 .  ? 32.774 30.132 0.612  1.00 23.31 ? 1051 HOH B O   1 
HETATM 1950 O  O   . HOH R 8 .  ? 18.640 18.326 36.514 1.00 21.99 ? 1052 HOH B O   1 
HETATM 1951 O  O   . HOH R 8 .  ? 25.896 18.263 13.631 1.00 26.17 ? 1053 HOH B O   1 
HETATM 1952 O  O   . HOH R 8 .  ? 23.176 28.530 35.043 1.00 24.33 ? 1055 HOH B O   1 
HETATM 1953 O  O   . HOH R 8 .  ? 17.132 14.411 32.705 1.00 23.34 ? 1056 HOH B O   1 
HETATM 1954 O  O   . HOH R 8 .  ? 34.680 22.905 -0.361 1.00 17.83 ? 1059 HOH B O   1 
HETATM 1955 O  O   . HOH R 8 .  ? 28.671 24.497 0.752  1.00 21.54 ? 1060 HOH B O   1 
HETATM 1956 O  O   . HOH R 8 .  ? 25.627 40.675 16.178 1.00 29.32 ? 1061 HOH B O   1 
HETATM 1957 O  O   . HOH R 8 .  ? 47.284 32.174 19.665 1.00 21.67 ? 1064 HOH B O   1 
HETATM 1958 O  O   . HOH R 8 .  ? 38.248 37.721 15.402 1.00 21.25 ? 1067 HOH B O   1 
HETATM 1959 O  O   . HOH R 8 .  ? 28.157 14.886 16.433 1.00 26.47 ? 1069 HOH B O   1 
HETATM 1960 O  O   . HOH R 8 .  ? 15.479 27.090 35.210 0.56 13.12 ? 1070 HOH B O   1 
HETATM 1961 O  O   . HOH R 8 .  ? 38.851 35.542 29.619 1.00 34.93 ? 1071 HOH B O   1 
HETATM 1962 O  O   . HOH R 8 .  ? 40.389 34.881 8.508  0.75 48.21 ? 1073 HOH B O   1 
HETATM 1963 O  O   . HOH R 8 .  ? 28.648 35.651 2.796  1.00 17.42 ? 1078 HOH B O   1 
HETATM 1964 O  O   . HOH R 8 .  ? 35.853 33.647 6.611  1.00 18.90 ? 1080 HOH B O   1 
HETATM 1965 O  O   . HOH R 8 .  ? 24.844 31.128 31.532 1.00 18.26 ? 1082 HOH B O   1 
HETATM 1966 O  O   . HOH R 8 .  ? 32.621 39.497 5.362  1.00 21.84 ? 1083 HOH B O   1 
HETATM 1967 O  O   . HOH R 8 .  ? 34.504 37.004 21.665 1.00 23.22 ? 1084 HOH B O   1 
HETATM 1968 O  O   . HOH R 8 .  ? 32.419 40.534 7.448  1.00 26.79 ? 1085 HOH B O   1 
HETATM 1969 O  O   . HOH R 8 .  ? 16.746 28.417 37.499 0.50 10.13 ? 1086 HOH B O   1 
HETATM 1970 O  O   . HOH R 8 .  ? 32.739 34.977 3.883  1.00 24.03 ? 1087 HOH B O   1 
HETATM 1971 O  O   . HOH R 8 .  ? 27.869 34.580 20.871 0.50 11.17 ? 1089 HOH B O   1 
HETATM 1972 O  O   . HOH R 8 .  ? 43.869 29.922 7.659  1.00 25.59 ? 1096 HOH B O   1 
HETATM 1973 O  O   . HOH R 8 .  ? 26.975 29.361 30.235 1.00 33.94 ? 1098 HOH B O   1 
HETATM 1974 O  O   . HOH R 8 .  ? 25.524 35.910 21.471 1.00 33.61 ? 1099 HOH B O   1 
HETATM 1975 O  O   . HOH R 8 .  ? 43.922 31.619 3.746  1.00 36.60 ? 1101 HOH B O   1 
HETATM 1976 O  O   . HOH R 8 .  ? 37.440 27.188 27.696 1.00 22.97 ? 1102 HOH B O   1 
HETATM 1977 O  O   . HOH R 8 .  ? 36.645 34.324 30.444 1.00 22.50 ? 1103 HOH B O   1 
HETATM 1978 O  O   . HOH R 8 .  ? 34.196 40.426 9.756  0.45 14.48 ? 1107 HOH B O   1 
HETATM 1979 O  O   . HOH R 8 .  ? 15.080 33.414 5.430  0.50 14.87 ? 1109 HOH B O   1 
HETATM 1980 O  O   . HOH R 8 .  ? 44.279 28.554 28.985 1.00 36.99 ? 1114 HOH B O   1 
HETATM 1981 O  O   . HOH R 8 .  ? 25.537 26.847 36.018 1.00 34.11 ? 1118 HOH B O   1 
HETATM 1982 O  O   . HOH R 8 .  ? 36.354 16.471 26.081 0.50 23.48 ? 1121 HOH B O   1 
HETATM 1983 O  O   . HOH R 8 .  ? 31.540 26.539 -1.748 0.50 22.42 ? 1123 HOH B O   1 
HETATM 1984 O  O   . HOH R 8 .  ? 45.733 21.811 8.425  0.50 22.72 ? 1127 HOH B O   1 
HETATM 1985 O  O   . HOH R 8 .  ? 22.287 24.973 7.581  0.50 24.01 ? 1129 HOH B O   1 
HETATM 1986 O  O   . HOH R 8 .  ? 31.250 18.466 33.888 1.00 37.16 ? 1133 HOH B O   1 
HETATM 1987 O  O   . HOH R 8 .  ? 31.113 18.319 11.593 0.50 25.32 ? 1135 HOH B O   1 
HETATM 1988 O  O   . HOH R 8 .  ? 16.267 38.852 18.313 0.50 24.53 ? 1138 HOH B O   1 
HETATM 1989 O  O   . HOH R 8 .  ? 34.653 35.691 5.477  1.00 26.41 ? 1140 HOH B O   1 
HETATM 1990 O  O   . HOH R 8 .  ? 19.298 22.707 13.720 1.00 7.30  ? 1142 HOH B O   1 
HETATM 1991 O  O   . HOH R 8 .  ? 43.595 26.174 2.656  1.00 26.88 ? 1144 HOH B O   1 
HETATM 1992 O  O   . HOH R 8 .  ? 38.999 21.736 5.792  0.50 25.18 ? 1145 HOH B O   1 
HETATM 1993 O  O   . HOH R 8 .  ? 27.584 38.030 4.380  1.00 29.86 ? 1146 HOH B O   1 
HETATM 1994 O  O   . HOH R 8 .  ? 21.874 16.071 12.677 1.00 34.49 ? 1147 HOH B O   1 
HETATM 1995 O  O   . HOH R 8 .  ? 29.986 20.566 11.268 0.50 16.88 ? 1148 HOH B O   1 
HETATM 1996 O  O   . HOH R 8 .  ? 35.098 31.561 1.505  1.00 39.89 ? 1149 HOH B O   1 
HETATM 1997 O  O   . HOH R 8 .  ? 40.846 27.368 27.944 0.50 25.43 ? 1151 HOH B O   1 
HETATM 1998 O  O   . HOH R 8 .  ? 26.457 12.588 27.762 1.00 42.64 ? 1152 HOH B O   1 
HETATM 1999 O  O   . HOH R 8 .  ? 31.079 36.671 2.933  1.00 42.10 ? 1153 HOH B O   1 
HETATM 2000 O  O   . HOH R 8 .  ? 45.150 22.698 22.740 0.50 18.17 ? 1154 HOH B O   1 
HETATM 2001 O  O   . HOH R 8 .  ? 16.288 34.002 3.549  1.00 33.68 ? 1156 HOH B O   1 
HETATM 2002 O  O   . HOH R 8 .  ? 37.285 33.451 2.540  1.00 34.31 ? 1157 HOH B O   1 
HETATM 2003 O  O   . HOH R 8 .  ? 26.454 38.095 6.916  0.50 23.49 ? 1159 HOH B O   1 
HETATM 2004 O  O   . HOH R 8 .  ? 41.672 22.986 1.386  0.50 22.77 ? 1161 HOH B O   1 
HETATM 2005 O  O   . HOH R 8 .  ? 22.803 31.023 33.564 1.00 39.87 ? 1168 HOH B O   1 
HETATM 2006 O  O   . HOH R 8 .  ? 25.012 36.430 2.720  0.50 28.85 ? 1169 HOH B O   1 
HETATM 2007 O  O   . HOH R 8 .  ? 9.849  17.052 33.345 0.50 25.38 ? 1170 HOH B O   1 
HETATM 2008 O  O   . HOH R 8 .  ? 32.520 21.882 -1.612 0.50 29.39 ? 1173 HOH B O   1 
HETATM 2009 O  O   . HOH R 8 .  ? 14.008 32.671 5.795  0.50 10.67 ? 1174 HOH B O   1 
HETATM 2010 O  O   . HOH R 8 .  ? 25.125 24.127 2.558  0.50 28.57 ? 1176 HOH B O   1 
HETATM 2011 O  O   . HOH R 8 .  ? 27.862 16.265 14.401 0.50 18.91 ? 1180 HOH B O   1 
HETATM 2012 O  O   . HOH R 8 .  ? 22.272 38.048 28.587 0.50 20.49 ? 1183 HOH B O   1 
HETATM 2013 O  O   . HOH R 8 .  ? 15.386 34.430 36.744 0.50 27.70 ? 1185 HOH B O   1 
HETATM 2014 O  O   . HOH R 8 .  ? 34.455 41.312 8.081  0.45 16.82 ? 1189 HOH B O   1 
HETATM 2015 O  O   . HOH R 8 .  ? 42.004 25.241 22.356 1.00 22.23 ? 1190 HOH B O   1 
HETATM 2016 O  O   . HOH R 8 .  ? 21.530 37.053 28.320 0.50 13.31 ? 1191 HOH B O   1 
HETATM 2017 O  O   . HOH R 8 .  ? 28.861 35.373 21.352 0.50 17.11 ? 1192 HOH B O   1 
HETATM 2018 O  O   . HOH R 8 .  ? 38.180 34.383 8.142  0.55 18.40 ? 1193 HOH B O   1 
HETATM 2019 O  O   . HOH R 8 .  ? 33.470 29.508 30.085 0.50 10.25 ? 1194 HOH B O   1 
HETATM 2020 O  O   . HOH R 8 .  ? 41.818 22.825 9.459  1.00 25.63 ? 1198 HOH B O   1 
HETATM 2021 O  O   . HOH R 8 .  ? 26.812 32.826 30.480 0.50 14.76 ? 1199 HOH B O   1 
HETATM 2022 O  O   . HOH R 8 .  ? 24.542 16.157 13.944 0.50 23.47 ? 1200 HOH B O   1 
HETATM 2023 O  O   . HOH R 8 .  ? 15.126 35.780 31.095 0.50 23.64 ? 1203 HOH B O   1 
HETATM 2024 O  O   . HOH R 8 .  ? 20.087 33.364 35.626 0.50 23.55 ? 1204 HOH B O   1 
HETATM 2025 O  O   . HOH R 8 .  ? 25.184 12.651 25.140 0.50 19.99 ? 1205 HOH B O   1 
HETATM 2026 O  O   . HOH R 8 .  ? 33.720 18.006 2.953  0.50 29.18 ? 1209 HOH B O   1 
HETATM 2027 O  O   . HOH R 8 .  ? 32.183 24.329 36.510 0.50 23.17 ? 1210 HOH B O   1 
HETATM 2028 O  O   . HOH R 8 .  ? 43.960 16.123 26.073 0.50 39.56 ? 1212 HOH B O   1 
HETATM 2029 O  O   . HOH R 8 .  ? 14.908 30.369 4.524  0.25 12.54 ? 1214 HOH B O   1 
HETATM 2030 O  O   . HOH R 8 .  ? 23.241 21.963 8.484  0.50 26.18 ? 1215 HOH B O   1 
HETATM 2031 O  O   . HOH R 8 .  ? 39.764 16.902 7.011  0.50 29.98 ? 1217 HOH B O   1 
HETATM 2032 O  O   . HOH R 8 .  ? 35.286 16.442 25.724 0.50 11.80 ? 1225 HOH B O   1 
HETATM 2033 O  O   . HOH R 8 .  ? 36.204 36.977 26.641 0.50 40.32 ? 1228 HOH B O   1 
HETATM 2034 O  O   . HOH R 8 .  ? 26.086 13.480 24.293 0.50 22.77 ? 1230 HOH B O   1 
HETATM 2035 O  O   . HOH R 8 .  ? 33.213 29.627 31.111 0.50 19.61 ? 1246 HOH B O   1 
HETATM 2036 O  O   . HOH R 8 .  ? 34.395 33.654 2.074  0.50 25.24 ? 1249 HOH B O   1 
HETATM 2037 O  O   . HOH R 8 .  ? 29.549 39.137 16.650 0.45 32.59 ? 1250 HOH B O   1 
HETATM 2038 O  O   . HOH R 8 .  ? 41.994 16.802 26.450 0.50 31.49 ? 1255 HOH B O   1 
HETATM 2039 O  O   . HOH R 8 .  ? 40.611 21.889 7.237  0.50 19.40 ? 1257 HOH B O   1 
HETATM 2040 O  O   . HOH R 8 .  ? 31.127 38.877 15.251 0.45 13.00 ? 1258 HOH B O   1 
HETATM 2041 O  O   . HOH R 8 .  ? 43.377 21.612 10.570 0.50 21.40 ? 1259 HOH B O   1 
HETATM 2042 O  O   . HOH R 8 .  ? 36.761 36.116 26.340 0.50 33.14 ? 1261 HOH B O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N  N   . PRO A 1  ? 0.1469 0.1704 0.2386 -0.0135 0.0655  0.0132  1    PRO A N   
2    C  CA  . PRO A 1  ? 0.1691 0.1882 0.1411 -0.0420 0.0503  0.0153  1    PRO A CA  
3    C  C   . PRO A 1  ? 0.1653 0.1167 0.1338 -0.0218 0.0524  -0.0152 1    PRO A C   
4    O  O   . PRO A 1  ? 0.1629 0.1045 0.1748 -0.0061 0.0549  0.0034  1    PRO A O   
5    C  CB  . PRO A 1  ? 0.2032 0.3336 0.2332 -0.0144 -0.0350 -0.0023 1    PRO A CB  
6    C  CG  . PRO A 1  ? 0.2171 0.3600 0.3387 0.0426  -0.0322 -0.0445 1    PRO A CG  
7    C  CD  . PRO A 1  ? 0.2141 0.3086 0.3570 0.0418  -0.0319 -0.0265 1    PRO A CD  
8    N  N   . GLN A 2  ? 0.1749 0.1129 0.1200 -0.0139 0.0550  0.0106  2    GLN A N   
9    C  CA  . GLN A 2  ? 0.1858 0.0937 0.1277 -0.0097 0.0750  -0.0001 2    GLN A CA  
10   C  C   . GLN A 2  ? 0.2178 0.1037 0.1384 -0.0480 0.0867  -0.0357 2    GLN A C   
11   O  O   . GLN A 2  ? 0.2999 0.1056 0.1690 -0.0770 0.0947  -0.0422 2    GLN A O   
12   C  CB  . GLN A 2  ? 0.1769 0.1140 0.1877 0.0011  0.0800  0.0028  2    GLN A CB  
13   C  CG  . GLN A 2  ? 0.1792 0.1353 0.2109 -0.0172 0.0834  -0.0098 2    GLN A CG  
14   C  CD  . GLN A 2  ? 0.1903 0.2040 0.3221 0.0463  0.0772  -0.0074 2    GLN A CD  
15   O  OE1 . GLN A 2  ? 0.2991 0.2139 0.4207 0.0915  0.0885  -0.0271 2    GLN A OE1 
16   N  NE2 . GLN A 2  ? 0.2364 0.1882 0.2680 0.0883  0.0388  0.0579  2    GLN A NE2 
17   N  N   . ILE A 3  ? 0.2138 0.1025 0.1095 -0.0535 0.0709  -0.0281 3    ILE A N   
18   C  CA  . ILE A 3  ? 0.2087 0.1503 0.1087 -0.0769 0.0588  -0.0513 3    ILE A CA  
19   C  C   . ILE A 3  ? 0.2215 0.0987 0.0942 -0.0396 0.0680  -0.0189 3    ILE A C   
20   O  O   . ILE A 3  ? 0.1568 0.1000 0.1096 -0.0109 0.0525  -0.0224 3    ILE A O   
21   C  CB  . ILE A 3  ? 0.1736 0.2658 0.1029 -0.0591 0.0325  -0.0138 3    ILE A CB  
22   C  CG1 . ILE A 3  ? 0.1739 0.4174 0.2478 -0.0747 0.0354  0.0772  3    ILE A CG1 
23   C  CG2 . ILE A 3  ? 0.3078 0.2691 0.0961 -0.0669 0.0163  -0.0412 3    ILE A CG2 
24   C  CD1 . ILE A 3  ? 0.2829 0.2897 0.5343 0.1510  0.1059  -0.0546 3    ILE A CD1 
25   N  N   A THR A 4  ? 0.1926 0.0851 0.1701 -0.0423 0.0643  -0.0131 4    THR A N   
26   N  N   B THR A 4  ? 0.3350 0.1022 0.1484 -0.0491 0.1369  -0.0356 4    THR A N   
27   C  CA  A THR A 4  ? 0.1577 0.0742 0.0573 -0.0292 -0.0042 -0.0169 4    THR A CA  
28   C  CA  B THR A 4  ? 0.2465 0.0814 0.0451 -0.0264 0.0395  -0.0123 4    THR A CA  
29   C  C   A THR A 4  ? 0.0889 0.1000 0.0811 -0.0233 -0.0234 0.0088  4    THR A C   
30   C  C   B THR A 4  ? 0.1533 0.0921 0.0897 -0.0288 0.0088  0.0157  4    THR A C   
31   O  O   A THR A 4  ? 0.0683 0.1372 0.0937 -0.0185 0.0014  0.0053  4    THR A O   
32   O  O   B THR A 4  ? 0.1154 0.0754 0.1104 -0.0431 0.0250  0.0034  4    THR A O   
33   C  CB  A THR A 4  ? 0.1907 0.0571 0.0558 -0.0258 0.0016  -0.0152 4    THR A CB  
34   C  CB  B THR A 4  ? 0.1976 0.0693 0.1241 0.0923  -0.0702 -0.0256 4    THR A CB  
35   O  OG1 A THR A 4  ? 0.1160 0.0838 0.1542 0.0758  -0.0746 -0.0538 4    THR A OG1 
36   O  OG1 B THR A 4  ? 0.1692 0.2037 0.3560 0.0779  -0.0351 -0.0269 4    THR A OG1 
37   C  CG2 A THR A 4  ? 0.3594 0.0602 0.1132 -0.0699 -0.0608 0.0249  4    THR A CG2 
38   C  CG2 B THR A 4  ? 0.5300 0.1253 0.1410 0.0535  -0.1580 -0.0768 4    THR A CG2 
39   N  N   A LEU A 5  ? 0.0784 0.0666 0.0895 0.0109  -0.0051 0.0024  5    LEU A N   
40   N  N   B LEU A 5  ? 0.1353 0.0697 0.0655 -0.0072 -0.0210 0.0093  5    LEU A N   
41   C  CA  A LEU A 5  ? 0.0631 0.0646 0.0904 -0.0006 -0.0034 0.0009  5    LEU A CA  
42   C  CA  B LEU A 5  ? 0.0832 0.0620 0.0733 -0.0010 -0.0101 0.0034  5    LEU A CA  
43   C  C   . LEU A 5  ? 0.0498 0.0600 0.0906 0.0093  -0.0135 -0.0027 5    LEU A C   
44   O  O   . LEU A 5  ? 0.0494 0.0670 0.0840 0.0100  -0.0072 -0.0029 5    LEU A O   
45   C  CB  . LEU A 5  ? 0.0652 0.0722 0.0897 0.0088  -0.0239 -0.0053 5    LEU A CB  
46   C  CG  . LEU A 5  ? 0.0902 0.0580 0.0832 0.0065  -0.0103 0.0003  5    LEU A CG  
47   C  CD1 . LEU A 5  ? 0.0955 0.0769 0.1053 0.0103  -0.0226 -0.0190 5    LEU A CD1 
48   C  CD2 . LEU A 5  ? 0.0709 0.0860 0.1122 0.0141  -0.0012 -0.0137 5    LEU A CD2 
49   N  N   . TRP A 6  ? 0.0683 0.0672 0.1031 0.0102  -0.0177 -0.0041 6    TRP A N   
50   C  CA  . TRP A 6  ? 0.0707 0.0776 0.1229 0.0185  -0.0212 -0.0272 6    TRP A CA  
51   C  C   . TRP A 6  ? 0.0736 0.1170 0.1052 0.0287  -0.0116 -0.0268 6    TRP A C   
52   O  O   . TRP A 6  ? 0.1007 0.2372 0.1130 0.0720  -0.0024 -0.0260 6    TRP A O   
53   C  CB  . TRP A 6  ? 0.0740 0.0768 0.1661 0.0185  -0.0235 -0.0350 6    TRP A CB  
54   C  CG  . TRP A 6  ? 0.0585 0.0692 0.1540 0.0037  -0.0061 -0.0133 6    TRP A CG  
55   C  CD1 . TRP A 6  ? 0.0798 0.1171 0.1995 -0.0124 0.0115  0.0267  6    TRP A CD1 
56   C  CD2 . TRP A 6  ? 0.0580 0.0734 0.1510 0.0067  -0.0042 0.0056  6    TRP A CD2 
57   N  NE1 . TRP A 6  ? 0.1036 0.1326 0.2041 -0.0163 -0.0019 0.0560  6    TRP A NE1 
58   C  CE2 . TRP A 6  ? 0.0775 0.0803 0.1797 0.0033  -0.0143 0.0310  6    TRP A CE2 
59   C  CE3 . TRP A 6  ? 0.0757 0.1041 0.1449 -0.0112 0.0039  -0.0002 6    TRP A CE3 
60   C  CZ2 . TRP A 6  ? 0.0848 0.1344 0.2142 0.0130  -0.0311 0.0504  6    TRP A CZ2 
61   C  CZ3 . TRP A 6  ? 0.0695 0.1181 0.2024 -0.0197 -0.0003 0.0171  6    TRP A CZ3 
62   C  CH2 . TRP A 6  ? 0.0705 0.1438 0.2050 0.0126  -0.0093 0.0089  6    TRP A CH2 
63   N  N   . LYS A 7  ? 0.0649 0.0904 0.0998 0.0065  -0.0172 -0.0168 7    LYS A N   
64   C  CA  . LYS A 7  ? 0.0765 0.0888 0.0933 0.0127  -0.0147 -0.0119 7    LYS A CA  
65   C  C   . LYS A 7  ? 0.0457 0.0944 0.0855 0.0040  -0.0100 -0.0158 7    LYS A C   
66   O  O   . LYS A 7  ? 0.0644 0.0892 0.0856 0.0078  -0.0063 -0.0133 7    LYS A O   
67   C  CB  A LYS A 7  ? 0.0863 0.0916 0.1443 0.0072  -0.0408 -0.0056 7    LYS A CB  
68   C  CB  B LYS A 7  ? 0.1148 0.0958 0.2266 0.0091  -0.0934 -0.0279 7    LYS A CB  
69   C  CG  A LYS A 7  ? 0.0976 0.0939 0.2137 0.0244  0.0088  0.0304  7    LYS A CG  
70   C  CG  B LYS A 7  ? 0.1548 0.0821 0.2550 0.0122  -0.0850 0.0080  7    LYS A CG  
71   C  CD  A LYS A 7  ? 0.0922 0.1897 0.2914 -0.0329 -0.0114 0.0102  7    LYS A CD  
72   C  CD  B LYS A 7  ? 0.1655 0.1133 0.3368 -0.0204 -0.1093 0.0116  7    LYS A CD  
73   C  CE  A LYS A 7  ? 0.2300 0.3469 0.3424 -0.0289 -0.1111 -0.0293 7    LYS A CE  
74   C  CE  B LYS A 7  ? 0.1536 0.2366 0.3749 0.0024  -0.0912 -0.0267 7    LYS A CE  
75   N  NZ  A LYS A 7  ? 0.5251 0.3709 0.4331 0.1243  -0.2401 -0.1169 7    LYS A NZ  
76   N  NZ  B LYS A 7  ? 0.2137 0.4493 0.3981 0.0567  -0.0945 -0.0928 7    LYS A NZ  
77   N  N   . ARG A 8  ? 0.0622 0.0897 0.0792 0.0124  -0.0030 -0.0198 8    ARG A N   
78   C  CA  . ARG A 8  ? 0.0597 0.0764 0.0859 0.0060  -0.0070 -0.0170 8    ARG A CA  
79   C  C   . ARG A 8  ? 0.0317 0.0809 0.0917 0.0080  -0.0088 -0.0075 8    ARG A C   
80   O  O   . ARG A 8  ? 0.0498 0.0691 0.1247 0.0028  -0.0064 -0.0195 8    ARG A O   
81   C  CB  . ARG A 8  ? 0.0793 0.0925 0.0966 0.0109  -0.0089 -0.0004 8    ARG A CB  
82   C  CG  . ARG A 8  ? 0.1048 0.1025 0.0957 0.0145  0.0059  0.0006  8    ARG A CG  
83   C  CD  A ARG A 8  ? 0.1714 0.1665 0.1038 0.0561  -0.0109 0.0250  8    ARG A CD  
84   C  CD  B ARG A 8  ? 0.1283 0.1901 0.1216 0.0085  0.0038  0.0528  8    ARG A CD  
85   N  NE  A ARG A 8  ? 0.2419 0.2973 0.1014 0.0102  -0.0502 -0.0496 8    ARG A NE  
86   N  NE  B ARG A 8  ? 0.1057 0.2623 0.0834 -0.0334 -0.0218 0.0303  8    ARG A NE  
87   C  CZ  A ARG A 8  ? 0.2403 0.4470 0.2240 -0.0510 -0.0657 -0.0292 8    ARG A CZ  
88   C  CZ  B ARG A 8  ? 0.1945 0.3877 0.0939 -0.1087 -0.0464 0.0644  8    ARG A CZ  
89   N  NH1 A ARG A 8  ? 0.1860 0.5288 0.1283 -0.1035 -0.0605 0.0987  8    ARG A NH1 
90   N  NH1 B ARG A 8  ? 0.2208 0.7007 0.1959 -0.1020 -0.1470 0.0852  8    ARG A NH1 
91   N  NH2 A ARG A 8  ? 0.2789 0.5285 0.3254 -0.0759 -0.0527 -0.1762 8    ARG A NH2 
92   N  NH2 B ARG A 8  ? 0.2431 0.5611 0.1166 -0.0419 0.0286  0.1004  8    ARG A NH2 
93   N  N   . PRO A 9  ? 0.0385 0.0734 0.0829 -0.0029 -0.0001 -0.0039 9    PRO A N   
94   C  CA  . PRO A 9  ? 0.0497 0.0858 0.0797 0.0056  0.0013  0.0132  9    PRO A CA  
95   C  C   . PRO A 9  ? 0.0413 0.0736 0.0914 -0.0060 0.0058  0.0033  9    PRO A C   
96   O  O   . PRO A 9  ? 0.0611 0.0645 0.1205 0.0025  -0.0147 -0.0002 9    PRO A O   
97   C  CB  . PRO A 9  ? 0.0594 0.1156 0.0892 0.0071  -0.0011 -0.0132 9    PRO A CB  
98   C  CG  . PRO A 9  ? 0.0695 0.1136 0.0916 -0.0191 -0.0002 -0.0270 9    PRO A CG  
99   C  CD  . PRO A 9  ? 0.0529 0.0957 0.0978 -0.0183 0.0030  -0.0106 9    PRO A CD  
100  N  N   . LEU A 10 ? 0.0393 0.0761 0.1253 0.0035  -0.0003 -0.0127 10   LEU A N   
101  C  CA  . LEU A 10 ? 0.0367 0.0755 0.1239 0.0006  -0.0005 -0.0101 10   LEU A CA  
102  C  C   . LEU A 10 ? 0.0494 0.0759 0.1514 -0.0001 0.0078  0.0030  10   LEU A C   
103  O  O   . LEU A 10 ? 0.0603 0.0749 0.2148 0.0066  0.0216  0.0076  10   LEU A O   
104  C  CB  . LEU A 10 ? 0.0771 0.1056 0.1355 -0.0041 -0.0184 -0.0272 10   LEU A CB  
105  C  CG  . LEU A 10 ? 0.0914 0.1703 0.1181 0.0094  -0.0042 -0.0310 10   LEU A CG  
106  C  CD1 . LEU A 10 ? 0.2140 0.2076 0.1348 0.0340  -0.0155 -0.0587 10   LEU A CD1 
107  C  CD2 . LEU A 10 ? 0.2332 0.1134 0.1998 -0.0346 0.0254  -0.0058 10   LEU A CD2 
108  N  N   . VAL A 11 ? 0.0274 0.0732 0.1295 0.0000  -0.0027 0.0166  11   VAL A N   
109  C  CA  . VAL A 11 ? 0.0396 0.0771 0.1304 -0.0089 -0.0034 0.0140  11   VAL A CA  
110  C  C   . VAL A 11 ? 0.0353 0.0719 0.1297 0.0001  0.0050  0.0047  11   VAL A C   
111  O  O   . VAL A 11 ? 0.0394 0.0904 0.1368 -0.0108 -0.0066 0.0246  11   VAL A O   
112  C  CB  . VAL A 11 ? 0.0488 0.1397 0.1329 -0.0043 -0.0032 -0.0006 11   VAL A CB  
113  C  CG1 . VAL A 11 ? 0.0830 0.1909 0.1453 -0.0038 -0.0302 0.0237  11   VAL A CG1 
114  C  CG2 . VAL A 11 ? 0.0824 0.1537 0.1477 0.0119  -0.0081 -0.0470 11   VAL A CG2 
115  N  N   . THR A 12 ? 0.0383 0.0814 0.1128 -0.0077 0.0009  0.0204  12   THR A N   
116  C  CA  . THR A 12 ? 0.0393 0.0797 0.1116 -0.0050 -0.0025 -0.0079 12   THR A CA  
117  C  C   . THR A 12 ? 0.0412 0.0800 0.1008 -0.0086 -0.0040 -0.0047 12   THR A C   
118  O  O   . THR A 12 ? 0.0680 0.0930 0.1060 0.0167  -0.0012 -0.0057 12   THR A O   
119  C  CB  . THR A 12 ? 0.0535 0.0847 0.1830 -0.0146 0.0092  -0.0097 12   THR A CB  
120  O  OG1 . THR A 12 ? 0.0928 0.1025 0.2324 -0.0259 -0.0131 -0.0570 12   THR A OG1 
121  C  CG2 . THR A 12 ? 0.0586 0.1357 0.2117 -0.0260 -0.0254 -0.0279 12   THR A CG2 
122  N  N   . ILE A 13 ? 0.0417 0.0960 0.0837 0.0051  0.0028  -0.0129 13   ILE A N   
123  C  CA  . ILE A 13 ? 0.0449 0.0834 0.0802 0.0029  0.0045  -0.0055 13   ILE A CA  
124  C  C   . ILE A 13 ? 0.0465 0.0778 0.0845 0.0023  0.0085  0.0018  13   ILE A C   
125  O  O   . ILE A 13 ? 0.0474 0.0938 0.0922 0.0043  0.0028  -0.0080 13   ILE A O   
126  C  CB  . ILE A 13 ? 0.0499 0.0871 0.0949 0.0020  -0.0026 -0.0078 13   ILE A CB  
127  C  CG1 . ILE A 13 ? 0.0703 0.0770 0.1055 0.0090  0.0042  0.0071  13   ILE A CG1 
128  C  CG2 . ILE A 13 ? 0.0514 0.1023 0.0999 -0.0190 -0.0024 -0.0059 13   ILE A CG2 
129  C  CD1 . ILE A 13 ? 0.0614 0.0878 0.1128 -0.0120 -0.0031 0.0019  13   ILE A CD1 
130  N  N   . LYS A 14 ? 0.0473 0.0812 0.0824 0.0121  -0.0070 -0.0062 14   LYS A N   
131  C  CA  . LYS A 14 ? 0.0405 0.0799 0.0861 0.0053  0.0005  0.0009  14   LYS A CA  
132  C  C   . LYS A 14 ? 0.0374 0.0819 0.0871 0.0040  -0.0014 -0.0027 14   LYS A C   
133  O  O   . LYS A 14 ? 0.0732 0.0830 0.0954 0.0103  -0.0164 -0.0020 14   LYS A O   
134  C  CB  . LYS A 14 ? 0.0617 0.1037 0.1273 0.0004  0.0106  0.0230  14   LYS A CB  
135  C  CG  . LYS A 14 ? 0.0481 0.1418 0.1488 -0.0181 0.0161  -0.0002 14   LYS A CG  
136  C  CD  . LYS A 14 ? 0.0911 0.2307 0.2175 -0.0327 0.0478  0.0433  14   LYS A CD  
137  C  CE  A LYS A 14 ? 0.1444 0.2834 0.2171 -0.0559 0.0505  0.0953  14   LYS A CE  
138  C  CE  B LYS A 14 ? 0.1016 0.3611 0.1916 -0.0533 0.0504  0.0617  14   LYS A CE  
139  N  NZ  A LYS A 14 ? 0.3817 0.4365 0.3677 -0.0530 0.0036  -0.1290 14   LYS A NZ  
140  N  NZ  B LYS A 14 ? 0.2182 0.3748 0.3234 -0.0668 0.1982  0.0287  14   LYS A NZ  
141  N  N   . ILE A 15 ? 0.0386 0.0659 0.0908 -0.0073 -0.0066 -0.0099 15   ILE A N   
142  C  CA  . ILE A 15 ? 0.0502 0.0749 0.0924 -0.0007 -0.0117 0.0006  15   ILE A CA  
143  C  C   . ILE A 15 ? 0.0381 0.0781 0.0891 -0.0028 0.0006  0.0030  15   ILE A C   
144  O  O   . ILE A 15 ? 0.0493 0.0856 0.0949 -0.0048 -0.0079 0.0073  15   ILE A O   
145  C  CB  . ILE A 15 ? 0.0460 0.0904 0.1296 -0.0124 -0.0150 -0.0023 15   ILE A CB  
146  C  CG1 . ILE A 15 ? 0.0819 0.0910 0.1608 -0.0147 -0.0011 0.0211  15   ILE A CG1 
147  C  CG2 . ILE A 15 ? 0.0715 0.1071 0.1215 -0.0025 0.0019  0.0207  15   ILE A CG2 
148  C  CD1 . ILE A 15 ? 0.0985 0.1244 0.1776 -0.0516 -0.0069 0.0044  15   ILE A CD1 
149  N  N   . GLY A 16 ? 0.0549 0.0963 0.0925 0.0080  -0.0117 -0.0038 16   GLY A N   
150  C  CA  . GLY A 16 ? 0.0546 0.0802 0.1303 0.0111  -0.0171 0.0054  16   GLY A CA  
151  C  C   . GLY A 16 ? 0.0450 0.0790 0.1079 0.0064  0.0035  0.0009  16   GLY A C   
152  O  O   . GLY A 16 ? 0.0647 0.1037 0.1336 -0.0099 -0.0218 0.0202  16   GLY A O   
153  N  N   . GLY A 17 ? 0.0396 0.0960 0.1100 0.0012  -0.0059 0.0059  17   GLY A N   
154  C  CA  . GLY A 17 ? 0.0494 0.0868 0.1401 -0.0007 -0.0105 0.0123  17   GLY A CA  
155  C  C   . GLY A 17 ? 0.0535 0.0742 0.1317 -0.0069 -0.0150 0.0170  17   GLY A C   
156  O  O   . GLY A 17 ? 0.0688 0.0821 0.1865 -0.0189 0.0009  -0.0004 17   GLY A O   
157  N  N   . GLN A 18 ? 0.0460 0.0877 0.1119 -0.0049 -0.0226 -0.0051 18   GLN A N   
158  C  CA  . GLN A 18 ? 0.0665 0.0951 0.1207 -0.0050 -0.0171 -0.0035 18   GLN A CA  
159  C  C   . GLN A 18 ? 0.0637 0.0882 0.1148 -0.0041 -0.0146 -0.0051 18   GLN A C   
160  O  O   . GLN A 18 ? 0.0791 0.0879 0.1216 0.0091  -0.0281 -0.0175 18   GLN A O   
161  C  CB  . GLN A 18 ? 0.1128 0.1376 0.1117 0.0077  -0.0073 0.0145  18   GLN A CB  
162  C  CG  A GLN A 18 ? 0.1401 0.2323 0.1277 0.0146  -0.0325 0.0511  18   GLN A CG  
163  C  CG  B GLN A 18 ? 0.1295 0.1314 0.1490 -0.0096 -0.0462 0.0132  18   GLN A CG  
164  C  CD  A GLN A 18 ? 0.1447 0.1644 0.2019 0.0740  -0.0684 0.0142  18   GLN A CD  
165  C  CD  B GLN A 18 ? 0.1322 0.1255 0.1468 0.0226  -0.0488 0.0279  18   GLN A CD  
166  O  OE1 A GLN A 18 ? 0.4367 0.1898 0.5073 0.1425  -0.1312 -0.0758 18   GLN A OE1 
167  O  OE1 B GLN A 18 ? 0.1276 0.1688 0.1711 0.0012  -0.0378 0.0417  18   GLN A OE1 
168  N  NE2 A GLN A 18 ? 0.1031 0.4254 0.3523 0.1042  -0.0542 -0.0821 18   GLN A NE2 
169  N  NE2 B GLN A 18 ? 0.2720 0.2087 0.1652 -0.0646 -0.1038 0.0626  18   GLN A NE2 
170  N  N   . LEU A 19 ? 0.0483 0.0921 0.1318 -0.0085 -0.0187 -0.0180 19   LEU A N   
171  C  CA  . LEU A 19 ? 0.0408 0.0968 0.1175 -0.0007 -0.0116 -0.0252 19   LEU A CA  
172  C  C   . LEU A 19 ? 0.0553 0.1337 0.1030 -0.0021 -0.0134 -0.0190 19   LEU A C   
173  O  O   . LEU A 19 ? 0.0651 0.2382 0.1145 -0.0013 -0.0161 -0.0335 19   LEU A O   
174  C  CB  . LEU A 19 ? 0.0634 0.0889 0.1327 0.0052  -0.0098 -0.0280 19   LEU A CB  
175  C  CG  . LEU A 19 ? 0.0862 0.0958 0.1519 0.0096  -0.0055 0.0062  19   LEU A CG  
176  C  CD1 . LEU A 19 ? 0.1281 0.0913 0.2112 0.0114  -0.0107 0.0164  19   LEU A CD1 
177  C  CD2 . LEU A 19 ? 0.1517 0.1597 0.1537 -0.0338 0.0306  -0.0275 19   LEU A CD2 
178  N  N   . LYS A 20 ? 0.0473 0.1387 0.1076 -0.0117 -0.0080 0.0001  20   LYS A N   
179  C  CA  . LYS A 20 ? 0.0566 0.1438 0.1048 -0.0075 -0.0005 -0.0118 20   LYS A CA  
180  C  C   . LYS A 20 ? 0.0534 0.1110 0.0984 -0.0078 -0.0020 -0.0309 20   LYS A C   
181  O  O   . LYS A 20 ? 0.0726 0.1306 0.1058 0.0178  0.0162  -0.0024 20   LYS A O   
182  C  CB  . LYS A 20 ? 0.0776 0.1422 0.1234 -0.0019 0.0186  0.0080  20   LYS A CB  
183  C  CG  . LYS A 20 ? 0.1067 0.1628 0.1767 0.0018  -0.0134 0.0221  20   LYS A CG  
184  C  CD  A LYS A 20 ? 0.1498 0.1421 0.2040 0.0381  0.0144  -0.0023 20   LYS A CD  
185  C  CD  B LYS A 20 ? 0.1429 0.1510 0.2431 0.0081  0.0196  0.0577  20   LYS A CD  
186  C  CE  A LYS A 20 ? 0.1188 0.1746 0.2113 0.0183  0.0378  0.0174  20   LYS A CE  
187  C  CE  B LYS A 20 ? 0.2533 0.1762 0.2060 -0.0260 0.0135  0.0315  20   LYS A CE  
188  N  NZ  A LYS A 20 ? 0.1496 0.1834 0.1935 -0.0041 0.0209  0.0785  20   LYS A NZ  
189  N  NZ  B LYS A 20 ? 0.2563 0.2727 0.3269 0.0580  -0.0784 0.1268  20   LYS A NZ  
190  N  N   . GLU A 21 ? 0.0579 0.1386 0.0913 -0.0114 0.0008  -0.0126 21   GLU A N   
191  C  CA  . GLU A 21 ? 0.0506 0.0980 0.1274 -0.0048 0.0029  -0.0137 21   GLU A CA  
192  C  C   . GLU A 21 ? 0.0533 0.0839 0.0911 -0.0073 0.0105  -0.0027 21   GLU A C   
193  O  O   . GLU A 21 ? 0.1053 0.0976 0.1021 -0.0141 -0.0207 -0.0029 21   GLU A O   
194  C  CB  . GLU A 21 ? 0.0874 0.1056 0.1555 -0.0054 0.0147  -0.0372 21   GLU A CB  
195  C  CG  . GLU A 21 ? 0.1566 0.1238 0.2290 -0.0367 0.0207  -0.0429 21   GLU A CG  
196  C  CD  . GLU A 21 ? 0.2293 0.1261 0.2684 -0.0266 0.0303  0.0081  21   GLU A CD  
197  O  OE1 . GLU A 21 ? 0.2721 0.2678 0.2870 -0.0464 0.0759  0.0155  21   GLU A OE1 
198  O  OE2 . GLU A 21 ? 0.2977 0.3099 0.3271 0.0693  0.0114  0.0573  21   GLU A OE2 
199  N  N   . ALA A 22 ? 0.0460 0.0760 0.0902 -0.0076 0.0079  0.0053  22   ALA A N   
200  C  CA  . ALA A 22 ? 0.0432 0.0635 0.0853 0.0039  -0.0019 0.0090  22   ALA A CA  
201  C  C   . ALA A 22 ? 0.0368 0.0688 0.0898 0.0055  0.0032  0.0141  22   ALA A C   
202  O  O   . ALA A 22 ? 0.0387 0.0769 0.1298 -0.0075 -0.0098 0.0336  22   ALA A O   
203  C  CB  . ALA A 22 ? 0.0551 0.0747 0.0826 0.0071  -0.0025 -0.0003 22   ALA A CB  
204  N  N   . LEU A 23 ? 0.0428 0.0512 0.0775 0.0048  -0.0077 0.0127  23   LEU A N   
205  C  CA  . LEU A 23 ? 0.0358 0.0596 0.1018 0.0058  -0.0016 0.0204  23   LEU A CA  
206  C  C   . LEU A 23 ? 0.0497 0.0682 0.1013 -0.0026 -0.0077 -0.0023 23   LEU A C   
207  O  O   . LEU A 23 ? 0.1152 0.0778 0.1139 0.0303  -0.0332 0.0019  23   LEU A O   
208  C  CB  . LEU A 23 ? 0.0554 0.0887 0.1160 -0.0080 0.0235  0.0105  23   LEU A CB  
209  C  CG  . LEU A 23 ? 0.1398 0.0712 0.1074 0.0105  0.0342  0.0170  23   LEU A CG  
210  C  CD1 . LEU A 23 ? 0.1285 0.1250 0.1251 -0.0250 0.0339  0.0200  23   LEU A CD1 
211  C  CD2 . LEU A 23 ? 0.1547 0.1397 0.1552 0.0648  0.0721  0.0329  23   LEU A CD2 
212  N  N   . LEU A 24 ? 0.0451 0.0580 0.0939 0.0100  -0.0032 -0.0040 24   LEU A N   
213  C  CA  . LEU A 24 ? 0.0509 0.0688 0.0941 -0.0007 -0.0056 -0.0155 24   LEU A CA  
214  C  C   . LEU A 24 ? 0.0442 0.0701 0.1039 0.0062  -0.0054 -0.0109 24   LEU A C   
215  O  O   . LEU A 24 ? 0.0512 0.0697 0.1500 0.0101  -0.0215 -0.0061 24   LEU A O   
216  C  CB  . LEU A 24 ? 0.0874 0.0787 0.1097 -0.0082 -0.0080 0.0016  24   LEU A CB  
217  C  CG  . LEU A 24 ? 0.0995 0.1001 0.0941 -0.0251 0.0042  0.0023  24   LEU A CG  
218  C  CD1 . LEU A 24 ? 0.1966 0.1574 0.1686 -0.0507 -0.0400 0.0795  24   LEU A CD1 
219  C  CD2 . LEU A 24 ? 0.0955 0.1335 0.1615 -0.0200 0.0208  -0.0238 24   LEU A CD2 
220  N  N   . ASP A 25 ? 0.0464 0.0613 0.0890 0.0094  -0.0126 0.0017  25   ASP A N   
221  C  CA  . ASP A 25 ? 0.0647 0.0686 0.0624 0.0107  -0.0068 -0.0007 25   ASP A CA  
222  C  C   . ASP A 25 ? 0.0454 0.0637 0.0839 0.0047  -0.0059 -0.0019 25   ASP A C   
223  O  O   . ASP A 25 ? 0.0533 0.0586 0.0856 0.0082  -0.0060 -0.0047 25   ASP A O   
224  C  CB  . ASP A 25 ? 0.0634 0.0792 0.0717 0.0150  -0.0049 0.0017  25   ASP A CB  
225  C  CG  . ASP A 25 ? 0.0903 0.0868 0.0642 0.0007  -0.0022 -0.0022 25   ASP A CG  
226  O  OD1 . ASP A 25 ? 0.0836 0.1006 0.0735 -0.0107 0.0083  -0.0015 25   ASP A OD1 
227  O  OD2 . ASP A 25 ? 0.0995 0.1091 0.0843 0.0107  0.0134  0.0101  25   ASP A OD2 
228  N  N   . THR A 26 ? 0.0498 0.0642 0.0671 0.0032  -0.0020 -0.0047 26   THR A N   
229  C  CA  . THR A 26 ? 0.0478 0.0611 0.0670 0.0067  0.0019  -0.0078 26   THR A CA  
230  C  C   . THR A 26 ? 0.0436 0.0664 0.0692 -0.0008 -0.0066 -0.0095 26   THR A C   
231  O  O   . THR A 26 ? 0.0620 0.0716 0.0770 0.0011  -0.0042 -0.0116 26   THR A O   
232  C  CB  . THR A 26 ? 0.0500 0.0615 0.0652 0.0042  0.0036  -0.0058 26   THR A CB  
233  O  OG1 . THR A 26 ? 0.0500 0.0708 0.0555 0.0178  -0.0008 -0.0070 26   THR A OG1 
234  C  CG2 . THR A 26 ? 0.0684 0.0749 0.0733 0.0088  0.0119  0.0007  26   THR A CG2 
235  N  N   . GLY A 27 ? 0.0483 0.0678 0.0690 0.0026  -0.0005 0.0026  27   GLY A N   
236  C  CA  . GLY A 27 ? 0.0483 0.0700 0.0878 -0.0041 0.0121  -0.0038 27   GLY A CA  
237  C  C   . GLY A 27 ? 0.0508 0.0725 0.0727 -0.0029 0.0002  0.0002  27   GLY A C   
238  O  O   . GLY A 27 ? 0.0673 0.0967 0.1133 -0.0093 0.0049  0.0271  27   GLY A O   
239  N  N   . ALA A 28 ? 0.0524 0.0651 0.0790 0.0059  0.0067  0.0138  28   ALA A N   
240  C  CA  . ALA A 28 ? 0.0534 0.0722 0.0818 0.0045  0.0062  0.0114  28   ALA A CA  
241  C  C   . ALA A 28 ? 0.0446 0.0656 0.0912 0.0020  0.0037  0.0078  28   ALA A C   
242  O  O   . ALA A 28 ? 0.0603 0.0762 0.0927 0.0004  0.0163  0.0114  28   ALA A O   
243  C  CB  . ALA A 28 ? 0.0686 0.0847 0.0762 0.0042  -0.0001 0.0059  28   ALA A CB  
244  N  N   . ASP A 29 ? 0.0607 0.0700 0.0918 0.0011  0.0037  0.0076  29   ASP A N   
245  C  CA  . ASP A 29 ? 0.0693 0.0763 0.0905 0.0006  -0.0090 -0.0036 29   ASP A CA  
246  C  C   . ASP A 29 ? 0.0706 0.0832 0.0873 0.0062  0.0013  -0.0047 29   ASP A C   
247  O  O   . ASP A 29 ? 0.0860 0.1323 0.1024 -0.0008 0.0136  -0.0250 29   ASP A O   
248  C  CB  . ASP A 29 ? 0.0916 0.0738 0.1381 0.0032  -0.0191 -0.0056 29   ASP A CB  
249  C  CG  . ASP A 29 ? 0.1122 0.0876 0.1560 -0.0243 -0.0369 0.0126  29   ASP A CG  
250  O  OD1 . ASP A 29 ? 0.0893 0.1120 0.1459 -0.0145 -0.0164 0.0056  29   ASP A OD1 
251  O  OD2 . ASP A 29 ? 0.1526 0.1186 0.2679 -0.0440 -0.0575 0.0540  29   ASP A OD2 
252  N  N   . ASP A 30 ? 0.0660 0.0837 0.0991 0.0044  -0.0114 -0.0171 30   ASP A N   
253  C  CA  . ASP A 30 ? 0.0763 0.0964 0.1254 -0.0002 -0.0282 -0.0077 30   ASP A CA  
254  C  C   . ASP A 30 ? 0.0617 0.0936 0.0804 0.0019  -0.0006 -0.0013 30   ASP A C   
255  O  O   . ASP A 30 ? 0.0950 0.1889 0.1795 -0.0563 0.0609  -0.0942 30   ASP A O   
256  C  CB  A ASP A 30 ? 0.1599 0.0948 0.2264 0.0030  -0.1259 0.0102  30   ASP A CB  
257  C  CB  B ASP A 30 ? 0.1582 0.0964 0.3504 0.0593  -0.0896 -0.0104 30   ASP A CB  
258  C  CG  A ASP A 30 ? 0.2472 0.0866 0.1727 -0.0100 0.0076  -0.0327 30   ASP A CG  
259  C  CG  B ASP A 30 ? 0.3134 0.0972 0.3158 0.0927  -0.1048 -0.0175 30   ASP A CG  
260  O  OD1 A ASP A 30 ? 0.3083 0.1317 0.1688 0.0251  -0.0016 -0.0415 30   ASP A OD1 
261  O  OD1 B ASP A 30 ? 0.6928 0.3669 0.3029 -0.1097 -0.0665 0.0083  30   ASP A OD1 
262  O  OD2 A ASP A 30 ? 0.2821 0.1520 0.2191 -0.0615 0.0638  -0.0634 30   ASP A OD2 
263  O  OD2 B ASP A 30 ? 0.5077 0.1403 0.3955 -0.0375 -0.0478 -0.0486 30   ASP A OD2 
264  N  N   . THR A 31 ? 0.0601 0.0934 0.0975 0.0017  -0.0051 -0.0237 31   THR A N   
265  C  CA  . THR A 31 ? 0.0540 0.0707 0.0704 0.0148  -0.0081 -0.0064 31   THR A CA  
266  C  C   . THR A 31 ? 0.0451 0.0608 0.0747 0.0004  -0.0054 0.0001  31   THR A C   
267  O  O   . THR A 31 ? 0.0592 0.0704 0.0886 0.0137  0.0017  0.0111  31   THR A O   
268  C  CB  . THR A 31 ? 0.0586 0.0817 0.0729 0.0060  -0.0145 0.0132  31   THR A CB  
269  O  OG1 . THR A 31 ? 0.0598 0.1040 0.0702 0.0258  -0.0075 0.0076  31   THR A OG1 
270  C  CG2 . THR A 31 ? 0.0587 0.0848 0.0796 0.0124  -0.0108 -0.0042 31   THR A CG2 
271  N  N   . VAL A 32 ? 0.0491 0.0611 0.0680 0.0090  -0.0137 0.0028  32   VAL A N   
272  C  CA  . VAL A 32 ? 0.0581 0.0660 0.0741 0.0064  -0.0217 0.0078  32   VAL A CA  
273  C  C   . VAL A 32 ? 0.0457 0.0722 0.0582 0.0164  -0.0049 -0.0008 32   VAL A C   
274  O  O   . VAL A 32 ? 0.0679 0.0695 0.1100 0.0139  -0.0316 -0.0058 32   VAL A O   
275  C  CB  . VAL A 32 ? 0.1110 0.1201 0.0710 -0.0402 -0.0123 0.0134  32   VAL A CB  
276  C  CG1 . VAL A 32 ? 0.1600 0.1134 0.0772 -0.0352 -0.0059 0.0147  32   VAL A CG1 
277  C  CG2 . VAL A 32 ? 0.0886 0.1503 0.1500 -0.0386 -0.0235 -0.0049 32   VAL A CG2 
278  N  N   . ILE A 33 ? 0.0503 0.0556 0.0818 0.0059  -0.0170 0.0001  33   ILE A N   
279  C  CA  . ILE A 33 ? 0.0446 0.0674 0.0861 0.0094  -0.0154 0.0005  33   ILE A CA  
280  C  C   . ILE A 33 ? 0.0501 0.0730 0.0861 -0.0037 -0.0145 -0.0032 33   ILE A C   
281  O  O   . ILE A 33 ? 0.0693 0.0709 0.0807 0.0070  -0.0133 0.0029  33   ILE A O   
282  C  CB  . ILE A 33 ? 0.0585 0.1135 0.0975 -0.0076 -0.0082 0.0115  33   ILE A CB  
283  C  CG1 . ILE A 33 ? 0.1076 0.1317 0.0894 -0.0245 -0.0059 0.0130  33   ILE A CG1 
284  C  CG2 . ILE A 33 ? 0.0633 0.1652 0.1000 -0.0331 -0.0095 0.0100  33   ILE A CG2 
285  C  CD1 . ILE A 33 ? 0.1370 0.1259 0.1296 -0.0262 -0.0303 0.0422  33   ILE A CD1 
286  N  N   . GLU A 34 ? 0.0665 0.0697 0.0758 0.0055  -0.0129 0.0028  34   GLU A N   
287  C  CA  . GLU A 34 ? 0.0751 0.0831 0.0823 -0.0061 -0.0152 0.0001  34   GLU A CA  
288  C  C   . GLU A 34 ? 0.0717 0.0866 0.0734 -0.0072 -0.0181 0.0003  34   GLU A C   
289  O  O   . GLU A 34 ? 0.0654 0.1524 0.0851 -0.0041 -0.0136 0.0340  34   GLU A O   
290  C  CB  . GLU A 34 ? 0.1263 0.0977 0.1047 0.0145  -0.0284 -0.0251 34   GLU A CB  
291  C  CG  . GLU A 34 ? 0.1193 0.1560 0.1514 0.0286  0.0029  -0.0460 34   GLU A CG  
292  C  CD  . GLU A 34 ? 0.1677 0.1859 0.2835 0.0606  -0.0485 -0.1078 34   GLU A CD  
293  O  OE1 . GLU A 34 ? 0.2681 0.2174 0.4259 0.0265  -0.1558 -0.1436 34   GLU A OE1 
294  O  OE2 . GLU A 34 ? 0.2228 0.2458 0.3559 0.1216  -0.1084 -0.1401 34   GLU A OE2 
295  N  N   . GLU A 35 ? 0.0718 0.1263 0.0714 0.0034  -0.0064 0.0150  35   GLU A N   
296  C  CA  . GLU A 35 ? 0.0709 0.1077 0.0627 0.0018  -0.0117 0.0030  35   GLU A CA  
297  C  C   . GLU A 35 ? 0.0735 0.1113 0.0789 -0.0005 -0.0242 0.0093  35   GLU A C   
298  O  O   . GLU A 35 ? 0.0844 0.1140 0.1058 -0.0107 -0.0231 -0.0005 35   GLU A O   
299  C  CB  . GLU A 35 ? 0.1123 0.1209 0.0809 -0.0088 -0.0162 0.0270  35   GLU A CB  
300  C  CG  . GLU A 35 ? 0.1836 0.1554 0.1110 0.0540  -0.0433 0.0283  35   GLU A CG  
301  C  CD  . GLU A 35 ? 0.1771 0.1608 0.1428 0.0331  -0.0113 0.0153  35   GLU A CD  
302  O  OE1 . GLU A 35 ? 0.2072 0.2246 0.1805 0.0289  0.0406  -0.0152 35   GLU A OE1 
303  O  OE2 . GLU A 35 ? 0.2326 0.1819 0.1517 -0.0161 -0.0111 0.0204  35   GLU A OE2 
304  N  N   . MET A 36 ? 0.0658 0.1080 0.0972 -0.0084 -0.0112 0.0156  36   MET A N   
305  C  CA  . MET A 36 ? 0.0659 0.1134 0.1427 -0.0070 -0.0079 0.0261  36   MET A CA  
306  C  C   . MET A 36 ? 0.0717 0.1236 0.1439 -0.0011 -0.0041 0.0210  36   MET A C   
307  O  O   . MET A 36 ? 0.0904 0.1210 0.1639 0.0004  -0.0144 0.0209  36   MET A O   
308  C  CB  . MET A 36 ? 0.0967 0.1128 0.1422 -0.0135 -0.0002 0.0302  36   MET A CB  
309  C  CG  . MET A 36 ? 0.1119 0.1233 0.1422 -0.0222 -0.0013 0.0176  36   MET A CG  
310  S  SD  . MET A 36 ? 0.0875 0.1911 0.1461 -0.0218 0.0027  0.0495  36   MET A SD  
311  C  CE  . MET A 36 ? 0.0954 0.1701 0.1285 -0.0218 -0.0047 0.0356  36   MET A CE  
312  N  N   . SER A 37 ? 0.0672 0.1524 0.2056 0.0094  -0.0025 -0.0154 37   SER A N   
313  C  CA  . SER A 37 ? 0.0806 0.1727 0.1963 0.0301  0.0023  0.0173  37   SER A CA  
314  C  C   . SER A 37 ? 0.0919 0.1730 0.1962 -0.0073 0.0293  0.0204  37   SER A C   
315  O  O   . SER A 37 ? 0.1011 0.2085 0.2329 -0.0320 0.0086  0.0564  37   SER A O   
316  C  CB  A SER A 37 ? 0.1103 0.2336 0.2237 0.0335  -0.0330 0.0377  37   SER A CB  
317  C  CB  B SER A 37 ? 0.0908 0.2956 0.2127 0.0347  -0.0154 0.0237  37   SER A CB  
318  O  OG  A SER A 37 ? 0.1464 0.2811 0.2099 0.0553  -0.0382 0.0329  37   SER A OG  
319  O  OG  B SER A 37 ? 0.1582 0.3639 0.2486 0.0888  -0.0180 0.1067  37   SER A OG  
320  N  N   . LEU A 38 ? 0.0959 0.2087 0.1895 -0.0564 0.0326  0.0442  38   LEU A N   
321  C  CA  . LEU A 38 ? 0.1023 0.1662 0.1795 -0.0518 0.0142  0.0599  38   LEU A CA  
322  C  C   . LEU A 38 ? 0.1182 0.1591 0.1850 -0.0524 0.0122  0.0421  38   LEU A C   
323  O  O   . LEU A 38 ? 0.1603 0.1517 0.2115 -0.0513 0.0249  0.0409  38   LEU A O   
324  C  CB  A LEU A 38 ? 0.1640 0.2150 0.2288 -0.0479 -0.0587 0.0936  38   LEU A CB  
325  C  CB  B LEU A 38 ? 0.1459 0.1466 0.2118 -0.0614 -0.0259 0.0774  38   LEU A CB  
326  C  CG  A LEU A 38 ? 0.1168 0.1106 0.1470 -0.0438 0.0109  -0.0018 38   LEU A CG  
327  C  CG  B LEU A 38 ? 0.1660 0.1189 0.1570 -0.0563 -0.0236 0.0544  38   LEU A CG  
328  C  CD1 A LEU A 38 ? 0.1597 0.0988 0.2909 -0.0163 -0.0505 0.0173  38   LEU A CD1 
329  C  CD1 B LEU A 38 ? 0.1258 0.1406 0.1317 -0.0346 0.0126  0.0446  38   LEU A CD1 
330  C  CD2 A LEU A 38 ? 0.1099 0.1134 0.1318 -0.0133 0.0099  0.0035  38   LEU A CD2 
331  C  CD2 B LEU A 38 ? 0.1588 0.0903 0.2405 -0.0296 0.0425  0.0395  38   LEU A CD2 
332  N  N   . PRO A 39 ? 0.1025 0.1725 0.2264 -0.0464 0.0170  0.0486  39   PRO A N   
333  C  CA  . PRO A 39 ? 0.1216 0.1806 0.2578 -0.0493 0.0255  0.0126  39   PRO A CA  
334  C  C   . PRO A 39 ? 0.1254 0.2133 0.2007 -0.0668 0.0488  0.0208  39   PRO A C   
335  O  O   . PRO A 39 ? 0.1339 0.4126 0.1807 -0.0639 0.0388  0.0238  39   PRO A O   
336  C  CB  . PRO A 39 ? 0.1178 0.1836 0.2913 -0.0485 0.0371  0.0113  39   PRO A CB  
337  C  CG  . PRO A 39 ? 0.0956 0.2466 0.2168 -0.0286 0.0335  0.0658  39   PRO A CG  
338  C  CD  . PRO A 39 ? 0.1287 0.1877 0.2746 -0.0457 0.0808  0.0493  39   PRO A CD  
339  N  N   . GLY A 40 ? 0.1515 0.2004 0.3420 -0.0809 0.0609  -0.0264 40   GLY A N   
340  C  CA  . GLY A 40 ? 0.1673 0.2158 0.3358 -0.0928 0.0836  -0.0292 40   GLY A CA  
341  C  C   . GLY A 40 ? 0.1611 0.1657 0.2832 -0.0611 0.0738  -0.0118 40   GLY A C   
342  O  O   . GLY A 40 ? 0.1062 0.1688 0.2714 -0.0333 0.0364  -0.0011 40   GLY A O   
343  N  N   . ARG A 41 ? 0.1003 0.2161 0.3181 -0.0524 0.0868  -0.0542 41   ARG A N   
344  C  CA  . ARG A 41 ? 0.0696 0.1755 0.3430 -0.0223 0.0792  -0.0597 41   ARG A CA  
345  C  C   . ARG A 41 ? 0.0880 0.1299 0.2482 -0.0058 0.0891  -0.0060 41   ARG A C   
346  O  O   . ARG A 41 ? 0.1236 0.1485 0.2108 -0.0301 0.1014  0.0137  41   ARG A O   
347  C  CB  A ARG A 41 ? 0.0927 0.1828 0.3411 0.0093  0.1047  -0.0472 41   ARG A CB  
348  C  CB  B ARG A 41 ? 0.1564 0.1533 0.3884 0.0461  0.0689  -0.0535 41   ARG A CB  
349  C  CG  A ARG A 41 ? 0.1350 0.2424 0.3007 0.0572  0.0879  -0.0078 41   ARG A CG  
350  C  CG  B ARG A 41 ? 0.1822 0.2949 0.3989 0.0550  0.1282  -0.0857 41   ARG A CG  
351  C  CD  A ARG A 41 ? 0.1470 0.1770 0.3106 0.0532  0.0852  0.0336  41   ARG A CD  
352  C  CD  B ARG A 41 ? 0.3057 0.4558 0.3900 0.0622  0.1573  -0.0103 41   ARG A CD  
353  N  NE  A ARG A 41 ? 0.0995 0.2679 0.3613 -0.0081 0.0063  0.0669  41   ARG A NE  
354  N  NE  B ARG A 41 ? 0.4495 0.4611 0.5127 -0.0092 0.0738  0.0800  41   ARG A NE  
355  C  CZ  A ARG A 41 ? 0.2551 0.3219 0.3312 -0.0891 -0.0518 0.1002  41   ARG A CZ  
356  C  CZ  B ARG A 41 ? 0.5146 0.5382 0.6055 -0.0448 0.1169  0.1160  41   ARG A CZ  
357  N  NH1 A ARG A 41 ? 0.5125 0.4966 0.3048 -0.0674 -0.0913 0.0783  41   ARG A NH1 
358  N  NH1 B ARG A 41 ? 0.5215 0.6898 0.7418 -0.0761 0.1823  0.0796  41   ARG A NH1 
359  N  NH2 A ARG A 41 ? 0.3307 0.2840 0.4829 -0.1006 -0.1449 0.2474  41   ARG A NH2 
360  N  NH2 B ARG A 41 ? 0.7020 0.8790 0.7372 0.0168  0.1541  0.4418  41   ARG A NH2 
361  N  N   . TRP A 42 ? 0.0524 0.1205 0.2011 -0.0019 0.0334  0.0109  42   TRP A N   
362  C  CA  . TRP A 42 ? 0.0492 0.0859 0.1500 0.0087  0.0269  0.0151  42   TRP A CA  
363  C  C   . TRP A 42 ? 0.0516 0.0863 0.1383 0.0064  0.0299  0.0097  42   TRP A C   
364  O  O   . TRP A 42 ? 0.0598 0.0860 0.1951 0.0145  0.0058  0.0232  42   TRP A O   
365  C  CB  . TRP A 42 ? 0.0675 0.0834 0.1561 -0.0125 0.0219  0.0139  42   TRP A CB  
366  C  CG  . TRP A 42 ? 0.0955 0.1301 0.1645 -0.0285 -0.0106 0.0020  42   TRP A CG  
367  C  CD1 . TRP A 42 ? 0.1073 0.2160 0.1966 -0.0422 -0.0271 0.0101  42   TRP A CD1 
368  C  CD2 . TRP A 42 ? 0.1104 0.1066 0.1450 -0.0045 -0.0073 -0.0031 42   TRP A CD2 
369  N  NE1 . TRP A 42 ? 0.1388 0.2379 0.2168 -0.0429 -0.0595 0.0303  42   TRP A NE1 
370  C  CE2 . TRP A 42 ? 0.1448 0.1582 0.1560 -0.0189 -0.0326 -0.0069 42   TRP A CE2 
371  C  CE3 . TRP A 42 ? 0.1098 0.0808 0.1368 0.0008  0.0087  0.0010  42   TRP A CE3 
372  C  CZ2 . TRP A 42 ? 0.2004 0.1488 0.1684 0.0194  -0.0215 0.0116  42   TRP A CZ2 
373  C  CZ3 . TRP A 42 ? 0.1907 0.0848 0.1385 -0.0195 0.0094  0.0048  42   TRP A CZ3 
374  C  CH2 . TRP A 42 ? 0.2111 0.1294 0.1427 0.0120  0.0014  0.0199  42   TRP A CH2 
375  N  N   . LYS A 43 ? 0.0559 0.0608 0.1382 0.0137  0.0220  0.0202  43   LYS A N   
376  C  CA  . LYS A 43 ? 0.0595 0.0829 0.1764 -0.0044 0.0435  0.0066  43   LYS A CA  
377  C  C   . LYS A 43 ? 0.0498 0.0552 0.1279 0.0012  0.0129  0.0105  43   LYS A C   
378  O  O   . LYS A 43 ? 0.0630 0.0634 0.1215 0.0168  0.0232  0.0132  43   LYS A O   
379  C  CB  . LYS A 43 ? 0.1316 0.1838 0.2503 -0.0310 0.0857  -0.1297 43   LYS A CB  
380  C  CG  . LYS A 43 ? 0.1824 0.2131 0.2592 -0.0533 -0.0063 -0.0786 43   LYS A CG  
381  C  CD  A LYS A 43 ? 0.1634 0.2153 0.2468 -0.0475 0.0111  -0.0830 43   LYS A CD  
382  C  CD  B LYS A 43 ? 0.2070 0.2026 0.2641 0.0340  -0.0242 -0.1175 43   LYS A CD  
383  C  CE  A LYS A 43 ? 0.1091 0.2897 0.1508 -0.1049 0.0133  -0.0516 43   LYS A CE  
384  C  CE  B LYS A 43 ? 0.4349 0.2694 0.4530 0.0104  -0.1662 0.0048  43   LYS A CE  
385  N  NZ  A LYS A 43 ? 0.2667 0.3116 0.2518 -0.0802 0.1174  -0.2067 43   LYS A NZ  
386  N  NZ  B LYS A 43 ? 0.6058 0.3593 0.4695 0.1621  -0.0874 0.0799  43   LYS A NZ  
387  N  N   . PRO A 44 ? 0.0397 0.0785 0.1487 -0.0048 0.0094  0.0278  44   PRO A N   
388  C  CA  . PRO A 44 ? 0.0558 0.1194 0.1165 -0.0148 0.0036  0.0140  44   PRO A CA  
389  C  C   . PRO A 44 ? 0.0422 0.0871 0.1004 -0.0119 0.0115  0.0109  44   PRO A C   
390  O  O   . PRO A 44 ? 0.0450 0.0798 0.1293 -0.0047 0.0101  0.0040  44   PRO A O   
391  C  CB  . PRO A 44 ? 0.0612 0.2936 0.1416 -0.0478 -0.0188 0.1173  44   PRO A CB  
392  C  CG  . PRO A 44 ? 0.2463 0.0890 0.1601 0.0111  -0.0213 0.0153  44   PRO A CG  
393  C  CD  . PRO A 44 ? 0.0824 0.0771 0.1880 -0.0078 -0.0296 0.0467  44   PRO A CD  
394  N  N   . LYS A 45 ? 0.0490 0.0927 0.0977 -0.0261 0.0065  -0.0088 45   LYS A N   
395  C  CA  . LYS A 45 ? 0.0458 0.0743 0.1000 -0.0051 0.0153  -0.0065 45   LYS A CA  
396  C  C   . LYS A 45 ? 0.0569 0.0684 0.0825 -0.0100 0.0066  -0.0004 45   LYS A C   
397  O  O   . LYS A 45 ? 0.0573 0.1165 0.0910 -0.0285 0.0036  -0.0258 45   LYS A O   
398  C  CB  . LYS A 45 ? 0.0762 0.0962 0.0900 0.0007  0.0290  -0.0036 45   LYS A CB  
399  C  CG  . LYS A 45 ? 0.0853 0.1056 0.1110 0.0104  0.0176  0.0117  45   LYS A CG  
400  C  CD  . LYS A 45 ? 0.1469 0.1408 0.1196 0.0160  0.0125  0.0264  45   LYS A CD  
401  C  CE  . LYS A 45 ? 0.2120 0.2100 0.1312 0.0454  -0.0317 0.0270  45   LYS A CE  
402  N  NZ  . LYS A 45 ? 0.2131 0.3097 0.2233 -0.0183 -0.0564 -0.0287 45   LYS A NZ  
403  N  N   . MET A 46 ? 0.0483 0.0600 0.0763 -0.0067 0.0068  -0.0207 46   MET A N   
404  C  CA  . MET A 46 ? 0.0601 0.0653 0.0751 -0.0004 0.0069  -0.0121 46   MET A CA  
405  C  C   . MET A 46 ? 0.0499 0.0798 0.0692 -0.0038 0.0141  -0.0062 46   MET A C   
406  O  O   . MET A 46 ? 0.0865 0.1142 0.0957 0.0234  -0.0253 -0.0268 46   MET A O   
407  C  CB  A MET A 46 ? 0.0672 0.0814 0.0988 0.0123  0.0288  0.0057  46   MET A CB  
408  C  CB  B MET A 46 ? 0.0732 0.0892 0.0635 0.0090  0.0112  -0.0013 46   MET A CB  
409  C  CG  A MET A 46 ? 0.1022 0.0759 0.1149 0.0207  0.0184  0.0108  46   MET A CG  
410  C  CG  B MET A 46 ? 0.0510 0.0544 0.0814 -0.0095 0.0064  -0.0098 46   MET A CG  
411  S  SD  A MET A 46 ? 0.1405 0.1068 0.1185 -0.0273 -0.0101 -0.0068 46   MET A SD  
412  S  SD  B MET A 46 ? 0.0654 0.0634 0.0799 -0.0078 -0.0016 0.0055  46   MET A SD  
413  C  CE  A MET A 46 ? 0.1882 0.1191 0.1386 -0.0163 0.0699  -0.0056 46   MET A CE  
414  C  CE  B MET A 46 ? 0.0749 0.1295 0.0788 -0.0152 0.0201  -0.0146 46   MET A CE  
415  N  N   . ILE A 47 ? 0.0443 0.0808 0.0701 0.0014  0.0010  -0.0051 47   ILE A N   
416  C  CA  . ILE A 47 ? 0.0465 0.0845 0.0769 0.0058  0.0035  -0.0043 47   ILE A CA  
417  C  C   . ILE A 47 ? 0.0550 0.0677 0.0897 0.0093  0.0092  0.0012  47   ILE A C   
418  O  O   . ILE A 47 ? 0.0676 0.0851 0.0915 -0.0095 0.0182  -0.0161 47   ILE A O   
419  C  CB  . ILE A 47 ? 0.0561 0.0902 0.0952 0.0069  0.0126  0.0037  47   ILE A CB  
420  C  CG1 . ILE A 47 ? 0.0752 0.0850 0.0941 0.0000  0.0070  0.0114  47   ILE A CG1 
421  C  CG2 . ILE A 47 ? 0.0894 0.1246 0.0981 0.0041  0.0322  0.0009  47   ILE A CG2 
422  C  CD1 . ILE A 47 ? 0.1152 0.0885 0.1121 -0.0106 0.0214  0.0040  47   ILE A CD1 
423  N  N   . GLY A 48 ? 0.0520 0.0935 0.1023 0.0163  0.0040  0.0133  48   GLY A N   
424  C  CA  . GLY A 48 ? 0.0647 0.1045 0.1127 0.0203  0.0188  0.0096  48   GLY A CA  
425  C  C   . GLY A 48 ? 0.0614 0.0808 0.0978 0.0040  0.0027  -0.0017 48   GLY A C   
426  O  O   . GLY A 48 ? 0.1060 0.1260 0.0991 0.0343  0.0014  -0.0026 48   GLY A O   
427  N  N   . GLY A 49 ? 0.0658 0.0729 0.0997 0.0070  0.0088  0.0061  49   GLY A N   
428  C  CA  . GLY A 49 ? 0.0796 0.0847 0.0981 0.0194  0.0033  0.0027  49   GLY A CA  
429  C  C   . GLY A 49 ? 0.0548 0.0767 0.1137 0.0012  0.0023  -0.0010 49   GLY A C   
430  O  O   . GLY A 49 ? 0.0611 0.0769 0.1210 -0.0001 0.0064  0.0037  49   GLY A O   
431  N  N   . ILE A 50 ? 0.0633 0.0864 0.1195 0.0182  0.0123  0.0140  50   ILE A N   
432  C  CA  . ILE A 50 ? 0.0560 0.0938 0.1264 0.0205  0.0160  0.0157  50   ILE A CA  
433  C  C   . ILE A 50 ? 0.0624 0.0993 0.1190 0.0165  0.0256  0.0140  50   ILE A C   
434  O  O   . ILE A 50 ? 0.0618 0.1267 0.1170 0.0088  0.0147  0.0070  50   ILE A O   
435  C  CB  . ILE A 50 ? 0.0783 0.1025 0.1214 0.0243  0.0105  -0.0004 50   ILE A CB  
436  C  CG1 . ILE A 50 ? 0.0941 0.0922 0.1275 0.0291  -0.0025 0.0089  50   ILE A CG1 
437  C  CG2 . ILE A 50 ? 0.0993 0.1084 0.1214 0.0303  0.0287  0.0075  50   ILE A CG2 
438  C  CD1 . ILE A 50 ? 0.1174 0.0891 0.1703 0.0224  -0.0246 0.0020  50   ILE A CD1 
439  N  N   . GLY A 51 ? 0.0750 0.1294 0.1176 0.0080  0.0343  0.0208  51   GLY A N   
440  C  CA  . GLY A 51 ? 0.0900 0.1245 0.1106 0.0293  0.0434  0.0145  51   GLY A CA  
441  C  C   . GLY A 51 ? 0.1001 0.1237 0.1270 0.0243  0.0248  0.0171  51   GLY A C   
442  O  O   . GLY A 51 ? 0.2312 0.2141 0.1360 0.1124  0.0112  0.0204  51   GLY A O   
443  N  N   . GLY A 52 ? 0.0460 0.0959 0.1270 0.0147  0.0252  0.0201  52   GLY A N   
444  C  CA  . GLY A 52 ? 0.0577 0.1115 0.1358 0.0189  0.0305  0.0313  52   GLY A CA  
445  C  C   . GLY A 52 ? 0.0458 0.0903 0.1065 0.0158  0.0200  0.0130  52   GLY A C   
446  O  O   . GLY A 52 ? 0.0592 0.1040 0.1208 0.0247  0.0300  0.0325  52   GLY A O   
447  N  N   . PHE A 53 ? 0.0569 0.1025 0.0951 0.0199  0.0187  0.0232  53   PHE A N   
448  C  CA  . PHE A 53 ? 0.0467 0.1027 0.0828 0.0259  0.0083  0.0085  53   PHE A CA  
449  C  C   . PHE A 53 ? 0.0611 0.1309 0.0809 0.0211  0.0035  -0.0173 53   PHE A C   
450  O  O   . PHE A 53 ? 0.0892 0.1913 0.0813 0.0366  -0.0012 -0.0043 53   PHE A O   
451  C  CB  . PHE A 53 ? 0.0726 0.0968 0.1096 0.0191  0.0061  0.0055  53   PHE A CB  
452  C  CG  . PHE A 53 ? 0.0515 0.0692 0.1200 0.0134  -0.0011 0.0226  53   PHE A CG  
453  C  CD1 . PHE A 53 ? 0.0637 0.0661 0.1349 0.0174  0.0262  0.0120  53   PHE A CD1 
454  C  CD2 . PHE A 53 ? 0.0494 0.0846 0.1106 -0.0040 0.0013  0.0149  53   PHE A CD2 
455  C  CE1 . PHE A 53 ? 0.0610 0.0726 0.2003 -0.0003 -0.0057 0.0121  53   PHE A CE1 
456  C  CE2 . PHE A 53 ? 0.0829 0.0809 0.1298 -0.0089 -0.0154 0.0134  53   PHE A CE2 
457  C  CZ  . PHE A 53 ? 0.0783 0.0825 0.1651 -0.0089 -0.0413 0.0066  53   PHE A CZ  
458  N  N   . ILE A 54 ? 0.0522 0.1213 0.0901 0.0161  -0.0014 -0.0221 54   ILE A N   
459  C  CA  . ILE A 54 ? 0.0564 0.1188 0.0998 0.0173  -0.0078 -0.0302 54   ILE A CA  
460  C  C   . ILE A 54 ? 0.0474 0.0900 0.0905 -0.0011 0.0006  -0.0208 54   ILE A C   
461  O  O   . ILE A 54 ? 0.0578 0.1039 0.0947 0.0060  0.0028  -0.0313 54   ILE A O   
462  C  CB  . ILE A 54 ? 0.0674 0.1112 0.1212 0.0301  -0.0179 -0.0397 54   ILE A CB  
463  C  CG1 . ILE A 54 ? 0.0864 0.0961 0.1334 0.0087  -0.0179 -0.0301 54   ILE A CG1 
464  C  CG2 . ILE A 54 ? 0.1435 0.1360 0.1387 0.0630  -0.0026 -0.0345 54   ILE A CG2 
465  C  CD1 . ILE A 54 ? 0.1200 0.0915 0.1838 0.0071  -0.0147 -0.0325 54   ILE A CD1 
466  N  N   . LYS A 55 ? 0.0559 0.0793 0.0854 0.0030  0.0026  -0.0230 55   LYS A N   
467  C  CA  . LYS A 55 ? 0.0387 0.0828 0.0928 -0.0037 -0.0012 -0.0204 55   LYS A CA  
468  C  C   . LYS A 55 ? 0.0431 0.0727 0.0903 -0.0003 -0.0102 -0.0102 55   LYS A C   
469  O  O   . LYS A 55 ? 0.0806 0.0860 0.1008 -0.0175 0.0091  -0.0220 55   LYS A O   
470  C  CB  . LYS A 55 ? 0.0886 0.0883 0.1147 0.0122  0.0091  0.0063  55   LYS A CB  
471  C  CG  . LYS A 55 ? 0.2331 0.1571 0.1998 -0.0414 0.0235  0.0562  55   LYS A CG  
472  C  CD  . LYS A 55 ? 0.4390 0.2233 0.2273 -0.0455 -0.0226 0.1255  55   LYS A CD  
473  C  CE  . LYS A 55 ? 0.5612 0.2093 0.2707 -0.0778 0.0317  0.1082  55   LYS A CE  
474  N  NZ  . LYS A 55 ? 0.6080 0.5697 0.3355 -0.1136 0.1539  0.0843  55   LYS A NZ  
475  N  N   . VAL A 56 ? 0.0495 0.0588 0.0920 -0.0054 0.0000  -0.0075 56   VAL A N   
476  C  CA  . VAL A 56 ? 0.0481 0.0624 0.0851 -0.0051 -0.0065 -0.0077 56   VAL A CA  
477  C  C   . VAL A 56 ? 0.0455 0.0652 0.0870 0.0036  -0.0057 0.0026  56   VAL A C   
478  O  O   . VAL A 56 ? 0.0594 0.0663 0.1429 -0.0133 0.0166  -0.0156 56   VAL A O   
479  C  CB  . VAL A 56 ? 0.0453 0.0819 0.1023 0.0028  -0.0084 0.0081  56   VAL A CB  
480  C  CG1 . VAL A 56 ? 0.0788 0.0944 0.1292 0.0272  -0.0117 0.0050  56   VAL A CG1 
481  C  CG2 . VAL A 56 ? 0.0825 0.1136 0.1045 -0.0175 -0.0214 0.0060  56   VAL A CG2 
482  N  N   . ARG A 57 ? 0.0528 0.0527 0.0960 -0.0028 0.0030  -0.0057 57   ARG A N   
483  C  CA  . ARG A 57 ? 0.0507 0.0605 0.1013 0.0102  0.0045  0.0019  57   ARG A CA  
484  C  C   . ARG A 57 ? 0.0378 0.0631 0.1005 0.0032  0.0067  0.0028  57   ARG A C   
485  O  O   . ARG A 57 ? 0.0682 0.0562 0.1132 0.0049  -0.0091 0.0038  57   ARG A O   
486  C  CB  . ARG A 57 ? 0.0458 0.0811 0.1014 0.0089  0.0064  0.0045  57   ARG A CB  
487  C  CG  . ARG A 57 ? 0.0779 0.1145 0.1033 0.0180  -0.0089 -0.0082 57   ARG A CG  
488  C  CD  . ARG A 57 ? 0.0938 0.1383 0.1437 0.0045  -0.0318 -0.0154 57   ARG A CD  
489  N  NE  . ARG A 57 ? 0.0873 0.1526 0.1559 0.0002  -0.0290 -0.0088 57   ARG A NE  
490  C  CZ  . ARG A 57 ? 0.1124 0.1325 0.1588 -0.0160 -0.0174 -0.0066 57   ARG A CZ  
491  N  NH1 . ARG A 57 ? 0.1458 0.1599 0.1617 -0.0045 0.0030  -0.0122 57   ARG A NH1 
492  N  NH2 . ARG A 57 ? 0.1488 0.1362 0.2210 -0.0129 -0.0292 0.0360  57   ARG A NH2 
493  N  N   . GLN A 58 ? 0.0567 0.0510 0.1016 0.0084  0.0024  0.0101  58   GLN A N   
494  C  CA  . GLN A 58 ? 0.0540 0.0735 0.0995 0.0124  0.0082  0.0089  58   GLN A CA  
495  C  C   . GLN A 58 ? 0.0570 0.0663 0.0929 0.0118  0.0044  0.0145  58   GLN A C   
496  O  O   . GLN A 58 ? 0.0691 0.0722 0.1400 0.0223  0.0330  0.0227  58   GLN A O   
497  C  CB  . GLN A 58 ? 0.0624 0.0653 0.1043 0.0027  0.0002  0.0167  58   GLN A CB  
498  C  CG  . GLN A 58 ? 0.0919 0.0881 0.1048 0.0037  0.0011  0.0009  58   GLN A CG  
499  C  CD  . GLN A 58 ? 0.1753 0.1774 0.1177 -0.0764 -0.0018 -0.0121 58   GLN A CD  
500  O  OE1 . GLN A 58 ? 0.1692 0.1761 0.1784 -0.0788 -0.0091 0.0154  58   GLN A OE1 
501  N  NE2 . GLN A 58 ? 0.2879 0.2421 0.1358 -0.0823 0.0244  -0.0521 58   GLN A NE2 
502  N  N   . TYR A 59 ? 0.0574 0.0617 0.1120 0.0130  0.0089  0.0164  59   TYR A N   
503  C  CA  . TYR A 59 ? 0.0608 0.0752 0.1194 0.0230  0.0262  0.0158  59   TYR A CA  
504  C  C   . TYR A 59 ? 0.0747 0.0987 0.1203 0.0159  0.0261  0.0217  59   TYR A C   
505  O  O   . TYR A 59 ? 0.0960 0.1590 0.1252 0.0546  0.0206  0.0285  59   TYR A O   
506  C  CB  . TYR A 59 ? 0.0629 0.0874 0.1430 0.0047  0.0202  0.0306  59   TYR A CB  
507  C  CG  . TYR A 59 ? 0.0515 0.0611 0.1442 -0.0011 0.0163  0.0245  59   TYR A CG  
508  C  CD1 . TYR A 59 ? 0.0704 0.0605 0.1475 0.0036  0.0158  0.0051  59   TYR A CD1 
509  C  CD2 . TYR A 59 ? 0.0554 0.0967 0.1569 -0.0056 0.0060  0.0101  59   TYR A CD2 
510  C  CE1 . TYR A 59 ? 0.0803 0.0996 0.1499 -0.0238 0.0141  -0.0069 59   TYR A CE1 
511  C  CE2 . TYR A 59 ? 0.0628 0.1380 0.1673 -0.0262 -0.0088 0.0016  59   TYR A CE2 
512  C  CZ  . TYR A 59 ? 0.0756 0.1334 0.1566 -0.0342 -0.0035 -0.0012 59   TYR A CZ  
513  O  OH  . TYR A 59 ? 0.1173 0.2277 0.1657 -0.0355 -0.0240 -0.0111 59   TYR A OH  
514  N  N   . ASP A 60 ? 0.1133 0.0923 0.1236 0.0342  0.0267  0.0161  60   ASP A N   
515  C  CA  . ASP A 60 ? 0.1349 0.1023 0.1242 0.0153  0.0194  0.0075  60   ASP A CA  
516  C  C   . ASP A 60 ? 0.1092 0.1163 0.0983 0.0220  0.0150  -0.0016 60   ASP A C   
517  O  O   . ASP A 60 ? 0.1091 0.1138 0.1483 0.0208  -0.0008 0.0217  60   ASP A O   
518  C  CB  . ASP A 60 ? 0.2482 0.1316 0.1947 -0.0167 0.0372  -0.0443 60   ASP A CB  
519  C  CG  . ASP A 60 ? 0.3127 0.1317 0.2715 -0.0458 0.0865  -0.0372 60   ASP A CG  
520  O  OD1 . ASP A 60 ? 0.4609 0.1128 0.4950 -0.0315 0.0388  -0.0084 60   ASP A OD1 
521  O  OD2 . ASP A 60 ? 0.2541 0.2143 0.2057 -0.0563 0.0288  -0.0422 60   ASP A OD2 
522  N  N   . GLN A 61 ? 0.1159 0.0989 0.1041 0.0048  0.0013  -0.0059 61   GLN A N   
523  C  CA  . GLN A 61 ? 0.1449 0.1007 0.1312 0.0002  0.0221  0.0020  61   GLN A CA  
524  C  C   . GLN A 61 ? 0.1155 0.1085 0.1114 -0.0018 0.0137  0.0062  61   GLN A C   
525  O  O   . GLN A 61 ? 0.1020 0.1551 0.1736 0.0032  0.0354  -0.0014 61   GLN A O   
526  C  CB  . GLN A 61 ? 0.2296 0.1556 0.1974 -0.0175 0.1061  -0.0511 61   GLN A CB  
527  C  CG  A GLN A 61 ? 0.3261 0.2522 0.2277 -0.0349 0.0933  -0.1236 61   GLN A CG  
528  C  CG  B GLN A 61 ? 0.3096 0.2357 0.2776 0.0038  0.0579  -0.1336 61   GLN A CG  
529  C  CD  A GLN A 61 ? 0.3664 0.3072 0.3068 -0.0974 0.0018  -0.0821 61   GLN A CD  
530  C  CD  B GLN A 61 ? 0.3763 0.2663 0.2372 -0.0407 0.0259  -0.1459 61   GLN A CD  
531  O  OE1 A GLN A 61 ? 0.3910 0.5116 0.3253 -0.1438 -0.0570 -0.1220 61   GLN A OE1 
532  O  OE1 B GLN A 61 ? 0.4531 0.5617 0.4165 -0.1000 0.1148  0.0346  61   GLN A OE1 
533  N  NE2 A GLN A 61 ? 0.4882 0.3228 0.4274 -0.0574 0.0482  0.0110  61   GLN A NE2 
534  N  NE2 B GLN A 61 ? 0.4457 0.3404 0.4023 0.0523  0.0063  -0.0449 61   GLN A NE2 
535  N  N   . ILE A 62 ? 0.0731 0.0868 0.1153 -0.0046 -0.0052 0.0067  62   ILE A N   
536  C  CA  . ILE A 62 ? 0.0640 0.0839 0.1182 -0.0010 -0.0096 0.0091  62   ILE A CA  
537  C  C   . ILE A 62 ? 0.0804 0.0873 0.1150 -0.0010 -0.0147 -0.0002 62   ILE A C   
538  O  O   . ILE A 62 ? 0.1009 0.0992 0.1191 0.0064  -0.0307 0.0115  62   ILE A O   
539  C  CB  . ILE A 62 ? 0.0751 0.1007 0.1089 -0.0058 -0.0141 0.0090  62   ILE A CB  
540  C  CG1 . ILE A 62 ? 0.0865 0.1083 0.1204 -0.0019 -0.0121 0.0165  62   ILE A CG1 
541  C  CG2 . ILE A 62 ? 0.1404 0.1085 0.1216 -0.0007 0.0045  -0.0100 62   ILE A CG2 
542  C  CD1 . ILE A 62 ? 0.0960 0.1498 0.1798 -0.0074 -0.0478 0.0418  62   ILE A CD1 
543  N  N   . ILE A 63 ? 0.1161 0.0824 0.1320 -0.0229 -0.0219 0.0087  63   ILE A N   
544  C  CA  . ILE A 63 ? 0.1847 0.1007 0.1260 -0.0208 -0.0170 0.0131  63   ILE A CA  
545  C  C   . ILE A 63 ? 0.1754 0.0855 0.1142 -0.0228 -0.0301 0.0136  63   ILE A C   
546  O  O   . ILE A 63 ? 0.1778 0.1142 0.1124 -0.0074 -0.0485 0.0031  63   ILE A O   
547  C  CB  A ILE A 63 ? 0.2508 0.1294 0.1808 -0.0732 0.0677  -0.0010 63   ILE A CB  
548  C  CB  B ILE A 63 ? 0.2357 0.1256 0.2287 -0.0463 0.0718  0.0325  63   ILE A CB  
549  C  CG1 A ILE A 63 ? 0.2351 0.1912 0.1900 -0.0737 0.0647  -0.0374 63   ILE A CG1 
550  C  CG1 B ILE A 63 ? 0.2365 0.1662 0.2184 -0.1127 0.0963  -0.0132 63   ILE A CG1 
551  C  CG2 A ILE A 63 ? 0.3461 0.1852 0.2098 -0.0442 0.1005  0.0625  63   ILE A CG2 
552  C  CG2 B ILE A 63 ? 0.3111 0.1642 0.1827 -0.0408 0.0581  0.0716  63   ILE A CG2 
553  C  CD1 A ILE A 63 ? 0.2519 0.2550 0.1990 -0.1213 0.0899  -0.0917 63   ILE A CD1 
554  C  CD1 B ILE A 63 ? 0.3435 0.1830 0.2688 0.1235  -0.0389 -0.0613 63   ILE A CD1 
555  N  N   A ILE A 64 ? 0.2267 0.0801 0.0942 0.0000  -0.0542 0.0156  64   ILE A N   
556  N  N   B ILE A 64 ? 0.1903 0.0897 0.0893 -0.0137 -0.0359 0.0101  64   ILE A N   
557  C  CA  . ILE A 64 ? 0.1615 0.0996 0.1137 -0.0232 -0.0310 0.0054  64   ILE A CA  
558  C  C   A ILE A 64 ? 0.1261 0.1055 0.0879 0.0214  -0.0332 -0.0093 64   ILE A C   
559  C  C   B ILE A 64 ? 0.1264 0.1174 0.0959 0.0030  -0.0227 -0.0072 64   ILE A C   
560  O  O   A ILE A 64 ? 0.2723 0.1528 0.0891 0.0824  -0.0331 -0.0237 64   ILE A O   
561  O  O   B ILE A 64 ? 0.0664 0.1433 0.0929 -0.0134 0.0023  -0.0058 64   ILE A O   
562  C  CB  A ILE A 64 ? 0.1866 0.1252 0.2026 -0.0484 -0.0129 0.0075  64   ILE A CB  
563  C  CB  B ILE A 64 ? 0.2080 0.1277 0.1533 -0.0569 0.0102  -0.0179 64   ILE A CB  
564  C  CG1 A ILE A 64 ? 0.1360 0.1892 0.1481 -0.0109 0.0015  0.0348  64   ILE A CG1 
565  C  CG1 B ILE A 64 ? 0.0953 0.0850 0.1627 -0.0478 -0.0498 0.0330  64   ILE A CG1 
566  C  CG2 A ILE A 64 ? 0.1487 0.1464 0.1704 -0.1213 0.0362  -0.0200 64   ILE A CG2 
567  C  CG2 B ILE A 64 ? 0.1026 0.2564 0.1597 -0.0658 0.0295  -0.0549 64   ILE A CG2 
568  C  CD1 A ILE A 64 ? 0.1871 0.2895 0.1514 0.0379  0.0335  0.0186  64   ILE A CD1 
569  C  CD1 B ILE A 64 ? 0.0856 0.1147 0.2005 -0.0218 -0.0174 0.0397  64   ILE A CD1 
570  N  N   . GLU A 65 ? 0.0692 0.0999 0.0781 0.0219  0.0140  -0.0034 65   GLU A N   
571  C  CA  . GLU A 65 ? 0.0784 0.1125 0.0874 0.0195  -0.0022 0.0049  65   GLU A CA  
572  C  C   . GLU A 65 ? 0.0819 0.1060 0.0993 0.0255  -0.0061 -0.0050 65   GLU A C   
573  O  O   . GLU A 65 ? 0.0957 0.1899 0.1006 0.0648  -0.0219 -0.0404 65   GLU A O   
574  C  CB  . GLU A 65 ? 0.0931 0.1159 0.1657 0.0121  0.0057  0.0323  65   GLU A CB  
575  C  CG  A GLU A 65 ? 0.1463 0.1569 0.2924 0.0067  -0.0273 0.1125  65   GLU A CG  
576  C  CG  B GLU A 65 ? 0.1168 0.1555 0.3086 0.0228  -0.0117 0.1095  65   GLU A CG  
577  C  CD  A GLU A 65 ? 0.1823 0.1563 0.3370 -0.0139 -0.0303 0.1279  65   GLU A CD  
578  C  CD  B GLU A 65 ? 0.1701 0.1922 0.3177 -0.0242 -0.0260 0.1327  65   GLU A CD  
579  O  OE1 A GLU A 65 ? 0.2709 0.1668 0.2793 -0.0317 -0.0855 0.0195  65   GLU A OE1 
580  O  OE1 B GLU A 65 ? 0.3625 0.2678 0.3333 -0.0606 0.0901  0.1062  65   GLU A OE1 
581  O  OE2 A GLU A 65 ? 0.1670 0.2160 0.5503 -0.0232 0.0028  0.1162  65   GLU A OE2 
582  O  OE2 B GLU A 65 ? 0.2576 0.2661 0.3706 -0.0600 -0.0382 -0.0164 65   GLU A OE2 
583  N  N   . ILE A 66 ? 0.0744 0.0958 0.0860 0.0112  0.0005  0.0070  66   ILE A N   
584  C  CA  . ILE A 66 ? 0.0733 0.1052 0.0974 0.0104  0.0056  0.0084  66   ILE A CA  
585  C  C   . ILE A 66 ? 0.0720 0.1095 0.1019 0.0142  0.0030  0.0095  66   ILE A C   
586  O  O   . ILE A 66 ? 0.0777 0.1150 0.1021 0.0185  -0.0156 0.0058  66   ILE A O   
587  C  CB  . ILE A 66 ? 0.0729 0.1177 0.1299 0.0075  0.0147  0.0027  66   ILE A CB  
588  C  CG1 . ILE A 66 ? 0.0940 0.1099 0.1782 0.0059  0.0265  0.0200  66   ILE A CG1 
589  C  CG2 . ILE A 66 ? 0.0735 0.1426 0.1544 0.0159  0.0143  -0.0075 66   ILE A CG2 
590  C  CD1 . ILE A 66 ? 0.1164 0.1380 0.2155 -0.0379 0.0479  0.0082  66   ILE A CD1 
591  N  N   . ALA A 67 ? 0.1474 0.1113 0.1062 0.0411  -0.0270 0.0006  67   ALA A N   
592  C  CA  . ALA A 67 ? 0.1579 0.1079 0.1099 0.0263  -0.0283 0.0062  67   ALA A CA  
593  C  C   . ALA A 67 ? 0.1707 0.0864 0.1194 0.0374  -0.0099 -0.0085 67   ALA A C   
594  O  O   . ALA A 67 ? 0.2072 0.1049 0.1311 0.0297  -0.0236 0.0152  67   ALA A O   
595  C  CB  . ALA A 67 ? 0.1577 0.1697 0.1552 0.0845  -0.0057 0.0139  67   ALA A CB  
596  N  N   . GLY A 68 ? 0.1501 0.0891 0.1614 0.0037  -0.0124 0.0066  68   GLY A N   
597  C  CA  . GLY A 68 ? 0.1400 0.1070 0.1842 -0.0302 -0.0127 0.0025  68   GLY A CA  
598  C  C   . GLY A 68 ? 0.1351 0.1241 0.1355 -0.0334 -0.0086 0.0243  68   GLY A C   
599  O  O   . GLY A 68 ? 0.2150 0.1805 0.1979 -0.0837 0.0592  0.0152  68   GLY A O   
600  N  N   . HIS A 69 ? 0.0989 0.0888 0.0984 0.0023  -0.0002 0.0117  69   HIS A N   
601  C  CA  . HIS A 69 ? 0.1064 0.0951 0.0890 0.0094  0.0081  0.0139  69   HIS A CA  
602  C  C   . HIS A 69 ? 0.0955 0.0940 0.0791 0.0019  -0.0004 0.0123  69   HIS A C   
603  O  O   . HIS A 69 ? 0.1397 0.1114 0.0847 0.0228  0.0195  0.0282  69   HIS A O   
604  C  CB  . HIS A 69 ? 0.1199 0.0928 0.0937 0.0006  -0.0173 0.0094  69   HIS A CB  
605  C  CG  . HIS A 69 ? 0.1207 0.1173 0.1054 0.0149  -0.0134 0.0136  69   HIS A CG  
606  N  ND1 . HIS A 69 ? 0.1670 0.1480 0.1252 0.0460  -0.0414 0.0206  69   HIS A ND1 
607  C  CD2 . HIS A 69 ? 0.1504 0.1105 0.1380 0.0248  -0.0132 0.0244  69   HIS A CD2 
608  C  CE1 . HIS A 69 ? 0.2439 0.1643 0.1360 0.0894  -0.0313 0.0166  69   HIS A CE1 
609  N  NE2 . HIS A 69 ? 0.1582 0.1445 0.1428 0.0368  -0.0346 0.0220  69   HIS A NE2 
610  N  N   . LYS A 70 ? 0.1065 0.1290 0.0790 0.0275  0.0035  0.0237  70   LYS A N   
611  C  CA  . LYS A 70 ? 0.1076 0.1169 0.0818 0.0246  -0.0076 0.0023  70   LYS A CA  
612  C  C   . LYS A 70 ? 0.1192 0.1219 0.0723 0.0187  -0.0134 -0.0026 70   LYS A C   
613  O  O   . LYS A 70 ? 0.1734 0.1279 0.1053 0.0143  -0.0554 0.0032  70   LYS A O   
614  C  CB  . LYS A 70 ? 0.1273 0.1358 0.1526 0.0287  0.0282  0.0019  70   LYS A CB  
615  C  CG  . LYS A 70 ? 0.1256 0.2255 0.2468 -0.0120 0.0398  -0.0257 70   LYS A CG  
616  C  CD  . LYS A 70 ? 0.1890 0.3544 0.4261 -0.0384 0.1509  -0.0288 70   LYS A CD  
617  C  CE  . LYS A 70 ? 0.1412 0.5445 0.5065 -0.0966 0.1005  -0.0822 70   LYS A CE  
618  N  NZ  . LYS A 70 ? 0.3110 0.6570 0.5730 -0.0671 0.1692  -0.2694 70   LYS A NZ  
619  N  N   . ALA A 71 ? 0.1167 0.1106 0.0945 0.0239  -0.0351 -0.0020 71   ALA A N   
620  C  CA  . ALA A 71 ? 0.1191 0.1115 0.1029 0.0180  -0.0214 -0.0057 71   ALA A CA  
621  C  C   . ALA A 71 ? 0.1043 0.1070 0.1037 0.0094  -0.0092 0.0063  71   ALA A C   
622  O  O   . ALA A 71 ? 0.1503 0.0947 0.1170 0.0262  -0.0410 -0.0012 71   ALA A O   
623  C  CB  . ALA A 71 ? 0.1179 0.1246 0.1774 0.0299  -0.0017 -0.0032 71   ALA A CB  
624  N  N   . ILE A 72 ? 0.0998 0.1127 0.0849 0.0157  -0.0175 0.0105  72   ILE A N   
625  C  CA  . ILE A 72 ? 0.0846 0.1119 0.1005 0.0098  0.0002  0.0220  72   ILE A CA  
626  C  C   . ILE A 72 ? 0.0836 0.1129 0.0787 0.0128  0.0040  0.0043  72   ILE A C   
627  O  O   . ILE A 72 ? 0.1168 0.1558 0.0944 -0.0143 -0.0142 0.0136  72   ILE A O   
628  C  CB  . ILE A 72 ? 0.1031 0.0991 0.1107 0.0089  0.0208  0.0131  72   ILE A CB  
629  C  CG1 . ILE A 72 ? 0.0995 0.1158 0.1451 0.0160  0.0295  0.0232  72   ILE A CG1 
630  C  CG2 . ILE A 72 ? 0.1598 0.1606 0.1159 0.0229  0.0206  0.0045  72   ILE A CG2 
631  C  CD1 . ILE A 72 ? 0.1047 0.1549 0.1893 0.0341  0.0396  0.0282  72   ILE A CD1 
632  N  N   . GLY A 73 ? 0.0675 0.0917 0.0915 0.0100  -0.0014 0.0080  73   GLY A N   
633  C  CA  . GLY A 73 ? 0.0786 0.1080 0.0902 0.0012  0.0010  0.0002  73   GLY A CA  
634  C  C   . GLY A 73 ? 0.0599 0.1037 0.0925 0.0060  0.0036  0.0040  73   GLY A C   
635  O  O   . GLY A 73 ? 0.0808 0.1282 0.1091 -0.0133 -0.0159 0.0201  73   GLY A O   
636  N  N   . THR A 74 ? 0.0661 0.1158 0.0973 -0.0056 -0.0072 0.0130  74   THR A N   
637  C  CA  . THR A 74 ? 0.0776 0.1009 0.1036 0.0055  0.0089  0.0144  74   THR A CA  
638  C  C   . THR A 74 ? 0.0527 0.0991 0.1011 0.0037  -0.0025 0.0211  74   THR A C   
639  O  O   . THR A 74 ? 0.0585 0.1159 0.0967 0.0159  -0.0090 0.0159  74   THR A O   
640  C  CB  . THR A 74 ? 0.1179 0.1119 0.1147 -0.0211 0.0040  0.0107  74   THR A CB  
641  O  OG1 . THR A 74 ? 0.1846 0.1128 0.1690 -0.0254 0.0215  -0.0156 74   THR A OG1 
642  C  CG2 . THR A 74 ? 0.1311 0.1613 0.1447 -0.0379 -0.0038 0.0477  74   THR A CG2 
643  N  N   . VAL A 75 ? 0.0495 0.0956 0.1024 0.0119  -0.0064 0.0190  75   VAL A N   
644  C  CA  . VAL A 75 ? 0.0492 0.0950 0.1113 0.0135  -0.0066 0.0128  75   VAL A CA  
645  C  C   . VAL A 75 ? 0.0622 0.0620 0.0979 0.0149  -0.0188 -0.0060 75   VAL A C   
646  O  O   . VAL A 75 ? 0.0733 0.0916 0.1159 0.0331  0.0013  0.0139  75   VAL A O   
647  C  CB  . VAL A 75 ? 0.0735 0.1007 0.1460 -0.0044 -0.0324 0.0289  75   VAL A CB  
648  C  CG1 . VAL A 75 ? 0.1307 0.0991 0.1790 -0.0160 -0.0032 0.0015  75   VAL A CG1 
649  C  CG2 . VAL A 75 ? 0.1169 0.1170 0.1824 -0.0062 -0.0071 0.0496  75   VAL A CG2 
650  N  N   . LEU A 76 ? 0.0489 0.0639 0.1075 0.0092  -0.0164 0.0078  76   LEU A N   
651  C  CA  . LEU A 76 ? 0.0545 0.0717 0.0956 0.0174  -0.0201 -0.0049 76   LEU A CA  
652  C  C   . LEU A 76 ? 0.0758 0.0746 0.1125 0.0377  -0.0366 -0.0155 76   LEU A C   
653  O  O   . LEU A 76 ? 0.1554 0.0945 0.1632 0.0703  -0.0901 -0.0412 76   LEU A O   
654  C  CB  . LEU A 76 ? 0.0651 0.0743 0.0704 0.0164  -0.0025 -0.0005 76   LEU A CB  
655  C  CG  . LEU A 76 ? 0.0506 0.0668 0.0863 -0.0068 -0.0004 0.0003  76   LEU A CG  
656  C  CD1 . LEU A 76 ? 0.0571 0.0891 0.1079 0.0006  0.0144  0.0081  76   LEU A CD1 
657  C  CD2 . LEU A 76 ? 0.0510 0.0783 0.1135 -0.0161 0.0016  -0.0245 76   LEU A CD2 
658  N  N   . VAL A 77 ? 0.0543 0.0592 0.0937 0.0096  -0.0190 -0.0055 77   VAL A N   
659  C  CA  . VAL A 77 ? 0.0477 0.0620 0.1012 0.0135  -0.0186 -0.0065 77   VAL A CA  
660  C  C   . VAL A 77 ? 0.0529 0.0727 0.0963 0.0094  -0.0251 -0.0012 77   VAL A C   
661  O  O   . VAL A 77 ? 0.0729 0.0713 0.1106 0.0095  -0.0265 -0.0012 77   VAL A O   
662  C  CB  . VAL A 77 ? 0.0494 0.0735 0.1049 0.0120  -0.0167 -0.0131 77   VAL A CB  
663  C  CG1 . VAL A 77 ? 0.0604 0.1305 0.1089 -0.0050 -0.0215 -0.0108 77   VAL A CG1 
664  C  CG2 . VAL A 77 ? 0.0711 0.0963 0.1127 0.0063  -0.0049 -0.0057 77   VAL A CG2 
665  N  N   . GLY A 78 ? 0.0731 0.0693 0.0961 0.0032  -0.0076 0.0065  78   GLY A N   
666  C  CA  . GLY A 78 ? 0.0970 0.0771 0.1009 0.0029  -0.0011 -0.0004 78   GLY A CA  
667  C  C   . GLY A 78 ? 0.0696 0.0743 0.1040 0.0108  -0.0128 0.0067  78   GLY A C   
668  O  O   . GLY A 78 ? 0.0817 0.0707 0.1306 0.0055  -0.0019 0.0022  78   GLY A O   
669  N  N   . PRO A 79 ? 0.0834 0.0722 0.0942 0.0088  -0.0178 -0.0037 79   PRO A N   
670  C  CA  . PRO A 79 ? 0.1002 0.0896 0.0906 0.0213  -0.0276 -0.0069 79   PRO A CA  
671  C  C   . PRO A 79 ? 0.0939 0.1153 0.0880 0.0264  -0.0145 0.0051  79   PRO A C   
672  O  O   . PRO A 79 ? 0.1288 0.2320 0.0999 0.0653  0.0184  0.0220  79   PRO A O   
673  C  CB  . PRO A 79 ? 0.1366 0.1043 0.0863 0.0109  -0.0321 -0.0016 79   PRO A CB  
674  C  CG  . PRO A 79 ? 0.1223 0.0964 0.0931 0.0147  -0.0024 -0.0063 79   PRO A CG  
675  C  CD  . PRO A 79 ? 0.0973 0.0802 0.0915 0.0059  -0.0116 0.0118  79   PRO A CD  
676  N  N   . THR A 80 ? 0.0799 0.1064 0.0987 0.0205  -0.0152 0.0159  80   THR A N   
677  C  CA  . THR A 80 ? 0.0743 0.0972 0.0989 0.0155  -0.0188 0.0091  80   THR A CA  
678  C  C   . THR A 80 ? 0.0700 0.1099 0.0702 0.0148  -0.0148 0.0089  80   THR A C   
679  O  O   . THR A 80 ? 0.0798 0.1036 0.0898 0.0093  -0.0189 -0.0042 80   THR A O   
680  C  CB  . THR A 80 ? 0.0675 0.0933 0.0906 -0.0024 -0.0194 -0.0018 80   THR A CB  
681  O  OG1 . THR A 80 ? 0.0544 0.1033 0.0890 -0.0001 -0.0149 0.0025  80   THR A OG1 
682  C  CG2 . THR A 80 ? 0.0594 0.1138 0.1109 0.0115  -0.0046 -0.0162 80   THR A CG2 
683  N  N   . PRO A 81 ? 0.0736 0.1151 0.0803 0.0081  -0.0165 0.0004  81   PRO A N   
684  C  CA  . PRO A 81 ? 0.0948 0.1283 0.0695 0.0192  -0.0023 -0.0039 81   PRO A CA  
685  C  C   . PRO A 81 ? 0.1047 0.1040 0.0685 0.0296  -0.0065 -0.0137 81   PRO A C   
686  O  O   . PRO A 81 ? 0.1992 0.1195 0.0861 0.0439  0.0038  -0.0131 81   PRO A O   
687  C  CB  . PRO A 81 ? 0.0979 0.1752 0.1057 0.0240  0.0095  -0.0107 81   PRO A CB  
688  C  CG  . PRO A 81 ? 0.0837 0.1792 0.1096 0.0099  0.0213  -0.0117 81   PRO A CG  
689  C  CD  . PRO A 81 ? 0.0712 0.1504 0.1079 -0.0011 -0.0047 0.0056  81   PRO A CD  
690  N  N   . ALA A 82 ? 0.0856 0.0988 0.0712 0.0244  -0.0034 0.0049  82   ALA A N   
691  C  CA  . ALA A 82 ? 0.1064 0.1039 0.0748 0.0336  -0.0072 0.0044  82   ALA A CA  
692  C  C   . ALA A 82 ? 0.0764 0.0943 0.0600 0.0203  -0.0122 -0.0009 82   ALA A C   
693  O  O   . ALA A 82 ? 0.1053 0.0947 0.0784 0.0096  -0.0012 -0.0023 82   ALA A O   
694  C  CB  . ALA A 82 ? 0.1078 0.1789 0.0937 0.0756  0.0016  0.0096  82   ALA A CB  
695  N  N   . ASN A 83 ? 0.0879 0.0746 0.0778 0.0153  -0.0195 -0.0053 83   ASN A N   
696  C  CA  . ASN A 83 ? 0.0710 0.0595 0.0873 0.0170  -0.0085 0.0062  83   ASN A CA  
697  C  C   . ASN A 83 ? 0.0565 0.0638 0.0704 0.0054  0.0062  0.0041  83   ASN A C   
698  O  O   . ASN A 83 ? 0.0787 0.0651 0.0857 0.0141  -0.0101 -0.0019 83   ASN A O   
699  C  CB  . ASN A 83 ? 0.0730 0.0778 0.1037 0.0131  -0.0173 -0.0028 83   ASN A CB  
700  C  CG  . ASN A 83 ? 0.0833 0.0901 0.1036 0.0112  -0.0178 -0.0095 83   ASN A CG  
701  O  OD1 . ASN A 83 ? 0.1351 0.1021 0.1572 0.0189  -0.0687 0.0056  83   ASN A OD1 
702  N  ND2 . ASN A 83 ? 0.0868 0.0973 0.1327 0.0062  -0.0352 -0.0042 83   ASN A ND2 
703  N  N   . ILE A 84 ? 0.0495 0.0600 0.0739 0.0225  -0.0059 0.0064  84   ILE A N   
704  C  CA  . ILE A 84 ? 0.0529 0.0816 0.0782 0.0179  -0.0081 0.0063  84   ILE A CA  
705  C  C   . ILE A 84 ? 0.0666 0.0680 0.0734 0.0162  -0.0058 0.0066  84   ILE A C   
706  O  O   . ILE A 84 ? 0.0912 0.0689 0.0745 0.0275  -0.0047 0.0033  84   ILE A O   
707  C  CB  A ILE A 84 ? 0.0754 0.1337 0.1071 -0.0252 -0.0107 0.0243  84   ILE A CB  
708  C  CB  B ILE A 84 ? 0.0540 0.0793 0.0683 0.0133  -0.0082 -0.0044 84   ILE A CB  
709  C  CG1 A ILE A 84 ? 0.0536 0.1419 0.1164 0.0043  -0.0050 0.0455  84   ILE A CG1 
710  C  CG1 B ILE A 84 ? 0.0554 0.0853 0.0744 0.0247  -0.0058 0.0141  84   ILE A CG1 
711  C  CG2 A ILE A 84 ? 0.1223 0.1551 0.1454 -0.0545 -0.0515 0.0326  84   ILE A CG2 
712  C  CG2 B ILE A 84 ? 0.0709 0.0751 0.0811 0.0176  -0.0423 0.0130  84   ILE A CG2 
713  C  CD1 A ILE A 84 ? 0.1619 0.2256 0.3045 0.0913  -0.0009 -0.0415 84   ILE A CD1 
714  C  CD1 B ILE A 84 ? 0.0335 0.0903 0.0912 -0.0082 -0.0013 0.0122  84   ILE A CD1 
715  N  N   . ILE A 85 ? 0.0655 0.0555 0.0699 0.0249  -0.0125 -0.0037 85   ILE A N   
716  C  CA  . ILE A 85 ? 0.0548 0.0637 0.0629 0.0092  -0.0122 0.0044  85   ILE A CA  
717  C  C   . ILE A 85 ? 0.0504 0.0643 0.0570 0.0070  -0.0006 0.0038  85   ILE A C   
718  O  O   . ILE A 85 ? 0.0435 0.0809 0.0986 0.0129  -0.0051 -0.0103 85   ILE A O   
719  C  CB  . ILE A 85 ? 0.0556 0.0596 0.0878 0.0095  -0.0075 0.0023  85   ILE A CB  
720  C  CG1 . ILE A 85 ? 0.0861 0.0700 0.1093 -0.0078 -0.0180 -0.0067 85   ILE A CG1 
721  C  CG2 . ILE A 85 ? 0.0615 0.0933 0.0852 -0.0078 0.0027  0.0080  85   ILE A CG2 
722  C  CD1 . ILE A 85 ? 0.0778 0.1144 0.1698 -0.0149 -0.0550 0.0055  85   ILE A CD1 
723  N  N   . GLY A 86 ? 0.0520 0.0576 0.0694 0.0040  -0.0025 0.0021  86   GLY A N   
724  C  CA  . GLY A 86 ? 0.0513 0.0621 0.0649 0.0091  0.0050  -0.0049 86   GLY A CA  
725  C  C   . GLY A 86 ? 0.0372 0.0754 0.0595 0.0116  -0.0028 0.0054  86   GLY A C   
726  O  O   . GLY A 86 ? 0.0498 0.0670 0.0686 -0.0019 0.0042  0.0001  86   GLY A O   
727  N  N   . ARG A 87 ? 0.0500 0.0600 0.0676 0.0008  -0.0071 0.0111  87   ARG A N   
728  C  CA  . ARG A 87 ? 0.0436 0.0809 0.0602 0.0019  -0.0016 0.0088  87   ARG A CA  
729  C  C   . ARG A 87 ? 0.0394 0.0802 0.0684 0.0014  -0.0067 0.0030  87   ARG A C   
730  O  O   . ARG A 87 ? 0.0522 0.1044 0.0742 0.0010  0.0040  0.0109  87   ARG A O   
731  C  CB  . ARG A 87 ? 0.0427 0.0777 0.0763 0.0017  -0.0038 0.0018  87   ARG A CB  
732  C  CG  . ARG A 87 ? 0.0465 0.0725 0.0747 0.0030  0.0022  0.0046  87   ARG A CG  
733  C  CD  . ARG A 87 ? 0.0423 0.0908 0.0837 0.0023  -0.0034 0.0014  87   ARG A CD  
734  N  NE  . ARG A 87 ? 0.0567 0.0916 0.0826 -0.0096 0.0013  -0.0018 87   ARG A NE  
735  C  CZ  . ARG A 87 ? 0.0684 0.0900 0.0945 -0.0149 -0.0080 -0.0049 87   ARG A CZ  
736  N  NH1 . ARG A 87 ? 0.0762 0.0848 0.0969 0.0141  0.0015  -0.0056 87   ARG A NH1 
737  N  NH2 . ARG A 87 ? 0.0955 0.0901 0.1238 -0.0007 -0.0051 0.0055  87   ARG A NH2 
738  N  N   . ASN A 88 ? 0.0476 0.0727 0.0690 0.0048  0.0032  0.0024  88   ASN A N   
739  C  CA  . ASN A 88 ? 0.0553 0.0737 0.0734 0.0124  -0.0002 -0.0123 88   ASN A CA  
740  C  C   . ASN A 88 ? 0.0444 0.0817 0.0820 0.0155  0.0081  -0.0075 88   ASN A C   
741  O  O   . ASN A 88 ? 0.0721 0.1050 0.0875 0.0032  0.0214  -0.0065 88   ASN A O   
742  C  CB  . ASN A 88 ? 0.0595 0.0724 0.0843 0.0125  -0.0010 -0.0032 88   ASN A CB  
743  C  CG  . ASN A 88 ? 0.0588 0.0759 0.0784 0.0077  -0.0013 0.0106  88   ASN A CG  
744  O  OD1 . ASN A 88 ? 0.0614 0.0902 0.0783 0.0032  -0.0041 -0.0021 88   ASN A OD1 
745  N  ND2 . ASN A 88 ? 0.0645 0.0936 0.0845 0.0117  -0.0112 0.0007  88   ASN A ND2 
746  N  N   . LEU A 89 ? 0.0485 0.0748 0.0676 0.0069  -0.0013 0.0036  89   LEU A N   
747  C  CA  . LEU A 89 ? 0.0452 0.0811 0.0734 0.0046  0.0071  0.0048  89   LEU A CA  
748  C  C   . LEU A 89 ? 0.0606 0.0843 0.0642 0.0039  0.0082  0.0098  89   LEU A C   
749  O  O   . LEU A 89 ? 0.0542 0.1032 0.0835 0.0147  0.0166  0.0259  89   LEU A O   
750  C  CB  . LEU A 89 ? 0.0602 0.0899 0.0808 -0.0045 -0.0043 -0.0034 89   LEU A CB  
751  C  CG  . LEU A 89 ? 0.0526 0.1017 0.1079 -0.0078 -0.0070 0.0080  89   LEU A CG  
752  C  CD1 . LEU A 89 ? 0.0921 0.1410 0.1190 -0.0167 -0.0393 0.0287  89   LEU A CD1 
753  C  CD2 . LEU A 89 ? 0.0633 0.1336 0.1458 0.0182  0.0038  0.0095  89   LEU A CD2 
754  N  N   . LEU A 90 ? 0.0499 0.0735 0.0712 0.0031  0.0075  0.0039  90   LEU A N   
755  C  CA  . LEU A 90 ? 0.0605 0.0724 0.0841 0.0053  0.0189  0.0092  90   LEU A CA  
756  C  C   . LEU A 90 ? 0.0458 0.0959 0.0806 0.0052  0.0115  0.0215  90   LEU A C   
757  O  O   . LEU A 90 ? 0.0788 0.1043 0.0894 0.0201  0.0268  0.0262  90   LEU A O   
758  C  CB  . LEU A 90 ? 0.0583 0.0815 0.0681 0.0110  0.0089  0.0116  90   LEU A CB  
759  C  CG  . LEU A 90 ? 0.0701 0.0745 0.0638 0.0061  0.0068  0.0093  90   LEU A CG  
760  C  CD1 . LEU A 90 ? 0.0740 0.1185 0.0699 -0.0009 0.0105  0.0012  90   LEU A CD1 
761  C  CD2 . LEU A 90 ? 0.0966 0.0951 0.0992 -0.0017 0.0015  -0.0107 90   LEU A CD2 
762  N  N   . THR A 91 ? 0.0630 0.0945 0.0649 0.0086  0.0028  0.0173  91   THR A N   
763  C  CA  . THR A 91 ? 0.0600 0.1334 0.0648 0.0171  0.0004  0.0164  91   THR A CA  
764  C  C   . THR A 91 ? 0.0623 0.1486 0.0837 0.0174  0.0184  0.0142  91   THR A C   
765  O  O   . THR A 91 ? 0.0940 0.2169 0.0834 0.0189  0.0171  0.0317  91   THR A O   
766  C  CB  . THR A 91 ? 0.0624 0.1459 0.0923 0.0151  -0.0043 -0.0183 91   THR A CB  
767  O  OG1 . THR A 91 ? 0.0805 0.1326 0.1302 0.0263  -0.0176 -0.0290 91   THR A OG1 
768  C  CG2 . THR A 91 ? 0.0736 0.1259 0.0967 0.0067  0.0007  -0.0199 91   THR A CG2 
769  N  N   . GLN A 92 ? 0.0592 0.1257 0.0921 0.0309  0.0226  0.0193  92   GLN A N   
770  C  CA  . GLN A 92 ? 0.0548 0.1516 0.0941 0.0189  0.0195  0.0013  92   GLN A CA  
771  C  C   . GLN A 92 ? 0.0834 0.1572 0.1296 0.0199  0.0369  0.0382  92   GLN A C   
772  O  O   . GLN A 92 ? 0.1420 0.2137 0.1504 0.0100  0.0767  0.0557  92   GLN A O   
773  C  CB  . GLN A 92 ? 0.0541 0.1576 0.0998 0.0354  0.0264  0.0108  92   GLN A CB  
774  C  CG  . GLN A 92 ? 0.0823 0.1543 0.1068 0.0176  0.0098  0.0119  92   GLN A CG  
775  C  CD  . GLN A 92 ? 0.0746 0.1330 0.1097 0.0138  0.0016  -0.0005 92   GLN A CD  
776  O  OE1 . GLN A 92 ? 0.1170 0.1414 0.1958 -0.0089 -0.0347 0.0146  92   GLN A OE1 
777  N  NE2 . GLN A 92 ? 0.1651 0.1241 0.3691 0.0121  -0.0947 0.0140  92   GLN A NE2 
778  N  N   . ILE A 93 ? 0.0821 0.1283 0.1665 0.0252  0.0524  0.0460  93   ILE A N   
779  C  CA  . ILE A 93 ? 0.1114 0.1388 0.2126 0.0202  0.0574  0.0498  93   ILE A CA  
780  C  C   . ILE A 93 ? 0.1421 0.1600 0.1615 0.0522  0.0736  0.0799  93   ILE A C   
781  O  O   . ILE A 93 ? 0.1997 0.1684 0.2263 0.0675  0.1005  0.0788  93   ILE A O   
782  C  CB  . ILE A 93 ? 0.1052 0.1220 0.2412 -0.0030 0.0324  0.0396  93   ILE A CB  
783  C  CG1 . ILE A 93 ? 0.1376 0.1358 0.2198 -0.0124 0.0522  -0.0042 93   ILE A CG1 
784  C  CG2 . ILE A 93 ? 0.1197 0.1522 0.3011 -0.0253 -0.0149 0.0253  93   ILE A CG2 
785  C  CD1 . ILE A 93 ? 0.1892 0.1676 0.2780 -0.0138 0.0314  -0.0616 93   ILE A CD1 
786  N  N   . GLY A 94 ? 0.1038 0.1770 0.1918 0.0746  0.0593  0.0897  94   GLY A N   
787  C  CA  . GLY A 94 ? 0.1325 0.2116 0.1480 0.0958  0.0655  0.0821  94   GLY A CA  
788  C  C   . GLY A 94 ? 0.1258 0.1661 0.1520 0.0839  0.0676  0.0850  94   GLY A C   
789  O  O   . GLY A 94 ? 0.1168 0.1647 0.1678 0.0651  0.0509  0.0876  94   GLY A O   
790  N  N   . ALA A 95 ? 0.1010 0.1412 0.1306 0.0688  0.0465  0.0555  95   ALA A N   
791  C  CA  . ALA A 95 ? 0.0815 0.0937 0.1230 0.0383  0.0344  0.0357  95   ALA A CA  
792  C  C   . ALA A 95 ? 0.0890 0.0898 0.1001 0.0290  0.0333  0.0156  95   ALA A C   
793  O  O   . ALA A 95 ? 0.1207 0.0876 0.1649 0.0285  0.0591  0.0056  95   ALA A O   
794  C  CB  . ALA A 95 ? 0.0946 0.1216 0.1195 0.0256  0.0172  0.0273  95   ALA A CB  
795  N  N   . THR A 96 ? 0.0783 0.0773 0.0767 0.0151  0.0175  0.0005  96   THR A N   
796  C  CA  . THR A 96 ? 0.0803 0.0873 0.0689 0.0053  0.0204  -0.0054 96   THR A CA  
797  C  C   . THR A 96 ? 0.0702 0.0753 0.0721 0.0086  0.0117  -0.0075 96   THR A C   
798  O  O   . THR A 96 ? 0.0715 0.0952 0.0865 -0.0049 0.0194  -0.0174 96   THR A O   
799  C  CB  . THR A 96 ? 0.0956 0.1146 0.0676 0.0043  0.0140  -0.0074 96   THR A CB  
800  O  OG1 . THR A 96 ? 0.1062 0.1306 0.0927 0.0153  0.0139  0.0266  96   THR A OG1 
801  C  CG2 . THR A 96 ? 0.2013 0.1663 0.0730 0.0025  0.0555  -0.0164 96   THR A CG2 
802  N  N   . LEU A 97 ? 0.0722 0.0804 0.0643 0.0022  0.0090  -0.0051 97   LEU A N   
803  C  CA  . LEU A 97 ? 0.0640 0.0845 0.0767 -0.0029 0.0116  -0.0176 97   LEU A CA  
804  C  C   . LEU A 97 ? 0.0722 0.1106 0.0887 0.0191  0.0081  -0.0316 97   LEU A C   
805  O  O   . LEU A 97 ? 0.1232 0.1389 0.1342 0.0421  -0.0462 -0.0565 97   LEU A O   
806  C  CB  A LEU A 97 ? 0.1253 0.1298 0.1219 -0.0199 0.0542  0.0041  97   LEU A CB  
807  C  CB  B LEU A 97 ? 0.0796 0.0832 0.0901 -0.0104 0.0203  -0.0256 97   LEU A CB  
808  C  CG  A LEU A 97 ? 0.1956 0.1362 0.1323 -0.0273 0.0310  0.0275  97   LEU A CG  
809  C  CG  B LEU A 97 ? 0.0522 0.0883 0.0525 0.0043  -0.0041 0.0074  97   LEU A CG  
810  C  CD1 A LEU A 97 ? 0.1747 0.1794 0.2305 -0.0243 -0.0330 0.1530  97   LEU A CD1 
811  C  CD1 B LEU A 97 ? 0.0834 0.0919 0.0425 0.0195  -0.0025 -0.0041 97   LEU A CD1 
812  C  CD2 A LEU A 97 ? 0.2130 0.1483 0.0891 0.0433  0.0185  0.0337  97   LEU A CD2 
813  C  CD2 B LEU A 97 ? 0.1223 0.0992 0.0842 -0.0027 0.0161  0.0268  97   LEU A CD2 
814  N  N   . ASN A 98 ? 0.0769 0.1043 0.0787 0.0116  0.0034  -0.0153 98   ASN A N   
815  C  CA  . ASN A 98 ? 0.0798 0.1285 0.0842 0.0189  0.0113  -0.0036 98   ASN A CA  
816  C  C   . ASN A 98 ? 0.0806 0.1455 0.0940 0.0192  0.0084  -0.0242 98   ASN A C   
817  O  O   . ASN A 98 ? 0.0907 0.1404 0.0927 0.0211  0.0059  -0.0202 98   ASN A O   
818  C  CB  . ASN A 98 ? 0.0964 0.1139 0.0975 0.0116  0.0055  0.0012  98   ASN A CB  
819  C  CG  . ASN A 98 ? 0.1087 0.1180 0.0880 0.0109  0.0161  0.0134  98   ASN A CG  
820  O  OD1 . ASN A 98 ? 0.1174 0.1577 0.1286 0.0471  0.0185  0.0142  98   ASN A OD1 
821  N  ND2 . ASN A 98 ? 0.1548 0.2203 0.0925 0.0173  0.0285  0.0140  98   ASN A ND2 
822  N  N   . PHE A 99 ? 0.0836 0.1465 0.1017 0.0255  -0.0050 -0.0092 99   PHE A N   
823  C  CA  . PHE A 99 ? 0.0952 0.1686 0.1140 0.0342  0.0156  -0.0053 99   PHE A CA  
824  C  C   . PHE A 99 ? 0.1068 0.2093 0.1449 0.0453  -0.0146 -0.0102 99   PHE A C   
825  O  O   . PHE A 99 ? 0.1438 0.2942 0.1889 0.0855  -0.0079 0.0061  99   PHE A O   
826  C  CB  . PHE A 99 ? 0.0911 0.1838 0.1268 0.0082  0.0090  -0.0029 99   PHE A CB  
827  C  CG  . PHE A 99 ? 0.1148 0.1837 0.1132 0.0194  -0.0056 0.0112  99   PHE A CG  
828  C  CD1 . PHE A 99 ? 0.1482 0.1901 0.1741 0.0381  -0.0165 0.0179  99   PHE A CD1 
829  C  CD2 . PHE A 99 ? 0.1215 0.1937 0.2030 -0.0063 -0.0121 0.0112  99   PHE A CD2 
830  C  CE1 . PHE A 99 ? 0.1959 0.1973 0.2427 0.0207  -0.0344 0.0645  99   PHE A CE1 
831  C  CE2 . PHE A 99 ? 0.1804 0.1902 0.2518 -0.0155 -0.0596 0.0491  99   PHE A CE2 
832  C  CZ  . PHE A 99 ? 0.1661 0.2019 0.2874 0.0097  0.0383  0.0451  99   PHE A CZ  
833  O  OXT . PHE A 99 ? 0.1640 0.3368 0.1363 0.0613  -0.0185 -0.0434 99   PHE A OXT 
834  N  N   . PRO B 1  ? 0.1071 0.3599 0.1730 0.0535  0.0043  -0.0065 101  PRO B N   
835  C  CA  . PRO B 1  ? 0.0979 0.2611 0.1832 0.0172  -0.0269 -0.0577 101  PRO B CA  
836  C  C   . PRO B 1  ? 0.0931 0.2051 0.0918 0.0168  -0.0055 -0.0118 101  PRO B C   
837  O  O   . PRO B 1  ? 0.1073 0.2248 0.1182 0.0379  -0.0023 -0.0422 101  PRO B O   
838  C  CB  . PRO B 1  ? 0.1844 0.3010 0.3214 -0.0619 -0.0377 -0.0510 101  PRO B CB  
839  C  CG  . PRO B 1  ? 0.1960 0.4001 0.3742 -0.0113 0.0157  0.0772  101  PRO B CG  
840  C  CD  . PRO B 1  ? 0.2350 0.4452 0.2833 0.0232  0.0711  0.0603  101  PRO B CD  
841  N  N   . GLN B 2  ? 0.0895 0.1887 0.0924 0.0064  -0.0089 -0.0165 102  GLN B N   
842  C  CA  . GLN B 2  ? 0.0903 0.1261 0.0764 0.0100  0.0017  0.0068  102  GLN B CA  
843  C  C   . GLN B 2  ? 0.1214 0.1105 0.0699 0.0003  0.0152  -0.0152 102  GLN B C   
844  O  O   . GLN B 2  ? 0.2274 0.1464 0.0833 -0.0219 -0.0018 -0.0239 102  GLN B O   
845  C  CB  . GLN B 2  ? 0.1049 0.1361 0.0950 0.0061  0.0097  0.0148  102  GLN B CB  
846  C  CG  . GLN B 2  ? 0.1055 0.1451 0.1157 -0.0016 0.0229  0.0352  102  GLN B CG  
847  C  CD  . GLN B 2  ? 0.1205 0.1406 0.1063 -0.0086 0.0169  0.0292  102  GLN B CD  
848  O  OE1 . GLN B 2  ? 0.2650 0.2413 0.1279 -0.1202 0.0230  0.0002  102  GLN B OE1 
849  N  NE2 . GLN B 2  ? 0.1435 0.1564 0.1178 0.0101  0.0500  0.0244  102  GLN B NE2 
850  N  N   . ILE B 3  ? 0.0879 0.0866 0.0841 0.0025  -0.0054 -0.0167 103  ILE B N   
851  C  CA  . ILE B 3  ? 0.0838 0.0912 0.0853 0.0042  0.0020  -0.0199 103  ILE B CA  
852  C  C   . ILE B 3  ? 0.0855 0.0949 0.0718 0.0049  0.0070  -0.0175 103  ILE B C   
853  O  O   . ILE B 3  ? 0.0907 0.1005 0.0911 -0.0026 -0.0016 -0.0283 103  ILE B O   
854  C  CB  . ILE B 3  ? 0.0939 0.1016 0.1079 0.0080  0.0214  -0.0065 103  ILE B CB  
855  C  CG1 . ILE B 3  ? 0.0905 0.1763 0.1586 0.0140  0.0289  0.0276  103  ILE B CG1 
856  C  CG2 . ILE B 3  ? 0.1283 0.1118 0.1418 0.0129  0.0276  0.0164  103  ILE B CG2 
857  C  CD1 . ILE B 3  ? 0.1498 0.2266 0.1913 0.0198  0.0884  -0.0235 103  ILE B CD1 
858  N  N   . THR B 4  ? 0.0782 0.0920 0.0755 0.0079  -0.0015 -0.0212 104  THR B N   
859  C  CA  . THR B 4  ? 0.0736 0.0806 0.0720 0.0026  0.0057  -0.0079 104  THR B CA  
860  C  C   . THR B 4  ? 0.0729 0.0934 0.0634 0.0013  0.0074  -0.0146 104  THR B C   
861  O  O   . THR B 4  ? 0.0727 0.1042 0.0943 -0.0089 0.0021  0.0093  104  THR B O   
862  C  CB  . THR B 4  ? 0.0961 0.1065 0.0677 0.0024  0.0098  -0.0156 104  THR B CB  
863  O  OG1 . THR B 4  ? 0.1313 0.1116 0.0938 -0.0102 0.0160  -0.0351 104  THR B OG1 
864  C  CG2 . THR B 4  ? 0.1156 0.1258 0.0741 0.0004  0.0179  -0.0060 104  THR B CG2 
865  N  N   . LEU B 5  ? 0.0736 0.0881 0.0618 0.0059  0.0115  -0.0097 105  LEU B N   
866  C  CA  . LEU B 5  ? 0.0749 0.0817 0.0655 -0.0126 0.0056  -0.0052 105  LEU B CA  
867  C  C   . LEU B 5  ? 0.0782 0.0862 0.0755 -0.0004 0.0115  -0.0074 105  LEU B C   
868  O  O   . LEU B 5  ? 0.0884 0.0886 0.0799 0.0053  0.0095  -0.0067 105  LEU B O   
869  C  CB  . LEU B 5  ? 0.0815 0.0918 0.0608 0.0040  0.0049  -0.0141 105  LEU B CB  
870  C  CG  . LEU B 5  ? 0.0730 0.0875 0.0652 0.0143  0.0005  -0.0062 105  LEU B CG  
871  C  CD1 . LEU B 5  ? 0.0971 0.0983 0.0977 -0.0064 0.0024  -0.0185 105  LEU B CD1 
872  C  CD2 . LEU B 5  ? 0.0783 0.1282 0.1026 0.0036  0.0217  -0.0362 105  LEU B CD2 
873  N  N   . TRP B 6  ? 0.0884 0.0977 0.0713 0.0138  0.0029  -0.0102 106  TRP B N   
874  C  CA  . TRP B 6  ? 0.1035 0.1013 0.0841 0.0161  0.0210  -0.0144 106  TRP B CA  
875  C  C   . TRP B 6  ? 0.0907 0.0970 0.0969 0.0085  0.0090  -0.0149 106  TRP B C   
876  O  O   . TRP B 6  ? 0.1053 0.1178 0.1755 0.0227  0.0280  0.0168  106  TRP B O   
877  C  CB  A TRP B 6  ? 0.1163 0.1544 0.1046 -0.0024 0.0410  -0.0424 106  TRP B CB  
878  C  CB  B TRP B 6  ? 0.1201 0.1147 0.0917 -0.0079 0.0195  -0.0294 106  TRP B CB  
879  C  CG  A TRP B 6  ? 0.1059 0.1594 0.1194 0.0188  0.0438  -0.0211 106  TRP B CG  
880  C  CG  B TRP B 6  ? 0.1107 0.1002 0.0877 0.0333  0.0415  -0.0249 106  TRP B CG  
881  C  CD1 A TRP B 6  ? 0.1065 0.1800 0.1037 0.0287  0.0644  -0.0245 106  TRP B CD1 
882  C  CD1 B TRP B 6  ? 0.1585 0.1613 0.1100 0.0323  0.0147  0.0248  106  TRP B CD1 
883  C  CD2 A TRP B 6  ? 0.1185 0.1636 0.1024 -0.0069 0.0138  -0.0230 106  TRP B CD2 
884  C  CD2 B TRP B 6  ? 0.1128 0.1411 0.0566 0.0144  0.0421  -0.0163 106  TRP B CD2 
885  N  NE1 A TRP B 6  ? 0.1122 0.1759 0.1623 0.0135  0.0545  -0.0180 106  TRP B NE1 
886  N  NE1 B TRP B 6  ? 0.1989 0.1492 0.1110 0.0186  0.0459  0.0133  106  TRP B NE1 
887  C  CE2 A TRP B 6  ? 0.1205 0.1581 0.0826 -0.0068 0.0319  -0.0499 106  TRP B CE2 
888  C  CE2 B TRP B 6  ? 0.1621 0.1413 0.1147 -0.0262 0.0330  -0.0082 106  TRP B CE2 
889  C  CE3 A TRP B 6  ? 0.1409 0.1715 0.1372 0.0154  0.0224  -0.0104 106  TRP B CE3 
890  C  CE3 B TRP B 6  ? 0.0925 0.1619 0.1169 0.0172  0.0295  -0.0241 106  TRP B CE3 
891  C  CZ2 A TRP B 6  ? 0.1165 0.1770 0.1307 0.0138  0.0580  -0.0224 106  TRP B CZ2 
892  C  CZ2 B TRP B 6  ? 0.1789 0.1577 0.0998 -0.0300 0.0774  -0.0353 106  TRP B CZ2 
893  C  CZ3 A TRP B 6  ? 0.1327 0.1668 0.1205 0.0027  0.0008  -0.0147 106  TRP B CZ3 
894  C  CZ3 B TRP B 6  ? 0.1026 0.1689 0.1461 0.0069  0.0439  -0.0456 106  TRP B CZ3 
895  C  CH2 A TRP B 6  ? 0.1334 0.2020 0.1452 0.0367  0.0583  -0.0087 106  TRP B CH2 
896  C  CH2 B TRP B 6  ? 0.1492 0.1804 0.1182 -0.0340 0.0489  -0.0625 106  TRP B CH2 
897  N  N   . LYS B 7  ? 0.0912 0.0901 0.1124 0.0048  0.0131  -0.0192 107  LYS B N   
898  C  CA  . LYS B 7  ? 0.0977 0.1084 0.1344 -0.0140 0.0213  -0.0352 107  LYS B CA  
899  C  C   . LYS B 7  ? 0.0577 0.0836 0.1254 0.0073  0.0087  -0.0165 107  LYS B C   
900  O  O   . LYS B 7  ? 0.0769 0.0911 0.0928 0.0019  0.0019  -0.0070 107  LYS B O   
901  C  CB  . LYS B 7  ? 0.1339 0.2208 0.1603 -0.0523 0.0113  -0.0691 107  LYS B CB  
902  C  CG  . LYS B 7  ? 0.3236 0.3607 0.1776 -0.1029 0.0261  -0.1456 107  LYS B CG  
903  C  CD  . LYS B 7  ? 0.4558 0.6233 0.3076 -0.0550 -0.1338 -0.2252 107  LYS B CD  
904  C  CE  . LYS B 7  ? 0.5142 0.8423 0.4165 0.0707  -0.1453 -0.1072 107  LYS B CE  
905  N  NZ  . LYS B 7  ? 0.5811 0.8738 0.3976 0.1006  -0.1794 -0.0786 107  LYS B NZ  
906  N  N   . ARG B 8  ? 0.0814 0.0834 0.1104 0.0048  -0.0031 -0.0187 108  ARG B N   
907  C  CA  . ARG B 8  ? 0.0601 0.0922 0.1107 0.0028  0.0025  -0.0132 108  ARG B CA  
908  C  C   . ARG B 8  ? 0.0422 0.0952 0.0861 -0.0102 0.0039  -0.0133 108  ARG B C   
909  O  O   . ARG B 8  ? 0.0565 0.1152 0.1030 -0.0038 -0.0036 -0.0298 108  ARG B O   
910  C  CB  . ARG B 8  ? 0.0674 0.0955 0.1302 -0.0028 0.0014  -0.0033 108  ARG B CB  
911  C  CG  . ARG B 8  ? 0.0893 0.1230 0.1368 0.0123  0.0040  0.0164  108  ARG B CG  
912  C  CD  A ARG B 8  ? 0.0782 0.1236 0.1461 -0.0037 -0.0118 0.0198  108  ARG B CD  
913  C  CD  B ARG B 8  ? 0.1541 0.1460 0.1777 -0.0041 0.0098  0.0507  108  ARG B CD  
914  N  NE  A ARG B 8  ? 0.0743 0.1109 0.1328 -0.0180 -0.0206 0.0221  108  ARG B NE  
915  N  NE  B ARG B 8  ? 0.1875 0.1405 0.3353 -0.0363 -0.0178 0.0403  108  ARG B NE  
916  C  CZ  A ARG B 8  ? 0.1050 0.1384 0.2210 -0.0328 -0.0311 0.0667  108  ARG B CZ  
917  C  CZ  B ARG B 8  ? 0.2654 0.2583 0.3982 -0.1151 0.0604  -0.0207 108  ARG B CZ  
918  N  NH1 A ARG B 8  ? 0.1302 0.1496 0.3270 -0.0591 -0.0685 0.1257  108  ARG B NH1 
919  N  NH1 B ARG B 8  ? 0.3250 0.2835 0.4156 0.0137  0.1058  0.1207  108  ARG B NH1 
920  N  NH2 A ARG B 8  ? 0.1481 0.1208 0.2501 -0.0461 -0.0814 0.0835  108  ARG B NH2 
921  N  NH2 B ARG B 8  ? 0.4254 0.1909 0.5629 -0.1774 0.0241  -0.0333 108  ARG B NH2 
922  N  N   . PRO B 9  ? 0.0434 0.1041 0.0733 0.0003  -0.0028 -0.0152 109  PRO B N   
923  C  CA  . PRO B 9  ? 0.0551 0.1020 0.0680 -0.0006 -0.0027 -0.0087 109  PRO B CA  
924  C  C   . PRO B 9  ? 0.0462 0.0986 0.0668 0.0047  -0.0040 -0.0141 109  PRO B C   
925  O  O   . PRO B 9  ? 0.0625 0.1030 0.0790 -0.0024 0.0043  -0.0161 109  PRO B O   
926  C  CB  . PRO B 9  ? 0.0766 0.0991 0.0915 -0.0125 -0.0030 0.0035  109  PRO B CB  
927  C  CG  . PRO B 9  ? 0.0619 0.0965 0.1089 -0.0028 -0.0155 -0.0191 109  PRO B CG  
928  C  CD  . PRO B 9  ? 0.0619 0.1097 0.0965 0.0062  -0.0163 -0.0321 109  PRO B CD  
929  N  N   . LEU B 10 ? 0.0520 0.1156 0.0767 -0.0064 0.0035  -0.0216 110  LEU B N   
930  C  CA  . LEU B 10 ? 0.0448 0.1150 0.0871 -0.0014 0.0058  -0.0179 110  LEU B CA  
931  C  C   . LEU B 10 ? 0.0496 0.1311 0.0651 -0.0207 0.0070  -0.0038 110  LEU B C   
932  O  O   . LEU B 10 ? 0.0733 0.2174 0.0713 0.0027  -0.0001 -0.0181 110  LEU B O   
933  C  CB  . LEU B 10 ? 0.0722 0.1185 0.1317 -0.0118 0.0105  -0.0139 110  LEU B CB  
934  C  CG  . LEU B 10 ? 0.1031 0.1127 0.1983 0.0053  -0.0044 0.0065  110  LEU B CG  
935  C  CD1 . LEU B 10 ? 0.2101 0.1205 0.2417 0.0197  0.0148  -0.0163 110  LEU B CD1 
936  C  CD2 . LEU B 10 ? 0.1584 0.1637 0.1682 0.0289  -0.0523 -0.0015 110  LEU B CD2 
937  N  N   . VAL B 11 ? 0.0411 0.1105 0.0833 0.0002  -0.0003 0.0035  111  VAL B N   
938  C  CA  . VAL B 11 ? 0.0485 0.1270 0.0900 -0.0084 -0.0115 0.0106  111  VAL B CA  
939  C  C   . VAL B 11 ? 0.0432 0.0967 0.0803 -0.0059 -0.0097 -0.0151 111  VAL B C   
940  O  O   . VAL B 11 ? 0.0479 0.1439 0.0894 -0.0187 -0.0155 0.0095  111  VAL B O   
941  C  CB  . VAL B 11 ? 0.0611 0.1149 0.1606 -0.0130 -0.0279 0.0296  111  VAL B CB  
942  C  CG1 . VAL B 11 ? 0.1015 0.1578 0.1838 -0.0335 0.0010  0.0418  111  VAL B CG1 
943  C  CG2 . VAL B 11 ? 0.1137 0.1292 0.2027 -0.0067 0.0279  -0.0329 111  VAL B CG2 
944  N  N   . THR B 12 ? 0.0536 0.1213 0.0800 -0.0045 -0.0157 0.0000  112  THR B N   
945  C  CA  . THR B 12 ? 0.0455 0.1025 0.0851 -0.0025 -0.0190 -0.0007 112  THR B CA  
946  C  C   . THR B 12 ? 0.0567 0.0981 0.0833 -0.0140 -0.0107 0.0000  112  THR B C   
947  O  O   . THR B 12 ? 0.0952 0.1032 0.1016 0.0094  0.0128  0.0148  112  THR B O   
948  C  CB  . THR B 12 ? 0.0653 0.1346 0.1023 -0.0038 -0.0221 -0.0281 112  THR B CB  
949  O  OG1 . THR B 12 ? 0.1048 0.1625 0.1313 0.0072  -0.0303 -0.0553 112  THR B OG1 
950  C  CG2 . THR B 12 ? 0.0707 0.1468 0.1295 -0.0211 -0.0291 -0.0147 112  THR B CG2 
951  N  N   . ILE B 13 ? 0.0499 0.0755 0.0913 -0.0059 -0.0087 0.0031  113  ILE B N   
952  C  CA  . ILE B 13 ? 0.0518 0.0763 0.0929 -0.0042 -0.0048 -0.0054 113  ILE B CA  
953  C  C   . ILE B 13 ? 0.0533 0.0814 0.1016 0.0023  -0.0101 0.0049  113  ILE B C   
954  O  O   . ILE B 13 ? 0.0501 0.0839 0.1287 -0.0025 -0.0109 -0.0059 113  ILE B O   
955  C  CB  . ILE B 13 ? 0.0526 0.0696 0.0994 0.0054  -0.0038 -0.0020 113  ILE B CB  
956  C  CG1 . ILE B 13 ? 0.0754 0.1092 0.0985 -0.0257 -0.0152 0.0127  113  ILE B CG1 
957  C  CG2 . ILE B 13 ? 0.0615 0.0926 0.1063 -0.0184 -0.0139 0.0079  113  ILE B CG2 
958  C  CD1 . ILE B 13 ? 0.0776 0.1366 0.0937 -0.0072 -0.0067 0.0011  113  ILE B CD1 
959  N  N   . LYS B 14 ? 0.0476 0.0688 0.1278 -0.0113 0.0122  0.0073  114  LYS B N   
960  C  CA  . LYS B 14 ? 0.0451 0.0763 0.1422 -0.0112 0.0017  0.0031  114  LYS B CA  
961  C  C   . LYS B 14 ? 0.0427 0.0873 0.1302 -0.0087 0.0039  0.0046  114  LYS B C   
962  O  O   . LYS B 14 ? 0.0838 0.0825 0.1457 -0.0044 0.0140  -0.0025 114  LYS B O   
963  C  CB  . LYS B 14 ? 0.0594 0.1260 0.1368 -0.0057 -0.0081 -0.0073 114  LYS B CB  
964  C  CG  . LYS B 14 ? 0.0494 0.2390 0.2604 -0.0471 -0.0341 0.0007  114  LYS B CG  
965  C  CD  A LYS B 14 ? 0.0936 0.3003 0.3134 -0.0433 -0.0804 0.0572  114  LYS B CD  
966  C  CD  B LYS B 14 ? 0.0730 0.3175 0.2810 -0.0143 -0.0483 -0.0040 114  LYS B CD  
967  C  CE  A LYS B 14 ? 0.2044 0.3343 0.2886 0.0270  -0.0716 0.0782  114  LYS B CE  
968  C  CE  B LYS B 14 ? 0.2137 0.2869 0.2185 0.0481  -0.0476 -0.0277 114  LYS B CE  
969  N  NZ  A LYS B 14 ? 0.4235 0.3220 0.3481 0.0217  -0.1316 -0.0548 114  LYS B NZ  
970  N  NZ  B LYS B 14 ? 0.5077 0.3587 0.3607 -0.0490 0.1077  -0.1258 114  LYS B NZ  
971  N  N   . ILE B 15 ? 0.0452 0.0920 0.1360 -0.0030 0.0069  0.0105  115  ILE B N   
972  C  CA  . ILE B 15 ? 0.0448 0.0859 0.1361 -0.0031 0.0096  0.0026  115  ILE B CA  
973  C  C   . ILE B 15 ? 0.0454 0.0944 0.1289 -0.0040 -0.0012 0.0048  115  ILE B C   
974  O  O   . ILE B 15 ? 0.0501 0.0907 0.1391 -0.0085 0.0094  0.0023  115  ILE B O   
975  C  CB  . ILE B 15 ? 0.0493 0.1145 0.1475 -0.0195 -0.0009 0.0124  115  ILE B CB  
976  C  CG1 . ILE B 15 ? 0.0773 0.1642 0.1466 -0.0260 0.0018  0.0015  115  ILE B CG1 
977  C  CG2 . ILE B 15 ? 0.0653 0.1301 0.1561 0.0070  0.0039  0.0350  115  ILE B CG2 
978  C  CD1 . ILE B 15 ? 0.0963 0.2136 0.1423 -0.0485 -0.0082 0.0039  115  ILE B CD1 
979  N  N   . GLY B 16 ? 0.0463 0.0983 0.1649 -0.0031 0.0145  -0.0077 116  GLY B N   
980  C  CA  . GLY B 16 ? 0.0628 0.1153 0.1449 -0.0168 0.0164  0.0051  116  GLY B CA  
981  C  C   . GLY B 16 ? 0.0461 0.1221 0.1586 0.0073  0.0051  -0.0004 116  GLY B C   
982  O  O   . GLY B 16 ? 0.0686 0.1609 0.1725 -0.0316 0.0181  -0.0243 116  GLY B O   
983  N  N   . GLY B 17 ? 0.0630 0.1327 0.1573 0.0224  -0.0022 0.0022  117  GLY B N   
984  C  CA  . GLY B 17 ? 0.0914 0.1829 0.1646 0.0373  -0.0219 -0.0104 117  GLY B CA  
985  C  C   . GLY B 17 ? 0.0886 0.1839 0.1802 0.0186  -0.0190 -0.0334 117  GLY B C   
986  O  O   . GLY B 17 ? 0.1093 0.2215 0.1956 0.0156  -0.0322 -0.0424 117  GLY B O   
987  N  N   . GLN B 18 ? 0.0682 0.1242 0.1489 -0.0052 0.0074  -0.0245 118  GLN B N   
988  C  CA  . GLN B 18 ? 0.0654 0.1279 0.1773 -0.0098 0.0268  -0.0234 118  GLN B CA  
989  C  C   . GLN B 18 ? 0.0547 0.1122 0.1443 -0.0132 0.0024  -0.0071 118  GLN B C   
990  O  O   . GLN B 18 ? 0.0669 0.1264 0.1535 -0.0237 0.0207  -0.0292 118  GLN B O   
991  C  CB  . GLN B 18 ? 0.1292 0.1197 0.2070 -0.0164 0.0594  0.0130  118  GLN B CB  
992  C  CG  . GLN B 18 ? 0.2242 0.1315 0.2383 0.0135  0.0814  0.0156  118  GLN B CG  
993  C  CD  . GLN B 18 ? 0.1949 0.1503 0.2680 0.0095  0.0364  0.0318  118  GLN B CD  
994  O  OE1 . GLN B 18 ? 0.2656 0.3733 0.3390 -0.0258 -0.0395 0.0093  118  GLN B OE1 
995  N  NE2 . GLN B 18 ? 0.1814 0.2095 0.4196 -0.0274 0.0790  0.1169  118  GLN B NE2 
996  N  N   . LEU B 19 ? 0.0562 0.1112 0.1521 -0.0278 0.0081  -0.0114 119  LEU B N   
997  C  CA  . LEU B 19 ? 0.0528 0.1094 0.1392 -0.0182 0.0039  -0.0104 119  LEU B CA  
998  C  C   . LEU B 19 ? 0.0611 0.0929 0.1420 -0.0225 0.0018  -0.0081 119  LEU B C   
999  O  O   . LEU B 19 ? 0.0752 0.1071 0.1933 -0.0187 0.0149  0.0199  119  LEU B O   
1000 C  CB  . LEU B 19 ? 0.1196 0.1471 0.1334 -0.0125 -0.0004 -0.0105 119  LEU B CB  
1001 C  CG  . LEU B 19 ? 0.1154 0.1756 0.1744 -0.0342 -0.0482 -0.0172 119  LEU B CG  
1002 C  CD1 . LEU B 19 ? 0.2732 0.2452 0.1633 -0.0999 -0.0726 -0.0161 119  LEU B CD1 
1003 C  CD2 . LEU B 19 ? 0.1422 0.1668 0.1837 -0.0208 -0.0321 0.0129  119  LEU B CD2 
1004 N  N   . LYS B 20 ? 0.0568 0.0871 0.1250 -0.0068 0.0000  0.0118  120  LYS B N   
1005 C  CA  . LYS B 20 ? 0.0653 0.0880 0.1234 -0.0052 -0.0056 0.0083  120  LYS B CA  
1006 C  C   . LYS B 20 ? 0.0641 0.0638 0.1102 -0.0049 -0.0018 -0.0162 120  LYS B C   
1007 O  O   . LYS B 20 ? 0.0845 0.1030 0.1387 0.0174  0.0195  0.0238  120  LYS B O   
1008 C  CB  . LYS B 20 ? 0.0937 0.1288 0.1140 -0.0079 -0.0096 0.0223  120  LYS B CB  
1009 C  CG  . LYS B 20 ? 0.1853 0.3260 0.1500 -0.0661 0.0545  -0.0228 120  LYS B CG  
1010 C  CD  . LYS B 20 ? 0.3255 0.3177 0.1476 -0.0825 0.0598  -0.0686 120  LYS B CD  
1011 C  CE  A LYS B 20 ? 0.4075 0.3582 0.1312 -0.1056 0.0583  -0.0583 120  LYS B CE  
1012 C  CE  B LYS B 20 ? 0.4181 0.3507 0.1605 -0.0641 0.1119  -0.0417 120  LYS B CE  
1013 N  NZ  A LYS B 20 ? 0.3823 0.3482 0.2448 -0.1187 0.1181  -0.0953 120  LYS B NZ  
1014 N  NZ  B LYS B 20 ? 0.2524 0.3402 0.1574 -0.1212 -0.0263 -0.0409 120  LYS B NZ  
1015 N  N   . GLU B 21 ? 0.0538 0.0983 0.1062 -0.0151 -0.0124 0.0170  121  GLU B N   
1016 C  CA  . GLU B 21 ? 0.0490 0.1107 0.1025 -0.0135 -0.0138 0.0117  121  GLU B CA  
1017 C  C   . GLU B 21 ? 0.0481 0.0834 0.0900 -0.0029 -0.0050 0.0066  121  GLU B C   
1018 O  O   . GLU B 21 ? 0.0928 0.1117 0.0959 -0.0381 -0.0051 0.0078  121  GLU B O   
1019 C  CB  . GLU B 21 ? 0.0874 0.1404 0.1294 -0.0116 -0.0100 -0.0399 121  GLU B CB  
1020 C  CG  A GLU B 21 ? 0.0875 0.1775 0.1965 -0.0189 0.0132  -0.0906 121  GLU B CG  
1021 C  CG  B GLU B 21 ? 0.1800 0.3085 0.2150 0.0254  0.0810  -0.0528 121  GLU B CG  
1022 C  CD  A GLU B 21 ? 0.2152 0.2723 0.2598 0.0866  0.0194  -0.1389 121  GLU B CD  
1023 C  CD  B GLU B 21 ? 0.3588 0.4283 0.2837 -0.0143 0.1380  -0.1761 121  GLU B CD  
1024 O  OE1 A GLU B 21 ? 0.5374 0.5407 0.2980 0.1335  0.0823  -0.2829 121  GLU B OE1 
1025 O  OE1 B GLU B 21 ? 0.5044 0.3515 0.4606 -0.0854 0.1222  -0.1320 121  GLU B OE1 
1026 O  OE2 A GLU B 21 ? 0.3222 0.2100 0.4027 0.0471  0.1255  0.0824  121  GLU B OE2 
1027 O  OE2 B GLU B 21 ? 0.4017 0.5905 0.4173 0.1207  0.1576  -0.2244 121  GLU B OE2 
1028 N  N   . ALA B 22 ? 0.0455 0.1004 0.0695 -0.0017 -0.0092 0.0093  122  ALA B N   
1029 C  CA  . ALA B 22 ? 0.0518 0.0761 0.0681 -0.0080 0.0000  0.0024  122  ALA B CA  
1030 C  C   . ALA B 22 ? 0.0427 0.0840 0.0670 0.0049  -0.0078 -0.0003 122  ALA B C   
1031 O  O   . ALA B 22 ? 0.0481 0.1503 0.0666 -0.0049 -0.0057 0.0223  122  ALA B O   
1032 C  CB  . ALA B 22 ? 0.0557 0.0872 0.1121 -0.0038 0.0158  -0.0025 122  ALA B CB  
1033 N  N   . LEU B 23 ? 0.0474 0.0808 0.0520 -0.0196 -0.0001 0.0058  123  LEU B N   
1034 C  CA  . LEU B 23 ? 0.0436 0.0836 0.0598 0.0009  -0.0063 -0.0115 123  LEU B CA  
1035 C  C   . LEU B 23 ? 0.0354 0.0821 0.0616 -0.0092 0.0001  -0.0128 123  LEU B C   
1036 O  O   . LEU B 23 ? 0.0786 0.0895 0.0694 -0.0097 0.0200  -0.0135 123  LEU B O   
1037 C  CB  . LEU B 23 ? 0.0613 0.1006 0.0683 0.0035  -0.0113 0.0003  123  LEU B CB  
1038 C  CG  . LEU B 23 ? 0.0626 0.1207 0.0871 0.0135  -0.0021 0.0132  123  LEU B CG  
1039 C  CD1 . LEU B 23 ? 0.0785 0.1872 0.0991 0.0199  0.0074  -0.0160 123  LEU B CD1 
1040 C  CD2 . LEU B 23 ? 0.0790 0.1787 0.1129 0.0370  -0.0152 0.0283  123  LEU B CD2 
1041 N  N   . LEU B 24 ? 0.0512 0.0785 0.0552 -0.0097 0.0014  -0.0200 124  LEU B N   
1042 C  CA  . LEU B 24 ? 0.0502 0.0762 0.0752 0.0015  -0.0013 -0.0093 124  LEU B CA  
1043 C  C   . LEU B 24 ? 0.0431 0.0828 0.0681 -0.0177 0.0064  -0.0083 124  LEU B C   
1044 O  O   . LEU B 24 ? 0.0463 0.1282 0.0702 -0.0114 0.0069  -0.0292 124  LEU B O   
1045 C  CB  . LEU B 24 ? 0.0771 0.0841 0.0799 0.0012  -0.0051 0.0008  124  LEU B CB  
1046 C  CG  . LEU B 24 ? 0.0795 0.1040 0.0719 0.0048  -0.0090 0.0008  124  LEU B CG  
1047 C  CD1 . LEU B 24 ? 0.1602 0.1612 0.1056 0.0039  -0.0335 0.0551  124  LEU B CD1 
1048 C  CD2 . LEU B 24 ? 0.0874 0.1387 0.1320 0.0278  -0.0265 -0.0443 124  LEU B CD2 
1049 N  N   . ASP B 25 ? 0.0451 0.0692 0.0711 -0.0060 0.0004  -0.0115 125  ASP B N   
1050 C  CA  . ASP B 25 ? 0.0405 0.0793 0.0606 0.0033  0.0111  -0.0102 125  ASP B CA  
1051 C  C   . ASP B 25 ? 0.0337 0.0796 0.0628 -0.0055 0.0010  -0.0027 125  ASP B C   
1052 O  O   . ASP B 25 ? 0.0432 0.0747 0.0574 0.0016  0.0063  -0.0010 125  ASP B O   
1053 C  CB  . ASP B 25 ? 0.0825 0.0776 0.0821 -0.0129 0.0009  0.0067  125  ASP B CB  
1054 C  CG  . ASP B 25 ? 0.1045 0.0794 0.0825 -0.0022 0.0041  0.0033  125  ASP B CG  
1055 O  OD1 . ASP B 25 ? 0.1000 0.0984 0.1015 0.0026  -0.0217 0.0025  125  ASP B OD1 
1056 O  OD2 . ASP B 25 ? 0.1346 0.1252 0.0965 0.0126  -0.0049 0.0235  125  ASP B OD2 
1057 N  N   . THR B 26 ? 0.0411 0.0743 0.0501 -0.0011 0.0024  -0.0077 126  THR B N   
1058 C  CA  . THR B 26 ? 0.0409 0.0573 0.0596 0.0107  0.0034  -0.0059 126  THR B CA  
1059 C  C   . THR B 26 ? 0.0308 0.0596 0.0600 -0.0001 0.0029  -0.0004 126  THR B C   
1060 O  O   . THR B 26 ? 0.0532 0.0677 0.0632 0.0007  -0.0073 0.0013  126  THR B O   
1061 C  CB  . THR B 26 ? 0.0378 0.0545 0.0580 0.0113  0.0030  -0.0021 126  THR B CB  
1062 O  OG1 . THR B 26 ? 0.0472 0.0594 0.0621 0.0106  0.0099  0.0026  126  THR B OG1 
1063 C  CG2 . THR B 26 ? 0.0541 0.0712 0.0538 0.0078  0.0023  0.0043  126  THR B CG2 
1064 N  N   . GLY B 27 ? 0.0479 0.0596 0.0593 -0.0043 -0.0032 -0.0036 127  GLY B N   
1065 C  CA  . GLY B 27 ? 0.0443 0.0651 0.0562 0.0062  0.0012  0.0078  127  GLY B CA  
1066 C  C   . GLY B 27 ? 0.0450 0.0606 0.0557 0.0106  0.0005  -0.0029 127  GLY B C   
1067 O  O   . GLY B 27 ? 0.0558 0.1019 0.0586 0.0033  -0.0025 0.0084  127  GLY B O   
1068 N  N   . ALA B 28 ? 0.0477 0.0631 0.0538 0.0108  0.0049  0.0014  128  ALA B N   
1069 C  CA  . ALA B 28 ? 0.0395 0.0707 0.0631 0.0118  0.0008  -0.0021 128  ALA B CA  
1070 C  C   . ALA B 28 ? 0.0279 0.0686 0.0628 -0.0044 -0.0012 0.0012  128  ALA B C   
1071 O  O   . ALA B 28 ? 0.0489 0.0726 0.0643 0.0110  -0.0058 0.0038  128  ALA B O   
1072 C  CB  . ALA B 28 ? 0.0506 0.0529 0.0779 0.0144  0.0037  0.0171  128  ALA B CB  
1073 N  N   . ASP B 29 ? 0.0494 0.0594 0.0558 0.0016  -0.0084 0.0067  129  ASP B N   
1074 C  CA  . ASP B 29 ? 0.0555 0.0633 0.0657 0.0006  0.0059  0.0029  129  ASP B CA  
1075 C  C   . ASP B 29 ? 0.0612 0.0617 0.0659 0.0113  -0.0014 -0.0038 129  ASP B C   
1076 O  O   . ASP B 29 ? 0.0628 0.0800 0.0958 0.0102  -0.0093 0.0041  129  ASP B O   
1077 C  CB  . ASP B 29 ? 0.0719 0.0912 0.0785 0.0030  -0.0026 -0.0172 129  ASP B CB  
1078 C  CG  . ASP B 29 ? 0.0823 0.1133 0.0769 -0.0033 -0.0127 -0.0181 129  ASP B CG  
1079 O  OD1 . ASP B 29 ? 0.0769 0.1089 0.0999 -0.0097 -0.0100 0.0066  129  ASP B OD1 
1080 O  OD2 . ASP B 29 ? 0.1439 0.1969 0.0813 -0.0353 -0.0264 -0.0070 129  ASP B OD2 
1081 N  N   . ASP B 30 ? 0.0378 0.0749 0.0693 0.0109  -0.0008 0.0004  130  ASP B N   
1082 C  CA  . ASP B 30 ? 0.0506 0.0777 0.0717 0.0025  0.0048  0.0052  130  ASP B CA  
1083 C  C   . ASP B 30 ? 0.0448 0.0656 0.0719 0.0036  0.0041  0.0182  130  ASP B C   
1084 O  O   . ASP B 30 ? 0.0483 0.0969 0.1223 0.0089  0.0071  -0.0280 130  ASP B O   
1085 C  CB  . ASP B 30 ? 0.0640 0.1394 0.0798 0.0116  0.0221  0.0037  130  ASP B CB  
1086 C  CG  . ASP B 30 ? 0.1550 0.2093 0.0676 -0.0144 0.0078  -0.0155 130  ASP B CG  
1087 O  OD1 . ASP B 30 ? 0.2502 0.1894 0.1872 -0.0136 -0.0016 -0.0740 130  ASP B OD1 
1088 O  OD2 . ASP B 30 ? 0.3712 0.4254 0.1485 0.0517  -0.1314 -0.0377 130  ASP B OD2 
1089 N  N   . THR B 31 ? 0.0417 0.0788 0.0895 0.0045  0.0053  -0.0021 131  THR B N   
1090 C  CA  . THR B 31 ? 0.0459 0.0747 0.0836 0.0070  0.0106  -0.0090 131  THR B CA  
1091 C  C   . THR B 31 ? 0.0323 0.0777 0.0765 0.0053  -0.0020 0.0000  131  THR B C   
1092 O  O   . THR B 31 ? 0.0720 0.0912 0.0751 0.0205  0.0116  -0.0020 131  THR B O   
1093 C  CB  . THR B 31 ? 0.0502 0.0680 0.0740 -0.0032 0.0123  0.0024  131  THR B CB  
1094 O  OG1 . THR B 31 ? 0.0526 0.0731 0.0874 0.0012  0.0096  0.0094  131  THR B OG1 
1095 C  CG2 . THR B 31 ? 0.0448 0.0922 0.0866 -0.0093 0.0060  0.0064  131  THR B CG2 
1096 N  N   . VAL B 32 ? 0.0485 0.0781 0.0671 0.0017  0.0182  0.0043  132  VAL B N   
1097 C  CA  . VAL B 32 ? 0.0463 0.0715 0.0696 -0.0015 0.0112  0.0082  132  VAL B CA  
1098 C  C   . VAL B 32 ? 0.0480 0.0766 0.0767 0.0013  0.0054  0.0109  132  VAL B C   
1099 O  O   . VAL B 32 ? 0.0684 0.0847 0.0758 -0.0039 0.0177  0.0004  132  VAL B O   
1100 C  CB  . VAL B 32 ? 0.0595 0.0865 0.0781 0.0044  -0.0036 -0.0010 132  VAL B CB  
1101 C  CG1 . VAL B 32 ? 0.0976 0.1047 0.0935 0.0031  -0.0121 0.0262  132  VAL B CG1 
1102 C  CG2 . VAL B 32 ? 0.0556 0.0924 0.0987 0.0136  -0.0080 -0.0128 132  VAL B CG2 
1103 N  N   . ILE B 33 ? 0.0608 0.0752 0.0679 -0.0113 0.0152  0.0013  133  ILE B N   
1104 C  CA  . ILE B 33 ? 0.0729 0.0882 0.0680 -0.0148 0.0107  0.0006  133  ILE B CA  
1105 C  C   . ILE B 33 ? 0.0576 0.0853 0.0734 -0.0059 0.0080  0.0066  133  ILE B C   
1106 O  O   . ILE B 33 ? 0.0886 0.0881 0.0709 -0.0069 0.0061  0.0034  133  ILE B O   
1107 C  CB  . ILE B 33 ? 0.0896 0.1027 0.1174 -0.0109 -0.0269 0.0207  133  ILE B CB  
1108 C  CG1 . ILE B 33 ? 0.1230 0.1206 0.1208 -0.0151 -0.0221 0.0341  133  ILE B CG1 
1109 C  CG2 . ILE B 33 ? 0.0873 0.1289 0.1464 -0.0271 -0.0282 0.0250  133  ILE B CG2 
1110 C  CD1 . ILE B 33 ? 0.1239 0.1378 0.1525 -0.0164 0.0105  0.0271  133  ILE B CD1 
1111 N  N   . GLU B 34 ? 0.0667 0.0835 0.0677 -0.0102 -0.0011 0.0031  134  GLU B N   
1112 C  CA  . GLU B 34 ? 0.0705 0.0842 0.0821 0.0020  -0.0083 0.0080  134  GLU B CA  
1113 C  C   . GLU B 34 ? 0.0674 0.0727 0.1055 -0.0180 -0.0065 0.0176  134  GLU B C   
1114 O  O   . GLU B 34 ? 0.0650 0.0949 0.1363 -0.0162 -0.0032 0.0428  134  GLU B O   
1115 C  CB  A GLU B 34 ? 0.1085 0.0889 0.1015 -0.0304 0.0012  -0.0104 134  GLU B CB  
1116 C  CB  B GLU B 34 ? 0.0969 0.0863 0.1196 -0.0171 -0.0108 -0.0090 134  GLU B CB  
1117 C  CG  A GLU B 34 ? 0.1345 0.1048 0.1158 0.0077  0.0267  -0.0015 134  GLU B CG  
1118 C  CG  B GLU B 34 ? 0.1123 0.0874 0.1308 -0.0335 -0.0288 -0.0013 134  GLU B CG  
1119 C  CD  A GLU B 34 ? 0.1840 0.1558 0.1964 -0.0432 0.0782  -0.0676 134  GLU B CD  
1120 C  CD  B GLU B 34 ? 0.1277 0.0997 0.1649 -0.0070 -0.0557 -0.0274 134  GLU B CD  
1121 O  OE1 A GLU B 34 ? 0.2633 0.2062 0.2112 -0.0357 0.0281  -0.1054 134  GLU B OE1 
1122 O  OE1 B GLU B 34 ? 0.1259 0.1313 0.1266 -0.0439 -0.0164 -0.0067 134  GLU B OE1 
1123 O  OE2 A GLU B 34 ? 0.2058 0.4342 0.3680 -0.0561 0.1678  -0.2250 134  GLU B OE2 
1124 O  OE2 B GLU B 34 ? 0.3320 0.1889 0.2500 0.1284  -0.0695 -0.0548 134  GLU B OE2 
1125 N  N   . GLU B 35 ? 0.0728 0.0999 0.1054 -0.0087 -0.0052 0.0290  135  GLU B N   
1126 C  CA  . GLU B 35 ? 0.0734 0.0986 0.1127 -0.0045 0.0023  0.0333  135  GLU B CA  
1127 C  C   . GLU B 35 ? 0.0735 0.0792 0.1212 -0.0167 0.0140  0.0313  135  GLU B C   
1128 O  O   . GLU B 35 ? 0.0968 0.1001 0.1363 -0.0181 0.0107  0.0019  135  GLU B O   
1129 C  CB  A GLU B 35 ? 0.1375 0.1697 0.1467 -0.0325 0.0001  0.0892  135  GLU B CB  
1130 C  CB  B GLU B 35 ? 0.1265 0.0998 0.1130 -0.0325 -0.0003 0.0331  135  GLU B CB  
1131 C  CG  A GLU B 35 ? 0.2406 0.2461 0.2246 -0.0127 0.0977  0.1077  135  GLU B CG  
1132 C  CG  B GLU B 35 ? 0.0744 0.1020 0.0975 0.0114  0.0172  0.0255  135  GLU B CG  
1133 C  CD  A GLU B 35 ? 0.2963 0.3580 0.2988 0.1074  0.0132  -0.0198 135  GLU B CD  
1134 C  CD  B GLU B 35 ? 0.2188 0.1174 0.1133 0.0558  -0.0103 0.0240  135  GLU B CD  
1135 O  OE1 A GLU B 35 ? 0.2368 0.2468 0.1863 -0.0196 0.0461  0.0936  135  GLU B OE1 
1136 O  OE1 B GLU B 35 ? 0.2317 0.1278 0.1692 0.0744  -0.0122 0.0133  135  GLU B OE1 
1137 O  OE2 A GLU B 35 ? 0.5731 0.2907 0.6025 0.1495  -0.2776 -0.0297 135  GLU B OE2 
1138 O  OE2 B GLU B 35 ? 0.2143 0.1816 0.1235 0.0361  -0.0505 0.0212  135  GLU B OE2 
1139 N  N   . MET B 36 ? 0.0752 0.0935 0.1494 -0.0023 -0.0089 0.0181  136  MET B N   
1140 C  CA  . MET B 36 ? 0.0693 0.1126 0.1483 -0.0018 -0.0041 0.0153  136  MET B CA  
1141 C  C   . MET B 36 ? 0.0808 0.1234 0.1454 0.0116  -0.0078 0.0057  136  MET B C   
1142 O  O   . MET B 36 ? 0.1096 0.1655 0.1518 0.0150  -0.0180 -0.0121 136  MET B O   
1143 C  CB  . MET B 36 ? 0.0829 0.1065 0.1397 -0.0156 -0.0145 0.0081  136  MET B CB  
1144 C  CG  A MET B 36 ? 0.0987 0.0881 0.1815 0.0021  -0.0181 0.0129  136  MET B CG  
1145 C  CG  B MET B 36 ? 0.0623 0.1165 0.1188 -0.0386 0.0063  0.0020  136  MET B CG  
1146 S  SD  A MET B 36 ? 0.0868 0.1567 0.2001 -0.0358 0.0075  0.0424  136  MET B SD  
1147 S  SD  B MET B 36 ? 0.0711 0.1239 0.1478 -0.0270 -0.0112 0.0268  136  MET B SD  
1148 C  CE  A MET B 36 ? 0.0815 0.1936 0.1954 0.0077  -0.0176 0.0311  136  MET B CE  
1149 C  CE  B MET B 36 ? 0.0492 0.1096 0.1576 -0.0268 0.0094  0.0449  136  MET B CE  
1150 N  N   . SER B 37 ? 0.0698 0.1327 0.1816 0.0100  -0.0089 0.0071  137  SER B N   
1151 C  CA  . SER B 37 ? 0.0877 0.1362 0.1675 0.0088  0.0127  0.0196  137  SER B CA  
1152 C  C   . SER B 37 ? 0.0966 0.1397 0.1573 0.0223  -0.0048 0.0195  137  SER B C   
1153 O  O   . SER B 37 ? 0.1822 0.1815 0.1602 0.0420  0.0237  0.0275  137  SER B O   
1154 C  CB  . SER B 37 ? 0.0660 0.2042 0.3117 0.0045  -0.0008 0.0898  137  SER B CB  
1155 O  OG  . SER B 37 ? 0.1730 0.2164 0.2988 -0.0473 0.0499  0.1011  137  SER B OG  
1156 N  N   . LEU B 38 ? 0.0842 0.1324 0.1626 0.0056  -0.0099 0.0322  138  LEU B N   
1157 C  CA  . LEU B 38 ? 0.0961 0.1300 0.1554 -0.0095 -0.0462 0.0342  138  LEU B CA  
1158 C  C   . LEU B 38 ? 0.1196 0.1173 0.2058 0.0023  -0.0479 0.0219  138  LEU B C   
1159 O  O   . LEU B 38 ? 0.1291 0.2406 0.2098 0.0616  -0.0460 -0.0234 138  LEU B O   
1160 C  CB  . LEU B 38 ? 0.1263 0.1665 0.1576 -0.0524 -0.0250 0.0411  138  LEU B CB  
1161 C  CG  A LEU B 38 ? 0.1437 0.2541 0.1556 -0.0618 -0.0125 -0.0163 138  LEU B CG  
1162 C  CG  B LEU B 38 ? 0.0842 0.1123 0.1040 -0.0039 -0.0218 0.0020  138  LEU B CG  
1163 C  CD1 A LEU B 38 ? 0.0754 0.2493 0.1159 -0.0308 0.0215  -0.0337 138  LEU B CD1 
1164 C  CD1 B LEU B 38 ? 0.1092 0.1267 0.1022 0.0136  -0.0131 -0.0220 138  LEU B CD1 
1165 C  CD2 A LEU B 38 ? 0.2029 0.1886 0.1555 -0.0365 -0.0308 -0.0455 138  LEU B CD2 
1166 C  CD2 B LEU B 38 ? 0.0800 0.0834 0.1056 0.0011  -0.0011 -0.0201 138  LEU B CD2 
1167 N  N   A PRO B 39 ? 0.0822 0.1098 0.2510 -0.0248 -0.0591 0.0209  139  PRO B N   
1168 N  N   B PRO B 39 ? 0.1053 0.1767 0.2467 0.0149  -0.0667 0.0030  139  PRO B N   
1169 C  CA  A PRO B 39 ? 0.1091 0.1271 0.2776 0.0017  -0.0721 0.0137  139  PRO B CA  
1170 C  CA  B PRO B 39 ? 0.1541 0.1786 0.2536 0.0474  -0.0705 -0.0070 139  PRO B CA  
1171 C  C   A PRO B 39 ? 0.0794 0.1221 0.1708 0.0041  -0.0099 0.0142  139  PRO B C   
1172 C  C   B PRO B 39 ? 0.2050 0.1815 0.2559 0.0307  -0.0606 -0.0069 139  PRO B C   
1173 O  O   A PRO B 39 ? 0.0761 0.1360 0.1455 0.0254  -0.0171 -0.0011 139  PRO B O   
1174 O  O   B PRO B 39 ? 0.1677 0.1985 0.2655 0.0492  -0.0719 -0.0220 139  PRO B O   
1175 C  CB  . PRO B 39 ? 0.1006 0.1504 0.3068 0.0023  -0.0842 0.0212  139  PRO B CB  
1176 C  CG  . PRO B 39 ? 0.0969 0.2055 0.2054 0.0119  -0.0346 0.0619  139  PRO B CG  
1177 C  CD  . PRO B 39 ? 0.0901 0.2074 0.2199 0.0077  -0.0265 0.0780  139  PRO B CD  
1178 N  N   A GLY B 40 ? 0.1078 0.1739 0.1566 0.0167  -0.0104 0.0124  140  GLY B N   
1179 N  N   B GLY B 40 ? 0.2335 0.1571 0.2447 0.0302  -0.0624 -0.0041 140  GLY B N   
1180 C  CA  A GLY B 40 ? 0.2496 0.2117 0.2672 0.0371  -0.0585 -0.0732 140  GLY B CA  
1181 C  CA  B GLY B 40 ? 0.2326 0.2394 0.2730 0.0142  -0.0550 -0.0635 140  GLY B CA  
1182 C  C   . GLY B 40 ? 0.2257 0.2329 0.3258 0.0659  -0.1682 -0.0848 140  GLY B C   
1183 O  O   . GLY B 40 ? 0.2508 0.2415 0.3691 0.0740  -0.1714 -0.0601 140  GLY B O   
1184 N  N   . ARG B 41 ? 0.2587 0.2489 0.3351 0.0890  -0.1916 -0.0927 141  ARG B N   
1185 C  CA  . ARG B 41 ? 0.1403 0.2491 0.2750 0.0780  -0.0960 -0.0758 141  ARG B CA  
1186 C  C   . ARG B 41 ? 0.1389 0.1601 0.1936 0.0502  -0.0549 -0.0394 141  ARG B C   
1187 O  O   . ARG B 41 ? 0.2339 0.2454 0.1561 0.1290  -0.0346 -0.0045 141  ARG B O   
1188 C  CB  A ARG B 41 ? 0.2198 0.3172 0.2981 0.1293  -0.0264 -0.1009 141  ARG B CB  
1189 C  CB  B ARG B 41 ? 0.1965 0.3120 0.3038 0.1279  -0.0525 -0.1053 141  ARG B CB  
1190 C  CG  A ARG B 41 ? 0.2339 0.4069 0.3788 0.1429  0.0158  -0.0591 141  ARG B CG  
1191 C  CG  B ARG B 41 ? 0.2060 0.3533 0.3466 0.1615  -0.0445 -0.0375 141  ARG B CG  
1192 C  CD  A ARG B 41 ? 0.2132 0.4283 0.3895 0.1599  0.0238  -0.0765 141  ARG B CD  
1193 C  CD  B ARG B 41 ? 0.2748 0.4558 0.3985 0.1733  0.0594  -0.1202 141  ARG B CD  
1194 N  NE  A ARG B 41 ? 0.3650 0.4790 0.4377 0.1254  0.0576  -0.1332 141  ARG B NE  
1195 N  NE  B ARG B 41 ? 0.4911 0.5250 0.4869 -0.0324 0.0285  -0.1602 141  ARG B NE  
1196 C  CZ  A ARG B 41 ? 0.5045 0.4554 0.4056 0.1461  0.0187  -0.1137 141  ARG B CZ  
1197 C  CZ  B ARG B 41 ? 0.6198 0.6649 0.4601 -0.0995 0.0146  -0.2010 141  ARG B CZ  
1198 N  NH1 A ARG B 41 ? 0.5246 0.5838 0.5654 0.1857  -0.0680 -0.0588 141  ARG B NH1 
1199 N  NH1 B ARG B 41 ? 0.8334 0.8669 0.4681 -0.1752 0.0557  -0.2217 141  ARG B NH1 
1200 N  NH2 A ARG B 41 ? 0.8321 0.3488 0.4449 -0.0112 0.0448  -0.1238 141  ARG B NH2 
1201 N  NH2 B ARG B 41 ? 0.7527 0.8135 0.4626 -0.2882 0.0222  -0.3118 141  ARG B NH2 
1202 N  N   . TRP B 42 ? 0.0755 0.1602 0.1805 0.0218  -0.0035 -0.0009 142  TRP B N   
1203 C  CA  . TRP B 42 ? 0.0773 0.1299 0.1158 0.0117  -0.0028 -0.0055 142  TRP B CA  
1204 C  C   . TRP B 42 ? 0.0736 0.1347 0.1101 0.0063  0.0182  -0.0203 142  TRP B C   
1205 O  O   . TRP B 42 ? 0.0879 0.1986 0.1233 0.0001  0.0379  -0.0266 142  TRP B O   
1206 C  CB  . TRP B 42 ? 0.0958 0.1425 0.0936 0.0134  0.0031  -0.0112 142  TRP B CB  
1207 C  CG  . TRP B 42 ? 0.0843 0.1280 0.1189 0.0126  0.0075  -0.0175 142  TRP B CG  
1208 C  CD1 . TRP B 42 ? 0.1103 0.1676 0.1462 -0.0160 -0.0035 -0.0088 142  TRP B CD1 
1209 C  CD2 . TRP B 42 ? 0.0902 0.1389 0.1098 0.0114  0.0234  -0.0076 142  TRP B CD2 
1210 N  NE1 . TRP B 42 ? 0.1288 0.1986 0.1545 -0.0455 0.0037  0.0052  142  TRP B NE1 
1211 C  CE2 . TRP B 42 ? 0.1151 0.1866 0.1160 -0.0130 0.0298  0.0036  142  TRP B CE2 
1212 C  CE3 . TRP B 42 ? 0.1044 0.1555 0.0897 0.0110  0.0164  -0.0025 142  TRP B CE3 
1213 C  CZ2 . TRP B 42 ? 0.1575 0.1815 0.1178 -0.0232 0.0427  0.0098  142  TRP B CZ2 
1214 C  CZ3 . TRP B 42 ? 0.1461 0.1973 0.0976 -0.0028 0.0154  0.0282  142  TRP B CZ3 
1215 C  CH2 . TRP B 42 ? 0.1459 0.2059 0.1157 0.0050  0.0374  0.0332  142  TRP B CH2 
1216 N  N   . LYS B 43 ? 0.0598 0.1552 0.1049 0.0276  0.0127  -0.0327 143  LYS B N   
1217 C  CA  . LYS B 43 ? 0.0857 0.1609 0.1189 0.0342  -0.0117 -0.0406 143  LYS B CA  
1218 C  C   . LYS B 43 ? 0.0797 0.1638 0.0847 0.0266  0.0034  -0.0464 143  LYS B C   
1219 O  O   . LYS B 43 ? 0.0730 0.1774 0.0953 0.0164  0.0115  -0.0364 143  LYS B O   
1220 C  CB  . LYS B 43 ? 0.1843 0.1591 0.2293 0.0241  -0.0753 -0.0590 143  LYS B CB  
1221 C  CG  . LYS B 43 ? 0.3441 0.2065 0.4753 -0.0844 0.0199  -0.0265 143  LYS B CG  
1222 C  CD  A LYS B 43 ? 0.3710 0.2306 0.5507 -0.0961 0.0475  -0.0786 143  LYS B CD  
1223 C  CD  B LYS B 43 ? 0.3737 0.2174 0.5771 -0.0853 0.0546  -0.0624 143  LYS B CD  
1224 C  CE  A LYS B 43 ? 0.3916 0.1667 0.5997 -0.0613 0.0781  -0.0682 143  LYS B CE  
1225 C  CE  B LYS B 43 ? 0.3738 0.1870 0.5989 -0.0614 0.0733  -0.0502 143  LYS B CE  
1226 N  NZ  A LYS B 43 ? 0.5825 0.1635 0.8365 -0.0466 0.0824  -0.1090 143  LYS B NZ  
1227 N  NZ  B LYS B 43 ? 0.4790 0.3127 0.5674 0.1527  0.0973  0.0397  143  LYS B NZ  
1228 N  N   . PRO B 44 ? 0.0642 0.1559 0.0975 0.0204  0.0104  -0.0254 144  PRO B N   
1229 C  CA  . PRO B 44 ? 0.0890 0.1617 0.1150 0.0286  0.0106  -0.0189 144  PRO B CA  
1230 C  C   . PRO B 44 ? 0.0742 0.1640 0.1075 0.0381  -0.0018 -0.0370 144  PRO B C   
1231 O  O   . PRO B 44 ? 0.0928 0.1852 0.1787 0.0206  0.0143  -0.0803 144  PRO B O   
1232 C  CB  . PRO B 44 ? 0.1424 0.2423 0.1416 0.0686  0.0340  0.0396  144  PRO B CB  
1233 C  CG  . PRO B 44 ? 0.2221 0.2419 0.1277 0.0979  0.0671  0.0115  144  PRO B CG  
1234 C  CD  . PRO B 44 ? 0.1048 0.1937 0.0915 0.0290  0.0156  -0.0418 144  PRO B CD  
1235 N  N   . LYS B 45 ? 0.0803 0.1317 0.1078 0.0255  -0.0019 -0.0362 145  LYS B N   
1236 C  CA  . LYS B 45 ? 0.0800 0.1353 0.1091 0.0308  0.0104  -0.0282 145  LYS B CA  
1237 C  C   . LYS B 45 ? 0.0774 0.1222 0.0775 0.0212  0.0006  -0.0215 145  LYS B C   
1238 O  O   . LYS B 45 ? 0.0712 0.1247 0.1056 0.0155  -0.0123 -0.0228 145  LYS B O   
1239 C  CB  . LYS B 45 ? 0.1220 0.1421 0.1358 0.0357  -0.0059 -0.0015 145  LYS B CB  
1240 C  CG  . LYS B 45 ? 0.1630 0.1471 0.1984 0.0487  -0.0317 -0.0234 145  LYS B CG  
1241 C  CD  . LYS B 45 ? 0.2376 0.1766 0.2121 0.0340  -0.0410 -0.0479 145  LYS B CD  
1242 C  CE  . LYS B 45 ? 0.3469 0.1867 0.2412 0.0680  -0.0034 -0.0661 145  LYS B CE  
1243 N  NZ  . LYS B 45 ? 0.5384 0.2331 0.3459 -0.0116 0.0179  -0.1313 145  LYS B NZ  
1244 N  N   . MET B 46 ? 0.0793 0.1018 0.0986 0.0221  0.0140  -0.0213 146  MET B N   
1245 C  CA  . MET B 46 ? 0.0863 0.1201 0.1192 0.0333  0.0392  -0.0075 146  MET B CA  
1246 C  C   . MET B 46 ? 0.1260 0.1075 0.1488 0.0355  0.0646  0.0059  146  MET B C   
1247 O  O   . MET B 46 ? 0.1898 0.1128 0.2628 0.0359  0.1363  0.0079  146  MET B O   
1248 C  CB  A MET B 46 ? 0.0812 0.1123 0.1524 0.0284  0.0254  0.0181  146  MET B CB  
1249 C  CB  B MET B 46 ? 0.1463 0.2081 0.1537 0.0973  -0.0080 -0.0003 146  MET B CB  
1250 C  CG  A MET B 46 ? 0.0789 0.1390 0.0903 -0.0266 0.0084  -0.0311 146  MET B CG  
1251 C  CG  B MET B 46 ? 0.1981 0.2306 0.1240 0.0681  -0.0225 -0.0244 146  MET B CG  
1252 S  SD  A MET B 46 ? 0.1219 0.1575 0.1010 0.0070  -0.0131 -0.0344 146  MET B SD  
1253 S  SD  B MET B 46 ? 0.2299 0.2707 0.2924 0.0074  0.0209  0.0158  146  MET B SD  
1254 C  CE  A MET B 46 ? 0.1376 0.1219 0.1070 0.0327  -0.0193 -0.0277 146  MET B CE  
1255 C  CE  B MET B 46 ? 0.2052 0.1202 0.1408 -0.0473 -0.0009 -0.0340 146  MET B CE  
1256 N  N   . ILE B 47 ? 0.0738 0.1151 0.1091 0.0270  0.0342  0.0014  147  ILE B N   
1257 C  CA  . ILE B 47 ? 0.1137 0.1024 0.1540 0.0372  0.0760  0.0258  147  ILE B CA  
1258 C  C   . ILE B 47 ? 0.0948 0.0857 0.1317 0.0179  0.0584  0.0048  147  ILE B C   
1259 O  O   . ILE B 47 ? 0.0943 0.0913 0.1385 0.0177  0.0395  0.0195  147  ILE B O   
1260 C  CB  A ILE B 47 ? 0.1541 0.1716 0.1399 0.0817  0.0790  0.0600  147  ILE B CB  
1261 C  CB  B ILE B 47 ? 0.1852 0.1984 0.1542 0.0904  0.0738  0.0807  147  ILE B CB  
1262 C  CG1 A ILE B 47 ? 0.1605 0.2160 0.1813 0.1022  0.0961  0.1039  147  ILE B CG1 
1263 C  CG1 B ILE B 47 ? 0.1666 0.2140 0.1539 0.1545  -0.0382 0.0445  147  ILE B CG1 
1264 C  CG2 A ILE B 47 ? 0.1240 0.1903 0.1100 0.0958  0.0218  0.0421  147  ILE B CG2 
1265 C  CG2 B ILE B 47 ? 0.2086 0.2174 0.1820 0.1079  0.0259  0.0235  147  ILE B CG2 
1266 C  CD1 A ILE B 47 ? 0.1063 0.2351 0.3230 0.0141  0.1068  0.0856  147  ILE B CD1 
1267 C  CD1 B ILE B 47 ? 0.1422 0.2807 0.1407 0.1269  -0.0547 0.1141  147  ILE B CD1 
1268 N  N   . GLY B 48 ? 0.0925 0.0806 0.1398 0.0177  0.0429  0.0134  148  GLY B N   
1269 C  CA  . GLY B 48 ? 0.0770 0.1183 0.0964 0.0183  0.0210  0.0016  148  GLY B CA  
1270 C  C   . GLY B 48 ? 0.0963 0.1045 0.0843 0.0293  0.0081  0.0138  148  GLY B C   
1271 O  O   . GLY B 48 ? 0.1803 0.1284 0.1204 0.0637  0.0360  0.0412  148  GLY B O   
1272 N  N   . GLY B 49 ? 0.0746 0.1039 0.0743 0.0271  0.0090  0.0182  149  GLY B N   
1273 C  CA  . GLY B 49 ? 0.0678 0.1089 0.0766 0.0185  -0.0018 0.0040  149  GLY B CA  
1274 C  C   . GLY B 49 ? 0.0570 0.0849 0.0843 -0.0015 0.0017  0.0059  149  GLY B C   
1275 O  O   . GLY B 49 ? 0.0683 0.1561 0.0813 0.0304  -0.0028 -0.0105 149  GLY B O   
1276 N  N   . ILE B 50 ? 0.0523 0.0854 0.0837 0.0071  0.0038  0.0145  150  ILE B N   
1277 C  CA  . ILE B 50 ? 0.0486 0.0951 0.0739 0.0050  0.0005  0.0149  150  ILE B CA  
1278 C  C   . ILE B 50 ? 0.0499 0.1113 0.0863 0.0181  0.0071  0.0210  150  ILE B C   
1279 O  O   . ILE B 50 ? 0.0634 0.1474 0.1003 0.0234  -0.0055 0.0304  150  ILE B O   
1280 C  CB  . ILE B 50 ? 0.0655 0.1005 0.0837 0.0062  0.0035  -0.0020 150  ILE B CB  
1281 C  CG1 . ILE B 50 ? 0.0676 0.1549 0.1064 0.0277  0.0133  -0.0171 150  ILE B CG1 
1282 C  CG2 . ILE B 50 ? 0.1243 0.0872 0.0970 0.0139  0.0015  0.0083  150  ILE B CG2 
1283 C  CD1 . ILE B 50 ? 0.0954 0.1761 0.0949 0.0183  0.0157  -0.0210 150  ILE B CD1 
1284 N  N   . GLY B 51 ? 0.0657 0.1106 0.1084 0.0257  0.0215  0.0449  151  GLY B N   
1285 C  CA  . GLY B 51 ? 0.0956 0.1068 0.1076 0.0367  0.0210  0.0410  151  GLY B CA  
1286 C  C   . GLY B 51 ? 0.0998 0.1358 0.1070 0.0421  0.0291  0.0463  151  GLY B C   
1287 O  O   . GLY B 51 ? 0.2637 0.1839 0.1563 0.1030  0.0992  0.0926  151  GLY B O   
1288 N  N   . GLY B 52 ? 0.0788 0.1387 0.1084 0.0257  0.0243  0.0304  152  GLY B N   
1289 C  CA  . GLY B 52 ? 0.0762 0.1502 0.1014 0.0258  -0.0101 -0.0034 152  GLY B CA  
1290 C  C   . GLY B 52 ? 0.0763 0.1098 0.0729 0.0189  0.0071  0.0149  152  GLY B C   
1291 O  O   . GLY B 52 ? 0.1037 0.1656 0.0910 0.0581  0.0289  0.0509  152  GLY B O   
1292 N  N   . PHE B 53 ? 0.0714 0.0937 0.0663 0.0073  0.0022  0.0080  153  PHE B N   
1293 C  CA  . PHE B 53 ? 0.0689 0.1077 0.0821 0.0176  0.0021  0.0000  153  PHE B CA  
1294 C  C   . PHE B 53 ? 0.0704 0.0942 0.1132 0.0192  0.0249  0.0193  153  PHE B C   
1295 O  O   . PHE B 53 ? 0.0930 0.0989 0.1459 0.0223  0.0029  0.0245  153  PHE B O   
1296 C  CB  . PHE B 53 ? 0.1273 0.1210 0.0829 0.0309  0.0161  0.0000  153  PHE B CB  
1297 C  CG  . PHE B 53 ? 0.1829 0.1225 0.0769 0.0053  -0.0146 -0.0069 153  PHE B CG  
1298 C  CD1 . PHE B 53 ? 0.2094 0.1629 0.1530 -0.0376 -0.0899 0.0106  153  PHE B CD1 
1299 C  CD2 . PHE B 53 ? 0.2200 0.1176 0.1368 0.0143  0.0278  -0.0065 153  PHE B CD2 
1300 C  CE1 . PHE B 53 ? 0.2644 0.1808 0.2823 -0.0735 -0.1632 -0.0090 153  PHE B CE1 
1301 C  CE2 . PHE B 53 ? 0.2788 0.1325 0.1284 -0.0145 0.0089  -0.0018 153  PHE B CE2 
1302 C  CZ  . PHE B 53 ? 0.2902 0.1561 0.1528 -0.0568 -0.0549 -0.0151 153  PHE B CZ  
1303 N  N   . ILE B 54 ? 0.0574 0.0880 0.1204 0.0140  0.0231  0.0089  154  ILE B N   
1304 C  CA  . ILE B 54 ? 0.0623 0.1014 0.1170 0.0109  0.0236  0.0019  154  ILE B CA  
1305 C  C   . ILE B 54 ? 0.0562 0.0986 0.0931 0.0112  0.0109  -0.0008 154  ILE B C   
1306 O  O   . ILE B 54 ? 0.0709 0.0967 0.1130 0.0071  0.0221  0.0012  154  ILE B O   
1307 C  CB  . ILE B 54 ? 0.0739 0.1028 0.1182 0.0149  0.0280  -0.0060 154  ILE B CB  
1308 C  CG1 . ILE B 54 ? 0.0930 0.1132 0.1084 0.0221  0.0419  -0.0033 154  ILE B CG1 
1309 C  CG2 . ILE B 54 ? 0.1054 0.1182 0.1697 0.0356  0.0353  -0.0165 154  ILE B CG2 
1310 C  CD1 . ILE B 54 ? 0.1249 0.1773 0.1124 0.0219  0.0273  -0.0029 154  ILE B CD1 
1311 N  N   . LYS B 55 ? 0.0628 0.0863 0.1000 0.0148  0.0201  0.0037  155  LYS B N   
1312 C  CA  . LYS B 55 ? 0.0636 0.1079 0.0863 0.0157  0.0131  -0.0065 155  LYS B CA  
1313 C  C   . LYS B 55 ? 0.0590 0.1012 0.0874 0.0011  0.0120  -0.0024 155  LYS B C   
1314 O  O   . LYS B 55 ? 0.1036 0.1100 0.1095 0.0109  -0.0006 -0.0155 155  LYS B O   
1315 C  CB  . LYS B 55 ? 0.0749 0.1635 0.0958 0.0280  0.0286  0.0060  155  LYS B CB  
1316 C  CG  . LYS B 55 ? 0.1103 0.2269 0.0961 0.0326  0.0186  0.0265  155  LYS B CG  
1317 C  CD  . LYS B 55 ? 0.1544 0.2399 0.1414 -0.0007 0.0026  0.0557  155  LYS B CD  
1318 C  CE  . LYS B 55 ? 0.1557 0.3234 0.2456 -0.0096 0.0608  0.0917  155  LYS B CE  
1319 N  NZ  . LYS B 55 ? 0.2945 0.5896 0.2996 -0.1700 0.0939  0.1442  155  LYS B NZ  
1320 N  N   . VAL B 56 ? 0.0608 0.1037 0.0799 0.0070  0.0089  -0.0094 156  VAL B N   
1321 C  CA  . VAL B 56 ? 0.0672 0.1005 0.0769 0.0090  0.0084  -0.0077 156  VAL B CA  
1322 C  C   . VAL B 56 ? 0.0616 0.1188 0.0650 0.0052  0.0067  -0.0003 156  VAL B C   
1323 O  O   . VAL B 56 ? 0.0746 0.1550 0.0834 0.0233  -0.0012 -0.0289 156  VAL B O   
1324 C  CB  . VAL B 56 ? 0.0516 0.1300 0.0821 0.0054  -0.0018 0.0001  156  VAL B CB  
1325 C  CG1 . VAL B 56 ? 0.0877 0.1494 0.1010 0.0037  0.0306  -0.0061 156  VAL B CG1 
1326 C  CG2 . VAL B 56 ? 0.1184 0.1178 0.0991 -0.0086 0.0016  0.0101  156  VAL B CG2 
1327 N  N   . ARG B 57 ? 0.0662 0.1027 0.0720 0.0150  0.0024  -0.0051 157  ARG B N   
1328 C  CA  . ARG B 57 ? 0.0597 0.1117 0.0716 0.0180  0.0141  -0.0132 157  ARG B CA  
1329 C  C   . ARG B 57 ? 0.0507 0.1144 0.0872 0.0185  0.0044  -0.0042 157  ARG B C   
1330 O  O   . ARG B 57 ? 0.0806 0.1190 0.0860 0.0066  0.0137  -0.0040 157  ARG B O   
1331 C  CB  . ARG B 57 ? 0.0675 0.1239 0.0841 0.0095  -0.0004 0.0037  157  ARG B CB  
1332 C  CG  . ARG B 57 ? 0.0947 0.1311 0.1104 -0.0064 0.0253  0.0096  157  ARG B CG  
1333 C  CD  A ARG B 57 ? 0.0995 0.1505 0.1734 -0.0183 0.0459  -0.0281 157  ARG B CD  
1334 C  CD  B ARG B 57 ? 0.0938 0.1419 0.1273 -0.0097 0.0378  -0.0217 157  ARG B CD  
1335 N  NE  A ARG B 57 ? 0.1869 0.3226 0.1983 -0.0160 -0.0337 -0.0700 157  ARG B NE  
1336 N  NE  B ARG B 57 ? 0.1313 0.1442 0.1393 -0.0342 0.0552  -0.0261 157  ARG B NE  
1337 C  CZ  A ARG B 57 ? 0.3079 0.4280 0.2290 -0.1610 -0.0372 -0.0330 157  ARG B CZ  
1338 C  CZ  B ARG B 57 ? 0.1619 0.1711 0.2193 -0.0755 0.0817  -0.0683 157  ARG B CZ  
1339 N  NH1 A ARG B 57 ? 0.3553 0.4185 0.4071 -0.1689 0.0700  -0.0695 157  ARG B NH1 
1340 N  NH1 B ARG B 57 ? 0.1486 0.4007 0.2440 -0.1249 0.0233  -0.0749 157  ARG B NH1 
1341 N  NH2 A ARG B 57 ? 0.1489 0.2147 0.2257 0.1659  -0.0726 -0.1083 157  ARG B NH2 
1342 N  NH2 B ARG B 57 ? 0.2466 0.2378 0.3248 -0.0949 0.1814  -0.0303 157  ARG B NH2 
1343 N  N   . GLN B 58 ? 0.0702 0.1130 0.0887 0.0185  0.0170  -0.0082 158  GLN B N   
1344 C  CA  . GLN B 58 ? 0.0613 0.1147 0.0885 0.0202  0.0200  -0.0045 158  GLN B CA  
1345 C  C   . GLN B 58 ? 0.0688 0.1103 0.1044 0.0216  0.0202  -0.0009 158  GLN B C   
1346 O  O   . GLN B 58 ? 0.0741 0.1166 0.1139 0.0315  0.0287  -0.0068 158  GLN B O   
1347 C  CB  . GLN B 58 ? 0.0905 0.1181 0.1130 0.0140  0.0186  -0.0218 158  GLN B CB  
1348 C  CG  . GLN B 58 ? 0.1007 0.1170 0.1399 0.0110  0.0191  -0.0111 158  GLN B CG  
1349 C  CD  . GLN B 58 ? 0.1892 0.1296 0.2104 -0.0147 -0.0673 0.0062  158  GLN B CD  
1350 O  OE1 . GLN B 58 ? 0.1818 0.2416 0.3223 -0.0239 -0.1090 0.0159  158  GLN B OE1 
1351 N  NE2 . GLN B 58 ? 0.2986 0.1290 0.4138 -0.0040 -0.1184 -0.0458 158  GLN B NE2 
1352 N  N   . TYR B 59 ? 0.0466 0.1058 0.1018 0.0132  0.0228  -0.0046 159  TYR B N   
1353 C  CA  . TYR B 59 ? 0.0583 0.1195 0.1020 0.0136  0.0222  0.0034  159  TYR B CA  
1354 C  C   . TYR B 59 ? 0.0662 0.1118 0.1299 0.0322  0.0162  0.0164  159  TYR B C   
1355 O  O   . TYR B 59 ? 0.0781 0.1082 0.1463 0.0264  0.0404  0.0214  159  TYR B O   
1356 C  CB  . TYR B 59 ? 0.0641 0.1338 0.0962 0.0161  0.0107  0.0096  159  TYR B CB  
1357 C  CG  . TYR B 59 ? 0.0677 0.1237 0.0997 0.0058  0.0058  -0.0076 159  TYR B CG  
1358 C  CD1 . TYR B 59 ? 0.0787 0.1217 0.1053 0.0065  -0.0055 -0.0111 159  TYR B CD1 
1359 C  CD2 . TYR B 59 ? 0.0736 0.1225 0.1065 0.0017  0.0034  -0.0100 159  TYR B CD2 
1360 C  CE1 . TYR B 59 ? 0.1208 0.1253 0.1066 -0.0020 -0.0131 -0.0051 159  TYR B CE1 
1361 C  CE2 . TYR B 59 ? 0.0926 0.1515 0.1173 -0.0285 0.0027  -0.0115 159  TYR B CE2 
1362 C  CZ  . TYR B 59 ? 0.1286 0.1219 0.1033 -0.0250 0.0050  -0.0119 159  TYR B CZ  
1363 O  OH  . TYR B 59 ? 0.1721 0.1417 0.1720 -0.0455 0.0143  -0.0124 159  TYR B OH  
1364 N  N   . ASP B 60 ? 0.1263 0.1228 0.1257 0.0263  0.0391  -0.0085 160  ASP B N   
1365 C  CA  . ASP B 60 ? 0.1164 0.0985 0.1580 0.0284  0.0144  -0.0163 160  ASP B CA  
1366 C  C   . ASP B 60 ? 0.0909 0.0964 0.1359 0.0087  0.0355  -0.0117 160  ASP B C   
1367 O  O   . ASP B 60 ? 0.1027 0.1095 0.1505 0.0069  0.0383  -0.0005 160  ASP B O   
1368 C  CB  . ASP B 60 ? 0.1753 0.1382 0.1902 -0.0088 0.0024  -0.0516 160  ASP B CB  
1369 C  CG  . ASP B 60 ? 0.2326 0.2839 0.2722 0.0125  -0.0699 -0.1091 160  ASP B CG  
1370 O  OD1 . ASP B 60 ? 0.2710 0.2443 0.2901 0.0699  -0.0957 -0.0364 160  ASP B OD1 
1371 O  OD2 . ASP B 60 ? 0.3602 0.4347 0.2309 0.0270  -0.0600 -0.1150 160  ASP B OD2 
1372 N  N   . GLN B 61 ? 0.0984 0.0984 0.1315 -0.0061 0.0230  -0.0218 161  GLN B N   
1373 C  CA  . GLN B 61 ? 0.0879 0.0935 0.1384 -0.0122 0.0396  -0.0065 161  GLN B CA  
1374 C  C   . GLN B 61 ? 0.0689 0.0838 0.1527 0.0122  0.0073  0.0150  161  GLN B C   
1375 O  O   . GLN B 61 ? 0.0659 0.0966 0.2007 0.0143  0.0132  0.0115  161  GLN B O   
1376 C  CB  . GLN B 61 ? 0.1373 0.1063 0.1931 0.0257  0.0529  -0.0042 161  GLN B CB  
1377 C  CG  . GLN B 61 ? 0.1439 0.1584 0.1405 0.0412  0.0222  0.0069  161  GLN B CG  
1378 C  CD  . GLN B 61 ? 0.1991 0.1101 0.1643 0.0369  -0.0081 0.0012  161  GLN B CD  
1379 O  OE1 . GLN B 61 ? 0.1628 0.1544 0.1634 0.0409  0.0075  0.0129  161  GLN B OE1 
1380 N  NE2 . GLN B 61 ? 0.2429 0.1438 0.1681 0.1015  -0.0439 -0.0079 161  GLN B NE2 
1381 N  N   . ILE B 62 ? 0.0460 0.0720 0.1294 -0.0062 0.0104  0.0047  162  ILE B N   
1382 C  CA  . ILE B 62 ? 0.0462 0.0812 0.1285 -0.0131 -0.0003 0.0114  162  ILE B CA  
1383 C  C   . ILE B 62 ? 0.0567 0.0574 0.1283 -0.0022 0.0130  0.0075  162  ILE B C   
1384 O  O   . ILE B 62 ? 0.0673 0.0709 0.1387 -0.0088 0.0175  0.0110  162  ILE B O   
1385 C  CB  . ILE B 62 ? 0.0680 0.0729 0.1405 -0.0114 -0.0092 0.0158  162  ILE B CB  
1386 C  CG1 . ILE B 62 ? 0.0641 0.1183 0.1378 -0.0077 0.0013  0.0198  162  ILE B CG1 
1387 C  CG2 . ILE B 62 ? 0.1126 0.0880 0.1387 0.0105  -0.0082 0.0084  162  ILE B CG2 
1388 C  CD1 . ILE B 62 ? 0.0603 0.1689 0.1578 -0.0099 0.0051  0.0382  162  ILE B CD1 
1389 N  N   . ILE B 63 ? 0.0734 0.0689 0.1280 -0.0084 0.0014  0.0081  163  ILE B N   
1390 C  CA  . ILE B 63 ? 0.0944 0.0800 0.1301 -0.0198 -0.0042 -0.0081 163  ILE B CA  
1391 C  C   . ILE B 63 ? 0.1205 0.0775 0.1460 -0.0118 0.0221  0.0033  163  ILE B C   
1392 O  O   . ILE B 63 ? 0.1626 0.0798 0.1795 -0.0238 0.0460  0.0019  163  ILE B O   
1393 C  CB  . ILE B 63 ? 0.1241 0.1107 0.1271 -0.0058 -0.0265 -0.0024 163  ILE B CB  
1394 C  CG1 . ILE B 63 ? 0.1068 0.0886 0.1743 -0.0060 -0.0410 0.0146  163  ILE B CG1 
1395 C  CG2 . ILE B 63 ? 0.2814 0.2448 0.1304 0.0492  -0.0641 -0.0019 163  ILE B CG2 
1396 C  CD1 . ILE B 63 ? 0.1056 0.1345 0.1581 -0.0170 -0.0457 0.0220  163  ILE B CD1 
1397 N  N   . ILE B 64 ? 0.1453 0.0777 0.1422 -0.0219 0.0348  -0.0046 164  ILE B N   
1398 C  CA  . ILE B 64 ? 0.1516 0.0712 0.1539 -0.0156 0.0393  -0.0002 164  ILE B CA  
1399 C  C   . ILE B 64 ? 0.1622 0.0767 0.1656 -0.0161 0.0611  -0.0141 164  ILE B C   
1400 O  O   . ILE B 64 ? 0.3144 0.0939 0.1888 -0.0650 0.0867  -0.0020 164  ILE B O   
1401 C  CB  . ILE B 64 ? 0.1862 0.0972 0.2408 0.0080  -0.0089 0.0020  164  ILE B CB  
1402 C  CG1 . ILE B 64 ? 0.1547 0.1440 0.2210 0.0110  0.0322  0.0199  164  ILE B CG1 
1403 C  CG2 . ILE B 64 ? 0.1396 0.1664 0.5387 0.0069  -0.0573 -0.0806 164  ILE B CG2 
1404 C  CD1 . ILE B 64 ? 0.1728 0.1386 0.3730 0.0078  -0.0631 -0.0014 164  ILE B CD1 
1405 N  N   . GLU B 65 ? 0.0764 0.0840 0.1351 0.0002  0.0157  0.0244  165  GLU B N   
1406 C  CA  . GLU B 65 ? 0.0867 0.1042 0.1335 0.0076  0.0121  0.0227  165  GLU B CA  
1407 C  C   . GLU B 65 ? 0.0928 0.0844 0.1319 -0.0078 0.0170  -0.0103 165  GLU B C   
1408 O  O   . GLU B 65 ? 0.1093 0.0865 0.2169 0.0036  0.0737  0.0125  165  GLU B O   
1409 C  CB  A GLU B 65 ? 0.1117 0.1958 0.1521 -0.0066 -0.0142 0.0332  165  GLU B CB  
1410 C  CB  B GLU B 65 ? 0.0957 0.2398 0.1524 -0.0084 0.0017  -0.0002 165  GLU B CB  
1411 C  CG  A GLU B 65 ? 0.1430 0.3484 0.2979 0.0981  -0.0657 -0.0201 165  GLU B CG  
1412 C  CG  B GLU B 65 ? 0.2138 0.2178 0.1399 0.0111  -0.0231 -0.0006 165  GLU B CG  
1413 C  CD  A GLU B 65 ? 0.1472 0.4076 0.5274 0.0819  -0.0355 -0.0530 165  GLU B CD  
1414 C  CD  B GLU B 65 ? 0.2116 0.2549 0.2218 0.0643  -0.0270 0.0527  165  GLU B CD  
1415 O  OE1 A GLU B 65 ? 0.2481 0.4820 0.8030 0.1595  0.1576  -0.0361 165  GLU B OE1 
1416 O  OE1 B GLU B 65 ? 0.5021 0.4074 0.2676 0.0692  -0.1024 0.1446  165  GLU B OE1 
1417 O  OE2 A GLU B 65 ? 0.2810 0.6166 0.6861 -0.0679 -0.1687 -0.0868 165  GLU B OE2 
1418 O  OE2 B GLU B 65 ? 0.1812 0.4833 0.4537 0.0216  -0.0115 0.0377  165  GLU B OE2 
1419 N  N   . ILE B 66 ? 0.0769 0.0905 0.0939 0.0026  -0.0023 0.0072  166  ILE B N   
1420 C  CA  . ILE B 66 ? 0.0760 0.0846 0.0970 0.0006  -0.0032 0.0076  166  ILE B CA  
1421 C  C   . ILE B 66 ? 0.0806 0.0827 0.0979 -0.0065 -0.0011 0.0030  166  ILE B C   
1422 O  O   . ILE B 66 ? 0.0879 0.0883 0.1086 -0.0129 -0.0074 0.0141  166  ILE B O   
1423 C  CB  . ILE B 66 ? 0.0751 0.0884 0.1037 -0.0021 -0.0099 0.0073  166  ILE B CB  
1424 C  CG1 . ILE B 66 ? 0.0928 0.1115 0.1037 0.0049  -0.0128 -0.0077 166  ILE B CG1 
1425 C  CG2 . ILE B 66 ? 0.0794 0.0929 0.1159 -0.0030 -0.0070 0.0037  166  ILE B CG2 
1426 C  CD1 . ILE B 66 ? 0.1168 0.1231 0.1449 0.0171  -0.0434 -0.0313 166  ILE B CD1 
1427 N  N   . ALA B 67 ? 0.1188 0.0873 0.0995 -0.0193 0.0082  -0.0021 167  ALA B N   
1428 C  CA  . ALA B 67 ? 0.1497 0.1237 0.0971 0.0027  0.0224  0.0004  167  ALA B CA  
1429 C  C   . ALA B 67 ? 0.1362 0.1408 0.0968 -0.0060 -0.0158 -0.0157 167  ALA B C   
1430 O  O   . ALA B 67 ? 0.2006 0.1541 0.1022 0.0052  -0.0028 0.0097  167  ALA B O   
1431 C  CB  . ALA B 67 ? 0.1387 0.1538 0.1404 0.0158  0.0255  0.0284  167  ALA B CB  
1432 N  N   . GLY B 68 ? 0.1296 0.1476 0.1240 -0.0136 -0.0262 -0.0248 168  GLY B N   
1433 C  CA  . GLY B 68 ? 0.1437 0.1761 0.1776 0.0069  -0.0680 -0.0484 168  GLY B CA  
1434 C  C   . GLY B 68 ? 0.1575 0.1691 0.1843 0.0363  -0.0757 -0.0442 168  GLY B C   
1435 O  O   . GLY B 68 ? 0.2667 0.2277 0.2529 0.0983  -0.1488 -0.0541 168  GLY B O   
1436 N  N   . HIS B 69 ? 0.1043 0.1152 0.1104 -0.0099 -0.0148 0.0046  169  HIS B N   
1437 C  CA  . HIS B 69 ? 0.1052 0.1114 0.1005 0.0055  -0.0221 0.0148  169  HIS B CA  
1438 C  C   . HIS B 69 ? 0.1037 0.0880 0.1074 0.0007  -0.0120 0.0146  169  HIS B C   
1439 O  O   . HIS B 69 ? 0.1710 0.1041 0.1108 0.0308  0.0122  0.0264  169  HIS B O   
1440 C  CB  . HIS B 69 ? 0.1012 0.1047 0.1269 -0.0026 -0.0052 0.0054  169  HIS B CB  
1441 C  CG  . HIS B 69 ? 0.1356 0.1633 0.1219 -0.0260 -0.0076 0.0183  169  HIS B CG  
1442 N  ND1 . HIS B 69 ? 0.2797 0.1979 0.1417 -0.0452 0.0083  0.0530  169  HIS B ND1 
1443 C  CD2 . HIS B 69 ? 0.1505 0.2204 0.1493 -0.0406 0.0398  -0.0110 169  HIS B CD2 
1444 C  CE1 . HIS B 69 ? 0.2720 0.2661 0.1641 -0.0137 0.0364  0.0753  169  HIS B CE1 
1445 N  NE2 . HIS B 69 ? 0.2462 0.2877 0.1570 -0.0371 0.0556  0.0192  169  HIS B NE2 
1446 N  N   . LYS B 70 ? 0.1187 0.0982 0.1064 0.0124  -0.0153 0.0209  170  LYS B N   
1447 C  CA  . LYS B 70 ? 0.0941 0.1110 0.1307 0.0136  -0.0029 0.0004  170  LYS B CA  
1448 C  C   . LYS B 70 ? 0.1028 0.0784 0.1119 0.0103  -0.0009 0.0085  170  LYS B C   
1449 O  O   . LYS B 70 ? 0.1727 0.0941 0.1296 -0.0278 -0.0029 0.0329  170  LYS B O   
1450 C  CB  A LYS B 70 ? 0.1176 0.1905 0.1560 0.0563  -0.0182 0.0239  170  LYS B CB  
1451 C  CB  B LYS B 70 ? 0.1294 0.2169 0.1677 0.0750  -0.0266 0.0004  170  LYS B CB  
1452 C  CG  A LYS B 70 ? 0.1713 0.3083 0.2213 0.0667  0.0641  -0.0281 170  LYS B CG  
1453 C  CG  B LYS B 70 ? 0.1099 0.2611 0.2930 0.0442  -0.0464 0.0361  170  LYS B CG  
1454 C  CD  A LYS B 70 ? 0.1563 0.3088 0.3633 0.0456  0.0825  0.0216  170  LYS B CD  
1455 C  CD  B LYS B 70 ? 0.2361 0.3358 0.3590 -0.0149 0.0072  0.0603  170  LYS B CD  
1456 C  CE  A LYS B 70 ? 0.2040 0.3869 0.4412 -0.0305 0.0814  0.0668  170  LYS B CE  
1457 C  CE  B LYS B 70 ? 0.2115 0.3202 0.3654 0.0342  0.0880  0.0603  170  LYS B CE  
1458 N  NZ  A LYS B 70 ? 0.2693 0.3139 0.6603 -0.0724 -0.0895 0.0646  170  LYS B NZ  
1459 N  NZ  B LYS B 70 ? 0.2348 0.3058 0.4325 -0.1303 -0.0695 0.0172  170  LYS B NZ  
1460 N  N   . ALA B 71 ? 0.0968 0.0617 0.1138 0.0041  0.0231  0.0018  171  ALA B N   
1461 C  CA  . ALA B 71 ? 0.0822 0.0677 0.1085 0.0106  0.0218  0.0081  171  ALA B CA  
1462 C  C   . ALA B 71 ? 0.0811 0.0631 0.1097 0.0028  0.0224  0.0001  171  ALA B C   
1463 O  O   . ALA B 71 ? 0.1094 0.0783 0.1229 -0.0213 0.0373  -0.0090 171  ALA B O   
1464 C  CB  . ALA B 71 ? 0.0882 0.0850 0.1136 0.0160  0.0250  0.0025  171  ALA B CB  
1465 N  N   . ILE B 72 ? 0.0561 0.0628 0.1085 -0.0022 0.0267  0.0045  172  ILE B N   
1466 C  CA  . ILE B 72 ? 0.0585 0.0468 0.1136 -0.0049 0.0274  0.0066  172  ILE B CA  
1467 C  C   . ILE B 72 ? 0.0402 0.0720 0.1051 -0.0012 0.0366  0.0068  172  ILE B C   
1468 O  O   . ILE B 72 ? 0.0683 0.0609 0.1119 -0.0018 0.0309  -0.0022 172  ILE B O   
1469 C  CB  . ILE B 72 ? 0.0564 0.0569 0.1193 -0.0032 0.0198  0.0055  172  ILE B CB  
1470 C  CG1 . ILE B 72 ? 0.0729 0.0687 0.1311 0.0070  0.0018  -0.0041 172  ILE B CG1 
1471 C  CG2 . ILE B 72 ? 0.0723 0.0870 0.1329 0.0102  0.0370  0.0108  172  ILE B CG2 
1472 C  CD1 . ILE B 72 ? 0.0611 0.1137 0.1492 0.0222  0.0020  -0.0153 172  ILE B CD1 
1473 N  N   . GLY B 73 ? 0.0503 0.0681 0.1178 0.0016  0.0188  -0.0007 173  GLY B N   
1474 C  CA  . GLY B 73 ? 0.0566 0.0719 0.1180 0.0015  0.0193  0.0024  173  GLY B CA  
1475 C  C   . GLY B 73 ? 0.0493 0.0829 0.1181 -0.0025 0.0114  0.0071  173  GLY B C   
1476 O  O   . GLY B 73 ? 0.0448 0.0903 0.1524 -0.0069 -0.0052 0.0309  173  GLY B O   
1477 N  N   . THR B 74 ? 0.0382 0.0801 0.1388 -0.0039 0.0073  0.0100  174  THR B N   
1478 C  CA  . THR B 74 ? 0.0443 0.0909 0.1216 0.0031  0.0083  0.0088  174  THR B CA  
1479 C  C   . THR B 74 ? 0.0449 0.0889 0.1059 0.0049  0.0049  0.0112  174  THR B C   
1480 O  O   . THR B 74 ? 0.0420 0.0954 0.1175 -0.0014 0.0163  0.0168  174  THR B O   
1481 C  CB  . THR B 74 ? 0.0791 0.1061 0.1236 0.0020  0.0034  -0.0082 174  THR B CB  
1482 O  OG1 . THR B 74 ? 0.1206 0.1119 0.1721 0.0150  -0.0140 -0.0232 174  THR B OG1 
1483 C  CG2 . THR B 74 ? 0.0972 0.1443 0.1312 0.0077  -0.0021 0.0112  174  THR B CG2 
1484 N  N   . VAL B 75 ? 0.0402 0.0940 0.0958 0.0067  0.0245  0.0080  175  VAL B N   
1485 C  CA  . VAL B 75 ? 0.0486 0.0853 0.1082 0.0025  0.0164  0.0194  175  VAL B CA  
1486 C  C   . VAL B 75 ? 0.0577 0.0850 0.0987 0.0138  0.0199  0.0057  175  VAL B C   
1487 O  O   . VAL B 75 ? 0.0579 0.1033 0.1101 0.0219  0.0279  0.0152  175  VAL B O   
1488 C  CB  . VAL B 75 ? 0.0937 0.0993 0.1047 -0.0042 -0.0048 0.0121  175  VAL B CB  
1489 C  CG1 . VAL B 75 ? 0.1176 0.1069 0.1162 0.0019  -0.0047 0.0061  175  VAL B CG1 
1490 C  CG2 . VAL B 75 ? 0.1215 0.1179 0.1160 -0.0042 -0.0180 0.0162  175  VAL B CG2 
1491 N  N   . LEU B 76 ? 0.0464 0.0842 0.0798 0.0017  0.0200  0.0047  176  LEU B N   
1492 C  CA  . LEU B 76 ? 0.0502 0.0775 0.0887 0.0093  0.0175  0.0003  176  LEU B CA  
1493 C  C   . LEU B 76 ? 0.0607 0.0828 0.0783 -0.0008 0.0264  0.0023  176  LEU B C   
1494 O  O   . LEU B 76 ? 0.1070 0.0967 0.1250 -0.0297 0.0635  -0.0238 176  LEU B O   
1495 C  CB  . LEU B 76 ? 0.0550 0.0855 0.0754 0.0093  0.0157  0.0031  176  LEU B CB  
1496 C  CG  . LEU B 76 ? 0.0552 0.0846 0.1012 0.0029  0.0122  0.0000  176  LEU B CG  
1497 C  CD1 . LEU B 76 ? 0.0615 0.1196 0.1112 0.0028  0.0026  -0.0146 176  LEU B CD1 
1498 C  CD2 . LEU B 76 ? 0.0698 0.0971 0.1467 -0.0020 0.0133  -0.0369 176  LEU B CD2 
1499 N  N   . VAL B 77 ? 0.0625 0.0799 0.0726 -0.0007 0.0138  -0.0019 177  VAL B N   
1500 C  CA  . VAL B 77 ? 0.0581 0.0859 0.0671 -0.0003 0.0200  -0.0004 177  VAL B CA  
1501 C  C   . VAL B 77 ? 0.0561 0.0790 0.0793 -0.0079 0.0153  -0.0032 177  VAL B C   
1502 O  O   . VAL B 77 ? 0.0854 0.0880 0.0748 -0.0019 0.0134  0.0021  177  VAL B O   
1503 C  CB  . VAL B 77 ? 0.0584 0.1082 0.0919 -0.0024 0.0075  -0.0041 177  VAL B CB  
1504 C  CG1 . VAL B 77 ? 0.0720 0.1204 0.1258 -0.0260 0.0157  -0.0089 177  VAL B CG1 
1505 C  CG2 . VAL B 77 ? 0.0633 0.1339 0.1031 0.0049  -0.0004 0.0012  177  VAL B CG2 
1506 N  N   . GLY B 78 ? 0.0822 0.0747 0.0661 -0.0029 0.0045  0.0022  178  GLY B N   
1507 C  CA  . GLY B 78 ? 0.1059 0.1023 0.0879 0.0193  0.0068  0.0105  178  GLY B CA  
1508 C  C   . GLY B 78 ? 0.1042 0.0939 0.0831 0.0079  -0.0115 0.0008  178  GLY B C   
1509 O  O   . GLY B 78 ? 0.1269 0.1025 0.0803 0.0168  -0.0033 -0.0029 178  GLY B O   
1510 N  N   . PRO B 79 ? 0.1399 0.0967 0.0827 0.0313  0.0067  0.0065  179  PRO B N   
1511 C  CA  . PRO B 79 ? 0.1762 0.0816 0.1113 0.0353  0.0112  0.0086  179  PRO B CA  
1512 C  C   . PRO B 79 ? 0.1489 0.0753 0.0896 0.0504  -0.0066 -0.0133 179  PRO B C   
1513 O  O   . PRO B 79 ? 0.1639 0.1288 0.1395 0.0532  -0.0235 0.0206  179  PRO B O   
1514 C  CB  . PRO B 79 ? 0.2385 0.1041 0.1041 0.0398  -0.0024 0.0162  179  PRO B CB  
1515 C  CG  . PRO B 79 ? 0.1961 0.1164 0.1069 0.0452  -0.0008 0.0120  179  PRO B CG  
1516 C  CD  . PRO B 79 ? 0.1660 0.1226 0.0763 0.0323  -0.0079 0.0108  179  PRO B CD  
1517 N  N   . THR B 80 ? 0.1481 0.1658 0.0938 0.0228  -0.0093 0.0215  180  THR B N   
1518 C  CA  . THR B 80 ? 0.1152 0.1112 0.1185 0.0191  -0.0192 0.0158  180  THR B CA  
1519 C  C   . THR B 80 ? 0.0944 0.0863 0.1143 -0.0023 -0.0136 0.0285  180  THR B C   
1520 O  O   . THR B 80 ? 0.1176 0.1263 0.1330 -0.0372 0.0045  0.0151  180  THR B O   
1521 C  CB  . THR B 80 ? 0.1146 0.1048 0.1228 0.0215  -0.0282 0.0111  180  THR B CB  
1522 O  OG1 . THR B 80 ? 0.1157 0.1063 0.1410 -0.0069 -0.0291 0.0192  180  THR B OG1 
1523 C  CG2 . THR B 80 ? 0.1109 0.1613 0.1143 0.0098  -0.0212 0.0379  180  THR B CG2 
1524 N  N   . PRO B 81 ? 0.0992 0.0808 0.1407 0.0079  -0.0152 0.0237  181  PRO B N   
1525 C  CA  . PRO B 81 ? 0.1197 0.0853 0.1513 -0.0030 0.0124  0.0263  181  PRO B CA  
1526 C  C   . PRO B 81 ? 0.1493 0.0762 0.1459 -0.0090 0.0076  0.0095  181  PRO B C   
1527 O  O   . PRO B 81 ? 0.1886 0.1016 0.1835 0.0110  -0.0018 -0.0201 181  PRO B O   
1528 C  CB  . PRO B 81 ? 0.1205 0.1282 0.2355 0.0338  0.0107  0.0201  181  PRO B CB  
1529 C  CG  . PRO B 81 ? 0.1108 0.2120 0.2228 -0.0262 -0.0034 -0.0432 181  PRO B CG  
1530 C  CD  . PRO B 81 ? 0.0950 0.1281 0.1812 -0.0037 -0.0248 0.0189  181  PRO B CD  
1531 N  N   . ALA B 82 ? 0.1060 0.0788 0.1287 -0.0074 -0.0103 0.0106  182  ALA B N   
1532 C  CA  . ALA B 82 ? 0.1074 0.0964 0.1232 -0.0020 0.0007  0.0074  182  ALA B CA  
1533 C  C   . ALA B 82 ? 0.1091 0.0873 0.0970 -0.0074 0.0050  0.0091  182  ALA B C   
1534 O  O   . ALA B 82 ? 0.1312 0.0859 0.0903 -0.0080 -0.0170 0.0119  182  ALA B O   
1535 C  CB  . ALA B 82 ? 0.1570 0.1837 0.1817 0.0610  0.0641  0.0657  182  ALA B CB  
1536 N  N   . ASN B 83 ? 0.0925 0.0641 0.0760 -0.0134 0.0186  -0.0059 183  ASN B N   
1537 C  CA  . ASN B 83 ? 0.0770 0.0771 0.0764 -0.0099 0.0211  -0.0033 183  ASN B CA  
1538 C  C   . ASN B 83 ? 0.0737 0.0701 0.0599 -0.0044 -0.0009 0.0044  183  ASN B C   
1539 O  O   . ASN B 83 ? 0.1007 0.0925 0.0619 -0.0271 0.0096  -0.0057 183  ASN B O   
1540 C  CB  . ASN B 83 ? 0.0883 0.0896 0.0713 -0.0189 0.0151  -0.0033 183  ASN B CB  
1541 C  CG  . ASN B 83 ? 0.0932 0.0941 0.0971 -0.0244 0.0294  -0.0145 183  ASN B CG  
1542 O  OD1 . ASN B 83 ? 0.1496 0.1325 0.0931 -0.0500 0.0463  -0.0095 183  ASN B OD1 
1543 N  ND2 . ASN B 83 ? 0.0869 0.1305 0.1081 -0.0391 0.0024  0.0036  183  ASN B ND2 
1544 N  N   . ILE B 84 ? 0.0553 0.0698 0.0617 -0.0035 0.0124  0.0003  184  ILE B N   
1545 C  CA  . ILE B 84 ? 0.0650 0.0655 0.0611 -0.0052 0.0149  0.0027  184  ILE B CA  
1546 C  C   . ILE B 84 ? 0.0542 0.0739 0.0659 -0.0018 0.0106  0.0044  184  ILE B C   
1547 O  O   . ILE B 84 ? 0.0812 0.0823 0.0703 0.0168  0.0159  0.0161  184  ILE B O   
1548 C  CB  . ILE B 84 ? 0.0638 0.0698 0.0803 0.0011  0.0054  -0.0005 184  ILE B CB  
1549 C  CG1 . ILE B 84 ? 0.0717 0.1137 0.0809 0.0004  0.0012  -0.0066 184  ILE B CG1 
1550 C  CG2 . ILE B 84 ? 0.1159 0.1038 0.0969 0.0367  -0.0070 -0.0093 184  ILE B CG2 
1551 C  CD1 . ILE B 84 ? 0.0859 0.1274 0.0971 -0.0054 -0.0139 -0.0127 184  ILE B CD1 
1552 N  N   . ILE B 85 ? 0.0570 0.0616 0.0650 -0.0024 0.0142  0.0007  185  ILE B N   
1553 C  CA  . ILE B 85 ? 0.0550 0.0633 0.0718 0.0020  0.0039  -0.0016 185  ILE B CA  
1554 C  C   . ILE B 85 ? 0.0378 0.0574 0.0596 0.0157  0.0006  0.0051  185  ILE B C   
1555 O  O   . ILE B 85 ? 0.0499 0.0844 0.0830 -0.0004 0.0087  -0.0074 185  ILE B O   
1556 C  CB  . ILE B 85 ? 0.0469 0.0666 0.0781 0.0010  -0.0007 -0.0011 185  ILE B CB  
1557 C  CG1 . ILE B 85 ? 0.0735 0.0886 0.0749 -0.0129 -0.0086 0.0009  185  ILE B CG1 
1558 C  CG2 . ILE B 85 ? 0.0648 0.0723 0.0844 0.0118  -0.0028 0.0111  185  ILE B CG2 
1559 C  CD1 . ILE B 85 ? 0.0568 0.1526 0.1146 -0.0305 -0.0009 -0.0139 185  ILE B CD1 
1560 N  N   . GLY B 86 ? 0.0421 0.0622 0.0649 0.0061  0.0003  0.0041  186  GLY B N   
1561 C  CA  . GLY B 86 ? 0.0488 0.0579 0.0704 0.0028  -0.0024 0.0035  186  GLY B CA  
1562 C  C   . GLY B 86 ? 0.0316 0.0579 0.0589 0.0079  -0.0042 0.0000  186  GLY B C   
1563 O  O   . GLY B 86 ? 0.0460 0.0499 0.0717 -0.0017 -0.0109 0.0042  186  GLY B O   
1564 N  N   . ARG B 87 ? 0.0398 0.0614 0.0649 -0.0009 -0.0080 0.0067  187  ARG B N   
1565 C  CA  . ARG B 87 ? 0.0358 0.0573 0.0567 0.0005  -0.0031 0.0094  187  ARG B CA  
1566 C  C   . ARG B 87 ? 0.0352 0.0549 0.0708 -0.0035 -0.0004 -0.0043 187  ARG B C   
1567 O  O   . ARG B 87 ? 0.0380 0.0623 0.0844 -0.0005 -0.0009 0.0080  187  ARG B O   
1568 C  CB  . ARG B 87 ? 0.0360 0.0677 0.0613 -0.0016 0.0068  -0.0100 187  ARG B CB  
1569 C  CG  . ARG B 87 ? 0.0372 0.0742 0.0646 0.0030  0.0058  0.0114  187  ARG B CG  
1570 C  CD  . ARG B 87 ? 0.0356 0.0737 0.0860 0.0018  0.0000  0.0088  187  ARG B CD  
1571 N  NE  . ARG B 87 ? 0.0423 0.0618 0.0899 -0.0053 -0.0120 0.0072  187  ARG B NE  
1572 C  CZ  . ARG B 87 ? 0.0594 0.0852 0.0892 -0.0074 -0.0103 -0.0022 187  ARG B CZ  
1573 N  NH1 . ARG B 87 ? 0.0746 0.0784 0.0930 0.0028  -0.0048 -0.0105 187  ARG B NH1 
1574 N  NH2 . ARG B 87 ? 0.0922 0.1233 0.0880 -0.0063 -0.0124 -0.0035 187  ARG B NH2 
1575 N  N   . ASN B 88 ? 0.0368 0.0544 0.0763 0.0029  -0.0010 0.0028  188  ASN B N   
1576 C  CA  . ASN B 88 ? 0.0368 0.0703 0.0890 0.0039  0.0080  -0.0058 188  ASN B CA  
1577 C  C   . ASN B 88 ? 0.0358 0.0657 0.0933 0.0009  0.0037  0.0063  188  ASN B C   
1578 O  O   . ASN B 88 ? 0.0671 0.0730 0.1162 0.0184  -0.0140 -0.0077 188  ASN B O   
1579 C  CB  . ASN B 88 ? 0.0473 0.0799 0.0845 -0.0041 0.0072  -0.0109 188  ASN B CB  
1580 C  CG  . ASN B 88 ? 0.0481 0.0819 0.0788 -0.0061 0.0092  -0.0008 188  ASN B CG  
1581 O  OD1 . ASN B 88 ? 0.0546 0.0690 0.0926 0.0030  0.0119  0.0054  188  ASN B OD1 
1582 N  ND2 . ASN B 88 ? 0.0490 0.0767 0.1120 -0.0063 0.0129  -0.0045 188  ASN B ND2 
1583 N  N   . LEU B 89 ? 0.0345 0.0600 0.0845 0.0009  -0.0003 0.0037  189  LEU B N   
1584 C  CA  . LEU B 89 ? 0.0312 0.0600 0.0883 0.0046  -0.0038 0.0030  189  LEU B CA  
1585 C  C   . LEU B 89 ? 0.0306 0.0569 0.0848 0.0013  -0.0115 0.0095  189  LEU B C   
1586 O  O   . LEU B 89 ? 0.0330 0.0760 0.0895 0.0006  -0.0053 0.0162  189  LEU B O   
1587 C  CB  . LEU B 89 ? 0.0479 0.0770 0.0731 -0.0086 -0.0064 0.0082  189  LEU B CB  
1588 C  CG  . LEU B 89 ? 0.0503 0.0882 0.0929 -0.0124 0.0022  0.0111  189  LEU B CG  
1589 C  CD1 . LEU B 89 ? 0.0793 0.1163 0.1037 -0.0432 -0.0112 0.0251  189  LEU B CD1 
1590 C  CD2 . LEU B 89 ? 0.0545 0.1279 0.1033 0.0157  0.0085  0.0148  189  LEU B CD2 
1591 N  N   . LEU B 90 ? 0.0369 0.0616 0.0665 0.0026  -0.0047 0.0103  190  LEU B N   
1592 C  CA  . LEU B 90 ? 0.0449 0.0705 0.0663 0.0038  -0.0046 0.0054  190  LEU B CA  
1593 C  C   . LEU B 90 ? 0.0246 0.0721 0.0650 0.0129  0.0089  0.0089  190  LEU B C   
1594 O  O   . LEU B 90 ? 0.0565 0.0766 0.0726 0.0144  0.0082  0.0066  190  LEU B O   
1595 C  CB  . LEU B 90 ? 0.0462 0.0702 0.0660 0.0094  -0.0010 -0.0015 190  LEU B CB  
1596 C  CG  . LEU B 90 ? 0.0590 0.0648 0.0759 -0.0031 0.0125  0.0084  190  LEU B CG  
1597 C  CD1 . LEU B 90 ? 0.0683 0.0701 0.1002 0.0175  0.0088  0.0092  190  LEU B CD1 
1598 C  CD2 . LEU B 90 ? 0.0831 0.0864 0.1140 0.0048  -0.0036 -0.0182 190  LEU B CD2 
1599 N  N   . THR B 91 ? 0.0364 0.0683 0.0761 -0.0023 0.0041  0.0092  191  THR B N   
1600 C  CA  . THR B 91 ? 0.0318 0.0690 0.0961 -0.0010 0.0062  0.0117  191  THR B CA  
1601 C  C   . THR B 91 ? 0.0363 0.0690 0.0950 0.0030  0.0092  0.0024  191  THR B C   
1602 O  O   . THR B 91 ? 0.0496 0.0833 0.1279 0.0081  0.0042  0.0276  191  THR B O   
1603 C  CB  . THR B 91 ? 0.0383 0.0803 0.1072 -0.0111 0.0085  -0.0039 191  THR B CB  
1604 O  OG1 . THR B 91 ? 0.0706 0.0917 0.1092 0.0028  0.0220  0.0004  191  THR B OG1 
1605 C  CG2 . THR B 91 ? 0.0472 0.0949 0.1029 0.0098  -0.0017 -0.0028 191  THR B CG2 
1606 N  N   . GLN B 92 ? 0.0298 0.0734 0.1000 0.0091  0.0148  -0.0006 192  GLN B N   
1607 C  CA  . GLN B 92 ? 0.0333 0.0737 0.1113 0.0154  0.0110  0.0085  192  GLN B CA  
1608 C  C   . GLN B 92 ? 0.0499 0.0988 0.1082 0.0142  0.0070  0.0183  192  GLN B C   
1609 O  O   . GLN B 92 ? 0.1226 0.1671 0.1067 0.0712  0.0046  0.0238  192  GLN B O   
1610 C  CB  . GLN B 92 ? 0.0326 0.0800 0.1071 0.0037  0.0036  0.0097  192  GLN B CB  
1611 C  CG  . GLN B 92 ? 0.0438 0.0596 0.1162 0.0038  0.0147  -0.0042 192  GLN B CG  
1612 C  CD  . GLN B 92 ? 0.0483 0.0546 0.1028 0.0068  0.0035  0.0106  192  GLN B CD  
1613 O  OE1 . GLN B 92 ? 0.0409 0.1019 0.1096 -0.0070 0.0115  0.0177  192  GLN B OE1 
1614 N  NE2 . GLN B 92 ? 0.0689 0.0922 0.0997 -0.0039 -0.0006 0.0177  192  GLN B NE2 
1615 N  N   . ILE B 93 ? 0.0482 0.1042 0.0932 0.0088  0.0045  0.0051  193  ILE B N   
1616 C  CA  . ILE B 93 ? 0.0623 0.1248 0.0903 0.0262  -0.0106 0.0181  193  ILE B CA  
1617 C  C   . ILE B 93 ? 0.0778 0.1171 0.0934 0.0219  0.0028  0.0054  193  ILE B C   
1618 O  O   . ILE B 93 ? 0.1396 0.1605 0.0840 0.0283  -0.0072 0.0127  193  ILE B O   
1619 C  CB  . ILE B 93 ? 0.0641 0.1360 0.0745 -0.0004 -0.0147 -0.0047 193  ILE B CB  
1620 C  CG1 . ILE B 93 ? 0.0938 0.1024 0.1086 0.0117  -0.0094 -0.0017 193  ILE B CG1 
1621 C  CG2 . ILE B 93 ? 0.1009 0.1612 0.1136 -0.0338 0.0057  -0.0054 193  ILE B CG2 
1622 C  CD1 . ILE B 93 ? 0.1432 0.1061 0.1596 -0.0041 -0.0012 -0.0130 193  ILE B CD1 
1623 N  N   . GLY B 94 ? 0.0684 0.1111 0.0958 0.0274  0.0069  0.0192  194  GLY B N   
1624 C  CA  . GLY B 94 ? 0.0752 0.1280 0.1242 0.0211  0.0180  0.0334  194  GLY B CA  
1625 C  C   . GLY B 94 ? 0.0801 0.1170 0.0905 0.0209  0.0182  0.0297  194  GLY B C   
1626 O  O   . GLY B 94 ? 0.1080 0.1493 0.1143 0.0329  0.0426  0.0557  194  GLY B O   
1627 N  N   . ALA B 95 ? 0.0639 0.1192 0.0777 0.0172  0.0142  0.0210  195  ALA B N   
1628 C  CA  . ALA B 95 ? 0.0707 0.1043 0.0768 0.0187  0.0069  0.0155  195  ALA B CA  
1629 C  C   . ALA B 95 ? 0.0644 0.1074 0.0844 0.0215  0.0131  0.0057  195  ALA B C   
1630 O  O   . ALA B 95 ? 0.0896 0.1366 0.0777 0.0221  0.0012  -0.0031 195  ALA B O   
1631 C  CB  . ALA B 95 ? 0.0823 0.1038 0.0924 0.0155  0.0090  0.0095  195  ALA B CB  
1632 N  N   . THR B 96 ? 0.0641 0.0956 0.0939 0.0150  0.0144  -0.0040 196  THR B N   
1633 C  CA  . THR B 96 ? 0.0584 0.0873 0.0743 0.0146  0.0020  0.0040  196  THR B CA  
1634 C  C   . THR B 96 ? 0.0620 0.0709 0.0749 0.0092  0.0057  0.0075  196  THR B C   
1635 O  O   . THR B 96 ? 0.0703 0.0882 0.0906 0.0148  -0.0096 -0.0004 196  THR B O   
1636 C  CB  . THR B 96 ? 0.0949 0.0801 0.1409 0.0160  0.0204  0.0165  196  THR B CB  
1637 O  OG1 . THR B 96 ? 0.1178 0.1215 0.1197 0.0373  0.0506  0.0326  196  THR B OG1 
1638 C  CG2 . THR B 96 ? 0.1526 0.0963 0.1564 0.0489  0.0152  0.0037  196  THR B CG2 
1639 N  N   . LEU B 97 ? 0.0580 0.0693 0.0782 0.0018  0.0111  -0.0070 197  LEU B N   
1640 C  CA  . LEU B 97 ? 0.0590 0.0862 0.0695 0.0157  0.0011  -0.0042 197  LEU B CA  
1641 C  C   . LEU B 97 ? 0.0623 0.0809 0.0832 0.0081  0.0107  -0.0075 197  LEU B C   
1642 O  O   . LEU B 97 ? 0.1190 0.1009 0.1005 -0.0057 0.0309  -0.0172 197  LEU B O   
1643 C  CB  . LEU B 97 ? 0.0834 0.0896 0.0895 0.0084  -0.0076 0.0039  197  LEU B CB  
1644 C  CG  . LEU B 97 ? 0.0771 0.1043 0.0867 -0.0082 -0.0020 0.0141  197  LEU B CG  
1645 C  CD1 . LEU B 97 ? 0.1002 0.1714 0.1105 -0.0009 -0.0237 0.0333  197  LEU B CD1 
1646 C  CD2 . LEU B 97 ? 0.1330 0.0913 0.1278 0.0143  0.0031  0.0143  197  LEU B CD2 
1647 N  N   . ASN B 98 ? 0.0762 0.0764 0.0764 0.0017  0.0108  0.0011  198  ASN B N   
1648 C  CA  . ASN B 98 ? 0.0849 0.0937 0.0866 0.0103  0.0211  0.0054  198  ASN B CA  
1649 C  C   . ASN B 98 ? 0.0783 0.0977 0.1032 0.0041  0.0247  0.0051  198  ASN B C   
1650 O  O   . ASN B 98 ? 0.0851 0.0995 0.1683 0.0008  0.0313  -0.0185 198  ASN B O   
1651 C  CB  . ASN B 98 ? 0.0941 0.1060 0.0860 0.0130  0.0200  0.0137  198  ASN B CB  
1652 C  CG  . ASN B 98 ? 0.1035 0.1155 0.0987 0.0239  0.0114  0.0136  198  ASN B CG  
1653 O  OD1 . ASN B 98 ? 0.1655 0.1123 0.1522 0.0336  0.0264  0.0319  198  ASN B OD1 
1654 N  ND2 . ASN B 98 ? 0.0893 0.1337 0.0969 0.0290  0.0138  0.0033  198  ASN B ND2 
1655 N  N   . PHE B 99 ? 0.0838 0.0962 0.1109 -0.0015 0.0303  -0.0122 199  PHE B N   
1656 C  CA  . PHE B 99 ? 0.0888 0.1215 0.1240 0.0240  0.0285  -0.0055 199  PHE B CA  
1657 C  C   . PHE B 99 ? 0.1254 0.1561 0.1471 0.0091  0.0513  0.0060  199  PHE B C   
1658 O  O   . PHE B 99 ? 0.1515 0.2218 0.2111 0.0158  0.0965  0.0022  199  PHE B O   
1659 C  CB  . PHE B 99 ? 0.0957 0.1355 0.1434 0.0183  0.0140  0.0034  199  PHE B CB  
1660 C  CG  . PHE B 99 ? 0.1208 0.1285 0.1273 0.0050  0.0225  0.0182  199  PHE B CG  
1661 C  CD1 . PHE B 99 ? 0.1684 0.2299 0.1169 -0.0257 0.0364  -0.0010 199  PHE B CD1 
1662 C  CD2 . PHE B 99 ? 0.1307 0.2231 0.1593 -0.0271 0.0101  -0.0169 199  PHE B CD2 
1663 C  CE1 . PHE B 99 ? 0.1905 0.3290 0.1367 0.0248  -0.0141 -0.0385 199  PHE B CE1 
1664 C  CE2 . PHE B 99 ? 0.1835 0.2734 0.1696 -0.0378 -0.0143 -0.0295 199  PHE B CE2 
1665 C  CZ  . PHE B 99 ? 0.2091 0.3092 0.1820 -0.0120 -0.0147 -0.0656 199  PHE B CZ  
1666 O  OXT . PHE B 99 ? 0.1689 0.1526 0.1808 0.0105  0.0608  0.0347  199  PHE B OXT 
1667 CL CL  A CL  C .  ? 0.3562 0.3445 0.2366 -0.0194 0.0011  -0.0816 501  CL  A CL  
1668 CL CL  B CL  C .  ? 0.1190 0.1804 0.1562 0.0232  -0.0030 -0.0235 501  CL  A CL  
1669 P  P   . PO4 D .  ? 0.1329 0.2338 0.2209 0.0133  0.0026  0.0442  701  PO4 A P   
1670 O  O1  . PO4 D .  ? 0.2431 0.5367 0.1459 -0.0171 0.0030  0.0601  701  PO4 A O1  
1671 O  O2  . PO4 D .  ? 0.1365 0.2439 0.1334 0.0155  -0.0080 0.0651  701  PO4 A O2  
1672 O  O3  . PO4 D .  ? 0.3084 0.2654 0.5839 0.1087  -0.1783 -0.1542 701  PO4 A O3  
1673 O  O4  . PO4 D .  ? 0.1134 0.3253 0.3525 -0.0127 -0.0320 0.0994  701  PO4 A O4  
1674 P  P   A PO4 E .  ? 0.1907 0.2015 0.4571 -0.0502 -0.1077 -0.0318 702  PO4 A P   
1675 P  P   B PO4 E .  ? 0.2455 0.1707 0.4220 -0.0434 -0.1122 -0.0628 702  PO4 A P   
1676 O  O1  A PO4 E .  ? 0.3396 0.2989 0.4585 -0.1100 -0.0061 -0.0755 702  PO4 A O1  
1677 O  O1  B PO4 E .  ? 0.2965 0.3426 0.5258 -0.1850 -0.0287 -0.1269 702  PO4 A O1  
1678 O  O2  A PO4 E .  ? 0.2340 0.3974 0.5338 -0.1362 -0.0116 -0.1738 702  PO4 A O2  
1679 O  O2  B PO4 E .  ? 0.3497 0.2933 0.5012 0.1128  -0.0736 0.0241  702  PO4 A O2  
1680 O  O3  A PO4 E .  ? 0.4349 0.3510 0.4897 0.1249  -0.1747 0.0666  702  PO4 A O3  
1681 O  O3  B PO4 E .  ? 0.4582 0.2330 0.4144 0.0048  -0.1449 0.0102  702  PO4 A O3  
1682 O  O4  A PO4 E .  ? 0.3215 0.1830 0.3532 0.0612  -0.0140 -0.0124 702  PO4 A O4  
1683 O  O4  B PO4 E .  ? 0.1521 0.2042 0.3485 -0.0339 -0.0335 -0.0324 702  PO4 A O4  
1684 P  P   . PO4 F .  ? 0.2608 0.4210 0.3445 -0.0755 0.0574  0.0393  704  PO4 A P   
1685 O  O1  . PO4 F .  ? 0.2722 0.5590 0.4228 -0.1071 0.0180  0.0245  704  PO4 A O1  
1686 O  O2  . PO4 F .  ? 0.5247 0.4101 0.4762 -0.0156 -0.1337 0.0326  704  PO4 A O2  
1687 O  O3  . PO4 F .  ? 0.5463 0.5389 0.4401 -0.0056 0.1095  0.1515  704  PO4 A O3  
1688 O  O4  . PO4 F .  ? 0.3479 0.6791 0.4825 0.1229  0.0939  0.1084  704  PO4 A O4  
1689 S  S   A DMS G .  ? 0.4842 0.3287 0.3793 0.0722  0.1745  0.1019  901  DMS A S   
1690 S  S   B DMS G .  ? 0.3390 0.4110 0.3302 -0.0414 0.0678  0.0939  901  DMS A S   
1691 O  O   A DMS G .  ? 0.4789 0.2889 0.3447 0.0380  0.0658  0.0653  901  DMS A O   
1692 O  O   B DMS G .  ? 0.6910 0.3319 0.3171 0.1291  0.1604  0.2449  901  DMS A O   
1693 C  C1  A DMS G .  ? 0.5831 0.0201 0.0122 -0.0481 0.0401  0.0355  901  DMS A C1  
1694 C  C1  B DMS G .  ? 0.3697 0.2523 0.6163 -0.1039 0.0085  -0.0483 901  DMS A C1  
1695 C  C2  A DMS G .  ? 0.2616 0.4493 0.6564 -0.1075 -0.0597 -0.1964 901  DMS A C2  
1696 C  C2  B DMS G .  ? 0.4728 0.3261 0.2474 -0.0644 -0.1642 0.2228  901  DMS A C2  
1697 C  C   . ACY H .  ? 0.0498 0.3354 0.2491 0.0077  -0.0277 -0.0886 601  ACY A C   
1698 O  O   . ACY H .  ? 0.4588 0.4682 0.5074 0.0722  -0.0593 0.1685  601  ACY A O   
1699 O  OXT . ACY H .  ? 0.1888 0.3597 0.2685 -0.0837 0.0338  -0.0689 601  ACY A OXT 
1700 C  CH3 . ACY H .  ? 0.2279 0.4747 0.6497 -0.0074 0.1851  -0.2558 601  ACY A CH3 
1701 C  C   . ACY I .  ? 0.1800 0.1726 0.3732 0.0070  0.0602  -0.0408 605  ACY A C   
1702 O  O   . ACY I .  ? 0.1857 0.3226 0.4535 0.0134  0.0082  -0.0229 605  ACY A O   
1703 O  OXT . ACY I .  ? 0.2391 0.1972 0.3139 -0.0140 0.0675  0.1765  605  ACY A OXT 
1704 C  CH3 . ACY I .  ? 0.2619 0.1577 0.1185 -0.0202 -0.1196 -0.0358 605  ACY A CH3 
1705 C  C1  . GOL J .  ? 0.4053 0.5384 0.3912 -0.0445 0.0971  0.0727  801  GOL A C1  
1706 O  O1  . GOL J .  ? 0.4372 0.4832 0.4728 0.0147  0.0689  0.0661  801  GOL A O1  
1707 C  C2  . GOL J .  ? 0.3816 0.5059 0.3697 0.0406  0.0777  0.0961  801  GOL A C2  
1708 O  O2  . GOL J .  ? 0.3372 0.4630 0.6400 -0.1142 -0.0157 -0.1024 801  GOL A O2  
1709 C  C3  . GOL J .  ? 0.3605 0.4717 0.3749 0.0726  0.1104  0.2031  801  GOL A C3  
1710 O  O3  . GOL J .  ? 0.5114 0.2242 0.2628 0.0442  0.1015  0.1048  801  GOL A O3  
1711 P  P   A PO4 K .  ? 0.4464 0.3997 0.2815 -0.0166 0.0228  0.0426  703  PO4 B P   
1712 P  P   B PO4 K .  ? 0.2895 0.3020 0.1782 0.0160  0.0075  0.0409  703  PO4 B P   
1713 O  O1  A PO4 K .  ? 0.3950 0.5777 0.3407 -0.0178 -0.1113 -0.0283 703  PO4 B O1  
1714 O  O1  B PO4 K .  ? 0.2873 0.4709 0.3531 -0.1834 -0.0285 0.0386  703  PO4 B O1  
1715 O  O2  A PO4 K .  ? 0.4756 0.2945 0.1985 -0.0501 0.1410  -0.0299 703  PO4 B O2  
1716 O  O2  B PO4 K .  ? 0.3746 0.4459 0.2852 -0.0983 0.0240  -0.0742 703  PO4 B O2  
1717 O  O3  A PO4 K .  ? 0.7231 0.6598 0.5016 0.2515  -0.0339 -0.0149 703  PO4 B O3  
1718 O  O3  B PO4 K .  ? 0.5059 0.4053 0.3476 0.2373  -0.1382 -0.0296 703  PO4 B O3  
1719 O  O4  A PO4 K .  ? 0.6374 0.3459 0.3001 -0.1118 0.1421  0.1039  703  PO4 B O4  
1720 O  O4  B PO4 K .  ? 0.2475 0.3154 0.2770 -0.0055 0.0128  0.0677  703  PO4 B O4  
1721 N  N1  A 017 L .  ? 0.1997 0.1354 0.1727 0.0114  0.0877  -0.0247 401  017 B N1  
1722 N  N1  B 017 L .  ? 0.1207 0.1464 0.1417 0.0548  0.0362  0.0215  401  017 B N1  
1723 C  C2  A 017 L .  ? 0.1055 0.1188 0.1884 0.0013  0.0646  -0.0066 401  017 B C2  
1724 C  C2  B 017 L .  ? 0.1196 0.1368 0.1692 0.0058  0.0486  -0.0184 401  017 B C2  
1725 C  C3  A 017 L .  ? 0.0495 0.1143 0.0806 0.0160  -0.0020 0.0255  401  017 B C3  
1726 C  C3  B 017 L .  ? 0.0869 0.1196 0.1158 0.0289  0.0174  0.0344  401  017 B C3  
1727 C  C4  A 017 L .  ? 0.0641 0.1131 0.0800 0.0084  0.0036  0.0222  401  017 B C4  
1728 C  C4  B 017 L .  ? 0.0820 0.0972 0.1005 0.0212  0.0043  0.0318  401  017 B C4  
1729 C  C5  A 017 L .  ? 0.0514 0.1063 0.0876 0.0066  0.0023  0.0194  401  017 B C5  
1730 C  C5  B 017 L .  ? 0.0941 0.1015 0.1031 0.0209  0.0164  0.0258  401  017 B C5  
1731 C  C6  A 017 L .  ? 0.0843 0.0966 0.0645 0.0059  -0.0013 0.0009  401  017 B C6  
1732 C  C6  B 017 L .  ? 0.1297 0.0866 0.0942 0.0173  0.0281  0.0281  401  017 B C6  
1733 C  C7  A 017 L .  ? 0.0936 0.0961 0.1370 0.0136  0.0335  0.0160  401  017 B C7  
1734 C  C7  B 017 L .  ? 0.0832 0.1075 0.1282 0.0356  0.0042  0.0212  401  017 B C7  
1735 S  S8  . 017 L .  ? 0.0876 0.0910 0.0858 0.0128  0.0029  0.0125  401  017 B S8  
1736 O  O9  . 017 L .  ? 0.0881 0.0967 0.1433 -0.0045 -0.0289 0.0093  401  017 B O9  
1737 O  O10 . 017 L .  ? 0.0906 0.1231 0.0920 0.0111  0.0223  0.0342  401  017 B O10 
1738 N  N11 . 017 L .  ? 0.0774 0.0790 0.1085 0.0095  -0.0075 0.0116  401  017 B N11 
1739 C  C12 . 017 L .  ? 0.0843 0.1097 0.1290 0.0045  -0.0145 -0.0172 401  017 B C12 
1740 C  C13 . 017 L .  ? 0.0852 0.1101 0.1005 0.0041  -0.0080 -0.0050 401  017 B C13 
1741 C  C14 . 017 L .  ? 0.0969 0.1344 0.1047 -0.0029 0.0045  0.0152  401  017 B C14 
1742 C  C15 . 017 L .  ? 0.1040 0.1319 0.1411 0.0100  -0.0312 -0.0267 401  017 B C15 
1743 C  C16 . 017 L .  ? 0.1065 0.0885 0.0841 0.0191  0.0185  0.0089  401  017 B C16 
1744 C  C17 . 017 L .  ? 0.0686 0.0726 0.0733 0.0087  0.0060  0.0129  401  017 B C17 
1745 O  O18 . 017 L .  ? 0.1038 0.0849 0.0746 0.0051  -0.0020 0.0138  401  017 B O18 
1746 C  C19 . 017 L .  ? 0.0555 0.0768 0.0714 0.0148  -0.0001 0.0140  401  017 B C19 
1747 N  N20 . 017 L .  ? 0.0566 0.0788 0.0712 0.0189  0.0049  0.0126  401  017 B N20 
1748 C  C21 . 017 L .  ? 0.0687 0.0829 0.0815 0.0071  0.0049  0.0025  401  017 B C21 
1749 O  O22 . 017 L .  ? 0.0734 0.0716 0.0923 0.0111  0.0175  0.0159  401  017 B O22 
1750 O  O23 . 017 L .  ? 0.0694 0.0830 0.0895 0.0240  0.0204  0.0208  401  017 B O23 
1751 C  C24 . 017 L .  ? 0.0688 0.0737 0.0835 0.0126  0.0122  0.0245  401  017 B C24 
1752 C  C25 . 017 L .  ? 0.0590 0.0720 0.0813 0.0017  0.0028  0.0031  401  017 B C25 
1753 O  O26 . 017 L .  ? 0.0595 0.0654 0.0921 0.0063  -0.0087 0.0071  401  017 B O26 
1754 C  C27 . 017 L .  ? 0.0612 0.0815 0.0713 0.0065  0.0009  0.0078  401  017 B C27 
1755 O  O28 . 017 L .  ? 0.0703 0.0775 0.0845 -0.0071 -0.0152 0.0127  401  017 B O28 
1756 C  C29 . 017 L .  ? 0.0636 0.0905 0.0911 -0.0006 -0.0047 0.0183  401  017 B C29 
1757 C  C30 . 017 L .  ? 0.0601 0.1092 0.0895 0.0148  0.0087  0.0272  401  017 B C30 
1758 C  C31 . 017 L .  ? 0.0645 0.0892 0.0753 0.0081  0.0034  0.0281  401  017 B C31 
1759 C  C32 . 017 L .  ? 0.0610 0.0824 0.0733 0.0061  0.0089  0.0071  401  017 B C32 
1760 C  C33 . 017 L .  ? 0.0647 0.0830 0.0841 0.0066  -0.0008 0.0101  401  017 B C33 
1761 C  C34 . 017 L .  ? 0.0689 0.1028 0.0982 0.0090  -0.0268 0.0060  401  017 B C34 
1762 C  C35 . 017 L .  ? 0.0868 0.1105 0.0898 0.0059  -0.0209 0.0103  401  017 B C35 
1763 C  C36 . 017 L .  ? 0.0925 0.1119 0.0846 -0.0096 -0.0151 0.0170  401  017 B C36 
1764 C  C37 . 017 L .  ? 0.0918 0.0929 0.0834 0.0042  -0.0100 0.0195  401  017 B C37 
1765 C  C38 . 017 L .  ? 0.0538 0.0832 0.0812 0.0014  -0.0050 0.0161  401  017 B C38 
1766 C  C   . ACY M .  ? 0.0531 0.1321 0.2486 -0.0161 0.0769  -0.0139 602  ACY B C   
1767 O  O   . ACY M .  ? 0.2294 0.2117 0.2815 0.0958  0.0330  0.0063  602  ACY B O   
1768 O  OXT . ACY M .  ? 0.2307 0.2926 0.3864 -0.0545 -0.0379 -0.0850 602  ACY B OXT 
1769 C  CH3 . ACY M .  ? 0.1531 0.2107 0.4977 0.0597  -0.0798 -0.0832 602  ACY B CH3 
1770 C  C   . ACY N .  ? 0.1579 0.1010 0.1338 0.0633  0.0731  0.0091  603  ACY B C   
1771 O  O   . ACY N .  ? 0.0251 0.1236 0.1939 0.0216  0.0229  0.0608  603  ACY B O   
1772 O  OXT . ACY N .  ? 0.3421 0.0984 0.2904 0.0594  -0.0501 -0.0439 603  ACY B OXT 
1773 C  CH3 . ACY N .  ? 0.3747 0.0370 0.1631 0.1273  -0.0349 -0.0367 603  ACY B CH3 
1774 C  C   . ACY O .  ? 0.2572 0.2376 0.3031 -0.0120 0.1192  0.0242  604  ACY B C   
1775 O  O   . ACY O .  ? 0.2283 0.3341 0.0987 0.0329  0.0521  -0.0173 604  ACY B O   
1776 O  OXT . ACY O .  ? 0.4485 0.2733 0.3887 0.0430  0.0914  -0.0318 604  ACY B OXT 
1777 C  CH3 . ACY O .  ? 0.1342 0.0478 0.4662 0.0562  -0.0622 -0.0355 604  ACY B CH3 
1778 C  C   A ACY P .  ? 0.3806 0.4894 0.2301 0.1313  0.1316  0.0265  606  ACY B C   
1779 C  C   B ACY P .  ? 0.2875 0.4339 0.2643 0.0312  0.1801  0.0580  606  ACY B C   
1780 O  O   A ACY P .  ? 0.3934 0.5347 0.4561 0.0436  0.1883  -0.1005 606  ACY B O   
1781 O  O   B ACY P .  ? 0.6167 0.4611 0.2739 0.0162  0.0982  0.0162  606  ACY B O   
1782 O  OXT A ACY P .  ? 0.4845 0.5165 0.2778 0.1553  0.0727  -0.1133 606  ACY B OXT 
1783 O  OXT B ACY P .  ? 0.4685 0.4556 0.2384 0.2394  0.0911  0.0784  606  ACY B OXT 
1784 C  CH3 A ACY P .  ? 0.3385 0.5197 0.1760 0.1061  0.2429  -0.1159 606  ACY B CH3 
1785 C  CH3 B ACY P .  ? 0.2808 0.4748 0.4058 -0.0485 0.1113  0.1234  606  ACY B CH3 
1786 O  O   . HOH Q .  ? 0.0995 0.0952 0.1117 -0.0119 0.0221  -0.0117 1003 HOH A O   
1787 O  O   . HOH Q .  ? 0.0900 0.1212 0.1185 -0.0019 0.0215  0.0079  1004 HOH A O   
1788 O  O   . HOH Q .  ? 0.0894 0.1032 0.1774 -0.0229 -0.0298 0.0006  1011 HOH A O   
1789 O  O   . HOH Q .  ? 0.1657 0.1711 0.1017 0.0416  -0.0343 -0.0471 1012 HOH A O   
1790 O  O   . HOH Q .  ? 0.1327 0.1710 0.1681 0.0232  -0.0253 -0.0710 1013 HOH A O   
1791 O  O   . HOH Q .  ? 0.1021 0.1580 0.2012 -0.0239 -0.0303 -0.0624 1014 HOH A O   
1792 O  O   . HOH Q .  ? 0.1092 0.1243 0.2643 -0.0402 0.0276  -0.0209 1016 HOH A O   
1793 O  O   . HOH Q .  ? 0.0634 0.1734 0.1796 -0.0448 -0.0102 0.0137  1018 HOH A O   
1794 O  O   . HOH Q .  ? 0.1746 0.2045 0.1513 0.0582  0.0416  0.0892  1020 HOH A O   
1795 O  O   . HOH Q .  ? 0.1176 0.2007 0.1333 0.0326  0.0341  0.0490  1022 HOH A O   
1796 O  O   . HOH Q .  ? 0.1318 0.1605 0.1810 -0.0149 0.0101  0.0394  1023 HOH A O   
1797 O  O   . HOH Q .  ? 0.1633 0.1688 0.1910 0.0030  -0.0111 -0.0379 1024 HOH A O   
1798 O  O   . HOH Q .  ? 0.0745 0.0734 0.0725 -0.0227 0.0338  -0.0113 1027 HOH A O   
1799 O  O   . HOH Q .  ? 0.1442 0.1697 0.2477 0.0430  0.0738  0.0375  1029 HOH A O   
1800 O  O   . HOH Q .  ? 0.1451 0.1640 0.1523 0.0256  -0.0220 -0.0311 1031 HOH A O   
1801 O  O   . HOH Q .  ? 0.2049 0.1938 0.2545 -0.0003 -0.1033 -0.0405 1032 HOH A O   
1802 O  O   . HOH Q .  ? 0.1932 0.1971 0.2849 0.0085  -0.0961 -0.0988 1033 HOH A O   
1803 O  O   . HOH Q .  ? 0.1244 0.1583 0.0827 0.0355  0.0074  0.0036  1034 HOH A O   
1804 O  O   . HOH Q .  ? 0.1524 0.2028 0.2472 -0.0272 0.0105  0.1056  1038 HOH A O   
1805 O  O   . HOH Q .  ? 0.1410 0.1386 0.0836 0.0620  -0.0313 -0.0343 1039 HOH A O   
1806 O  O   . HOH Q .  ? 0.0435 0.1986 0.0641 0.0070  -0.0065 0.0397  1040 HOH A O   
1807 O  O   . HOH Q .  ? 0.2740 0.2108 0.1501 0.0592  0.0028  0.0033  1041 HOH A O   
1808 O  O   . HOH Q .  ? 0.2337 0.3045 0.1699 0.0415  -0.0425 0.0105  1043 HOH A O   
1809 O  O   . HOH Q .  ? 0.2713 0.2709 0.2004 -0.1133 0.0308  0.0543  1044 HOH A O   
1810 O  O   . HOH Q .  ? 0.2989 0.2786 0.4106 -0.0759 0.0812  -0.1330 1054 HOH A O   
1811 O  O   . HOH Q .  ? 0.2680 0.2876 0.3724 -0.1035 0.1400  -0.2100 1057 HOH A O   
1812 O  O   . HOH Q .  ? 0.1795 0.1809 0.1465 0.0055  0.0509  0.0334  1058 HOH A O   
1813 O  O   . HOH Q .  ? 0.3781 0.2922 0.2818 0.0496  0.1568  0.1409  1062 HOH A O   
1814 O  O   . HOH Q .  ? 0.2796 0.2884 0.2318 -0.0215 0.0736  -0.0330 1063 HOH A O   
1815 O  O   . HOH Q .  ? 0.2897 0.3495 0.2821 0.2192  0.0158  -0.0068 1065 HOH A O   
1816 O  O   . HOH Q .  ? 0.2837 0.4135 0.1891 0.0292  0.0081  0.1348  1066 HOH A O   
1817 O  O   . HOH Q .  ? 0.3767 0.4874 0.2888 -0.0674 -0.0070 -0.1830 1068 HOH A O   
1818 O  O   . HOH Q .  ? 0.2783 0.2361 0.1110 0.1414  0.0103  0.0174  1072 HOH A O   
1819 O  O   . HOH Q .  ? 0.2139 0.3917 0.3459 -0.0307 0.0277  0.0837  1074 HOH A O   
1820 O  O   . HOH Q .  ? 0.1562 0.1794 0.1350 0.0057  0.0059  -0.0293 1075 HOH A O   
1821 O  O   . HOH Q .  ? 0.2297 0.2541 0.2766 -0.0560 -0.0292 0.1402  1076 HOH A O   
1822 O  O   . HOH Q .  ? 0.1872 0.2276 0.2701 -0.0500 -0.0342 0.0760  1077 HOH A O   
1823 O  O   . HOH Q .  ? 0.0675 0.0892 0.1015 0.0174  -0.0138 0.0059  1079 HOH A O   
1824 O  O   . HOH Q .  ? 0.3301 0.1177 0.0530 -0.0040 -0.0403 -0.0085 1081 HOH A O   
1825 O  O   . HOH Q .  ? 0.2825 0.4466 0.2463 0.0062  0.0896  0.0851  1088 HOH A O   
1826 O  O   . HOH Q .  ? 0.0935 0.0497 0.1020 -0.0208 0.0040  -0.0062 1090 HOH A O   
1827 O  O   . HOH Q .  ? 0.3455 0.2402 0.2648 -0.1028 0.0269  0.0357  1091 HOH A O   
1828 O  O   . HOH Q .  ? 0.2069 0.2644 0.1263 0.0065  0.0476  0.0306  1092 HOH A O   
1829 O  O   . HOH Q .  ? 0.1379 0.2076 0.1690 0.0615  0.0277  0.0852  1093 HOH A O   
1830 O  O   . HOH Q .  ? 0.2510 0.2461 0.3298 -0.0461 -0.0294 0.1135  1094 HOH A O   
1831 O  O   . HOH Q .  ? 0.3405 0.2176 0.3067 -0.0057 0.0991  -0.1115 1095 HOH A O   
1832 O  O   . HOH Q .  ? 0.2330 0.3188 0.2356 0.0250  -0.0011 0.0144  1097 HOH A O   
1833 O  O   . HOH Q .  ? 0.3700 0.2788 0.4322 0.1397  0.0461  0.0245  1100 HOH A O   
1834 O  O   . HOH Q .  ? 0.0771 0.2982 0.0964 0.0055  0.0232  -0.0068 1104 HOH A O   
1835 O  O   . HOH Q .  ? 0.1501 0.2155 0.1871 -0.0236 -0.0105 0.0404  1105 HOH A O   
1836 O  O   . HOH Q .  ? 0.3063 0.2013 0.2156 0.1137  0.0533  -0.0068 1106 HOH A O   
1837 O  O   . HOH Q .  ? 0.2818 0.2953 0.3976 0.0175  0.0653  0.1334  1110 HOH A O   
1838 O  O   . HOH Q .  ? 0.5155 0.2468 0.2940 0.0087  0.0782  0.0072  1111 HOH A O   
1839 O  O   . HOH Q .  ? 0.2273 0.2323 0.2083 0.0754  0.0043  0.0115  1112 HOH A O   
1840 O  O   . HOH Q .  ? 0.4930 0.5537 0.2932 0.0771  -0.1957 0.0224  1113 HOH A O   
1841 O  O   . HOH Q .  ? 0.1548 0.3154 0.2391 0.0289  -0.0180 -0.1012 1115 HOH A O   
1842 O  O   . HOH Q .  ? 0.1882 0.1497 0.1700 0.0338  0.0158  0.0224  1116 HOH A O   
1843 O  O   . HOH Q .  ? 0.3978 0.4401 0.5344 -0.0943 0.1750  0.0015  1117 HOH A O   
1844 O  O   . HOH Q .  ? 0.6122 0.2875 0.5124 0.1214  0.1087  0.0739  1119 HOH A O   
1845 O  O   . HOH Q .  ? 0.3044 0.4508 0.3631 0.0092  -0.0787 0.1250  1120 HOH A O   
1846 O  O   . HOH Q .  ? 0.4627 0.3684 0.4828 0.1397  -0.1712 -0.1270 1122 HOH A O   
1847 O  O   . HOH Q .  ? 0.1154 0.2611 0.1407 0.0227  0.0088  0.0653  1124 HOH A O   
1848 O  O   . HOH Q .  ? 0.4650 0.4089 0.6266 0.1459  -0.0430 0.1682  1125 HOH A O   
1849 O  O   . HOH Q .  ? 0.1438 0.2556 0.2891 0.0735  -0.0334 0.0208  1126 HOH A O   
1850 O  O   . HOH Q .  ? 0.2309 0.1957 0.3635 0.0136  0.0321  -0.1721 1130 HOH A O   
1851 O  O   . HOH Q .  ? 0.4551 0.5179 0.4150 -0.0378 -0.0088 -0.1222 1131 HOH A O   
1852 O  O   . HOH Q .  ? 0.1662 0.1674 0.1373 0.0137  0.0273  0.0329  1132 HOH A O   
1853 O  O   . HOH Q .  ? 0.3152 0.4428 0.4489 0.0308  -0.1288 0.0383  1134 HOH A O   
1854 O  O   . HOH Q .  ? 0.1850 0.5232 0.3154 -0.0044 -0.1296 -0.1408 1136 HOH A O   
1855 O  O   . HOH Q .  ? 0.4235 0.3481 0.2580 -0.0119 -0.0453 0.0396  1137 HOH A O   
1856 O  O   . HOH Q .  ? 0.8299 0.3674 0.3924 0.1514  0.1472  0.1061  1141 HOH A O   
1857 O  O   . HOH Q .  ? 0.3587 0.1051 0.1575 -0.0301 0.0128  0.0055  1143 HOH A O   
1858 O  O   . HOH Q .  ? 0.4505 0.3814 0.7987 -0.1312 -0.1518 -0.1023 1150 HOH A O   
1859 O  O   . HOH Q .  ? 0.2603 0.2533 0.2938 -0.0458 0.0465  -0.0045 1158 HOH A O   
1860 O  O   . HOH Q .  ? 0.4967 0.6142 0.5426 0.0812  -0.0978 -0.0129 1160 HOH A O   
1861 O  O   . HOH Q .  ? 0.2716 0.1010 0.4471 -0.0721 0.1965  -0.0816 1162 HOH A O   
1862 O  O   . HOH Q .  ? 0.6150 0.5747 0.3077 -0.0194 -0.0523 0.1477  1163 HOH A O   
1863 O  O   . HOH Q .  ? 0.3373 0.2304 0.5145 0.0562  -0.0967 -0.1727 1164 HOH A O   
1864 O  O   . HOH Q .  ? 0.3330 0.2885 0.2828 -0.1465 0.0187  -0.0922 1165 HOH A O   
1865 O  O   . HOH Q .  ? 0.1893 0.4427 0.2390 -0.0179 0.0853  0.0327  1166 HOH A O   
1866 O  O   . HOH Q .  ? 0.3694 0.3290 0.2523 0.0405  -0.0331 -0.0583 1171 HOH A O   
1867 O  O   . HOH Q .  ? 0.1400 0.5895 0.1705 0.1019  0.0398  0.0804  1172 HOH A O   
1868 O  O   . HOH Q .  ? 0.4475 0.3741 0.5013 0.0827  -0.0296 -0.1245 1175 HOH A O   
1869 O  O   . HOH Q .  ? 0.7196 0.5414 0.4355 0.0617  0.0192  0.2014  1178 HOH A O   
1870 O  O   . HOH Q .  ? 0.5067 0.4890 0.4580 0.0899  -0.0985 -0.0777 1179 HOH A O   
1871 O  O   . HOH Q .  ? 0.5117 0.4917 0.4562 -0.0166 0.0367  -0.0557 1181 HOH A O   
1872 O  O   . HOH Q .  ? 0.2904 0.3082 0.3443 0.0360  -0.0123 -0.0663 1182 HOH A O   
1873 O  O   . HOH Q .  ? 0.3188 0.2999 0.1705 0.0669  -0.1080 -0.0636 1184 HOH A O   
1874 O  O   . HOH Q .  ? 0.0867 0.1211 0.1125 -0.0203 -0.0378 -0.0004 1186 HOH A O   
1875 O  O   . HOH Q .  ? 0.4099 0.3441 0.3567 0.0380  -0.0438 -0.1094 1187 HOH A O   
1876 O  O   . HOH Q .  ? 0.1557 0.1104 0.1202 -0.0152 -0.0686 0.0132  1195 HOH A O   
1877 O  O   . HOH Q .  ? 0.2406 0.2152 0.1215 -0.0235 -0.0616 0.0613  1196 HOH A O   
1878 O  O   . HOH Q .  ? 0.3307 0.3070 0.2295 0.0852  0.0290  0.0285  1197 HOH A O   
1879 O  O   . HOH Q .  ? 0.3652 0.2544 0.2085 -0.1230 -0.0567 -0.0210 1201 HOH A O   
1880 O  O   . HOH Q .  ? 0.3241 0.3504 0.2051 0.0423  -0.0237 -0.1216 1202 HOH A O   
1881 O  O   . HOH Q .  ? 0.1565 0.2523 0.2271 0.0392  0.0014  0.0912  1206 HOH A O   
1882 O  O   . HOH Q .  ? 0.2975 0.2804 0.1593 0.0921  -0.0516 0.0117  1207 HOH A O   
1883 O  O   . HOH Q .  ? 0.1937 0.2082 0.1631 0.0881  -0.0871 0.0126  1208 HOH A O   
1884 O  O   . HOH Q .  ? 0.0283 0.0876 0.1728 0.0212  -0.0307 0.0054  1211 HOH A O   
1885 O  O   . HOH Q .  ? 0.3207 0.1942 0.3777 0.0667  0.1569  0.0335  1213 HOH A O   
1886 O  O   . HOH Q .  ? 0.3940 0.3530 0.4867 -0.1233 0.0641  0.0145  1216 HOH A O   
1887 O  O   . HOH Q .  ? 0.2274 0.2525 0.1788 -0.0266 0.0269  -0.0711 1219 HOH A O   
1888 O  O   . HOH Q .  ? 0.2693 0.0900 0.0768 0.0083  -0.0326 -0.0433 1220 HOH A O   
1889 O  O   . HOH Q .  ? 0.2897 0.2150 0.2811 -0.0251 -0.0857 0.0509  1221 HOH A O   
1890 O  O   . HOH Q .  ? 0.2366 0.1762 0.1898 0.0148  -0.1305 -0.0099 1222 HOH A O   
1891 O  O   . HOH Q .  ? 0.5165 0.2662 0.2779 -0.1570 -0.0473 -0.0162 1223 HOH A O   
1892 O  O   . HOH Q .  ? 0.3727 0.1576 0.3597 -0.0702 0.0790  -0.0628 1224 HOH A O   
1893 O  O   . HOH Q .  ? 0.3335 0.4684 0.4812 0.0893  0.0472  -0.0876 1226 HOH A O   
1894 O  O   . HOH Q .  ? 0.3134 0.2042 0.3700 0.0223  -0.0516 0.0997  1227 HOH A O   
1895 O  O   . HOH Q .  ? 0.2167 0.4100 0.3201 -0.0737 -0.0136 0.1801  1229 HOH A O   
1896 O  O   . HOH Q .  ? 0.2231 0.2572 0.3082 0.0284  0.0862  -0.1178 1231 HOH A O   
1897 O  O   . HOH Q .  ? 0.2336 0.4077 0.3847 -0.0597 0.0818  0.0351  1232 HOH A O   
1898 O  O   . HOH Q .  ? 0.3433 0.4220 0.5124 -0.0427 0.0157  0.0378  1233 HOH A O   
1899 O  O   . HOH Q .  ? 0.3700 0.2115 0.2782 0.0594  -0.0618 -0.0311 1234 HOH A O   
1900 O  O   . HOH Q .  ? 0.5255 0.4988 0.5664 -0.0204 0.0468  -0.0450 1235 HOH A O   
1901 O  O   . HOH Q .  ? 0.2838 0.1972 0.2565 -0.0177 -0.0087 -0.0153 1237 HOH A O   
1902 O  O   . HOH Q .  ? 0.3615 0.3110 0.4250 0.1080  0.0242  -0.1671 1238 HOH A O   
1903 O  O   . HOH Q .  ? 0.4348 0.3722 0.3906 -0.0217 -0.0709 -0.1066 1241 HOH A O   
1904 O  O   . HOH Q .  ? 0.4972 0.5229 0.5838 -0.0187 -0.0483 0.0154  1242 HOH A O   
1905 O  O   . HOH Q .  ? 0.2522 0.4689 0.2676 0.1225  0.0276  0.0342  1244 HOH A O   
1906 O  O   . HOH Q .  ? 0.2201 0.6071 0.3156 -0.1214 -0.0443 0.0520  1245 HOH A O   
1907 O  O   . HOH Q .  ? 0.2472 0.2637 0.3454 0.0801  0.0465  -0.0930 1247 HOH A O   
1908 O  O   . HOH Q .  ? 0.4832 0.1422 0.1730 -0.0055 -0.1149 0.0255  1248 HOH A O   
1909 O  O   . HOH Q .  ? 0.4509 0.2863 0.3524 -0.0332 -0.1022 -0.1285 1260 HOH A O   
1910 O  O   . HOH Q .  ? 0.2910 0.1638 0.2549 -0.0026 -0.0711 -0.0717 1262 HOH A O   
1911 O  O   . HOH Q .  ? 0.2349 0.2878 0.2087 -0.0130 -0.0010 0.1087  1263 HOH A O   
1912 O  O   . HOH Q .  ? 0.1315 0.2632 0.1680 -0.0133 -0.0121 0.1183  1264 HOH A O   
1913 O  O   . HOH Q .  ? 0.1219 0.3059 0.0666 -0.0112 -0.0596 -0.0060 1266 HOH A O   
1914 O  O   . HOH Q .  ? 0.5254 0.5157 0.3199 0.0174  -0.1201 0.0830  1267 HOH A O   
1915 O  O   . HOH Q .  ? 0.4456 0.4257 0.2787 -0.1226 -0.1674 0.1357  1268 HOH A O   
1916 O  O   . HOH Q .  ? 0.1132 0.1274 0.2696 -0.0139 0.0160  0.0356  1269 HOH A O   
1917 O  O   . HOH Q .  ? 0.3919 0.3057 0.4498 0.0057  -0.0988 -0.0820 1270 HOH A O   
1918 O  O   . HOH Q .  ? 0.1900 0.3564 0.3660 0.1236  -0.0793 0.0175  1271 HOH A O   
1919 O  O   . HOH Q .  ? 0.2264 0.3513 0.2449 0.0573  -0.0636 0.1474  1272 HOH A O   
1920 O  O   . HOH Q .  ? 0.1763 0.1764 0.1611 -0.0325 0.0977  -0.0042 1273 HOH A O   
1921 O  O   . HOH Q .  ? 0.1908 0.2741 0.1750 -0.0265 0.0331  -0.0091 1274 HOH A O   
1922 O  O   . HOH Q .  ? 0.5194 0.6047 0.2471 0.0344  0.0595  -0.0932 1275 HOH A O   
1923 O  O   . HOH R .  ? 0.0808 0.0813 0.0712 0.0162  0.0042  0.0184  1001 HOH B O   
1924 O  O   . HOH R .  ? 0.0904 0.0702 0.0747 0.0071  -0.0030 -0.0055 1002 HOH B O   
1925 O  O   . HOH R .  ? 0.0810 0.1091 0.1783 -0.0101 0.0084  -0.0326 1005 HOH B O   
1926 O  O   . HOH R .  ? 0.0707 0.1057 0.1786 -0.0146 0.0206  -0.0197 1006 HOH B O   
1927 O  O   . HOH R .  ? 0.0893 0.1321 0.1958 -0.0255 -0.0201 0.0288  1007 HOH B O   
1928 O  O   . HOH R .  ? 0.0905 0.1780 0.1147 0.0657  0.0218  0.0049  1008 HOH B O   
1929 O  O   . HOH R .  ? 0.1233 0.0907 0.1011 0.0275  -0.0041 -0.0011 1009 HOH B O   
1930 O  O   . HOH R .  ? 0.0998 0.1485 0.1657 0.0005  0.0191  0.0426  1010 HOH B O   
1931 O  O   . HOH R .  ? 0.1272 0.1162 0.1823 0.0309  0.0343  0.0486  1015 HOH B O   
1932 O  O   . HOH R .  ? 0.1088 0.1395 0.2223 0.0025  0.0165  -0.0214 1017 HOH B O   
1933 O  O   . HOH R .  ? 0.1605 0.1730 0.1107 -0.0350 0.0140  -0.0420 1019 HOH B O   
1934 O  O   . HOH R .  ? 0.1578 0.1908 0.2250 0.0541  0.0404  0.0753  1021 HOH B O   
1935 O  O   . HOH R .  ? 0.2116 0.1406 0.1269 0.0743  -0.0390 -0.0095 1025 HOH B O   
1936 O  O   . HOH R .  ? 0.1482 0.1261 0.2564 -0.0068 0.0401  0.0297  1026 HOH B O   
1937 O  O   . HOH R .  ? 0.2426 0.2441 0.1484 0.0205  0.0574  0.0206  1028 HOH B O   
1938 O  O   . HOH R .  ? 0.2576 0.1410 0.1467 0.0179  -0.0320 -0.0253 1030 HOH B O   
1939 O  O   . HOH R .  ? 0.1366 0.1832 0.1529 0.0510  -0.0054 -0.0133 1035 HOH B O   
1940 O  O   . HOH R .  ? 0.1880 0.2133 0.2814 -0.0373 0.0294  -0.1089 1036 HOH B O   
1941 O  O   . HOH R .  ? 0.1294 0.2317 0.2722 -0.0538 -0.0527 0.0770  1037 HOH B O   
1942 O  O   . HOH R .  ? 0.1980 0.2065 0.2330 -0.0112 0.0270  -0.1089 1042 HOH B O   
1943 O  O   . HOH R .  ? 0.2322 0.2376 0.2934 -0.0384 -0.0078 0.0578  1045 HOH B O   
1944 O  O   . HOH R .  ? 0.1814 0.2732 0.3263 -0.1155 -0.0216 -0.0950 1046 HOH B O   
1945 O  O   . HOH R .  ? 0.2514 0.1752 0.3746 -0.0120 -0.0585 0.0138  1047 HOH B O   
1946 O  O   . HOH R .  ? 0.2565 0.3343 0.1715 0.0202  0.0692  -0.0008 1048 HOH B O   
1947 O  O   . HOH R .  ? 0.1863 0.2768 0.2638 -0.0280 0.0484  0.0097  1049 HOH B O   
1948 O  O   . HOH R .  ? 0.1366 0.1177 0.1521 -0.0007 -0.0293 -0.0850 1050 HOH B O   
1949 O  O   . HOH R .  ? 0.3365 0.2358 0.3134 0.0869  0.1742  0.0635  1051 HOH B O   
1950 O  O   . HOH R .  ? 0.2879 0.2563 0.2913 -0.0946 0.0424  0.0665  1052 HOH B O   
1951 O  O   . HOH R .  ? 0.3323 0.2402 0.4220 -0.0165 -0.1400 0.0013  1053 HOH B O   
1952 O  O   . HOH R .  ? 0.1546 0.2824 0.4874 0.0174  -0.0516 -0.1130 1055 HOH B O   
1953 O  O   . HOH R .  ? 0.3128 0.2721 0.3019 0.0443  0.1130  0.0868  1056 HOH B O   
1954 O  O   . HOH R .  ? 0.2372 0.2094 0.2308 0.0521  -0.0321 -0.0278 1059 HOH B O   
1955 O  O   . HOH R .  ? 0.2532 0.2200 0.3452 0.0409  -0.0729 -0.0939 1060 HOH B O   
1956 O  O   . HOH R .  ? 0.5082 0.2048 0.4009 0.0477  -0.0792 -0.0645 1061 HOH B O   
1957 O  O   . HOH R .  ? 0.1802 0.3262 0.3171 -0.1529 0.0683  -0.1180 1064 HOH B O   
1958 O  O   . HOH R .  ? 0.2863 0.2943 0.2269 0.0720  -0.0631 -0.0543 1067 HOH B O   
1959 O  O   . HOH R .  ? 0.3607 0.3491 0.2959 -0.0989 -0.0246 0.0468  1069 HOH B O   
1960 O  O   . HOH R .  ? 0.2136 0.1661 0.1188 -0.0126 0.0337  -0.0044 1070 HOH B O   
1961 O  O   . HOH R .  ? 0.2955 0.4318 0.5998 0.0089  -0.0422 -0.1352 1071 HOH B O   
1962 O  O   . HOH R .  ? 0.5990 0.7037 0.5292 0.0637  0.0566  -0.0403 1073 HOH B O   
1963 O  O   . HOH R .  ? 0.2482 0.1595 0.2543 0.0117  0.0595  0.0339  1078 HOH B O   
1964 O  O   . HOH R .  ? 0.2568 0.2229 0.2384 -0.0323 0.1202  0.0066  1080 HOH B O   
1965 O  O   . HOH R .  ? 0.1992 0.3012 0.1933 -0.0490 0.0026  -0.0197 1082 HOH B O   
1966 O  O   . HOH R .  ? 0.3471 0.2150 0.2676 -0.0132 0.0473  0.0769  1083 HOH B O   
1967 O  O   . HOH R .  ? 0.2912 0.2197 0.3713 0.0653  0.0567  0.1161  1084 HOH B O   
1968 O  O   . HOH R .  ? 0.3877 0.2019 0.4282 0.0952  -0.0629 0.0530  1085 HOH B O   
1969 O  O   . HOH R .  ? 0.1622 0.1277 0.0948 0.0365  0.0442  -0.0149 1086 HOH B O   
1970 O  O   . HOH R .  ? 0.3542 0.3499 0.2089 -0.1418 0.0776  -0.0447 1087 HOH B O   
1971 O  O   . HOH R .  ? 0.1364 0.1366 0.1515 0.0020  0.0321  -0.0275 1089 HOH B O   
1972 O  O   . HOH R .  ? 0.3179 0.3771 0.2773 -0.1783 -0.0667 0.0724  1096 HOH B O   
1973 O  O   . HOH R .  ? 0.3905 0.5284 0.3709 -0.1300 0.1437  0.1071  1098 HOH B O   
1974 O  O   . HOH R .  ? 0.4643 0.3194 0.4932 -0.0346 -0.0392 0.0300  1099 HOH B O   
1975 O  O   . HOH R .  ? 0.2495 0.4904 0.6506 -0.2019 -0.0887 0.0968  1101 HOH B O   
1976 O  O   . HOH R .  ? 0.2398 0.2979 0.3351 0.0282  0.0026  0.1153  1102 HOH B O   
1977 O  O   . HOH R .  ? 0.2529 0.3421 0.2598 0.0717  -0.0748 -0.0978 1103 HOH B O   
1978 O  O   . HOH R .  ? 0.1868 0.1748 0.1885 -0.0139 -0.0437 -0.0025 1107 HOH B O   
1979 O  O   . HOH R .  ? 0.1206 0.3317 0.1127 0.0035  0.0211  0.0152  1109 HOH B O   
1980 O  O   . HOH R .  ? 0.5035 0.3232 0.5789 -0.0412 0.2032  -0.0809 1114 HOH B O   
1981 O  O   . HOH R .  ? 0.5598 0.3860 0.3503 -0.0018 -0.0493 -0.1676 1118 HOH B O   
1982 O  O   . HOH R .  ? 0.3187 0.3015 0.2720 -0.1378 -0.0505 0.0422  1121 HOH B O   
1983 O  O   . HOH R .  ? 0.3436 0.1995 0.3088 0.0306  -0.1753 -0.0332 1123 HOH B O   
1984 O  O   . HOH R .  ? 0.3987 0.2717 0.1927 0.0109  -0.1014 -0.0025 1127 HOH B O   
1985 O  O   . HOH R .  ? 0.2530 0.3397 0.3197 -0.0390 -0.0969 -0.0549 1129 HOH B O   
1986 O  O   . HOH R .  ? 0.5349 0.4549 0.4220 -0.0229 -0.1833 -0.0518 1133 HOH B O   
1987 O  O   . HOH R .  ? 0.2638 0.4219 0.2765 -0.1747 -0.0788 0.0116  1135 HOH B O   
1988 O  O   . HOH R .  ? 0.4062 0.3053 0.2204 0.1353  0.0439  -0.1136 1138 HOH B O   
1989 O  O   . HOH R .  ? 0.3016 0.3159 0.3859 -0.0421 -0.0768 0.0208  1140 HOH B O   
1990 O  O   . HOH R .  ? 0.0999 0.0972 0.0804 0.0080  -0.0093 0.0142  1142 HOH B O   
1991 O  O   . HOH R .  ? 0.1633 0.4516 0.4063 -0.0816 0.1283  -0.0894 1144 HOH B O   
1992 O  O   . HOH R .  ? 0.4058 0.1565 0.3946 -0.0450 0.2039  -0.0080 1145 HOH B O   
1993 O  O   . HOH R .  ? 0.3508 0.4307 0.3529 -0.0053 0.0158  0.1399  1146 HOH B O   
1994 O  O   . HOH R .  ? 0.7433 0.2731 0.2940 0.0223  0.1286  -0.1227 1147 HOH B O   
1995 O  O   . HOH R .  ? 0.1266 0.2165 0.2983 -0.0009 -0.1038 -0.0806 1148 HOH B O   
1996 O  O   . HOH R .  ? 0.4373 0.4228 0.6557 0.1871  -0.0496 -0.0149 1149 HOH B O   
1997 O  O   . HOH R .  ? 0.4912 0.2844 0.1907 -0.0285 -0.1113 -0.0079 1151 HOH B O   
1998 O  O   . HOH R .  ? 0.6783 0.3810 0.5610 -0.1034 -0.0216 0.1238  1152 HOH B O   
1999 O  O   . HOH R .  ? 0.5705 0.4446 0.5847 -0.0401 0.0356  -0.0567 1153 HOH B O   
2000 O  O   . HOH R .  ? 0.2392 0.1716 0.2795 -0.0120 -0.0400 -0.0509 1154 HOH B O   
2001 O  O   . HOH R .  ? 0.3635 0.5831 0.3332 0.0039  -0.1753 0.0009  1156 HOH B O   
2002 O  O   . HOH R .  ? 0.5317 0.4179 0.3542 0.0859  -0.0057 0.1971  1157 HOH B O   
2003 O  O   . HOH R .  ? 0.4779 0.1174 0.2972 -0.1553 0.1251  -0.0459 1159 HOH B O   
2004 O  O   . HOH R .  ? 0.3178 0.3138 0.2337 0.1601  0.0900  -0.0104 1161 HOH B O   
2005 O  O   . HOH R .  ? 0.5031 0.4895 0.5223 0.1158  0.0927  0.1268  1168 HOH B O   
2006 O  O   . HOH R .  ? 0.4106 0.2343 0.4513 -0.1689 -0.0864 0.1629  1169 HOH B O   
2007 O  O   . HOH R .  ? 0.2057 0.4336 0.3252 0.0731  0.0440  0.0021  1170 HOH B O   
2008 O  O   . HOH R .  ? 0.4115 0.3415 0.3636 -0.1862 0.1305  0.0389  1173 HOH B O   
2009 O  O   . HOH R .  ? 0.1628 0.1419 0.1010 0.0193  -0.0018 -0.0031 1174 HOH B O   
2010 O  O   . HOH R .  ? 0.2655 0.2680 0.5522 -0.0044 -0.1112 -0.0684 1176 HOH B O   
2011 O  O   . HOH R .  ? 0.2996 0.2485 0.1702 -0.0696 -0.0031 -0.0205 1180 HOH B O   
2012 O  O   . HOH R .  ? 0.3264 0.1400 0.3122 0.0297  -0.0291 -0.0405 1183 HOH B O   
2013 O  O   . HOH R .  ? 0.4481 0.3348 0.2694 -0.0009 0.0209  -0.1734 1185 HOH B O   
2014 O  O   . HOH R .  ? 0.2332 0.1282 0.2776 -0.0065 0.0590  0.0049  1189 HOH B O   
2015 O  O   . HOH R .  ? 0.2168 0.2496 0.3782 0.0419  0.0432  0.0061  1190 HOH B O   
2016 O  O   . HOH R .  ? 0.2414 0.0619 0.2023 -0.0333 -0.0276 -0.0400 1191 HOH B O   
2017 O  O   . HOH R .  ? 0.2032 0.2221 0.2246 0.0316  -0.0590 -0.0379 1192 HOH B O   
2018 O  O   . HOH R .  ? 0.2020 0.1900 0.3072 0.0403  -0.0011 -0.0885 1193 HOH B O   
2019 O  O   . HOH R .  ? 0.1607 0.1759 0.0527 -0.0090 -0.0400 0.0418  1194 HOH B O   
2020 O  O   . HOH R .  ? 0.2904 0.3058 0.3775 -0.0488 -0.0439 0.0564  1198 HOH B O   
2021 O  O   . HOH R .  ? 0.1644 0.2414 0.1549 -0.0513 0.0504  -0.0708 1199 HOH B O   
2022 O  O   . HOH R .  ? 0.3658 0.2014 0.3246 0.0262  0.2022  -0.0758 1200 HOH B O   
2023 O  O   . HOH R .  ? 0.1966 0.2218 0.4798 0.1143  0.0984  0.0959  1203 HOH B O   
2024 O  O   . HOH R .  ? 0.3707 0.2680 0.2561 0.0255  -0.0779 -0.1906 1204 HOH B O   
2025 O  O   . HOH R .  ? 0.2288 0.2039 0.3269 0.0229  0.0533  0.0476  1205 HOH B O   
2026 O  O   . HOH R .  ? 0.4553 0.2960 0.3575 0.1075  0.0189  0.0091  1209 HOH B O   
2027 O  O   . HOH R .  ? 0.2547 0.3490 0.2769 -0.0694 0.0091  -0.0461 1210 HOH B O   
2028 O  O   . HOH R .  ? 0.4555 0.5516 0.4960 0.1030  -0.2130 0.0835  1212 HOH B O   
2029 O  O   . HOH R .  ? 0.1866 0.1894 0.1003 0.0443  -0.0610 0.0031  1214 HOH B O   
2030 O  O   . HOH R .  ? 0.3115 0.5206 0.1628 -0.0968 -0.0358 -0.0772 1215 HOH B O   
2031 O  O   . HOH R .  ? 0.4068 0.4163 0.3160 -0.0091 -0.0086 -0.1143 1217 HOH B O   
2032 O  O   . HOH R .  ? 0.0847 0.2153 0.1484 -0.0609 -0.0019 0.0871  1225 HOH B O   
2033 O  O   . HOH R .  ? 0.5380 0.4866 0.5074 -0.0084 0.0388  -0.1073 1228 HOH B O   
2034 O  O   . HOH R .  ? 0.2566 0.2670 0.3415 -0.0027 0.1109  0.0093  1230 HOH B O   
2035 O  O   . HOH R .  ? 0.2799 0.2849 0.1803 -0.0004 -0.0868 -0.0704 1246 HOH B O   
2036 O  O   . HOH R .  ? 0.1947 0.4446 0.3198 -0.0525 0.0423  -0.1315 1249 HOH B O   
2037 O  O   . HOH R .  ? 0.4157 0.3505 0.4720 -0.0745 0.0512  0.0725  1250 HOH B O   
2038 O  O   . HOH R .  ? 0.3423 0.3372 0.5171 0.0547  -0.0344 0.1214  1255 HOH B O   
2039 O  O   . HOH R .  ? 0.2530 0.2500 0.2341 0.0932  0.1630  0.0022  1257 HOH B O   
2040 O  O   . HOH R .  ? 0.1847 0.1104 0.1987 -0.0359 0.0122  0.0024  1258 HOH B O   
2041 O  O   . HOH R .  ? 0.2181 0.1444 0.4507 0.0635  0.0694  -0.0255 1259 HOH B O   
2042 O  O   . HOH R .  ? 0.4335 0.3725 0.4531 0.0772  0.0443  -0.1800 1261 HOH B O   
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  PRO 1  1   1   PRO PRO A . n 
A 1 2  GLN 2  2   2   GLN GLN A . n 
A 1 3  ILE 3  3   3   ILE ILE A . n 
A 1 4  THR 4  4   4   THR THR A . n 
A 1 5  LEU 5  5   5   LEU LEU A . n 
A 1 6  TRP 6  6   6   TRP TRP A . n 
A 1 7  LYS 7  7   7   LYS LYS A . n 
A 1 8  ARG 8  8   8   ARG ARG A . n 
A 1 9  PRO 9  9   9   PRO PRO A . n 
A 1 10 LEU 10 10  10  LEU LEU A . n 
A 1 11 VAL 11 11  11  VAL VAL A . n 
A 1 12 THR 12 12  12  THR THR A . n 
A 1 13 ILE 13 13  13  ILE ILE A . n 
A 1 14 LYS 14 14  14  LYS LYS A . n 
A 1 15 ILE 15 15  15  ILE ILE A . n 
A 1 16 GLY 16 16  16  GLY GLY A . n 
A 1 17 GLY 17 17  17  GLY GLY A . n 
A 1 18 GLN 18 18  18  GLN GLN A . n 
A 1 19 LEU 19 19  19  LEU LEU A . n 
A 1 20 LYS 20 20  20  LYS LYS A . n 
A 1 21 GLU 21 21  21  GLU GLU A . n 
A 1 22 ALA 22 22  22  ALA ALA A . n 
A 1 23 LEU 23 23  23  LEU LEU A . n 
A 1 24 LEU 24 24  24  LEU LEU A . n 
A 1 25 ASP 25 25  25  ASP ASP A . n 
A 1 26 THR 26 26  26  THR THR A . n 
A 1 27 GLY 27 27  27  GLY GLY A . n 
A 1 28 ALA 28 28  28  ALA ALA A . n 
A 1 29 ASP 29 29  29  ASP ASP A . n 
A 1 30 ASP 30 30  30  ASP ASP A . n 
A 1 31 THR 31 31  31  THR THR A . n 
A 1 32 VAL 32 32  32  VAL VAL A . n 
A 1 33 ILE 33 33  33  ILE ILE A . n 
A 1 34 GLU 34 34  34  GLU GLU A . n 
A 1 35 GLU 35 35  35  GLU GLU A . n 
A 1 36 MET 36 36  36  MET MET A . n 
A 1 37 SER 37 37  37  SER SER A . n 
A 1 38 LEU 38 38  38  LEU LEU A . n 
A 1 39 PRO 39 39  39  PRO PRO A . n 
A 1 40 GLY 40 40  40  GLY GLY A . n 
A 1 41 ARG 41 41  41  ARG ARG A . n 
A 1 42 TRP 42 42  42  TRP TRP A . n 
A 1 43 LYS 43 43  43  LYS LYS A . n 
A 1 44 PRO 44 44  44  PRO PRO A . n 
A 1 45 LYS 45 45  45  LYS LYS A . n 
A 1 46 MET 46 46  46  MET MET A . n 
A 1 47 ILE 47 47  47  ILE ILE A . n 
A 1 48 GLY 48 48  48  GLY GLY A . n 
A 1 49 GLY 49 49  49  GLY GLY A . n 
A 1 50 ILE 50 50  50  ILE ILE A . n 
A 1 51 GLY 51 51  51  GLY GLY A . n 
A 1 52 GLY 52 52  52  GLY GLY A . n 
A 1 53 PHE 53 53  53  PHE PHE A . n 
A 1 54 ILE 54 54  54  ILE ILE A . n 
A 1 55 LYS 55 55  55  LYS LYS A . n 
A 1 56 VAL 56 56  56  VAL VAL A . n 
A 1 57 ARG 57 57  57  ARG ARG A . n 
A 1 58 GLN 58 58  58  GLN GLN A . n 
A 1 59 TYR 59 59  59  TYR TYR A . n 
A 1 60 ASP 60 60  60  ASP ASP A . n 
A 1 61 GLN 61 61  61  GLN GLN A . n 
A 1 62 ILE 62 62  62  ILE ILE A . n 
A 1 63 ILE 63 63  63  ILE ILE A . n 
A 1 64 ILE 64 64  64  ILE ILE A . n 
A 1 65 GLU 65 65  65  GLU GLU A . n 
A 1 66 ILE 66 66  66  ILE ILE A . n 
A 1 67 ALA 67 67  67  ALA ALA A . n 
A 1 68 GLY 68 68  68  GLY GLY A . n 
A 1 69 HIS 69 69  69  HIS HIS A . n 
A 1 70 LYS 70 70  70  LYS LYS A . n 
A 1 71 ALA 71 71  71  ALA ALA A . n 
A 1 72 ILE 72 72  72  ILE ILE A . n 
A 1 73 GLY 73 73  73  GLY GLY A . n 
A 1 74 THR 74 74  74  THR THR A . n 
A 1 75 VAL 75 75  75  VAL VAL A . n 
A 1 76 LEU 76 76  76  LEU LEU A . n 
A 1 77 VAL 77 77  77  VAL VAL A . n 
A 1 78 GLY 78 78  78  GLY GLY A . n 
A 1 79 PRO 79 79  79  PRO PRO A . n 
A 1 80 THR 80 80  80  THR THR A . n 
A 1 81 PRO 81 81  81  PRO PRO A . n 
A 1 82 ALA 82 82  82  ALA ALA A . n 
A 1 83 ASN 83 83  83  ASN ASN A . n 
A 1 84 ILE 84 84  84  ILE ILE A . n 
A 1 85 ILE 85 85  85  ILE ILE A . n 
A 1 86 GLY 86 86  86  GLY GLY A . n 
A 1 87 ARG 87 87  87  ARG ARG A . n 
A 1 88 ASN 88 88  88  ASN ASN A . n 
A 1 89 LEU 89 89  89  LEU LEU A . n 
A 1 90 LEU 90 90  90  LEU LEU A . n 
A 1 91 THR 91 91  91  THR THR A . n 
A 1 92 GLN 92 92  92  GLN GLN A . n 
A 1 93 ILE 93 93  93  ILE ILE A . n 
A 1 94 GLY 94 94  94  GLY GLY A . n 
A 1 95 ALA 95 95  95  ALA ALA A . n 
A 1 96 THR 96 96  96  THR THR A . n 
A 1 97 LEU 97 97  97  LEU LEU A . n 
A 1 98 ASN 98 98  98  ASN ASN A . n 
A 1 99 PHE 99 99  99  PHE PHE A . n 
B 1 1  PRO 1  101 101 PRO PRO B . n 
B 1 2  GLN 2  102 102 GLN GLN B . n 
B 1 3  ILE 3  103 103 ILE ILE B . n 
B 1 4  THR 4  104 104 THR THR B . n 
B 1 5  LEU 5  105 105 LEU LEU B . n 
B 1 6  TRP 6  106 106 TRP TRP B . n 
B 1 7  LYS 7  107 107 LYS LYS B . n 
B 1 8  ARG 8  108 108 ARG ARG B . n 
B 1 9  PRO 9  109 109 PRO PRO B . n 
B 1 10 LEU 10 110 110 LEU LEU B . n 
B 1 11 VAL 11 111 111 VAL VAL B . n 
B 1 12 THR 12 112 112 THR THR B . n 
B 1 13 ILE 13 113 113 ILE ILE B . n 
B 1 14 LYS 14 114 114 LYS LYS B . n 
B 1 15 ILE 15 115 115 ILE ILE B . n 
B 1 16 GLY 16 116 116 GLY GLY B . n 
B 1 17 GLY 17 117 117 GLY GLY B . n 
B 1 18 GLN 18 118 118 GLN GLN B . n 
B 1 19 LEU 19 119 119 LEU LEU B . n 
B 1 20 LYS 20 120 120 LYS LYS B . n 
B 1 21 GLU 21 121 121 GLU GLU B . n 
B 1 22 ALA 22 122 122 ALA ALA B . n 
B 1 23 LEU 23 123 123 LEU LEU B . n 
B 1 24 LEU 24 124 124 LEU LEU B . n 
B 1 25 ASP 25 125 125 ASP ASP B . n 
B 1 26 THR 26 126 126 THR THR B . n 
B 1 27 GLY 27 127 127 GLY GLY B . n 
B 1 28 ALA 28 128 128 ALA ALA B . n 
B 1 29 ASP 29 129 129 ASP ASP B . n 
B 1 30 ASP 30 130 130 ASP ASP B . n 
B 1 31 THR 31 131 131 THR THR B . n 
B 1 32 VAL 32 132 132 VAL VAL B . n 
B 1 33 ILE 33 133 133 ILE ILE B . n 
B 1 34 GLU 34 134 134 GLU GLU B . n 
B 1 35 GLU 35 135 135 GLU GLU B . n 
B 1 36 MET 36 136 136 MET MET B . n 
B 1 37 SER 37 137 137 SER SER B . n 
B 1 38 LEU 38 138 138 LEU LEU B . n 
B 1 39 PRO 39 139 139 PRO PRO B . n 
B 1 40 GLY 40 140 140 GLY GLY B . n 
B 1 41 ARG 41 141 141 ARG ARG B . n 
B 1 42 TRP 42 142 142 TRP TRP B . n 
B 1 43 LYS 43 143 143 LYS LYS B . n 
B 1 44 PRO 44 144 144 PRO PRO B . n 
B 1 45 LYS 45 145 145 LYS LYS B . n 
B 1 46 MET 46 146 146 MET MET B . n 
B 1 47 ILE 47 147 147 ILE ILE B . n 
B 1 48 GLY 48 148 148 GLY GLY B . n 
B 1 49 GLY 49 149 149 GLY GLY B . n 
B 1 50 ILE 50 150 150 ILE ILE B . n 
B 1 51 GLY 51 151 151 GLY GLY B . n 
B 1 52 GLY 52 152 152 GLY GLY B . n 
B 1 53 PHE 53 153 153 PHE PHE B . n 
B 1 54 ILE 54 154 154 ILE ILE B . n 
B 1 55 LYS 55 155 155 LYS LYS B . n 
B 1 56 VAL 56 156 156 VAL VAL B . n 
B 1 57 ARG 57 157 157 ARG ARG B . n 
B 1 58 GLN 58 158 158 GLN GLN B . n 
B 1 59 TYR 59 159 159 TYR TYR B . n 
B 1 60 ASP 60 160 160 ASP ASP B . n 
B 1 61 GLN 61 161 161 GLN GLN B . n 
B 1 62 ILE 62 162 162 ILE ILE B . n 
B 1 63 ILE 63 163 163 ILE ILE B . n 
B 1 64 ILE 64 164 164 ILE ILE B . n 
B 1 65 GLU 65 165 165 GLU GLU B . n 
B 1 66 ILE 66 166 166 ILE ILE B . n 
B 1 67 ALA 67 167 167 ALA ALA B . n 
B 1 68 GLY 68 168 168 GLY GLY B . n 
B 1 69 HIS 69 169 169 HIS HIS B . n 
B 1 70 LYS 70 170 170 LYS LYS B . n 
B 1 71 ALA 71 171 171 ALA ALA B . n 
B 1 72 ILE 72 172 172 ILE ILE B . n 
B 1 73 GLY 73 173 173 GLY GLY B . n 
B 1 74 THR 74 174 174 THR THR B . n 
B 1 75 VAL 75 175 175 VAL VAL B . n 
B 1 76 LEU 76 176 176 LEU LEU B . n 
B 1 77 VAL 77 177 177 VAL VAL B . n 
B 1 78 GLY 78 178 178 GLY GLY B . n 
B 1 79 PRO 79 179 179 PRO PRO B . n 
B 1 80 THR 80 180 180 THR THR B . n 
B 1 81 PRO 81 181 181 PRO PRO B . n 
B 1 82 ALA 82 182 182 ALA ALA B . n 
B 1 83 ASN 83 183 183 ASN ASN B . n 
B 1 84 ILE 84 184 184 ILE ILE B . n 
B 1 85 ILE 85 185 185 ILE ILE B . n 
B 1 86 GLY 86 186 186 GLY GLY B . n 
B 1 87 ARG 87 187 187 ARG ARG B . n 
B 1 88 ASN 88 188 188 ASN ASN B . n 
B 1 89 LEU 89 189 189 LEU LEU B . n 
B 1 90 LEU 90 190 190 LEU LEU B . n 
B 1 91 THR 91 191 191 THR THR B . n 
B 1 92 GLN 92 192 192 GLN GLN B . n 
B 1 93 ILE 93 193 193 ILE ILE B . n 
B 1 94 GLY 94 194 194 GLY GLY B . n 
B 1 95 ALA 95 195 195 ALA ALA B . n 
B 1 96 THR 96 196 196 THR THR B . n 
B 1 97 LEU 97 197 197 LEU LEU B . n 
B 1 98 ASN 98 198 198 ASN ASN B . n 
B 1 99 PHE 99 199 199 PHE PHE B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 CL  1   501  501  CL  NCL A . 
D 3 PO4 1   701  701  PO4 PO4 A . 
E 3 PO4 1   702  702  PO4 PO4 A . 
F 3 PO4 1   704  704  PO4 PO4 A . 
G 4 DMS 1   901  901  DMS DMS A . 
H 5 ACY 1   601  601  ACY ACY A . 
I 5 ACY 1   605  605  ACY ACY A . 
J 6 GOL 1   801  801  GOL GOL A . 
K 3 PO4 1   703  703  PO4 PO4 B . 
L 7 017 1   401  401  017 017 B . 
M 5 ACY 1   602  602  ACY ACY B . 
N 5 ACY 1   603  603  ACY ACY B . 
O 5 ACY 1   604  604  ACY ACY B . 
P 5 ACY 1   606  606  ACY ACY B . 
Q 8 HOH 1   1003 1003 HOH HOH A . 
Q 8 HOH 2   1004 1004 HOH HOH A . 
Q 8 HOH 3   1011 1011 HOH HOH A . 
Q 8 HOH 4   1012 1012 HOH HOH A . 
Q 8 HOH 5   1013 1013 HOH HOH A . 
Q 8 HOH 6   1014 1014 HOH HOH A . 
Q 8 HOH 7   1016 1016 HOH HOH A . 
Q 8 HOH 8   1018 1018 HOH HOH A . 
Q 8 HOH 9   1020 1020 HOH HOH A . 
Q 8 HOH 10  1022 1022 HOH HOH A . 
Q 8 HOH 11  1023 1023 HOH HOH A . 
Q 8 HOH 12  1024 1024 HOH HOH A . 
Q 8 HOH 13  1027 1027 HOH HOH A . 
Q 8 HOH 14  1029 1029 HOH HOH A . 
Q 8 HOH 15  1031 1031 HOH HOH A . 
Q 8 HOH 16  1032 1032 HOH HOH A . 
Q 8 HOH 17  1033 1033 HOH HOH A . 
Q 8 HOH 18  1034 1034 HOH HOH A . 
Q 8 HOH 19  1038 1038 HOH HOH A . 
Q 8 HOH 20  1039 1039 HOH HOH A . 
Q 8 HOH 21  1040 1040 HOH HOH A . 
Q 8 HOH 22  1041 1041 HOH HOH A . 
Q 8 HOH 23  1043 1043 HOH HOH A . 
Q 8 HOH 24  1044 1044 HOH HOH A . 
Q 8 HOH 25  1054 1054 HOH HOH A . 
Q 8 HOH 26  1057 1057 HOH HOH A . 
Q 8 HOH 27  1058 1058 HOH HOH A . 
Q 8 HOH 28  1062 1062 HOH HOH A . 
Q 8 HOH 29  1063 1063 HOH HOH A . 
Q 8 HOH 30  1065 1065 HOH HOH A . 
Q 8 HOH 31  1066 1066 HOH HOH A . 
Q 8 HOH 32  1068 1068 HOH HOH A . 
Q 8 HOH 33  1072 1072 HOH HOH A . 
Q 8 HOH 34  1074 1074 HOH HOH A . 
Q 8 HOH 35  1075 1075 HOH HOH A . 
Q 8 HOH 36  1076 1076 HOH HOH A . 
Q 8 HOH 37  1077 1077 HOH HOH A . 
Q 8 HOH 38  1079 1079 HOH HOH A . 
Q 8 HOH 39  1081 1081 HOH HOH A . 
Q 8 HOH 40  1088 1088 HOH HOH A . 
Q 8 HOH 41  1090 1090 HOH HOH A . 
Q 8 HOH 42  1091 1091 HOH HOH A . 
Q 8 HOH 43  1092 1092 HOH HOH A . 
Q 8 HOH 44  1093 1093 HOH HOH A . 
Q 8 HOH 45  1094 1094 HOH HOH A . 
Q 8 HOH 46  1095 1095 HOH HOH A . 
Q 8 HOH 47  1097 1097 HOH HOH A . 
Q 8 HOH 48  1100 1100 HOH HOH A . 
Q 8 HOH 49  1104 1104 HOH HOH A . 
Q 8 HOH 50  1105 1105 HOH HOH A . 
Q 8 HOH 51  1106 1106 HOH HOH A . 
Q 8 HOH 52  1110 1110 HOH HOH A . 
Q 8 HOH 53  1111 1111 HOH HOH A . 
Q 8 HOH 54  1112 1112 HOH HOH A . 
Q 8 HOH 55  1113 1113 HOH HOH A . 
Q 8 HOH 56  1115 1115 HOH HOH A . 
Q 8 HOH 57  1116 1116 HOH HOH A . 
Q 8 HOH 58  1117 1117 HOH HOH A . 
Q 8 HOH 59  1119 1119 HOH HOH A . 
Q 8 HOH 60  1120 1120 HOH HOH A . 
Q 8 HOH 61  1122 1122 HOH HOH A . 
Q 8 HOH 62  1124 1124 HOH HOH A . 
Q 8 HOH 63  1125 1125 HOH HOH A . 
Q 8 HOH 64  1126 1126 HOH HOH A . 
Q 8 HOH 65  1130 1130 HOH HOH A . 
Q 8 HOH 66  1131 1131 HOH HOH A . 
Q 8 HOH 67  1132 1132 HOH HOH A . 
Q 8 HOH 68  1134 1134 HOH HOH A . 
Q 8 HOH 69  1136 1136 HOH HOH A . 
Q 8 HOH 70  1137 1137 HOH HOH A . 
Q 8 HOH 71  1141 1141 HOH HOH A . 
Q 8 HOH 72  1143 1143 HOH HOH A . 
Q 8 HOH 73  1150 1150 HOH HOH A . 
Q 8 HOH 74  1158 1158 HOH HOH A . 
Q 8 HOH 75  1160 1160 HOH HOH A . 
Q 8 HOH 76  1162 1162 HOH HOH A . 
Q 8 HOH 77  1163 1163 HOH HOH A . 
Q 8 HOH 78  1164 1164 HOH HOH A . 
Q 8 HOH 79  1165 1165 HOH HOH A . 
Q 8 HOH 80  1166 1166 HOH HOH A . 
Q 8 HOH 81  1171 1171 HOH HOH A . 
Q 8 HOH 82  1172 1172 HOH HOH A . 
Q 8 HOH 83  1175 1175 HOH HOH A . 
Q 8 HOH 84  1178 1178 HOH HOH A . 
Q 8 HOH 85  1179 1179 HOH HOH A . 
Q 8 HOH 86  1181 1181 HOH HOH A . 
Q 8 HOH 87  1182 1182 HOH HOH A . 
Q 8 HOH 88  1184 1184 HOH HOH A . 
Q 8 HOH 89  1186 1186 HOH HOH A . 
Q 8 HOH 90  1187 1187 HOH HOH A . 
Q 8 HOH 91  1195 1195 HOH HOH A . 
Q 8 HOH 92  1196 1196 HOH HOH A . 
Q 8 HOH 93  1197 1197 HOH HOH A . 
Q 8 HOH 94  1201 1201 HOH HOH A . 
Q 8 HOH 95  1202 1202 HOH HOH A . 
Q 8 HOH 96  1206 1206 HOH HOH A . 
Q 8 HOH 97  1207 1207 HOH HOH A . 
Q 8 HOH 98  1208 1208 HOH HOH A . 
Q 8 HOH 99  1211 1211 HOH HOH A . 
Q 8 HOH 100 1213 1213 HOH HOH A . 
Q 8 HOH 101 1216 1216 HOH HOH A . 
Q 8 HOH 102 1219 1219 HOH HOH A . 
Q 8 HOH 103 1220 1220 HOH HOH A . 
Q 8 HOH 104 1221 1221 HOH HOH A . 
Q 8 HOH 105 1222 1222 HOH HOH A . 
Q 8 HOH 106 1223 1223 HOH HOH A . 
Q 8 HOH 107 1224 1224 HOH HOH A . 
Q 8 HOH 108 1226 1226 HOH HOH A . 
Q 8 HOH 109 1227 1227 HOH HOH A . 
Q 8 HOH 110 1229 1229 HOH HOH A . 
Q 8 HOH 111 1231 1231 HOH HOH A . 
Q 8 HOH 112 1232 1232 HOH HOH A . 
Q 8 HOH 113 1233 1233 HOH HOH A . 
Q 8 HOH 114 1234 1234 HOH HOH A . 
Q 8 HOH 115 1235 1235 HOH HOH A . 
Q 8 HOH 116 1237 1237 HOH HOH A . 
Q 8 HOH 117 1238 1238 HOH HOH A . 
Q 8 HOH 118 1241 1241 HOH HOH A . 
Q 8 HOH 119 1242 1242 HOH HOH A . 
Q 8 HOH 120 1244 1244 HOH HOH A . 
Q 8 HOH 121 1245 1245 HOH HOH A . 
Q 8 HOH 122 1247 1247 HOH HOH A . 
Q 8 HOH 123 1248 1248 HOH HOH A . 
Q 8 HOH 124 1260 1260 HOH HOH A . 
Q 8 HOH 125 1262 1262 HOH HOH A . 
Q 8 HOH 126 1263 1263 HOH HOH A . 
Q 8 HOH 127 1264 1264 HOH HOH A . 
Q 8 HOH 128 1266 1266 HOH HOH A . 
Q 8 HOH 129 1267 1267 HOH HOH A . 
Q 8 HOH 130 1268 1268 HOH HOH A . 
Q 8 HOH 131 1269 1269 HOH HOH A . 
Q 8 HOH 132 1270 1270 HOH HOH A . 
Q 8 HOH 133 1271 1271 HOH HOH A . 
Q 8 HOH 134 1272 1272 HOH HOH A . 
Q 8 HOH 135 1273 1273 HOH HOH A . 
Q 8 HOH 136 1274 1274 HOH HOH A . 
Q 8 HOH 137 1275 1275 HOH HOH A . 
R 8 HOH 1   1001 1001 HOH HOH B . 
R 8 HOH 2   1002 1002 HOH HOH B . 
R 8 HOH 3   1005 1005 HOH HOH B . 
R 8 HOH 4   1006 1006 HOH HOH B . 
R 8 HOH 5   1007 1007 HOH HOH B . 
R 8 HOH 6   1008 1008 HOH HOH B . 
R 8 HOH 7   1009 1009 HOH HOH B . 
R 8 HOH 8   1010 1010 HOH HOH B . 
R 8 HOH 9   1015 1015 HOH HOH B . 
R 8 HOH 10  1017 1017 HOH HOH B . 
R 8 HOH 11  1019 1019 HOH HOH B . 
R 8 HOH 12  1021 1021 HOH HOH B . 
R 8 HOH 13  1025 1025 HOH HOH B . 
R 8 HOH 14  1026 1026 HOH HOH B . 
R 8 HOH 15  1028 1028 HOH HOH B . 
R 8 HOH 16  1030 1030 HOH HOH B . 
R 8 HOH 17  1035 1035 HOH HOH B . 
R 8 HOH 18  1036 1036 HOH HOH B . 
R 8 HOH 19  1037 1037 HOH HOH B . 
R 8 HOH 20  1042 1042 HOH HOH B . 
R 8 HOH 21  1045 1045 HOH HOH B . 
R 8 HOH 22  1046 1046 HOH HOH B . 
R 8 HOH 23  1047 1047 HOH HOH B . 
R 8 HOH 24  1048 1048 HOH HOH B . 
R 8 HOH 25  1049 1049 HOH HOH B . 
R 8 HOH 26  1050 1050 HOH HOH B . 
R 8 HOH 27  1051 1051 HOH HOH B . 
R 8 HOH 28  1052 1052 HOH HOH B . 
R 8 HOH 29  1053 1053 HOH HOH B . 
R 8 HOH 30  1055 1055 HOH HOH B . 
R 8 HOH 31  1056 1056 HOH HOH B . 
R 8 HOH 32  1059 1059 HOH HOH B . 
R 8 HOH 33  1060 1060 HOH HOH B . 
R 8 HOH 34  1061 1061 HOH HOH B . 
R 8 HOH 35  1064 1064 HOH HOH B . 
R 8 HOH 36  1067 1067 HOH HOH B . 
R 8 HOH 37  1069 1069 HOH HOH B . 
R 8 HOH 38  1070 1070 HOH HOH B . 
R 8 HOH 39  1071 1071 HOH HOH B . 
R 8 HOH 40  1073 1073 HOH HOH B . 
R 8 HOH 41  1078 1078 HOH HOH B . 
R 8 HOH 42  1080 1080 HOH HOH B . 
R 8 HOH 43  1082 1082 HOH HOH B . 
R 8 HOH 44  1083 1083 HOH HOH B . 
R 8 HOH 45  1084 1084 HOH HOH B . 
R 8 HOH 46  1085 1085 HOH HOH B . 
R 8 HOH 47  1086 1086 HOH HOH B . 
R 8 HOH 48  1087 1087 HOH HOH B . 
R 8 HOH 49  1089 1089 HOH HOH B . 
R 8 HOH 50  1096 1096 HOH HOH B . 
R 8 HOH 51  1098 1098 HOH HOH B . 
R 8 HOH 52  1099 1099 HOH HOH B . 
R 8 HOH 53  1101 1101 HOH HOH B . 
R 8 HOH 54  1102 1102 HOH HOH B . 
R 8 HOH 55  1103 1103 HOH HOH B . 
R 8 HOH 56  1107 1107 HOH HOH B . 
R 8 HOH 57  1109 1109 HOH HOH B . 
R 8 HOH 58  1114 1114 HOH HOH B . 
R 8 HOH 59  1118 1118 HOH HOH B . 
R 8 HOH 60  1121 1121 HOH HOH B . 
R 8 HOH 61  1123 1123 HOH HOH B . 
R 8 HOH 62  1127 1127 HOH HOH B . 
R 8 HOH 63  1129 1129 HOH HOH B . 
R 8 HOH 64  1133 1133 HOH HOH B . 
R 8 HOH 65  1135 1135 HOH HOH B . 
R 8 HOH 66  1138 1138 HOH HOH B . 
R 8 HOH 67  1140 1140 HOH HOH B . 
R 8 HOH 68  1142 1142 HOH HOH B . 
R 8 HOH 69  1144 1144 HOH HOH B . 
R 8 HOH 70  1145 1145 HOH HOH B . 
R 8 HOH 71  1146 1146 HOH HOH B . 
R 8 HOH 72  1147 1147 HOH HOH B . 
R 8 HOH 73  1148 1148 HOH HOH B . 
R 8 HOH 74  1149 1149 HOH HOH B . 
R 8 HOH 75  1151 1151 HOH HOH B . 
R 8 HOH 76  1152 1152 HOH HOH B . 
R 8 HOH 77  1153 1153 HOH HOH B . 
R 8 HOH 78  1154 1154 HOH HOH B . 
R 8 HOH 79  1156 1156 HOH HOH B . 
R 8 HOH 80  1157 1157 HOH HOH B . 
R 8 HOH 81  1159 1159 HOH HOH B . 
R 8 HOH 82  1161 1161 HOH HOH B . 
R 8 HOH 83  1168 1168 HOH HOH B . 
R 8 HOH 84  1169 1169 HOH HOH B . 
R 8 HOH 85  1170 1170 HOH HOH B . 
R 8 HOH 86  1173 1173 HOH HOH B . 
R 8 HOH 87  1174 1174 HOH HOH B . 
R 8 HOH 88  1176 1176 HOH HOH B . 
R 8 HOH 89  1180 1180 HOH HOH B . 
R 8 HOH 90  1183 1183 HOH HOH B . 
R 8 HOH 91  1185 1185 HOH HOH B . 
R 8 HOH 92  1189 1189 HOH HOH B . 
R 8 HOH 93  1190 1190 HOH HOH B . 
R 8 HOH 94  1191 1191 HOH HOH B . 
R 8 HOH 95  1192 1192 HOH HOH B . 
R 8 HOH 96  1193 1193 HOH HOH B . 
R 8 HOH 97  1194 1194 HOH HOH B . 
R 8 HOH 98  1198 1198 HOH HOH B . 
R 8 HOH 99  1199 1199 HOH HOH B . 
R 8 HOH 100 1200 1200 HOH HOH B . 
R 8 HOH 101 1203 1203 HOH HOH B . 
R 8 HOH 102 1204 1204 HOH HOH B . 
R 8 HOH 103 1205 1205 HOH HOH B . 
R 8 HOH 104 1209 1209 HOH HOH B . 
R 8 HOH 105 1210 1210 HOH HOH B . 
R 8 HOH 106 1212 1212 HOH HOH B . 
R 8 HOH 107 1214 1214 HOH HOH B . 
R 8 HOH 108 1215 1215 HOH HOH B . 
R 8 HOH 109 1217 1217 HOH HOH B . 
R 8 HOH 110 1225 1225 HOH HOH B . 
R 8 HOH 111 1228 1228 HOH HOH B . 
R 8 HOH 112 1230 1230 HOH HOH B . 
R 8 HOH 113 1246 1246 HOH HOH B . 
R 8 HOH 114 1249 1249 HOH HOH B . 
R 8 HOH 115 1250 1250 HOH HOH B . 
R 8 HOH 116 1255 1255 HOH HOH B . 
R 8 HOH 117 1257 1257 HOH HOH B . 
R 8 HOH 118 1258 1258 HOH HOH B . 
R 8 HOH 119 1259 1259 HOH HOH B . 
R 8 HOH 120 1261 1261 HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P,Q,R 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 5970 ? 
1 MORE         -60  ? 
1 'SSA (A^2)'  9660 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2006-10-03 
2 'Structure model' 1 1 2008-05-01 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2017-10-18 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Non-polymer description'   
3 3 'Structure model' 'Version format compliance' 
4 4 'Structure model' 'Refinement description'    
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    4 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            software 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_software.classification' 
2 4 'Structure model' '_software.name'           
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
AMoRE     phasing           . ? 1 
SHELXL-97 refinement        . ? 2 
MAR345    'data collection' . ? 3 
HKL-2000  'data scaling'    . ? 4 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   CL 
_pdbx_validate_close_contact.auth_asym_id_1   A 
_pdbx_validate_close_contact.auth_comp_id_1   CL 
_pdbx_validate_close_contact.auth_seq_id_1    501 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   A 
_pdbx_validate_close_contact.auth_atom_id_2   O 
_pdbx_validate_close_contact.auth_asym_id_2   A 
_pdbx_validate_close_contact.auth_comp_id_2   HOH 
_pdbx_validate_close_contact.auth_seq_id_2    1163 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             1.64 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 O  A ILE 3   ? ? C  A ILE 3   ? ? N   A THR 4   ? B 132.66 122.70 9.96   1.60 Y 
2  1 CD A ARG 8   ? A NE A ARG 8   ? A CZ  A ARG 8   ? A 136.95 123.60 13.35  1.40 N 
3  1 NE A ARG 8   ? A CZ A ARG 8   ? A NH1 A ARG 8   ? A 126.39 120.30 6.09   0.50 N 
4  1 CB A ASP 30  ? A CG A ASP 30  ? A OD2 A ASP 30  ? A 124.14 118.30 5.84   0.90 N 
5  1 NE A ARG 41  ? A CZ A ARG 41  ? A NH2 A ARG 41  ? A 116.91 120.30 -3.39  0.50 N 
6  1 NE A ARG 57  ? ? CZ A ARG 57  ? ? NH2 A ARG 57  ? ? 115.55 120.30 -4.75  0.50 N 
7  1 CB A ASP 60  ? ? CG A ASP 60  ? ? OD1 A ASP 60  ? ? 112.30 118.30 -6.00  0.90 N 
8  1 CB A ASP 60  ? ? CG A ASP 60  ? ? OD2 A ASP 60  ? ? 123.79 118.30 5.49   0.90 N 
9  1 CD B ARG 108 ? B NE B ARG 108 ? B CZ  B ARG 108 ? B 132.71 123.60 9.11   1.40 N 
10 1 NE B ARG 108 ? B CZ B ARG 108 ? B NH1 B ARG 108 ? B 125.27 120.30 4.97   0.50 N 
11 1 NE B ARG 108 ? A CZ B ARG 108 ? A NH2 B ARG 108 ? A 117.22 120.30 -3.08  0.50 N 
12 1 CA B PRO 139 ? B C  B PRO 139 ? B N   B GLY 140 ? B 129.66 116.20 13.46  2.00 Y 
13 1 O  B PRO 139 ? B C  B PRO 139 ? B N   B GLY 140 ? B 107.15 123.20 -16.05 1.70 Y 
14 1 CD B ARG 141 ? B NE B ARG 141 ? B CZ  B ARG 141 ? B 134.09 123.60 10.49  1.40 N 
15 1 CA B LYS 143 ? ? CB B LYS 143 ? ? CG  B LYS 143 ? ? 126.82 113.40 13.42  2.20 N 
16 1 NE B ARG 187 ? ? CZ B ARG 187 ? ? NH1 B ARG 187 ? ? 123.80 120.30 3.50   0.50 N 
17 1 NE B ARG 187 ? ? CZ B ARG 187 ? ? NH2 B ARG 187 ? ? 116.68 120.30 -3.62  0.50 N 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'CHLORIDE ION' CL  
3 'PHOSPHATE ION' PO4 
4 'DIMETHYL SULFOXIDE' DMS 
5 'ACETIC ACID' ACY 
6 GLYCEROL GOL 
7 
'(3R,3AS,6AR)-HEXAHYDROFURO[2,3-B]FURAN-3-YL(1S,2R)-3-[[(4-AMINOPHENYL)SULFONYL](ISOBUTYL)AMINO]-1-BENZYL-2-HYDROXYPROPYLCARBAMATE' 
017 
8 water HOH 
#