data_2IHB
# 
_entry.id   2IHB 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2IHB         
RCSB  RCSB039570   
WWPDB D_1000039570 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2IHB 
_pdbx_database_status.recvd_initial_deposition_date   2006-09-26 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Soundararajan, M.'                    1  
'Turnbull, A.P.'                       2  
'Papagrigoriou, E.'                    3  
'Pike, A.C.W.'                         4  
'Bunkoczi, G.'                         5  
'Ugochukwu, E.'                        6  
'Gorrec, F.'                           7  
'von Delft, F.'                        8  
'Weigelt, J.'                          9  
'Edwards, A.'                          10 
'Arrowsmith, C.'                       11 
'Sundstrom, M.'                        12 
'Doyle, D.A.'                          13 
'Structural Genomics Consortium (SGC)' 14 
# 
_citation.id                        primary 
_citation.title                     
'Structural diversity in the RGS domain and its interaction with heterotrimeric G protein alpha-subunits.' 
_citation.journal_abbrev            Proc.Natl.Acad.Sci.Usa 
_citation.journal_volume            105 
_citation.page_first                6457 
_citation.page_last                 6462 
_citation.year                      2008 
_citation.journal_id_ASTM           PNASA6 
_citation.country                   US 
_citation.journal_id_ISSN           0027-8424 
_citation.journal_id_CSD            0040 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   18434541 
_citation.pdbx_database_id_DOI      10.1073/pnas.0801508105 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Soundararajan, M.' 1  
primary 'Willard, F.S.'     2  
primary 'Kimple, A.J.'      3  
primary 'Turnbull, A.P.'    4  
primary 'Ball, L.J.'        5  
primary 'Schoch, G.A.'      6  
primary 'Gileadi, C.'       7  
primary 'Fedorov, O.Y.'     8  
primary 'Dowler, E.F.'      9  
primary 'Higman, V.A.'      10 
primary 'Hutsell, S.Q.'     11 
primary 'Sundstrom, M.'     12 
primary 'Doyle, D.A.'       13 
primary 'Siderovski, D.P.'  14 
# 
_cell.entry_id           2IHB 
_cell.length_a           100.628 
_cell.length_b           100.628 
_cell.length_c           145.359 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         2IHB 
_symmetry.space_group_name_H-M             'P 43 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                96 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Guanine nucleotide-binding protein G(k) subunit alpha' 37201.324 1  ? ? ? ? 
2 polymer     man 'Regulator of G-protein signalling 10'                  18021.410 1  ? ? ? ? 
3 non-polymer syn 'TETRAFLUOROALUMINATE ION'                              102.975   1  ? ? ? ? 
4 non-polymer syn 'MAGNESIUM ION'                                         24.305    1  ? ? ? ? 
5 non-polymer syn "GUANOSINE-5'-DIPHOSPHATE"                              443.201   1  ? ? ? ? 
6 water       nat water                                                   18.015    18 ? ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Gi, alpha-3' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;KEVKLLLLGAGESGKSTIVKQMKIIHEDGYSEDECKQYKVVVYSNTIQSIIAIIRAMGRLKIDFGEAARADDARQLFVLA
GSAEEGVMTPELAGVIKRLWRDGGVQACFSRSREYQLNDSASYYLNDLDRISQSNYIPTQQDVLRTRVKTTGIVETHFTF
KDLYFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEMNRMHESMKLFDSICNNKWFTETSIILFLNKK
DLFEEKIKRSPLTICYPEYTGSNTYEEAAAYIQCQFEDLNRRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKEC
GLY
;
;KEVKLLLLGAGESGKSTIVKQMKIIHEDGYSEDECKQYKVVVYSNTIQSIIAIIRAMGRLKIDFGEAARADDARQLFVLA
GSAEEGVMTPELAGVIKRLWRDGGVQACFSRSREYQLNDSASYYLNDLDRISQSNYIPTQQDVLRTRVKTTGIVETHFTF
KDLYFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEMNRMHESMKLFDSICNNKWFTETSIILFLNKK
DLFEEKIKRSPLTICYPEYTGSNTYEEAAAYIQCQFEDLNRRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKEC
GLY
;
A ? 
2 'polypeptide(L)' no no 
;SMSRKRPPSDIHDSDGSSSSSHQSLKSTAKWAASLENLLEDPEGVKRFREFLKKEFSEENVLFWLACEDFKKMQDKTQMQ
EKAKEIYMTFLSSKASSQVNVEGQSRLNEKILEEPHPLMFQKLQDQIFNLMKYDSYSRFLKSDLFLKHKRTEE
;
;SMSRKRPPSDIHDSDGSSSSSHQSLKSTAKWAASLENLLEDPEGVKRFREFLKKEFSEENVLFWLACEDFKKMQDKTQMQ
EKAKEIYMTFLSSKASSQVNVEGQSRLNEKILEEPHPLMFQKLQDQIFNLMKYDSYSRFLKSDLFLKHKRTEE
;
B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   LYS n 
1 2   GLU n 
1 3   VAL n 
1 4   LYS n 
1 5   LEU n 
1 6   LEU n 
1 7   LEU n 
1 8   LEU n 
1 9   GLY n 
1 10  ALA n 
1 11  GLY n 
1 12  GLU n 
1 13  SER n 
1 14  GLY n 
1 15  LYS n 
1 16  SER n 
1 17  THR n 
1 18  ILE n 
1 19  VAL n 
1 20  LYS n 
1 21  GLN n 
1 22  MET n 
1 23  LYS n 
1 24  ILE n 
1 25  ILE n 
1 26  HIS n 
1 27  GLU n 
1 28  ASP n 
1 29  GLY n 
1 30  TYR n 
1 31  SER n 
1 32  GLU n 
1 33  ASP n 
1 34  GLU n 
1 35  CYS n 
1 36  LYS n 
1 37  GLN n 
1 38  TYR n 
1 39  LYS n 
1 40  VAL n 
1 41  VAL n 
1 42  VAL n 
1 43  TYR n 
1 44  SER n 
1 45  ASN n 
1 46  THR n 
1 47  ILE n 
1 48  GLN n 
1 49  SER n 
1 50  ILE n 
1 51  ILE n 
1 52  ALA n 
1 53  ILE n 
1 54  ILE n 
1 55  ARG n 
1 56  ALA n 
1 57  MET n 
1 58  GLY n 
1 59  ARG n 
1 60  LEU n 
1 61  LYS n 
1 62  ILE n 
1 63  ASP n 
1 64  PHE n 
1 65  GLY n 
1 66  GLU n 
1 67  ALA n 
1 68  ALA n 
1 69  ARG n 
1 70  ALA n 
1 71  ASP n 
1 72  ASP n 
1 73  ALA n 
1 74  ARG n 
1 75  GLN n 
1 76  LEU n 
1 77  PHE n 
1 78  VAL n 
1 79  LEU n 
1 80  ALA n 
1 81  GLY n 
1 82  SER n 
1 83  ALA n 
1 84  GLU n 
1 85  GLU n 
1 86  GLY n 
1 87  VAL n 
1 88  MET n 
1 89  THR n 
1 90  PRO n 
1 91  GLU n 
1 92  LEU n 
1 93  ALA n 
1 94  GLY n 
1 95  VAL n 
1 96  ILE n 
1 97  LYS n 
1 98  ARG n 
1 99  LEU n 
1 100 TRP n 
1 101 ARG n 
1 102 ASP n 
1 103 GLY n 
1 104 GLY n 
1 105 VAL n 
1 106 GLN n 
1 107 ALA n 
1 108 CYS n 
1 109 PHE n 
1 110 SER n 
1 111 ARG n 
1 112 SER n 
1 113 ARG n 
1 114 GLU n 
1 115 TYR n 
1 116 GLN n 
1 117 LEU n 
1 118 ASN n 
1 119 ASP n 
1 120 SER n 
1 121 ALA n 
1 122 SER n 
1 123 TYR n 
1 124 TYR n 
1 125 LEU n 
1 126 ASN n 
1 127 ASP n 
1 128 LEU n 
1 129 ASP n 
1 130 ARG n 
1 131 ILE n 
1 132 SER n 
1 133 GLN n 
1 134 SER n 
1 135 ASN n 
1 136 TYR n 
1 137 ILE n 
1 138 PRO n 
1 139 THR n 
1 140 GLN n 
1 141 GLN n 
1 142 ASP n 
1 143 VAL n 
1 144 LEU n 
1 145 ARG n 
1 146 THR n 
1 147 ARG n 
1 148 VAL n 
1 149 LYS n 
1 150 THR n 
1 151 THR n 
1 152 GLY n 
1 153 ILE n 
1 154 VAL n 
1 155 GLU n 
1 156 THR n 
1 157 HIS n 
1 158 PHE n 
1 159 THR n 
1 160 PHE n 
1 161 LYS n 
1 162 ASP n 
1 163 LEU n 
1 164 TYR n 
1 165 PHE n 
1 166 LYS n 
1 167 MET n 
1 168 PHE n 
1 169 ASP n 
1 170 VAL n 
1 171 GLY n 
1 172 GLY n 
1 173 GLN n 
1 174 ARG n 
1 175 SER n 
1 176 GLU n 
1 177 ARG n 
1 178 LYS n 
1 179 LYS n 
1 180 TRP n 
1 181 ILE n 
1 182 HIS n 
1 183 CYS n 
1 184 PHE n 
1 185 GLU n 
1 186 GLY n 
1 187 VAL n 
1 188 THR n 
1 189 ALA n 
1 190 ILE n 
1 191 ILE n 
1 192 PHE n 
1 193 CYS n 
1 194 VAL n 
1 195 ALA n 
1 196 LEU n 
1 197 SER n 
1 198 ASP n 
1 199 TYR n 
1 200 ASP n 
1 201 LEU n 
1 202 VAL n 
1 203 LEU n 
1 204 ALA n 
1 205 GLU n 
1 206 ASP n 
1 207 GLU n 
1 208 GLU n 
1 209 MET n 
1 210 ASN n 
1 211 ARG n 
1 212 MET n 
1 213 HIS n 
1 214 GLU n 
1 215 SER n 
1 216 MET n 
1 217 LYS n 
1 218 LEU n 
1 219 PHE n 
1 220 ASP n 
1 221 SER n 
1 222 ILE n 
1 223 CYS n 
1 224 ASN n 
1 225 ASN n 
1 226 LYS n 
1 227 TRP n 
1 228 PHE n 
1 229 THR n 
1 230 GLU n 
1 231 THR n 
1 232 SER n 
1 233 ILE n 
1 234 ILE n 
1 235 LEU n 
1 236 PHE n 
1 237 LEU n 
1 238 ASN n 
1 239 LYS n 
1 240 LYS n 
1 241 ASP n 
1 242 LEU n 
1 243 PHE n 
1 244 GLU n 
1 245 GLU n 
1 246 LYS n 
1 247 ILE n 
1 248 LYS n 
1 249 ARG n 
1 250 SER n 
1 251 PRO n 
1 252 LEU n 
1 253 THR n 
1 254 ILE n 
1 255 CYS n 
1 256 TYR n 
1 257 PRO n 
1 258 GLU n 
1 259 TYR n 
1 260 THR n 
1 261 GLY n 
1 262 SER n 
1 263 ASN n 
1 264 THR n 
1 265 TYR n 
1 266 GLU n 
1 267 GLU n 
1 268 ALA n 
1 269 ALA n 
1 270 ALA n 
1 271 TYR n 
1 272 ILE n 
1 273 GLN n 
1 274 CYS n 
1 275 GLN n 
1 276 PHE n 
1 277 GLU n 
1 278 ASP n 
1 279 LEU n 
1 280 ASN n 
1 281 ARG n 
1 282 ARG n 
1 283 LYS n 
1 284 ASP n 
1 285 THR n 
1 286 LYS n 
1 287 GLU n 
1 288 ILE n 
1 289 TYR n 
1 290 THR n 
1 291 HIS n 
1 292 PHE n 
1 293 THR n 
1 294 CYS n 
1 295 ALA n 
1 296 THR n 
1 297 ASP n 
1 298 THR n 
1 299 LYS n 
1 300 ASN n 
1 301 VAL n 
1 302 GLN n 
1 303 PHE n 
1 304 VAL n 
1 305 PHE n 
1 306 ASP n 
1 307 ALA n 
1 308 VAL n 
1 309 THR n 
1 310 ASP n 
1 311 VAL n 
1 312 ILE n 
1 313 ILE n 
1 314 LYS n 
1 315 ASN n 
1 316 ASN n 
1 317 LEU n 
1 318 LYS n 
1 319 GLU n 
1 320 CYS n 
1 321 GLY n 
1 322 LEU n 
1 323 TYR n 
2 1   SER n 
2 2   MET n 
2 3   SER n 
2 4   ARG n 
2 5   LYS n 
2 6   ARG n 
2 7   PRO n 
2 8   PRO n 
2 9   SER n 
2 10  ASP n 
2 11  ILE n 
2 12  HIS n 
2 13  ASP n 
2 14  SER n 
2 15  ASP n 
2 16  GLY n 
2 17  SER n 
2 18  SER n 
2 19  SER n 
2 20  SER n 
2 21  SER n 
2 22  HIS n 
2 23  GLN n 
2 24  SER n 
2 25  LEU n 
2 26  LYS n 
2 27  SER n 
2 28  THR n 
2 29  ALA n 
2 30  LYS n 
2 31  TRP n 
2 32  ALA n 
2 33  ALA n 
2 34  SER n 
2 35  LEU n 
2 36  GLU n 
2 37  ASN n 
2 38  LEU n 
2 39  LEU n 
2 40  GLU n 
2 41  ASP n 
2 42  PRO n 
2 43  GLU n 
2 44  GLY n 
2 45  VAL n 
2 46  LYS n 
2 47  ARG n 
2 48  PHE n 
2 49  ARG n 
2 50  GLU n 
2 51  PHE n 
2 52  LEU n 
2 53  LYS n 
2 54  LYS n 
2 55  GLU n 
2 56  PHE n 
2 57  SER n 
2 58  GLU n 
2 59  GLU n 
2 60  ASN n 
2 61  VAL n 
2 62  LEU n 
2 63  PHE n 
2 64  TRP n 
2 65  LEU n 
2 66  ALA n 
2 67  CYS n 
2 68  GLU n 
2 69  ASP n 
2 70  PHE n 
2 71  LYS n 
2 72  LYS n 
2 73  MET n 
2 74  GLN n 
2 75  ASP n 
2 76  LYS n 
2 77  THR n 
2 78  GLN n 
2 79  MET n 
2 80  GLN n 
2 81  GLU n 
2 82  LYS n 
2 83  ALA n 
2 84  LYS n 
2 85  GLU n 
2 86  ILE n 
2 87  TYR n 
2 88  MET n 
2 89  THR n 
2 90  PHE n 
2 91  LEU n 
2 92  SER n 
2 93  SER n 
2 94  LYS n 
2 95  ALA n 
2 96  SER n 
2 97  SER n 
2 98  GLN n 
2 99  VAL n 
2 100 ASN n 
2 101 VAL n 
2 102 GLU n 
2 103 GLY n 
2 104 GLN n 
2 105 SER n 
2 106 ARG n 
2 107 LEU n 
2 108 ASN n 
2 109 GLU n 
2 110 LYS n 
2 111 ILE n 
2 112 LEU n 
2 113 GLU n 
2 114 GLU n 
2 115 PRO n 
2 116 HIS n 
2 117 PRO n 
2 118 LEU n 
2 119 MET n 
2 120 PHE n 
2 121 GLN n 
2 122 LYS n 
2 123 LEU n 
2 124 GLN n 
2 125 ASP n 
2 126 GLN n 
2 127 ILE n 
2 128 PHE n 
2 129 ASN n 
2 130 LEU n 
2 131 MET n 
2 132 LYS n 
2 133 TYR n 
2 134 ASP n 
2 135 SER n 
2 136 TYR n 
2 137 SER n 
2 138 ARG n 
2 139 PHE n 
2 140 LEU n 
2 141 LYS n 
2 142 SER n 
2 143 ASP n 
2 144 LEU n 
2 145 PHE n 
2 146 LEU n 
2 147 LYS n 
2 148 HIS n 
2 149 LYS n 
2 150 ARG n 
2 151 THR n 
2 152 GLU n 
2 153 GLU n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? human Homo GNAI3 ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 Escherichia ? ? ? ? ? 
'BL21(DE3)R3' ? ? ? ? ? ? ? PLASMID ? ? ? pNIC28-Bsa4 ? ? 
2 1 sample ? ? ? human Homo RGS10 ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 Escherichia ? ? ? ? ? 
'BL21(DE3)R3' ? ? ? ? ? ? ? PLASMID ? ? ? pNIC28-Bsa4 ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP GNAI3_HUMAN  P08754 1 
;KEVKLLLLGAGESGKSTIVKQMKIIHEDGYSEDECKQYKVVVYSNTIQSIIAIIRAMGRLKIDFGEAARADDARQLFVLA
GSAEEGVMTPELAGVIKRLWRDGGVQACFSRSREYQLNDSASYYLNDLDRISQSNYIPTQQDVLRTRVKTTGIVETHFTF
KDLYFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEMNRMHESMKLFDSICNNKWFTETSIILFLNKK
DLFEEKIKRSPLTICYPEYTGSNTYEEAAAYIQCQFEDLNRRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKEC
GLY
;
31 ? 
2 UNP Q96GN0_HUMAN Q96GN0 2 
;SRKRPPSDIHDSDGSSSSSHQSLKSTAKWAASLENLLEDPEGVKRFREFLKKEFSEENVLFWLACEDFKKMQDKTQMQEK
AKEIYMTFLSSKASSQVNVEGQSRLNEKILEEPHPLMFQKLQDQIFNLMKYDSYSRFLKSDLFLKHKRTEE
;
10 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2IHB A 1 ? 323 ? P08754 32 ? 354 ? 32 354 
2 2 2IHB B 3 ? 153 ? Q96GN0 10 ? 160 ? 2  152 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
2 2IHB SER B 1 ? UNP Q96GN0 ? ? 'EXPRESSION TAG' 0 1 
2 2IHB MET B 2 ? UNP Q96GN0 ? ? 'EXPRESSION TAG' 1 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                    ? 'C3 H7 N O2'        89.093  
ALF non-polymer         . 'TETRAFLUOROALUMINATE ION' ? 'Al F4 -1'          102.975 
ARG 'L-peptide linking' y ARGININE                   ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                 ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'            ? 'C4 H7 N O4'        133.103 
CYS 'L-peptide linking' y CYSTEINE                   ? 'C3 H7 N O2 S'      121.158 
GDP 'RNA linking'       n "GUANOSINE-5'-DIPHOSPHATE" ? 'C10 H15 N5 O11 P2' 443.201 
GLN 'L-peptide linking' y GLUTAMINE                  ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'            ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                    ? 'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                  ? 'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                      ? 'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                 ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                    ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                     ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                 ? 'C5 H11 N O2 S'     149.211 
MG  non-polymer         . 'MAGNESIUM ION'            ? 'Mg 2'              24.305  
PHE 'L-peptide linking' y PHENYLALANINE              ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                    ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                     ? 'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                  ? 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                 ? 'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                   ? 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                     ? 'C5 H11 N O2'       117.146 
# 
_exptl.entry_id          2IHB 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.33 
_exptl_crystal.density_percent_sol   63.08 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              5.5 
_exptl_crystal_grow.pdbx_details    
'0.2M (NH4)2SO4, 0.1M Bis-Tris, pH 5.5, 25% PEG3350 , VAPOR DIFFUSION, SITTING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 225 mm CCD' 
_diffrn_detector.pdbx_collection_date   2006-05-06 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Si (111)' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97925 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SLS BEAMLINE X10SA' 
_diffrn_source.pdbx_synchrotron_site       SLS 
_diffrn_source.pdbx_synchrotron_beamline   X10SA 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.97925 
# 
_reflns.entry_id                     2IHB 
_reflns.observed_criterion_sigma_F   0 
_reflns.observed_criterion_sigma_I   0 
_reflns.d_resolution_high            2.7 
_reflns.d_resolution_low             50 
_reflns.number_all                   20815 
_reflns.number_obs                   20470 
_reflns.percent_possible_obs         97.2 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.70 
_reflns_shell.d_res_low              2.75 
_reflns_shell.percent_possible_all   80.2 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 2IHB 
_refine.ls_number_reflns_obs                     19430 
_refine.ls_number_reflns_all                     19430 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             47.6 
_refine.ls_d_res_high                            2.71 
_refine.ls_percent_reflns_obs                    97.42 
_refine.ls_R_factor_obs                          0.20913 
_refine.ls_R_factor_all                          0.20913 
_refine.ls_R_factor_R_work                       0.20763 
_refine.ls_R_factor_R_free                       0.23632 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.1 
_refine.ls_number_reflns_R_free                  1040 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.942 
_refine.correlation_coeff_Fo_to_Fc_free          0.933 
_refine.B_iso_mean                               48.111 
_refine.aniso_B[1][1]                            2.07 
_refine.aniso_B[2][2]                            2.07 
_refine.aniso_B[3][3]                            -4.13 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      'Swissmodel based on the coordinates of PDB entries  1agr, 1ezt, 1ezy, 2bv1' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.452 
_refine.pdbx_overall_ESU_R_Free                  0.277 
_refine.overall_SU_ML                            0.211 
_refine.overall_SU_B                             21.321 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3399 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         34 
_refine_hist.number_atoms_solvent             18 
_refine_hist.number_atoms_total               3451 
_refine_hist.d_res_high                       2.71 
_refine_hist.d_res_low                        47.6 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.009  0.022  ? 3497 'X-RAY DIFFRACTION' ? 
r_bond_other_d               0.001  0.020  ? 2340 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.057  1.957  ? 4725 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            0.806  3.000  ? 5697 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       5.349  5.000  ? 425  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       36.469 24.485 ? 165  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       15.248 15.000 ? 612  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       21.765 15.000 ? 18   'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.055  0.200  ? 526  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.003  0.020  ? 3864 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           0.001  0.020  ? 737  'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.213  0.200  ? 763  'X-RAY DIFFRACTION' ? 
r_nbd_other                  0.173  0.200  ? 2332 'X-RAY DIFFRACTION' ? 
r_nbtor_refined              0.186  0.200  ? 1722 'X-RAY DIFFRACTION' ? 
r_nbtor_other                0.083  0.200  ? 1840 'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.141  0.200  ? 78   'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          0.102  0.200  ? 3    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.056  0.200  ? 3    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         0.178  0.200  ? 15   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.027  0.200  ? 2    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  0.386  1.500  ? 2186 'X-RAY DIFFRACTION' ? 
r_mcbond_other               0.053  1.500  ? 865  'X-RAY DIFFRACTION' ? 
r_mcangle_it                 0.702  2.000  ? 3420 'X-RAY DIFFRACTION' ? 
r_scbond_it                  0.895  3.000  ? 1507 'X-RAY DIFFRACTION' ? 
r_scangle_it                 1.470  4.500  ? 1305 'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.71 
_refine_ls_shell.d_res_low                        2.777 
_refine_ls_shell.number_reflns_R_work             1144 
_refine_ls_shell.R_factor_R_work                  0.322 
_refine_ls_shell.percent_reflns_obs               80.23 
_refine_ls_shell.R_factor_R_free                  0.367 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             57 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2IHB 
_struct.title                     'Crystal structure of the heterodimeric complex of human RGS10 and activated Gi alpha 3' 
_struct.pdbx_descriptor           'Guanine nucleotide-binding protein G(k) subunit alpha, Regulator of G-protein signalling 10' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2IHB 
_struct_keywords.pdbx_keywords   'SIGNALING PROTEIN' 
_struct_keywords.text            
;G protein signalling, RGS, heterotrimeric G protein, signalling complex, Structural Genomics, Structural Genomics Consortium, SGC, SIGNALING PROTEIN
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 6 ? 
G N N 6 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLY A 14  ? GLU A 27  ? GLY A 45  GLU A 58  1 ? 14 
HELX_P HELX_P2  2  SER A 31  ? GLN A 37  ? SER A 62  GLN A 68  1 ? 7  
HELX_P HELX_P3  3  TYR A 38  ? LYS A 61  ? TYR A 69  LYS A 92  1 ? 24 
HELX_P HELX_P4  4  ALA A 68  ? LEU A 79  ? ALA A 99  LEU A 110 1 ? 12 
HELX_P HELX_P5  5  ALA A 80  ? GLU A 84  ? ALA A 111 GLU A 115 5 ? 5  
HELX_P HELX_P6  6  THR A 89  ? ASP A 102 ? THR A 120 ASP A 133 1 ? 14 
HELX_P HELX_P7  7  ASP A 102 ? ARG A 111 ? ASP A 133 ARG A 142 1 ? 10 
HELX_P HELX_P8  8  SER A 112 ? TYR A 115 ? SER A 143 TYR A 146 5 ? 4  
HELX_P HELX_P9  9  SER A 120 ? ASN A 126 ? SER A 151 ASN A 157 1 ? 7  
HELX_P HELX_P10 10 ASP A 127 ? GLN A 133 ? ASP A 158 GLN A 164 1 ? 7  
HELX_P HELX_P11 11 THR A 139 ? ARG A 145 ? THR A 170 ARG A 176 1 ? 7  
HELX_P HELX_P12 12 GLN A 173 ? LYS A 178 ? GLN A 204 LYS A 209 1 ? 6  
HELX_P HELX_P13 13 LYS A 179 ? PHE A 184 ? LYS A 210 PHE A 215 5 ? 6  
HELX_P HELX_P14 14 SER A 197 ? LEU A 201 ? SER A 228 LEU A 232 5 ? 5  
HELX_P HELX_P15 15 ASN A 210 ? ASN A 224 ? ASN A 241 ASN A 255 1 ? 15 
HELX_P HELX_P16 16 ASN A 225 ? THR A 229 ? ASN A 256 THR A 260 5 ? 5  
HELX_P HELX_P17 17 LYS A 239 ? SER A 250 ? LYS A 270 SER A 281 1 ? 12 
HELX_P HELX_P18 18 PRO A 251 ? CYS A 255 ? PRO A 282 CYS A 286 5 ? 5  
HELX_P HELX_P19 19 THR A 264 ? ASP A 278 ? THR A 295 ASP A 309 1 ? 15 
HELX_P HELX_P20 20 ASP A 297 ? ASN A 315 ? ASP A 328 ASN A 346 1 ? 19 
HELX_P HELX_P21 21 LEU B 25  ? SER B 34  ? LEU B 24  SER B 33  1 ? 10 
HELX_P HELX_P22 22 SER B 34  ? ASP B 41  ? SER B 33  ASP B 40  1 ? 8  
HELX_P HELX_P23 23 ASP B 41  ? GLU B 55  ? ASP B 40  GLU B 54  1 ? 15 
HELX_P HELX_P24 24 GLU B 58  ? MET B 73  ? GLU B 57  MET B 72  1 ? 16 
HELX_P HELX_P25 25 ASP B 75  ? LEU B 91  ? ASP B 74  LEU B 90  1 ? 17 
HELX_P HELX_P26 26 PHE B 120 ? ASP B 134 ? PHE B 119 ASP B 133 1 ? 15 
HELX_P HELX_P27 27 ASP B 134 ? LEU B 140 ? ASP B 133 LEU B 139 1 ? 7  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? D MG  .   MG  ? ? ? 1_555 E GDP . O1B ? ? A MG  355 A GDP 356 1_555 ? ? ? ? ? ? ? 2.073 ? 
metalc2 metalc ? ? D MG  .   MG  ? ? ? 1_555 F HOH . O   ? ? A MG  355 A HOH 360 1_555 ? ? ? ? ? ? ? 1.879 ? 
metalc3 metalc ? ? D MG  .   MG  ? ? ? 1_555 F HOH . O   ? ? A MG  355 A HOH 359 1_555 ? ? ? ? ? ? ? 1.854 ? 
metalc4 metalc ? ? A SER 16  OG  ? ? ? 1_555 D MG  . MG  ? ? A SER 47  A MG  355 1_555 ? ? ? ? ? ? ? 2.242 ? 
metalc5 metalc ? ? A THR 150 OG1 ? ? ? 1_555 D MG  . MG  ? ? A THR 181 A MG  355 1_555 ? ? ? ? ? ? ? 1.974 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   6 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? parallel      
A 3 4 ? parallel      
A 4 5 ? parallel      
A 5 6 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ILE A 153 ? PHE A 160 ? ILE A 184 PHE A 191 
A 2 LEU A 163 ? VAL A 170 ? LEU A 194 VAL A 201 
A 3 VAL A 3   ? LEU A 8   ? VAL A 34  LEU A 39  
A 4 ALA A 189 ? ALA A 195 ? ALA A 220 ALA A 226 
A 5 SER A 232 ? ASN A 238 ? SER A 263 ASN A 269 
A 6 ILE A 288 ? PHE A 292 ? ILE A 319 PHE A 323 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N PHE A 158 ? N PHE A 189 O PHE A 165 ? O PHE A 196 
A 2 3 O LYS A 166 ? O LYS A 197 N LEU A 5   ? N LEU A 36  
A 3 4 N LEU A 6   ? N LEU A 37  O ILE A 191 ? O ILE A 222 
A 4 5 N ILE A 190 ? N ILE A 221 O ILE A 234 ? O ILE A 265 
A 5 6 N LEU A 235 ? N LEU A 266 O TYR A 289 ? O TYR A 320 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE ALF A 354' 
AC2 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG A 355'  
AC3 Software ? ? ? ? 22 'BINDING SITE FOR RESIDUE GDP A 356' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 14 GLY A 11  ? GLY A 42  . ? 1_555 ? 
2  AC1 14 GLU A 12  ? GLU A 43  . ? 1_555 ? 
3  AC1 14 LYS A 15  ? LYS A 46  . ? 1_555 ? 
4  AC1 14 ARG A 147 ? ARG A 178 . ? 1_555 ? 
5  AC1 14 LYS A 149 ? LYS A 180 . ? 1_555 ? 
6  AC1 14 THR A 150 ? THR A 181 . ? 1_555 ? 
7  AC1 14 VAL A 170 ? VAL A 201 . ? 1_555 ? 
8  AC1 14 GLY A 172 ? GLY A 203 . ? 1_555 ? 
9  AC1 14 GLN A 173 ? GLN A 204 . ? 1_555 ? 
10 AC1 14 MG  D .   ? MG  A 355 . ? 1_555 ? 
11 AC1 14 GDP E .   ? GDP A 356 . ? 1_555 ? 
12 AC1 14 HOH F .   ? HOH A 358 . ? 1_555 ? 
13 AC1 14 HOH F .   ? HOH A 359 . ? 1_555 ? 
14 AC1 14 HOH F .   ? HOH A 360 . ? 1_555 ? 
15 AC2 6  SER A 16  ? SER A 47  . ? 1_555 ? 
16 AC2 6  THR A 150 ? THR A 181 . ? 1_555 ? 
17 AC2 6  ALF C .   ? ALF A 354 . ? 1_555 ? 
18 AC2 6  GDP E .   ? GDP A 356 . ? 1_555 ? 
19 AC2 6  HOH F .   ? HOH A 359 . ? 1_555 ? 
20 AC2 6  HOH F .   ? HOH A 360 . ? 1_555 ? 
21 AC3 22 GLU A 12  ? GLU A 43  . ? 1_555 ? 
22 AC3 22 SER A 13  ? SER A 44  . ? 1_555 ? 
23 AC3 22 GLY A 14  ? GLY A 45  . ? 1_555 ? 
24 AC3 22 LYS A 15  ? LYS A 46  . ? 1_555 ? 
25 AC3 22 SER A 16  ? SER A 47  . ? 1_555 ? 
26 AC3 22 THR A 17  ? THR A 48  . ? 1_555 ? 
27 AC3 22 SER A 120 ? SER A 151 . ? 1_555 ? 
28 AC3 22 LEU A 144 ? LEU A 175 . ? 1_555 ? 
29 AC3 22 ARG A 145 ? ARG A 176 . ? 1_555 ? 
30 AC3 22 THR A 146 ? THR A 177 . ? 1_555 ? 
31 AC3 22 ARG A 147 ? ARG A 178 . ? 1_555 ? 
32 AC3 22 ASN A 238 ? ASN A 269 . ? 1_555 ? 
33 AC3 22 LYS A 239 ? LYS A 270 . ? 1_555 ? 
34 AC3 22 ASP A 241 ? ASP A 272 . ? 1_555 ? 
35 AC3 22 LEU A 242 ? LEU A 273 . ? 1_555 ? 
36 AC3 22 CYS A 294 ? CYS A 325 . ? 1_555 ? 
37 AC3 22 ALA A 295 ? ALA A 326 . ? 1_555 ? 
38 AC3 22 THR A 296 ? THR A 327 . ? 1_555 ? 
39 AC3 22 ALF C .   ? ALF A 354 . ? 1_555 ? 
40 AC3 22 MG  D .   ? MG  A 355 . ? 1_555 ? 
41 AC3 22 HOH F .   ? HOH A 359 . ? 1_555 ? 
42 AC3 22 HOH F .   ? HOH A 360 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2IHB 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2IHB 
_atom_sites.fract_transf_matrix[1][1]   0.009938 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009938 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006880 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
AL 
C  
F  
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . GLU A 1 2   ? -21.509 -1.766  -37.821 1.00 55.68 ? 33  GLU A N     1 
ATOM   2    C  CA    . GLU A 1 2   ? -20.904 -2.462  -36.646 1.00 55.90 ? 33  GLU A CA    1 
ATOM   3    C  C     . GLU A 1 2   ? -21.381 -3.911  -36.579 1.00 56.01 ? 33  GLU A C     1 
ATOM   4    O  O     . GLU A 1 2   ? -22.558 -4.190  -36.785 1.00 56.13 ? 33  GLU A O     1 
ATOM   5    C  CB    . GLU A 1 2   ? -21.247 -1.741  -35.338 1.00 55.81 ? 33  GLU A CB    1 
ATOM   6    N  N     . VAL A 1 3   ? -20.462 -4.823  -36.269 1.00 56.13 ? 34  VAL A N     1 
ATOM   7    C  CA    . VAL A 1 3   ? -20.730 -6.262  -36.309 1.00 56.06 ? 34  VAL A CA    1 
ATOM   8    C  C     . VAL A 1 3   ? -20.251 -6.955  -35.041 1.00 56.17 ? 34  VAL A C     1 
ATOM   9    O  O     . VAL A 1 3   ? -19.071 -6.877  -34.706 1.00 56.23 ? 34  VAL A O     1 
ATOM   10   C  CB    . VAL A 1 3   ? -20.018 -6.895  -37.512 1.00 56.05 ? 34  VAL A CB    1 
ATOM   11   C  CG1   . VAL A 1 3   ? -19.948 -8.415  -37.377 1.00 55.23 ? 34  VAL A CG1   1 
ATOM   12   C  CG2   . VAL A 1 3   ? -20.716 -6.468  -38.798 1.00 55.95 ? 34  VAL A CG2   1 
ATOM   13   N  N     . LYS A 1 4   ? -21.163 -7.634  -34.348 1.00 56.26 ? 35  LYS A N     1 
ATOM   14   C  CA    . LYS A 1 4   ? -20.816 -8.360  -33.126 1.00 56.55 ? 35  LYS A CA    1 
ATOM   15   C  C     . LYS A 1 4   ? -20.532 -9.822  -33.458 1.00 56.51 ? 35  LYS A C     1 
ATOM   16   O  O     . LYS A 1 4   ? -21.439 -10.560 -33.842 1.00 56.49 ? 35  LYS A O     1 
ATOM   17   C  CB    . LYS A 1 4   ? -21.937 -8.249  -32.082 1.00 56.66 ? 35  LYS A CB    1 
ATOM   18   C  CG    . LYS A 1 4   ? -21.540 -8.745  -30.680 1.00 56.76 ? 35  LYS A CG    1 
ATOM   19   C  CD    . LYS A 1 4   ? -22.654 -8.509  -29.659 1.00 56.89 ? 35  LYS A CD    1 
ATOM   20   C  CE    . LYS A 1 4   ? -22.306 -9.084  -28.282 1.00 57.15 ? 35  LYS A CE    1 
ATOM   21   N  NZ    . LYS A 1 4   ? -23.416 -8.878  -27.291 1.00 57.42 ? 35  LYS A NZ    1 
ATOM   22   N  N     . LEU A 1 5   ? -19.271 -10.227 -33.299 1.00 56.65 ? 36  LEU A N     1 
ATOM   23   C  CA    . LEU A 1 5   ? -18.803 -11.566 -33.668 1.00 56.75 ? 36  LEU A CA    1 
ATOM   24   C  C     . LEU A 1 5   ? -18.380 -12.391 -32.451 1.00 56.58 ? 36  LEU A C     1 
ATOM   25   O  O     . LEU A 1 5   ? -17.503 -11.981 -31.693 1.00 56.69 ? 36  LEU A O     1 
ATOM   26   C  CB    . LEU A 1 5   ? -17.620 -11.441 -34.626 1.00 56.75 ? 36  LEU A CB    1 
ATOM   27   C  CG    . LEU A 1 5   ? -16.964 -12.733 -35.121 1.00 57.26 ? 36  LEU A CG    1 
ATOM   28   C  CD1   . LEU A 1 5   ? -17.985 -13.718 -35.702 1.00 56.89 ? 36  LEU A CD1   1 
ATOM   29   C  CD2   . LEU A 1 5   ? -15.900 -12.378 -36.156 1.00 57.13 ? 36  LEU A CD2   1 
ATOM   30   N  N     . LEU A 1 6   ? -19.001 -13.553 -32.272 1.00 56.35 ? 37  LEU A N     1 
ATOM   31   C  CA    . LEU A 1 6   ? -18.616 -14.479 -31.210 1.00 56.18 ? 37  LEU A CA    1 
ATOM   32   C  C     . LEU A 1 6   ? -17.749 -15.593 -31.761 1.00 56.03 ? 37  LEU A C     1 
ATOM   33   O  O     . LEU A 1 6   ? -18.093 -16.235 -32.754 1.00 55.62 ? 37  LEU A O     1 
ATOM   34   C  CB    . LEU A 1 6   ? -19.845 -15.104 -30.547 1.00 56.27 ? 37  LEU A CB    1 
ATOM   35   C  CG    . LEU A 1 6   ? -20.410 -14.428 -29.304 1.00 56.74 ? 37  LEU A CG    1 
ATOM   36   C  CD1   . LEU A 1 6   ? -20.346 -12.911 -29.423 1.00 57.63 ? 37  LEU A CD1   1 
ATOM   37   C  CD2   . LEU A 1 6   ? -21.837 -14.896 -29.046 1.00 56.16 ? 37  LEU A CD2   1 
ATOM   38   N  N     . LEU A 1 7   ? -16.620 -15.817 -31.098 1.00 56.08 ? 38  LEU A N     1 
ATOM   39   C  CA    . LEU A 1 7   ? -15.832 -17.016 -31.303 1.00 56.02 ? 38  LEU A CA    1 
ATOM   40   C  C     . LEU A 1 7   ? -16.187 -18.024 -30.217 1.00 55.80 ? 38  LEU A C     1 
ATOM   41   O  O     . LEU A 1 7   ? -15.858 -17.826 -29.057 1.00 56.00 ? 38  LEU A O     1 
ATOM   42   C  CB    . LEU A 1 7   ? -14.350 -16.679 -31.268 1.00 56.15 ? 38  LEU A CB    1 
ATOM   43   C  CG    . LEU A 1 7   ? -13.861 -16.111 -32.599 1.00 57.11 ? 38  LEU A CG    1 
ATOM   44   C  CD1   . LEU A 1 7   ? -12.491 -15.489 -32.447 1.00 58.28 ? 38  LEU A CD1   1 
ATOM   45   C  CD2   . LEU A 1 7   ? -13.842 -17.201 -33.677 1.00 57.49 ? 38  LEU A CD2   1 
ATOM   46   N  N     . LEU A 1 8   ? -16.883 -19.090 -30.598 1.00 55.64 ? 39  LEU A N     1 
ATOM   47   C  CA    . LEU A 1 8   ? -17.262 -20.147 -29.668 1.00 55.52 ? 39  LEU A CA    1 
ATOM   48   C  C     . LEU A 1 8   ? -16.688 -21.480 -30.124 1.00 55.48 ? 39  LEU A C     1 
ATOM   49   O  O     . LEU A 1 8   ? -16.285 -21.617 -31.270 1.00 56.10 ? 39  LEU A O     1 
ATOM   50   C  CB    . LEU A 1 8   ? -18.779 -20.239 -29.577 1.00 55.46 ? 39  LEU A CB    1 
ATOM   51   C  CG    . LEU A 1 8   ? -19.482 -18.903 -29.312 1.00 55.35 ? 39  LEU A CG    1 
ATOM   52   C  CD1   . LEU A 1 8   ? -20.969 -19.111 -29.122 1.00 54.15 ? 39  LEU A CD1   1 
ATOM   53   C  CD2   . LEU A 1 8   ? -18.888 -18.215 -28.102 1.00 55.64 ? 39  LEU A CD2   1 
ATOM   54   N  N     . GLY A 1 9   ? -16.638 -22.448 -29.216 1.00 55.36 ? 40  GLY A N     1 
ATOM   55   C  CA    . GLY A 1 9   ? -16.170 -23.807 -29.510 1.00 55.13 ? 40  GLY A CA    1 
ATOM   56   C  C     . GLY A 1 9   ? -15.626 -24.425 -28.243 1.00 55.17 ? 40  GLY A C     1 
ATOM   57   O  O     . GLY A 1 9   ? -15.319 -23.708 -27.301 1.00 55.02 ? 40  GLY A O     1 
ATOM   58   N  N     . ALA A 1 10  ? -15.494 -25.747 -28.200 1.00 55.49 ? 41  ALA A N     1 
ATOM   59   C  CA    . ALA A 1 10  ? -14.910 -26.403 -27.022 1.00 55.66 ? 41  ALA A CA    1 
ATOM   60   C  C     . ALA A 1 10  ? -13.438 -26.011 -26.908 1.00 56.12 ? 41  ALA A C     1 
ATOM   61   O  O     . ALA A 1 10  ? -12.871 -25.424 -27.830 1.00 56.29 ? 41  ALA A O     1 
ATOM   62   C  CB    . ALA A 1 10  ? -15.057 -27.912 -27.106 1.00 55.57 ? 41  ALA A CB    1 
ATOM   63   N  N     . GLY A 1 11  ? -12.822 -26.341 -25.779 1.00 56.46 ? 42  GLY A N     1 
ATOM   64   C  CA    . GLY A 1 11  ? -11.467 -25.900 -25.493 1.00 56.38 ? 42  GLY A CA    1 
ATOM   65   C  C     . GLY A 1 11  ? -10.486 -26.458 -26.486 1.00 56.65 ? 42  GLY A C     1 
ATOM   66   O  O     . GLY A 1 11  ? -10.634 -27.583 -26.909 1.00 56.54 ? 42  GLY A O     1 
ATOM   67   N  N     . GLU A 1 12  ? -9.506  -25.648 -26.873 1.00 57.42 ? 43  GLU A N     1 
ATOM   68   C  CA    . GLU A 1 12  ? -8.432  -26.047 -27.794 1.00 58.20 ? 43  GLU A CA    1 
ATOM   69   C  C     . GLU A 1 12  ? -8.875  -26.249 -29.233 1.00 57.91 ? 43  GLU A C     1 
ATOM   70   O  O     . GLU A 1 12  ? -8.181  -26.914 -29.999 1.00 58.31 ? 43  GLU A O     1 
ATOM   71   C  CB    . GLU A 1 12  ? -7.695  -27.294 -27.288 1.00 58.56 ? 43  GLU A CB    1 
ATOM   72   C  CG    . GLU A 1 12  ? -6.876  -27.010 -26.057 1.00 61.97 ? 43  GLU A CG    1 
ATOM   73   C  CD    . GLU A 1 12  ? -6.193  -28.235 -25.482 1.00 67.06 ? 43  GLU A CD    1 
ATOM   74   O  OE1   . GLU A 1 12  ? -6.774  -29.343 -25.550 1.00 69.62 ? 43  GLU A OE1   1 
ATOM   75   O  OE2   . GLU A 1 12  ? -5.070  -28.080 -24.942 1.00 70.78 ? 43  GLU A OE2   1 
ATOM   76   N  N     . SER A 1 13  ? -10.008 -25.667 -29.614 1.00 57.60 ? 44  SER A N     1 
ATOM   77   C  CA    . SER A 1 13  ? -10.506 -25.798 -30.984 1.00 57.17 ? 44  SER A CA    1 
ATOM   78   C  C     . SER A 1 13  ? -9.871  -24.774 -31.899 1.00 56.95 ? 44  SER A C     1 
ATOM   79   O  O     . SER A 1 13  ? -9.937  -24.913 -33.105 1.00 57.25 ? 44  SER A O     1 
ATOM   80   C  CB    . SER A 1 13  ? -12.021 -25.667 -31.027 1.00 57.23 ? 44  SER A CB    1 
ATOM   81   O  OG    . SER A 1 13  ? -12.466 -24.575 -30.253 1.00 57.36 ? 44  SER A OG    1 
ATOM   82   N  N     . GLY A 1 14  ? -9.249  -23.749 -31.324 1.00 56.73 ? 45  GLY A N     1 
ATOM   83   C  CA    . GLY A 1 14  ? -8.464  -22.800 -32.098 1.00 56.54 ? 45  GLY A CA    1 
ATOM   84   C  C     . GLY A 1 14  ? -9.042  -21.403 -32.181 1.00 56.45 ? 45  GLY A C     1 
ATOM   85   O  O     . GLY A 1 14  ? -8.713  -20.660 -33.098 1.00 56.63 ? 45  GLY A O     1 
ATOM   86   N  N     . LYS A 1 15  ? -9.863  -21.022 -31.208 1.00 56.22 ? 46  LYS A N     1 
ATOM   87   C  CA    . LYS A 1 15  ? -10.507 -19.708 -31.216 1.00 55.96 ? 46  LYS A CA    1 
ATOM   88   C  C     . LYS A 1 15  ? -9.471  -18.596 -31.078 1.00 55.71 ? 46  LYS A C     1 
ATOM   89   O  O     . LYS A 1 15  ? -9.448  -17.647 -31.859 1.00 55.56 ? 46  LYS A O     1 
ATOM   90   C  CB    . LYS A 1 15  ? -11.512 -19.562 -30.067 1.00 55.93 ? 46  LYS A CB    1 
ATOM   91   C  CG    . LYS A 1 15  ? -12.511 -20.675 -29.903 1.00 55.85 ? 46  LYS A CG    1 
ATOM   92   C  CD    . LYS A 1 15  ? -13.247 -20.504 -28.584 1.00 56.57 ? 46  LYS A CD    1 
ATOM   93   C  CE    . LYS A 1 15  ? -13.352 -21.804 -27.819 1.00 56.63 ? 46  LYS A CE    1 
ATOM   94   N  NZ    . LYS A 1 15  ? -12.102 -22.223 -27.149 1.00 55.68 ? 46  LYS A NZ    1 
ATOM   95   N  N     . SER A 1 16  ? -8.632  -18.705 -30.058 1.00 55.59 ? 47  SER A N     1 
ATOM   96   C  CA    . SER A 1 16  ? -7.620  -17.696 -29.814 1.00 55.61 ? 47  SER A CA    1 
ATOM   97   C  C     . SER A 1 16  ? -6.651  -17.580 -30.994 1.00 55.40 ? 47  SER A C     1 
ATOM   98   O  O     . SER A 1 16  ? -6.211  -16.485 -31.323 1.00 55.64 ? 47  SER A O     1 
ATOM   99   C  CB    . SER A 1 16  ? -6.884  -17.984 -28.507 1.00 55.75 ? 47  SER A CB    1 
ATOM   100  O  OG    . SER A 1 16  ? -7.749  -17.770 -27.390 1.00 56.00 ? 47  SER A OG    1 
ATOM   101  N  N     . THR A 1 17  ? -6.352  -18.693 -31.656 1.00 55.10 ? 48  THR A N     1 
ATOM   102  C  CA    . THR A 1 17  ? -5.499  -18.652 -32.847 1.00 54.87 ? 48  THR A CA    1 
ATOM   103  C  C     . THR A 1 17  ? -6.137  -17.827 -33.953 1.00 54.96 ? 48  THR A C     1 
ATOM   104  O  O     . THR A 1 17  ? -5.456  -17.103 -34.658 1.00 55.40 ? 48  THR A O     1 
ATOM   105  C  CB    . THR A 1 17  ? -5.185  -20.052 -33.364 1.00 54.52 ? 48  THR A CB    1 
ATOM   106  O  OG1   . THR A 1 17  ? -4.652  -20.826 -32.293 1.00 55.51 ? 48  THR A OG1   1 
ATOM   107  C  CG2   . THR A 1 17  ? -4.163  -20.004 -34.452 1.00 53.61 ? 48  THR A CG2   1 
ATOM   108  N  N     . ILE A 1 18  ? -7.446  -17.929 -34.106 1.00 55.07 ? 49  ILE A N     1 
ATOM   109  C  CA    . ILE A 1 18  ? -8.150  -17.099 -35.074 1.00 55.11 ? 49  ILE A CA    1 
ATOM   110  C  C     . ILE A 1 18  ? -8.092  -15.623 -34.679 1.00 55.06 ? 49  ILE A C     1 
ATOM   111  O  O     . ILE A 1 18  ? -7.974  -14.756 -35.540 1.00 55.11 ? 49  ILE A O     1 
ATOM   112  C  CB    . ILE A 1 18  ? -9.623  -17.535 -35.214 1.00 55.19 ? 49  ILE A CB    1 
ATOM   113  C  CG1   . ILE A 1 18  ? -9.700  -18.922 -35.878 1.00 55.36 ? 49  ILE A CG1   1 
ATOM   114  C  CG2   . ILE A 1 18  ? -10.434 -16.478 -35.975 1.00 54.44 ? 49  ILE A CG2   1 
ATOM   115  C  CD1   . ILE A 1 18  ? -9.087  -18.996 -37.269 1.00 56.16 ? 49  ILE A CD1   1 
ATOM   116  N  N     . VAL A 1 19  ? -8.179  -15.344 -33.382 1.00 54.83 ? 50  VAL A N     1 
ATOM   117  C  CA    . VAL A 1 19  ? -8.100  -13.972 -32.902 1.00 54.81 ? 50  VAL A CA    1 
ATOM   118  C  C     . VAL A 1 19  ? -6.754  -13.347 -33.273 1.00 55.10 ? 50  VAL A C     1 
ATOM   119  O  O     . VAL A 1 19  ? -6.691  -12.195 -33.718 1.00 54.82 ? 50  VAL A O     1 
ATOM   120  C  CB    . VAL A 1 19  ? -8.303  -13.892 -31.379 1.00 54.69 ? 50  VAL A CB    1 
ATOM   121  C  CG1   . VAL A 1 19  ? -7.866  -12.527 -30.849 1.00 53.95 ? 50  VAL A CG1   1 
ATOM   122  C  CG2   . VAL A 1 19  ? -9.756  -14.174 -31.034 1.00 54.13 ? 50  VAL A CG2   1 
ATOM   123  N  N     . LYS A 1 20  ? -5.688  -14.119 -33.085 1.00 55.28 ? 51  LYS A N     1 
ATOM   124  C  CA    . LYS A 1 20  ? -4.351  -13.686 -33.467 1.00 55.69 ? 51  LYS A CA    1 
ATOM   125  C  C     . LYS A 1 20  ? -4.260  -13.426 -34.966 1.00 55.79 ? 51  LYS A C     1 
ATOM   126  O  O     . LYS A 1 20  ? -3.615  -12.460 -35.398 1.00 55.54 ? 51  LYS A O     1 
ATOM   127  C  CB    . LYS A 1 20  ? -3.312  -14.722 -33.068 1.00 55.71 ? 51  LYS A CB    1 
ATOM   128  C  CG    . LYS A 1 20  ? -3.176  -14.849 -31.590 1.00 56.41 ? 51  LYS A CG    1 
ATOM   129  C  CD    . LYS A 1 20  ? -2.079  -15.803 -31.185 1.00 56.85 ? 51  LYS A CD    1 
ATOM   130  C  CE    . LYS A 1 20  ? -2.078  -15.988 -29.688 1.00 57.60 ? 51  LYS A CE    1 
ATOM   131  N  NZ    . LYS A 1 20  ? -2.041  -17.420 -29.331 1.00 59.04 ? 51  LYS A NZ    1 
ATOM   132  N  N     . GLN A 1 21  ? -4.910  -14.276 -35.757 1.00 55.80 ? 52  GLN A N     1 
ATOM   133  C  CA    . GLN A 1 21  ? -4.913  -14.072 -37.196 1.00 55.89 ? 52  GLN A CA    1 
ATOM   134  C  C     . GLN A 1 21  ? -5.587  -12.746 -37.546 1.00 56.17 ? 52  GLN A C     1 
ATOM   135  O  O     . GLN A 1 21  ? -5.122  -12.035 -38.438 1.00 56.66 ? 52  GLN A O     1 
ATOM   136  C  CB    . GLN A 1 21  ? -5.553  -15.247 -37.944 1.00 55.72 ? 52  GLN A CB    1 
ATOM   137  C  CG    . GLN A 1 21  ? -4.736  -16.537 -37.932 1.00 55.66 ? 52  GLN A CG    1 
ATOM   138  C  CD    . GLN A 1 21  ? -3.414  -16.443 -38.682 1.00 56.38 ? 52  GLN A CD    1 
ATOM   139  O  OE1   . GLN A 1 21  ? -2.949  -15.356 -39.036 1.00 56.35 ? 52  GLN A OE1   1 
ATOM   140  N  NE2   . GLN A 1 21  ? -2.798  -17.590 -38.927 1.00 57.11 ? 52  GLN A NE2   1 
ATOM   141  N  N     . MET A 1 22  ? -6.644  -12.380 -36.828 1.00 56.44 ? 53  MET A N     1 
ATOM   142  C  CA    . MET A 1 22  ? -7.293  -11.092 -37.089 1.00 56.81 ? 53  MET A CA    1 
ATOM   143  C  C     . MET A 1 22  ? -6.333  -9.925  -36.871 1.00 56.71 ? 53  MET A C     1 
ATOM   144  O  O     . MET A 1 22  ? -6.392  -8.934  -37.585 1.00 57.01 ? 53  MET A O     1 
ATOM   145  C  CB    . MET A 1 22  ? -8.543  -10.903 -36.231 1.00 56.95 ? 53  MET A CB    1 
ATOM   146  C  CG    . MET A 1 22  ? -9.668  -11.893 -36.514 1.00 57.66 ? 53  MET A CG    1 
ATOM   147  S  SD    . MET A 1 22  ? -10.257 -11.920 -38.226 1.00 59.31 ? 53  MET A SD    1 
ATOM   148  C  CE    . MET A 1 22  ? -9.332  -13.302 -38.892 1.00 58.48 ? 53  MET A CE    1 
ATOM   149  N  N     . LYS A 1 23  ? -5.445  -10.050 -35.894 1.00 56.80 ? 54  LYS A N     1 
ATOM   150  C  CA    . LYS A 1 23  ? -4.428  -9.037  -35.652 1.00 56.73 ? 54  LYS A CA    1 
ATOM   151  C  C     . LYS A 1 23  ? -3.428  -9.034  -36.806 1.00 56.81 ? 54  LYS A C     1 
ATOM   152  O  O     . LYS A 1 23  ? -3.035  -7.975  -37.283 1.00 56.67 ? 54  LYS A O     1 
ATOM   153  C  CB    . LYS A 1 23  ? -3.715  -9.303  -34.321 1.00 56.63 ? 54  LYS A CB    1 
ATOM   154  C  CG    . LYS A 1 23  ? -2.756  -8.207  -33.897 1.00 56.86 ? 54  LYS A CG    1 
ATOM   155  C  CD    . LYS A 1 23  ? -2.028  -8.537  -32.590 1.00 56.83 ? 54  LYS A CD    1 
ATOM   156  C  CE    . LYS A 1 23  ? -0.817  -7.606  -32.370 1.00 57.07 ? 54  LYS A CE    1 
ATOM   157  N  NZ    . LYS A 1 23  ? -1.133  -6.144  -32.514 1.00 56.51 ? 54  LYS A NZ    1 
ATOM   158  N  N     . ILE A 1 24  ? -3.034  -10.220 -37.265 1.00 57.08 ? 55  ILE A N     1 
ATOM   159  C  CA    . ILE A 1 24  ? -2.040  -10.331 -38.337 1.00 57.19 ? 55  ILE A CA    1 
ATOM   160  C  C     . ILE A 1 24  ? -2.563  -9.745  -39.637 1.00 57.92 ? 55  ILE A C     1 
ATOM   161  O  O     . ILE A 1 24  ? -1.851  -9.003  -40.321 1.00 58.13 ? 55  ILE A O     1 
ATOM   162  C  CB    . ILE A 1 24  ? -1.597  -11.793 -38.591 1.00 57.28 ? 55  ILE A CB    1 
ATOM   163  C  CG1   . ILE A 1 24  ? -0.846  -12.349 -37.365 1.00 57.07 ? 55  ILE A CG1   1 
ATOM   164  C  CG2   . ILE A 1 24  ? -0.712  -11.871 -39.830 1.00 56.00 ? 55  ILE A CG2   1 
ATOM   165  C  CD1   . ILE A 1 24  ? -0.478  -13.808 -37.461 1.00 56.48 ? 55  ILE A CD1   1 
ATOM   166  N  N     . ILE A 1 25  ? -3.815  -10.059 -39.956 1.00 58.49 ? 56  ILE A N     1 
ATOM   167  C  CA    . ILE A 1 25  ? -4.403  -9.708  -41.242 1.00 58.86 ? 56  ILE A CA    1 
ATOM   168  C  C     . ILE A 1 25  ? -5.022  -8.311  -41.255 1.00 59.66 ? 56  ILE A C     1 
ATOM   169  O  O     . ILE A 1 25  ? -4.820  -7.557  -42.204 1.00 59.84 ? 56  ILE A O     1 
ATOM   170  C  CB    . ILE A 1 25  ? -5.466  -10.743 -41.633 1.00 58.74 ? 56  ILE A CB    1 
ATOM   171  C  CG1   . ILE A 1 25  ? -4.813  -12.113 -41.830 1.00 58.51 ? 56  ILE A CG1   1 
ATOM   172  C  CG2   . ILE A 1 25  ? -6.189  -10.315 -42.896 1.00 58.50 ? 56  ILE A CG2   1 
ATOM   173  C  CD1   . ILE A 1 25  ? -5.730  -13.281 -41.562 1.00 58.06 ? 56  ILE A CD1   1 
ATOM   174  N  N     . HIS A 1 26  ? -5.765  -7.967  -40.205 1.00 60.63 ? 57  HIS A N     1 
ATOM   175  C  CA    . HIS A 1 26  ? -6.570  -6.743  -40.189 1.00 61.34 ? 57  HIS A CA    1 
ATOM   176  C  C     . HIS A 1 26  ? -6.136  -5.686  -39.174 1.00 62.41 ? 57  HIS A C     1 
ATOM   177  O  O     . HIS A 1 26  ? -6.760  -4.630  -39.080 1.00 62.35 ? 57  HIS A O     1 
ATOM   178  C  CB    . HIS A 1 26  ? -8.032  -7.096  -39.947 1.00 61.28 ? 57  HIS A CB    1 
ATOM   179  C  CG    . HIS A 1 26  ? -8.621  -7.967  -41.007 1.00 61.20 ? 57  HIS A CG    1 
ATOM   180  N  ND1   . HIS A 1 26  ? -8.957  -9.285  -40.785 1.00 61.03 ? 57  HIS A ND1   1 
ATOM   181  C  CD2   . HIS A 1 26  ? -8.927  -7.712  -42.300 1.00 61.11 ? 57  HIS A CD2   1 
ATOM   182  C  CE1   . HIS A 1 26  ? -9.451  -9.802  -41.895 1.00 61.09 ? 57  HIS A CE1   1 
ATOM   183  N  NE2   . HIS A 1 26  ? -9.443  -8.869  -42.829 1.00 61.41 ? 57  HIS A NE2   1 
ATOM   184  N  N     . GLU A 1 27  ? -5.101  -5.962  -38.390 1.00 63.67 ? 58  GLU A N     1 
ATOM   185  C  CA    . GLU A 1 27  ? -4.442  -4.893  -37.649 1.00 64.88 ? 58  GLU A CA    1 
ATOM   186  C  C     . GLU A 1 27  ? -3.075  -4.706  -38.320 1.00 65.12 ? 58  GLU A C     1 
ATOM   187  O  O     . GLU A 1 27  ? -3.028  -4.371  -39.506 1.00 65.63 ? 58  GLU A O     1 
ATOM   188  C  CB    . GLU A 1 27  ? -4.391  -5.176  -36.138 1.00 64.92 ? 58  GLU A CB    1 
ATOM   189  C  CG    . GLU A 1 27  ? -5.787  -5.286  -35.476 1.00 66.01 ? 58  GLU A CG    1 
ATOM   190  C  CD    . GLU A 1 27  ? -5.751  -5.798  -34.015 1.00 66.68 ? 58  GLU A CD    1 
ATOM   191  O  OE1   . GLU A 1 27  ? -4.895  -5.325  -33.223 1.00 69.23 ? 58  GLU A OE1   1 
ATOM   192  O  OE2   . GLU A 1 27  ? -6.594  -6.663  -33.652 1.00 68.80 ? 58  GLU A OE2   1 
ATOM   193  N  N     . ASP A 1 28  ? -1.974  -4.963  -37.625 1.00 65.31 ? 59  ASP A N     1 
ATOM   194  C  CA    . ASP A 1 28  ? -0.658  -4.541  -38.126 1.00 65.44 ? 59  ASP A CA    1 
ATOM   195  C  C     . ASP A 1 28  ? 0.431   -5.639  -38.052 1.00 64.74 ? 59  ASP A C     1 
ATOM   196  O  O     . ASP A 1 28  ? 1.634   -5.352  -38.105 1.00 64.69 ? 59  ASP A O     1 
ATOM   197  C  CB    . ASP A 1 28  ? -0.229  -3.275  -37.350 1.00 65.95 ? 59  ASP A CB    1 
ATOM   198  C  CG    . ASP A 1 28  ? -0.483  -3.385  -35.827 1.00 67.14 ? 59  ASP A CG    1 
ATOM   199  O  OD1   . ASP A 1 28  ? -0.700  -4.517  -35.316 1.00 68.36 ? 59  ASP A OD1   1 
ATOM   200  O  OD2   . ASP A 1 28  ? -0.458  -2.327  -35.148 1.00 68.37 ? 59  ASP A OD2   1 
ATOM   201  N  N     . GLY A 1 29  ? 0.009   -6.896  -37.950 1.00 63.78 ? 60  GLY A N     1 
ATOM   202  C  CA    . GLY A 1 29  ? 0.924   -7.964  -37.570 1.00 62.71 ? 60  GLY A CA    1 
ATOM   203  C  C     . GLY A 1 29  ? 1.395   -7.790  -36.133 1.00 61.76 ? 60  GLY A C     1 
ATOM   204  O  O     . GLY A 1 29  ? 0.943   -6.899  -35.401 1.00 61.36 ? 60  GLY A O     1 
ATOM   205  N  N     . TYR A 1 30  ? 2.297   -8.672  -35.728 1.00 60.64 ? 61  TYR A N     1 
ATOM   206  C  CA    . TYR A 1 30  ? 2.991   -8.542  -34.467 1.00 59.77 ? 61  TYR A CA    1 
ATOM   207  C  C     . TYR A 1 30  ? 4.290   -7.780  -34.704 1.00 58.93 ? 61  TYR A C     1 
ATOM   208  O  O     . TYR A 1 30  ? 4.972   -7.995  -35.713 1.00 58.92 ? 61  TYR A O     1 
ATOM   209  C  CB    . TYR A 1 30  ? 3.276   -9.922  -33.883 1.00 59.79 ? 61  TYR A CB    1 
ATOM   210  C  CG    . TYR A 1 30  ? 2.037   -10.575 -33.350 1.00 59.86 ? 61  TYR A CG    1 
ATOM   211  C  CD1   . TYR A 1 30  ? 1.786   -10.619 -31.990 1.00 60.11 ? 61  TYR A CD1   1 
ATOM   212  C  CD2   . TYR A 1 30  ? 1.092   -11.113 -34.205 1.00 59.93 ? 61  TYR A CD2   1 
ATOM   213  C  CE1   . TYR A 1 30  ? 0.637   -11.205 -31.492 1.00 60.05 ? 61  TYR A CE1   1 
ATOM   214  C  CE2   . TYR A 1 30  ? -0.054  -11.699 -33.722 1.00 59.81 ? 61  TYR A CE2   1 
ATOM   215  C  CZ    . TYR A 1 30  ? -0.279  -11.747 -32.364 1.00 60.34 ? 61  TYR A CZ    1 
ATOM   216  O  OH    . TYR A 1 30  ? -1.436  -12.332 -31.880 1.00 60.67 ? 61  TYR A OH    1 
ATOM   217  N  N     . SER A 1 31  ? 4.618   -6.878  -33.787 1.00 57.79 ? 62  SER A N     1 
ATOM   218  C  CA    . SER A 1 31  ? 5.911   -6.217  -33.806 1.00 57.07 ? 62  SER A CA    1 
ATOM   219  C  C     . SER A 1 31  ? 6.945   -7.169  -33.240 1.00 56.49 ? 62  SER A C     1 
ATOM   220  O  O     . SER A 1 31  ? 6.601   -8.201  -32.663 1.00 56.23 ? 62  SER A O     1 
ATOM   221  C  CB    . SER A 1 31  ? 5.885   -4.930  -32.979 1.00 57.05 ? 62  SER A CB    1 
ATOM   222  O  OG    . SER A 1 31  ? 5.821   -5.210  -31.590 1.00 56.55 ? 62  SER A OG    1 
ATOM   223  N  N     . GLU A 1 32  ? 8.211   -6.805  -33.408 1.00 55.94 ? 63  GLU A N     1 
ATOM   224  C  CA    . GLU A 1 32  ? 9.315   -7.565  -32.854 1.00 55.49 ? 63  GLU A CA    1 
ATOM   225  C  C     . GLU A 1 32  ? 9.202   -7.627  -31.333 1.00 55.55 ? 63  GLU A C     1 
ATOM   226  O  O     . GLU A 1 32  ? 9.305   -8.700  -30.748 1.00 55.40 ? 63  GLU A O     1 
ATOM   227  C  CB    . GLU A 1 32  ? 10.641  -6.943  -33.277 1.00 55.24 ? 63  GLU A CB    1 
ATOM   228  C  CG    . GLU A 1 32  ? 11.853  -7.679  -32.766 1.00 55.00 ? 63  GLU A CG    1 
ATOM   229  C  CD    . GLU A 1 32  ? 13.140  -7.092  -33.285 1.00 54.69 ? 63  GLU A CD    1 
ATOM   230  O  OE1   . GLU A 1 32  ? 13.831  -6.398  -32.510 1.00 55.11 ? 63  GLU A OE1   1 
ATOM   231  O  OE2   . GLU A 1 32  ? 13.457  -7.313  -34.471 1.00 54.26 ? 63  GLU A OE2   1 
ATOM   232  N  N     . ASP A 1 33  ? 8.971   -6.482  -30.697 1.00 55.80 ? 64  ASP A N     1 
ATOM   233  C  CA    . ASP A 1 33  ? 8.761   -6.435  -29.243 1.00 56.03 ? 64  ASP A CA    1 
ATOM   234  C  C     . ASP A 1 33  ? 7.603   -7.313  -28.787 1.00 55.84 ? 64  ASP A C     1 
ATOM   235  O  O     . ASP A 1 33  ? 7.724   -8.040  -27.806 1.00 55.85 ? 64  ASP A O     1 
ATOM   236  C  CB    . ASP A 1 33  ? 8.542   -4.996  -28.770 1.00 56.23 ? 64  ASP A CB    1 
ATOM   237  C  CG    . ASP A 1 33  ? 9.831   -4.181  -28.768 1.00 57.50 ? 64  ASP A CG    1 
ATOM   238  O  OD1   . ASP A 1 33  ? 10.927  -4.783  -28.694 1.00 58.99 ? 64  ASP A OD1   1 
ATOM   239  O  OD2   . ASP A 1 33  ? 9.754   -2.935  -28.837 1.00 59.43 ? 64  ASP A OD2   1 
ATOM   240  N  N     . GLU A 1 34  ? 6.490   -7.259  -29.507 1.00 55.78 ? 65  GLU A N     1 
ATOM   241  C  CA    . GLU A 1 34  ? 5.362   -8.125  -29.215 1.00 55.90 ? 65  GLU A CA    1 
ATOM   242  C  C     . GLU A 1 34  ? 5.733   -9.605  -29.382 1.00 55.84 ? 65  GLU A C     1 
ATOM   243  O  O     . GLU A 1 34  ? 5.277   -10.442 -28.607 1.00 55.63 ? 65  GLU A O     1 
ATOM   244  C  CB    . GLU A 1 34  ? 4.169   -7.768  -30.099 1.00 55.98 ? 65  GLU A CB    1 
ATOM   245  C  CG    . GLU A 1 34  ? 3.504   -6.439  -29.767 1.00 56.29 ? 65  GLU A CG    1 
ATOM   246  C  CD    . GLU A 1 34  ? 2.470   -6.021  -30.813 1.00 56.92 ? 65  GLU A CD    1 
ATOM   247  O  OE1   . GLU A 1 34  ? 2.831   -5.812  -31.996 1.00 58.38 ? 65  GLU A OE1   1 
ATOM   248  O  OE2   . GLU A 1 34  ? 1.283   -5.895  -30.453 1.00 59.62 ? 65  GLU A OE2   1 
ATOM   249  N  N     . CYS A 1 35  ? 6.556   -9.929  -30.380 1.00 55.87 ? 66  CYS A N     1 
ATOM   250  C  CA    . CYS A 1 35  ? 7.046   -11.305 -30.542 1.00 56.11 ? 66  CYS A CA    1 
ATOM   251  C  C     . CYS A 1 35  ? 7.991   -11.725 -29.416 1.00 56.27 ? 66  CYS A C     1 
ATOM   252  O  O     . CYS A 1 35  ? 7.943   -12.868 -28.959 1.00 56.07 ? 66  CYS A O     1 
ATOM   253  C  CB    . CYS A 1 35  ? 7.774   -11.479 -31.864 1.00 56.11 ? 66  CYS A CB    1 
ATOM   254  S  SG    . CYS A 1 35  ? 6.706   -11.492 -33.278 1.00 57.20 ? 66  CYS A SG    1 
ATOM   255  N  N     . LYS A 1 36  ? 8.857   -10.806 -28.991 1.00 56.38 ? 67  LYS A N     1 
ATOM   256  C  CA    . LYS A 1 36  ? 9.743   -11.049 -27.860 1.00 56.64 ? 67  LYS A CA    1 
ATOM   257  C  C     . LYS A 1 36  ? 8.967   -11.449 -26.595 1.00 56.95 ? 67  LYS A C     1 
ATOM   258  O  O     . LYS A 1 36  ? 9.412   -12.320 -25.833 1.00 57.14 ? 67  LYS A O     1 
ATOM   259  C  CB    . LYS A 1 36  ? 10.624  -9.822  -27.574 1.00 56.84 ? 67  LYS A CB    1 
ATOM   260  C  CG    . LYS A 1 36  ? 11.779  -9.608  -28.569 1.00 56.70 ? 67  LYS A CG    1 
ATOM   261  C  CD    . LYS A 1 36  ? 12.825  -8.659  -28.005 1.00 56.69 ? 67  LYS A CD    1 
ATOM   262  C  CE    . LYS A 1 36  ? 13.882  -8.294  -29.045 1.00 56.93 ? 67  LYS A CE    1 
ATOM   263  N  NZ    . LYS A 1 36  ? 14.917  -7.377  -28.497 1.00 55.94 ? 67  LYS A NZ    1 
ATOM   264  N  N     . GLN A 1 37  ? 7.807   -10.829 -26.379 1.00 56.91 ? 68  GLN A N     1 
ATOM   265  C  CA    . GLN A 1 37  ? 6.958   -11.170 -25.240 1.00 56.74 ? 68  GLN A CA    1 
ATOM   266  C  C     . GLN A 1 37  ? 6.428   -12.612 -25.257 1.00 56.38 ? 68  GLN A C     1 
ATOM   267  O  O     . GLN A 1 37  ? 5.986   -13.110 -24.228 1.00 56.35 ? 68  GLN A O     1 
ATOM   268  C  CB    . GLN A 1 37  ? 5.771   -10.228 -25.171 1.00 56.98 ? 68  GLN A CB    1 
ATOM   269  C  CG    . GLN A 1 37  ? 6.110   -8.817  -24.818 1.00 58.33 ? 68  GLN A CG    1 
ATOM   270  C  CD    . GLN A 1 37  ? 4.862   -7.940  -24.737 1.00 60.91 ? 68  GLN A CD    1 
ATOM   271  O  OE1   . GLN A 1 37  ? 4.064   -7.865  -25.679 1.00 61.14 ? 68  GLN A OE1   1 
ATOM   272  N  NE2   . GLN A 1 37  ? 4.693   -7.270  -23.603 1.00 63.37 ? 68  GLN A NE2   1 
ATOM   273  N  N     . TYR A 1 38  ? 6.444   -13.273 -26.412 1.00 55.98 ? 69  TYR A N     1 
ATOM   274  C  CA    . TYR A 1 38  ? 5.980   -14.664 -26.500 1.00 55.61 ? 69  TYR A CA    1 
ATOM   275  C  C     . TYR A 1 38  ? 7.087   -15.686 -26.274 1.00 55.63 ? 69  TYR A C     1 
ATOM   276  O  O     . TYR A 1 38  ? 6.820   -16.878 -26.168 1.00 55.62 ? 69  TYR A O     1 
ATOM   277  C  CB    . TYR A 1 38  ? 5.280   -14.921 -27.835 1.00 55.23 ? 69  TYR A CB    1 
ATOM   278  C  CG    . TYR A 1 38  ? 3.824   -14.557 -27.782 1.00 55.35 ? 69  TYR A CG    1 
ATOM   279  C  CD1   . TYR A 1 38  ? 3.390   -13.279 -28.117 1.00 54.87 ? 69  TYR A CD1   1 
ATOM   280  C  CD2   . TYR A 1 38  ? 2.876   -15.485 -27.355 1.00 55.65 ? 69  TYR A CD2   1 
ATOM   281  C  CE1   . TYR A 1 38  ? 2.056   -12.937 -28.040 1.00 54.85 ? 69  TYR A CE1   1 
ATOM   282  C  CE2   . TYR A 1 38  ? 1.540   -15.154 -27.274 1.00 55.25 ? 69  TYR A CE2   1 
ATOM   283  C  CZ    . TYR A 1 38  ? 1.131   -13.878 -27.617 1.00 55.31 ? 69  TYR A CZ    1 
ATOM   284  O  OH    . TYR A 1 38  ? -0.213  -13.560 -27.553 1.00 55.49 ? 69  TYR A OH    1 
ATOM   285  N  N     . LYS A 1 39  ? 8.321   -15.215 -26.179 1.00 55.83 ? 70  LYS A N     1 
ATOM   286  C  CA    . LYS A 1 39  ? 9.487   -16.087 -26.062 1.00 56.17 ? 70  LYS A CA    1 
ATOM   287  C  C     . LYS A 1 39  ? 9.336   -17.004 -24.855 1.00 55.58 ? 70  LYS A C     1 
ATOM   288  O  O     . LYS A 1 39  ? 9.463   -18.215 -24.952 1.00 55.45 ? 70  LYS A O     1 
ATOM   289  C  CB    . LYS A 1 39  ? 10.721  -15.201 -25.941 1.00 56.34 ? 70  LYS A CB    1 
ATOM   290  C  CG    . LYS A 1 39  ? 12.084  -15.850 -26.069 1.00 57.53 ? 70  LYS A CG    1 
ATOM   291  C  CD    . LYS A 1 39  ? 13.155  -14.751 -25.861 1.00 57.85 ? 70  LYS A CD    1 
ATOM   292  C  CE    . LYS A 1 39  ? 14.564  -15.285 -25.872 1.00 59.81 ? 70  LYS A CE    1 
ATOM   293  N  NZ    . LYS A 1 39  ? 15.515  -14.269 -25.342 1.00 61.47 ? 70  LYS A NZ    1 
ATOM   294  N  N     . VAL A 1 40  ? 9.010   -16.419 -23.717 1.00 55.52 ? 71  VAL A N     1 
ATOM   295  C  CA    . VAL A 1 40  ? 8.804   -17.189 -22.502 1.00 55.31 ? 71  VAL A CA    1 
ATOM   296  C  C     . VAL A 1 40  ? 7.721   -18.258 -22.700 1.00 54.88 ? 71  VAL A C     1 
ATOM   297  O  O     . VAL A 1 40  ? 7.842   -19.358 -22.180 1.00 55.21 ? 71  VAL A O     1 
ATOM   298  C  CB    . VAL A 1 40  ? 8.459   -16.264 -21.304 1.00 55.24 ? 71  VAL A CB    1 
ATOM   299  C  CG1   . VAL A 1 40  ? 7.111   -15.596 -21.513 1.00 55.52 ? 71  VAL A CG1   1 
ATOM   300  C  CG2   . VAL A 1 40  ? 8.455   -17.052 -20.012 1.00 56.21 ? 71  VAL A CG2   1 
ATOM   301  N  N     . VAL A 1 41  ? 6.680   -17.940 -23.465 1.00 54.49 ? 72  VAL A N     1 
ATOM   302  C  CA    . VAL A 1 41  ? 5.557   -18.862 -23.688 1.00 53.94 ? 72  VAL A CA    1 
ATOM   303  C  C     . VAL A 1 41  ? 5.946   -20.027 -24.596 1.00 53.85 ? 72  VAL A C     1 
ATOM   304  O  O     . VAL A 1 41  ? 5.512   -21.159 -24.391 1.00 54.10 ? 72  VAL A O     1 
ATOM   305  C  CB    . VAL A 1 41  ? 4.343   -18.141 -24.315 1.00 53.93 ? 72  VAL A CB    1 
ATOM   306  C  CG1   . VAL A 1 41  ? 3.141   -19.101 -24.449 1.00 53.37 ? 72  VAL A CG1   1 
ATOM   307  C  CG2   . VAL A 1 41  ? 3.975   -16.911 -23.503 1.00 53.33 ? 72  VAL A CG2   1 
ATOM   308  N  N     . VAL A 1 42  ? 6.752   -19.752 -25.612 1.00 53.56 ? 73  VAL A N     1 
ATOM   309  C  CA    . VAL A 1 42  ? 7.308   -20.815 -26.435 1.00 53.25 ? 73  VAL A CA    1 
ATOM   310  C  C     . VAL A 1 42  ? 8.146   -21.769 -25.581 1.00 53.33 ? 73  VAL A C     1 
ATOM   311  O  O     . VAL A 1 42  ? 8.048   -22.984 -25.713 1.00 53.18 ? 73  VAL A O     1 
ATOM   312  C  CB    . VAL A 1 42  ? 8.171   -20.246 -27.584 1.00 53.24 ? 73  VAL A CB    1 
ATOM   313  C  CG1   . VAL A 1 42  ? 8.986   -21.350 -28.244 1.00 52.88 ? 73  VAL A CG1   1 
ATOM   314  C  CG2   . VAL A 1 42  ? 7.292   -19.552 -28.607 1.00 52.58 ? 73  VAL A CG2   1 
ATOM   315  N  N     . TYR A 1 43  ? 8.969   -21.225 -24.694 1.00 53.39 ? 74  TYR A N     1 
ATOM   316  C  CA    . TYR A 1 43  ? 9.837   -22.076 -23.909 1.00 53.51 ? 74  TYR A CA    1 
ATOM   317  C  C     . TYR A 1 43  ? 9.034   -22.916 -22.916 1.00 53.77 ? 74  TYR A C     1 
ATOM   318  O  O     . TYR A 1 43  ? 9.323   -24.096 -22.718 1.00 53.91 ? 74  TYR A O     1 
ATOM   319  C  CB    . TYR A 1 43  ? 10.912  -21.252 -23.200 1.00 53.67 ? 74  TYR A CB    1 
ATOM   320  C  CG    . TYR A 1 43  ? 11.984  -20.690 -24.107 1.00 53.52 ? 74  TYR A CG    1 
ATOM   321  C  CD1   . TYR A 1 43  ? 12.150  -21.153 -25.411 1.00 53.90 ? 74  TYR A CD1   1 
ATOM   322  C  CD2   . TYR A 1 43  ? 12.858  -19.713 -23.649 1.00 53.88 ? 74  TYR A CD2   1 
ATOM   323  C  CE1   . TYR A 1 43  ? 13.136  -20.652 -26.229 1.00 53.64 ? 74  TYR A CE1   1 
ATOM   324  C  CE2   . TYR A 1 43  ? 13.857  -19.197 -24.474 1.00 54.24 ? 74  TYR A CE2   1 
ATOM   325  C  CZ    . TYR A 1 43  ? 13.984  -19.679 -25.765 1.00 54.25 ? 74  TYR A CZ    1 
ATOM   326  O  OH    . TYR A 1 43  ? 14.960  -19.209 -26.608 1.00 54.62 ? 74  TYR A OH    1 
ATOM   327  N  N     . SER A 1 44  ? 8.016   -22.314 -22.311 1.00 53.71 ? 75  SER A N     1 
ATOM   328  C  CA    . SER A 1 44  ? 7.181   -23.027 -21.372 1.00 53.53 ? 75  SER A CA    1 
ATOM   329  C  C     . SER A 1 44  ? 6.426   -24.110 -22.127 1.00 53.45 ? 75  SER A C     1 
ATOM   330  O  O     . SER A 1 44  ? 6.433   -25.267 -21.721 1.00 53.30 ? 75  SER A O     1 
ATOM   331  C  CB    . SER A 1 44  ? 6.230   -22.074 -20.649 1.00 53.57 ? 75  SER A CB    1 
ATOM   332  O  OG    . SER A 1 44  ? 5.032   -22.734 -20.283 1.00 54.56 ? 75  SER A OG    1 
ATOM   333  N  N     . ASN A 1 45  ? 5.797   -23.752 -23.240 1.00 53.47 ? 76  ASN A N     1 
ATOM   334  C  CA    . ASN A 1 45  ? 5.095   -24.753 -24.049 1.00 53.42 ? 76  ASN A CA    1 
ATOM   335  C  C     . ASN A 1 45  ? 6.036   -25.909 -24.410 1.00 53.81 ? 76  ASN A C     1 
ATOM   336  O  O     . ASN A 1 45  ? 5.616   -27.064 -24.411 1.00 53.97 ? 76  ASN A O     1 
ATOM   337  C  CB    . ASN A 1 45  ? 4.531   -24.151 -25.348 1.00 53.17 ? 76  ASN A CB    1 
ATOM   338  C  CG    . ASN A 1 45  ? 3.247   -23.337 -25.157 1.00 52.57 ? 76  ASN A CG    1 
ATOM   339  O  OD1   . ASN A 1 45  ? 2.726   -22.798 -26.123 1.00 54.44 ? 76  ASN A OD1   1 
ATOM   340  N  ND2   . ASN A 1 45  ? 2.747   -23.239 -23.948 1.00 51.90 ? 76  ASN A ND2   1 
ATOM   341  N  N     . THR A 1 46  ? 7.300   -25.596 -24.723 1.00 54.04 ? 77  THR A N     1 
ATOM   342  C  CA    . THR A 1 46  ? 8.258   -26.604 -25.204 1.00 54.07 ? 77  THR A CA    1 
ATOM   343  C  C     . THR A 1 46  ? 8.695   -27.523 -24.083 1.00 54.40 ? 77  THR A C     1 
ATOM   344  O  O     . THR A 1 46  ? 8.769   -28.733 -24.262 1.00 54.66 ? 77  THR A O     1 
ATOM   345  C  CB    . THR A 1 46  ? 9.505   -25.953 -25.858 1.00 54.17 ? 77  THR A CB    1 
ATOM   346  O  OG1   . THR A 1 46  ? 9.091   -25.180 -26.988 1.00 54.21 ? 77  THR A OG1   1 
ATOM   347  C  CG2   . THR A 1 46  ? 10.504  -26.996 -26.325 1.00 52.51 ? 77  THR A CG2   1 
ATOM   348  N  N     . ILE A 1 47  ? 8.968   -26.936 -22.926 1.00 54.67 ? 78  ILE A N     1 
ATOM   349  C  CA    . ILE A 1 47  ? 9.314   -27.689 -21.729 1.00 54.92 ? 78  ILE A CA    1 
ATOM   350  C  C     . ILE A 1 47  ? 8.151   -28.544 -21.213 1.00 55.75 ? 78  ILE A C     1 
ATOM   351  O  O     . ILE A 1 47  ? 8.333   -29.724 -20.930 1.00 56.14 ? 78  ILE A O     1 
ATOM   352  C  CB    . ILE A 1 47  ? 9.787   -26.743 -20.612 1.00 54.64 ? 78  ILE A CB    1 
ATOM   353  C  CG1   . ILE A 1 47  ? 11.106  -26.076 -21.013 1.00 54.50 ? 78  ILE A CG1   1 
ATOM   354  C  CG2   . ILE A 1 47  ? 9.976   -27.499 -19.325 1.00 54.58 ? 78  ILE A CG2   1 
ATOM   355  C  CD1   . ILE A 1 47  ? 11.418  -24.834 -20.233 1.00 54.48 ? 78  ILE A CD1   1 
ATOM   356  N  N     . GLN A 1 48  ? 6.959   -27.968 -21.081 1.00 56.62 ? 79  GLN A N     1 
ATOM   357  C  CA    . GLN A 1 48  ? 5.826   -28.730 -20.538 1.00 57.11 ? 79  GLN A CA    1 
ATOM   358  C  C     . GLN A 1 48  ? 5.449   -29.893 -21.457 1.00 56.61 ? 79  GLN A C     1 
ATOM   359  O  O     . GLN A 1 48  ? 4.968   -30.935 -20.983 1.00 56.66 ? 79  GLN A O     1 
ATOM   360  C  CB    . GLN A 1 48  ? 4.605   -27.837 -20.266 1.00 57.57 ? 79  GLN A CB    1 
ATOM   361  C  CG    . GLN A 1 48  ? 4.803   -26.776 -19.149 1.00 60.16 ? 79  GLN A CG    1 
ATOM   362  C  CD    . GLN A 1 48  ? 5.431   -27.326 -17.841 1.00 63.79 ? 79  GLN A CD    1 
ATOM   363  O  OE1   . GLN A 1 48  ? 4.974   -28.333 -17.274 1.00 64.97 ? 79  GLN A OE1   1 
ATOM   364  N  NE2   . GLN A 1 48  ? 6.474   -26.640 -17.355 1.00 65.75 ? 79  GLN A NE2   1 
ATOM   365  N  N     . SER A 1 49  ? 5.694   -29.726 -22.754 1.00 55.85 ? 80  SER A N     1 
ATOM   366  C  CA    . SER A 1 49  ? 5.419   -30.779 -23.730 1.00 55.53 ? 80  SER A CA    1 
ATOM   367  C  C     . SER A 1 49  ? 6.359   -31.949 -23.531 1.00 55.16 ? 80  SER A C     1 
ATOM   368  O  O     . SER A 1 49  ? 5.917   -33.089 -23.417 1.00 55.50 ? 80  SER A O     1 
ATOM   369  C  CB    . SER A 1 49  ? 5.550   -30.260 -25.164 1.00 55.47 ? 80  SER A CB    1 
ATOM   370  O  OG    . SER A 1 49  ? 4.549   -29.289 -25.438 1.00 55.56 ? 80  SER A OG    1 
ATOM   371  N  N     . ILE A 1 50  ? 7.655   -31.677 -23.468 1.00 54.49 ? 81  ILE A N     1 
ATOM   372  C  CA    . ILE A 1 50  ? 8.613   -32.754 -23.296 1.00 53.96 ? 81  ILE A CA    1 
ATOM   373  C  C     . ILE A 1 50  ? 8.429   -33.428 -21.933 1.00 53.97 ? 81  ILE A C     1 
ATOM   374  O  O     . ILE A 1 50  ? 8.627   -34.638 -21.808 1.00 54.43 ? 81  ILE A O     1 
ATOM   375  C  CB    . ILE A 1 50  ? 10.063  -32.290 -23.525 1.00 53.57 ? 81  ILE A CB    1 
ATOM   376  C  CG1   . ILE A 1 50  ? 11.023  -33.485 -23.516 1.00 53.55 ? 81  ILE A CG1   1 
ATOM   377  C  CG2   . ILE A 1 50  ? 10.472  -31.292 -22.489 1.00 53.36 ? 81  ILE A CG2   1 
ATOM   378  C  CD1   . ILE A 1 50  ? 10.668  -34.601 -24.479 1.00 52.48 ? 81  ILE A CD1   1 
ATOM   379  N  N     . ILE A 1 51  ? 8.015   -32.665 -20.929 1.00 53.66 ? 82  ILE A N     1 
ATOM   380  C  CA    . ILE A 1 51  ? 7.758   -33.231 -19.611 1.00 53.48 ? 82  ILE A CA    1 
ATOM   381  C  C     . ILE A 1 51  ? 6.537   -34.150 -19.647 1.00 53.45 ? 82  ILE A C     1 
ATOM   382  O  O     . ILE A 1 51  ? 6.560   -35.246 -19.068 1.00 53.58 ? 82  ILE A O     1 
ATOM   383  C  CB    . ILE A 1 51  ? 7.571   -32.121 -18.544 1.00 53.67 ? 82  ILE A CB    1 
ATOM   384  C  CG1   . ILE A 1 51  ? 8.937   -31.561 -18.133 1.00 53.73 ? 82  ILE A CG1   1 
ATOM   385  C  CG2   . ILE A 1 51  ? 6.822   -32.644 -17.312 1.00 52.68 ? 82  ILE A CG2   1 
ATOM   386  C  CD1   . ILE A 1 51  ? 8.866   -30.490 -17.045 1.00 53.31 ? 82  ILE A CD1   1 
ATOM   387  N  N     . ALA A 1 52  ? 5.480   -33.709 -20.327 1.00 53.20 ? 83  ALA A N     1 
ATOM   388  C  CA    . ALA A 1 52  ? 4.240   -34.489 -20.414 1.00 53.02 ? 83  ALA A CA    1 
ATOM   389  C  C     . ALA A 1 52  ? 4.523   -35.866 -21.004 1.00 53.07 ? 83  ALA A C     1 
ATOM   390  O  O     . ALA A 1 52  ? 4.033   -36.887 -20.501 1.00 53.18 ? 83  ALA A O     1 
ATOM   391  C  CB    . ALA A 1 52  ? 3.193   -33.758 -21.239 1.00 52.48 ? 83  ALA A CB    1 
ATOM   392  N  N     . ILE A 1 53  ? 5.354   -35.885 -22.043 1.00 53.16 ? 84  ILE A N     1 
ATOM   393  C  CA    . ILE A 1 53  ? 5.737   -37.131 -22.692 1.00 53.16 ? 84  ILE A CA    1 
ATOM   394  C  C     . ILE A 1 53  ? 6.494   -38.022 -21.713 1.00 53.32 ? 84  ILE A C     1 
ATOM   395  O  O     . ILE A 1 53  ? 6.212   -39.206 -21.616 1.00 53.61 ? 84  ILE A O     1 
ATOM   396  C  CB    . ILE A 1 53  ? 6.597   -36.902 -23.950 1.00 52.87 ? 84  ILE A CB    1 
ATOM   397  C  CG1   . ILE A 1 53  ? 5.868   -36.034 -24.965 1.00 52.35 ? 84  ILE A CG1   1 
ATOM   398  C  CG2   . ILE A 1 53  ? 6.879   -38.212 -24.624 1.00 53.25 ? 84  ILE A CG2   1 
ATOM   399  C  CD1   . ILE A 1 53  ? 6.743   -35.568 -26.071 1.00 51.34 ? 84  ILE A CD1   1 
ATOM   400  N  N     . ILE A 1 54  ? 7.430   -37.451 -20.970 1.00 53.50 ? 85  ILE A N     1 
ATOM   401  C  CA    . ILE A 1 54  ? 8.246   -38.244 -20.056 1.00 53.87 ? 85  ILE A CA    1 
ATOM   402  C  C     . ILE A 1 54  ? 7.448   -38.813 -18.877 1.00 54.16 ? 85  ILE A C     1 
ATOM   403  O  O     . ILE A 1 54  ? 7.713   -39.926 -18.434 1.00 54.17 ? 85  ILE A O     1 
ATOM   404  C  CB    . ILE A 1 54  ? 9.447   -37.435 -19.551 1.00 54.00 ? 85  ILE A CB    1 
ATOM   405  C  CG1   . ILE A 1 54  ? 10.449  -37.257 -20.692 1.00 54.52 ? 85  ILE A CG1   1 
ATOM   406  C  CG2   . ILE A 1 54  ? 10.113  -38.129 -18.371 1.00 53.66 ? 85  ILE A CG2   1 
ATOM   407  C  CD1   . ILE A 1 54  ? 11.470  -36.195 -20.426 1.00 55.75 ? 85  ILE A CD1   1 
ATOM   408  N  N     . ARG A 1 55  ? 6.479   -38.060 -18.368 1.00 54.44 ? 86  ARG A N     1 
ATOM   409  C  CA    . ARG A 1 55  ? 5.597   -38.586 -17.324 1.00 54.76 ? 86  ARG A CA    1 
ATOM   410  C  C     . ARG A 1 55  ? 4.715   -39.690 -17.884 1.00 55.04 ? 86  ARG A C     1 
ATOM   411  O  O     . ARG A 1 55  ? 4.417   -40.662 -17.192 1.00 55.32 ? 86  ARG A O     1 
ATOM   412  C  CB    . ARG A 1 55  ? 4.720   -37.486 -16.721 1.00 54.80 ? 86  ARG A CB    1 
ATOM   413  C  CG    . ARG A 1 55  ? 5.429   -36.601 -15.705 1.00 55.14 ? 86  ARG A CG    1 
ATOM   414  C  CD    . ARG A 1 55  ? 4.733   -35.256 -15.579 1.00 55.81 ? 86  ARG A CD    1 
ATOM   415  N  NE    . ARG A 1 55  ? 5.139   -34.501 -14.393 1.00 55.51 ? 86  ARG A NE    1 
ATOM   416  C  CZ    . ARG A 1 55  ? 4.843   -33.221 -14.191 1.00 55.20 ? 86  ARG A CZ    1 
ATOM   417  N  NH1   . ARG A 1 55  ? 4.132   -32.530 -15.076 1.00 54.81 ? 86  ARG A NH1   1 
ATOM   418  N  NH2   . ARG A 1 55  ? 5.256   -32.624 -13.088 1.00 56.32 ? 86  ARG A NH2   1 
ATOM   419  N  N     . ALA A 1 56  ? 4.298   -39.536 -19.138 1.00 55.41 ? 87  ALA A N     1 
ATOM   420  C  CA    . ALA A 1 56  ? 3.493   -40.549 -19.803 1.00 55.68 ? 87  ALA A CA    1 
ATOM   421  C  C     . ALA A 1 56  ? 4.252   -41.877 -19.899 1.00 56.18 ? 87  ALA A C     1 
ATOM   422  O  O     . ALA A 1 56  ? 3.677   -42.943 -19.673 1.00 56.42 ? 87  ALA A O     1 
ATOM   423  C  CB    . ALA A 1 56  ? 3.078   -40.068 -21.171 1.00 55.63 ? 87  ALA A CB    1 
ATOM   424  N  N     . MET A 1 57  ? 5.545   -41.814 -20.205 1.00 56.53 ? 88  MET A N     1 
ATOM   425  C  CA    . MET A 1 57  ? 6.369   -43.018 -20.260 1.00 56.97 ? 88  MET A CA    1 
ATOM   426  C  C     . MET A 1 57  ? 6.310   -43.808 -18.940 1.00 57.60 ? 88  MET A C     1 
ATOM   427  O  O     . MET A 1 57  ? 6.257   -45.042 -18.944 1.00 57.59 ? 88  MET A O     1 
ATOM   428  C  CB    . MET A 1 57  ? 7.824   -42.660 -20.570 1.00 57.08 ? 88  MET A CB    1 
ATOM   429  C  CG    . MET A 1 57  ? 8.057   -42.085 -21.955 1.00 56.88 ? 88  MET A CG    1 
ATOM   430  S  SD    . MET A 1 57  ? 9.793   -41.704 -22.226 1.00 56.36 ? 88  MET A SD    1 
ATOM   431  C  CE    . MET A 1 57  ? 10.493  -43.355 -22.240 1.00 56.58 ? 88  MET A CE    1 
ATOM   432  N  N     . GLY A 1 58  ? 6.327   -43.088 -17.819 1.00 58.06 ? 89  GLY A N     1 
ATOM   433  C  CA    . GLY A 1 58  ? 6.233   -43.703 -16.500 1.00 58.38 ? 89  GLY A CA    1 
ATOM   434  C  C     . GLY A 1 58  ? 4.901   -44.386 -16.258 1.00 58.75 ? 89  GLY A C     1 
ATOM   435  O  O     . GLY A 1 58  ? 4.855   -45.483 -15.715 1.00 58.56 ? 89  GLY A O     1 
ATOM   436  N  N     . ARG A 1 59  ? 3.813   -43.732 -16.652 1.00 59.38 ? 90  ARG A N     1 
ATOM   437  C  CA    . ARG A 1 59  ? 2.487   -44.334 -16.533 1.00 59.91 ? 90  ARG A CA    1 
ATOM   438  C  C     . ARG A 1 59  ? 2.362   -45.519 -17.488 1.00 59.89 ? 90  ARG A C     1 
ATOM   439  O  O     . ARG A 1 59  ? 2.109   -46.640 -17.047 1.00 59.94 ? 90  ARG A O     1 
ATOM   440  C  CB    . ARG A 1 59  ? 1.378   -43.303 -16.785 1.00 59.99 ? 90  ARG A CB    1 
ATOM   441  C  CG    . ARG A 1 59  ? 1.017   -42.441 -15.560 1.00 60.43 ? 90  ARG A CG    1 
ATOM   442  C  CD    . ARG A 1 59  ? 0.067   -41.310 -15.954 1.00 60.97 ? 90  ARG A CD    1 
ATOM   443  N  NE    . ARG A 1 59  ? 0.793   -40.228 -16.635 1.00 62.25 ? 90  ARG A NE    1 
ATOM   444  C  CZ    . ARG A 1 59  ? 0.363   -39.545 -17.699 1.00 62.52 ? 90  ARG A CZ    1 
ATOM   445  N  NH1   . ARG A 1 59  ? -0.816  -39.801 -18.268 1.00 62.54 ? 90  ARG A NH1   1 
ATOM   446  N  NH2   . ARG A 1 59  ? 1.138   -38.592 -18.216 1.00 63.73 ? 90  ARG A NH2   1 
ATOM   447  N  N     . LEU A 1 60  ? 2.582   -45.280 -18.782 1.00 59.98 ? 91  LEU A N     1 
ATOM   448  C  CA    . LEU A 1 60  ? 2.432   -46.328 -19.810 1.00 60.06 ? 91  LEU A CA    1 
ATOM   449  C  C     . LEU A 1 60  ? 3.510   -47.435 -19.804 1.00 60.15 ? 91  LEU A C     1 
ATOM   450  O  O     . LEU A 1 60  ? 3.399   -48.410 -20.560 1.00 60.20 ? 91  LEU A O     1 
ATOM   451  C  CB    . LEU A 1 60  ? 2.363   -45.697 -21.201 1.00 60.00 ? 91  LEU A CB    1 
ATOM   452  C  CG    . LEU A 1 60  ? 1.155   -44.794 -21.471 1.00 60.26 ? 91  LEU A CG    1 
ATOM   453  C  CD1   . LEU A 1 60  ? 1.199   -44.248 -22.906 1.00 59.15 ? 91  LEU A CD1   1 
ATOM   454  C  CD2   . LEU A 1 60  ? -0.156  -45.538 -21.202 1.00 59.91 ? 91  LEU A CD2   1 
ATOM   455  N  N     . LYS A 1 61  ? 4.536   -47.281 -18.963 1.00 60.09 ? 92  LYS A N     1 
ATOM   456  C  CA    . LYS A 1 61  ? 5.598   -48.288 -18.791 1.00 60.00 ? 92  LYS A CA    1 
ATOM   457  C  C     . LYS A 1 61  ? 6.421   -48.500 -20.068 1.00 59.84 ? 92  LYS A C     1 
ATOM   458  O  O     . LYS A 1 61  ? 6.747   -49.630 -20.415 1.00 60.27 ? 92  LYS A O     1 
ATOM   459  C  CB    . LYS A 1 61  ? 5.023   -49.623 -18.280 1.00 59.77 ? 92  LYS A CB    1 
ATOM   460  N  N     . ILE A 1 62  ? 6.751   -47.407 -20.754 1.00 59.54 ? 93  ILE A N     1 
ATOM   461  C  CA    . ILE A 1 62  ? 7.653   -47.435 -21.905 1.00 59.30 ? 93  ILE A CA    1 
ATOM   462  C  C     . ILE A 1 62  ? 9.071   -47.093 -21.451 1.00 59.39 ? 93  ILE A C     1 
ATOM   463  O  O     . ILE A 1 62  ? 9.291   -46.039 -20.864 1.00 59.53 ? 93  ILE A O     1 
ATOM   464  C  CB    . ILE A 1 62  ? 7.251   -46.392 -22.973 1.00 59.19 ? 93  ILE A CB    1 
ATOM   465  C  CG1   . ILE A 1 62  ? 5.790   -46.570 -23.402 1.00 59.32 ? 93  ILE A CG1   1 
ATOM   466  C  CG2   . ILE A 1 62  ? 8.169   -46.485 -24.186 1.00 58.57 ? 93  ILE A CG2   1 
ATOM   467  C  CD1   . ILE A 1 62  ? 5.296   -45.496 -24.376 1.00 59.01 ? 93  ILE A CD1   1 
ATOM   468  N  N     . ASP A 1 63  ? 10.032  -47.965 -21.736 1.00 59.45 ? 94  ASP A N     1 
ATOM   469  C  CA    . ASP A 1 63  ? 11.429  -47.705 -21.374 1.00 59.62 ? 94  ASP A CA    1 
ATOM   470  C  C     . ASP A 1 63  ? 12.097  -46.741 -22.340 1.00 59.60 ? 94  ASP A C     1 
ATOM   471  O  O     . ASP A 1 63  ? 11.643  -46.559 -23.476 1.00 59.60 ? 94  ASP A O     1 
ATOM   472  C  CB    . ASP A 1 63  ? 12.245  -49.003 -21.344 1.00 59.76 ? 94  ASP A CB    1 
ATOM   473  C  CG    . ASP A 1 63  ? 11.930  -49.870 -20.143 1.00 59.94 ? 94  ASP A CG    1 
ATOM   474  O  OD1   . ASP A 1 63  ? 10.837  -49.711 -19.562 1.00 60.78 ? 94  ASP A OD1   1 
ATOM   475  O  OD2   . ASP A 1 63  ? 12.777  -50.717 -19.786 1.00 60.37 ? 94  ASP A OD2   1 
ATOM   476  N  N     . PHE A 1 64  ? 13.188  -46.135 -21.875 1.00 59.57 ? 95  PHE A N     1 
ATOM   477  C  CA    . PHE A 1 64  ? 14.041  -45.314 -22.725 1.00 59.55 ? 95  PHE A CA    1 
ATOM   478  C  C     . PHE A 1 64  ? 14.796  -46.213 -23.679 1.00 59.63 ? 95  PHE A C     1 
ATOM   479  O  O     . PHE A 1 64  ? 15.169  -47.329 -23.316 1.00 59.59 ? 95  PHE A O     1 
ATOM   480  C  CB    . PHE A 1 64  ? 15.073  -44.542 -21.902 1.00 59.51 ? 95  PHE A CB    1 
ATOM   481  C  CG    . PHE A 1 64  ? 14.513  -43.372 -21.158 1.00 59.60 ? 95  PHE A CG    1 
ATOM   482  C  CD1   . PHE A 1 64  ? 14.129  -42.224 -21.840 1.00 59.43 ? 95  PHE A CD1   1 
ATOM   483  C  CD2   . PHE A 1 64  ? 14.392  -43.404 -19.774 1.00 59.42 ? 95  PHE A CD2   1 
ATOM   484  C  CE1   . PHE A 1 64  ? 13.617  -41.137 -21.158 1.00 59.27 ? 95  PHE A CE1   1 
ATOM   485  C  CE2   . PHE A 1 64  ? 13.882  -42.318 -19.082 1.00 59.39 ? 95  PHE A CE2   1 
ATOM   486  C  CZ    . PHE A 1 64  ? 13.493  -41.182 -19.773 1.00 59.37 ? 95  PHE A CZ    1 
ATOM   487  N  N     . GLY A 1 65  ? 15.038  -45.712 -24.887 1.00 59.78 ? 96  GLY A N     1 
ATOM   488  C  CA    . GLY A 1 65  ? 15.918  -46.376 -25.854 1.00 59.86 ? 96  GLY A CA    1 
ATOM   489  C  C     . GLY A 1 65  ? 17.346  -46.546 -25.359 1.00 59.89 ? 96  GLY A C     1 
ATOM   490  O  O     . GLY A 1 65  ? 18.027  -47.481 -25.762 1.00 60.06 ? 96  GLY A O     1 
ATOM   491  N  N     . GLU A 1 66  ? 17.801  -45.641 -24.492 1.00 60.00 ? 97  GLU A N     1 
ATOM   492  C  CA    . GLU A 1 66  ? 19.126  -45.743 -23.864 1.00 60.31 ? 97  GLU A CA    1 
ATOM   493  C  C     . GLU A 1 66  ? 19.064  -45.367 -22.381 1.00 59.96 ? 97  GLU A C     1 
ATOM   494  O  O     . GLU A 1 66  ? 18.287  -44.492 -21.995 1.00 60.11 ? 97  GLU A O     1 
ATOM   495  C  CB    . GLU A 1 66  ? 20.134  -44.836 -24.575 1.00 60.40 ? 97  GLU A CB    1 
ATOM   496  C  CG    . GLU A 1 66  ? 20.131  -44.955 -26.098 1.00 61.11 ? 97  GLU A CG    1 
ATOM   497  C  CD    . GLU A 1 66  ? 21.331  -44.278 -26.748 1.00 61.15 ? 97  GLU A CD    1 
ATOM   498  O  OE1   . GLU A 1 66  ? 21.126  -43.512 -27.718 1.00 62.24 ? 97  GLU A OE1   1 
ATOM   499  O  OE2   . GLU A 1 66  ? 22.473  -44.513 -26.289 1.00 61.83 ? 97  GLU A OE2   1 
ATOM   500  N  N     . ALA A 1 67  ? 19.891  -46.014 -21.561 1.00 59.43 ? 98  ALA A N     1 
ATOM   501  C  CA    . ALA A 1 67  ? 19.887  -45.780 -20.115 1.00 59.13 ? 98  ALA A CA    1 
ATOM   502  C  C     . ALA A 1 67  ? 20.346  -44.365 -19.725 1.00 58.84 ? 98  ALA A C     1 
ATOM   503  O  O     . ALA A 1 67  ? 19.856  -43.797 -18.742 1.00 58.78 ? 98  ALA A O     1 
ATOM   504  C  CB    . ALA A 1 67  ? 20.750  -46.827 -19.409 1.00 59.27 ? 98  ALA A CB    1 
ATOM   505  N  N     . ALA A 1 68  ? 21.275  -43.799 -20.495 1.00 58.41 ? 99  ALA A N     1 
ATOM   506  C  CA    . ALA A 1 68  ? 21.832  -42.471 -20.203 1.00 58.20 ? 99  ALA A CA    1 
ATOM   507  C  C     . ALA A 1 68  ? 20.777  -41.354 -20.198 1.00 58.00 ? 99  ALA A C     1 
ATOM   508  O  O     . ALA A 1 68  ? 20.990  -40.296 -19.608 1.00 58.15 ? 99  ALA A O     1 
ATOM   509  C  CB    . ALA A 1 68  ? 22.944  -42.140 -21.193 1.00 58.06 ? 99  ALA A CB    1 
ATOM   510  N  N     . ARG A 1 69  ? 19.646  -41.592 -20.856 1.00 57.58 ? 100 ARG A N     1 
ATOM   511  C  CA    . ARG A 1 69  ? 18.559  -40.618 -20.907 1.00 57.32 ? 100 ARG A CA    1 
ATOM   512  C  C     . ARG A 1 69  ? 17.869  -40.424 -19.563 1.00 56.97 ? 100 ARG A C     1 
ATOM   513  O  O     . ARG A 1 69  ? 17.264  -39.383 -19.326 1.00 56.81 ? 100 ARG A O     1 
ATOM   514  C  CB    . ARG A 1 69  ? 17.522  -41.034 -21.954 1.00 57.32 ? 100 ARG A CB    1 
ATOM   515  C  CG    . ARG A 1 69  ? 18.056  -41.104 -23.377 1.00 57.44 ? 100 ARG A CG    1 
ATOM   516  C  CD    . ARG A 1 69  ? 18.480  -39.733 -23.916 1.00 57.33 ? 100 ARG A CD    1 
ATOM   517  N  NE    . ARG A 1 69  ? 19.828  -39.345 -23.500 1.00 57.12 ? 100 ARG A NE    1 
ATOM   518  C  CZ    . ARG A 1 69  ? 20.955  -39.878 -23.964 1.00 56.79 ? 100 ARG A CZ    1 
ATOM   519  N  NH1   . ARG A 1 69  ? 22.122  -39.436 -23.509 1.00 56.90 ? 100 ARG A NH1   1 
ATOM   520  N  NH2   . ARG A 1 69  ? 20.931  -40.858 -24.860 1.00 56.45 ? 100 ARG A NH2   1 
ATOM   521  N  N     . ALA A 1 70  ? 17.950  -41.426 -18.695 1.00 56.67 ? 101 ALA A N     1 
ATOM   522  C  CA    . ALA A 1 70  ? 17.432  -41.309 -17.338 1.00 56.45 ? 101 ALA A CA    1 
ATOM   523  C  C     . ALA A 1 70  ? 18.057  -40.112 -16.624 1.00 56.19 ? 101 ALA A C     1 
ATOM   524  O  O     . ALA A 1 70  ? 17.370  -39.389 -15.906 1.00 56.17 ? 101 ALA A O     1 
ATOM   525  C  CB    . ALA A 1 70  ? 17.692  -42.587 -16.559 1.00 56.59 ? 101 ALA A CB    1 
ATOM   526  N  N     . ASP A 1 71  ? 19.354  -39.902 -16.837 1.00 55.86 ? 102 ASP A N     1 
ATOM   527  C  CA    . ASP A 1 71  ? 20.039  -38.740 -16.277 1.00 55.73 ? 102 ASP A CA    1 
ATOM   528  C  C     . ASP A 1 71  ? 19.573  -37.459 -16.957 1.00 55.18 ? 102 ASP A C     1 
ATOM   529  O  O     . ASP A 1 71  ? 19.382  -36.446 -16.300 1.00 55.38 ? 102 ASP A O     1 
ATOM   530  C  CB    . ASP A 1 71  ? 21.559  -38.896 -16.374 1.00 55.86 ? 102 ASP A CB    1 
ATOM   531  C  CG    . ASP A 1 71  ? 22.070  -40.092 -15.578 1.00 57.10 ? 102 ASP A CG    1 
ATOM   532  O  OD1   . ASP A 1 71  ? 21.253  -40.993 -15.267 1.00 58.24 ? 102 ASP A OD1   1 
ATOM   533  O  OD2   . ASP A 1 71  ? 23.283  -40.137 -15.262 1.00 58.53 ? 102 ASP A OD2   1 
ATOM   534  N  N     . ASP A 1 72  ? 19.372  -37.505 -18.266 1.00 54.61 ? 103 ASP A N     1 
ATOM   535  C  CA    . ASP A 1 72  ? 18.804  -36.363 -18.975 1.00 54.28 ? 103 ASP A CA    1 
ATOM   536  C  C     . ASP A 1 72  ? 17.397  -36.021 -18.474 1.00 53.91 ? 103 ASP A C     1 
ATOM   537  O  O     . ASP A 1 72  ? 17.014  -34.852 -18.441 1.00 53.94 ? 103 ASP A O     1 
ATOM   538  C  CB    . ASP A 1 72  ? 18.775  -36.617 -20.491 1.00 54.29 ? 103 ASP A CB    1 
ATOM   539  C  CG    . ASP A 1 72  ? 20.132  -36.427 -21.148 1.00 54.12 ? 103 ASP A CG    1 
ATOM   540  O  OD1   . ASP A 1 72  ? 21.016  -35.785 -20.549 1.00 54.36 ? 103 ASP A OD1   1 
ATOM   541  O  OD2   . ASP A 1 72  ? 20.318  -36.910 -22.280 1.00 54.05 ? 103 ASP A OD2   1 
ATOM   542  N  N     . ALA A 1 73  ? 16.632  -37.040 -18.093 1.00 53.44 ? 104 ALA A N     1 
ATOM   543  C  CA    . ALA A 1 73  ? 15.282  -36.838 -17.571 1.00 52.98 ? 104 ALA A CA    1 
ATOM   544  C  C     . ALA A 1 73  ? 15.336  -36.073 -16.252 1.00 52.75 ? 104 ALA A C     1 
ATOM   545  O  O     . ALA A 1 73  ? 14.625  -35.094 -16.055 1.00 52.36 ? 104 ALA A O     1 
ATOM   546  C  CB    . ALA A 1 73  ? 14.590  -38.170 -17.378 1.00 52.71 ? 104 ALA A CB    1 
ATOM   547  N  N     . ARG A 1 74  ? 16.196  -36.522 -15.350 1.00 52.53 ? 105 ARG A N     1 
ATOM   548  C  CA    . ARG A 1 74  ? 16.368  -35.838 -14.082 1.00 52.55 ? 105 ARG A CA    1 
ATOM   549  C  C     . ARG A 1 74  ? 16.714  -34.369 -14.304 1.00 52.41 ? 105 ARG A C     1 
ATOM   550  O  O     . ARG A 1 74  ? 16.110  -33.478 -13.716 1.00 52.52 ? 105 ARG A O     1 
ATOM   551  C  CB    . ARG A 1 74  ? 17.467  -36.503 -13.268 1.00 52.41 ? 105 ARG A CB    1 
ATOM   552  C  CG    . ARG A 1 74  ? 17.519  -36.021 -11.848 1.00 52.65 ? 105 ARG A CG    1 
ATOM   553  C  CD    . ARG A 1 74  ? 18.803  -36.441 -11.184 1.00 53.31 ? 105 ARG A CD    1 
ATOM   554  N  NE    . ARG A 1 74  ? 19.955  -35.795 -11.814 1.00 53.90 ? 105 ARG A NE    1 
ATOM   555  C  CZ    . ARG A 1 74  ? 20.996  -36.425 -12.355 1.00 54.03 ? 105 ARG A CZ    1 
ATOM   556  N  NH1   . ARG A 1 74  ? 21.970  -35.708 -12.902 1.00 53.64 ? 105 ARG A NH1   1 
ATOM   557  N  NH2   . ARG A 1 74  ? 21.089  -37.755 -12.343 1.00 54.52 ? 105 ARG A NH2   1 
ATOM   558  N  N     . GLN A 1 75  ? 17.680  -34.127 -15.178 1.00 52.32 ? 106 GLN A N     1 
ATOM   559  C  CA    . GLN A 1 75  ? 18.206  -32.785 -15.389 1.00 52.30 ? 106 GLN A CA    1 
ATOM   560  C  C     . GLN A 1 75  ? 17.156  -31.860 -16.009 1.00 51.94 ? 106 GLN A C     1 
ATOM   561  O  O     . GLN A 1 75  ? 17.196  -30.648 -15.812 1.00 51.77 ? 106 GLN A O     1 
ATOM   562  C  CB    . GLN A 1 75  ? 19.465  -32.858 -16.266 1.00 52.50 ? 106 GLN A CB    1 
ATOM   563  C  CG    . GLN A 1 75  ? 20.486  -31.741 -16.039 1.00 53.45 ? 106 GLN A CG    1 
ATOM   564  C  CD    . GLN A 1 75  ? 20.988  -31.645 -14.604 1.00 53.78 ? 106 GLN A CD    1 
ATOM   565  O  OE1   . GLN A 1 75  ? 20.933  -32.613 -13.843 1.00 55.15 ? 106 GLN A OE1   1 
ATOM   566  N  NE2   . GLN A 1 75  ? 21.474  -30.465 -14.230 1.00 53.66 ? 106 GLN A NE2   1 
ATOM   567  N  N     . LEU A 1 76  ? 16.219  -32.443 -16.753 1.00 51.58 ? 107 LEU A N     1 
ATOM   568  C  CA    . LEU A 1 76  ? 15.115  -31.697 -17.315 1.00 51.07 ? 107 LEU A CA    1 
ATOM   569  C  C     . LEU A 1 76  ? 14.324  -31.055 -16.187 1.00 51.35 ? 107 LEU A C     1 
ATOM   570  O  O     . LEU A 1 76  ? 14.039  -29.867 -16.217 1.00 51.44 ? 107 LEU A O     1 
ATOM   571  C  CB    . LEU A 1 76  ? 14.212  -32.618 -18.139 1.00 50.77 ? 107 LEU A CB    1 
ATOM   572  C  CG    . LEU A 1 76  ? 12.911  -32.009 -18.671 1.00 50.20 ? 107 LEU A CG    1 
ATOM   573  C  CD1   . LEU A 1 76  ? 13.212  -30.879 -19.612 1.00 49.11 ? 107 LEU A CD1   1 
ATOM   574  C  CD2   . LEU A 1 76  ? 12.018  -33.047 -19.357 1.00 50.64 ? 107 LEU A CD2   1 
ATOM   575  N  N     . PHE A 1 77  ? 13.971  -31.844 -15.185 1.00 51.50 ? 108 PHE A N     1 
ATOM   576  C  CA    . PHE A 1 77  ? 13.168  -31.326 -14.098 1.00 51.80 ? 108 PHE A CA    1 
ATOM   577  C  C     . PHE A 1 77  ? 13.967  -30.366 -13.225 1.00 52.40 ? 108 PHE A C     1 
ATOM   578  O  O     . PHE A 1 77  ? 13.415  -29.401 -12.705 1.00 52.48 ? 108 PHE A O     1 
ATOM   579  C  CB    . PHE A 1 77  ? 12.595  -32.463 -13.267 1.00 51.49 ? 108 PHE A CB    1 
ATOM   580  C  CG    . PHE A 1 77  ? 11.587  -33.285 -13.996 1.00 51.22 ? 108 PHE A CG    1 
ATOM   581  C  CD1   . PHE A 1 77  ? 10.294  -32.825 -14.164 1.00 50.68 ? 108 PHE A CD1   1 
ATOM   582  C  CD2   . PHE A 1 77  ? 11.925  -34.530 -14.512 1.00 51.65 ? 108 PHE A CD2   1 
ATOM   583  C  CE1   . PHE A 1 77  ? 9.350   -33.591 -14.839 1.00 50.76 ? 108 PHE A CE1   1 
ATOM   584  C  CE2   . PHE A 1 77  ? 10.987  -35.306 -15.187 1.00 50.92 ? 108 PHE A CE2   1 
ATOM   585  C  CZ    . PHE A 1 77  ? 9.701   -34.838 -15.349 1.00 50.74 ? 108 PHE A CZ    1 
ATOM   586  N  N     . VAL A 1 78  ? 15.262  -30.614 -13.076 1.00 53.12 ? 109 VAL A N     1 
ATOM   587  C  CA    . VAL A 1 78  ? 16.116  -29.692 -12.337 1.00 53.90 ? 109 VAL A CA    1 
ATOM   588  C  C     . VAL A 1 78  ? 16.116  -28.295 -12.978 1.00 54.73 ? 109 VAL A C     1 
ATOM   589  O  O     . VAL A 1 78  ? 16.063  -27.288 -12.275 1.00 55.12 ? 109 VAL A O     1 
ATOM   590  C  CB    . VAL A 1 78  ? 17.568  -30.209 -12.238 1.00 53.84 ? 109 VAL A CB    1 
ATOM   591  C  CG1   . VAL A 1 78  ? 18.479  -29.137 -11.660 1.00 53.36 ? 109 VAL A CG1   1 
ATOM   592  C  CG2   . VAL A 1 78  ? 17.627  -31.473 -11.392 1.00 54.00 ? 109 VAL A CG2   1 
ATOM   593  N  N     . LEU A 1 79  ? 16.158  -28.237 -14.305 1.00 55.58 ? 110 LEU A N     1 
ATOM   594  C  CA    . LEU A 1 79  ? 16.267  -26.966 -15.014 1.00 56.25 ? 110 LEU A CA    1 
ATOM   595  C  C     . LEU A 1 79  ? 14.929  -26.432 -15.528 1.00 57.64 ? 110 LEU A C     1 
ATOM   596  O  O     . LEU A 1 79  ? 14.900  -25.430 -16.235 1.00 58.03 ? 110 LEU A O     1 
ATOM   597  C  CB    . LEU A 1 79  ? 17.234  -27.124 -16.191 1.00 55.99 ? 110 LEU A CB    1 
ATOM   598  C  CG    . LEU A 1 79  ? 18.651  -27.614 -15.868 1.00 54.88 ? 110 LEU A CG    1 
ATOM   599  C  CD1   . LEU A 1 79  ? 19.386  -27.929 -17.153 1.00 53.12 ? 110 LEU A CD1   1 
ATOM   600  C  CD2   . LEU A 1 79  ? 19.416  -26.593 -15.041 1.00 52.67 ? 110 LEU A CD2   1 
ATOM   601  N  N     . ALA A 1 80  ? 13.821  -27.080 -15.173 1.00 59.32 ? 111 ALA A N     1 
ATOM   602  C  CA    . ALA A 1 80  ? 12.507  -26.753 -15.757 1.00 60.47 ? 111 ALA A CA    1 
ATOM   603  C  C     . ALA A 1 80  ? 12.079  -25.297 -15.540 1.00 61.75 ? 111 ALA A C     1 
ATOM   604  O  O     . ALA A 1 80  ? 11.457  -24.699 -16.405 1.00 62.11 ? 111 ALA A O     1 
ATOM   605  C  CB    . ALA A 1 80  ? 11.442  -27.694 -15.218 1.00 60.27 ? 111 ALA A CB    1 
ATOM   606  N  N     . GLY A 1 81  ? 12.410  -24.728 -14.387 1.00 63.39 ? 112 GLY A N     1 
ATOM   607  C  CA    . GLY A 1 81  ? 12.085  -23.329 -14.100 1.00 64.56 ? 112 GLY A CA    1 
ATOM   608  C  C     . GLY A 1 81  ? 13.118  -22.315 -14.573 1.00 65.68 ? 112 GLY A C     1 
ATOM   609  O  O     . GLY A 1 81  ? 12.985  -21.120 -14.304 1.00 65.87 ? 112 GLY A O     1 
ATOM   610  N  N     . SER A 1 82  ? 14.141  -22.786 -15.283 1.00 66.99 ? 113 SER A N     1 
ATOM   611  C  CA    . SER A 1 82  ? 15.279  -21.953 -15.670 1.00 67.90 ? 113 SER A CA    1 
ATOM   612  C  C     . SER A 1 82  ? 14.936  -20.979 -16.806 1.00 68.47 ? 113 SER A C     1 
ATOM   613  O  O     . SER A 1 82  ? 15.638  -19.980 -17.004 1.00 68.52 ? 113 SER A O     1 
ATOM   614  C  CB    . SER A 1 82  ? 16.448  -22.853 -16.091 1.00 68.01 ? 113 SER A CB    1 
ATOM   615  O  OG    . SER A 1 82  ? 17.671  -22.137 -16.117 1.00 69.54 ? 113 SER A OG    1 
ATOM   616  N  N     . ALA A 1 83  ? 13.856  -21.270 -17.539 1.00 69.16 ? 114 ALA A N     1 
ATOM   617  C  CA    . ALA A 1 83  ? 13.466  -20.496 -18.720 1.00 69.55 ? 114 ALA A CA    1 
ATOM   618  C  C     . ALA A 1 83  ? 12.386  -19.430 -18.456 1.00 70.09 ? 114 ALA A C     1 
ATOM   619  O  O     . ALA A 1 83  ? 11.948  -18.752 -19.394 1.00 70.17 ? 114 ALA A O     1 
ATOM   620  C  CB    . ALA A 1 83  ? 13.014  -21.446 -19.827 1.00 69.28 ? 114 ALA A CB    1 
ATOM   621  N  N     . GLU A 1 84  ? 11.981  -19.261 -17.194 1.00 70.72 ? 115 GLU A N     1 
ATOM   622  C  CA    . GLU A 1 84  ? 10.876  -18.345 -16.836 1.00 71.25 ? 115 GLU A CA    1 
ATOM   623  C  C     . GLU A 1 84  ? 11.194  -16.859 -17.048 1.00 70.85 ? 115 GLU A C     1 
ATOM   624  O  O     . GLU A 1 84  ? 10.272  -16.041 -17.181 1.00 70.90 ? 115 GLU A O     1 
ATOM   625  C  CB    . GLU A 1 84  ? 10.398  -18.587 -15.393 1.00 71.62 ? 115 GLU A CB    1 
ATOM   626  C  CG    . GLU A 1 84  ? 9.892   -20.021 -15.177 1.00 73.67 ? 115 GLU A CG    1 
ATOM   627  C  CD    . GLU A 1 84  ? 8.489   -20.094 -14.588 1.00 76.18 ? 115 GLU A CD    1 
ATOM   628  O  OE1   . GLU A 1 84  ? 8.341   -19.837 -13.364 1.00 76.81 ? 115 GLU A OE1   1 
ATOM   629  O  OE2   . GLU A 1 84  ? 7.545   -20.431 -15.355 1.00 77.21 ? 115 GLU A OE2   1 
ATOM   630  N  N     . GLU A 1 85  ? 12.484  -16.518 -17.078 1.00 70.18 ? 116 GLU A N     1 
ATOM   631  C  CA    . GLU A 1 85  ? 12.918  -15.195 -17.525 1.00 69.62 ? 116 GLU A CA    1 
ATOM   632  C  C     . GLU A 1 85  ? 13.366  -15.225 -19.001 1.00 69.13 ? 116 GLU A C     1 
ATOM   633  O  O     . GLU A 1 85  ? 14.110  -14.357 -19.454 1.00 69.43 ? 116 GLU A O     1 
ATOM   634  C  CB    . GLU A 1 85  ? 14.006  -14.631 -16.596 1.00 69.63 ? 116 GLU A CB    1 
ATOM   635  C  CG    . GLU A 1 85  ? 13.491  -14.255 -15.199 1.00 69.24 ? 116 GLU A CG    1 
ATOM   636  N  N     . GLY A 1 86  ? 12.899  -16.223 -19.746 1.00 68.30 ? 117 GLY A N     1 
ATOM   637  C  CA    . GLY A 1 86  ? 13.045  -16.249 -21.190 1.00 67.62 ? 117 GLY A CA    1 
ATOM   638  C  C     . GLY A 1 86  ? 14.422  -16.591 -21.722 1.00 67.13 ? 117 GLY A C     1 
ATOM   639  O  O     . GLY A 1 86  ? 14.806  -16.113 -22.784 1.00 67.19 ? 117 GLY A O     1 
ATOM   640  N  N     . VAL A 1 87  ? 15.166  -17.425 -21.004 1.00 66.61 ? 118 VAL A N     1 
ATOM   641  C  CA    . VAL A 1 87  ? 16.456  -17.909 -21.495 1.00 66.10 ? 118 VAL A CA    1 
ATOM   642  C  C     . VAL A 1 87  ? 16.564  -19.430 -21.407 1.00 65.43 ? 118 VAL A C     1 
ATOM   643  O  O     . VAL A 1 87  ? 16.534  -20.002 -20.320 1.00 65.63 ? 118 VAL A O     1 
ATOM   644  C  CB    . VAL A 1 87  ? 17.645  -17.293 -20.725 1.00 66.20 ? 118 VAL A CB    1 
ATOM   645  C  CG1   . VAL A 1 87  ? 18.957  -17.663 -21.421 1.00 66.40 ? 118 VAL A CG1   1 
ATOM   646  C  CG2   . VAL A 1 87  ? 17.502  -15.776 -20.623 1.00 66.13 ? 118 VAL A CG2   1 
ATOM   647  N  N     . MET A 1 88  ? 16.695  -20.082 -22.558 1.00 64.71 ? 119 MET A N     1 
ATOM   648  C  CA    . MET A 1 88  ? 16.984  -21.513 -22.601 1.00 63.96 ? 119 MET A CA    1 
ATOM   649  C  C     . MET A 1 88  ? 18.495  -21.697 -22.630 1.00 63.04 ? 119 MET A C     1 
ATOM   650  O  O     . MET A 1 88  ? 19.136  -21.396 -23.631 1.00 62.92 ? 119 MET A O     1 
ATOM   651  C  CB    . MET A 1 88  ? 16.334  -22.167 -23.825 1.00 63.82 ? 119 MET A CB    1 
ATOM   652  C  CG    . MET A 1 88  ? 16.383  -23.686 -23.794 1.00 63.70 ? 119 MET A CG    1 
ATOM   653  S  SD    . MET A 1 88  ? 15.359  -24.452 -25.066 1.00 64.31 ? 119 MET A SD    1 
ATOM   654  C  CE    . MET A 1 88  ? 13.720  -24.141 -24.391 1.00 63.13 ? 119 MET A CE    1 
ATOM   655  N  N     . THR A 1 89  ? 19.057  -22.181 -21.525 1.00 62.27 ? 120 THR A N     1 
ATOM   656  C  CA    . THR A 1 89  ? 20.501  -22.392 -21.433 1.00 61.52 ? 120 THR A CA    1 
ATOM   657  C  C     . THR A 1 89  ? 20.886  -23.517 -22.379 1.00 61.13 ? 120 THR A C     1 
ATOM   658  O  O     . THR A 1 89  ? 20.079  -24.414 -22.640 1.00 61.05 ? 120 THR A O     1 
ATOM   659  C  CB    . THR A 1 89  ? 20.969  -22.767 -20.002 1.00 61.51 ? 120 THR A CB    1 
ATOM   660  O  OG1   . THR A 1 89  ? 20.583  -24.114 -19.695 1.00 61.18 ? 120 THR A OG1   1 
ATOM   661  C  CG2   . THR A 1 89  ? 20.393  -21.806 -18.958 1.00 60.90 ? 120 THR A CG2   1 
ATOM   662  N  N     . PRO A 1 90  ? 22.114  -23.470 -22.917 1.00 60.58 ? 121 PRO A N     1 
ATOM   663  C  CA    . PRO A 1 90  ? 22.551  -24.549 -23.799 1.00 60.21 ? 121 PRO A CA    1 
ATOM   664  C  C     . PRO A 1 90  ? 22.504  -25.914 -23.113 1.00 59.72 ? 121 PRO A C     1 
ATOM   665  O  O     . PRO A 1 90  ? 22.302  -26.932 -23.782 1.00 59.61 ? 121 PRO A O     1 
ATOM   666  C  CB    . PRO A 1 90  ? 23.993  -24.161 -24.157 1.00 60.17 ? 121 PRO A CB    1 
ATOM   667  C  CG    . PRO A 1 90  ? 24.388  -23.131 -23.172 1.00 60.54 ? 121 PRO A CG    1 
ATOM   668  C  CD    . PRO A 1 90  ? 23.144  -22.432 -22.761 1.00 60.58 ? 121 PRO A CD    1 
ATOM   669  N  N     . GLU A 1 91  ? 22.677  -25.925 -21.792 1.00 59.02 ? 122 GLU A N     1 
ATOM   670  C  CA    . GLU A 1 91  ? 22.563  -27.152 -21.015 1.00 58.79 ? 122 GLU A CA    1 
ATOM   671  C  C     . GLU A 1 91  ? 21.161  -27.736 -21.171 1.00 57.70 ? 122 GLU A C     1 
ATOM   672  O  O     . GLU A 1 91  ? 20.997  -28.913 -21.506 1.00 57.50 ? 122 GLU A O     1 
ATOM   673  C  CB    . GLU A 1 91  ? 22.880  -26.891 -19.538 1.00 58.78 ? 122 GLU A CB    1 
ATOM   674  C  CG    . GLU A 1 91  ? 23.373  -28.129 -18.791 1.00 59.64 ? 122 GLU A CG    1 
ATOM   675  C  CD    . GLU A 1 91  ? 23.421  -27.955 -17.265 1.00 60.65 ? 122 GLU A CD    1 
ATOM   676  O  OE1   . GLU A 1 91  ? 23.136  -26.840 -16.752 1.00 62.49 ? 122 GLU A OE1   1 
ATOM   677  O  OE2   . GLU A 1 91  ? 23.748  -28.953 -16.573 1.00 63.66 ? 122 GLU A OE2   1 
ATOM   678  N  N     . LEU A 1 92  ? 20.154  -26.896 -20.950 1.00 56.72 ? 123 LEU A N     1 
ATOM   679  C  CA    . LEU A 1 92  ? 18.758  -27.312 -21.085 1.00 55.84 ? 123 LEU A CA    1 
ATOM   680  C  C     . LEU A 1 92  ? 18.431  -27.704 -22.519 1.00 55.47 ? 123 LEU A C     1 
ATOM   681  O  O     . LEU A 1 92  ? 17.765  -28.710 -22.754 1.00 55.50 ? 123 LEU A O     1 
ATOM   682  C  CB    . LEU A 1 92  ? 17.808  -26.204 -20.609 1.00 55.69 ? 123 LEU A CB    1 
ATOM   683  C  CG    . LEU A 1 92  ? 16.319  -26.555 -20.577 1.00 55.04 ? 123 LEU A CG    1 
ATOM   684  C  CD1   . LEU A 1 92  ? 16.083  -27.856 -19.849 1.00 54.12 ? 123 LEU A CD1   1 
ATOM   685  C  CD2   . LEU A 1 92  ? 15.536  -25.438 -19.935 1.00 55.25 ? 123 LEU A CD2   1 
ATOM   686  N  N     . ALA A 1 93  ? 18.904  -26.919 -23.480 1.00 54.93 ? 124 ALA A N     1 
ATOM   687  C  CA    . ALA A 1 93  ? 18.668  -27.243 -24.887 1.00 54.60 ? 124 ALA A CA    1 
ATOM   688  C  C     . ALA A 1 93  ? 19.190  -28.640 -25.214 1.00 54.19 ? 124 ALA A C     1 
ATOM   689  O  O     . ALA A 1 93  ? 18.510  -29.418 -25.872 1.00 54.32 ? 124 ALA A O     1 
ATOM   690  C  CB    . ALA A 1 93  ? 19.308  -26.201 -25.798 1.00 54.54 ? 124 ALA A CB    1 
ATOM   691  N  N     . GLY A 1 94  ? 20.390  -28.954 -24.734 1.00 53.80 ? 125 GLY A N     1 
ATOM   692  C  CA    . GLY A 1 94  ? 20.996  -30.265 -24.956 1.00 53.52 ? 125 GLY A CA    1 
ATOM   693  C  C     . GLY A 1 94  ? 20.185  -31.402 -24.365 1.00 53.19 ? 125 GLY A C     1 
ATOM   694  O  O     . GLY A 1 94  ? 19.983  -32.428 -25.010 1.00 52.97 ? 125 GLY A O     1 
ATOM   695  N  N     . VAL A 1 95  ? 19.722  -31.214 -23.134 1.00 52.85 ? 126 VAL A N     1 
ATOM   696  C  CA    . VAL A 1 95  ? 18.876  -32.198 -22.479 1.00 52.74 ? 126 VAL A CA    1 
ATOM   697  C  C     . VAL A 1 95  ? 17.620  -32.457 -23.301 1.00 52.79 ? 126 VAL A C     1 
ATOM   698  O  O     . VAL A 1 95  ? 17.247  -33.602 -23.530 1.00 52.72 ? 126 VAL A O     1 
ATOM   699  C  CB    . VAL A 1 95  ? 18.481  -31.748 -21.047 1.00 52.81 ? 126 VAL A CB    1 
ATOM   700  C  CG1   . VAL A 1 95  ? 17.215  -32.458 -20.575 1.00 52.59 ? 126 VAL A CG1   1 
ATOM   701  C  CG2   . VAL A 1 95  ? 19.629  -31.994 -20.074 1.00 52.59 ? 126 VAL A CG2   1 
ATOM   702  N  N     . ILE A 1 96  ? 16.976  -31.395 -23.760 1.00 52.95 ? 127 ILE A N     1 
ATOM   703  C  CA    . ILE A 1 96  ? 15.725  -31.557 -24.480 1.00 53.24 ? 127 ILE A CA    1 
ATOM   704  C  C     . ILE A 1 96  ? 15.982  -32.251 -25.825 1.00 53.83 ? 127 ILE A C     1 
ATOM   705  O  O     . ILE A 1 96  ? 15.253  -33.168 -26.186 1.00 53.66 ? 127 ILE A O     1 
ATOM   706  C  CB    . ILE A 1 96  ? 14.955  -30.217 -24.621 1.00 53.31 ? 127 ILE A CB    1 
ATOM   707  C  CG1   . ILE A 1 96  ? 14.610  -29.652 -23.240 1.00 52.93 ? 127 ILE A CG1   1 
ATOM   708  C  CG2   . ILE A 1 96  ? 13.649  -30.420 -25.376 1.00 53.47 ? 127 ILE A CG2   1 
ATOM   709  C  CD1   . ILE A 1 96  ? 13.940  -28.298 -23.263 1.00 52.65 ? 127 ILE A CD1   1 
ATOM   710  N  N     . LYS A 1 97  ? 17.032  -31.830 -26.536 1.00 54.57 ? 128 LYS A N     1 
ATOM   711  C  CA    . LYS A 1 97  ? 17.472  -32.477 -27.790 1.00 55.21 ? 128 LYS A CA    1 
ATOM   712  C  C     . LYS A 1 97  ? 17.638  -33.994 -27.661 1.00 54.91 ? 128 LYS A C     1 
ATOM   713  O  O     . LYS A 1 97  ? 17.110  -34.767 -28.474 1.00 54.99 ? 128 LYS A O     1 
ATOM   714  C  CB    . LYS A 1 97  ? 18.819  -31.896 -28.266 1.00 55.39 ? 128 LYS A CB    1 
ATOM   715  C  CG    . LYS A 1 97  ? 18.731  -30.828 -29.365 1.00 56.31 ? 128 LYS A CG    1 
ATOM   716  C  CD    . LYS A 1 97  ? 20.123  -30.503 -29.978 1.00 56.81 ? 128 LYS A CD    1 
ATOM   717  C  CE    . LYS A 1 97  ? 21.045  -29.713 -29.020 1.00 58.17 ? 128 LYS A CE    1 
ATOM   718  N  N     . ARG A 1 98  ? 18.397  -34.408 -26.652 1.00 54.60 ? 129 ARG A N     1 
ATOM   719  C  CA    . ARG A 1 98  ? 18.736  -35.816 -26.483 1.00 54.48 ? 129 ARG A CA    1 
ATOM   720  C  C     . ARG A 1 98  ? 17.499  -36.632 -26.138 1.00 54.59 ? 129 ARG A C     1 
ATOM   721  O  O     . ARG A 1 98  ? 17.313  -37.731 -26.659 1.00 54.70 ? 129 ARG A O     1 
ATOM   722  C  CB    . ARG A 1 98  ? 19.832  -35.999 -25.426 1.00 54.46 ? 129 ARG A CB    1 
ATOM   723  C  CG    . ARG A 1 98  ? 21.188  -35.440 -25.857 1.00 54.17 ? 129 ARG A CG    1 
ATOM   724  C  CD    . ARG A 1 98  ? 22.321  -35.830 -24.911 1.00 54.04 ? 129 ARG A CD    1 
ATOM   725  N  NE    . ARG A 1 98  ? 22.273  -35.139 -23.616 1.00 54.18 ? 129 ARG A NE    1 
ATOM   726  C  CZ    . ARG A 1 98  ? 22.641  -33.873 -23.406 1.00 53.73 ? 129 ARG A CZ    1 
ATOM   727  N  NH1   . ARG A 1 98  ? 23.093  -33.113 -24.400 1.00 54.18 ? 129 ARG A NH1   1 
ATOM   728  N  NH2   . ARG A 1 98  ? 22.559  -33.357 -22.183 1.00 52.67 ? 129 ARG A NH2   1 
ATOM   729  N  N     . LEU A 1 99  ? 16.648  -36.081 -25.277 1.00 54.68 ? 130 LEU A N     1 
ATOM   730  C  CA    . LEU A 1 99  ? 15.386  -36.730 -24.919 1.00 54.64 ? 130 LEU A CA    1 
ATOM   731  C  C     . LEU A 1 99  ? 14.471  -36.912 -26.126 1.00 54.84 ? 130 LEU A C     1 
ATOM   732  O  O     . LEU A 1 99  ? 13.932  -37.987 -26.343 1.00 54.94 ? 130 LEU A O     1 
ATOM   733  C  CB    . LEU A 1 99  ? 14.659  -35.938 -23.832 1.00 54.43 ? 130 LEU A CB    1 
ATOM   734  C  CG    . LEU A 1 99  ? 15.220  -36.087 -22.415 1.00 54.04 ? 130 LEU A CG    1 
ATOM   735  C  CD1   . LEU A 1 99  ? 14.702  -34.988 -21.491 1.00 52.50 ? 130 LEU A CD1   1 
ATOM   736  C  CD2   . LEU A 1 99  ? 14.885  -37.456 -21.855 1.00 53.15 ? 130 LEU A CD2   1 
ATOM   737  N  N     . TRP A 1 100 ? 14.308  -35.856 -26.907 1.00 55.22 ? 131 TRP A N     1 
ATOM   738  C  CA    . TRP A 1 100 ? 13.423  -35.875 -28.072 1.00 55.53 ? 131 TRP A CA    1 
ATOM   739  C  C     . TRP A 1 100 ? 13.909  -36.850 -29.157 1.00 55.86 ? 131 TRP A C     1 
ATOM   740  O  O     . TRP A 1 100 ? 13.089  -37.505 -29.801 1.00 55.77 ? 131 TRP A O     1 
ATOM   741  C  CB    . TRP A 1 100 ? 13.305  -34.453 -28.620 1.00 55.55 ? 131 TRP A CB    1 
ATOM   742  C  CG    . TRP A 1 100 ? 12.457  -34.260 -29.846 1.00 55.59 ? 131 TRP A CG    1 
ATOM   743  C  CD1   . TRP A 1 100 ? 12.853  -33.694 -31.017 1.00 55.60 ? 131 TRP A CD1   1 
ATOM   744  C  CD2   . TRP A 1 100 ? 11.070  -34.580 -30.006 1.00 55.80 ? 131 TRP A CD2   1 
ATOM   745  N  NE1   . TRP A 1 100 ? 11.811  -33.650 -31.904 1.00 55.54 ? 131 TRP A NE1   1 
ATOM   746  C  CE2   . TRP A 1 100 ? 10.703  -34.191 -31.313 1.00 55.55 ? 131 TRP A CE2   1 
ATOM   747  C  CE3   . TRP A 1 100 ? 10.104  -35.157 -29.176 1.00 55.72 ? 131 TRP A CE3   1 
ATOM   748  C  CZ2   . TRP A 1 100 ? 9.416   -34.369 -31.815 1.00 55.43 ? 131 TRP A CZ2   1 
ATOM   749  C  CZ3   . TRP A 1 100 ? 8.823   -35.333 -29.674 1.00 55.79 ? 131 TRP A CZ3   1 
ATOM   750  C  CH2   . TRP A 1 100 ? 8.489   -34.938 -30.986 1.00 55.72 ? 131 TRP A CH2   1 
ATOM   751  N  N     . ARG A 1 101 ? 15.228  -36.948 -29.345 1.00 55.97 ? 132 ARG A N     1 
ATOM   752  C  CA    . ARG A 1 101 ? 15.804  -37.904 -30.295 1.00 56.24 ? 132 ARG A CA    1 
ATOM   753  C  C     . ARG A 1 101 ? 15.581  -39.364 -29.869 1.00 56.50 ? 132 ARG A C     1 
ATOM   754  O  O     . ARG A 1 101 ? 15.548  -40.250 -30.719 1.00 56.75 ? 132 ARG A O     1 
ATOM   755  C  CB    . ARG A 1 101 ? 17.315  -37.667 -30.480 1.00 56.34 ? 132 ARG A CB    1 
ATOM   756  C  CG    . ARG A 1 101 ? 17.690  -36.337 -31.131 1.00 56.72 ? 132 ARG A CG    1 
ATOM   757  N  N     . ASP A 1 102 ? 15.432  -39.626 -28.570 1.00 56.63 ? 133 ASP A N     1 
ATOM   758  C  CA    . ASP A 1 102 ? 15.340  -41.007 -28.077 1.00 56.70 ? 133 ASP A CA    1 
ATOM   759  C  C     . ASP A 1 102 ? 14.149  -41.805 -28.632 1.00 56.92 ? 133 ASP A C     1 
ATOM   760  O  O     . ASP A 1 102 ? 13.015  -41.314 -28.665 1.00 56.85 ? 133 ASP A O     1 
ATOM   761  C  CB    . ASP A 1 102 ? 15.268  -41.037 -26.555 1.00 56.76 ? 133 ASP A CB    1 
ATOM   762  C  CG    . ASP A 1 102 ? 15.383  -42.445 -26.002 1.00 56.62 ? 133 ASP A CG    1 
ATOM   763  O  OD1   . ASP A 1 102 ? 16.515  -42.972 -25.945 1.00 55.91 ? 133 ASP A OD1   1 
ATOM   764  O  OD2   . ASP A 1 102 ? 14.341  -43.028 -25.635 1.00 56.54 ? 133 ASP A OD2   1 
ATOM   765  N  N     . GLY A 1 103 ? 14.424  -43.051 -29.036 1.00 56.96 ? 134 GLY A N     1 
ATOM   766  C  CA    . GLY A 1 103 ? 13.417  -43.950 -29.606 1.00 56.76 ? 134 GLY A CA    1 
ATOM   767  C  C     . GLY A 1 103 ? 12.249  -44.233 -28.679 1.00 56.75 ? 134 GLY A C     1 
ATOM   768  O  O     . GLY A 1 103 ? 11.115  -44.365 -29.128 1.00 56.64 ? 134 GLY A O     1 
ATOM   769  N  N     . GLY A 1 104 ? 12.525  -44.332 -27.383 1.00 56.89 ? 135 GLY A N     1 
ATOM   770  C  CA    . GLY A 1 104 ? 11.479  -44.549 -26.388 1.00 57.00 ? 135 GLY A CA    1 
ATOM   771  C  C     . GLY A 1 104 ? 10.554  -43.350 -26.294 1.00 57.18 ? 135 GLY A C     1 
ATOM   772  O  O     . GLY A 1 104 ? 9.326   -43.494 -26.308 1.00 57.33 ? 135 GLY A O     1 
ATOM   773  N  N     . VAL A 1 105 ? 11.144  -42.161 -26.207 1.00 57.19 ? 136 VAL A N     1 
ATOM   774  C  CA    . VAL A 1 105 ? 10.371  -40.922 -26.175 1.00 57.23 ? 136 VAL A CA    1 
ATOM   775  C  C     . VAL A 1 105 ? 9.478   -40.822 -27.427 1.00 57.42 ? 136 VAL A C     1 
ATOM   776  O  O     . VAL A 1 105 ? 8.297   -40.468 -27.347 1.00 57.53 ? 136 VAL A O     1 
ATOM   777  C  CB    . VAL A 1 105 ? 11.309  -39.687 -26.050 1.00 57.25 ? 136 VAL A CB    1 
ATOM   778  C  CG1   . VAL A 1 105 ? 10.530  -38.379 -26.128 1.00 57.03 ? 136 VAL A CG1   1 
ATOM   779  C  CG2   . VAL A 1 105 ? 12.106  -39.754 -24.747 1.00 56.97 ? 136 VAL A CG2   1 
ATOM   780  N  N     . GLN A 1 106 ? 10.038  -41.169 -28.578 1.00 57.63 ? 137 GLN A N     1 
ATOM   781  C  CA    . GLN A 1 106 ? 9.287   -41.133 -29.825 1.00 57.64 ? 137 GLN A CA    1 
ATOM   782  C  C     . GLN A 1 106 ? 8.143   -42.139 -29.834 1.00 57.87 ? 137 GLN A C     1 
ATOM   783  O  O     . GLN A 1 106 ? 7.075   -41.852 -30.375 1.00 58.22 ? 137 GLN A O     1 
ATOM   784  C  CB    . GLN A 1 106 ? 10.223  -41.332 -31.022 1.00 57.40 ? 137 GLN A CB    1 
ATOM   785  C  CG    . GLN A 1 106 ? 11.114  -40.121 -31.293 1.00 57.16 ? 137 GLN A CG    1 
ATOM   786  C  CD    . GLN A 1 106 ? 10.304  -38.860 -31.547 1.00 57.05 ? 137 GLN A CD    1 
ATOM   787  O  OE1   . GLN A 1 106 ? 9.305   -38.901 -32.251 1.00 58.33 ? 137 GLN A OE1   1 
ATOM   788  N  NE2   . GLN A 1 106 ? 10.720  -37.740 -30.960 1.00 56.11 ? 137 GLN A NE2   1 
ATOM   789  N  N     . ALA A 1 107 ? 8.347   -43.298 -29.218 1.00 58.11 ? 138 ALA A N     1 
ATOM   790  C  CA    . ALA A 1 107 ? 7.291   -44.301 -29.126 1.00 58.55 ? 138 ALA A CA    1 
ATOM   791  C  C     . ALA A 1 107 ? 6.151   -43.796 -28.253 1.00 59.07 ? 138 ALA A C     1 
ATOM   792  O  O     . ALA A 1 107 ? 4.983   -44.042 -28.554 1.00 59.28 ? 138 ALA A O     1 
ATOM   793  C  CB    . ALA A 1 107 ? 7.831   -45.609 -28.588 1.00 58.49 ? 138 ALA A CB    1 
ATOM   794  N  N     . CYS A 1 108 ? 6.488   -43.074 -27.185 1.00 59.66 ? 139 CYS A N     1 
ATOM   795  C  CA    . CYS A 1 108 ? 5.468   -42.481 -26.317 1.00 59.95 ? 139 CYS A CA    1 
ATOM   796  C  C     . CYS A 1 108 ? 4.732   -41.341 -27.005 1.00 60.07 ? 139 CYS A C     1 
ATOM   797  O  O     . CYS A 1 108 ? 3.523   -41.199 -26.848 1.00 59.85 ? 139 CYS A O     1 
ATOM   798  C  CB    . CYS A 1 108 ? 6.077   -41.969 -25.013 1.00 59.99 ? 139 CYS A CB    1 
ATOM   799  S  SG    . CYS A 1 108 ? 4.822   -41.393 -23.829 1.00 60.18 ? 139 CYS A SG    1 
ATOM   800  N  N     . PHE A 1 109 ? 5.469   -40.527 -27.756 1.00 60.58 ? 140 PHE A N     1 
ATOM   801  C  CA    . PHE A 1 109 ? 4.879   -39.422 -28.522 1.00 60.93 ? 140 PHE A CA    1 
ATOM   802  C  C     . PHE A 1 109 ? 3.861   -39.945 -29.531 1.00 61.19 ? 140 PHE A C     1 
ATOM   803  O  O     . PHE A 1 109 ? 2.793   -39.364 -29.703 1.00 61.06 ? 140 PHE A O     1 
ATOM   804  C  CB    . PHE A 1 109 ? 5.972   -38.628 -29.240 1.00 61.05 ? 140 PHE A CB    1 
ATOM   805  C  CG    . PHE A 1 109 ? 5.449   -37.654 -30.255 1.00 61.24 ? 140 PHE A CG    1 
ATOM   806  C  CD1   . PHE A 1 109 ? 4.914   -36.437 -29.860 1.00 61.97 ? 140 PHE A CD1   1 
ATOM   807  C  CD2   . PHE A 1 109 ? 5.499   -37.949 -31.610 1.00 61.38 ? 140 PHE A CD2   1 
ATOM   808  C  CE1   . PHE A 1 109 ? 4.425   -35.536 -30.804 1.00 61.78 ? 140 PHE A CE1   1 
ATOM   809  C  CE2   . PHE A 1 109 ? 5.011   -37.059 -32.557 1.00 61.17 ? 140 PHE A CE2   1 
ATOM   810  C  CZ    . PHE A 1 109 ? 4.476   -35.851 -32.155 1.00 61.45 ? 140 PHE A CZ    1 
ATOM   811  N  N     . SER A 1 110 ? 4.193   -41.054 -30.185 1.00 61.38 ? 141 SER A N     1 
ATOM   812  C  CA    . SER A 1 110 ? 3.266   -41.686 -31.112 1.00 61.54 ? 141 SER A CA    1 
ATOM   813  C  C     . SER A 1 110 ? 1.974   -42.108 -30.446 1.00 61.67 ? 141 SER A C     1 
ATOM   814  O  O     . SER A 1 110 ? 0.954   -42.191 -31.117 1.00 61.97 ? 141 SER A O     1 
ATOM   815  C  CB    . SER A 1 110 ? 3.901   -42.895 -31.781 1.00 61.50 ? 141 SER A CB    1 
ATOM   816  O  OG    . SER A 1 110 ? 4.839   -42.453 -32.733 1.00 61.83 ? 141 SER A OG    1 
ATOM   817  N  N     . ARG A 1 111 ? 2.017   -42.376 -29.143 1.00 61.74 ? 142 ARG A N     1 
ATOM   818  C  CA    . ARG A 1 111 ? 0.824   -42.757 -28.381 1.00 61.94 ? 142 ARG A CA    1 
ATOM   819  C  C     . ARG A 1 111 ? 0.104   -41.561 -27.728 1.00 61.96 ? 142 ARG A C     1 
ATOM   820  O  O     . ARG A 1 111 ? -0.789  -41.765 -26.901 1.00 61.49 ? 142 ARG A O     1 
ATOM   821  C  CB    . ARG A 1 111 ? 1.207   -43.746 -27.277 1.00 62.15 ? 142 ARG A CB    1 
ATOM   822  C  CG    . ARG A 1 111 ? 2.023   -44.961 -27.731 1.00 62.76 ? 142 ARG A CG    1 
ATOM   823  C  CD    . ARG A 1 111 ? 1.193   -46.231 -27.789 1.00 63.17 ? 142 ARG A CD    1 
ATOM   824  N  NE    . ARG A 1 111 ? 0.801   -46.717 -26.466 1.00 63.36 ? 142 ARG A NE    1 
ATOM   825  C  CZ    . ARG A 1 111 ? 1.612   -47.343 -25.621 1.00 63.65 ? 142 ARG A CZ    1 
ATOM   826  N  NH1   . ARG A 1 111 ? 1.142   -47.744 -24.447 1.00 63.41 ? 142 ARG A NH1   1 
ATOM   827  N  NH2   . ARG A 1 111 ? 2.880   -47.589 -25.941 1.00 64.22 ? 142 ARG A NH2   1 
ATOM   828  N  N     . SER A 1 112 ? 0.472   -40.331 -28.098 1.00 62.07 ? 143 SER A N     1 
ATOM   829  C  CA    . SER A 1 112 ? -0.032  -39.126 -27.407 1.00 62.43 ? 143 SER A CA    1 
ATOM   830  C  C     . SER A 1 112 ? -1.537  -39.184 -27.110 1.00 62.81 ? 143 SER A C     1 
ATOM   831  O  O     . SER A 1 112 ? -2.002  -38.713 -26.065 1.00 63.28 ? 143 SER A O     1 
ATOM   832  C  CB    . SER A 1 112 ? 0.317   -37.833 -28.175 1.00 62.27 ? 143 SER A CB    1 
ATOM   833  O  OG    . SER A 1 112 ? -0.697  -37.444 -29.086 1.00 62.48 ? 143 SER A OG    1 
ATOM   834  N  N     . ARG A 1 113 ? -2.281  -39.765 -28.044 1.00 62.88 ? 144 ARG A N     1 
ATOM   835  C  CA    . ARG A 1 113 ? -3.703  -40.054 -27.900 1.00 62.90 ? 144 ARG A CA    1 
ATOM   836  C  C     . ARG A 1 113 ? -4.096  -40.575 -26.510 1.00 62.29 ? 144 ARG A C     1 
ATOM   837  O  O     . ARG A 1 113 ? -5.213  -40.353 -26.053 1.00 62.13 ? 144 ARG A O     1 
ATOM   838  C  CB    . ARG A 1 113 ? -4.063  -41.096 -28.961 1.00 63.47 ? 144 ARG A CB    1 
ATOM   839  C  CG    . ARG A 1 113 ? -5.524  -41.377 -29.120 1.00 65.35 ? 144 ARG A CG    1 
ATOM   840  C  CD    . ARG A 1 113 ? -5.750  -42.332 -30.267 1.00 67.64 ? 144 ARG A CD    1 
ATOM   841  N  NE    . ARG A 1 113 ? -5.684  -43.727 -29.844 1.00 69.24 ? 144 ARG A NE    1 
ATOM   842  C  CZ    . ARG A 1 113 ? -6.667  -44.380 -29.221 1.00 69.97 ? 144 ARG A CZ    1 
ATOM   843  N  NH1   . ARG A 1 113 ? -7.815  -43.771 -28.913 1.00 70.45 ? 144 ARG A NH1   1 
ATOM   844  N  NH2   . ARG A 1 113 ? -6.494  -45.654 -28.891 1.00 69.69 ? 144 ARG A NH2   1 
ATOM   845  N  N     . GLU A 1 114 ? -3.181  -41.278 -25.850 1.00 61.69 ? 145 GLU A N     1 
ATOM   846  C  CA    . GLU A 1 114 ? -3.450  -41.853 -24.531 1.00 61.21 ? 145 GLU A CA    1 
ATOM   847  C  C     . GLU A 1 114 ? -3.319  -40.884 -23.360 1.00 60.55 ? 145 GLU A C     1 
ATOM   848  O  O     . GLU A 1 114 ? -3.705  -41.228 -22.241 1.00 60.77 ? 145 GLU A O     1 
ATOM   849  C  CB    . GLU A 1 114 ? -2.552  -43.072 -24.296 1.00 61.22 ? 145 GLU A CB    1 
ATOM   850  C  CG    . GLU A 1 114 ? -3.088  -44.328 -24.959 1.00 61.41 ? 145 GLU A CG    1 
ATOM   851  C  CD    . GLU A 1 114 ? -2.014  -45.357 -25.233 1.00 61.69 ? 145 GLU A CD    1 
ATOM   852  O  OE1   . GLU A 1 114 ? -1.468  -45.931 -24.267 1.00 61.59 ? 145 GLU A OE1   1 
ATOM   853  O  OE2   . GLU A 1 114 ? -1.727  -45.593 -26.426 1.00 62.02 ? 145 GLU A OE2   1 
ATOM   854  N  N     . TYR A 1 115 ? -2.777  -39.692 -23.605 1.00 59.68 ? 146 TYR A N     1 
ATOM   855  C  CA    . TYR A 1 115 ? -2.631  -38.666 -22.556 1.00 58.94 ? 146 TYR A CA    1 
ATOM   856  C  C     . TYR A 1 115 ? -2.945  -37.273 -23.130 1.00 58.74 ? 146 TYR A C     1 
ATOM   857  O  O     . TYR A 1 115 ? -3.518  -37.175 -24.210 1.00 58.64 ? 146 TYR A O     1 
ATOM   858  C  CB    . TYR A 1 115 ? -1.239  -38.753 -21.899 1.00 58.35 ? 146 TYR A CB    1 
ATOM   859  C  CG    . TYR A 1 115 ? -0.064  -38.815 -22.856 1.00 57.59 ? 146 TYR A CG    1 
ATOM   860  C  CD1   . TYR A 1 115 ? 0.357   -40.021 -23.400 1.00 57.00 ? 146 TYR A CD1   1 
ATOM   861  C  CD2   . TYR A 1 115 ? 0.638   -37.672 -23.196 1.00 57.44 ? 146 TYR A CD2   1 
ATOM   862  C  CE1   . TYR A 1 115 ? 1.435   -40.084 -24.268 1.00 56.30 ? 146 TYR A CE1   1 
ATOM   863  C  CE2   . TYR A 1 115 ? 1.718   -37.724 -24.052 1.00 57.25 ? 146 TYR A CE2   1 
ATOM   864  C  CZ    . TYR A 1 115 ? 2.112   -38.930 -24.588 1.00 57.17 ? 146 TYR A CZ    1 
ATOM   865  O  OH    . TYR A 1 115 ? 3.186   -38.962 -25.450 1.00 57.32 ? 146 TYR A OH    1 
ATOM   866  N  N     . GLN A 1 116 ? -2.615  -36.207 -22.405 1.00 58.68 ? 147 GLN A N     1 
ATOM   867  C  CA    . GLN A 1 116 ? -2.854  -34.842 -22.878 1.00 58.62 ? 147 GLN A CA    1 
ATOM   868  C  C     . GLN A 1 116 ? -1.548  -34.175 -23.308 1.00 58.78 ? 147 GLN A C     1 
ATOM   869  O  O     . GLN A 1 116 ? -0.634  -34.024 -22.517 1.00 59.25 ? 147 GLN A O     1 
ATOM   870  C  CB    . GLN A 1 116 ? -3.540  -34.021 -21.782 1.00 58.63 ? 147 GLN A CB    1 
ATOM   871  C  CG    . GLN A 1 116 ? -4.912  -34.571 -21.337 1.00 58.53 ? 147 GLN A CG    1 
ATOM   872  C  CD    . GLN A 1 116 ? -5.924  -34.656 -22.487 1.00 59.48 ? 147 GLN A CD    1 
ATOM   873  O  OE1   . GLN A 1 116 ? -5.861  -33.875 -23.443 1.00 60.51 ? 147 GLN A OE1   1 
ATOM   874  N  NE2   . GLN A 1 116 ? -6.852  -35.610 -22.402 1.00 58.45 ? 147 GLN A NE2   1 
ATOM   875  N  N     . LEU A 1 117 ? -1.461  -33.790 -24.573 1.00 59.10 ? 148 LEU A N     1 
ATOM   876  C  CA    . LEU A 1 117 ? -0.256  -33.170 -25.121 1.00 59.33 ? 148 LEU A CA    1 
ATOM   877  C  C     . LEU A 1 117 ? -0.627  -32.061 -26.087 1.00 59.85 ? 148 LEU A C     1 
ATOM   878  O  O     . LEU A 1 117 ? -1.536  -32.229 -26.888 1.00 59.28 ? 148 LEU A O     1 
ATOM   879  C  CB    . LEU A 1 117 ? 0.559   -34.214 -25.869 1.00 59.15 ? 148 LEU A CB    1 
ATOM   880  C  CG    . LEU A 1 117 ? 1.877   -33.761 -26.480 1.00 58.33 ? 148 LEU A CG    1 
ATOM   881  C  CD1   . LEU A 1 117 ? 2.872   -33.457 -25.376 1.00 57.12 ? 148 LEU A CD1   1 
ATOM   882  C  CD2   . LEU A 1 117 ? 2.401   -34.844 -27.413 1.00 57.23 ? 148 LEU A CD2   1 
ATOM   883  N  N     . ASN A 1 118 ? 0.083   -30.936 -26.016 1.00 60.93 ? 149 ASN A N     1 
ATOM   884  C  CA    . ASN A 1 118 ? -0.126  -29.824 -26.964 1.00 61.66 ? 149 ASN A CA    1 
ATOM   885  C  C     . ASN A 1 118 ? 0.093   -30.275 -28.404 1.00 61.96 ? 149 ASN A C     1 
ATOM   886  O  O     . ASN A 1 118 ? 0.983   -31.077 -28.688 1.00 62.36 ? 149 ASN A O     1 
ATOM   887  C  CB    . ASN A 1 118 ? 0.842   -28.665 -26.703 1.00 61.87 ? 149 ASN A CB    1 
ATOM   888  C  CG    . ASN A 1 118 ? 0.718   -28.096 -25.316 1.00 62.67 ? 149 ASN A CG    1 
ATOM   889  O  OD1   . ASN A 1 118 ? -0.384  -27.960 -24.790 1.00 64.48 ? 149 ASN A OD1   1 
ATOM   890  N  ND2   . ASN A 1 118 ? 1.856   -27.758 -24.707 1.00 62.96 ? 149 ASN A ND2   1 
ATOM   891  N  N     . ASP A 1 119 ? -0.698  -29.723 -29.314 1.00 62.14 ? 150 ASP A N     1 
ATOM   892  C  CA    . ASP A 1 119 ? -0.563  -30.018 -30.739 1.00 61.92 ? 150 ASP A CA    1 
ATOM   893  C  C     . ASP A 1 119 ? 0.770   -29.474 -31.259 1.00 60.88 ? 150 ASP A C     1 
ATOM   894  O  O     . ASP A 1 119 ? 1.409   -30.083 -32.111 1.00 60.88 ? 150 ASP A O     1 
ATOM   895  C  CB    . ASP A 1 119 ? -1.727  -29.399 -31.522 1.00 62.40 ? 150 ASP A CB    1 
ATOM   896  C  CG    . ASP A 1 119 ? -3.116  -29.801 -30.966 1.00 64.47 ? 150 ASP A CG    1 
ATOM   897  O  OD1   . ASP A 1 119 ? -3.754  -30.727 -31.550 1.00 64.87 ? 150 ASP A OD1   1 
ATOM   898  O  OD2   . ASP A 1 119 ? -3.563  -29.171 -29.951 1.00 66.89 ? 150 ASP A OD2   1 
ATOM   899  N  N     . SER A 1 120 ? 1.207   -28.345 -30.714 1.00 59.90 ? 151 SER A N     1 
ATOM   900  C  CA    . SER A 1 120 ? 2.434   -27.698 -31.174 1.00 59.13 ? 151 SER A CA    1 
ATOM   901  C  C     . SER A 1 120 ? 3.724   -28.320 -30.637 1.00 58.82 ? 151 SER A C     1 
ATOM   902  O  O     . SER A 1 120 ? 4.808   -27.895 -31.028 1.00 58.82 ? 151 SER A O     1 
ATOM   903  C  CB    . SER A 1 120 ? 2.416   -26.220 -30.814 1.00 58.77 ? 151 SER A CB    1 
ATOM   904  O  OG    . SER A 1 120 ? 1.401   -25.550 -31.519 1.00 58.46 ? 151 SER A OG    1 
ATOM   905  N  N     . ALA A 1 121 ? 3.620   -29.315 -29.760 1.00 58.40 ? 152 ALA A N     1 
ATOM   906  C  CA    . ALA A 1 121 ? 4.808   -29.959 -29.190 1.00 58.23 ? 152 ALA A CA    1 
ATOM   907  C  C     . ALA A 1 121 ? 5.847   -30.292 -30.258 1.00 58.11 ? 152 ALA A C     1 
ATOM   908  O  O     . ALA A 1 121 ? 6.972   -29.787 -30.228 1.00 58.18 ? 152 ALA A O     1 
ATOM   909  C  CB    . ALA A 1 121 ? 4.418   -31.211 -28.423 1.00 58.16 ? 152 ALA A CB    1 
ATOM   910  N  N     . SER A 1 122 ? 5.461   -31.119 -31.216 1.00 57.97 ? 153 SER A N     1 
ATOM   911  C  CA    . SER A 1 122 ? 6.391   -31.550 -32.255 1.00 58.10 ? 153 SER A CA    1 
ATOM   912  C  C     . SER A 1 122 ? 6.943   -30.395 -33.082 1.00 57.53 ? 153 SER A C     1 
ATOM   913  O  O     . SER A 1 122 ? 8.061   -30.485 -33.582 1.00 57.67 ? 153 SER A O     1 
ATOM   914  C  CB    . SER A 1 122 ? 5.726   -32.563 -33.190 1.00 58.38 ? 153 SER A CB    1 
ATOM   915  O  OG    . SER A 1 122 ? 4.753   -31.937 -34.009 1.00 59.98 ? 153 SER A OG    1 
ATOM   916  N  N     . TYR A 1 123 ? 6.159   -29.326 -33.229 1.00 57.01 ? 154 TYR A N     1 
ATOM   917  C  CA    . TYR A 1 123 ? 6.559   -28.154 -34.025 1.00 56.49 ? 154 TYR A CA    1 
ATOM   918  C  C     . TYR A 1 123 ? 7.738   -27.439 -33.373 1.00 56.50 ? 154 TYR A C     1 
ATOM   919  O  O     . TYR A 1 123 ? 8.726   -27.133 -34.032 1.00 57.21 ? 154 TYR A O     1 
ATOM   920  C  CB    . TYR A 1 123 ? 5.374   -27.197 -34.222 1.00 56.04 ? 154 TYR A CB    1 
ATOM   921  C  CG    . TYR A 1 123 ? 5.743   -25.826 -34.737 1.00 56.02 ? 154 TYR A CG    1 
ATOM   922  C  CD1   . TYR A 1 123 ? 5.775   -25.544 -36.109 1.00 55.41 ? 154 TYR A CD1   1 
ATOM   923  C  CD2   . TYR A 1 123 ? 6.051   -24.798 -33.850 1.00 55.40 ? 154 TYR A CD2   1 
ATOM   924  C  CE1   . TYR A 1 123 ? 6.118   -24.273 -36.573 1.00 54.40 ? 154 TYR A CE1   1 
ATOM   925  C  CE2   . TYR A 1 123 ? 6.396   -23.541 -34.305 1.00 55.06 ? 154 TYR A CE2   1 
ATOM   926  C  CZ    . TYR A 1 123 ? 6.425   -23.283 -35.660 1.00 54.98 ? 154 TYR A CZ    1 
ATOM   927  O  OH    . TYR A 1 123 ? 6.768   -22.025 -36.068 1.00 54.94 ? 154 TYR A OH    1 
ATOM   928  N  N     . TYR A 1 124 ? 7.647   -27.191 -32.077 1.00 56.19 ? 155 TYR A N     1 
ATOM   929  C  CA    . TYR A 1 124 ? 8.755   -26.596 -31.356 1.00 55.96 ? 155 TYR A CA    1 
ATOM   930  C  C     . TYR A 1 124 ? 9.925   -27.574 -31.228 1.00 56.18 ? 155 TYR A C     1 
ATOM   931  O  O     . TYR A 1 124 ? 11.062  -27.245 -31.583 1.00 56.31 ? 155 TYR A O     1 
ATOM   932  C  CB    . TYR A 1 124 ? 8.302   -26.130 -29.979 1.00 55.70 ? 155 TYR A CB    1 
ATOM   933  C  CG    . TYR A 1 124 ? 7.294   -25.001 -30.030 1.00 55.39 ? 155 TYR A CG    1 
ATOM   934  C  CD1   . TYR A 1 124 ? 7.618   -23.788 -30.612 1.00 55.39 ? 155 TYR A CD1   1 
ATOM   935  C  CD2   . TYR A 1 124 ? 6.023   -25.139 -29.479 1.00 55.23 ? 155 TYR A CD2   1 
ATOM   936  C  CE1   . TYR A 1 124 ? 6.705   -22.742 -30.657 1.00 56.30 ? 155 TYR A CE1   1 
ATOM   937  C  CE2   . TYR A 1 124 ? 5.105   -24.095 -29.511 1.00 55.35 ? 155 TYR A CE2   1 
ATOM   938  C  CZ    . TYR A 1 124 ? 5.446   -22.900 -30.108 1.00 55.64 ? 155 TYR A CZ    1 
ATOM   939  O  OH    . TYR A 1 124 ? 4.546   -21.855 -30.167 1.00 54.98 ? 155 TYR A OH    1 
ATOM   940  N  N     . LEU A 1 125 ? 9.647   -28.782 -30.748 1.00 56.17 ? 156 LEU A N     1 
ATOM   941  C  CA    . LEU A 1 125 ? 10.710  -29.753 -30.491 1.00 56.02 ? 156 LEU A CA    1 
ATOM   942  C  C     . LEU A 1 125 ? 11.518  -30.101 -31.741 1.00 56.37 ? 156 LEU A C     1 
ATOM   943  O  O     . LEU A 1 125 ? 12.732  -30.262 -31.662 1.00 56.72 ? 156 LEU A O     1 
ATOM   944  C  CB    . LEU A 1 125 ? 10.146  -31.010 -29.828 1.00 55.79 ? 156 LEU A CB    1 
ATOM   945  C  CG    . LEU A 1 125 ? 9.637   -30.747 -28.403 1.00 55.13 ? 156 LEU A CG    1 
ATOM   946  C  CD1   . LEU A 1 125 ? 8.663   -31.833 -27.941 1.00 53.47 ? 156 LEU A CD1   1 
ATOM   947  C  CD2   . LEU A 1 125 ? 10.812  -30.603 -27.438 1.00 53.85 ? 156 LEU A CD2   1 
ATOM   948  N  N     . ASN A 1 126 ? 10.872  -30.189 -32.902 1.00 56.71 ? 157 ASN A N     1 
ATOM   949  C  CA    . ASN A 1 126 ? 11.622  -30.419 -34.144 1.00 56.76 ? 157 ASN A CA    1 
ATOM   950  C  C     . ASN A 1 126 ? 12.423  -29.186 -34.560 1.00 57.10 ? 157 ASN A C     1 
ATOM   951  O  O     . ASN A 1 126 ? 13.285  -29.284 -35.408 1.00 57.49 ? 157 ASN A O     1 
ATOM   952  C  CB    . ASN A 1 126 ? 10.709  -30.878 -35.297 1.00 56.48 ? 157 ASN A CB    1 
ATOM   953  C  CG    . ASN A 1 126 ? 10.230  -32.328 -35.140 1.00 56.11 ? 157 ASN A CG    1 
ATOM   954  O  OD1   . ASN A 1 126 ? 10.969  -33.195 -34.678 1.00 53.71 ? 157 ASN A OD1   1 
ATOM   955  N  ND2   . ASN A 1 126 ? 8.984   -32.591 -35.537 1.00 56.42 ? 157 ASN A ND2   1 
ATOM   956  N  N     . ASP A 1 127 ? 12.147  -28.035 -33.960 1.00 57.58 ? 158 ASP A N     1 
ATOM   957  C  CA    . ASP A 1 127 ? 12.819  -26.797 -34.327 1.00 58.07 ? 158 ASP A CA    1 
ATOM   958  C  C     . ASP A 1 127 ? 13.648  -26.225 -33.160 1.00 57.99 ? 158 ASP A C     1 
ATOM   959  O  O     . ASP A 1 127 ? 13.864  -25.015 -33.054 1.00 57.61 ? 158 ASP A O     1 
ATOM   960  C  CB    . ASP A 1 127 ? 11.768  -25.788 -34.787 1.00 58.38 ? 158 ASP A CB    1 
ATOM   961  C  CG    . ASP A 1 127 ? 12.159  -25.063 -36.063 1.00 60.10 ? 158 ASP A CG    1 
ATOM   962  O  OD1   . ASP A 1 127 ? 13.372  -24.846 -36.337 1.00 63.28 ? 158 ASP A OD1   1 
ATOM   963  O  OD2   . ASP A 1 127 ? 11.225  -24.703 -36.804 1.00 62.25 ? 158 ASP A OD2   1 
ATOM   964  N  N     . LEU A 1 128 ? 14.144  -27.111 -32.307 1.00 58.00 ? 159 LEU A N     1 
ATOM   965  C  CA    . LEU A 1 128 ? 14.837  -26.704 -31.095 1.00 58.10 ? 159 LEU A CA    1 
ATOM   966  C  C     . LEU A 1 128 ? 16.096  -25.860 -31.331 1.00 58.25 ? 159 LEU A C     1 
ATOM   967  O  O     . LEU A 1 128 ? 16.374  -24.953 -30.554 1.00 58.18 ? 159 LEU A O     1 
ATOM   968  C  CB    . LEU A 1 128 ? 15.189  -27.938 -30.268 1.00 58.10 ? 159 LEU A CB    1 
ATOM   969  C  CG    . LEU A 1 128 ? 15.538  -27.661 -28.812 1.00 58.72 ? 159 LEU A CG    1 
ATOM   970  C  CD1   . LEU A 1 128 ? 14.360  -27.005 -28.106 1.00 58.92 ? 159 LEU A CD1   1 
ATOM   971  C  CD2   . LEU A 1 128 ? 15.933  -28.969 -28.121 1.00 59.81 ? 159 LEU A CD2   1 
ATOM   972  N  N     . ASP A 1 129 ? 16.853  -26.155 -32.388 1.00 58.63 ? 160 ASP A N     1 
ATOM   973  C  CA    . ASP A 1 129 ? 18.083  -25.402 -32.688 1.00 58.89 ? 160 ASP A CA    1 
ATOM   974  C  C     . ASP A 1 129 ? 17.799  -23.912 -32.858 1.00 58.36 ? 160 ASP A C     1 
ATOM   975  O  O     . ASP A 1 129 ? 18.484  -23.072 -32.272 1.00 58.79 ? 160 ASP A O     1 
ATOM   976  C  CB    . ASP A 1 129 ? 18.788  -25.934 -33.949 1.00 59.14 ? 160 ASP A CB    1 
ATOM   977  C  CG    . ASP A 1 129 ? 19.425  -27.307 -33.741 1.00 60.79 ? 160 ASP A CG    1 
ATOM   978  O  OD1   . ASP A 1 129 ? 19.570  -27.757 -32.578 1.00 63.47 ? 160 ASP A OD1   1 
ATOM   979  O  OD2   . ASP A 1 129 ? 19.788  -27.947 -34.751 1.00 62.39 ? 160 ASP A OD2   1 
ATOM   980  N  N     . ARG A 1 130 ? 16.788  -23.595 -33.657 1.00 57.61 ? 161 ARG A N     1 
ATOM   981  C  CA    . ARG A 1 130 ? 16.392  -22.215 -33.880 1.00 57.02 ? 161 ARG A CA    1 
ATOM   982  C  C     . ARG A 1 130 ? 15.891  -21.585 -32.579 1.00 57.19 ? 161 ARG A C     1 
ATOM   983  O  O     . ARG A 1 130 ? 16.334  -20.503 -32.194 1.00 57.08 ? 161 ARG A O     1 
ATOM   984  C  CB    . ARG A 1 130 ? 15.312  -22.165 -34.958 1.00 56.70 ? 161 ARG A CB    1 
ATOM   985  C  CG    . ARG A 1 130 ? 14.839  -20.773 -35.318 1.00 55.37 ? 161 ARG A CG    1 
ATOM   986  C  CD    . ARG A 1 130 ? 13.993  -20.820 -36.580 1.00 53.54 ? 161 ARG A CD    1 
ATOM   987  N  NE    . ARG A 1 130 ? 12.776  -21.611 -36.403 1.00 52.39 ? 161 ARG A NE    1 
ATOM   988  C  CZ    . ARG A 1 130 ? 11.702  -21.190 -35.740 1.00 51.09 ? 161 ARG A CZ    1 
ATOM   989  N  NH1   . ARG A 1 130 ? 11.681  -19.984 -35.179 1.00 50.34 ? 161 ARG A NH1   1 
ATOM   990  N  NH2   . ARG A 1 130 ? 10.647  -21.979 -35.628 1.00 50.27 ? 161 ARG A NH2   1 
ATOM   991  N  N     . ILE A 1 131 ? 14.981  -22.285 -31.905 1.00 57.32 ? 162 ILE A N     1 
ATOM   992  C  CA    . ILE A 1 131 ? 14.375  -21.824 -30.653 1.00 57.50 ? 162 ILE A CA    1 
ATOM   993  C  C     . ILE A 1 131 ? 15.411  -21.588 -29.543 1.00 57.34 ? 162 ILE A C     1 
ATOM   994  O  O     . ILE A 1 131 ? 15.239  -20.697 -28.717 1.00 57.27 ? 162 ILE A O     1 
ATOM   995  C  CB    . ILE A 1 131 ? 13.280  -22.853 -30.188 1.00 57.87 ? 162 ILE A CB    1 
ATOM   996  C  CG1   . ILE A 1 131 ? 12.103  -22.895 -31.165 1.00 58.16 ? 162 ILE A CG1   1 
ATOM   997  C  CG2   . ILE A 1 131 ? 12.735  -22.549 -28.834 1.00 58.62 ? 162 ILE A CG2   1 
ATOM   998  C  CD1   . ILE A 1 131 ? 11.887  -21.618 -31.927 1.00 58.72 ? 162 ILE A CD1   1 
ATOM   999  N  N     . SER A 1 132 ? 16.494  -22.363 -29.551 1.00 57.37 ? 163 SER A N     1 
ATOM   1000 C  CA    . SER A 1 132 ? 17.525  -22.326 -28.491 1.00 57.59 ? 163 SER A CA    1 
ATOM   1001 C  C     . SER A 1 132 ? 18.427  -21.097 -28.427 1.00 57.40 ? 163 SER A C     1 
ATOM   1002 O  O     . SER A 1 132 ? 19.016  -20.831 -27.376 1.00 57.35 ? 163 SER A O     1 
ATOM   1003 C  CB    . SER A 1 132 ? 18.462  -23.528 -28.640 1.00 57.68 ? 163 SER A CB    1 
ATOM   1004 O  OG    . SER A 1 132 ? 17.838  -24.708 -28.192 1.00 59.46 ? 163 SER A OG    1 
ATOM   1005 N  N     . GLN A 1 133 ? 18.579  -20.388 -29.546 1.00 57.30 ? 164 GLN A N     1 
ATOM   1006 C  CA    . GLN A 1 133 ? 19.600  -19.339 -29.672 1.00 57.15 ? 164 GLN A CA    1 
ATOM   1007 C  C     . GLN A 1 133 ? 19.332  -18.192 -28.708 1.00 56.63 ? 164 GLN A C     1 
ATOM   1008 O  O     . GLN A 1 133 ? 18.198  -17.762 -28.564 1.00 56.38 ? 164 GLN A O     1 
ATOM   1009 C  CB    . GLN A 1 133 ? 19.649  -18.784 -31.102 1.00 57.34 ? 164 GLN A CB    1 
ATOM   1010 C  CG    . GLN A 1 133 ? 19.857  -19.826 -32.206 1.00 58.50 ? 164 GLN A CG    1 
ATOM   1011 C  CD    . GLN A 1 133 ? 21.143  -20.638 -32.033 1.00 60.42 ? 164 GLN A CD    1 
ATOM   1012 O  OE1   . GLN A 1 133 ? 22.246  -20.079 -31.947 1.00 60.39 ? 164 GLN A OE1   1 
ATOM   1013 N  NE2   . GLN A 1 133 ? 21.002  -21.968 -31.990 1.00 60.60 ? 164 GLN A NE2   1 
ATOM   1014 N  N     . SER A 1 134 ? 20.376  -17.700 -28.050 1.00 56.25 ? 165 SER A N     1 
ATOM   1015 C  CA    . SER A 1 134 ? 20.258  -16.525 -27.185 1.00 56.03 ? 165 SER A CA    1 
ATOM   1016 C  C     . SER A 1 134 ? 19.536  -15.372 -27.895 1.00 55.89 ? 165 SER A C     1 
ATOM   1017 O  O     . SER A 1 134 ? 18.681  -14.710 -27.308 1.00 56.50 ? 165 SER A O     1 
ATOM   1018 C  CB    . SER A 1 134 ? 21.644  -16.070 -26.713 1.00 55.91 ? 165 SER A CB    1 
ATOM   1019 O  OG    . SER A 1 134 ? 22.593  -16.187 -27.757 1.00 55.79 ? 165 SER A OG    1 
ATOM   1020 N  N     . ASN A 1 135 ? 19.859  -15.162 -29.168 1.00 55.32 ? 166 ASN A N     1 
ATOM   1021 C  CA    . ASN A 1 135 ? 19.255  -14.090 -29.953 1.00 54.79 ? 166 ASN A CA    1 
ATOM   1022 C  C     . ASN A 1 135 ? 17.811  -14.375 -30.441 1.00 53.93 ? 166 ASN A C     1 
ATOM   1023 O  O     . ASN A 1 135 ? 17.186  -13.529 -31.070 1.00 54.18 ? 166 ASN A O     1 
ATOM   1024 C  CB    . ASN A 1 135 ? 20.175  -13.754 -31.137 1.00 55.17 ? 166 ASN A CB    1 
ATOM   1025 C  CG    . ASN A 1 135 ? 20.362  -14.932 -32.125 1.00 56.34 ? 166 ASN A CG    1 
ATOM   1026 O  OD1   . ASN A 1 135 ? 19.395  -15.582 -32.554 1.00 57.76 ? 166 ASN A OD1   1 
ATOM   1027 N  ND2   . ASN A 1 135 ? 21.611  -15.170 -32.520 1.00 56.87 ? 166 ASN A ND2   1 
ATOM   1028 N  N     . TYR A 1 136 ? 17.287  -15.559 -30.152 1.00 52.63 ? 167 TYR A N     1 
ATOM   1029 C  CA    . TYR A 1 136 ? 15.984  -15.984 -30.654 1.00 51.61 ? 167 TYR A CA    1 
ATOM   1030 C  C     . TYR A 1 136 ? 14.871  -14.952 -30.474 1.00 51.07 ? 167 TYR A C     1 
ATOM   1031 O  O     . TYR A 1 136 ? 14.626  -14.458 -29.369 1.00 51.08 ? 167 TYR A O     1 
ATOM   1032 C  CB    . TYR A 1 136 ? 15.564  -17.286 -29.975 1.00 51.16 ? 167 TYR A CB    1 
ATOM   1033 C  CG    . TYR A 1 136 ? 14.144  -17.705 -30.248 1.00 50.54 ? 167 TYR A CG    1 
ATOM   1034 C  CD1   . TYR A 1 136 ? 13.715  -17.956 -31.543 1.00 49.14 ? 167 TYR A CD1   1 
ATOM   1035 C  CD2   . TYR A 1 136 ? 13.236  -17.884 -29.207 1.00 50.72 ? 167 TYR A CD2   1 
ATOM   1036 C  CE1   . TYR A 1 136 ? 12.428  -18.351 -31.805 1.00 48.78 ? 167 TYR A CE1   1 
ATOM   1037 C  CE2   . TYR A 1 136 ? 11.925  -18.284 -29.461 1.00 49.77 ? 167 TYR A CE2   1 
ATOM   1038 C  CZ    . TYR A 1 136 ? 11.534  -18.512 -30.766 1.00 49.82 ? 167 TYR A CZ    1 
ATOM   1039 O  OH    . TYR A 1 136 ? 10.249  -18.911 -31.039 1.00 50.06 ? 167 TYR A OH    1 
ATOM   1040 N  N     . ILE A 1 137 ? 14.224  -14.639 -31.595 1.00 50.39 ? 168 ILE A N     1 
ATOM   1041 C  CA    . ILE A 1 137 ? 12.992  -13.867 -31.635 1.00 49.61 ? 168 ILE A CA    1 
ATOM   1042 C  C     . ILE A 1 137 ? 11.962  -14.751 -32.300 1.00 49.46 ? 168 ILE A C     1 
ATOM   1043 O  O     . ILE A 1 137 ? 12.176  -15.190 -33.432 1.00 49.37 ? 168 ILE A O     1 
ATOM   1044 C  CB    . ILE A 1 137 ? 13.148  -12.569 -32.448 1.00 49.29 ? 168 ILE A CB    1 
ATOM   1045 C  CG1   . ILE A 1 137 ? 14.205  -11.676 -31.790 1.00 48.39 ? 168 ILE A CG1   1 
ATOM   1046 C  CG2   . ILE A 1 137 ? 11.807  -11.840 -32.550 1.00 48.03 ? 168 ILE A CG2   1 
ATOM   1047 C  CD1   . ILE A 1 137 ? 14.439  -10.389 -32.510 1.00 47.64 ? 168 ILE A CD1   1 
ATOM   1048 N  N     . PRO A 1 138 ? 10.861  -15.051 -31.599 1.00 49.18 ? 169 PRO A N     1 
ATOM   1049 C  CA    . PRO A 1 138 ? 9.844   -15.902 -32.213 1.00 49.32 ? 169 PRO A CA    1 
ATOM   1050 C  C     . PRO A 1 138 ? 9.272   -15.285 -33.462 1.00 49.47 ? 169 PRO A C     1 
ATOM   1051 O  O     . PRO A 1 138 ? 9.164   -14.072 -33.545 1.00 49.50 ? 169 PRO A O     1 
ATOM   1052 C  CB    . PRO A 1 138 ? 8.757   -16.004 -31.137 1.00 49.55 ? 169 PRO A CB    1 
ATOM   1053 C  CG    . PRO A 1 138 ? 9.434   -15.620 -29.850 1.00 49.38 ? 169 PRO A CG    1 
ATOM   1054 C  CD    . PRO A 1 138 ? 10.510  -14.656 -30.226 1.00 49.15 ? 169 PRO A CD    1 
ATOM   1055 N  N     . THR A 1 139 ? 8.931   -16.125 -34.428 1.00 49.93 ? 170 THR A N     1 
ATOM   1056 C  CA    . THR A 1 139 ? 8.290   -15.688 -35.659 1.00 50.23 ? 170 THR A CA    1 
ATOM   1057 C  C     . THR A 1 139 ? 6.796   -15.680 -35.454 1.00 50.47 ? 170 THR A C     1 
ATOM   1058 O  O     . THR A 1 139 ? 6.293   -16.311 -34.536 1.00 51.18 ? 170 THR A O     1 
ATOM   1059 C  CB    . THR A 1 139 ? 8.562   -16.679 -36.786 1.00 50.41 ? 170 THR A CB    1 
ATOM   1060 O  OG1   . THR A 1 139 ? 7.966   -17.934 -36.441 1.00 51.44 ? 170 THR A OG1   1 
ATOM   1061 C  CG2   . THR A 1 139 ? 10.057  -16.871 -37.021 1.00 49.46 ? 170 THR A CG2   1 
ATOM   1062 N  N     . GLN A 1 140 ? 6.066   -15.000 -36.321 1.00 50.92 ? 171 GLN A N     1 
ATOM   1063 C  CA    . GLN A 1 140 ? 4.601   -15.043 -36.248 1.00 51.31 ? 171 GLN A CA    1 
ATOM   1064 C  C     . GLN A 1 140 ? 4.044   -16.454 -36.212 1.00 51.67 ? 171 GLN A C     1 
ATOM   1065 O  O     . GLN A 1 140 ? 3.099   -16.711 -35.473 1.00 52.69 ? 171 GLN A O     1 
ATOM   1066 C  CB    . GLN A 1 140 ? 3.950   -14.237 -37.366 1.00 51.20 ? 171 GLN A CB    1 
ATOM   1067 C  CG    . GLN A 1 140 ? 3.860   -12.762 -37.007 1.00 51.76 ? 171 GLN A CG    1 
ATOM   1068 C  CD    . GLN A 1 140 ? 3.300   -11.911 -38.109 1.00 52.01 ? 171 GLN A CD    1 
ATOM   1069 O  OE1   . GLN A 1 140 ? 3.203   -10.691 -37.970 1.00 53.86 ? 171 GLN A OE1   1 
ATOM   1070 N  NE2   . GLN A 1 140 ? 2.917   -12.539 -39.208 1.00 50.99 ? 171 GLN A NE2   1 
ATOM   1071 N  N     . GLN A 1 141 ? 4.626   -17.381 -36.956 1.00 51.94 ? 172 GLN A N     1 
ATOM   1072 C  CA    . GLN A 1 141 ? 4.171   -18.768 -36.874 1.00 52.51 ? 172 GLN A CA    1 
ATOM   1073 C  C     . GLN A 1 141 ? 4.386   -19.312 -35.460 1.00 53.16 ? 172 GLN A C     1 
ATOM   1074 O  O     . GLN A 1 141 ? 3.503   -19.969 -34.903 1.00 53.37 ? 172 GLN A O     1 
ATOM   1075 C  CB    . GLN A 1 141 ? 4.881   -19.653 -37.901 1.00 52.55 ? 172 GLN A CB    1 
ATOM   1076 C  CG    . GLN A 1 141 ? 4.357   -21.087 -38.012 1.00 53.01 ? 172 GLN A CG    1 
ATOM   1077 C  CD    . GLN A 1 141 ? 2.889   -21.182 -38.430 1.00 54.91 ? 172 GLN A CD    1 
ATOM   1078 O  OE1   . GLN A 1 141 ? 2.191   -22.150 -38.085 1.00 56.24 ? 172 GLN A OE1   1 
ATOM   1079 N  NE2   . GLN A 1 141 ? 2.414   -20.182 -39.164 1.00 53.74 ? 172 GLN A NE2   1 
ATOM   1080 N  N     . ASP A 1 142 ? 5.542   -19.020 -34.865 1.00 53.56 ? 173 ASP A N     1 
ATOM   1081 C  CA    . ASP A 1 142 ? 5.797   -19.449 -33.487 1.00 53.70 ? 173 ASP A CA    1 
ATOM   1082 C  C     . ASP A 1 142 ? 4.706   -18.923 -32.566 1.00 53.79 ? 173 ASP A C     1 
ATOM   1083 O  O     . ASP A 1 142 ? 4.230   -19.649 -31.693 1.00 54.29 ? 173 ASP A O     1 
ATOM   1084 C  CB    . ASP A 1 142 ? 7.163   -18.964 -32.968 1.00 53.66 ? 173 ASP A CB    1 
ATOM   1085 C  CG    . ASP A 1 142 ? 8.346   -19.565 -33.724 1.00 53.53 ? 173 ASP A CG    1 
ATOM   1086 O  OD1   . ASP A 1 142 ? 8.191   -20.603 -34.412 1.00 53.51 ? 173 ASP A OD1   1 
ATOM   1087 O  OD2   . ASP A 1 142 ? 9.444   -18.982 -33.616 1.00 52.02 ? 173 ASP A OD2   1 
ATOM   1088 N  N     . VAL A 1 143 ? 4.319   -17.662 -32.749 1.00 53.65 ? 174 VAL A N     1 
ATOM   1089 C  CA    . VAL A 1 143 ? 3.336   -17.049 -31.859 1.00 53.51 ? 174 VAL A CA    1 
ATOM   1090 C  C     . VAL A 1 143 ? 1.980   -17.688 -32.077 1.00 53.62 ? 174 VAL A C     1 
ATOM   1091 O  O     . VAL A 1 143 ? 1.290   -18.003 -31.114 1.00 53.58 ? 174 VAL A O     1 
ATOM   1092 C  CB    . VAL A 1 143 ? 3.224   -15.526 -32.060 1.00 53.45 ? 174 VAL A CB    1 
ATOM   1093 C  CG1   . VAL A 1 143 ? 2.091   -14.960 -31.235 1.00 52.16 ? 174 VAL A CG1   1 
ATOM   1094 C  CG2   . VAL A 1 143 ? 4.534   -14.851 -31.694 1.00 53.15 ? 174 VAL A CG2   1 
ATOM   1095 N  N     . LEU A 1 144 ? 1.605   -17.889 -33.337 1.00 53.56 ? 175 LEU A N     1 
ATOM   1096 C  CA    . LEU A 1 144 ? 0.335   -18.549 -33.644 1.00 53.82 ? 175 LEU A CA    1 
ATOM   1097 C  C     . LEU A 1 144 ? 0.302   -19.960 -33.044 1.00 54.18 ? 175 LEU A C     1 
ATOM   1098 O  O     . LEU A 1 144 ? -0.748  -20.452 -32.635 1.00 54.91 ? 175 LEU A O     1 
ATOM   1099 C  CB    . LEU A 1 144 ? 0.090   -18.609 -35.156 1.00 53.69 ? 175 LEU A CB    1 
ATOM   1100 C  CG    . LEU A 1 144 ? -0.261  -17.287 -35.864 1.00 53.26 ? 175 LEU A CG    1 
ATOM   1101 C  CD1   . LEU A 1 144 ? 0.037   -17.337 -37.351 1.00 50.64 ? 175 LEU A CD1   1 
ATOM   1102 C  CD2   . LEU A 1 144 ? -1.717  -16.934 -35.645 1.00 52.83 ? 175 LEU A CD2   1 
ATOM   1103 N  N     . ARG A 1 145 ? 1.458   -20.604 -32.961 1.00 54.18 ? 176 ARG A N     1 
ATOM   1104 C  CA    . ARG A 1 145 ? 1.507   -21.979 -32.486 1.00 54.09 ? 176 ARG A CA    1 
ATOM   1105 C  C     . ARG A 1 145 ? 1.430   -22.095 -30.975 1.00 53.88 ? 176 ARG A C     1 
ATOM   1106 O  O     . ARG A 1 145 ? 1.276   -23.208 -30.461 1.00 53.64 ? 176 ARG A O     1 
ATOM   1107 C  CB    . ARG A 1 145 ? 2.779   -22.671 -32.968 1.00 54.28 ? 176 ARG A CB    1 
ATOM   1108 C  CG    . ARG A 1 145 ? 2.779   -22.955 -34.444 1.00 54.45 ? 176 ARG A CG    1 
ATOM   1109 C  CD    . ARG A 1 145 ? 2.038   -24.200 -34.780 1.00 55.23 ? 176 ARG A CD    1 
ATOM   1110 N  NE    . ARG A 1 145 ? 2.251   -24.515 -36.188 1.00 57.65 ? 176 ARG A NE    1 
ATOM   1111 C  CZ    . ARG A 1 145 ? 2.148   -25.730 -36.721 1.00 57.64 ? 176 ARG A CZ    1 
ATOM   1112 N  NH1   . ARG A 1 145 ? 1.842   -26.795 -35.979 1.00 58.12 ? 176 ARG A NH1   1 
ATOM   1113 N  NH2   . ARG A 1 145 ? 2.384   -25.881 -38.011 1.00 56.73 ? 176 ARG A NH2   1 
ATOM   1114 N  N     . THR A 1 146 ? 1.529   -20.976 -30.259 1.00 53.48 ? 177 THR A N     1 
ATOM   1115 C  CA    . THR A 1 146 ? 1.615   -21.061 -28.804 1.00 53.48 ? 177 THR A CA    1 
ATOM   1116 C  C     . THR A 1 146 ? 0.293   -21.523 -28.243 1.00 53.42 ? 177 THR A C     1 
ATOM   1117 O  O     . THR A 1 146 ? -0.738  -21.378 -28.887 1.00 53.26 ? 177 THR A O     1 
ATOM   1118 C  CB    . THR A 1 146 ? 2.015   -19.745 -28.140 1.00 53.11 ? 177 THR A CB    1 
ATOM   1119 O  OG1   . THR A 1 146 ? 1.113   -18.714 -28.547 1.00 53.36 ? 177 THR A OG1   1 
ATOM   1120 C  CG2   . THR A 1 146 ? 3.426   -19.378 -28.523 1.00 53.40 ? 177 THR A CG2   1 
ATOM   1121 N  N     . ARG A 1 147 ? 0.354   -22.109 -27.054 1.00 53.41 ? 178 ARG A N     1 
ATOM   1122 C  CA    . ARG A 1 147 ? -0.812  -22.582 -26.356 1.00 53.76 ? 178 ARG A CA    1 
ATOM   1123 C  C     . ARG A 1 147 ? -0.889  -21.871 -25.031 1.00 53.47 ? 178 ARG A C     1 
ATOM   1124 O  O     . ARG A 1 147 ? 0.008   -22.006 -24.204 1.00 53.91 ? 178 ARG A O     1 
ATOM   1125 C  CB    . ARG A 1 147 ? -0.721  -24.087 -26.129 1.00 54.33 ? 178 ARG A CB    1 
ATOM   1126 C  CG    . ARG A 1 147 ? -1.753  -24.663 -25.170 1.00 55.81 ? 178 ARG A CG    1 
ATOM   1127 C  CD    . ARG A 1 147 ? -3.166  -24.331 -25.593 1.00 58.48 ? 178 ARG A CD    1 
ATOM   1128 N  NE    . ARG A 1 147 ? -4.138  -24.787 -24.606 1.00 60.11 ? 178 ARG A NE    1 
ATOM   1129 C  CZ    . ARG A 1 147 ? -5.414  -24.420 -24.580 1.00 60.64 ? 178 ARG A CZ    1 
ATOM   1130 N  NH1   . ARG A 1 147 ? -5.892  -23.585 -25.500 1.00 61.61 ? 178 ARG A NH1   1 
ATOM   1131 N  NH2   . ARG A 1 147 ? -6.209  -24.888 -23.627 1.00 60.43 ? 178 ARG A NH2   1 
ATOM   1132 N  N     . VAL A 1 148 ? -1.957  -21.104 -24.857 1.00 53.21 ? 179 VAL A N     1 
ATOM   1133 C  CA    . VAL A 1 148 ? -2.251  -20.404 -23.632 1.00 53.06 ? 179 VAL A CA    1 
ATOM   1134 C  C     . VAL A 1 148 ? -3.748  -20.478 -23.440 1.00 53.48 ? 179 VAL A C     1 
ATOM   1135 O  O     . VAL A 1 148 ? -4.509  -19.817 -24.148 1.00 53.52 ? 179 VAL A O     1 
ATOM   1136 C  CB    . VAL A 1 148 ? -1.837  -18.917 -23.680 1.00 53.00 ? 179 VAL A CB    1 
ATOM   1137 C  CG1   . VAL A 1 148 ? -2.330  -18.177 -22.420 1.00 52.02 ? 179 VAL A CG1   1 
ATOM   1138 C  CG2   . VAL A 1 148 ? -0.338  -18.788 -23.831 1.00 52.11 ? 179 VAL A CG2   1 
ATOM   1139 N  N     . LYS A 1 149 ? -4.152  -21.287 -22.468 1.00 53.99 ? 180 LYS A N     1 
ATOM   1140 C  CA    . LYS A 1 149 ? -5.559  -21.491 -22.111 1.00 54.08 ? 180 LYS A CA    1 
ATOM   1141 C  C     . LYS A 1 149 ? -6.249  -20.156 -21.816 1.00 53.30 ? 180 LYS A C     1 
ATOM   1142 O  O     . LYS A 1 149 ? -5.763  -19.388 -21.010 1.00 52.66 ? 180 LYS A O     1 
ATOM   1143 C  CB    . LYS A 1 149 ? -5.611  -22.414 -20.900 1.00 54.32 ? 180 LYS A CB    1 
ATOM   1144 C  CG    . LYS A 1 149 ? -6.963  -23.027 -20.547 1.00 56.36 ? 180 LYS A CG    1 
ATOM   1145 C  CD    . LYS A 1 149 ? -6.720  -24.310 -19.705 1.00 57.47 ? 180 LYS A CD    1 
ATOM   1146 C  CE    . LYS A 1 149 ? -7.744  -24.536 -18.649 1.00 57.92 ? 180 LYS A CE    1 
ATOM   1147 N  NZ    . LYS A 1 149 ? -7.179  -25.312 -17.494 1.00 60.12 ? 180 LYS A NZ    1 
ATOM   1148 N  N     . THR A 1 150 ? -7.363  -19.890 -22.496 1.00 53.21 ? 181 THR A N     1 
ATOM   1149 C  CA    . THR A 1 150 ? -8.127  -18.657 -22.300 1.00 53.07 ? 181 THR A CA    1 
ATOM   1150 C  C     . THR A 1 150 ? -9.110  -18.818 -21.157 1.00 53.32 ? 181 THR A C     1 
ATOM   1151 O  O     . THR A 1 150 ? -9.813  -19.824 -21.071 1.00 53.39 ? 181 THR A O     1 
ATOM   1152 C  CB    . THR A 1 150 ? -8.963  -18.274 -23.529 1.00 52.85 ? 181 THR A CB    1 
ATOM   1153 O  OG1   . THR A 1 150 ? -8.194  -18.453 -24.723 1.00 52.57 ? 181 THR A OG1   1 
ATOM   1154 C  CG2   . THR A 1 150 ? -9.412  -16.828 -23.421 1.00 52.23 ? 181 THR A CG2   1 
ATOM   1155 N  N     . THR A 1 151 ? -9.171  -17.818 -20.289 1.00 53.44 ? 182 THR A N     1 
ATOM   1156 C  CA    . THR A 1 151 ? -10.165 -17.798 -19.242 1.00 53.56 ? 182 THR A CA    1 
ATOM   1157 C  C     . THR A 1 151 ? -10.907 -16.468 -19.323 1.00 54.00 ? 182 THR A C     1 
ATOM   1158 O  O     . THR A 1 151 ? -10.280 -15.417 -19.418 1.00 54.41 ? 182 THR A O     1 
ATOM   1159 C  CB    . THR A 1 151 ? -9.528  -18.018 -17.858 1.00 53.40 ? 182 THR A CB    1 
ATOM   1160 O  OG1   . THR A 1 151 ? -10.549 -18.017 -16.845 1.00 53.25 ? 182 THR A OG1   1 
ATOM   1161 C  CG2   . THR A 1 151 ? -8.469  -16.949 -17.559 1.00 53.18 ? 182 THR A CG2   1 
ATOM   1162 N  N     . GLY A 1 152 ? -12.239 -16.529 -19.324 1.00 54.25 ? 183 GLY A N     1 
ATOM   1163 C  CA    . GLY A 1 152 ? -13.081 -15.336 -19.315 1.00 54.34 ? 183 GLY A CA    1 
ATOM   1164 C  C     . GLY A 1 152 ? -13.587 -14.946 -20.697 1.00 54.49 ? 183 GLY A C     1 
ATOM   1165 O  O     . GLY A 1 152 ? -13.681 -15.784 -21.596 1.00 54.25 ? 183 GLY A O     1 
ATOM   1166 N  N     . ILE A 1 153 ? -13.937 -13.667 -20.841 1.00 54.63 ? 184 ILE A N     1 
ATOM   1167 C  CA    . ILE A 1 153 ? -14.380 -13.089 -22.105 1.00 54.76 ? 184 ILE A CA    1 
ATOM   1168 C  C     . ILE A 1 153 ? -13.497 -11.893 -22.439 1.00 55.33 ? 184 ILE A C     1 
ATOM   1169 O  O     . ILE A 1 153 ? -13.329 -10.985 -21.621 1.00 55.24 ? 184 ILE A O     1 
ATOM   1170 C  CB    . ILE A 1 153 ? -15.838 -12.606 -22.020 1.00 54.74 ? 184 ILE A CB    1 
ATOM   1171 C  CG1   . ILE A 1 153 ? -16.785 -13.791 -21.809 1.00 54.39 ? 184 ILE A CG1   1 
ATOM   1172 C  CG2   . ILE A 1 153 ? -16.215 -11.828 -23.272 1.00 53.87 ? 184 ILE A CG2   1 
ATOM   1173 C  CD1   . ILE A 1 153 ? -18.151 -13.402 -21.306 1.00 53.63 ? 184 ILE A CD1   1 
ATOM   1174 N  N     . VAL A 1 154 ? -12.942 -11.899 -23.646 1.00 56.18 ? 185 VAL A N     1 
ATOM   1175 C  CA    . VAL A 1 154 ? -11.990 -10.882 -24.083 1.00 56.86 ? 185 VAL A CA    1 
ATOM   1176 C  C     . VAL A 1 154 ? -12.503 -10.222 -25.356 1.00 57.62 ? 185 VAL A C     1 
ATOM   1177 O  O     . VAL A 1 154 ? -12.689 -10.894 -26.367 1.00 57.54 ? 185 VAL A O     1 
ATOM   1178 C  CB    . VAL A 1 154 ? -10.602 -11.507 -24.367 1.00 56.90 ? 185 VAL A CB    1 
ATOM   1179 C  CG1   . VAL A 1 154 ? -9.548  -10.423 -24.610 1.00 56.39 ? 185 VAL A CG1   1 
ATOM   1180 C  CG2   . VAL A 1 154 ? -10.186 -12.437 -23.221 1.00 57.22 ? 185 VAL A CG2   1 
ATOM   1181 N  N     . GLU A 1 155 ? -12.712 -8.907  -25.295 1.00 58.74 ? 186 GLU A N     1 
ATOM   1182 C  CA    . GLU A 1 155 ? -13.228 -8.120  -26.418 1.00 59.71 ? 186 GLU A CA    1 
ATOM   1183 C  C     . GLU A 1 155 ? -12.103 -7.518  -27.265 1.00 60.32 ? 186 GLU A C     1 
ATOM   1184 O  O     . GLU A 1 155 ? -11.088 -7.054  -26.738 1.00 60.28 ? 186 GLU A O     1 
ATOM   1185 C  CB    . GLU A 1 155 ? -14.130 -6.996  -25.899 1.00 59.67 ? 186 GLU A CB    1 
ATOM   1186 C  CG    . GLU A 1 155 ? -14.942 -6.289  -26.983 1.00 60.20 ? 186 GLU A CG    1 
ATOM   1187 C  CD    . GLU A 1 155 ? -15.905 -5.238  -26.427 1.00 60.54 ? 186 GLU A CD    1 
ATOM   1188 O  OE1   . GLU A 1 155 ? -15.922 -5.026  -25.189 1.00 61.54 ? 186 GLU A OE1   1 
ATOM   1189 O  OE2   . GLU A 1 155 ? -16.644 -4.620  -27.235 1.00 61.34 ? 186 GLU A OE2   1 
ATOM   1190 N  N     . THR A 1 156 ? -12.303 -7.525  -28.580 1.00 61.33 ? 187 THR A N     1 
ATOM   1191 C  CA    . THR A 1 156 ? -11.332 -6.981  -29.533 1.00 62.24 ? 187 THR A CA    1 
ATOM   1192 C  C     . THR A 1 156 ? -12.030 -6.214  -30.645 1.00 62.72 ? 187 THR A C     1 
ATOM   1193 O  O     . THR A 1 156 ? -13.172 -6.507  -30.996 1.00 62.45 ? 187 THR A O     1 
ATOM   1194 C  CB    . THR A 1 156 ? -10.448 -8.098  -30.129 1.00 62.45 ? 187 THR A CB    1 
ATOM   1195 O  OG1   . THR A 1 156 ? -9.275  -8.215  -29.327 1.00 63.50 ? 187 THR A OG1   1 
ATOM   1196 C  CG2   . THR A 1 156 ? -10.024 -7.805  -31.579 1.00 62.72 ? 187 THR A CG2   1 
ATOM   1197 N  N     . HIS A 1 157 ? -11.325 -5.224  -31.179 1.00 63.51 ? 188 HIS A N     1 
ATOM   1198 C  CA    . HIS A 1 157 ? -11.859 -4.353  -32.207 1.00 64.18 ? 188 HIS A CA    1 
ATOM   1199 C  C     . HIS A 1 157 ? -11.008 -4.463  -33.453 1.00 63.83 ? 188 HIS A C     1 
ATOM   1200 O  O     . HIS A 1 157 ? -9.781  -4.546  -33.358 1.00 63.90 ? 188 HIS A O     1 
ATOM   1201 C  CB    . HIS A 1 157 ? -11.849 -2.903  -31.718 1.00 64.84 ? 188 HIS A CB    1 
ATOM   1202 C  CG    . HIS A 1 157 ? -12.714 -2.663  -30.519 1.00 67.15 ? 188 HIS A CG    1 
ATOM   1203 N  ND1   . HIS A 1 157 ? -12.517 -1.602  -29.658 1.00 69.85 ? 188 HIS A ND1   1 
ATOM   1204 C  CD2   . HIS A 1 157 ? -13.784 -3.344  -30.038 1.00 69.21 ? 188 HIS A CD2   1 
ATOM   1205 C  CE1   . HIS A 1 157 ? -13.434 -1.635  -28.704 1.00 70.37 ? 188 HIS A CE1   1 
ATOM   1206 N  NE2   . HIS A 1 157 ? -14.213 -2.684  -28.910 1.00 70.39 ? 188 HIS A NE2   1 
ATOM   1207 N  N     . PHE A 1 158 ? -11.657 -4.489  -34.615 1.00 63.46 ? 189 PHE A N     1 
ATOM   1208 C  CA    . PHE A 1 158 ? -10.966 -4.215  -35.880 1.00 63.20 ? 189 PHE A CA    1 
ATOM   1209 C  C     . PHE A 1 158 ? -11.916 -3.777  -37.002 1.00 63.02 ? 189 PHE A C     1 
ATOM   1210 O  O     . PHE A 1 158 ? -13.137 -3.859  -36.866 1.00 62.89 ? 189 PHE A O     1 
ATOM   1211 C  CB    . PHE A 1 158 ? -10.081 -5.390  -36.319 1.00 63.06 ? 189 PHE A CB    1 
ATOM   1212 C  CG    . PHE A 1 158 ? -10.835 -6.630  -36.691 1.00 62.92 ? 189 PHE A CG    1 
ATOM   1213 C  CD1   . PHE A 1 158 ? -11.068 -7.622  -35.750 1.00 62.75 ? 189 PHE A CD1   1 
ATOM   1214 C  CD2   . PHE A 1 158 ? -11.272 -6.828  -37.993 1.00 62.42 ? 189 PHE A CD2   1 
ATOM   1215 C  CE1   . PHE A 1 158 ? -11.742 -8.780  -36.096 1.00 62.71 ? 189 PHE A CE1   1 
ATOM   1216 C  CE2   . PHE A 1 158 ? -11.953 -7.986  -38.343 1.00 62.61 ? 189 PHE A CE2   1 
ATOM   1217 C  CZ    . PHE A 1 158 ? -12.190 -8.962  -37.394 1.00 62.46 ? 189 PHE A CZ    1 
ATOM   1218 N  N     . THR A 1 159 ? -11.331 -3.307  -38.102 1.00 62.92 ? 190 THR A N     1 
ATOM   1219 C  CA    . THR A 1 159 ? -12.088 -2.793  -39.238 1.00 62.88 ? 190 THR A CA    1 
ATOM   1220 C  C     . THR A 1 159 ? -11.740 -3.546  -40.516 1.00 62.66 ? 190 THR A C     1 
ATOM   1221 O  O     . THR A 1 159 ? -10.582 -3.892  -40.751 1.00 62.58 ? 190 THR A O     1 
ATOM   1222 C  CB    . THR A 1 159 ? -11.817 -1.293  -39.438 1.00 62.98 ? 190 THR A CB    1 
ATOM   1223 O  OG1   . THR A 1 159 ? -11.977 -0.613  -38.188 1.00 63.32 ? 190 THR A OG1   1 
ATOM   1224 C  CG2   . THR A 1 159 ? -12.777 -0.691  -40.468 1.00 63.27 ? 190 THR A CG2   1 
ATOM   1225 N  N     . PHE A 1 160 ? -12.753 -3.795  -41.338 1.00 62.60 ? 191 PHE A N     1 
ATOM   1226 C  CA    . PHE A 1 160 ? -12.584 -4.539  -42.579 1.00 62.65 ? 191 PHE A CA    1 
ATOM   1227 C  C     . PHE A 1 160 ? -13.757 -4.239  -43.499 1.00 62.82 ? 191 PHE A C     1 
ATOM   1228 O  O     . PHE A 1 160 ? -14.912 -4.404  -43.105 1.00 62.73 ? 191 PHE A O     1 
ATOM   1229 C  CB    . PHE A 1 160 ? -12.512 -6.036  -42.262 1.00 62.64 ? 191 PHE A CB    1 
ATOM   1230 C  CG    . PHE A 1 160 ? -12.170 -6.919  -43.440 1.00 62.66 ? 191 PHE A CG    1 
ATOM   1231 C  CD1   . PHE A 1 160 ? -11.199 -6.552  -44.366 1.00 62.86 ? 191 PHE A CD1   1 
ATOM   1232 C  CD2   . PHE A 1 160 ? -12.793 -8.155  -43.587 1.00 62.70 ? 191 PHE A CD2   1 
ATOM   1233 C  CE1   . PHE A 1 160 ? -10.881 -7.387  -45.428 1.00 62.75 ? 191 PHE A CE1   1 
ATOM   1234 C  CE2   . PHE A 1 160 ? -12.479 -8.994  -44.645 1.00 62.62 ? 191 PHE A CE2   1 
ATOM   1235 C  CZ    . PHE A 1 160 ? -11.522 -8.611  -45.566 1.00 62.72 ? 191 PHE A CZ    1 
ATOM   1236 N  N     . LYS A 1 161 ? -13.463 -3.771  -44.710 1.00 62.96 ? 192 LYS A N     1 
ATOM   1237 C  CA    . LYS A 1 161 ? -14.502 -3.453  -45.684 1.00 63.28 ? 192 LYS A CA    1 
ATOM   1238 C  C     . LYS A 1 161 ? -15.584 -2.539  -45.087 1.00 63.34 ? 192 LYS A C     1 
ATOM   1239 O  O     . LYS A 1 161 ? -16.784 -2.802  -45.218 1.00 63.39 ? 192 LYS A O     1 
ATOM   1240 C  CB    . LYS A 1 161 ? -15.132 -4.737  -46.251 1.00 63.22 ? 192 LYS A CB    1 
ATOM   1241 C  CG    . LYS A 1 161 ? -14.172 -5.623  -47.045 1.00 63.61 ? 192 LYS A CG    1 
ATOM   1242 C  CD    . LYS A 1 161 ? -14.931 -6.660  -47.887 1.00 63.86 ? 192 LYS A CD    1 
ATOM   1243 C  CE    . LYS A 1 161 ? -14.006 -7.747  -48.451 1.00 64.56 ? 192 LYS A CE    1 
ATOM   1244 N  NZ    . LYS A 1 161 ? -14.746 -8.972  -48.906 1.00 64.47 ? 192 LYS A NZ    1 
ATOM   1245 N  N     . ASP A 1 162 ? -15.144 -1.469  -44.425 1.00 63.47 ? 193 ASP A N     1 
ATOM   1246 C  CA    . ASP A 1 162 ? -16.044 -0.429  -43.894 1.00 63.50 ? 193 ASP A CA    1 
ATOM   1247 C  C     . ASP A 1 162 ? -16.970 -0.938  -42.776 1.00 63.42 ? 193 ASP A C     1 
ATOM   1248 O  O     . ASP A 1 162 ? -18.032 -0.359  -42.537 1.00 63.62 ? 193 ASP A O     1 
ATOM   1249 C  CB    . ASP A 1 162 ? -16.866 0.213   -45.029 1.00 63.20 ? 193 ASP A CB    1 
ATOM   1250 N  N     . LEU A 1 163 ? -16.561 -2.011  -42.096 1.00 63.28 ? 194 LEU A N     1 
ATOM   1251 C  CA    . LEU A 1 163 ? -17.331 -2.585  -40.992 1.00 63.15 ? 194 LEU A CA    1 
ATOM   1252 C  C     . LEU A 1 163 ? -16.476 -2.620  -39.739 1.00 63.06 ? 194 LEU A C     1 
ATOM   1253 O  O     . LEU A 1 163 ? -15.326 -3.049  -39.784 1.00 62.97 ? 194 LEU A O     1 
ATOM   1254 C  CB    . LEU A 1 163 ? -17.781 -4.012  -41.318 1.00 63.15 ? 194 LEU A CB    1 
ATOM   1255 C  CG    . LEU A 1 163 ? -18.828 -4.233  -42.412 1.00 63.08 ? 194 LEU A CG    1 
ATOM   1256 C  CD1   . LEU A 1 163 ? -19.114 -5.723  -42.545 1.00 62.28 ? 194 LEU A CD1   1 
ATOM   1257 C  CD2   . LEU A 1 163 ? -20.113 -3.460  -42.124 1.00 62.99 ? 194 LEU A CD2   1 
ATOM   1258 N  N     . TYR A 1 164 ? -17.048 -2.179  -38.624 1.00 63.04 ? 195 TYR A N     1 
ATOM   1259 C  CA    . TYR A 1 164 ? -16.373 -2.211  -37.327 1.00 63.05 ? 195 TYR A CA    1 
ATOM   1260 C  C     . TYR A 1 164 ? -16.723 -3.534  -36.637 1.00 62.50 ? 195 TYR A C     1 
ATOM   1261 O  O     . TYR A 1 164 ? -17.876 -3.763  -36.281 1.00 62.42 ? 195 TYR A O     1 
ATOM   1262 C  CB    . TYR A 1 164 ? -16.824 -1.005  -36.492 1.00 63.48 ? 195 TYR A CB    1 
ATOM   1263 C  CG    . TYR A 1 164 ? -16.154 -0.843  -35.139 1.00 64.41 ? 195 TYR A CG    1 
ATOM   1264 C  CD1   . TYR A 1 164 ? -16.856 -1.097  -33.959 1.00 65.14 ? 195 TYR A CD1   1 
ATOM   1265 C  CD2   . TYR A 1 164 ? -14.829 -0.405  -35.033 1.00 65.25 ? 195 TYR A CD2   1 
ATOM   1266 C  CE1   . TYR A 1 164 ? -16.256 -0.935  -32.707 1.00 65.26 ? 195 TYR A CE1   1 
ATOM   1267 C  CE2   . TYR A 1 164 ? -14.215 -0.240  -33.780 1.00 65.03 ? 195 TYR A CE2   1 
ATOM   1268 C  CZ    . TYR A 1 164 ? -14.939 -0.508  -32.623 1.00 64.94 ? 195 TYR A CZ    1 
ATOM   1269 O  OH    . TYR A 1 164 ? -14.363 -0.352  -31.381 1.00 64.63 ? 195 TYR A OH    1 
ATOM   1270 N  N     . PHE A 1 165 ? -15.737 -4.413  -36.477 1.00 61.95 ? 196 PHE A N     1 
ATOM   1271 C  CA    . PHE A 1 165 ? -15.949 -5.699  -35.802 1.00 61.49 ? 196 PHE A CA    1 
ATOM   1272 C  C     . PHE A 1 165 ? -15.667 -5.602  -34.313 1.00 61.15 ? 196 PHE A C     1 
ATOM   1273 O  O     . PHE A 1 165 ? -14.540 -5.315  -33.912 1.00 60.87 ? 196 PHE A O     1 
ATOM   1274 C  CB    . PHE A 1 165 ? -15.043 -6.782  -36.380 1.00 61.31 ? 196 PHE A CB    1 
ATOM   1275 C  CG    . PHE A 1 165 ? -15.508 -7.329  -37.694 1.00 61.36 ? 196 PHE A CG    1 
ATOM   1276 C  CD1   . PHE A 1 165 ? -16.130 -8.563  -37.764 1.00 61.07 ? 196 PHE A CD1   1 
ATOM   1277 C  CD2   . PHE A 1 165 ? -15.310 -6.612  -38.869 1.00 61.40 ? 196 PHE A CD2   1 
ATOM   1278 C  CE1   . PHE A 1 165 ? -16.549 -9.074  -38.979 1.00 60.89 ? 196 PHE A CE1   1 
ATOM   1279 C  CE2   . PHE A 1 165 ? -15.723 -7.120  -40.085 1.00 60.99 ? 196 PHE A CE2   1 
ATOM   1280 C  CZ    . PHE A 1 165 ? -16.342 -8.354  -40.141 1.00 60.95 ? 196 PHE A CZ    1 
ATOM   1281 N  N     . LYS A 1 166 ? -16.699 -5.831  -33.505 1.00 60.88 ? 197 LYS A N     1 
ATOM   1282 C  CA    . LYS A 1 166 ? -16.522 -6.120  -32.093 1.00 60.75 ? 197 LYS A CA    1 
ATOM   1283 C  C     . LYS A 1 166 ? -16.483 -7.644  -31.991 1.00 60.71 ? 197 LYS A C     1 
ATOM   1284 O  O     . LYS A 1 166 ? -17.449 -8.315  -32.328 1.00 60.74 ? 197 LYS A O     1 
ATOM   1285 C  CB    . LYS A 1 166 ? -17.667 -5.533  -31.264 1.00 60.80 ? 197 LYS A CB    1 
ATOM   1286 C  CG    . LYS A 1 166 ? -17.758 -4.003  -31.304 1.00 60.41 ? 197 LYS A CG    1 
ATOM   1287 N  N     . MET A 1 167 ? -15.351 -8.188  -31.560 1.00 60.81 ? 198 MET A N     1 
ATOM   1288 C  CA    . MET A 1 167 ? -15.145 -9.636  -31.530 1.00 61.03 ? 198 MET A CA    1 
ATOM   1289 C  C     . MET A 1 167 ? -14.888 -10.133 -30.111 1.00 60.52 ? 198 MET A C     1 
ATOM   1290 O  O     . MET A 1 167 ? -14.129 -9.525  -29.363 1.00 60.24 ? 198 MET A O     1 
ATOM   1291 C  CB    . MET A 1 167 ? -13.969 -10.013 -32.428 1.00 60.92 ? 198 MET A CB    1 
ATOM   1292 C  CG    . MET A 1 167 ? -13.525 -11.455 -32.289 1.00 61.47 ? 198 MET A CG    1 
ATOM   1293 S  SD    . MET A 1 167 ? -12.126 -11.832 -33.357 1.00 62.67 ? 198 MET A SD    1 
ATOM   1294 C  CE    . MET A 1 167 ? -12.962 -11.912 -34.948 1.00 63.81 ? 198 MET A CE    1 
ATOM   1295 N  N     . PHE A 1 168 ? -15.502 -11.261 -29.770 1.00 60.35 ? 199 PHE A N     1 
ATOM   1296 C  CA    . PHE A 1 168 ? -15.443 -11.810 -28.423 1.00 60.23 ? 199 PHE A CA    1 
ATOM   1297 C  C     . PHE A 1 168 ? -14.826 -13.200 -28.429 1.00 60.25 ? 199 PHE A C     1 
ATOM   1298 O  O     . PHE A 1 168 ? -15.338 -14.112 -29.073 1.00 60.47 ? 199 PHE A O     1 
ATOM   1299 C  CB    . PHE A 1 168 ? -16.848 -11.852 -27.820 1.00 60.17 ? 199 PHE A CB    1 
ATOM   1300 C  CG    . PHE A 1 168 ? -17.398 -10.501 -27.510 1.00 59.78 ? 199 PHE A CG    1 
ATOM   1301 C  CD1   . PHE A 1 168 ? -17.867 -9.684  -28.523 1.00 60.13 ? 199 PHE A CD1   1 
ATOM   1302 C  CD2   . PHE A 1 168 ? -17.428 -10.033 -26.208 1.00 59.78 ? 199 PHE A CD2   1 
ATOM   1303 C  CE1   . PHE A 1 168 ? -18.368 -8.417  -28.239 1.00 60.30 ? 199 PHE A CE1   1 
ATOM   1304 C  CE2   . PHE A 1 168 ? -17.922 -8.774  -25.911 1.00 59.91 ? 199 PHE A CE2   1 
ATOM   1305 C  CZ    . PHE A 1 168 ? -18.393 -7.962  -26.926 1.00 60.27 ? 199 PHE A CZ    1 
ATOM   1306 N  N     . ASP A 1 169 ? -13.709 -13.341 -27.725 1.00 60.39 ? 200 ASP A N     1 
ATOM   1307 C  CA    . ASP A 1 169 ? -13.029 -14.623 -27.562 1.00 60.48 ? 200 ASP A CA    1 
ATOM   1308 C  C     . ASP A 1 169 ? -13.433 -15.172 -26.202 1.00 60.05 ? 200 ASP A C     1 
ATOM   1309 O  O     . ASP A 1 169 ? -13.453 -14.436 -25.208 1.00 60.14 ? 200 ASP A O     1 
ATOM   1310 C  CB    . ASP A 1 169 ? -11.507 -14.417 -27.625 1.00 60.74 ? 200 ASP A CB    1 
ATOM   1311 C  CG    . ASP A 1 169 ? -10.727 -15.729 -27.694 1.00 61.92 ? 200 ASP A CG    1 
ATOM   1312 O  OD1   . ASP A 1 169 ? -11.370 -16.789 -27.887 1.00 62.48 ? 200 ASP A OD1   1 
ATOM   1313 O  OD2   . ASP A 1 169 ? -9.467  -15.692 -27.562 1.00 62.85 ? 200 ASP A OD2   1 
ATOM   1314 N  N     . VAL A 1 170 ? -13.773 -16.452 -26.146 1.00 59.41 ? 201 VAL A N     1 
ATOM   1315 C  CA    . VAL A 1 170 ? -14.170 -17.057 -24.877 1.00 58.79 ? 201 VAL A CA    1 
ATOM   1316 C  C     . VAL A 1 170 ? -13.401 -18.339 -24.597 1.00 58.37 ? 201 VAL A C     1 
ATOM   1317 O  O     . VAL A 1 170 ? -12.829 -18.968 -25.501 1.00 58.40 ? 201 VAL A O     1 
ATOM   1318 C  CB    . VAL A 1 170 ? -15.673 -17.351 -24.848 1.00 58.61 ? 201 VAL A CB    1 
ATOM   1319 C  CG1   . VAL A 1 170 ? -16.447 -16.132 -25.283 1.00 58.42 ? 201 VAL A CG1   1 
ATOM   1320 C  CG2   . VAL A 1 170 ? -15.995 -18.519 -25.741 1.00 58.47 ? 201 VAL A CG2   1 
ATOM   1321 N  N     . GLY A 1 171 ? -13.386 -18.717 -23.327 1.00 57.76 ? 202 GLY A N     1 
ATOM   1322 C  CA    . GLY A 1 171 ? -12.828 -19.997 -22.922 1.00 57.34 ? 202 GLY A CA    1 
ATOM   1323 C  C     . GLY A 1 171 ? -13.826 -21.080 -23.266 1.00 56.88 ? 202 GLY A C     1 
ATOM   1324 O  O     . GLY A 1 171 ? -15.030 -20.858 -23.197 1.00 56.50 ? 202 GLY A O     1 
ATOM   1325 N  N     . GLY A 1 172 ? -13.320 -22.252 -23.633 1.00 56.49 ? 203 GLY A N     1 
ATOM   1326 C  CA    . GLY A 1 172 ? -14.167 -23.342 -24.111 1.00 56.06 ? 203 GLY A CA    1 
ATOM   1327 C  C     . GLY A 1 172 ? -14.313 -24.533 -23.190 1.00 55.39 ? 203 GLY A C     1 
ATOM   1328 O  O     . GLY A 1 172 ? -15.046 -25.453 -23.500 1.00 55.76 ? 203 GLY A O     1 
ATOM   1329 N  N     . GLN A 1 173 ? -13.617 -24.536 -22.067 1.00 54.76 ? 204 GLN A N     1 
ATOM   1330 C  CA    . GLN A 1 173 ? -13.752 -25.628 -21.118 1.00 54.55 ? 204 GLN A CA    1 
ATOM   1331 C  C     . GLN A 1 173 ? -15.118 -25.541 -20.456 1.00 54.70 ? 204 GLN A C     1 
ATOM   1332 O  O     . GLN A 1 173 ? -15.695 -24.460 -20.354 1.00 55.08 ? 204 GLN A O     1 
ATOM   1333 C  CB    . GLN A 1 173 ? -12.649 -25.579 -20.058 1.00 54.37 ? 204 GLN A CB    1 
ATOM   1334 C  CG    . GLN A 1 173 ? -11.297 -26.084 -20.540 1.00 53.53 ? 204 GLN A CG    1 
ATOM   1335 C  CD    . GLN A 1 173 ? -10.616 -25.138 -21.504 1.00 53.10 ? 204 GLN A CD    1 
ATOM   1336 O  OE1   . GLN A 1 173 ? -10.767 -23.917 -21.415 1.00 53.25 ? 204 GLN A OE1   1 
ATOM   1337 N  NE2   . GLN A 1 173 ? -9.858  -25.696 -22.434 1.00 51.56 ? 204 GLN A NE2   1 
ATOM   1338 N  N     . ARG A 1 174 ? -15.635 -26.672 -19.998 1.00 54.70 ? 205 ARG A N     1 
ATOM   1339 C  CA    . ARG A 1 174 ? -16.967 -26.712 -19.408 1.00 54.88 ? 205 ARG A CA    1 
ATOM   1340 C  C     . ARG A 1 174 ? -17.238 -25.568 -18.442 1.00 54.81 ? 205 ARG A C     1 
ATOM   1341 O  O     . ARG A 1 174 ? -18.259 -24.904 -18.556 1.00 55.24 ? 205 ARG A O     1 
ATOM   1342 C  CB    . ARG A 1 174 ? -17.209 -28.050 -18.710 1.00 55.05 ? 205 ARG A CB    1 
ATOM   1343 C  CG    . ARG A 1 174 ? -17.513 -29.173 -19.675 1.00 55.80 ? 205 ARG A CG    1 
ATOM   1344 C  CD    . ARG A 1 174 ? -17.640 -30.509 -18.980 1.00 57.29 ? 205 ARG A CD    1 
ATOM   1345 N  NE    . ARG A 1 174 ? -17.998 -31.549 -19.942 1.00 58.45 ? 205 ARG A NE    1 
ATOM   1346 C  CZ    . ARG A 1 174 ? -18.046 -32.853 -19.676 1.00 59.17 ? 205 ARG A CZ    1 
ATOM   1347 N  NH1   . ARG A 1 174 ? -17.753 -33.317 -18.464 1.00 59.59 ? 205 ARG A NH1   1 
ATOM   1348 N  NH2   . ARG A 1 174 ? -18.393 -33.703 -20.637 1.00 59.34 ? 205 ARG A NH2   1 
ATOM   1349 N  N     . SER A 1 175 ? -16.327 -25.343 -17.501 1.00 54.86 ? 206 SER A N     1 
ATOM   1350 C  CA    . SER A 1 175 ? -16.496 -24.298 -16.489 1.00 54.92 ? 206 SER A CA    1 
ATOM   1351 C  C     . SER A 1 175 ? -16.722 -22.903 -17.085 1.00 55.23 ? 206 SER A C     1 
ATOM   1352 O  O     . SER A 1 175 ? -17.533 -22.137 -16.569 1.00 55.37 ? 206 SER A O     1 
ATOM   1353 C  CB    . SER A 1 175 ? -15.291 -24.273 -15.541 1.00 55.01 ? 206 SER A CB    1 
ATOM   1354 O  OG    . SER A 1 175 ? -14.091 -23.903 -16.211 1.00 54.97 ? 206 SER A OG    1 
ATOM   1355 N  N     . GLU A 1 176 ? -16.019 -22.586 -18.172 1.00 55.56 ? 207 GLU A N     1 
ATOM   1356 C  CA    . GLU A 1 176 ? -16.100 -21.264 -18.808 1.00 55.91 ? 207 GLU A CA    1 
ATOM   1357 C  C     . GLU A 1 176 ? -17.454 -21.010 -19.492 1.00 55.94 ? 207 GLU A C     1 
ATOM   1358 O  O     . GLU A 1 176 ? -17.905 -19.872 -19.587 1.00 55.81 ? 207 GLU A O     1 
ATOM   1359 C  CB    . GLU A 1 176 ? -14.966 -21.091 -19.836 1.00 56.13 ? 207 GLU A CB    1 
ATOM   1360 C  CG    . GLU A 1 176 ? -13.538 -21.212 -19.265 1.00 56.67 ? 207 GLU A CG    1 
ATOM   1361 C  CD    . GLU A 1 176 ? -13.121 -20.026 -18.390 1.00 58.12 ? 207 GLU A CD    1 
ATOM   1362 O  OE1   . GLU A 1 176 ? -13.774 -18.960 -18.464 1.00 59.13 ? 207 GLU A OE1   1 
ATOM   1363 O  OE2   . GLU A 1 176 ? -12.124 -20.152 -17.634 1.00 58.31 ? 207 GLU A OE2   1 
ATOM   1364 N  N     . ARG A 1 177 ? -18.107 -22.077 -19.938 1.00 56.22 ? 208 ARG A N     1 
ATOM   1365 C  CA    . ARG A 1 177 ? -19.344 -21.980 -20.730 1.00 56.55 ? 208 ARG A CA    1 
ATOM   1366 C  C     . ARG A 1 177 ? -20.524 -21.304 -20.020 1.00 56.62 ? 208 ARG A C     1 
ATOM   1367 O  O     . ARG A 1 177 ? -21.372 -20.686 -20.666 1.00 56.79 ? 208 ARG A O     1 
ATOM   1368 C  CB    . ARG A 1 177 ? -19.763 -23.369 -21.215 1.00 56.59 ? 208 ARG A CB    1 
ATOM   1369 C  CG    . ARG A 1 177 ? -18.711 -24.035 -22.066 1.00 57.33 ? 208 ARG A CG    1 
ATOM   1370 C  CD    . ARG A 1 177 ? -19.226 -25.275 -22.735 1.00 58.52 ? 208 ARG A CD    1 
ATOM   1371 N  NE    . ARG A 1 177 ? -18.135 -26.010 -23.384 1.00 58.40 ? 208 ARG A NE    1 
ATOM   1372 C  CZ    . ARG A 1 177 ? -17.963 -27.326 -23.322 1.00 58.51 ? 208 ARG A CZ    1 
ATOM   1373 N  NH1   . ARG A 1 177 ? -18.812 -28.092 -22.665 1.00 59.01 ? 208 ARG A NH1   1 
ATOM   1374 N  NH2   . ARG A 1 177 ? -16.944 -27.889 -23.946 1.00 59.75 ? 208 ARG A NH2   1 
ATOM   1375 N  N     . LYS A 1 178 ? -20.569 -21.403 -18.699 1.00 56.57 ? 209 LYS A N     1 
ATOM   1376 C  CA    . LYS A 1 178 ? -21.617 -20.736 -17.917 1.00 56.66 ? 209 LYS A CA    1 
ATOM   1377 C  C     . LYS A 1 178 ? -21.582 -19.213 -18.083 1.00 56.00 ? 209 LYS A C     1 
ATOM   1378 O  O     . LYS A 1 178 ? -22.561 -18.540 -17.802 1.00 55.80 ? 209 LYS A O     1 
ATOM   1379 C  CB    . LYS A 1 178 ? -21.469 -21.062 -16.428 1.00 56.79 ? 209 LYS A CB    1 
ATOM   1380 C  CG    . LYS A 1 178 ? -20.909 -22.471 -16.122 1.00 57.84 ? 209 LYS A CG    1 
ATOM   1381 C  CD    . LYS A 1 178 ? -20.969 -22.796 -14.628 1.00 57.75 ? 209 LYS A CD    1 
ATOM   1382 C  CE    . LYS A 1 178 ? -20.271 -21.734 -13.810 1.00 58.85 ? 209 LYS A CE    1 
ATOM   1383 N  NZ    . LYS A 1 178 ? -20.273 -22.069 -12.369 1.00 60.35 ? 209 LYS A NZ    1 
ATOM   1384 N  N     . LYS A 1 179 ? -20.440 -18.680 -18.515 1.00 55.68 ? 210 LYS A N     1 
ATOM   1385 C  CA    . LYS A 1 179 ? -20.248 -17.235 -18.676 1.00 55.46 ? 210 LYS A CA    1 
ATOM   1386 C  C     . LYS A 1 179 ? -20.641 -16.726 -20.066 1.00 55.14 ? 210 LYS A C     1 
ATOM   1387 O  O     . LYS A 1 179 ? -20.726 -15.522 -20.290 1.00 54.89 ? 210 LYS A O     1 
ATOM   1388 C  CB    . LYS A 1 179 ? -18.776 -16.862 -18.438 1.00 55.45 ? 210 LYS A CB    1 
ATOM   1389 C  CG    . LYS A 1 179 ? -18.161 -17.327 -17.121 1.00 55.07 ? 210 LYS A CG    1 
ATOM   1390 C  CD    . LYS A 1 179 ? -16.644 -17.353 -17.253 1.00 54.78 ? 210 LYS A CD    1 
ATOM   1391 C  CE    . LYS A 1 179 ? -15.941 -17.771 -15.979 1.00 54.70 ? 210 LYS A CE    1 
ATOM   1392 N  NZ    . LYS A 1 179 ? -14.480 -17.983 -16.222 1.00 54.78 ? 210 LYS A NZ    1 
ATOM   1393 N  N     . TRP A 1 180 ? -20.855 -17.636 -21.005 1.00 55.06 ? 211 TRP A N     1 
ATOM   1394 C  CA    . TRP A 1 180 ? -21.133 -17.254 -22.391 1.00 54.97 ? 211 TRP A CA    1 
ATOM   1395 C  C     . TRP A 1 180 ? -22.402 -16.420 -22.514 1.00 55.00 ? 211 TRP A C     1 
ATOM   1396 O  O     . TRP A 1 180 ? -22.468 -15.493 -23.315 1.00 54.83 ? 211 TRP A O     1 
ATOM   1397 C  CB    . TRP A 1 180 ? -21.232 -18.502 -23.263 1.00 54.73 ? 211 TRP A CB    1 
ATOM   1398 C  CG    . TRP A 1 180 ? -19.918 -19.181 -23.467 1.00 54.84 ? 211 TRP A CG    1 
ATOM   1399 C  CD1   . TRP A 1 180 ? -18.740 -18.925 -22.813 1.00 54.83 ? 211 TRP A CD1   1 
ATOM   1400 C  CD2   . TRP A 1 180 ? -19.642 -20.243 -24.379 1.00 54.30 ? 211 TRP A CD2   1 
ATOM   1401 N  NE1   . TRP A 1 180 ? -17.756 -19.755 -23.272 1.00 54.53 ? 211 TRP A NE1   1 
ATOM   1402 C  CE2   . TRP A 1 180 ? -18.281 -20.577 -24.232 1.00 53.89 ? 211 TRP A CE2   1 
ATOM   1403 C  CE3   . TRP A 1 180 ? -20.415 -20.947 -25.305 1.00 54.43 ? 211 TRP A CE3   1 
ATOM   1404 C  CZ2   . TRP A 1 180 ? -17.675 -21.578 -24.977 1.00 54.46 ? 211 TRP A CZ2   1 
ATOM   1405 C  CZ3   . TRP A 1 180 ? -19.814 -21.945 -26.044 1.00 55.02 ? 211 TRP A CZ3   1 
ATOM   1406 C  CH2   . TRP A 1 180 ? -18.452 -22.252 -25.878 1.00 54.72 ? 211 TRP A CH2   1 
ATOM   1407 N  N     . ILE A 1 181 ? -23.394 -16.729 -21.692 1.00 55.13 ? 212 ILE A N     1 
ATOM   1408 C  CA    . ILE A 1 181 ? -24.665 -16.021 -21.737 1.00 55.61 ? 212 ILE A CA    1 
ATOM   1409 C  C     . ILE A 1 181 ? -24.527 -14.486 -21.587 1.00 55.97 ? 212 ILE A C     1 
ATOM   1410 O  O     . ILE A 1 181 ? -25.445 -13.739 -21.928 1.00 55.95 ? 212 ILE A O     1 
ATOM   1411 C  CB    . ILE A 1 181 ? -25.628 -16.587 -20.653 1.00 55.87 ? 212 ILE A CB    1 
ATOM   1412 C  CG1   . ILE A 1 181 ? -27.095 -16.353 -21.040 1.00 55.91 ? 212 ILE A CG1   1 
ATOM   1413 C  CG2   . ILE A 1 181 ? -25.282 -16.023 -19.256 1.00 55.10 ? 212 ILE A CG2   1 
ATOM   1414 C  CD1   . ILE A 1 181 ? -28.062 -17.270 -20.298 1.00 56.49 ? 212 ILE A CD1   1 
ATOM   1415 N  N     . HIS A 1 182 ? -23.382 -14.022 -21.089 1.00 56.41 ? 213 HIS A N     1 
ATOM   1416 C  CA    . HIS A 1 182 ? -23.161 -12.595 -20.855 1.00 56.77 ? 213 HIS A CA    1 
ATOM   1417 C  C     . HIS A 1 182 ? -23.066 -11.783 -22.143 1.00 56.99 ? 213 HIS A C     1 
ATOM   1418 O  O     . HIS A 1 182 ? -23.446 -10.619 -22.168 1.00 57.13 ? 213 HIS A O     1 
ATOM   1419 C  CB    . HIS A 1 182 ? -21.923 -12.369 -19.969 1.00 56.74 ? 213 HIS A CB    1 
ATOM   1420 C  CG    . HIS A 1 182 ? -22.122 -12.804 -18.547 1.00 56.97 ? 213 HIS A CG    1 
ATOM   1421 N  ND1   . HIS A 1 182 ? -23.035 -12.204 -17.708 1.00 57.25 ? 213 HIS A ND1   1 
ATOM   1422 C  CD2   . HIS A 1 182 ? -21.541 -13.788 -17.820 1.00 57.40 ? 213 HIS A CD2   1 
ATOM   1423 C  CE1   . HIS A 1 182 ? -23.006 -12.793 -16.526 1.00 57.02 ? 213 HIS A CE1   1 
ATOM   1424 N  NE2   . HIS A 1 182 ? -22.107 -13.758 -16.566 1.00 57.27 ? 213 HIS A NE2   1 
ATOM   1425 N  N     . CYS A 1 183 ? -22.596 -12.388 -23.222 1.00 57.31 ? 214 CYS A N     1 
ATOM   1426 C  CA    . CYS A 1 183 ? -22.469 -11.646 -24.473 1.00 57.85 ? 214 CYS A CA    1 
ATOM   1427 C  C     . CYS A 1 183 ? -23.274 -12.234 -25.643 1.00 57.21 ? 214 CYS A C     1 
ATOM   1428 O  O     . CYS A 1 183 ? -22.851 -12.160 -26.794 1.00 57.24 ? 214 CYS A O     1 
ATOM   1429 C  CB    . CYS A 1 183 ? -20.992 -11.521 -24.834 1.00 58.19 ? 214 CYS A CB    1 
ATOM   1430 S  SG    . CYS A 1 183 ? -20.182 -13.105 -25.050 1.00 61.11 ? 214 CYS A SG    1 
ATOM   1431 N  N     . PHE A 1 184 ? -24.450 -12.775 -25.337 1.00 56.71 ? 215 PHE A N     1 
ATOM   1432 C  CA    . PHE A 1 184 ? -25.334 -13.375 -26.341 1.00 56.36 ? 215 PHE A CA    1 
ATOM   1433 C  C     . PHE A 1 184 ? -26.268 -12.361 -27.038 1.00 56.44 ? 215 PHE A C     1 
ATOM   1434 O  O     . PHE A 1 184 ? -26.870 -12.682 -28.070 1.00 56.36 ? 215 PHE A O     1 
ATOM   1435 C  CB    . PHE A 1 184 ? -26.174 -14.490 -25.687 1.00 56.08 ? 215 PHE A CB    1 
ATOM   1436 C  CG    . PHE A 1 184 ? -25.526 -15.864 -25.693 1.00 55.22 ? 215 PHE A CG    1 
ATOM   1437 C  CD1   . PHE A 1 184 ? -24.168 -16.036 -25.923 1.00 54.72 ? 215 PHE A CD1   1 
ATOM   1438 C  CD2   . PHE A 1 184 ? -26.301 -16.989 -25.438 1.00 54.72 ? 215 PHE A CD2   1 
ATOM   1439 C  CE1   . PHE A 1 184 ? -23.602 -17.304 -25.920 1.00 54.78 ? 215 PHE A CE1   1 
ATOM   1440 C  CE2   . PHE A 1 184 ? -25.747 -18.256 -25.423 1.00 54.84 ? 215 PHE A CE2   1 
ATOM   1441 C  CZ    . PHE A 1 184 ? -24.392 -18.417 -25.660 1.00 55.24 ? 215 PHE A CZ    1 
ATOM   1442 N  N     . GLU A 1 185 ? -26.386 -11.149 -26.496 1.00 56.42 ? 216 GLU A N     1 
ATOM   1443 C  CA    . GLU A 1 185 ? -27.350 -10.173 -27.029 1.00 56.46 ? 216 GLU A CA    1 
ATOM   1444 C  C     . GLU A 1 185 ? -26.918 -9.533  -28.353 1.00 56.02 ? 216 GLU A C     1 
ATOM   1445 O  O     . GLU A 1 185 ? -25.796 -9.035  -28.474 1.00 55.80 ? 216 GLU A O     1 
ATOM   1446 C  CB    . GLU A 1 185 ? -27.643 -9.081  -25.994 1.00 56.69 ? 216 GLU A CB    1 
ATOM   1447 C  CG    . GLU A 1 185 ? -28.448 -9.589  -24.810 1.00 57.65 ? 216 GLU A CG    1 
ATOM   1448 C  CD    . GLU A 1 185 ? -28.625 -8.544  -23.724 1.00 58.68 ? 216 GLU A CD    1 
ATOM   1449 O  OE1   . GLU A 1 185 ? -27.867 -8.593  -22.727 1.00 59.14 ? 216 GLU A OE1   1 
ATOM   1450 O  OE2   . GLU A 1 185 ? -29.516 -7.676  -23.873 1.00 59.07 ? 216 GLU A OE2   1 
ATOM   1451 N  N     . GLY A 1 186 ? -27.828 -9.554  -29.331 1.00 55.64 ? 217 GLY A N     1 
ATOM   1452 C  CA    . GLY A 1 186 ? -27.641 -8.880  -30.618 1.00 55.39 ? 217 GLY A CA    1 
ATOM   1453 C  C     . GLY A 1 186 ? -26.434 -9.372  -31.393 1.00 55.26 ? 217 GLY A C     1 
ATOM   1454 O  O     . GLY A 1 186 ? -25.651 -8.573  -31.908 1.00 55.26 ? 217 GLY A O     1 
ATOM   1455 N  N     . VAL A 1 187 ? -26.278 -10.689 -31.477 1.00 54.90 ? 218 VAL A N     1 
ATOM   1456 C  CA    . VAL A 1 187 ? -25.106 -11.272 -32.115 1.00 54.60 ? 218 VAL A CA    1 
ATOM   1457 C  C     . VAL A 1 187 ? -25.311 -11.369 -33.629 1.00 54.54 ? 218 VAL A C     1 
ATOM   1458 O  O     . VAL A 1 187 ? -26.260 -11.995 -34.100 1.00 54.44 ? 218 VAL A O     1 
ATOM   1459 C  CB    . VAL A 1 187 ? -24.780 -12.652 -31.518 1.00 54.50 ? 218 VAL A CB    1 
ATOM   1460 C  CG1   . VAL A 1 187 ? -23.683 -13.333 -32.310 1.00 54.47 ? 218 VAL A CG1   1 
ATOM   1461 C  CG2   . VAL A 1 187 ? -24.373 -12.501 -30.065 1.00 53.98 ? 218 VAL A CG2   1 
ATOM   1462 N  N     . THR A 1 188 ? -24.411 -10.743 -34.383 1.00 54.46 ? 219 THR A N     1 
ATOM   1463 C  CA    . THR A 1 188 ? -24.492 -10.724 -35.841 1.00 54.47 ? 219 THR A CA    1 
ATOM   1464 C  C     . THR A 1 188 ? -24.069 -12.060 -36.430 1.00 54.43 ? 219 THR A C     1 
ATOM   1465 O  O     . THR A 1 188 ? -24.761 -12.619 -37.289 1.00 54.39 ? 219 THR A O     1 
ATOM   1466 C  CB    . THR A 1 188 ? -23.578 -9.643  -36.444 1.00 54.45 ? 219 THR A CB    1 
ATOM   1467 O  OG1   . THR A 1 188 ? -23.758 -8.409  -35.743 1.00 54.55 ? 219 THR A OG1   1 
ATOM   1468 C  CG2   . THR A 1 188 ? -23.895 -9.440  -37.918 1.00 54.56 ? 219 THR A CG2   1 
ATOM   1469 N  N     . ALA A 1 189 ? -22.923 -12.553 -35.964 1.00 54.31 ? 220 ALA A N     1 
ATOM   1470 C  CA    . ALA A 1 189 ? -22.343 -13.795 -36.462 1.00 54.19 ? 220 ALA A CA    1 
ATOM   1471 C  C     . ALA A 1 189 ? -21.610 -14.571 -35.366 1.00 54.21 ? 220 ALA A C     1 
ATOM   1472 O  O     . ALA A 1 189 ? -21.013 -13.993 -34.448 1.00 54.01 ? 220 ALA A O     1 
ATOM   1473 C  CB    . ALA A 1 189 ? -21.392 -13.505 -37.618 1.00 54.07 ? 220 ALA A CB    1 
ATOM   1474 N  N     . ILE A 1 190 ? -21.665 -15.892 -35.481 1.00 54.18 ? 221 ILE A N     1 
ATOM   1475 C  CA    . ILE A 1 190 ? -20.942 -16.780 -34.596 1.00 54.20 ? 221 ILE A CA    1 
ATOM   1476 C  C     . ILE A 1 190 ? -20.010 -17.592 -35.466 1.00 54.47 ? 221 ILE A C     1 
ATOM   1477 O  O     . ILE A 1 190 ? -20.451 -18.172 -36.455 1.00 55.21 ? 221 ILE A O     1 
ATOM   1478 C  CB    . ILE A 1 190 ? -21.900 -17.736 -33.880 1.00 53.98 ? 221 ILE A CB    1 
ATOM   1479 C  CG1   . ILE A 1 190 ? -22.657 -16.993 -32.787 1.00 53.66 ? 221 ILE A CG1   1 
ATOM   1480 C  CG2   . ILE A 1 190 ? -21.146 -18.900 -33.287 1.00 54.00 ? 221 ILE A CG2   1 
ATOM   1481 C  CD1   . ILE A 1 190 ? -23.912 -17.681 -32.370 1.00 53.27 ? 221 ILE A CD1   1 
ATOM   1482 N  N     . ILE A 1 191 ? -18.727 -17.607 -35.126 1.00 54.18 ? 222 ILE A N     1 
ATOM   1483 C  CA    . ILE A 1 191 ? -17.811 -18.564 -35.700 1.00 53.90 ? 222 ILE A CA    1 
ATOM   1484 C  C     . ILE A 1 191 ? -17.608 -19.635 -34.663 1.00 54.01 ? 222 ILE A C     1 
ATOM   1485 O  O     . ILE A 1 191 ? -17.084 -19.363 -33.582 1.00 53.78 ? 222 ILE A O     1 
ATOM   1486 C  CB    . ILE A 1 191 ? -16.474 -17.933 -36.056 1.00 54.01 ? 222 ILE A CB    1 
ATOM   1487 C  CG1   . ILE A 1 191 ? -16.678 -16.955 -37.220 1.00 54.59 ? 222 ILE A CG1   1 
ATOM   1488 C  CG2   . ILE A 1 191 ? -15.460 -19.012 -36.430 1.00 53.21 ? 222 ILE A CG2   1 
ATOM   1489 C  CD1   . ILE A 1 191 ? -15.403 -16.312 -37.747 1.00 55.11 ? 222 ILE A CD1   1 
ATOM   1490 N  N     . PHE A 1 192 ? -18.044 -20.850 -34.986 1.00 54.23 ? 223 PHE A N     1 
ATOM   1491 C  CA    . PHE A 1 192 ? -17.887 -21.992 -34.091 1.00 54.27 ? 223 PHE A CA    1 
ATOM   1492 C  C     . PHE A 1 192 ? -16.764 -22.894 -34.568 1.00 54.41 ? 223 PHE A C     1 
ATOM   1493 O  O     . PHE A 1 192 ? -16.837 -23.448 -35.662 1.00 54.56 ? 223 PHE A O     1 
ATOM   1494 C  CB    . PHE A 1 192 ? -19.173 -22.791 -34.015 1.00 54.09 ? 223 PHE A CB    1 
ATOM   1495 C  CG    . PHE A 1 192 ? -19.170 -23.822 -32.939 1.00 54.02 ? 223 PHE A CG    1 
ATOM   1496 C  CD1   . PHE A 1 192 ? -19.730 -23.550 -31.702 1.00 53.75 ? 223 PHE A CD1   1 
ATOM   1497 C  CD2   . PHE A 1 192 ? -18.605 -25.066 -33.156 1.00 53.88 ? 223 PHE A CD2   1 
ATOM   1498 C  CE1   . PHE A 1 192 ? -19.732 -24.500 -30.707 1.00 53.69 ? 223 PHE A CE1   1 
ATOM   1499 C  CE2   . PHE A 1 192 ? -18.607 -26.022 -32.162 1.00 53.67 ? 223 PHE A CE2   1 
ATOM   1500 C  CZ    . PHE A 1 192 ? -19.172 -25.739 -30.937 1.00 53.77 ? 223 PHE A CZ    1 
ATOM   1501 N  N     . CYS A 1 193 ? -15.735 -23.045 -33.739 1.00 54.61 ? 224 CYS A N     1 
ATOM   1502 C  CA    . CYS A 1 193 ? -14.568 -23.843 -34.091 1.00 54.86 ? 224 CYS A CA    1 
ATOM   1503 C  C     . CYS A 1 193 ? -14.664 -25.253 -33.555 1.00 54.60 ? 224 CYS A C     1 
ATOM   1504 O  O     . CYS A 1 193 ? -15.052 -25.469 -32.408 1.00 54.58 ? 224 CYS A O     1 
ATOM   1505 C  CB    . CYS A 1 193 ? -13.295 -23.216 -33.542 1.00 55.04 ? 224 CYS A CB    1 
ATOM   1506 S  SG    . CYS A 1 193 ? -13.028 -21.530 -34.074 1.00 56.53 ? 224 CYS A SG    1 
ATOM   1507 N  N     . VAL A 1 194 ? -14.293 -26.199 -34.410 1.00 54.63 ? 225 VAL A N     1 
ATOM   1508 C  CA    . VAL A 1 194 ? -14.136 -27.593 -34.049 1.00 54.59 ? 225 VAL A CA    1 
ATOM   1509 C  C     . VAL A 1 194 ? -12.716 -28.039 -34.406 1.00 54.64 ? 225 VAL A C     1 
ATOM   1510 O  O     . VAL A 1 194 ? -12.218 -27.738 -35.497 1.00 54.72 ? 225 VAL A O     1 
ATOM   1511 C  CB    . VAL A 1 194 ? -15.147 -28.467 -34.808 1.00 54.38 ? 225 VAL A CB    1 
ATOM   1512 C  CG1   . VAL A 1 194 ? -14.797 -29.943 -34.665 1.00 54.44 ? 225 VAL A CG1   1 
ATOM   1513 C  CG2   . VAL A 1 194 ? -16.530 -28.206 -34.294 1.00 54.48 ? 225 VAL A CG2   1 
ATOM   1514 N  N     . ALA A 1 195 ? -12.074 -28.752 -33.483 1.00 54.54 ? 226 ALA A N     1 
ATOM   1515 C  CA    . ALA A 1 195 ? -10.792 -29.388 -33.758 1.00 54.39 ? 226 ALA A CA    1 
ATOM   1516 C  C     . ALA A 1 195 ? -11.002 -30.736 -34.470 1.00 54.43 ? 226 ALA A C     1 
ATOM   1517 O  O     . ALA A 1 195 ? -11.241 -31.751 -33.828 1.00 54.65 ? 226 ALA A O     1 
ATOM   1518 C  CB    . ALA A 1 195 ? -9.996  -29.571 -32.465 1.00 53.62 ? 226 ALA A CB    1 
ATOM   1519 N  N     . LEU A 1 196 ? -10.894 -30.742 -35.794 1.00 54.67 ? 227 LEU A N     1 
ATOM   1520 C  CA    . LEU A 1 196 ? -11.018 -31.986 -36.565 1.00 55.06 ? 227 LEU A CA    1 
ATOM   1521 C  C     . LEU A 1 196 ? -10.150 -33.116 -36.017 1.00 55.78 ? 227 LEU A C     1 
ATOM   1522 O  O     . LEU A 1 196 ? -10.533 -34.280 -36.068 1.00 55.72 ? 227 LEU A O     1 
ATOM   1523 C  CB    . LEU A 1 196 ? -10.675 -31.757 -38.036 1.00 54.54 ? 227 LEU A CB    1 
ATOM   1524 C  CG    . LEU A 1 196 ? -11.815 -31.186 -38.874 1.00 54.34 ? 227 LEU A CG    1 
ATOM   1525 C  CD1   . LEU A 1 196 ? -11.309 -30.642 -40.231 1.00 53.53 ? 227 LEU A CD1   1 
ATOM   1526 C  CD2   . LEU A 1 196 ? -12.886 -32.249 -39.067 1.00 52.29 ? 227 LEU A CD2   1 
ATOM   1527 N  N     . SER A 1 197 ? -8.987  -32.764 -35.480 1.00 56.65 ? 228 SER A N     1 
ATOM   1528 C  CA    . SER A 1 197 ? -8.012  -33.750 -35.054 1.00 57.54 ? 228 SER A CA    1 
ATOM   1529 C  C     . SER A 1 197 ? -8.337  -34.350 -33.687 1.00 58.05 ? 228 SER A C     1 
ATOM   1530 O  O     . SER A 1 197 ? -7.641  -35.258 -33.226 1.00 57.96 ? 228 SER A O     1 
ATOM   1531 C  CB    . SER A 1 197 ? -6.639  -33.101 -35.014 1.00 57.75 ? 228 SER A CB    1 
ATOM   1532 O  OG    . SER A 1 197 ? -6.596  -32.114 -33.991 1.00 59.83 ? 228 SER A OG    1 
ATOM   1533 N  N     . ASP A 1 198 ? -9.386  -33.840 -33.042 1.00 58.68 ? 229 ASP A N     1 
ATOM   1534 C  CA    . ASP A 1 198 ? -9.839  -34.355 -31.750 1.00 59.45 ? 229 ASP A CA    1 
ATOM   1535 C  C     . ASP A 1 198 ? -10.636 -35.655 -31.836 1.00 58.97 ? 229 ASP A C     1 
ATOM   1536 O  O     . ASP A 1 198 ? -11.075 -36.154 -30.807 1.00 59.01 ? 229 ASP A O     1 
ATOM   1537 C  CB    . ASP A 1 198 ? -10.732 -33.311 -31.042 1.00 60.17 ? 229 ASP A CB    1 
ATOM   1538 C  CG    . ASP A 1 198 ? -9.940  -32.145 -30.451 1.00 63.12 ? 229 ASP A CG    1 
ATOM   1539 O  OD1   . ASP A 1 198 ? -8.718  -32.017 -30.755 1.00 66.39 ? 229 ASP A OD1   1 
ATOM   1540 O  OD2   . ASP A 1 198 ? -10.550 -31.363 -29.671 1.00 66.05 ? 229 ASP A OD2   1 
ATOM   1541 N  N     . TYR A 1 199 ? -10.850 -36.204 -33.031 1.00 58.52 ? 230 TYR A N     1 
ATOM   1542 C  CA    . TYR A 1 199 ? -11.806 -37.312 -33.161 1.00 58.09 ? 230 TYR A CA    1 
ATOM   1543 C  C     . TYR A 1 199 ? -11.472 -38.531 -32.320 1.00 57.80 ? 230 TYR A C     1 
ATOM   1544 O  O     . TYR A 1 199 ? -12.377 -39.231 -31.892 1.00 58.21 ? 230 TYR A O     1 
ATOM   1545 C  CB    . TYR A 1 199 ? -12.051 -37.711 -34.621 1.00 57.70 ? 230 TYR A CB    1 
ATOM   1546 C  CG    . TYR A 1 199 ? -10.914 -38.394 -35.310 1.00 57.49 ? 230 TYR A CG    1 
ATOM   1547 C  CD1   . TYR A 1 199 ? -9.986  -37.667 -36.038 1.00 57.22 ? 230 TYR A CD1   1 
ATOM   1548 C  CD2   . TYR A 1 199 ? -10.776 -39.779 -35.262 1.00 56.89 ? 230 TYR A CD2   1 
ATOM   1549 C  CE1   . TYR A 1 199 ? -8.945  -38.296 -36.684 1.00 56.85 ? 230 TYR A CE1   1 
ATOM   1550 C  CE2   . TYR A 1 199 ? -9.742  -40.411 -35.907 1.00 55.97 ? 230 TYR A CE2   1 
ATOM   1551 C  CZ    . TYR A 1 199 ? -8.834  -39.666 -36.613 1.00 56.47 ? 230 TYR A CZ    1 
ATOM   1552 O  OH    . TYR A 1 199 ? -7.801  -40.283 -37.256 1.00 57.45 ? 230 TYR A OH    1 
ATOM   1553 N  N     . ASP A 1 200 ? -10.195 -38.764 -32.050 1.00 57.67 ? 231 ASP A N     1 
ATOM   1554 C  CA    . ASP A 1 200 ? -9.785  -39.890 -31.210 1.00 57.78 ? 231 ASP A CA    1 
ATOM   1555 C  C     . ASP A 1 200 ? -9.231  -39.480 -29.847 1.00 57.64 ? 231 ASP A C     1 
ATOM   1556 O  O     . ASP A 1 200 ? -8.719  -40.318 -29.122 1.00 57.75 ? 231 ASP A O     1 
ATOM   1557 C  CB    . ASP A 1 200 ? -8.746  -40.736 -31.946 1.00 57.97 ? 231 ASP A CB    1 
ATOM   1558 C  CG    . ASP A 1 200 ? -7.430  -40.006 -32.149 1.00 58.18 ? 231 ASP A CG    1 
ATOM   1559 O  OD1   . ASP A 1 200 ? -7.295  -38.857 -31.669 1.00 58.12 ? 231 ASP A OD1   1 
ATOM   1560 O  OD2   . ASP A 1 200 ? -6.535  -40.584 -32.802 1.00 58.98 ? 231 ASP A OD2   1 
ATOM   1561 N  N     . LEU A 1 201 ? -9.319  -38.200 -29.507 1.00 57.71 ? 232 LEU A N     1 
ATOM   1562 C  CA    . LEU A 1 201 ? -8.876  -37.725 -28.200 1.00 57.89 ? 232 LEU A CA    1 
ATOM   1563 C  C     . LEU A 1 201 ? -10.027 -37.696 -27.185 1.00 58.47 ? 232 LEU A C     1 
ATOM   1564 O  O     . LEU A 1 201 ? -11.199 -37.861 -27.537 1.00 58.49 ? 232 LEU A O     1 
ATOM   1565 C  CB    . LEU A 1 201 ? -8.254  -36.337 -28.321 1.00 57.71 ? 232 LEU A CB    1 
ATOM   1566 C  CG    . LEU A 1 201 ? -7.051  -36.184 -29.262 1.00 57.47 ? 232 LEU A CG    1 
ATOM   1567 C  CD1   . LEU A 1 201 ? -6.479  -34.778 -29.183 1.00 55.44 ? 232 LEU A CD1   1 
ATOM   1568 C  CD2   . LEU A 1 201 ? -5.972  -37.228 -28.963 1.00 57.01 ? 232 LEU A CD2   1 
ATOM   1569 N  N     . VAL A 1 202 ? -9.672  -37.505 -25.918 1.00 59.10 ? 233 VAL A N     1 
ATOM   1570 C  CA    . VAL A 1 202 ? -10.638 -37.409 -24.821 1.00 59.43 ? 233 VAL A CA    1 
ATOM   1571 C  C     . VAL A 1 202 ? -10.468 -36.043 -24.157 1.00 60.04 ? 233 VAL A C     1 
ATOM   1572 O  O     . VAL A 1 202 ? -9.398  -35.433 -24.250 1.00 59.89 ? 233 VAL A O     1 
ATOM   1573 C  CB    . VAL A 1 202 ? -10.447 -38.551 -23.768 1.00 59.55 ? 233 VAL A CB    1 
ATOM   1574 C  CG1   . VAL A 1 202 ? -10.656 -39.928 -24.408 1.00 58.77 ? 233 VAL A CG1   1 
ATOM   1575 C  CG2   . VAL A 1 202 ? -9.073  -38.470 -23.102 1.00 58.90 ? 233 VAL A CG2   1 
ATOM   1576 N  N     . LEU A 1 203 ? -11.524 -35.563 -23.501 1.00 60.99 ? 234 LEU A N     1 
ATOM   1577 C  CA    . LEU A 1 203 ? -11.520 -34.229 -22.863 1.00 61.70 ? 234 LEU A CA    1 
ATOM   1578 C  C     . LEU A 1 203 ? -10.474 -34.075 -21.742 1.00 62.30 ? 234 LEU A C     1 
ATOM   1579 O  O     . LEU A 1 203 ? -10.240 -35.003 -20.961 1.00 62.24 ? 234 LEU A O     1 
ATOM   1580 C  CB    . LEU A 1 203 ? -12.896 -33.913 -22.271 1.00 61.63 ? 234 LEU A CB    1 
ATOM   1581 C  CG    . LEU A 1 203 ? -14.059 -33.671 -23.227 1.00 62.18 ? 234 LEU A CG    1 
ATOM   1582 C  CD1   . LEU A 1 203 ? -15.378 -33.587 -22.435 1.00 61.20 ? 234 LEU A CD1   1 
ATOM   1583 C  CD2   . LEU A 1 203 ? -13.812 -32.403 -24.062 1.00 62.12 ? 234 LEU A CD2   1 
ATOM   1584 N  N     . ALA A 1 204 ? -9.870  -32.889 -21.660 1.00 63.10 ? 235 ALA A N     1 
ATOM   1585 C  CA    . ALA A 1 204 ? -8.999  -32.536 -20.544 1.00 63.72 ? 235 ALA A CA    1 
ATOM   1586 C  C     . ALA A 1 204 ? -9.760  -32.568 -19.211 1.00 64.56 ? 235 ALA A C     1 
ATOM   1587 O  O     . ALA A 1 204 ? -9.191  -32.928 -18.178 1.00 64.54 ? 235 ALA A O     1 
ATOM   1588 C  CB    . ALA A 1 204 ? -8.375  -31.162 -20.770 1.00 63.44 ? 235 ALA A CB    1 
ATOM   1589 N  N     . GLU A 1 205 ? -11.044 -32.202 -19.243 1.00 65.67 ? 236 GLU A N     1 
ATOM   1590 C  CA    . GLU A 1 205 ? -11.880 -32.159 -18.022 1.00 66.66 ? 236 GLU A CA    1 
ATOM   1591 C  C     . GLU A 1 205 ? -12.631 -33.458 -17.706 1.00 67.30 ? 236 GLU A C     1 
ATOM   1592 O  O     . GLU A 1 205 ? -13.231 -33.577 -16.637 1.00 67.69 ? 236 GLU A O     1 
ATOM   1593 C  CB    . GLU A 1 205 ? -12.866 -30.967 -18.042 1.00 66.67 ? 236 GLU A CB    1 
ATOM   1594 C  CG    . GLU A 1 205 ? -13.807 -30.873 -19.248 1.00 66.98 ? 236 GLU A CG    1 
ATOM   1595 C  CD    . GLU A 1 205 ? -13.296 -29.946 -20.361 1.00 67.06 ? 236 GLU A CD    1 
ATOM   1596 O  OE1   . GLU A 1 205 ? -12.271 -30.259 -21.008 1.00 66.34 ? 236 GLU A OE1   1 
ATOM   1597 O  OE2   . GLU A 1 205 ? -13.944 -28.909 -20.601 1.00 67.44 ? 236 GLU A OE2   1 
ATOM   1598 N  N     . ASP A 1 206 ? -12.596 -34.430 -18.615 1.00 68.14 ? 237 ASP A N     1 
ATOM   1599 C  CA    . ASP A 1 206 ? -13.211 -35.736 -18.360 1.00 68.77 ? 237 ASP A CA    1 
ATOM   1600 C  C     . ASP A 1 206 ? -12.608 -36.808 -19.272 1.00 69.07 ? 237 ASP A C     1 
ATOM   1601 O  O     . ASP A 1 206 ? -13.059 -36.982 -20.413 1.00 69.15 ? 237 ASP A O     1 
ATOM   1602 C  CB    . ASP A 1 206 ? -14.729 -35.649 -18.563 1.00 68.92 ? 237 ASP A CB    1 
ATOM   1603 C  CG    . ASP A 1 206 ? -15.453 -36.917 -18.152 1.00 69.68 ? 237 ASP A CG    1 
ATOM   1604 O  OD1   . ASP A 1 206 ? -14.808 -37.822 -17.575 1.00 71.18 ? 237 ASP A OD1   1 
ATOM   1605 O  OD2   . ASP A 1 206 ? -16.678 -37.002 -18.399 1.00 70.43 ? 237 ASP A OD2   1 
ATOM   1606 N  N     . GLU A 1 207 ? -11.617 -37.544 -18.755 1.00 69.24 ? 238 GLU A N     1 
ATOM   1607 C  CA    . GLU A 1 207 ? -10.849 -38.514 -19.571 1.00 69.21 ? 238 GLU A CA    1 
ATOM   1608 C  C     . GLU A 1 207 ? -11.685 -39.671 -20.172 1.00 69.06 ? 238 GLU A C     1 
ATOM   1609 O  O     . GLU A 1 207 ? -11.156 -40.474 -20.951 1.00 68.93 ? 238 GLU A O     1 
ATOM   1610 C  CB    . GLU A 1 207 ? -9.640  -39.064 -18.785 1.00 69.24 ? 238 GLU A CB    1 
ATOM   1611 C  CG    . GLU A 1 207 ? -8.408  -38.132 -18.795 1.00 69.53 ? 238 GLU A CG    1 
ATOM   1612 N  N     . GLU A 1 208 ? -12.975 -39.741 -19.829 1.00 68.68 ? 239 GLU A N     1 
ATOM   1613 C  CA    . GLU A 1 208 ? -13.884 -40.749 -20.389 1.00 68.60 ? 239 GLU A CA    1 
ATOM   1614 C  C     . GLU A 1 208 ? -14.681 -40.284 -21.619 1.00 67.85 ? 239 GLU A C     1 
ATOM   1615 O  O     . GLU A 1 208 ? -15.212 -41.123 -22.347 1.00 68.04 ? 239 GLU A O     1 
ATOM   1616 C  CB    . GLU A 1 208 ? -14.871 -41.242 -19.320 1.00 68.66 ? 239 GLU A CB    1 
ATOM   1617 C  CG    . GLU A 1 208 ? -14.400 -42.465 -18.533 1.00 69.19 ? 239 GLU A CG    1 
ATOM   1618 C  CD    . GLU A 1 208 ? -15.237 -42.708 -17.276 1.00 69.59 ? 239 GLU A CD    1 
ATOM   1619 O  OE1   . GLU A 1 208 ? -15.541 -41.719 -16.563 1.00 70.86 ? 239 GLU A OE1   1 
ATOM   1620 O  OE2   . GLU A 1 208 ? -15.581 -43.881 -16.993 1.00 70.30 ? 239 GLU A OE2   1 
ATOM   1621 N  N     . MET A 1 209 ? -14.780 -38.974 -21.849 1.00 66.87 ? 240 MET A N     1 
ATOM   1622 C  CA    . MET A 1 209 ? -15.639 -38.442 -22.921 1.00 65.86 ? 240 MET A CA    1 
ATOM   1623 C  C     . MET A 1 209 ? -14.829 -38.059 -24.167 1.00 64.96 ? 240 MET A C     1 
ATOM   1624 O  O     . MET A 1 209 ? -13.821 -37.353 -24.083 1.00 64.74 ? 240 MET A O     1 
ATOM   1625 C  CB    . MET A 1 209 ? -16.452 -37.245 -22.407 1.00 65.88 ? 240 MET A CB    1 
ATOM   1626 C  CG    . MET A 1 209 ? -17.217 -36.445 -23.482 1.00 66.49 ? 240 MET A CG    1 
ATOM   1627 S  SD    . MET A 1 209 ? -18.915 -36.978 -23.821 1.00 66.66 ? 240 MET A SD    1 
ATOM   1628 C  CE    . MET A 1 209 ? -19.062 -36.554 -25.546 1.00 66.17 ? 240 MET A CE    1 
ATOM   1629 N  N     . ASN A 1 210 ? -15.292 -38.533 -25.322 1.00 63.90 ? 241 ASN A N     1 
ATOM   1630 C  CA    . ASN A 1 210 ? -14.690 -38.200 -26.601 1.00 63.08 ? 241 ASN A CA    1 
ATOM   1631 C  C     . ASN A 1 210 ? -14.875 -36.721 -26.919 1.00 62.49 ? 241 ASN A C     1 
ATOM   1632 O  O     . ASN A 1 210 ? -15.972 -36.192 -26.792 1.00 62.53 ? 241 ASN A O     1 
ATOM   1633 C  CB    . ASN A 1 210 ? -15.301 -39.058 -27.711 1.00 62.86 ? 241 ASN A CB    1 
ATOM   1634 C  CG    . ASN A 1 210 ? -14.753 -38.711 -29.081 1.00 63.35 ? 241 ASN A CG    1 
ATOM   1635 O  OD1   . ASN A 1 210 ? -15.134 -37.702 -29.676 1.00 64.29 ? 241 ASN A OD1   1 
ATOM   1636 N  ND2   . ASN A 1 210 ? -13.845 -39.539 -29.585 1.00 63.08 ? 241 ASN A ND2   1 
ATOM   1637 N  N     . ARG A 1 211 ? -13.802 -36.070 -27.352 1.00 61.78 ? 242 ARG A N     1 
ATOM   1638 C  CA    . ARG A 1 211 ? -13.816 -34.633 -27.599 1.00 61.60 ? 242 ARG A CA    1 
ATOM   1639 C  C     . ARG A 1 211 ? -14.751 -34.190 -28.711 1.00 61.29 ? 242 ARG A C     1 
ATOM   1640 O  O     . ARG A 1 211 ? -15.319 -33.106 -28.635 1.00 61.27 ? 242 ARG A O     1 
ATOM   1641 C  CB    . ARG A 1 211 ? -12.414 -34.134 -27.943 1.00 61.77 ? 242 ARG A CB    1 
ATOM   1642 C  CG    . ARG A 1 211 ? -11.483 -34.047 -26.766 1.00 62.21 ? 242 ARG A CG    1 
ATOM   1643 C  CD    . ARG A 1 211 ? -10.324 -33.127 -27.066 1.00 63.16 ? 242 ARG A CD    1 
ATOM   1644 N  NE    . ARG A 1 211 ? -9.468  -32.950 -25.896 1.00 64.48 ? 242 ARG A NE    1 
ATOM   1645 C  CZ    . ARG A 1 211 ? -8.360  -32.214 -25.874 1.00 64.13 ? 242 ARG A CZ    1 
ATOM   1646 N  NH1   . ARG A 1 211 ? -7.950  -31.575 -26.965 1.00 65.45 ? 242 ARG A NH1   1 
ATOM   1647 N  NH2   . ARG A 1 211 ? -7.668  -32.115 -24.748 1.00 63.42 ? 242 ARG A NH2   1 
ATOM   1648 N  N     . MET A 1 212 ? -14.873 -34.998 -29.760 1.00 61.08 ? 243 MET A N     1 
ATOM   1649 C  CA    . MET A 1 212 ? -15.691 -34.636 -30.914 1.00 60.85 ? 243 MET A CA    1 
ATOM   1650 C  C     . MET A 1 212 ? -17.147 -34.660 -30.495 1.00 60.46 ? 243 MET A C     1 
ATOM   1651 O  O     . MET A 1 212 ? -17.913 -33.762 -30.821 1.00 60.00 ? 243 MET A O     1 
ATOM   1652 C  CB    . MET A 1 212 ? -15.457 -35.622 -32.059 1.00 61.25 ? 243 MET A CB    1 
ATOM   1653 C  CG    . MET A 1 212 ? -16.141 -35.276 -33.376 1.00 62.02 ? 243 MET A CG    1 
ATOM   1654 S  SD    . MET A 1 212 ? -15.310 -33.933 -34.233 1.00 65.21 ? 243 MET A SD    1 
ATOM   1655 C  CE    . MET A 1 212 ? -14.173 -34.841 -35.259 1.00 62.56 ? 243 MET A CE    1 
ATOM   1656 N  N     . HIS A 1 213 ? -17.525 -35.693 -29.753 1.00 60.35 ? 244 HIS A N     1 
ATOM   1657 C  CA    . HIS A 1 213 ? -18.903 -35.837 -29.314 1.00 60.21 ? 244 HIS A CA    1 
ATOM   1658 C  C     . HIS A 1 213 ? -19.285 -34.681 -28.410 1.00 59.28 ? 244 HIS A C     1 
ATOM   1659 O  O     . HIS A 1 213 ? -20.416 -34.207 -28.439 1.00 58.80 ? 244 HIS A O     1 
ATOM   1660 C  CB    . HIS A 1 213 ? -19.107 -37.190 -28.639 1.00 60.67 ? 244 HIS A CB    1 
ATOM   1661 C  CG    . HIS A 1 213 ? -19.202 -38.327 -29.611 1.00 62.87 ? 244 HIS A CG    1 
ATOM   1662 N  ND1   . HIS A 1 213 ? -20.235 -38.444 -30.521 1.00 64.96 ? 244 HIS A ND1   1 
ATOM   1663 C  CD2   . HIS A 1 213 ? -18.397 -39.397 -29.820 1.00 64.56 ? 244 HIS A CD2   1 
ATOM   1664 C  CE1   . HIS A 1 213 ? -20.066 -39.538 -31.242 1.00 65.00 ? 244 HIS A CE1   1 
ATOM   1665 N  NE2   . HIS A 1 213 ? -18.956 -40.133 -30.838 1.00 65.52 ? 244 HIS A NE2   1 
ATOM   1666 N  N     . GLU A 1 214 ? -18.312 -34.207 -27.642 1.00 58.73 ? 245 GLU A N     1 
ATOM   1667 C  CA    . GLU A 1 214 ? -18.494 -33.048 -26.781 1.00 58.31 ? 245 GLU A CA    1 
ATOM   1668 C  C     . GLU A 1 214 ? -18.769 -31.821 -27.617 1.00 57.72 ? 245 GLU A C     1 
ATOM   1669 O  O     . GLU A 1 214 ? -19.696 -31.051 -27.362 1.00 57.87 ? 245 GLU A O     1 
ATOM   1670 C  CB    . GLU A 1 214 ? -17.226 -32.814 -25.973 1.00 58.50 ? 245 GLU A CB    1 
ATOM   1671 C  CG    . GLU A 1 214 ? -17.279 -31.631 -25.024 1.00 58.95 ? 245 GLU A CG    1 
ATOM   1672 C  CD    . GLU A 1 214 ? -18.264 -31.823 -23.902 1.00 59.78 ? 245 GLU A CD    1 
ATOM   1673 O  OE1   . GLU A 1 214 ? -18.857 -32.921 -23.764 1.00 61.00 ? 245 GLU A OE1   1 
ATOM   1674 O  OE2   . GLU A 1 214 ? -18.444 -30.858 -23.147 1.00 60.39 ? 245 GLU A OE2   1 
ATOM   1675 N  N     . SER A 1 215 ? -17.931 -31.656 -28.621 1.00 56.93 ? 246 SER A N     1 
ATOM   1676 C  CA    . SER A 1 215 ? -18.042 -30.567 -29.555 1.00 56.48 ? 246 SER A CA    1 
ATOM   1677 C  C     . SER A 1 215 ? -19.393 -30.569 -30.294 1.00 55.77 ? 246 SER A C     1 
ATOM   1678 O  O     . SER A 1 215 ? -19.980 -29.514 -30.515 1.00 55.53 ? 246 SER A O     1 
ATOM   1679 C  CB    . SER A 1 215 ? -16.884 -30.661 -30.542 1.00 56.25 ? 246 SER A CB    1 
ATOM   1680 O  OG    . SER A 1 215 ? -16.582 -29.392 -31.061 1.00 58.57 ? 246 SER A OG    1 
ATOM   1681 N  N     . MET A 1 216 ? -19.885 -31.749 -30.665 1.00 55.22 ? 247 MET A N     1 
ATOM   1682 C  CA    . MET A 1 216 ? -21.173 -31.863 -31.357 1.00 54.74 ? 247 MET A CA    1 
ATOM   1683 C  C     . MET A 1 216 ? -22.322 -31.456 -30.432 1.00 54.50 ? 247 MET A C     1 
ATOM   1684 O  O     . MET A 1 216 ? -23.155 -30.623 -30.793 1.00 53.85 ? 247 MET A O     1 
ATOM   1685 C  CB    . MET A 1 216 ? -21.401 -33.292 -31.853 1.00 54.63 ? 247 MET A CB    1 
ATOM   1686 C  CG    . MET A 1 216 ? -20.461 -33.739 -32.952 1.00 54.39 ? 247 MET A CG    1 
ATOM   1687 S  SD    . MET A 1 216 ? -20.718 -35.480 -33.400 1.00 54.75 ? 247 MET A SD    1 
ATOM   1688 C  CE    . MET A 1 216 ? -22.353 -35.427 -34.134 1.00 52.59 ? 247 MET A CE    1 
ATOM   1689 N  N     . LYS A 1 217 ? -22.357 -32.046 -29.240 1.00 54.47 ? 248 LYS A N     1 
ATOM   1690 C  CA    . LYS A 1 217 ? -23.322 -31.642 -28.217 1.00 54.82 ? 248 LYS A CA    1 
ATOM   1691 C  C     . LYS A 1 217 ? -23.326 -30.115 -28.038 1.00 54.66 ? 248 LYS A C     1 
ATOM   1692 O  O     . LYS A 1 217 ? -24.389 -29.498 -27.984 1.00 54.70 ? 248 LYS A O     1 
ATOM   1693 C  CB    . LYS A 1 217 ? -23.029 -32.328 -26.873 1.00 54.82 ? 248 LYS A CB    1 
ATOM   1694 C  CG    . LYS A 1 217 ? -23.415 -33.810 -26.804 1.00 55.41 ? 248 LYS A CG    1 
ATOM   1695 C  CD    . LYS A 1 217 ? -23.357 -34.370 -25.357 1.00 55.70 ? 248 LYS A CD    1 
ATOM   1696 C  CE    . LYS A 1 217 ? -24.385 -35.513 -25.120 1.00 56.18 ? 248 LYS A CE    1 
ATOM   1697 N  N     . LEU A 1 218 ? -22.140 -29.507 -27.964 1.00 54.44 ? 249 LEU A N     1 
ATOM   1698 C  CA    . LEU A 1 218 ? -22.036 -28.053 -27.799 1.00 54.21 ? 249 LEU A CA    1 
ATOM   1699 C  C     . LEU A 1 218 ? -22.591 -27.314 -29.013 1.00 54.29 ? 249 LEU A C     1 
ATOM   1700 O  O     . LEU A 1 218 ? -23.365 -26.372 -28.860 1.00 54.34 ? 249 LEU A O     1 
ATOM   1701 C  CB    . LEU A 1 218 ? -20.587 -27.632 -27.547 1.00 54.22 ? 249 LEU A CB    1 
ATOM   1702 C  CG    . LEU A 1 218 ? -20.339 -26.195 -27.075 1.00 54.17 ? 249 LEU A CG    1 
ATOM   1703 C  CD1   . LEU A 1 218 ? -21.122 -25.862 -25.804 1.00 52.66 ? 249 LEU A CD1   1 
ATOM   1704 C  CD2   . LEU A 1 218 ? -18.839 -25.967 -26.858 1.00 53.91 ? 249 LEU A CD2   1 
ATOM   1705 N  N     . PHE A 1 219 ? -22.210 -27.748 -30.213 1.00 54.28 ? 250 PHE A N     1 
ATOM   1706 C  CA    . PHE A 1 219 ? -22.725 -27.139 -31.437 1.00 54.28 ? 250 PHE A CA    1 
ATOM   1707 C  C     . PHE A 1 219 ? -24.239 -27.273 -31.539 1.00 54.34 ? 250 PHE A C     1 
ATOM   1708 O  O     . PHE A 1 219 ? -24.911 -26.340 -31.951 1.00 53.99 ? 250 PHE A O     1 
ATOM   1709 C  CB    . PHE A 1 219 ? -22.087 -27.748 -32.677 1.00 54.44 ? 250 PHE A CB    1 
ATOM   1710 C  CG    . PHE A 1 219 ? -22.512 -27.085 -33.957 1.00 54.36 ? 250 PHE A CG    1 
ATOM   1711 C  CD1   . PHE A 1 219 ? -22.017 -25.838 -34.302 1.00 54.58 ? 250 PHE A CD1   1 
ATOM   1712 C  CD2   . PHE A 1 219 ? -23.410 -27.699 -34.809 1.00 54.75 ? 250 PHE A CD2   1 
ATOM   1713 C  CE1   . PHE A 1 219 ? -22.415 -25.210 -35.480 1.00 54.91 ? 250 PHE A CE1   1 
ATOM   1714 C  CE2   . PHE A 1 219 ? -23.808 -27.075 -35.996 1.00 55.05 ? 250 PHE A CE2   1 
ATOM   1715 C  CZ    . PHE A 1 219 ? -23.308 -25.831 -36.328 1.00 54.37 ? 250 PHE A CZ    1 
ATOM   1716 N  N     . ASP A 1 220 ? -24.762 -28.437 -31.163 1.00 54.59 ? 251 ASP A N     1 
ATOM   1717 C  CA    . ASP A 1 220 ? -26.211 -28.664 -31.094 1.00 54.84 ? 251 ASP A CA    1 
ATOM   1718 C  C     . ASP A 1 220 ? -26.874 -27.577 -30.254 1.00 54.71 ? 251 ASP A C     1 
ATOM   1719 O  O     . ASP A 1 220 ? -27.887 -27.007 -30.646 1.00 54.37 ? 251 ASP A O     1 
ATOM   1720 C  CB    . ASP A 1 220 ? -26.492 -30.050 -30.489 1.00 55.09 ? 251 ASP A CB    1 
ATOM   1721 C  CG    . ASP A 1 220 ? -27.941 -30.511 -30.655 1.00 56.23 ? 251 ASP A CG    1 
ATOM   1722 O  OD1   . ASP A 1 220 ? -28.819 -29.737 -31.104 1.00 57.96 ? 251 ASP A OD1   1 
ATOM   1723 O  OD2   . ASP A 1 220 ? -28.202 -31.683 -30.313 1.00 58.01 ? 251 ASP A OD2   1 
ATOM   1724 N  N     . SER A 1 221 ? -26.278 -27.283 -29.105 1.00 54.85 ? 252 SER A N     1 
ATOM   1725 C  CA    . SER A 1 221 ? -26.847 -26.314 -28.189 1.00 55.04 ? 252 SER A CA    1 
ATOM   1726 C  C     . SER A 1 221 ? -26.783 -24.908 -28.765 1.00 55.24 ? 252 SER A C     1 
ATOM   1727 O  O     . SER A 1 221 ? -27.763 -24.179 -28.724 1.00 55.16 ? 252 SER A O     1 
ATOM   1728 C  CB    . SER A 1 221 ? -26.130 -26.367 -26.840 1.00 55.02 ? 252 SER A CB    1 
ATOM   1729 O  OG    . SER A 1 221 ? -26.588 -25.330 -25.988 1.00 55.40 ? 252 SER A OG    1 
ATOM   1730 N  N     . ILE A 1 222 ? -25.629 -24.528 -29.299 1.00 55.61 ? 253 ILE A N     1 
ATOM   1731 C  CA    . ILE A 1 222 ? -25.448 -23.172 -29.797 1.00 55.97 ? 253 ILE A CA    1 
ATOM   1732 C  C     . ILE A 1 222 ? -26.294 -22.965 -31.028 1.00 56.58 ? 253 ILE A C     1 
ATOM   1733 O  O     . ILE A 1 222 ? -27.107 -22.057 -31.091 1.00 56.70 ? 253 ILE A O     1 
ATOM   1734 C  CB    . ILE A 1 222 ? -23.976 -22.877 -30.140 1.00 55.79 ? 253 ILE A CB    1 
ATOM   1735 C  CG1   . ILE A 1 222 ? -23.138 -22.843 -28.863 1.00 55.65 ? 253 ILE A CG1   1 
ATOM   1736 C  CG2   . ILE A 1 222 ? -23.840 -21.547 -30.872 1.00 55.39 ? 253 ILE A CG2   1 
ATOM   1737 C  CD1   . ILE A 1 222 ? -23.559 -21.777 -27.866 1.00 54.77 ? 253 ILE A CD1   1 
ATOM   1738 N  N     . CYS A 1 223 ? -26.102 -23.840 -31.998 1.00 57.60 ? 254 CYS A N     1 
ATOM   1739 C  CA    . CYS A 1 223 ? -26.754 -23.740 -33.299 1.00 57.93 ? 254 CYS A CA    1 
ATOM   1740 C  C     . CYS A 1 223 ? -28.264 -23.514 -33.244 1.00 58.05 ? 254 CYS A C     1 
ATOM   1741 O  O     . CYS A 1 223 ? -28.805 -22.705 -34.004 1.00 58.18 ? 254 CYS A O     1 
ATOM   1742 C  CB    . CYS A 1 223 ? -26.478 -25.012 -34.084 1.00 57.95 ? 254 CYS A CB    1 
ATOM   1743 S  SG    . CYS A 1 223 ? -27.003 -24.908 -35.737 1.00 59.02 ? 254 CYS A SG    1 
ATOM   1744 N  N     . ASN A 1 224 ? -28.929 -24.233 -32.343 1.00 58.19 ? 255 ASN A N     1 
ATOM   1745 C  CA    . ASN A 1 224 ? -30.392 -24.204 -32.231 1.00 58.19 ? 255 ASN A CA    1 
ATOM   1746 C  C     . ASN A 1 224 ? -30.920 -23.233 -31.162 1.00 58.05 ? 255 ASN A C     1 
ATOM   1747 O  O     . ASN A 1 224 ? -32.117 -23.205 -30.884 1.00 57.82 ? 255 ASN A O     1 
ATOM   1748 C  CB    . ASN A 1 224 ? -30.913 -25.622 -31.960 1.00 58.23 ? 255 ASN A CB    1 
ATOM   1749 C  CG    . ASN A 1 224 ? -30.553 -26.604 -33.075 1.00 58.62 ? 255 ASN A CG    1 
ATOM   1750 O  OD1   . ASN A 1 224 ? -30.829 -26.359 -34.253 1.00 58.66 ? 255 ASN A OD1   1 
ATOM   1751 N  ND2   . ASN A 1 224 ? -29.946 -27.727 -32.701 1.00 58.71 ? 255 ASN A ND2   1 
ATOM   1752 N  N     . ASN A 1 225 ? -30.031 -22.431 -30.583 1.00 57.92 ? 256 ASN A N     1 
ATOM   1753 C  CA    . ASN A 1 225 ? -30.409 -21.479 -29.546 1.00 57.92 ? 256 ASN A CA    1 
ATOM   1754 C  C     . ASN A 1 225 ? -31.223 -20.318 -30.103 1.00 57.95 ? 256 ASN A C     1 
ATOM   1755 O  O     . ASN A 1 225 ? -30.869 -19.735 -31.130 1.00 57.69 ? 256 ASN A O     1 
ATOM   1756 C  CB    . ASN A 1 225 ? -29.158 -20.929 -28.864 1.00 58.03 ? 256 ASN A CB    1 
ATOM   1757 C  CG    . ASN A 1 225 ? -29.462 -20.245 -27.556 1.00 58.03 ? 256 ASN A CG    1 
ATOM   1758 O  OD1   . ASN A 1 225 ? -30.441 -19.510 -27.439 1.00 58.78 ? 256 ASN A OD1   1 
ATOM   1759 N  ND2   . ASN A 1 225 ? -28.621 -20.482 -26.558 1.00 58.03 ? 256 ASN A ND2   1 
ATOM   1760 N  N     . LYS A 1 226 ? -32.290 -19.965 -29.390 1.00 58.11 ? 257 LYS A N     1 
ATOM   1761 C  CA    . LYS A 1 226 ? -33.217 -18.922 -29.837 1.00 58.38 ? 257 LYS A CA    1 
ATOM   1762 C  C     . LYS A 1 226 ? -32.613 -17.508 -29.827 1.00 58.47 ? 257 LYS A C     1 
ATOM   1763 O  O     . LYS A 1 226 ? -33.162 -16.588 -30.431 1.00 58.48 ? 257 LYS A O     1 
ATOM   1764 C  CB    . LYS A 1 226 ? -34.527 -18.970 -29.028 1.00 58.47 ? 257 LYS A CB    1 
ATOM   1765 C  CG    . LYS A 1 226 ? -35.556 -19.980 -29.563 1.00 58.33 ? 257 LYS A CG    1 
ATOM   1766 N  N     . TRP A 1 227 ? -31.481 -17.333 -29.159 1.00 58.64 ? 258 TRP A N     1 
ATOM   1767 C  CA    . TRP A 1 227 ? -30.719 -16.092 -29.284 1.00 58.88 ? 258 TRP A CA    1 
ATOM   1768 C  C     . TRP A 1 227 ? -30.191 -15.890 -30.705 1.00 58.91 ? 258 TRP A C     1 
ATOM   1769 O  O     . TRP A 1 227 ? -30.007 -14.758 -31.148 1.00 58.79 ? 258 TRP A O     1 
ATOM   1770 C  CB    . TRP A 1 227 ? -29.532 -16.080 -28.312 1.00 59.09 ? 258 TRP A CB    1 
ATOM   1771 C  CG    . TRP A 1 227 ? -29.906 -15.789 -26.900 1.00 59.27 ? 258 TRP A CG    1 
ATOM   1772 C  CD1   . TRP A 1 227 ? -29.879 -16.656 -25.844 1.00 59.39 ? 258 TRP A CD1   1 
ATOM   1773 C  CD2   . TRP A 1 227 ? -30.369 -14.540 -26.384 1.00 59.53 ? 258 TRP A CD2   1 
ATOM   1774 N  NE1   . TRP A 1 227 ? -30.290 -16.020 -24.700 1.00 59.55 ? 258 TRP A NE1   1 
ATOM   1775 C  CE2   . TRP A 1 227 ? -30.604 -14.721 -25.003 1.00 59.75 ? 258 TRP A CE2   1 
ATOM   1776 C  CE3   . TRP A 1 227 ? -30.614 -13.282 -26.957 1.00 59.55 ? 258 TRP A CE3   1 
ATOM   1777 C  CZ2   . TRP A 1 227 ? -31.070 -13.688 -24.179 1.00 59.63 ? 258 TRP A CZ2   1 
ATOM   1778 C  CZ3   . TRP A 1 227 ? -31.077 -12.255 -26.140 1.00 59.61 ? 258 TRP A CZ3   1 
ATOM   1779 C  CH2   . TRP A 1 227 ? -31.300 -12.466 -24.763 1.00 59.63 ? 258 TRP A CH2   1 
ATOM   1780 N  N     . PHE A 1 228 ? -29.935 -16.988 -31.410 1.00 58.96 ? 259 PHE A N     1 
ATOM   1781 C  CA    . PHE A 1 228 ? -29.238 -16.919 -32.683 1.00 59.01 ? 259 PHE A CA    1 
ATOM   1782 C  C     . PHE A 1 228 ? -30.107 -17.374 -33.835 1.00 59.02 ? 259 PHE A C     1 
ATOM   1783 O  O     . PHE A 1 228 ? -29.638 -18.056 -34.740 1.00 59.11 ? 259 PHE A O     1 
ATOM   1784 C  CB    . PHE A 1 228 ? -27.968 -17.766 -32.620 1.00 59.12 ? 259 PHE A CB    1 
ATOM   1785 C  CG    . PHE A 1 228 ? -27.130 -17.504 -31.404 1.00 59.12 ? 259 PHE A CG    1 
ATOM   1786 C  CD1   . PHE A 1 228 ? -26.731 -16.212 -31.086 1.00 59.30 ? 259 PHE A CD1   1 
ATOM   1787 C  CD2   . PHE A 1 228 ? -26.731 -18.546 -30.583 1.00 59.09 ? 259 PHE A CD2   1 
ATOM   1788 C  CE1   . PHE A 1 228 ? -25.960 -15.963 -29.970 1.00 59.05 ? 259 PHE A CE1   1 
ATOM   1789 C  CE2   . PHE A 1 228 ? -25.956 -18.306 -29.466 1.00 59.40 ? 259 PHE A CE2   1 
ATOM   1790 C  CZ    . PHE A 1 228 ? -25.572 -17.011 -29.158 1.00 59.45 ? 259 PHE A CZ    1 
ATOM   1791 N  N     . THR A 1 229 ? -31.377 -16.992 -33.807 1.00 59.05 ? 260 THR A N     1 
ATOM   1792 C  CA    . THR A 1 229 ? -32.270 -17.302 -34.914 1.00 59.01 ? 260 THR A CA    1 
ATOM   1793 C  C     . THR A 1 229 ? -31.905 -16.446 -36.117 1.00 58.98 ? 260 THR A C     1 
ATOM   1794 O  O     . THR A 1 229 ? -31.930 -16.919 -37.249 1.00 58.91 ? 260 THR A O     1 
ATOM   1795 C  CB    . THR A 1 229 ? -33.720 -17.067 -34.527 1.00 58.99 ? 260 THR A CB    1 
ATOM   1796 O  OG1   . THR A 1 229 ? -34.032 -17.899 -33.405 1.00 58.81 ? 260 THR A OG1   1 
ATOM   1797 C  CG2   . THR A 1 229 ? -34.653 -17.397 -35.691 1.00 59.16 ? 260 THR A CG2   1 
ATOM   1798 N  N     . GLU A 1 230 ? -31.541 -15.195 -35.850 1.00 59.04 ? 261 GLU A N     1 
ATOM   1799 C  CA    . GLU A 1 230 ? -31.192 -14.235 -36.891 1.00 59.04 ? 261 GLU A CA    1 
ATOM   1800 C  C     . GLU A 1 230 ? -29.682 -14.000 -36.958 1.00 58.82 ? 261 GLU A C     1 
ATOM   1801 O  O     . GLU A 1 230 ? -29.238 -12.963 -37.446 1.00 58.82 ? 261 GLU A O     1 
ATOM   1802 C  CB    . GLU A 1 230 ? -31.906 -12.897 -36.631 1.00 59.24 ? 261 GLU A CB    1 
ATOM   1803 C  CG    . GLU A 1 230 ? -33.437 -12.977 -36.455 1.00 59.72 ? 261 GLU A CG    1 
ATOM   1804 C  CD    . GLU A 1 230 ? -34.197 -13.004 -37.783 1.00 60.58 ? 261 GLU A CD    1 
ATOM   1805 O  OE1   . GLU A 1 230 ? -33.805 -13.770 -38.696 1.00 60.66 ? 261 GLU A OE1   1 
ATOM   1806 O  OE2   . GLU A 1 230 ? -35.198 -12.261 -37.907 1.00 60.79 ? 261 GLU A OE2   1 
ATOM   1807 N  N     . THR A 1 231 ? -28.896 -14.957 -36.468 1.00 58.56 ? 262 THR A N     1 
ATOM   1808 C  CA    . THR A 1 231 ? -27.438 -14.855 -36.505 1.00 58.26 ? 262 THR A CA    1 
ATOM   1809 C  C     . THR A 1 231 ? -26.868 -15.750 -37.600 1.00 57.86 ? 262 THR A C     1 
ATOM   1810 O  O     . THR A 1 231 ? -27.251 -16.914 -37.724 1.00 57.70 ? 262 THR A O     1 
ATOM   1811 C  CB    . THR A 1 231 ? -26.811 -15.288 -35.170 1.00 58.37 ? 262 THR A CB    1 
ATOM   1812 O  OG1   . THR A 1 231 ? -27.447 -14.594 -34.097 1.00 58.70 ? 262 THR A OG1   1 
ATOM   1813 C  CG2   . THR A 1 231 ? -25.308 -14.989 -35.141 1.00 58.46 ? 262 THR A CG2   1 
ATOM   1814 N  N     . SER A 1 232 ? -25.947 -15.202 -38.386 1.00 57.44 ? 263 SER A N     1 
ATOM   1815 C  CA    . SER A 1 232 ? -25.231 -15.984 -39.385 1.00 57.08 ? 263 SER A CA    1 
ATOM   1816 C  C     . SER A 1 232 ? -24.297 -16.938 -38.662 1.00 56.81 ? 263 SER A C     1 
ATOM   1817 O  O     . SER A 1 232 ? -23.390 -16.505 -37.969 1.00 57.20 ? 263 SER A O     1 
ATOM   1818 C  CB    . SER A 1 232 ? -24.434 -15.073 -40.317 1.00 56.95 ? 263 SER A CB    1 
ATOM   1819 O  OG    . SER A 1 232 ? -25.291 -14.212 -41.049 1.00 56.59 ? 263 SER A OG    1 
ATOM   1820 N  N     . ILE A 1 233 ? -24.532 -18.238 -38.803 1.00 56.56 ? 264 ILE A N     1 
ATOM   1821 C  CA    . ILE A 1 233 ? -23.738 -19.243 -38.094 1.00 55.99 ? 264 ILE A CA    1 
ATOM   1822 C  C     . ILE A 1 233 ? -22.693 -19.888 -39.008 1.00 55.71 ? 264 ILE A C     1 
ATOM   1823 O  O     . ILE A 1 233 ? -23.031 -20.574 -39.969 1.00 55.60 ? 264 ILE A O     1 
ATOM   1824 C  CB    . ILE A 1 233 ? -24.650 -20.293 -37.445 1.00 55.75 ? 264 ILE A CB    1 
ATOM   1825 C  CG1   . ILE A 1 233 ? -25.458 -19.619 -36.338 1.00 55.90 ? 264 ILE A CG1   1 
ATOM   1826 C  CG2   . ILE A 1 233 ? -23.844 -21.443 -36.883 1.00 55.38 ? 264 ILE A CG2   1 
ATOM   1827 C  CD1   . ILE A 1 233 ? -26.133 -20.571 -35.399 1.00 57.26 ? 264 ILE A CD1   1 
ATOM   1828 N  N     . ILE A 1 234 ? -21.425 -19.642 -38.683 1.00 55.44 ? 265 ILE A N     1 
ATOM   1829 C  CA    . ILE A 1 234 ? -20.291 -20.152 -39.433 1.00 55.36 ? 265 ILE A CA    1 
ATOM   1830 C  C     . ILE A 1 234 ? -19.645 -21.283 -38.662 1.00 55.52 ? 265 ILE A C     1 
ATOM   1831 O  O     . ILE A 1 234 ? -19.453 -21.178 -37.456 1.00 55.78 ? 265 ILE A O     1 
ATOM   1832 C  CB    . ILE A 1 234 ? -19.218 -19.069 -39.642 1.00 55.32 ? 265 ILE A CB    1 
ATOM   1833 C  CG1   . ILE A 1 234 ? -19.803 -17.867 -40.392 1.00 55.79 ? 265 ILE A CG1   1 
ATOM   1834 C  CG2   . ILE A 1 234 ? -18.037 -19.631 -40.406 1.00 54.53 ? 265 ILE A CG2   1 
ATOM   1835 C  CD1   . ILE A 1 234 ? -20.585 -16.903 -39.506 1.00 56.16 ? 265 ILE A CD1   1 
ATOM   1836 N  N     . LEU A 1 235 ? -19.288 -22.354 -39.365 1.00 55.61 ? 266 LEU A N     1 
ATOM   1837 C  CA    . LEU A 1 235 ? -18.613 -23.493 -38.761 1.00 55.67 ? 266 LEU A CA    1 
ATOM   1838 C  C     . LEU A 1 235 ? -17.191 -23.585 -39.314 1.00 55.81 ? 266 LEU A C     1 
ATOM   1839 O  O     . LEU A 1 235 ? -16.995 -23.650 -40.530 1.00 56.03 ? 266 LEU A O     1 
ATOM   1840 C  CB    . LEU A 1 235 ? -19.395 -24.771 -39.066 1.00 55.78 ? 266 LEU A CB    1 
ATOM   1841 C  CG    . LEU A 1 235 ? -18.918 -26.098 -38.472 1.00 56.09 ? 266 LEU A CG    1 
ATOM   1842 C  CD1   . LEU A 1 235 ? -18.958 -26.074 -36.956 1.00 56.29 ? 266 LEU A CD1   1 
ATOM   1843 C  CD2   . LEU A 1 235 ? -19.765 -27.234 -39.014 1.00 55.50 ? 266 LEU A CD2   1 
ATOM   1844 N  N     . PHE A 1 236 ? -16.202 -23.571 -38.422 1.00 55.78 ? 267 PHE A N     1 
ATOM   1845 C  CA    . PHE A 1 236 ? -14.795 -23.729 -38.799 1.00 55.53 ? 267 PHE A CA    1 
ATOM   1846 C  C     . PHE A 1 236 ? -14.354 -25.106 -38.366 1.00 55.46 ? 267 PHE A C     1 
ATOM   1847 O  O     . PHE A 1 236 ? -14.137 -25.350 -37.183 1.00 55.42 ? 267 PHE A O     1 
ATOM   1848 C  CB    . PHE A 1 236 ? -13.918 -22.687 -38.106 1.00 55.45 ? 267 PHE A CB    1 
ATOM   1849 C  CG    . PHE A 1 236 ? -13.822 -21.372 -38.826 1.00 55.49 ? 267 PHE A CG    1 
ATOM   1850 C  CD1   . PHE A 1 236 ? -14.805 -20.941 -39.703 1.00 55.77 ? 267 PHE A CD1   1 
ATOM   1851 C  CD2   . PHE A 1 236 ? -12.743 -20.539 -38.590 1.00 55.95 ? 267 PHE A CD2   1 
ATOM   1852 C  CE1   . PHE A 1 236 ? -14.690 -19.716 -40.349 1.00 55.57 ? 267 PHE A CE1   1 
ATOM   1853 C  CE2   . PHE A 1 236 ? -12.632 -19.316 -39.230 1.00 55.66 ? 267 PHE A CE2   1 
ATOM   1854 C  CZ    . PHE A 1 236 ? -13.608 -18.908 -40.109 1.00 55.44 ? 267 PHE A CZ    1 
ATOM   1855 N  N     . LEU A 1 237 ? -14.253 -26.021 -39.318 1.00 55.38 ? 268 LEU A N     1 
ATOM   1856 C  CA    . LEU A 1 237 ? -13.679 -27.316 -39.034 1.00 55.45 ? 268 LEU A CA    1 
ATOM   1857 C  C     . LEU A 1 237 ? -12.166 -27.137 -39.135 1.00 55.61 ? 268 LEU A C     1 
ATOM   1858 O  O     . LEU A 1 237 ? -11.574 -27.240 -40.209 1.00 55.93 ? 268 LEU A O     1 
ATOM   1859 C  CB    . LEU A 1 237 ? -14.226 -28.369 -39.990 1.00 55.40 ? 268 LEU A CB    1 
ATOM   1860 C  CG    . LEU A 1 237 ? -15.730 -28.597 -39.826 1.00 55.36 ? 268 LEU A CG    1 
ATOM   1861 C  CD1   . LEU A 1 237 ? -16.290 -29.434 -40.963 1.00 55.24 ? 268 LEU A CD1   1 
ATOM   1862 C  CD2   . LEU A 1 237 ? -16.035 -29.249 -38.484 1.00 55.77 ? 268 LEU A CD2   1 
ATOM   1863 N  N     . ASN A 1 238 ? -11.564 -26.845 -37.992 1.00 55.55 ? 269 ASN A N     1 
ATOM   1864 C  CA    . ASN A 1 238 ? -10.182 -26.413 -37.910 1.00 55.66 ? 269 ASN A CA    1 
ATOM   1865 C  C     . ASN A 1 238 ? -9.214  -27.582 -37.735 1.00 55.80 ? 269 ASN A C     1 
ATOM   1866 O  O     . ASN A 1 238 ? -9.640  -28.717 -37.589 1.00 56.14 ? 269 ASN A O     1 
ATOM   1867 C  CB    . ASN A 1 238 ? -10.060 -25.445 -36.731 1.00 55.64 ? 269 ASN A CB    1 
ATOM   1868 C  CG    . ASN A 1 238 ? -8.763  -24.704 -36.724 1.00 55.07 ? 269 ASN A CG    1 
ATOM   1869 O  OD1   . ASN A 1 238 ? -8.312  -24.198 -37.750 1.00 54.36 ? 269 ASN A OD1   1 
ATOM   1870 N  ND2   . ASN A 1 238 ? -8.144  -24.639 -35.568 1.00 54.76 ? 269 ASN A ND2   1 
ATOM   1871 N  N     . LYS A 1 239 ? -7.916  -27.299 -37.747 1.00 55.89 ? 270 LYS A N     1 
ATOM   1872 C  CA    . LYS A 1 239 ? -6.880  -28.326 -37.608 1.00 56.04 ? 270 LYS A CA    1 
ATOM   1873 C  C     . LYS A 1 239 ? -6.929  -29.343 -38.747 1.00 56.04 ? 270 LYS A C     1 
ATOM   1874 O  O     . LYS A 1 239 ? -6.645  -30.524 -38.562 1.00 56.00 ? 270 LYS A O     1 
ATOM   1875 C  CB    . LYS A 1 239 ? -6.962  -29.022 -36.239 1.00 56.10 ? 270 LYS A CB    1 
ATOM   1876 C  CG    . LYS A 1 239 ? -6.790  -28.053 -35.090 1.00 56.54 ? 270 LYS A CG    1 
ATOM   1877 C  CD    . LYS A 1 239 ? -6.493  -28.731 -33.774 1.00 56.14 ? 270 LYS A CD    1 
ATOM   1878 C  CE    . LYS A 1 239 ? -6.007  -27.713 -32.744 1.00 56.52 ? 270 LYS A CE    1 
ATOM   1879 N  NZ    . LYS A 1 239 ? -5.830  -28.294 -31.376 1.00 56.88 ? 270 LYS A NZ    1 
ATOM   1880 N  N     . LYS A 1 240 ? -7.263  -28.878 -39.943 1.00 56.13 ? 271 LYS A N     1 
ATOM   1881 C  CA    . LYS A 1 240 ? -7.350  -29.782 -41.072 1.00 56.32 ? 271 LYS A CA    1 
ATOM   1882 C  C     . LYS A 1 240 ? -5.975  -30.373 -41.369 1.00 56.59 ? 271 LYS A C     1 
ATOM   1883 O  O     . LYS A 1 240 ? -5.865  -31.511 -41.828 1.00 56.52 ? 271 LYS A O     1 
ATOM   1884 C  CB    . LYS A 1 240 ? -7.948  -29.083 -42.295 1.00 56.21 ? 271 LYS A CB    1 
ATOM   1885 C  CG    . LYS A 1 240 ? -7.042  -28.091 -42.968 1.00 56.38 ? 271 LYS A CG    1 
ATOM   1886 C  CD    . LYS A 1 240 ? -7.788  -27.256 -43.993 1.00 56.60 ? 271 LYS A CD    1 
ATOM   1887 C  CE    . LYS A 1 240 ? -6.858  -26.749 -45.081 1.00 56.99 ? 271 LYS A CE    1 
ATOM   1888 N  NZ    . LYS A 1 240 ? -7.347  -25.469 -45.643 1.00 57.99 ? 271 LYS A NZ    1 
ATOM   1889 N  N     . ASP A 1 241 ? -4.924  -29.605 -41.090 1.00 57.12 ? 272 ASP A N     1 
ATOM   1890 C  CA    . ASP A 1 241 ? -3.562  -30.084 -41.339 1.00 57.45 ? 272 ASP A CA    1 
ATOM   1891 C  C     . ASP A 1 241 ? -3.239  -31.258 -40.427 1.00 57.27 ? 272 ASP A C     1 
ATOM   1892 O  O     . ASP A 1 241 ? -2.748  -32.276 -40.902 1.00 57.38 ? 272 ASP A O     1 
ATOM   1893 C  CB    . ASP A 1 241 ? -2.520  -28.965 -41.222 1.00 57.40 ? 272 ASP A CB    1 
ATOM   1894 C  CG    . ASP A 1 241 ? -2.487  -28.329 -39.853 1.00 59.21 ? 272 ASP A CG    1 
ATOM   1895 O  OD1   . ASP A 1 241 ? -3.551  -28.209 -39.208 1.00 60.08 ? 272 ASP A OD1   1 
ATOM   1896 O  OD2   . ASP A 1 241 ? -1.386  -27.947 -39.413 1.00 62.18 ? 272 ASP A OD2   1 
ATOM   1897 N  N     . LEU A 1 242 ? -3.564  -31.145 -39.143 1.00 57.27 ? 273 LEU A N     1 
ATOM   1898 C  CA    . LEU A 1 242 ? -3.303  -32.235 -38.209 1.00 57.60 ? 273 LEU A CA    1 
ATOM   1899 C  C     . LEU A 1 242 ? -4.191  -33.436 -38.517 1.00 57.55 ? 273 LEU A C     1 
ATOM   1900 O  O     . LEU A 1 242 ? -3.772  -34.585 -38.383 1.00 57.22 ? 273 LEU A O     1 
ATOM   1901 C  CB    . LEU A 1 242 ? -3.493  -31.778 -36.754 1.00 57.92 ? 273 LEU A CB    1 
ATOM   1902 C  CG    . LEU A 1 242 ? -2.540  -30.671 -36.242 1.00 58.48 ? 273 LEU A CG    1 
ATOM   1903 C  CD1   . LEU A 1 242 ? -2.836  -30.295 -34.800 1.00 56.93 ? 273 LEU A CD1   1 
ATOM   1904 C  CD2   . LEU A 1 242 ? -1.079  -31.066 -36.389 1.00 58.49 ? 273 LEU A CD2   1 
ATOM   1905 N  N     . PHE A 1 243 ? -5.413  -33.153 -38.957 1.00 57.73 ? 274 PHE A N     1 
ATOM   1906 C  CA    . PHE A 1 243 ? -6.370  -34.189 -39.295 1.00 57.59 ? 274 PHE A CA    1 
ATOM   1907 C  C     . PHE A 1 243 ? -5.867  -35.016 -40.456 1.00 57.99 ? 274 PHE A C     1 
ATOM   1908 O  O     . PHE A 1 243 ? -6.048  -36.234 -40.481 1.00 58.01 ? 274 PHE A O     1 
ATOM   1909 C  CB    . PHE A 1 243 ? -7.708  -33.558 -39.644 1.00 57.47 ? 274 PHE A CB    1 
ATOM   1910 C  CG    . PHE A 1 243 ? -8.773  -34.547 -39.991 1.00 56.84 ? 274 PHE A CG    1 
ATOM   1911 C  CD1   . PHE A 1 243 ? -9.395  -35.278 -39.006 1.00 56.80 ? 274 PHE A CD1   1 
ATOM   1912 C  CD2   . PHE A 1 243 ? -9.164  -34.732 -41.301 1.00 57.19 ? 274 PHE A CD2   1 
ATOM   1913 C  CE1   . PHE A 1 243 ? -10.386 -36.190 -39.321 1.00 57.15 ? 274 PHE A CE1   1 
ATOM   1914 C  CE2   . PHE A 1 243 ? -10.153 -35.643 -41.628 1.00 57.10 ? 274 PHE A CE2   1 
ATOM   1915 C  CZ    . PHE A 1 243 ? -10.765 -36.371 -40.637 1.00 57.04 ? 274 PHE A CZ    1 
ATOM   1916 N  N     . GLU A 1 244 ? -5.227  -34.348 -41.412 1.00 58.48 ? 275 GLU A N     1 
ATOM   1917 C  CA    . GLU A 1 244 ? -4.719  -35.016 -42.604 1.00 58.80 ? 275 GLU A CA    1 
ATOM   1918 C  C     . GLU A 1 244 ? -3.634  -36.035 -42.269 1.00 58.64 ? 275 GLU A C     1 
ATOM   1919 O  O     . GLU A 1 244 ? -3.625  -37.124 -42.836 1.00 58.87 ? 275 GLU A O     1 
ATOM   1920 C  CB    . GLU A 1 244 ? -4.192  -34.005 -43.618 1.00 58.99 ? 275 GLU A CB    1 
ATOM   1921 C  CG    . GLU A 1 244 ? -3.498  -34.657 -44.806 1.00 60.71 ? 275 GLU A CG    1 
ATOM   1922 C  CD    . GLU A 1 244 ? -3.318  -33.714 -45.973 1.00 63.30 ? 275 GLU A CD    1 
ATOM   1923 O  OE1   . GLU A 1 244 ? -3.096  -32.503 -45.733 1.00 64.81 ? 275 GLU A OE1   1 
ATOM   1924 O  OE2   . GLU A 1 244 ? -3.398  -34.188 -47.132 1.00 64.68 ? 275 GLU A OE2   1 
ATOM   1925 N  N     . GLU A 1 245 ? -2.721  -35.691 -41.365 1.00 58.43 ? 276 GLU A N     1 
ATOM   1926 C  CA    . GLU A 1 245 ? -1.679  -36.640 -40.971 1.00 58.35 ? 276 GLU A CA    1 
ATOM   1927 C  C     . GLU A 1 245 ? -2.290  -37.797 -40.154 1.00 58.29 ? 276 GLU A C     1 
ATOM   1928 O  O     . GLU A 1 245 ? -1.891  -38.954 -40.294 1.00 58.38 ? 276 GLU A O     1 
ATOM   1929 C  CB    . GLU A 1 245 ? -0.548  -35.937 -40.207 1.00 57.99 ? 276 GLU A CB    1 
ATOM   1930 N  N     . LYS A 1 246 ? -3.305  -37.481 -39.360 1.00 58.25 ? 277 LYS A N     1 
ATOM   1931 C  CA    . LYS A 1 246 ? -3.840  -38.398 -38.351 1.00 58.30 ? 277 LYS A CA    1 
ATOM   1932 C  C     . LYS A 1 246 ? -4.725  -39.506 -38.913 1.00 58.69 ? 277 LYS A C     1 
ATOM   1933 O  O     . LYS A 1 246 ? -4.684  -40.638 -38.442 1.00 58.31 ? 277 LYS A O     1 
ATOM   1934 C  CB    . LYS A 1 246 ? -4.655  -37.576 -37.366 1.00 58.44 ? 277 LYS A CB    1 
ATOM   1935 C  CG    . LYS A 1 246 ? -4.919  -38.200 -36.031 1.00 57.82 ? 277 LYS A CG    1 
ATOM   1936 C  CD    . LYS A 1 246 ? -5.159  -37.090 -35.023 1.00 56.89 ? 277 LYS A CD    1 
ATOM   1937 C  CE    . LYS A 1 246 ? -5.304  -37.618 -33.637 1.00 56.97 ? 277 LYS A CE    1 
ATOM   1938 N  NZ    . LYS A 1 246 ? -5.297  -36.508 -32.654 1.00 57.80 ? 277 LYS A NZ    1 
ATOM   1939 N  N     . ILE A 1 247 ? -5.527  -39.160 -39.917 1.00 59.22 ? 278 ILE A N     1 
ATOM   1940 C  CA    . ILE A 1 247 ? -6.529  -40.064 -40.484 1.00 59.69 ? 278 ILE A CA    1 
ATOM   1941 C  C     . ILE A 1 247 ? -5.902  -41.275 -41.175 1.00 60.31 ? 278 ILE A C     1 
ATOM   1942 O  O     . ILE A 1 247 ? -6.559  -42.307 -41.356 1.00 60.65 ? 278 ILE A O     1 
ATOM   1943 C  CB    . ILE A 1 247 ? -7.444  -39.306 -41.488 1.00 59.74 ? 278 ILE A CB    1 
ATOM   1944 C  CG1   . ILE A 1 247 ? -8.730  -40.086 -41.789 1.00 59.58 ? 278 ILE A CG1   1 
ATOM   1945 C  CG2   . ILE A 1 247 ? -6.687  -38.985 -42.777 1.00 59.78 ? 278 ILE A CG2   1 
ATOM   1946 C  CD1   . ILE A 1 247 ? -9.671  -40.193 -40.625 1.00 59.37 ? 278 ILE A CD1   1 
ATOM   1947 N  N     . LYS A 1 248 ? -4.638  -41.149 -41.572 1.00 60.74 ? 279 LYS A N     1 
ATOM   1948 C  CA    . LYS A 1 248 ? -3.889  -42.286 -42.129 1.00 61.09 ? 279 LYS A CA    1 
ATOM   1949 C  C     . LYS A 1 248 ? -3.561  -43.309 -41.028 1.00 60.58 ? 279 LYS A C     1 
ATOM   1950 O  O     . LYS A 1 248 ? -3.650  -44.509 -41.239 1.00 60.74 ? 279 LYS A O     1 
ATOM   1951 C  CB    . LYS A 1 248 ? -2.590  -41.796 -42.788 1.00 61.36 ? 279 LYS A CB    1 
ATOM   1952 C  CG    . LYS A 1 248 ? -2.776  -40.797 -43.949 1.00 61.95 ? 279 LYS A CG    1 
ATOM   1953 C  CD    . LYS A 1 248 ? -1.492  -39.991 -44.195 1.00 62.08 ? 279 LYS A CD    1 
ATOM   1954 C  CE    . LYS A 1 248 ? -1.633  -39.016 -45.374 1.00 62.73 ? 279 LYS A CE    1 
ATOM   1955 N  NZ    . LYS A 1 248 ? -0.415  -38.152 -45.544 1.00 62.98 ? 279 LYS A NZ    1 
ATOM   1956 N  N     . ARG A 1 249 ? -3.203  -42.806 -39.849 1.00 60.21 ? 280 ARG A N     1 
ATOM   1957 C  CA    . ARG A 1 249 ? -2.752  -43.627 -38.725 1.00 59.75 ? 280 ARG A CA    1 
ATOM   1958 C  C     . ARG A 1 249 ? -3.908  -44.170 -37.868 1.00 59.17 ? 280 ARG A C     1 
ATOM   1959 O  O     . ARG A 1 249 ? -3.786  -45.247 -37.303 1.00 59.09 ? 280 ARG A O     1 
ATOM   1960 C  CB    . ARG A 1 249 ? -1.818  -42.803 -37.805 1.00 59.95 ? 280 ARG A CB    1 
ATOM   1961 C  CG    . ARG A 1 249 ? -0.604  -42.143 -38.480 1.00 59.62 ? 280 ARG A CG    1 
ATOM   1962 N  N     . SER A 1 250 ? -5.018  -43.431 -37.776 1.00 58.40 ? 281 SER A N     1 
ATOM   1963 C  CA    . SER A 1 250 ? -6.018  -43.636 -36.702 1.00 57.72 ? 281 SER A CA    1 
ATOM   1964 C  C     . SER A 1 250 ? -7.466  -43.619 -37.217 1.00 56.74 ? 281 SER A C     1 
ATOM   1965 O  O     . SER A 1 250 ? -7.939  -42.598 -37.707 1.00 56.69 ? 281 SER A O     1 
ATOM   1966 C  CB    . SER A 1 250 ? -5.826  -42.547 -35.624 1.00 57.80 ? 281 SER A CB    1 
ATOM   1967 O  OG    . SER A 1 250 ? -6.673  -42.742 -34.501 1.00 57.82 ? 281 SER A OG    1 
ATOM   1968 N  N     . PRO A 1 251 ? -8.189  -44.738 -37.082 1.00 55.76 ? 282 PRO A N     1 
ATOM   1969 C  CA    . PRO A 1 251 ? -9.482  -44.837 -37.770 1.00 55.11 ? 282 PRO A CA    1 
ATOM   1970 C  C     . PRO A 1 251 ? -10.571 -43.961 -37.163 1.00 54.30 ? 282 PRO A C     1 
ATOM   1971 O  O     . PRO A 1 251 ? -10.631 -43.801 -35.953 1.00 54.33 ? 282 PRO A O     1 
ATOM   1972 C  CB    . PRO A 1 251 ? -9.853  -46.316 -37.620 1.00 54.99 ? 282 PRO A CB    1 
ATOM   1973 C  CG    . PRO A 1 251 ? -9.185  -46.752 -36.383 1.00 55.43 ? 282 PRO A CG    1 
ATOM   1974 C  CD    . PRO A 1 251 ? -7.895  -45.946 -36.292 1.00 55.91 ? 282 PRO A CD    1 
ATOM   1975 N  N     . LEU A 1 252 ? -11.438 -43.425 -38.011 1.00 53.56 ? 283 LEU A N     1 
ATOM   1976 C  CA    . LEU A 1 252 ? -12.531 -42.571 -37.565 1.00 53.08 ? 283 LEU A CA    1 
ATOM   1977 C  C     . LEU A 1 252 ? -13.593 -43.322 -36.755 1.00 52.94 ? 283 LEU A C     1 
ATOM   1978 O  O     . LEU A 1 252 ? -14.365 -42.696 -36.034 1.00 52.99 ? 283 LEU A O     1 
ATOM   1979 C  CB    . LEU A 1 252 ? -13.176 -41.899 -38.773 1.00 53.03 ? 283 LEU A CB    1 
ATOM   1980 C  CG    . LEU A 1 252 ? -14.165 -40.756 -38.547 1.00 52.55 ? 283 LEU A CG    1 
ATOM   1981 C  CD1   . LEU A 1 252 ? -13.483 -39.537 -38.019 1.00 50.46 ? 283 LEU A CD1   1 
ATOM   1982 C  CD2   . LEU A 1 252 ? -14.883 -40.449 -39.858 1.00 52.93 ? 283 LEU A CD2   1 
ATOM   1983 N  N     . THR A 1 253 ? -13.625 -44.649 -36.862 1.00 52.72 ? 284 THR A N     1 
ATOM   1984 C  CA    . THR A 1 253 ? -14.561 -45.474 -36.086 1.00 52.59 ? 284 THR A CA    1 
ATOM   1985 C  C     . THR A 1 253 ? -14.350 -45.389 -34.568 1.00 52.61 ? 284 THR A C     1 
ATOM   1986 O  O     . THR A 1 253 ? -15.228 -45.768 -33.796 1.00 52.71 ? 284 THR A O     1 
ATOM   1987 C  CB    . THR A 1 253 ? -14.507 -46.968 -36.513 1.00 52.65 ? 284 THR A CB    1 
ATOM   1988 O  OG1   . THR A 1 253 ? -13.143 -47.404 -36.594 1.00 52.77 ? 284 THR A OG1   1 
ATOM   1989 C  CG2   . THR A 1 253 ? -15.195 -47.178 -37.859 1.00 51.68 ? 284 THR A CG2   1 
ATOM   1990 N  N     . ILE A 1 254 ? -13.186 -44.907 -34.145 1.00 52.70 ? 285 ILE A N     1 
ATOM   1991 C  CA    . ILE A 1 254 ? -12.955 -44.559 -32.748 1.00 52.87 ? 285 ILE A CA    1 
ATOM   1992 C  C     . ILE A 1 254 ? -14.018 -43.577 -32.270 1.00 53.07 ? 285 ILE A C     1 
ATOM   1993 O  O     . ILE A 1 254 ? -14.487 -43.656 -31.136 1.00 53.07 ? 285 ILE A O     1 
ATOM   1994 C  CB    . ILE A 1 254 ? -11.587 -43.882 -32.571 1.00 53.09 ? 285 ILE A CB    1 
ATOM   1995 C  CG1   . ILE A 1 254 ? -10.453 -44.897 -32.766 1.00 53.41 ? 285 ILE A CG1   1 
ATOM   1996 C  CG2   . ILE A 1 254 ? -11.481 -43.223 -31.204 1.00 52.40 ? 285 ILE A CG2   1 
ATOM   1997 C  CD1   . ILE A 1 254 ? -9.106  -44.246 -33.104 1.00 52.80 ? 285 ILE A CD1   1 
ATOM   1998 N  N     . CYS A 1 255 ? -14.389 -42.656 -33.152 1.00 53.35 ? 286 CYS A N     1 
ATOM   1999 C  CA    . CYS A 1 255 ? -15.325 -41.584 -32.827 1.00 53.34 ? 286 CYS A CA    1 
ATOM   2000 C  C     . CYS A 1 255 ? -16.748 -41.899 -33.252 1.00 52.88 ? 286 CYS A C     1 
ATOM   2001 O  O     . CYS A 1 255 ? -17.674 -41.746 -32.469 1.00 53.24 ? 286 CYS A O     1 
ATOM   2002 C  CB    . CYS A 1 255 ? -14.900 -40.296 -33.521 1.00 53.46 ? 286 CYS A CB    1 
ATOM   2003 S  SG    . CYS A 1 255 ? -15.947 -38.896 -33.123 1.00 54.17 ? 286 CYS A SG    1 
ATOM   2004 N  N     . TYR A 1 256 ? -16.911 -42.290 -34.513 1.00 52.26 ? 287 TYR A N     1 
ATOM   2005 C  CA    . TYR A 1 256 ? -18.211 -42.640 -35.071 1.00 51.59 ? 287 TYR A CA    1 
ATOM   2006 C  C     . TYR A 1 256 ? -18.210 -44.112 -35.456 1.00 51.17 ? 287 TYR A C     1 
ATOM   2007 O  O     . TYR A 1 256 ? -17.859 -44.463 -36.583 1.00 51.01 ? 287 TYR A O     1 
ATOM   2008 C  CB    . TYR A 1 256 ? -18.497 -41.816 -36.316 1.00 51.43 ? 287 TYR A CB    1 
ATOM   2009 C  CG    . TYR A 1 256 ? -18.525 -40.332 -36.102 1.00 51.31 ? 287 TYR A CG    1 
ATOM   2010 C  CD1   . TYR A 1 256 ? -17.463 -39.540 -36.501 1.00 50.90 ? 287 TYR A CD1   1 
ATOM   2011 C  CD2   . TYR A 1 256 ? -19.624 -39.716 -35.526 1.00 51.26 ? 287 TYR A CD2   1 
ATOM   2012 C  CE1   . TYR A 1 256 ? -17.491 -38.183 -36.328 1.00 50.53 ? 287 TYR A CE1   1 
ATOM   2013 C  CE2   . TYR A 1 256 ? -19.656 -38.354 -35.343 1.00 50.52 ? 287 TYR A CE2   1 
ATOM   2014 C  CZ    . TYR A 1 256 ? -18.589 -37.595 -35.751 1.00 50.80 ? 287 TYR A CZ    1 
ATOM   2015 O  OH    . TYR A 1 256 ? -18.608 -36.232 -35.581 1.00 52.08 ? 287 TYR A OH    1 
ATOM   2016 N  N     . PRO A 1 257 ? -18.629 -44.986 -34.532 1.00 50.68 ? 288 PRO A N     1 
ATOM   2017 C  CA    . PRO A 1 257 ? -18.509 -46.412 -34.820 1.00 50.30 ? 288 PRO A CA    1 
ATOM   2018 C  C     . PRO A 1 257 ? -19.422 -46.911 -35.950 1.00 49.75 ? 288 PRO A C     1 
ATOM   2019 O  O     . PRO A 1 257 ? -19.266 -48.040 -36.384 1.00 49.44 ? 288 PRO A O     1 
ATOM   2020 C  CB    . PRO A 1 257 ? -18.855 -47.068 -33.477 1.00 50.39 ? 288 PRO A CB    1 
ATOM   2021 C  CG    . PRO A 1 257 ? -19.700 -46.079 -32.775 1.00 50.37 ? 288 PRO A CG    1 
ATOM   2022 C  CD    . PRO A 1 257 ? -19.231 -44.730 -33.211 1.00 50.56 ? 288 PRO A CD    1 
ATOM   2023 N  N     . GLU A 1 258 ? -20.335 -46.073 -36.433 1.00 49.45 ? 289 GLU A N     1 
ATOM   2024 C  CA    . GLU A 1 258 ? -21.210 -46.441 -37.563 1.00 49.52 ? 289 GLU A CA    1 
ATOM   2025 C  C     . GLU A 1 258 ? -20.583 -46.098 -38.915 1.00 49.12 ? 289 GLU A C     1 
ATOM   2026 O  O     . GLU A 1 258 ? -21.132 -46.460 -39.950 1.00 48.96 ? 289 GLU A O     1 
ATOM   2027 C  CB    . GLU A 1 258 ? -22.593 -45.765 -37.497 1.00 49.54 ? 289 GLU A CB    1 
ATOM   2028 C  CG    . GLU A 1 258 ? -22.881 -44.919 -36.273 1.00 50.75 ? 289 GLU A CG    1 
ATOM   2029 C  CD    . GLU A 1 258 ? -22.133 -43.601 -36.292 1.00 51.99 ? 289 GLU A CD    1 
ATOM   2030 O  OE1   . GLU A 1 258 ? -22.324 -42.811 -37.240 1.00 53.27 ? 289 GLU A OE1   1 
ATOM   2031 O  OE2   . GLU A 1 258 ? -21.346 -43.358 -35.361 1.00 53.60 ? 289 GLU A OE2   1 
ATOM   2032 N  N     . TYR A 1 259 ? -19.457 -45.387 -38.912 1.00 48.87 ? 290 TYR A N     1 
ATOM   2033 C  CA    . TYR A 1 259 ? -18.812 -44.975 -40.152 1.00 48.80 ? 290 TYR A CA    1 
ATOM   2034 C  C     . TYR A 1 259 ? -18.331 -46.189 -40.938 1.00 48.94 ? 290 TYR A C     1 
ATOM   2035 O  O     . TYR A 1 259 ? -17.587 -47.018 -40.421 1.00 49.09 ? 290 TYR A O     1 
ATOM   2036 C  CB    . TYR A 1 259 ? -17.639 -44.052 -39.849 1.00 48.69 ? 290 TYR A CB    1 
ATOM   2037 C  CG    . TYR A 1 259 ? -16.928 -43.499 -41.068 1.00 48.65 ? 290 TYR A CG    1 
ATOM   2038 C  CD1   . TYR A 1 259 ? -17.601 -42.693 -41.981 1.00 48.82 ? 290 TYR A CD1   1 
ATOM   2039 C  CD2   . TYR A 1 259 ? -15.571 -43.760 -41.294 1.00 48.39 ? 290 TYR A CD2   1 
ATOM   2040 C  CE1   . TYR A 1 259 ? -16.946 -42.173 -43.105 1.00 49.27 ? 290 TYR A CE1   1 
ATOM   2041 C  CE2   . TYR A 1 259 ? -14.905 -43.241 -42.409 1.00 48.46 ? 290 TYR A CE2   1 
ATOM   2042 C  CZ    . TYR A 1 259 ? -15.598 -42.447 -43.312 1.00 48.77 ? 290 TYR A CZ    1 
ATOM   2043 O  OH    . TYR A 1 259 ? -14.963 -41.924 -44.413 1.00 47.66 ? 290 TYR A OH    1 
ATOM   2044 N  N     . THR A 1 260 ? -18.775 -46.296 -42.184 1.00 49.09 ? 291 THR A N     1 
ATOM   2045 C  CA    . THR A 1 260 ? -18.416 -47.427 -43.046 1.00 49.10 ? 291 THR A CA    1 
ATOM   2046 C  C     . THR A 1 260 ? -17.500 -47.005 -44.195 1.00 49.51 ? 291 THR A C     1 
ATOM   2047 O  O     . THR A 1 260 ? -17.022 -47.845 -44.956 1.00 48.90 ? 291 THR A O     1 
ATOM   2048 C  CB    . THR A 1 260 ? -19.671 -48.063 -43.625 1.00 48.87 ? 291 THR A CB    1 
ATOM   2049 O  OG1   . THR A 1 260 ? -20.394 -47.080 -44.369 1.00 48.03 ? 291 THR A OG1   1 
ATOM   2050 C  CG2   . THR A 1 260 ? -20.551 -48.581 -42.510 1.00 48.39 ? 291 THR A CG2   1 
ATOM   2051 N  N     . GLY A 1 261 ? -17.251 -45.699 -44.299 1.00 50.36 ? 292 GLY A N     1 
ATOM   2052 C  CA    . GLY A 1 261 ? -16.408 -45.149 -45.344 1.00 51.05 ? 292 GLY A CA    1 
ATOM   2053 C  C     . GLY A 1 261 ? -14.941 -45.428 -45.100 1.00 51.73 ? 292 GLY A C     1 
ATOM   2054 O  O     . GLY A 1 261 ? -14.569 -46.082 -44.124 1.00 51.62 ? 292 GLY A O     1 
ATOM   2055 N  N     . SER A 1 262 ? -14.108 -44.919 -45.996 1.00 52.66 ? 293 SER A N     1 
ATOM   2056 C  CA    . SER A 1 262 ? -12.680 -45.186 -45.957 1.00 53.64 ? 293 SER A CA    1 
ATOM   2057 C  C     . SER A 1 262 ? -11.946 -44.122 -45.145 1.00 53.79 ? 293 SER A C     1 
ATOM   2058 O  O     . SER A 1 262 ? -12.329 -42.956 -45.147 1.00 53.54 ? 293 SER A O     1 
ATOM   2059 C  CB    . SER A 1 262 ? -12.124 -45.267 -47.382 1.00 53.92 ? 293 SER A CB    1 
ATOM   2060 O  OG    . SER A 1 262 ? -12.258 -44.024 -48.050 1.00 55.54 ? 293 SER A OG    1 
ATOM   2061 N  N     . ASN A 1 263 ? -10.897 -44.544 -44.444 1.00 54.36 ? 294 ASN A N     1 
ATOM   2062 C  CA    . ASN A 1 263 ? -10.098 -43.646 -43.615 1.00 54.93 ? 294 ASN A CA    1 
ATOM   2063 C  C     . ASN A 1 263 ? -9.174  -42.787 -44.462 1.00 55.06 ? 294 ASN A C     1 
ATOM   2064 O  O     . ASN A 1 263 ? -7.973  -43.027 -44.523 1.00 55.51 ? 294 ASN A O     1 
ATOM   2065 C  CB    . ASN A 1 263 ? -9.282  -44.447 -42.596 1.00 55.06 ? 294 ASN A CB    1 
ATOM   2066 C  CG    . ASN A 1 263 ? -10.139 -45.019 -41.498 1.00 55.92 ? 294 ASN A CG    1 
ATOM   2067 O  OD1   . ASN A 1 263 ? -10.863 -44.289 -40.820 1.00 57.97 ? 294 ASN A OD1   1 
ATOM   2068 N  ND2   . ASN A 1 263 ? -10.064 -46.328 -41.311 1.00 56.43 ? 294 ASN A ND2   1 
ATOM   2069 N  N     . THR A 1 264 ? -9.751  -41.795 -45.127 1.00 55.26 ? 295 THR A N     1 
ATOM   2070 C  CA    . THR A 1 264 ? -9.017  -40.921 -46.033 1.00 55.20 ? 295 THR A CA    1 
ATOM   2071 C  C     . THR A 1 264 ? -9.490  -39.515 -45.779 1.00 55.48 ? 295 THR A C     1 
ATOM   2072 O  O     . THR A 1 264 ? -10.666 -39.296 -45.501 1.00 55.68 ? 295 THR A O     1 
ATOM   2073 C  CB    . THR A 1 264 ? -9.290  -41.262 -47.509 1.00 55.17 ? 295 THR A CB    1 
ATOM   2074 O  OG1   . THR A 1 264 ? -10.695 -41.140 -47.776 1.00 55.44 ? 295 THR A OG1   1 
ATOM   2075 C  CG2   . THR A 1 264 ? -8.824  -42.674 -47.837 1.00 53.82 ? 295 THR A CG2   1 
ATOM   2076 N  N     . TYR A 1 265 ? -8.577  -38.562 -45.882 1.00 55.76 ? 296 TYR A N     1 
ATOM   2077 C  CA    . TYR A 1 265 ? -8.899  -37.172 -45.621 1.00 55.95 ? 296 TYR A CA    1 
ATOM   2078 C  C     . TYR A 1 265 ? -10.265 -36.764 -46.193 1.00 55.33 ? 296 TYR A C     1 
ATOM   2079 O  O     . TYR A 1 265 ? -11.113 -36.269 -45.475 1.00 55.15 ? 296 TYR A O     1 
ATOM   2080 C  CB    . TYR A 1 265 ? -7.790  -36.270 -46.170 1.00 56.69 ? 296 TYR A CB    1 
ATOM   2081 C  CG    . TYR A 1 265 ? -8.062  -34.809 -45.940 1.00 58.04 ? 296 TYR A CG    1 
ATOM   2082 C  CD1   . TYR A 1 265 ? -7.847  -34.227 -44.702 1.00 58.84 ? 296 TYR A CD1   1 
ATOM   2083 C  CD2   . TYR A 1 265 ? -8.569  -34.012 -46.961 1.00 60.01 ? 296 TYR A CD2   1 
ATOM   2084 C  CE1   . TYR A 1 265 ? -8.111  -32.884 -44.490 1.00 59.70 ? 296 TYR A CE1   1 
ATOM   2085 C  CE2   . TYR A 1 265 ? -8.839  -32.670 -46.762 1.00 60.00 ? 296 TYR A CE2   1 
ATOM   2086 C  CZ    . TYR A 1 265 ? -8.607  -32.107 -45.531 1.00 59.77 ? 296 TYR A CZ    1 
ATOM   2087 O  OH    . TYR A 1 265 ? -8.883  -30.766 -45.350 1.00 59.75 ? 296 TYR A OH    1 
ATOM   2088 N  N     . GLU A 1 266 ? -10.488 -37.020 -47.471 1.00 54.84 ? 297 GLU A N     1 
ATOM   2089 C  CA    . GLU A 1 266 ? -11.667 -36.491 -48.157 1.00 54.80 ? 297 GLU A CA    1 
ATOM   2090 C  C     . GLU A 1 266 ? -12.989 -37.060 -47.636 1.00 53.90 ? 297 GLU A C     1 
ATOM   2091 O  O     . GLU A 1 266 ? -13.924 -36.299 -47.387 1.00 53.83 ? 297 GLU A O     1 
ATOM   2092 C  CB    . GLU A 1 266 ? -11.569 -36.711 -49.670 1.00 55.13 ? 297 GLU A CB    1 
ATOM   2093 C  CG    . GLU A 1 266 ? -10.254 -36.217 -50.284 1.00 57.25 ? 297 GLU A CG    1 
ATOM   2094 C  CD    . GLU A 1 266 ? -9.174  -37.297 -50.295 1.00 59.99 ? 297 GLU A CD    1 
ATOM   2095 O  OE1   . GLU A 1 266 ? -9.366  -38.307 -51.009 1.00 62.50 ? 297 GLU A OE1   1 
ATOM   2096 O  OE2   . GLU A 1 266 ? -8.150  -37.147 -49.589 1.00 61.58 ? 297 GLU A OE2   1 
ATOM   2097 N  N     . GLU A 1 267 ? -13.072 -38.381 -47.476 1.00 52.84 ? 298 GLU A N     1 
ATOM   2098 C  CA    . GLU A 1 267 ? -14.293 -39.011 -46.955 1.00 52.11 ? 298 GLU A CA    1 
ATOM   2099 C  C     . GLU A 1 267 ? -14.508 -38.722 -45.481 1.00 51.51 ? 298 GLU A C     1 
ATOM   2100 O  O     . GLU A 1 267 ? -15.615 -38.386 -45.064 1.00 51.56 ? 298 GLU A O     1 
ATOM   2101 C  CB    . GLU A 1 267 ? -14.271 -40.524 -47.132 1.00 52.08 ? 298 GLU A CB    1 
ATOM   2102 C  CG    . GLU A 1 267 ? -14.583 -40.986 -48.509 1.00 51.56 ? 298 GLU A CG    1 
ATOM   2103 C  CD    . GLU A 1 267 ? -14.818 -42.466 -48.569 1.00 51.60 ? 298 GLU A CD    1 
ATOM   2104 O  OE1   . GLU A 1 267 ? -14.183 -43.136 -49.410 1.00 52.69 ? 298 GLU A OE1   1 
ATOM   2105 O  OE2   . GLU A 1 267 ? -15.636 -42.966 -47.775 1.00 51.39 ? 298 GLU A OE2   1 
ATOM   2106 N  N     . ALA A 1 268 ? -13.454 -38.875 -44.693 1.00 50.64 ? 299 ALA A N     1 
ATOM   2107 C  CA    . ALA A 1 268 ? -13.557 -38.656 -43.269 1.00 50.29 ? 299 ALA A CA    1 
ATOM   2108 C  C     . ALA A 1 268 ? -14.003 -37.230 -42.979 1.00 50.17 ? 299 ALA A C     1 
ATOM   2109 O  O     . ALA A 1 268 ? -14.877 -37.004 -42.148 1.00 50.65 ? 299 ALA A O     1 
ATOM   2110 C  CB    . ALA A 1 268 ? -12.247 -38.965 -42.589 1.00 50.07 ? 299 ALA A CB    1 
ATOM   2111 N  N     . ALA A 1 269 ? -13.429 -36.264 -43.685 1.00 49.91 ? 300 ALA A N     1 
ATOM   2112 C  CA    . ALA A 1 269 ? -13.775 -34.867 -43.462 1.00 49.49 ? 300 ALA A CA    1 
ATOM   2113 C  C     . ALA A 1 269 ? -15.218 -34.604 -43.862 1.00 49.30 ? 300 ALA A C     1 
ATOM   2114 O  O     . ALA A 1 269 ? -15.946 -33.912 -43.149 1.00 49.61 ? 300 ALA A O     1 
ATOM   2115 C  CB    . ALA A 1 269 ? -12.850 -33.969 -44.221 1.00 49.47 ? 300 ALA A CB    1 
ATOM   2116 N  N     . ALA A 1 270 ? -15.636 -35.168 -44.991 1.00 48.88 ? 301 ALA A N     1 
ATOM   2117 C  CA    . ALA A 1 270 ? -17.005 -35.002 -45.459 1.00 48.53 ? 301 ALA A CA    1 
ATOM   2118 C  C     . ALA A 1 270 ? -17.977 -35.504 -44.387 1.00 48.53 ? 301 ALA A C     1 
ATOM   2119 O  O     . ALA A 1 270 ? -18.983 -34.852 -44.094 1.00 48.32 ? 301 ALA A O     1 
ATOM   2120 C  CB    . ALA A 1 270 ? -17.216 -35.740 -46.766 1.00 48.09 ? 301 ALA A CB    1 
ATOM   2121 N  N     . TYR A 1 271 ? -17.649 -36.646 -43.782 1.00 48.37 ? 302 TYR A N     1 
ATOM   2122 C  CA    . TYR A 1 271 ? -18.559 -37.307 -42.859 1.00 48.09 ? 302 TYR A CA    1 
ATOM   2123 C  C     . TYR A 1 271 ? -18.754 -36.456 -41.630 1.00 48.00 ? 302 TYR A C     1 
ATOM   2124 O  O     . TYR A 1 271 ? -19.871 -36.317 -41.131 1.00 48.13 ? 302 TYR A O     1 
ATOM   2125 C  CB    . TYR A 1 271 ? -18.021 -38.674 -42.449 1.00 48.28 ? 302 TYR A CB    1 
ATOM   2126 C  CG    . TYR A 1 271 ? -19.037 -39.507 -41.698 1.00 48.49 ? 302 TYR A CG    1 
ATOM   2127 C  CD1   . TYR A 1 271 ? -20.013 -40.220 -42.380 1.00 47.55 ? 302 TYR A CD1   1 
ATOM   2128 C  CD2   . TYR A 1 271 ? -19.035 -39.559 -40.299 1.00 48.89 ? 302 TYR A CD2   1 
ATOM   2129 C  CE1   . TYR A 1 271 ? -20.955 -40.978 -41.703 1.00 48.28 ? 302 TYR A CE1   1 
ATOM   2130 C  CE2   . TYR A 1 271 ? -19.978 -40.317 -39.608 1.00 49.06 ? 302 TYR A CE2   1 
ATOM   2131 C  CZ    . TYR A 1 271 ? -20.932 -41.032 -40.318 1.00 48.77 ? 302 TYR A CZ    1 
ATOM   2132 O  OH    . TYR A 1 271 ? -21.873 -41.788 -39.654 1.00 48.57 ? 302 TYR A OH    1 
ATOM   2133 N  N     . ILE A 1 272 ? -17.657 -35.876 -41.157 1.00 47.58 ? 303 ILE A N     1 
ATOM   2134 C  CA    . ILE A 1 272 ? -17.695 -35.031 -39.989 1.00 47.33 ? 303 ILE A CA    1 
ATOM   2135 C  C     . ILE A 1 272 ? -18.575 -33.816 -40.283 1.00 47.78 ? 303 ILE A C     1 
ATOM   2136 O  O     . ILE A 1 272 ? -19.499 -33.533 -39.539 1.00 47.90 ? 303 ILE A O     1 
ATOM   2137 C  CB    . ILE A 1 272 ? -16.268 -34.625 -39.540 1.00 46.97 ? 303 ILE A CB    1 
ATOM   2138 C  CG1   . ILE A 1 272 ? -15.505 -35.854 -39.045 1.00 46.06 ? 303 ILE A CG1   1 
ATOM   2139 C  CG2   . ILE A 1 272 ? -16.329 -33.610 -38.437 1.00 45.99 ? 303 ILE A CG2   1 
ATOM   2140 C  CD1   . ILE A 1 272 ? -14.034 -35.618 -38.796 1.00 45.09 ? 303 ILE A CD1   1 
ATOM   2141 N  N     . GLN A 1 273 ? -18.309 -33.120 -41.383 1.00 48.46 ? 304 GLN A N     1 
ATOM   2142 C  CA    . GLN A 1 273 ? -19.145 -31.976 -41.786 1.00 48.95 ? 304 GLN A CA    1 
ATOM   2143 C  C     . GLN A 1 273 ? -20.645 -32.285 -41.694 1.00 49.22 ? 304 GLN A C     1 
ATOM   2144 O  O     . GLN A 1 273 ? -21.392 -31.535 -41.074 1.00 49.54 ? 304 GLN A O     1 
ATOM   2145 C  CB    . GLN A 1 273 ? -18.799 -31.518 -43.209 1.00 48.89 ? 304 GLN A CB    1 
ATOM   2146 C  CG    . GLN A 1 273 ? -19.734 -30.440 -43.756 1.00 49.02 ? 304 GLN A CG    1 
ATOM   2147 C  CD    . GLN A 1 273 ? -19.236 -29.795 -45.034 1.00 49.07 ? 304 GLN A CD    1 
ATOM   2148 O  OE1   . GLN A 1 273 ? -18.168 -30.130 -45.547 1.00 50.58 ? 304 GLN A OE1   1 
ATOM   2149 N  NE2   . GLN A 1 273 ? -20.016 -28.860 -45.557 1.00 48.83 ? 304 GLN A NE2   1 
ATOM   2150 N  N     . CYS A 1 274 ? -21.073 -33.384 -42.304 1.00 49.53 ? 305 CYS A N     1 
ATOM   2151 C  CA    . CYS A 1 274 ? -22.477 -33.792 -42.265 1.00 50.07 ? 305 CYS A CA    1 
ATOM   2152 C  C     . CYS A 1 274 ? -22.994 -34.042 -40.867 1.00 50.62 ? 305 CYS A C     1 
ATOM   2153 O  O     . CYS A 1 274 ? -24.134 -33.698 -40.566 1.00 50.74 ? 305 CYS A O     1 
ATOM   2154 C  CB    . CYS A 1 274 ? -22.690 -35.069 -43.067 1.00 50.01 ? 305 CYS A CB    1 
ATOM   2155 S  SG    . CYS A 1 274 ? -22.302 -34.847 -44.765 1.00 49.58 ? 305 CYS A SG    1 
ATOM   2156 N  N     . GLN A 1 275 ? -22.171 -34.667 -40.028 1.00 51.20 ? 306 GLN A N     1 
ATOM   2157 C  CA    . GLN A 1 275 ? -22.571 -34.945 -38.659 1.00 51.84 ? 306 GLN A CA    1 
ATOM   2158 C  C     . GLN A 1 275 ? -22.934 -33.660 -37.948 1.00 52.27 ? 306 GLN A C     1 
ATOM   2159 O  O     . GLN A 1 275 ? -23.942 -33.608 -37.249 1.00 52.53 ? 306 GLN A O     1 
ATOM   2160 C  CB    . GLN A 1 275 ? -21.474 -35.680 -37.875 1.00 51.84 ? 306 GLN A CB    1 
ATOM   2161 C  CG    . GLN A 1 275 ? -21.168 -37.087 -38.373 1.00 52.30 ? 306 GLN A CG    1 
ATOM   2162 C  CD    . GLN A 1 275 ? -22.410 -37.862 -38.741 1.00 52.71 ? 306 GLN A CD    1 
ATOM   2163 O  OE1   . GLN A 1 275 ? -23.263 -38.115 -37.891 1.00 52.88 ? 306 GLN A OE1   1 
ATOM   2164 N  NE2   . GLN A 1 275 ? -22.528 -38.232 -40.014 1.00 52.29 ? 306 GLN A NE2   1 
ATOM   2165 N  N     . PHE A 1 276 ? -22.124 -32.625 -38.138 1.00 52.72 ? 307 PHE A N     1 
ATOM   2166 C  CA    . PHE A 1 276 ? -22.385 -31.341 -37.502 1.00 53.39 ? 307 PHE A CA    1 
ATOM   2167 C  C     . PHE A 1 276 ? -23.581 -30.639 -38.121 1.00 54.00 ? 307 PHE A C     1 
ATOM   2168 O  O     . PHE A 1 276 ? -24.432 -30.130 -37.398 1.00 53.94 ? 307 PHE A O     1 
ATOM   2169 C  CB    . PHE A 1 276 ? -21.149 -30.429 -37.539 1.00 53.25 ? 307 PHE A CB    1 
ATOM   2170 C  CG    . PHE A 1 276 ? -20.188 -30.681 -36.415 1.00 53.23 ? 307 PHE A CG    1 
ATOM   2171 C  CD1   . PHE A 1 276 ? -19.207 -31.655 -36.525 1.00 53.11 ? 307 PHE A CD1   1 
ATOM   2172 C  CD2   . PHE A 1 276 ? -20.281 -29.967 -35.238 1.00 52.67 ? 307 PHE A CD2   1 
ATOM   2173 C  CE1   . PHE A 1 276 ? -18.343 -31.908 -35.488 1.00 51.84 ? 307 PHE A CE1   1 
ATOM   2174 C  CE2   . PHE A 1 276 ? -19.413 -30.218 -34.204 1.00 52.71 ? 307 PHE A CE2   1 
ATOM   2175 C  CZ    . PHE A 1 276 ? -18.444 -31.195 -34.334 1.00 52.71 ? 307 PHE A CZ    1 
ATOM   2176 N  N     . GLU A 1 277 ? -23.651 -30.612 -39.448 1.00 54.82 ? 308 GLU A N     1 
ATOM   2177 C  CA    . GLU A 1 277 ? -24.740 -29.906 -40.129 1.00 55.73 ? 308 GLU A CA    1 
ATOM   2178 C  C     . GLU A 1 277 ? -26.110 -30.551 -39.885 1.00 56.39 ? 308 GLU A C     1 
ATOM   2179 O  O     . GLU A 1 277 ? -27.126 -29.865 -39.913 1.00 56.49 ? 308 GLU A O     1 
ATOM   2180 C  CB    . GLU A 1 277 ? -24.445 -29.762 -41.623 1.00 55.60 ? 308 GLU A CB    1 
ATOM   2181 C  CG    . GLU A 1 277 ? -23.291 -28.796 -41.903 1.00 56.09 ? 308 GLU A CG    1 
ATOM   2182 C  CD    . GLU A 1 277 ? -23.044 -28.549 -43.384 1.00 56.50 ? 308 GLU A CD    1 
ATOM   2183 O  OE1   . GLU A 1 277 ? -23.556 -29.322 -44.220 1.00 59.03 ? 308 GLU A OE1   1 
ATOM   2184 O  OE2   . GLU A 1 277 ? -22.333 -27.577 -43.721 1.00 57.05 ? 308 GLU A OE2   1 
ATOM   2185 N  N     . ASP A 1 278 ? -26.138 -31.853 -39.610 1.00 57.38 ? 309 ASP A N     1 
ATOM   2186 C  CA    . ASP A 1 278 ? -27.393 -32.537 -39.297 1.00 58.25 ? 309 ASP A CA    1 
ATOM   2187 C  C     . ASP A 1 278 ? -27.981 -32.138 -37.941 1.00 58.61 ? 309 ASP A C     1 
ATOM   2188 O  O     . ASP A 1 278 ? -29.142 -32.429 -37.667 1.00 58.66 ? 309 ASP A O     1 
ATOM   2189 C  CB    . ASP A 1 278 ? -27.226 -34.062 -39.370 1.00 58.49 ? 309 ASP A CB    1 
ATOM   2190 C  CG    . ASP A 1 278 ? -27.482 -34.612 -40.772 1.00 60.36 ? 309 ASP A CG    1 
ATOM   2191 O  OD1   . ASP A 1 278 ? -26.750 -34.233 -41.721 1.00 62.06 ? 309 ASP A OD1   1 
ATOM   2192 O  OD2   . ASP A 1 278 ? -28.426 -35.427 -40.926 1.00 63.03 ? 309 ASP A OD2   1 
ATOM   2193 N  N     . LEU A 1 279 ? -27.186 -31.478 -37.103 1.00 59.18 ? 310 LEU A N     1 
ATOM   2194 C  CA    . LEU A 1 279 ? -27.648 -31.000 -35.801 1.00 59.78 ? 310 LEU A CA    1 
ATOM   2195 C  C     . LEU A 1 279 ? -28.459 -29.712 -35.920 1.00 60.64 ? 310 LEU A C     1 
ATOM   2196 O  O     . LEU A 1 279 ? -29.101 -29.290 -34.960 1.00 60.94 ? 310 LEU A O     1 
ATOM   2197 C  CB    . LEU A 1 279 ? -26.463 -30.759 -34.871 1.00 59.75 ? 310 LEU A CB    1 
ATOM   2198 C  CG    . LEU A 1 279 ? -25.537 -31.954 -34.641 1.00 59.40 ? 310 LEU A CG    1 
ATOM   2199 C  CD1   . LEU A 1 279 ? -24.272 -31.500 -33.946 1.00 57.71 ? 310 LEU A CD1   1 
ATOM   2200 C  CD2   . LEU A 1 279 ? -26.250 -33.044 -33.848 1.00 58.90 ? 310 LEU A CD2   1 
ATOM   2201 N  N     . ASN A 1 280 ? -28.418 -29.079 -37.087 1.00 61.57 ? 311 ASN A N     1 
ATOM   2202 C  CA    . ASN A 1 280 ? -29.311 -27.967 -37.388 1.00 62.37 ? 311 ASN A CA    1 
ATOM   2203 C  C     . ASN A 1 280 ? -30.763 -28.457 -37.427 1.00 63.14 ? 311 ASN A C     1 
ATOM   2204 O  O     . ASN A 1 280 ? -31.131 -29.198 -38.334 1.00 63.13 ? 311 ASN A O     1 
ATOM   2205 C  CB    . ASN A 1 280 ? -28.920 -27.350 -38.736 1.00 62.36 ? 311 ASN A CB    1 
ATOM   2206 C  CG    . ASN A 1 280 ? -29.710 -26.102 -39.067 1.00 62.56 ? 311 ASN A CG    1 
ATOM   2207 O  OD1   . ASN A 1 280 ? -30.670 -25.761 -38.380 1.00 63.35 ? 311 ASN A OD1   1 
ATOM   2208 N  ND2   . ASN A 1 280 ? -29.308 -25.410 -40.127 1.00 62.49 ? 311 ASN A ND2   1 
ATOM   2209 N  N     . ARG A 1 281 ? -31.572 -28.057 -36.443 1.00 64.28 ? 312 ARG A N     1 
ATOM   2210 C  CA    . ARG A 1 281 ? -32.995 -28.452 -36.387 1.00 65.34 ? 312 ARG A CA    1 
ATOM   2211 C  C     . ARG A 1 281 ? -33.843 -27.699 -37.409 1.00 65.75 ? 312 ARG A C     1 
ATOM   2212 O  O     . ARG A 1 281 ? -34.725 -28.278 -38.040 1.00 65.71 ? 312 ARG A O     1 
ATOM   2213 C  CB    . ARG A 1 281 ? -33.591 -28.205 -34.997 1.00 65.69 ? 312 ARG A CB    1 
ATOM   2214 C  CG    . ARG A 1 281 ? -32.966 -29.017 -33.877 1.00 67.25 ? 312 ARG A CG    1 
ATOM   2215 C  CD    . ARG A 1 281 ? -33.355 -30.498 -33.915 1.00 69.61 ? 312 ARG A CD    1 
ATOM   2216 N  NE    . ARG A 1 281 ? -32.189 -31.326 -33.601 1.00 71.37 ? 312 ARG A NE    1 
ATOM   2217 C  CZ    . ARG A 1 281 ? -31.644 -31.458 -32.389 1.00 72.04 ? 312 ARG A CZ    1 
ATOM   2218 N  NH1   . ARG A 1 281 ? -30.563 -32.221 -32.236 1.00 71.71 ? 312 ARG A NH1   1 
ATOM   2219 N  NH2   . ARG A 1 281 ? -32.164 -30.838 -31.329 1.00 72.05 ? 312 ARG A NH2   1 
ATOM   2220 N  N     . ARG A 1 282 ? -33.569 -26.406 -37.559 1.00 66.45 ? 313 ARG A N     1 
ATOM   2221 C  CA    . ARG A 1 282 ? -34.314 -25.540 -38.471 1.00 66.96 ? 313 ARG A CA    1 
ATOM   2222 C  C     . ARG A 1 282 ? -33.653 -25.472 -39.844 1.00 67.22 ? 313 ARG A C     1 
ATOM   2223 O  O     . ARG A 1 282 ? -33.194 -24.408 -40.255 1.00 67.38 ? 313 ARG A O     1 
ATOM   2224 C  CB    . ARG A 1 282 ? -34.398 -24.131 -37.881 1.00 67.15 ? 313 ARG A CB    1 
ATOM   2225 C  CG    . ARG A 1 282 ? -35.165 -24.062 -36.579 1.00 68.19 ? 313 ARG A CG    1 
ATOM   2226 C  CD    . ARG A 1 282 ? -36.657 -23.767 -36.797 1.00 69.53 ? 313 ARG A CD    1 
ATOM   2227 N  NE    . ARG A 1 282 ? -37.511 -24.435 -35.812 1.00 70.31 ? 313 ARG A NE    1 
ATOM   2228 C  CZ    . ARG A 1 282 ? -37.490 -24.216 -34.493 1.00 70.79 ? 313 ARG A CZ    1 
ATOM   2229 N  NH1   . ARG A 1 282 ? -36.643 -23.341 -33.945 1.00 71.28 ? 313 ARG A NH1   1 
ATOM   2230 N  NH2   . ARG A 1 282 ? -38.323 -24.891 -33.705 1.00 70.35 ? 313 ARG A NH2   1 
ATOM   2231 N  N     . LYS A 1 283 ? -33.602 -26.601 -40.552 1.00 67.57 ? 314 LYS A N     1 
ATOM   2232 C  CA    . LYS A 1 283 ? -32.984 -26.647 -41.894 1.00 67.68 ? 314 LYS A CA    1 
ATOM   2233 C  C     . LYS A 1 283 ? -33.781 -25.827 -42.916 1.00 67.47 ? 314 LYS A C     1 
ATOM   2234 O  O     . LYS A 1 283 ? -33.196 -25.189 -43.795 1.00 67.35 ? 314 LYS A O     1 
ATOM   2235 C  CB    . LYS A 1 283 ? -32.823 -28.095 -42.385 1.00 67.87 ? 314 LYS A CB    1 
ATOM   2236 C  CG    . LYS A 1 283 ? -31.520 -28.762 -41.949 1.00 68.10 ? 314 LYS A CG    1 
ATOM   2237 C  CD    . LYS A 1 283 ? -31.619 -30.286 -42.007 1.00 68.39 ? 314 LYS A CD    1 
ATOM   2238 C  CE    . LYS A 1 283 ? -30.348 -30.955 -41.494 1.00 68.66 ? 314 LYS A CE    1 
ATOM   2239 N  NZ    . LYS A 1 283 ? -30.653 -32.178 -40.691 1.00 68.62 ? 314 LYS A NZ    1 
ATOM   2240 N  N     . ASP A 1 284 ? -35.108 -25.848 -42.793 1.00 67.27 ? 315 ASP A N     1 
ATOM   2241 C  CA    . ASP A 1 284 ? -35.976 -25.011 -43.629 1.00 67.11 ? 315 ASP A CA    1 
ATOM   2242 C  C     . ASP A 1 284 ? -35.595 -23.525 -43.498 1.00 66.84 ? 315 ASP A C     1 
ATOM   2243 O  O     . ASP A 1 284 ? -35.382 -22.853 -44.504 1.00 66.88 ? 315 ASP A O     1 
ATOM   2244 C  CB    . ASP A 1 284 ? -37.455 -25.232 -43.278 1.00 66.96 ? 315 ASP A CB    1 
ATOM   2245 N  N     . THR A 1 285 ? -35.482 -23.032 -42.265 1.00 66.47 ? 316 THR A N     1 
ATOM   2246 C  CA    . THR A 1 285 ? -35.103 -21.633 -42.012 1.00 66.10 ? 316 THR A CA    1 
ATOM   2247 C  C     . THR A 1 285 ? -33.606 -21.361 -42.239 1.00 65.84 ? 316 THR A C     1 
ATOM   2248 O  O     . THR A 1 285 ? -33.224 -20.628 -43.151 1.00 65.87 ? 316 THR A O     1 
ATOM   2249 C  CB    . THR A 1 285 ? -35.444 -21.216 -40.559 1.00 66.07 ? 316 THR A CB    1 
ATOM   2250 O  OG1   . THR A 1 285 ? -36.834 -21.438 -40.307 1.00 65.61 ? 316 THR A OG1   1 
ATOM   2251 C  CG2   . THR A 1 285 ? -35.093 -19.742 -40.304 1.00 66.25 ? 316 THR A CG2   1 
ATOM   2252 N  N     . LYS A 1 286 ? -32.773 -21.982 -41.410 1.00 65.37 ? 317 LYS A N     1 
ATOM   2253 C  CA    . LYS A 1 286 ? -31.392 -21.552 -41.191 1.00 64.89 ? 317 LYS A CA    1 
ATOM   2254 C  C     . LYS A 1 286 ? -30.368 -22.271 -42.070 1.00 64.35 ? 317 LYS A C     1 
ATOM   2255 O  O     . LYS A 1 286 ? -30.621 -23.365 -42.573 1.00 64.41 ? 317 LYS A O     1 
ATOM   2256 C  CB    . LYS A 1 286 ? -31.046 -21.783 -39.719 1.00 64.95 ? 317 LYS A CB    1 
ATOM   2257 C  CG    . LYS A 1 286 ? -29.908 -20.942 -39.206 1.00 65.29 ? 317 LYS A CG    1 
ATOM   2258 C  CD    . LYS A 1 286 ? -29.832 -20.989 -37.695 1.00 65.42 ? 317 LYS A CD    1 
ATOM   2259 C  CE    . LYS A 1 286 ? -28.851 -19.957 -37.190 1.00 65.81 ? 317 LYS A CE    1 
ATOM   2260 N  NZ    . LYS A 1 286 ? -29.269 -18.567 -37.546 1.00 66.02 ? 317 LYS A NZ    1 
ATOM   2261 N  N     . GLU A 1 287 ? -29.206 -21.648 -42.244 1.00 63.67 ? 318 GLU A N     1 
ATOM   2262 C  CA    . GLU A 1 287 ? -28.104 -22.272 -42.968 1.00 63.26 ? 318 GLU A CA    1 
ATOM   2263 C  C     . GLU A 1 287 ? -26.773 -22.145 -42.213 1.00 62.35 ? 318 GLU A C     1 
ATOM   2264 O  O     . GLU A 1 287 ? -26.511 -21.134 -41.550 1.00 62.46 ? 318 GLU A O     1 
ATOM   2265 C  CB    . GLU A 1 287 ? -27.980 -21.677 -44.375 1.00 63.50 ? 318 GLU A CB    1 
ATOM   2266 C  CG    . GLU A 1 287 ? -27.335 -22.642 -45.372 1.00 64.76 ? 318 GLU A CG    1 
ATOM   2267 C  CD    . GLU A 1 287 ? -26.764 -21.946 -46.597 1.00 66.10 ? 318 GLU A CD    1 
ATOM   2268 O  OE1   . GLU A 1 287 ? -27.553 -21.281 -47.315 1.00 65.28 ? 318 GLU A OE1   1 
ATOM   2269 O  OE2   . GLU A 1 287 ? -25.528 -22.075 -46.829 1.00 66.27 ? 318 GLU A OE2   1 
ATOM   2270 N  N     . ILE A 1 288 ? -25.953 -23.191 -42.310 1.00 61.22 ? 319 ILE A N     1 
ATOM   2271 C  CA    . ILE A 1 288 ? -24.619 -23.215 -41.721 1.00 60.23 ? 319 ILE A CA    1 
ATOM   2272 C  C     . ILE A 1 288 ? -23.605 -22.994 -42.823 1.00 59.51 ? 319 ILE A C     1 
ATOM   2273 O  O     . ILE A 1 288 ? -23.623 -23.696 -43.834 1.00 59.53 ? 319 ILE A O     1 
ATOM   2274 C  CB    . ILE A 1 288 ? -24.285 -24.581 -41.066 1.00 60.21 ? 319 ILE A CB    1 
ATOM   2275 C  CG1   . ILE A 1 288 ? -25.332 -24.969 -40.012 1.00 59.94 ? 319 ILE A CG1   1 
ATOM   2276 C  CG2   . ILE A 1 288 ? -22.878 -24.556 -40.473 1.00 59.65 ? 319 ILE A CG2   1 
ATOM   2277 C  CD1   . ILE A 1 288 ? -25.606 -23.908 -38.988 1.00 59.94 ? 319 ILE A CD1   1 
ATOM   2278 N  N     . TYR A 1 289 ? -22.712 -22.035 -42.617 1.00 58.58 ? 320 TYR A N     1 
ATOM   2279 C  CA    . TYR A 1 289 ? -21.636 -21.775 -43.559 1.00 57.93 ? 320 TYR A CA    1 
ATOM   2280 C  C     . TYR A 1 289 ? -20.357 -22.430 -43.042 1.00 57.40 ? 320 TYR A C     1 
ATOM   2281 O  O     . TYR A 1 289 ? -19.768 -21.980 -42.068 1.00 57.44 ? 320 TYR A O     1 
ATOM   2282 C  CB    . TYR A 1 289 ? -21.476 -20.267 -43.767 1.00 57.81 ? 320 TYR A CB    1 
ATOM   2283 C  CG    . TYR A 1 289 ? -22.781 -19.611 -44.150 1.00 57.57 ? 320 TYR A CG    1 
ATOM   2284 C  CD1   . TYR A 1 289 ? -23.281 -19.735 -45.439 1.00 57.71 ? 320 TYR A CD1   1 
ATOM   2285 C  CD2   . TYR A 1 289 ? -23.538 -18.906 -43.212 1.00 57.52 ? 320 TYR A CD2   1 
ATOM   2286 C  CE1   . TYR A 1 289 ? -24.491 -19.152 -45.803 1.00 57.75 ? 320 TYR A CE1   1 
ATOM   2287 C  CE2   . TYR A 1 289 ? -24.753 -18.316 -43.562 1.00 57.45 ? 320 TYR A CE2   1 
ATOM   2288 C  CZ    . TYR A 1 289 ? -25.225 -18.444 -44.864 1.00 57.64 ? 320 TYR A CZ    1 
ATOM   2289 O  OH    . TYR A 1 289 ? -26.425 -17.877 -45.246 1.00 57.49 ? 320 TYR A OH    1 
ATOM   2290 N  N     . THR A 1 290 ? -19.940 -23.496 -43.711 1.00 56.74 ? 321 THR A N     1 
ATOM   2291 C  CA    . THR A 1 290 ? -18.854 -24.334 -43.249 1.00 56.36 ? 321 THR A CA    1 
ATOM   2292 C  C     . THR A 1 290 ? -17.583 -24.127 -44.062 1.00 56.36 ? 321 THR A C     1 
ATOM   2293 O  O     . THR A 1 290 ? -17.630 -24.037 -45.276 1.00 56.17 ? 321 THR A O     1 
ATOM   2294 C  CB    . THR A 1 290 ? -19.283 -25.787 -43.315 1.00 56.18 ? 321 THR A CB    1 
ATOM   2295 O  OG1   . THR A 1 290 ? -20.377 -25.969 -42.418 1.00 56.35 ? 321 THR A OG1   1 
ATOM   2296 C  CG2   . THR A 1 290 ? -18.170 -26.708 -42.905 1.00 56.63 ? 321 THR A CG2   1 
ATOM   2297 N  N     . HIS A 1 291 ? -16.446 -24.036 -43.372 1.00 56.56 ? 322 HIS A N     1 
ATOM   2298 C  CA    . HIS A 1 291 ? -15.140 -23.917 -44.018 1.00 56.63 ? 322 HIS A CA    1 
ATOM   2299 C  C     . HIS A 1 291 ? -14.116 -24.772 -43.292 1.00 56.71 ? 322 HIS A C     1 
ATOM   2300 O  O     . HIS A 1 291 ? -14.105 -24.837 -42.072 1.00 56.84 ? 322 HIS A O     1 
ATOM   2301 C  CB    . HIS A 1 291 ? -14.649 -22.471 -44.022 1.00 56.61 ? 322 HIS A CB    1 
ATOM   2302 C  CG    . HIS A 1 291 ? -15.552 -21.529 -44.743 1.00 57.11 ? 322 HIS A CG    1 
ATOM   2303 N  ND1   . HIS A 1 291 ? -15.416 -21.253 -46.085 1.00 57.29 ? 322 HIS A ND1   1 
ATOM   2304 C  CD2   . HIS A 1 291 ? -16.606 -20.798 -44.309 1.00 57.92 ? 322 HIS A CD2   1 
ATOM   2305 C  CE1   . HIS A 1 291 ? -16.350 -20.391 -46.447 1.00 57.94 ? 322 HIS A CE1   1 
ATOM   2306 N  NE2   . HIS A 1 291 ? -17.083 -20.095 -45.388 1.00 58.14 ? 322 HIS A NE2   1 
ATOM   2307 N  N     . PHE A 1 292 ? -13.255 -25.422 -44.060 1.00 56.98 ? 323 PHE A N     1 
ATOM   2308 C  CA    . PHE A 1 292 ? -12.164 -26.197 -43.508 1.00 57.08 ? 323 PHE A CA    1 
ATOM   2309 C  C     . PHE A 1 292 ? -10.989 -25.275 -43.378 1.00 57.21 ? 323 PHE A C     1 
ATOM   2310 O  O     . PHE A 1 292 ? -10.556 -24.679 -44.361 1.00 57.17 ? 323 PHE A O     1 
ATOM   2311 C  CB    . PHE A 1 292 ? -11.832 -27.374 -44.414 1.00 57.10 ? 323 PHE A CB    1 
ATOM   2312 C  CG    . PHE A 1 292 ? -12.883 -28.432 -44.398 1.00 56.97 ? 323 PHE A CG    1 
ATOM   2313 C  CD1   . PHE A 1 292 ? -13.990 -28.325 -45.215 1.00 56.64 ? 323 PHE A CD1   1 
ATOM   2314 C  CD2   . PHE A 1 292 ? -12.787 -29.505 -43.523 1.00 56.60 ? 323 PHE A CD2   1 
ATOM   2315 C  CE1   . PHE A 1 292 ? -14.978 -29.276 -45.174 1.00 57.01 ? 323 PHE A CE1   1 
ATOM   2316 C  CE2   . PHE A 1 292 ? -13.759 -30.460 -43.481 1.00 56.72 ? 323 PHE A CE2   1 
ATOM   2317 C  CZ    . PHE A 1 292 ? -14.862 -30.353 -44.311 1.00 57.04 ? 323 PHE A CZ    1 
ATOM   2318 N  N     . THR A 1 293 ? -10.483 -25.160 -42.159 1.00 57.36 ? 324 THR A N     1 
ATOM   2319 C  CA    . THR A 1 293 ? -9.480  -24.175 -41.846 1.00 57.52 ? 324 THR A CA    1 
ATOM   2320 C  C     . THR A 1 293 ? -8.263  -24.821 -41.232 1.00 57.89 ? 324 THR A C     1 
ATOM   2321 O  O     . THR A 1 293 ? -8.356  -25.857 -40.567 1.00 58.19 ? 324 THR A O     1 
ATOM   2322 C  CB    . THR A 1 293 ? -10.017 -23.147 -40.835 1.00 57.66 ? 324 THR A CB    1 
ATOM   2323 O  OG1   . THR A 1 293 ? -10.312 -23.793 -39.585 1.00 57.36 ? 324 THR A OG1   1 
ATOM   2324 C  CG2   . THR A 1 293 ? -11.273 -22.472 -41.371 1.00 57.56 ? 324 THR A CG2   1 
ATOM   2325 N  N     . CYS A 1 294 ? -7.115  -24.200 -41.473 1.00 58.03 ? 325 CYS A N     1 
ATOM   2326 C  CA    . CYS A 1 294 ? -5.940  -24.381 -40.642 1.00 57.56 ? 325 CYS A CA    1 
ATOM   2327 C  C     . CYS A 1 294 ? -5.711  -23.026 -39.984 1.00 57.19 ? 325 CYS A C     1 
ATOM   2328 O  O     . CYS A 1 294 ? -5.198  -22.094 -40.614 1.00 57.45 ? 325 CYS A O     1 
ATOM   2329 C  CB    . CYS A 1 294 ? -4.736  -24.790 -41.485 1.00 57.53 ? 325 CYS A CB    1 
ATOM   2330 S  SG    . CYS A 1 294 ? -3.279  -25.068 -40.493 1.00 58.79 ? 325 CYS A SG    1 
ATOM   2331 N  N     . ALA A 1 295 ? -6.131  -22.898 -38.733 1.00 56.79 ? 326 ALA A N     1 
ATOM   2332 C  CA    . ALA A 1 295 ? -6.110  -21.600 -38.046 1.00 56.43 ? 326 ALA A CA    1 
ATOM   2333 C  C     . ALA A 1 295 ? -4.714  -20.975 -38.014 1.00 56.05 ? 326 ALA A C     1 
ATOM   2334 O  O     . ALA A 1 295 ? -4.579  -19.763 -38.088 1.00 55.94 ? 326 ALA A O     1 
ATOM   2335 C  CB    . ALA A 1 295 ? -6.668  -21.728 -36.636 1.00 56.05 ? 326 ALA A CB    1 
ATOM   2336 N  N     . THR A 1 296 ? -3.679  -21.805 -37.930 1.00 55.85 ? 327 THR A N     1 
ATOM   2337 C  CA    . THR A 1 296 ? -2.298  -21.315 -37.845 1.00 55.52 ? 327 THR A CA    1 
ATOM   2338 C  C     . THR A 1 296 ? -1.720  -20.857 -39.194 1.00 55.53 ? 327 THR A C     1 
ATOM   2339 O  O     . THR A 1 296 ? -0.565  -20.409 -39.254 1.00 55.07 ? 327 THR A O     1 
ATOM   2340 C  CB    . THR A 1 296 ? -1.381  -22.407 -37.289 1.00 55.32 ? 327 THR A CB    1 
ATOM   2341 O  OG1   . THR A 1 296 ? -1.563  -23.592 -38.062 1.00 56.25 ? 327 THR A OG1   1 
ATOM   2342 C  CG2   . THR A 1 296 ? -1.713  -22.707 -35.867 1.00 54.75 ? 327 THR A CG2   1 
ATOM   2343 N  N     . ASP A 1 297 ? -2.516  -20.976 -40.261 1.00 55.57 ? 328 ASP A N     1 
ATOM   2344 C  CA    . ASP A 1 297 ? -2.086  -20.641 -41.613 1.00 55.86 ? 328 ASP A CA    1 
ATOM   2345 C  C     . ASP A 1 297 ? -2.745  -19.353 -42.085 1.00 55.74 ? 328 ASP A C     1 
ATOM   2346 O  O     . ASP A 1 297 ? -3.920  -19.331 -42.445 1.00 55.65 ? 328 ASP A O     1 
ATOM   2347 C  CB    . ASP A 1 297 ? -2.418  -21.790 -42.560 1.00 56.05 ? 328 ASP A CB    1 
ATOM   2348 C  CG    . ASP A 1 297 ? -2.107  -21.467 -44.015 1.00 57.48 ? 328 ASP A CG    1 
ATOM   2349 O  OD1   . ASP A 1 297 ? -2.064  -20.278 -44.381 1.00 58.99 ? 328 ASP A OD1   1 
ATOM   2350 O  OD2   . ASP A 1 297 ? -1.936  -22.409 -44.814 1.00 60.70 ? 328 ASP A OD2   1 
ATOM   2351 N  N     . THR A 1 298 ? -1.962  -18.283 -42.113 1.00 55.90 ? 329 THR A N     1 
ATOM   2352 C  CA    . THR A 1 298 ? -2.486  -16.947 -42.386 1.00 55.71 ? 329 THR A CA    1 
ATOM   2353 C  C     . THR A 1 298 ? -3.146  -16.791 -43.752 1.00 55.82 ? 329 THR A C     1 
ATOM   2354 O  O     . THR A 1 298 ? -4.244  -16.239 -43.838 1.00 56.18 ? 329 THR A O     1 
ATOM   2355 C  CB    . THR A 1 298 ? -1.396  -15.897 -42.212 1.00 55.61 ? 329 THR A CB    1 
ATOM   2356 O  OG1   . THR A 1 298 ? -0.902  -15.965 -40.865 1.00 55.08 ? 329 THR A OG1   1 
ATOM   2357 C  CG2   . THR A 1 298 ? -1.937  -14.506 -42.495 1.00 55.23 ? 329 THR A CG2   1 
ATOM   2358 N  N     . LYS A 1 299 ? -2.506  -17.265 -44.815 1.00 55.87 ? 330 LYS A N     1 
ATOM   2359 C  CA    . LYS A 1 299 ? -3.140  -17.196 -46.144 1.00 55.95 ? 330 LYS A CA    1 
ATOM   2360 C  C     . LYS A 1 299 ? -4.480  -17.935 -46.156 1.00 55.96 ? 330 LYS A C     1 
ATOM   2361 O  O     . LYS A 1 299 ? -5.461  -17.439 -46.709 1.00 56.38 ? 330 LYS A O     1 
ATOM   2362 C  CB    . LYS A 1 299 ? -2.218  -17.707 -47.264 1.00 55.94 ? 330 LYS A CB    1 
ATOM   2363 C  CG    . LYS A 1 299 ? -1.251  -16.642 -47.829 1.00 56.06 ? 330 LYS A CG    1 
ATOM   2364 N  N     . ASN A 1 300 ? -4.539  -19.104 -45.530 1.00 56.16 ? 331 ASN A N     1 
ATOM   2365 C  CA    . ASN A 1 300 ? -5.803  -19.841 -45.443 1.00 56.31 ? 331 ASN A CA    1 
ATOM   2366 C  C     . ASN A 1 300 ? -6.881  -19.085 -44.669 1.00 56.02 ? 331 ASN A C     1 
ATOM   2367 O  O     . ASN A 1 300 ? -8.014  -18.980 -45.125 1.00 55.80 ? 331 ASN A O     1 
ATOM   2368 C  CB    . ASN A 1 300 ? -5.611  -21.219 -44.814 1.00 56.45 ? 331 ASN A CB    1 
ATOM   2369 C  CG    . ASN A 1 300 ? -6.898  -22.028 -44.799 1.00 57.42 ? 331 ASN A CG    1 
ATOM   2370 O  OD1   . ASN A 1 300 ? -7.349  -22.499 -43.745 1.00 59.79 ? 331 ASN A OD1   1 
ATOM   2371 N  ND2   . ASN A 1 300 ? -7.512  -22.171 -45.967 1.00 56.67 ? 331 ASN A ND2   1 
ATOM   2372 N  N     . VAL A 1 301 ? -6.525  -18.559 -43.500 1.00 56.01 ? 332 VAL A N     1 
ATOM   2373 C  CA    . VAL A 1 301 ? -7.492  -17.840 -42.674 1.00 55.85 ? 332 VAL A CA    1 
ATOM   2374 C  C     . VAL A 1 301 ? -7.933  -16.550 -43.372 1.00 56.01 ? 332 VAL A C     1 
ATOM   2375 O  O     . VAL A 1 301 ? -9.102  -16.193 -43.304 1.00 55.98 ? 332 VAL A O     1 
ATOM   2376 C  CB    . VAL A 1 301 ? -6.956  -17.567 -41.241 1.00 55.85 ? 332 VAL A CB    1 
ATOM   2377 C  CG1   . VAL A 1 301 ? -7.918  -16.681 -40.454 1.00 54.81 ? 332 VAL A CG1   1 
ATOM   2378 C  CG2   . VAL A 1 301 ? -6.716  -18.892 -40.504 1.00 55.01 ? 332 VAL A CG2   1 
ATOM   2379 N  N     . GLN A 1 302 ? -7.020  -15.879 -44.072 1.00 56.25 ? 333 GLN A N     1 
ATOM   2380 C  CA    . GLN A 1 302 ? -7.381  -14.667 -44.827 1.00 56.44 ? 333 GLN A CA    1 
ATOM   2381 C  C     . GLN A 1 302 ? -8.464  -14.925 -45.882 1.00 56.62 ? 333 GLN A C     1 
ATOM   2382 O  O     . GLN A 1 302 ? -9.438  -14.168 -45.987 1.00 56.55 ? 333 GLN A O     1 
ATOM   2383 C  CB    . GLN A 1 302 ? -6.161  -14.031 -45.498 1.00 56.35 ? 333 GLN A CB    1 
ATOM   2384 C  CG    . GLN A 1 302 ? -6.544  -12.849 -46.386 1.00 56.61 ? 333 GLN A CG    1 
ATOM   2385 C  CD    . GLN A 1 302 ? -5.375  -11.982 -46.802 1.00 56.92 ? 333 GLN A CD    1 
ATOM   2386 O  OE1   . GLN A 1 302 ? -4.213  -12.338 -46.607 1.00 57.68 ? 333 GLN A OE1   1 
ATOM   2387 N  NE2   . GLN A 1 302 ? -5.682  -10.831 -47.387 1.00 56.38 ? 333 GLN A NE2   1 
ATOM   2388 N  N     . PHE A 1 303 ? -8.279  -15.984 -46.667 1.00 56.84 ? 334 PHE A N     1 
ATOM   2389 C  CA    . PHE A 1 303 ? -9.253  -16.366 -47.694 1.00 56.99 ? 334 PHE A CA    1 
ATOM   2390 C  C     . PHE A 1 303 ? -10.591 -16.710 -47.038 1.00 56.74 ? 334 PHE A C     1 
ATOM   2391 O  O     . PHE A 1 303 ? -11.616 -16.132 -47.396 1.00 56.57 ? 334 PHE A O     1 
ATOM   2392 C  CB    . PHE A 1 303 ? -8.704  -17.542 -48.516 1.00 57.47 ? 334 PHE A CB    1 
ATOM   2393 C  CG    . PHE A 1 303 ? -9.699  -18.167 -49.469 1.00 58.00 ? 334 PHE A CG    1 
ATOM   2394 C  CD1   . PHE A 1 303 ? -9.951  -17.591 -50.715 1.00 58.26 ? 334 PHE A CD1   1 
ATOM   2395 C  CD2   . PHE A 1 303 ? -10.341 -19.363 -49.141 1.00 58.23 ? 334 PHE A CD2   1 
ATOM   2396 C  CE1   . PHE A 1 303 ? -10.857 -18.175 -51.611 1.00 58.09 ? 334 PHE A CE1   1 
ATOM   2397 C  CE2   . PHE A 1 303 ? -11.246 -19.959 -50.035 1.00 58.92 ? 334 PHE A CE2   1 
ATOM   2398 C  CZ    . PHE A 1 303 ? -11.502 -19.359 -51.275 1.00 58.07 ? 334 PHE A CZ    1 
ATOM   2399 N  N     . VAL A 1 304 ? -10.566 -17.611 -46.053 1.00 56.33 ? 335 VAL A N     1 
ATOM   2400 C  CA    . VAL A 1 304 ? -11.791 -18.050 -45.379 1.00 55.97 ? 335 VAL A CA    1 
ATOM   2401 C  C     . VAL A 1 304 ? -12.555 -16.899 -44.740 1.00 56.01 ? 335 VAL A C     1 
ATOM   2402 O  O     . VAL A 1 304 ? -13.774 -16.852 -44.821 1.00 56.07 ? 335 VAL A O     1 
ATOM   2403 C  CB    . VAL A 1 304 ? -11.524 -19.124 -44.306 1.00 55.87 ? 335 VAL A CB    1 
ATOM   2404 C  CG1   . VAL A 1 304 ? -12.725 -19.276 -43.391 1.00 55.17 ? 335 VAL A CG1   1 
ATOM   2405 C  CG2   . VAL A 1 304 ? -11.176 -20.458 -44.955 1.00 55.17 ? 335 VAL A CG2   1 
ATOM   2406 N  N     . PHE A 1 305 ? -11.850 -15.963 -44.122 1.00 56.21 ? 336 PHE A N     1 
ATOM   2407 C  CA    . PHE A 1 305 ? -12.528 -14.858 -43.455 1.00 56.53 ? 336 PHE A CA    1 
ATOM   2408 C  C     . PHE A 1 305 ? -13.109 -13.847 -44.433 1.00 57.08 ? 336 PHE A C     1 
ATOM   2409 O  O     . PHE A 1 305 ? -14.092 -13.178 -44.118 1.00 57.15 ? 336 PHE A O     1 
ATOM   2410 C  CB    . PHE A 1 305 ? -11.598 -14.151 -42.485 1.00 56.50 ? 336 PHE A CB    1 
ATOM   2411 C  CG    . PHE A 1 305 ? -12.313 -13.224 -41.549 1.00 56.84 ? 336 PHE A CG    1 
ATOM   2412 C  CD1   . PHE A 1 305 ? -13.038 -13.727 -40.477 1.00 56.41 ? 336 PHE A CD1   1 
ATOM   2413 C  CD2   . PHE A 1 305 ? -12.283 -11.853 -41.749 1.00 56.53 ? 336 PHE A CD2   1 
ATOM   2414 C  CE1   . PHE A 1 305 ? -13.710 -12.882 -39.626 1.00 55.61 ? 336 PHE A CE1   1 
ATOM   2415 C  CE2   . PHE A 1 305 ? -12.945 -11.011 -40.890 1.00 56.05 ? 336 PHE A CE2   1 
ATOM   2416 C  CZ    . PHE A 1 305 ? -13.660 -11.530 -39.827 1.00 55.60 ? 336 PHE A CZ    1 
ATOM   2417 N  N     . ASP A 1 306 ? -12.498 -13.735 -45.613 1.00 57.71 ? 337 ASP A N     1 
ATOM   2418 C  CA    . ASP A 1 306 ? -13.005 -12.859 -46.669 1.00 57.93 ? 337 ASP A CA    1 
ATOM   2419 C  C     . ASP A 1 306 ? -14.372 -13.365 -47.121 1.00 57.82 ? 337 ASP A C     1 
ATOM   2420 O  O     . ASP A 1 306 ? -15.312 -12.584 -47.278 1.00 57.91 ? 337 ASP A O     1 
ATOM   2421 C  CB    . ASP A 1 306 ? -12.025 -12.813 -47.847 1.00 58.12 ? 337 ASP A CB    1 
ATOM   2422 C  CG    . ASP A 1 306 ? -12.277 -11.631 -48.779 1.00 59.78 ? 337 ASP A CG    1 
ATOM   2423 O  OD1   . ASP A 1 306 ? -13.143 -11.731 -49.678 1.00 61.65 ? 337 ASP A OD1   1 
ATOM   2424 O  OD2   . ASP A 1 306 ? -11.598 -10.591 -48.622 1.00 62.12 ? 337 ASP A OD2   1 
ATOM   2425 N  N     . ALA A 1 307 ? -14.479 -14.678 -47.307 1.00 57.74 ? 338 ALA A N     1 
ATOM   2426 C  CA    . ALA A 1 307 ? -15.746 -15.315 -47.669 1.00 57.61 ? 338 ALA A CA    1 
ATOM   2427 C  C     . ALA A 1 307 ? -16.797 -15.134 -46.574 1.00 57.58 ? 338 ALA A C     1 
ATOM   2428 O  O     . ALA A 1 307 ? -17.945 -14.799 -46.854 1.00 57.64 ? 338 ALA A O     1 
ATOM   2429 C  CB    . ALA A 1 307 ? -15.529 -16.792 -47.952 1.00 57.37 ? 338 ALA A CB    1 
ATOM   2430 N  N     . VAL A 1 308 ? -16.395 -15.354 -45.328 1.00 57.61 ? 339 VAL A N     1 
ATOM   2431 C  CA    . VAL A 1 308 ? -17.289 -15.179 -44.181 1.00 57.67 ? 339 VAL A CA    1 
ATOM   2432 C  C     . VAL A 1 308 ? -17.841 -13.755 -44.096 1.00 57.76 ? 339 VAL A C     1 
ATOM   2433 O  O     . VAL A 1 308 ? -19.018 -13.547 -43.805 1.00 57.44 ? 339 VAL A O     1 
ATOM   2434 C  CB    . VAL A 1 308 ? -16.562 -15.526 -42.863 1.00 57.70 ? 339 VAL A CB    1 
ATOM   2435 C  CG1   . VAL A 1 308 ? -17.247 -14.871 -41.675 1.00 57.77 ? 339 VAL A CG1   1 
ATOM   2436 C  CG2   . VAL A 1 308 ? -16.485 -17.032 -42.693 1.00 57.36 ? 339 VAL A CG2   1 
ATOM   2437 N  N     . THR A 1 309 ? -16.979 -12.780 -44.354 1.00 58.05 ? 340 THR A N     1 
ATOM   2438 C  CA    . THR A 1 309 ? -17.379 -11.383 -44.348 1.00 58.19 ? 340 THR A CA    1 
ATOM   2439 C  C     . THR A 1 309 ? -18.387 -11.094 -45.458 1.00 58.49 ? 340 THR A C     1 
ATOM   2440 O  O     . THR A 1 309 ? -19.342 -10.346 -45.247 1.00 58.76 ? 340 THR A O     1 
ATOM   2441 C  CB    . THR A 1 309 ? -16.160 -10.465 -44.498 1.00 58.13 ? 340 THR A CB    1 
ATOM   2442 O  OG1   . THR A 1 309 ? -15.218 -10.763 -43.465 1.00 57.68 ? 340 THR A OG1   1 
ATOM   2443 C  CG2   . THR A 1 309 ? -16.559 -9.007  -44.392 1.00 58.29 ? 340 THR A CG2   1 
ATOM   2444 N  N     . ASP A 1 310 ? -18.188 -11.685 -46.634 1.00 58.72 ? 341 ASP A N     1 
ATOM   2445 C  CA    . ASP A 1 310 ? -19.136 -11.492 -47.738 1.00 58.96 ? 341 ASP A CA    1 
ATOM   2446 C  C     . ASP A 1 310 ? -20.517 -12.078 -47.409 1.00 58.90 ? 341 ASP A C     1 
ATOM   2447 O  O     . ASP A 1 310 ? -21.537 -11.489 -47.758 1.00 58.98 ? 341 ASP A O     1 
ATOM   2448 C  CB    . ASP A 1 310 ? -18.585 -12.060 -49.054 1.00 59.03 ? 341 ASP A CB    1 
ATOM   2449 C  CG    . ASP A 1 310 ? -17.524 -11.155 -49.694 1.00 59.90 ? 341 ASP A CG    1 
ATOM   2450 O  OD1   . ASP A 1 310 ? -17.542 -9.929  -49.449 1.00 60.93 ? 341 ASP A OD1   1 
ATOM   2451 O  OD2   . ASP A 1 310 ? -16.670 -11.669 -50.454 1.00 60.93 ? 341 ASP A OD2   1 
ATOM   2452 N  N     . VAL A 1 311 ? -20.544 -13.218 -46.722 1.00 58.91 ? 342 VAL A N     1 
ATOM   2453 C  CA    . VAL A 1 311 ? -21.797 -13.801 -46.226 1.00 58.96 ? 342 VAL A CA    1 
ATOM   2454 C  C     . VAL A 1 311 ? -22.516 -12.866 -45.256 1.00 59.13 ? 342 VAL A C     1 
ATOM   2455 O  O     . VAL A 1 311 ? -23.724 -12.682 -45.345 1.00 59.06 ? 342 VAL A O     1 
ATOM   2456 C  CB    . VAL A 1 311 ? -21.559 -15.151 -45.502 1.00 58.93 ? 342 VAL A CB    1 
ATOM   2457 C  CG1   . VAL A 1 311 ? -22.787 -15.550 -44.690 1.00 58.41 ? 342 VAL A CG1   1 
ATOM   2458 C  CG2   . VAL A 1 311 ? -21.185 -16.242 -46.502 1.00 58.99 ? 342 VAL A CG2   1 
ATOM   2459 N  N     . ILE A 1 312 ? -21.770 -12.292 -44.321 1.00 59.55 ? 343 ILE A N     1 
ATOM   2460 C  CA    . ILE A 1 312 ? -22.341 -11.385 -43.328 1.00 59.97 ? 343 ILE A CA    1 
ATOM   2461 C  C     . ILE A 1 312 ? -22.958 -10.166 -44.001 1.00 60.60 ? 343 ILE A C     1 
ATOM   2462 O  O     . ILE A 1 312 ? -24.060 -9.731  -43.635 1.00 60.79 ? 343 ILE A O     1 
ATOM   2463 C  CB    . ILE A 1 312 ? -21.275 -10.915 -42.322 1.00 59.96 ? 343 ILE A CB    1 
ATOM   2464 C  CG1   . ILE A 1 312 ? -20.912 -12.059 -41.365 1.00 59.79 ? 343 ILE A CG1   1 
ATOM   2465 C  CG2   . ILE A 1 312 ? -21.775 -9.708  -41.543 1.00 59.86 ? 343 ILE A CG2   1 
ATOM   2466 C  CD1   . ILE A 1 312 ? -19.669 -11.814 -40.556 1.00 58.61 ? 343 ILE A CD1   1 
ATOM   2467 N  N     . ILE A 1 313 ? -22.245 -9.628  -44.989 1.00 61.10 ? 344 ILE A N     1 
ATOM   2468 C  CA    . ILE A 1 313 ? -22.738 -8.503  -45.774 1.00 61.45 ? 344 ILE A CA    1 
ATOM   2469 C  C     . ILE A 1 313 ? -24.031 -8.871  -46.500 1.00 61.80 ? 344 ILE A C     1 
ATOM   2470 O  O     . ILE A 1 313 ? -24.992 -8.115  -46.437 1.00 62.14 ? 344 ILE A O     1 
ATOM   2471 C  CB    . ILE A 1 313 ? -21.668 -7.994  -46.772 1.00 61.68 ? 344 ILE A CB    1 
ATOM   2472 C  CG1   . ILE A 1 313 ? -20.509 -7.330  -46.013 1.00 61.48 ? 344 ILE A CG1   1 
ATOM   2473 C  CG2   . ILE A 1 313 ? -22.272 -7.002  -47.769 1.00 61.22 ? 344 ILE A CG2   1 
ATOM   2474 C  CD1   . ILE A 1 313 ? -19.366 -6.886  -46.905 1.00 61.40 ? 344 ILE A CD1   1 
ATOM   2475 N  N     . LYS A 1 314 ? -24.053 -10.022 -47.174 1.00 62.30 ? 345 LYS A N     1 
ATOM   2476 C  CA    . LYS A 1 314 ? -25.287 -10.554 -47.787 1.00 62.71 ? 345 LYS A CA    1 
ATOM   2477 C  C     . LYS A 1 314 ? -26.457 -10.562 -46.804 1.00 63.28 ? 345 LYS A C     1 
ATOM   2478 O  O     . LYS A 1 314 ? -27.533 -10.060 -47.110 1.00 63.22 ? 345 LYS A O     1 
ATOM   2479 C  CB    . LYS A 1 314 ? -25.087 -11.985 -48.328 1.00 62.75 ? 345 LYS A CB    1 
ATOM   2480 C  CG    . LYS A 1 314 ? -25.015 -12.105 -49.845 1.00 62.28 ? 345 LYS A CG    1 
ATOM   2481 N  N     . ASN A 1 315 ? -26.236 -11.121 -45.618 1.00 64.07 ? 346 ASN A N     1 
ATOM   2482 C  CA    . ASN A 1 315 ? -27.318 -11.345 -44.660 1.00 64.78 ? 346 ASN A CA    1 
ATOM   2483 C  C     . ASN A 1 315 ? -27.682 -10.137 -43.800 1.00 65.67 ? 346 ASN A C     1 
ATOM   2484 O  O     . ASN A 1 315 ? -28.526 -10.248 -42.914 1.00 65.90 ? 346 ASN A O     1 
ATOM   2485 C  CB    . ASN A 1 315 ? -26.979 -12.529 -43.754 1.00 64.74 ? 346 ASN A CB    1 
ATOM   2486 C  CG    . ASN A 1 315 ? -26.812 -13.827 -44.524 1.00 64.42 ? 346 ASN A CG    1 
ATOM   2487 O  OD1   . ASN A 1 315 ? -27.036 -13.886 -45.739 1.00 62.90 ? 346 ASN A OD1   1 
ATOM   2488 N  ND2   . ASN A 1 315 ? -26.415 -14.880 -43.815 1.00 63.54 ? 346 ASN A ND2   1 
ATOM   2489 N  N     . ASN A 1 316 ? -27.044 -8.994  -44.039 1.00 66.66 ? 347 ASN A N     1 
ATOM   2490 C  CA    . ASN A 1 316 ? -27.467 -7.740  -43.416 1.00 67.44 ? 347 ASN A CA    1 
ATOM   2491 C  C     . ASN A 1 316 ? -27.951 -6.716  -44.440 1.00 68.11 ? 347 ASN A C     1 
ATOM   2492 O  O     . ASN A 1 316 ? -27.837 -5.510  -44.226 1.00 68.20 ? 347 ASN A O     1 
ATOM   2493 C  CB    . ASN A 1 316 ? -26.354 -7.170  -42.535 1.00 67.58 ? 347 ASN A CB    1 
ATOM   2494 C  CG    . ASN A 1 316 ? -26.210 -7.926  -41.228 1.00 67.83 ? 347 ASN A CG    1 
ATOM   2495 O  OD1   . ASN A 1 316 ? -26.268 -9.159  -41.198 1.00 67.94 ? 347 ASN A OD1   1 
ATOM   2496 N  ND2   . ASN A 1 316 ? -26.027 -7.189  -40.137 1.00 67.93 ? 347 ASN A ND2   1 
ATOM   2497 N  N     . LEU A 1 317 ? -28.465 -7.216  -45.563 1.00 69.01 ? 348 LEU A N     1 
ATOM   2498 C  CA    . LEU A 1 317 ? -29.364 -6.451  -46.435 1.00 69.69 ? 348 LEU A CA    1 
ATOM   2499 C  C     . LEU A 1 317 ? -30.806 -6.923  -46.195 1.00 70.23 ? 348 LEU A C     1 
ATOM   2500 O  O     . LEU A 1 317 ? -31.747 -6.128  -46.275 1.00 70.23 ? 348 LEU A O     1 
ATOM   2501 C  CB    . LEU A 1 317 ? -29.001 -6.628  -47.917 1.00 69.79 ? 348 LEU A CB    1 
ATOM   2502 C  CG    . LEU A 1 317 ? -27.585 -6.278  -48.396 1.00 69.99 ? 348 LEU A CG    1 
ATOM   2503 C  CD1   . LEU A 1 317 ? -27.578 -6.124  -49.919 1.00 69.54 ? 348 LEU A CD1   1 
ATOM   2504 C  CD2   . LEU A 1 317 ? -27.049 -5.013  -47.724 1.00 70.32 ? 348 LEU A CD2   1 
ATOM   2505 N  N     . LYS A 1 318 ? -30.963 -8.224  -45.923 1.00 70.90 ? 349 LYS A N     1 
ATOM   2506 C  CA    . LYS A 1 318 ? -32.246 -8.809  -45.515 1.00 71.20 ? 349 LYS A CA    1 
ATOM   2507 C  C     . LYS A 1 318 ? -32.386 -8.747  -43.990 1.00 71.33 ? 349 LYS A C     1 
ATOM   2508 O  O     . LYS A 1 318 ? -32.877 -7.758  -43.435 1.00 71.41 ? 349 LYS A O     1 
ATOM   2509 C  CB    . LYS A 1 318 ? -32.351 -10.264 -45.993 1.00 71.23 ? 349 LYS A CB    1 
ATOM   2510 N  N     . LEU B 2 25  ? 4.262   4.457   -8.826  1.00 63.56 ? 24  LEU B N     1 
ATOM   2511 C  CA    . LEU B 2 25  ? 5.625   4.510   -9.448  1.00 63.62 ? 24  LEU B CA    1 
ATOM   2512 C  C     . LEU B 2 25  ? 6.381   3.201   -9.187  1.00 63.59 ? 24  LEU B C     1 
ATOM   2513 O  O     . LEU B 2 25  ? 6.523   2.372   -10.093 1.00 63.50 ? 24  LEU B O     1 
ATOM   2514 C  CB    . LEU B 2 25  ? 6.423   5.717   -8.922  1.00 63.45 ? 24  LEU B CB    1 
ATOM   2515 N  N     . LYS B 2 26  ? 6.854   3.028   -7.949  1.00 63.59 ? 25  LYS B N     1 
ATOM   2516 C  CA    . LYS B 2 26  ? 7.512   1.787   -7.508  1.00 63.41 ? 25  LYS B CA    1 
ATOM   2517 C  C     . LYS B 2 26  ? 6.508   0.627   -7.441  1.00 63.28 ? 25  LYS B C     1 
ATOM   2518 O  O     . LYS B 2 26  ? 6.824   -0.498  -7.847  1.00 63.22 ? 25  LYS B O     1 
ATOM   2519 C  CB    . LYS B 2 26  ? 8.172   1.972   -6.128  1.00 63.39 ? 25  LYS B CB    1 
ATOM   2520 C  CG    . LYS B 2 26  ? 9.285   3.020   -6.072  1.00 63.40 ? 25  LYS B CG    1 
ATOM   2521 C  CD    . LYS B 2 26  ? 9.985   3.023   -4.715  1.00 63.29 ? 25  LYS B CD    1 
ATOM   2522 N  N     . SER B 2 27  ? 5.308   0.912   -6.927  1.00 63.02 ? 26  SER B N     1 
ATOM   2523 C  CA    . SER B 2 27  ? 4.249   -0.092  -6.778  1.00 62.77 ? 26  SER B CA    1 
ATOM   2524 C  C     . SER B 2 27  ? 3.867   -0.704  -8.130  1.00 62.66 ? 26  SER B C     1 
ATOM   2525 O  O     . SER B 2 27  ? 3.805   -1.928  -8.258  1.00 62.67 ? 26  SER B O     1 
ATOM   2526 C  CB    . SER B 2 27  ? 3.016   0.510   -6.089  1.00 62.58 ? 26  SER B CB    1 
ATOM   2527 N  N     . THR B 2 28  ? 3.631   0.140   -9.135  1.00 62.50 ? 27  THR B N     1 
ATOM   2528 C  CA    . THR B 2 28  ? 3.320   -0.340  -10.497 1.00 62.39 ? 27  THR B CA    1 
ATOM   2529 C  C     . THR B 2 28  ? 4.488   -1.103  -11.155 1.00 62.04 ? 27  THR B C     1 
ATOM   2530 O  O     . THR B 2 28  ? 4.276   -2.133  -11.799 1.00 61.84 ? 27  THR B O     1 
ATOM   2531 C  CB    . THR B 2 28  ? 2.861   0.814   -11.435 1.00 62.45 ? 27  THR B CB    1 
ATOM   2532 O  OG1   . THR B 2 28  ? 3.745   1.937   -11.305 1.00 62.92 ? 27  THR B OG1   1 
ATOM   2533 C  CG2   . THR B 2 28  ? 1.432   1.245   -11.096 1.00 62.51 ? 27  THR B CG2   1 
ATOM   2534 N  N     . ALA B 2 29  ? 5.712   -0.601  -10.983 1.00 61.67 ? 28  ALA B N     1 
ATOM   2535 C  CA    . ALA B 2 29  ? 6.908   -1.281  -11.493 1.00 61.33 ? 28  ALA B CA    1 
ATOM   2536 C  C     . ALA B 2 29  ? 7.038   -2.720  -10.962 1.00 61.04 ? 28  ALA B C     1 
ATOM   2537 O  O     . ALA B 2 29  ? 7.402   -3.629  -11.711 1.00 61.04 ? 28  ALA B O     1 
ATOM   2538 C  CB    . ALA B 2 29  ? 8.157   -0.476  -11.157 1.00 61.26 ? 28  ALA B CB    1 
ATOM   2539 N  N     . LYS B 2 30  ? 6.725   -2.922  -9.682  1.00 60.63 ? 29  LYS B N     1 
ATOM   2540 C  CA    . LYS B 2 30  ? 6.826   -4.245  -9.053  1.00 60.21 ? 29  LYS B CA    1 
ATOM   2541 C  C     . LYS B 2 30  ? 5.743   -5.214  -9.515  1.00 59.74 ? 29  LYS B C     1 
ATOM   2542 O  O     . LYS B 2 30  ? 5.988   -6.412  -9.563  1.00 59.90 ? 29  LYS B O     1 
ATOM   2543 C  CB    . LYS B 2 30  ? 6.804   -4.137  -7.523  1.00 60.28 ? 29  LYS B CB    1 
ATOM   2544 C  CG    . LYS B 2 30  ? 8.036   -3.439  -6.927  1.00 60.53 ? 29  LYS B CG    1 
ATOM   2545 N  N     . TRP B 2 31  ? 4.558   -4.713  -9.857  1.00 59.06 ? 30  TRP B N     1 
ATOM   2546 C  CA    . TRP B 2 31  ? 3.491   -5.587  -10.351 1.00 58.55 ? 30  TRP B CA    1 
ATOM   2547 C  C     . TRP B 2 31  ? 3.797   -6.131  -11.740 1.00 58.21 ? 30  TRP B C     1 
ATOM   2548 O  O     . TRP B 2 31  ? 3.290   -7.187  -12.109 1.00 58.35 ? 30  TRP B O     1 
ATOM   2549 C  CB    . TRP B 2 31  ? 2.142   -4.870  -10.403 1.00 58.60 ? 30  TRP B CB    1 
ATOM   2550 C  CG    . TRP B 2 31  ? 1.694   -4.272  -9.109  1.00 58.61 ? 30  TRP B CG    1 
ATOM   2551 C  CD1   . TRP B 2 31  ? 2.186   -4.539  -7.867  1.00 58.64 ? 30  TRP B CD1   1 
ATOM   2552 C  CD2   . TRP B 2 31  ? 0.641   -3.317  -8.929  1.00 58.84 ? 30  TRP B CD2   1 
ATOM   2553 N  NE1   . TRP B 2 31  ? 1.520   -3.794  -6.925  1.00 58.78 ? 30  TRP B NE1   1 
ATOM   2554 C  CE2   . TRP B 2 31  ? 0.566   -3.034  -7.548  1.00 58.94 ? 30  TRP B CE2   1 
ATOM   2555 C  CE3   . TRP B 2 31  ? -0.241  -2.663  -9.802  1.00 58.87 ? 30  TRP B CE3   1 
ATOM   2556 C  CZ2   . TRP B 2 31  ? -0.355  -2.119  -7.015  1.00 58.84 ? 30  TRP B CZ2   1 
ATOM   2557 C  CZ3   . TRP B 2 31  ? -1.163  -1.755  -9.269  1.00 58.81 ? 30  TRP B CZ3   1 
ATOM   2558 C  CH2   . TRP B 2 31  ? -1.211  -1.496  -7.889  1.00 58.71 ? 30  TRP B CH2   1 
ATOM   2559 N  N     . ALA B 2 32  ? 4.604   -5.396  -12.509 1.00 57.79 ? 31  ALA B N     1 
ATOM   2560 C  CA    . ALA B 2 32  ? 4.978   -5.783  -13.877 1.00 57.21 ? 31  ALA B CA    1 
ATOM   2561 C  C     . ALA B 2 32  ? 6.031   -6.894  -13.929 1.00 56.91 ? 31  ALA B C     1 
ATOM   2562 O  O     . ALA B 2 32  ? 6.134   -7.594  -14.936 1.00 57.02 ? 31  ALA B O     1 
ATOM   2563 C  CB    . ALA B 2 32  ? 5.469   -4.568  -14.654 1.00 56.94 ? 31  ALA B CB    1 
ATOM   2564 N  N     . ALA B 2 33  ? 6.803   -7.058  -12.856 1.00 56.51 ? 32  ALA B N     1 
ATOM   2565 C  CA    . ALA B 2 33  ? 7.870   -8.060  -12.813 1.00 56.31 ? 32  ALA B CA    1 
ATOM   2566 C  C     . ALA B 2 33  ? 7.342   -9.497  -12.758 1.00 56.21 ? 32  ALA B C     1 
ATOM   2567 O  O     . ALA B 2 33  ? 7.897   -10.382 -13.400 1.00 56.31 ? 32  ALA B O     1 
ATOM   2568 C  CB    . ALA B 2 33  ? 8.795   -7.796  -11.632 1.00 56.26 ? 32  ALA B CB    1 
ATOM   2569 N  N     . SER B 2 34  ? 6.291   -9.737  -11.980 1.00 56.05 ? 33  SER B N     1 
ATOM   2570 C  CA    . SER B 2 34  ? 5.715   -11.076 -11.879 1.00 56.10 ? 33  SER B CA    1 
ATOM   2571 C  C     . SER B 2 34  ? 4.335   -11.074 -11.235 1.00 56.37 ? 33  SER B C     1 
ATOM   2572 O  O     . SER B 2 34  ? 3.980   -10.158 -10.494 1.00 56.00 ? 33  SER B O     1 
ATOM   2573 C  CB    . SER B 2 34  ? 6.627   -11.999 -11.069 1.00 56.00 ? 33  SER B CB    1 
ATOM   2574 O  OG    . SER B 2 34  ? 6.509   -11.749 -9.680  1.00 56.14 ? 33  SER B OG    1 
ATOM   2575 N  N     . LEU B 2 35  ? 3.565   -12.121 -11.511 1.00 56.77 ? 34  LEU B N     1 
ATOM   2576 C  CA    . LEU B 2 35  ? 2.279   -12.306 -10.852 1.00 56.96 ? 34  LEU B CA    1 
ATOM   2577 C  C     . LEU B 2 35  ? 2.442   -12.480 -9.335  1.00 57.65 ? 34  LEU B C     1 
ATOM   2578 O  O     . LEU B 2 35  ? 1.609   -12.006 -8.562  1.00 58.00 ? 34  LEU B O     1 
ATOM   2579 C  CB    . LEU B 2 35  ? 1.549   -13.501 -11.441 1.00 56.69 ? 34  LEU B CB    1 
ATOM   2580 C  CG    . LEU B 2 35  ? 0.103   -13.681 -10.992 1.00 56.14 ? 34  LEU B CG    1 
ATOM   2581 C  CD1   . LEU B 2 35  ? -0.724  -12.435 -11.256 1.00 55.09 ? 34  LEU B CD1   1 
ATOM   2582 C  CD2   . LEU B 2 35  ? -0.477  -14.883 -11.696 1.00 54.80 ? 34  LEU B CD2   1 
ATOM   2583 N  N     . GLU B 2 36  ? 3.514   -13.141 -8.906  1.00 58.06 ? 35  GLU B N     1 
ATOM   2584 C  CA    . GLU B 2 36  ? 3.801   -13.268 -7.479  1.00 58.42 ? 35  GLU B CA    1 
ATOM   2585 C  C     . GLU B 2 36  ? 3.817   -11.903 -6.806  1.00 58.22 ? 35  GLU B C     1 
ATOM   2586 O  O     . GLU B 2 36  ? 3.174   -11.709 -5.774  1.00 58.55 ? 35  GLU B O     1 
ATOM   2587 C  CB    . GLU B 2 36  ? 5.139   -13.967 -7.236  1.00 58.67 ? 35  GLU B CB    1 
ATOM   2588 C  CG    . GLU B 2 36  ? 5.124   -15.470 -7.509  1.00 60.63 ? 35  GLU B CG    1 
ATOM   2589 C  CD    . GLU B 2 36  ? 5.695   -15.861 -8.882  1.00 63.39 ? 35  GLU B CD    1 
ATOM   2590 O  OE1   . GLU B 2 36  ? 5.607   -15.057 -9.853  1.00 64.43 ? 35  GLU B OE1   1 
ATOM   2591 O  OE2   . GLU B 2 36  ? 6.227   -16.994 -8.981  1.00 64.57 ? 35  GLU B OE2   1 
ATOM   2592 N  N     . ASN B 2 37  ? 4.553   -10.961 -7.386  1.00 57.79 ? 36  ASN B N     1 
ATOM   2593 C  CA    . ASN B 2 37  ? 4.618   -9.618  -6.834  1.00 57.43 ? 36  ASN B CA    1 
ATOM   2594 C  C     . ASN B 2 37  ? 3.239   -8.978  -6.759  1.00 57.22 ? 36  ASN B C     1 
ATOM   2595 O  O     . ASN B 2 37  ? 2.900   -8.363  -5.759  1.00 57.21 ? 36  ASN B O     1 
ATOM   2596 C  CB    . ASN B 2 37  ? 5.550   -8.736  -7.655  1.00 57.42 ? 36  ASN B CB    1 
ATOM   2597 C  CG    . ASN B 2 37  ? 7.011   -9.148  -7.541  1.00 57.82 ? 36  ASN B CG    1 
ATOM   2598 O  OD1   . ASN B 2 37  ? 7.379   -9.995  -6.725  1.00 58.28 ? 36  ASN B OD1   1 
ATOM   2599 N  ND2   . ASN B 2 37  ? 7.853   -8.538  -8.366  1.00 57.86 ? 36  ASN B ND2   1 
ATOM   2600 N  N     . LEU B 2 38  ? 2.436   -9.147  -7.808  1.00 57.14 ? 37  LEU B N     1 
ATOM   2601 C  CA    . LEU B 2 38  ? 1.065   -8.607  -7.834  1.00 57.07 ? 37  LEU B CA    1 
ATOM   2602 C  C     . LEU B 2 38  ? 0.197   -9.190  -6.715  1.00 57.00 ? 37  LEU B C     1 
ATOM   2603 O  O     . LEU B 2 38  ? -0.436  -8.445  -5.976  1.00 56.89 ? 37  LEU B O     1 
ATOM   2604 C  CB    . LEU B 2 38  ? 0.405   -8.858  -9.199  1.00 56.99 ? 37  LEU B CB    1 
ATOM   2605 C  CG    . LEU B 2 38  ? -0.929  -8.170  -9.521  1.00 56.73 ? 37  LEU B CG    1 
ATOM   2606 C  CD1   . LEU B 2 38  ? -0.833  -6.661  -9.429  1.00 55.95 ? 37  LEU B CD1   1 
ATOM   2607 C  CD2   . LEU B 2 38  ? -1.393  -8.567  -10.911 1.00 56.70 ? 37  LEU B CD2   1 
ATOM   2608 N  N     . LEU B 2 39  ? 0.204   -10.512 -6.577  1.00 57.00 ? 38  LEU B N     1 
ATOM   2609 C  CA    . LEU B 2 39  ? -0.621  -11.195 -5.580  1.00 57.23 ? 38  LEU B CA    1 
ATOM   2610 C  C     . LEU B 2 39  ? -0.165  -11.025 -4.127  1.00 57.64 ? 38  LEU B C     1 
ATOM   2611 O  O     . LEU B 2 39  ? -0.936  -11.289 -3.214  1.00 58.08 ? 38  LEU B O     1 
ATOM   2612 C  CB    . LEU B 2 39  ? -0.735  -12.689 -5.906  1.00 57.10 ? 38  LEU B CB    1 
ATOM   2613 C  CG    . LEU B 2 39  ? -1.326  -13.029 -7.281  1.00 56.69 ? 38  LEU B CG    1 
ATOM   2614 C  CD1   . LEU B 2 39  ? -1.360  -14.541 -7.512  1.00 56.66 ? 38  LEU B CD1   1 
ATOM   2615 C  CD2   . LEU B 2 39  ? -2.698  -12.427 -7.447  1.00 55.05 ? 38  LEU B CD2   1 
ATOM   2616 N  N     . GLU B 2 40  ? 1.071   -10.596 -3.899  1.00 58.15 ? 39  GLU B N     1 
ATOM   2617 C  CA    . GLU B 2 40  ? 1.546   -10.328 -2.532  1.00 58.50 ? 39  GLU B CA    1 
ATOM   2618 C  C     . GLU B 2 40  ? 1.151   -8.937  -2.057  1.00 58.05 ? 39  GLU B C     1 
ATOM   2619 O  O     . GLU B 2 40  ? 0.941   -8.732  -0.868  1.00 58.22 ? 39  GLU B O     1 
ATOM   2620 C  CB    . GLU B 2 40  ? 3.064   -10.474 -2.437  1.00 58.61 ? 39  GLU B CB    1 
ATOM   2621 C  CG    . GLU B 2 40  ? 3.550   -11.920 -2.475  1.00 59.61 ? 39  GLU B CG    1 
ATOM   2622 C  CD    . GLU B 2 40  ? 5.076   -12.026 -2.444  1.00 59.93 ? 39  GLU B CD    1 
ATOM   2623 O  OE1   . GLU B 2 40  ? 5.729   -11.206 -1.742  1.00 59.90 ? 39  GLU B OE1   1 
ATOM   2624 O  OE2   . GLU B 2 40  ? 5.616   -12.932 -3.128  1.00 62.04 ? 39  GLU B OE2   1 
ATOM   2625 N  N     . ASP B 2 41  ? 1.080   -7.984  -2.986  1.00 57.69 ? 40  ASP B N     1 
ATOM   2626 C  CA    . ASP B 2 41  ? 0.648   -6.620  -2.679  1.00 57.42 ? 40  ASP B CA    1 
ATOM   2627 C  C     . ASP B 2 41  ? -0.883  -6.552  -2.682  1.00 57.06 ? 40  ASP B C     1 
ATOM   2628 O  O     . ASP B 2 41  ? -1.518  -6.731  -3.723  1.00 56.90 ? 40  ASP B O     1 
ATOM   2629 C  CB    . ASP B 2 41  ? 1.226   -5.623  -3.694  1.00 57.48 ? 40  ASP B CB    1 
ATOM   2630 C  CG    . ASP B 2 41  ? 0.865   -4.184  -3.374  1.00 57.81 ? 40  ASP B CG    1 
ATOM   2631 O  OD1   . ASP B 2 41  ? -0.333  -3.897  -3.174  1.00 59.76 ? 40  ASP B OD1   1 
ATOM   2632 O  OD2   . ASP B 2 41  ? 1.772   -3.332  -3.335  1.00 57.79 ? 40  ASP B OD2   1 
ATOM   2633 N  N     . PRO B 2 42  ? -1.487  -6.293  -1.514  1.00 56.59 ? 41  PRO B N     1 
ATOM   2634 C  CA    . PRO B 2 42  ? -2.946  -6.274  -1.482  1.00 56.34 ? 41  PRO B CA    1 
ATOM   2635 C  C     . PRO B 2 42  ? -3.603  -5.191  -2.366  1.00 56.13 ? 41  PRO B C     1 
ATOM   2636 O  O     . PRO B 2 42  ? -4.704  -5.423  -2.878  1.00 56.08 ? 41  PRO B O     1 
ATOM   2637 C  CB    . PRO B 2 42  ? -3.262  -6.098  0.004   1.00 56.21 ? 41  PRO B CB    1 
ATOM   2638 C  CG    . PRO B 2 42  ? -2.038  -5.569  0.615   1.00 56.46 ? 41  PRO B CG    1 
ATOM   2639 C  CD    . PRO B 2 42  ? -0.896  -6.048  -0.188  1.00 56.41 ? 41  PRO B CD    1 
ATOM   2640 N  N     . GLU B 2 43  ? -2.940  -4.046  -2.560  1.00 55.86 ? 42  GLU B N     1 
ATOM   2641 C  CA    . GLU B 2 43  ? -3.432  -3.018  -3.490  1.00 55.72 ? 42  GLU B CA    1 
ATOM   2642 C  C     . GLU B 2 43  ? -3.349  -3.545  -4.917  1.00 55.43 ? 42  GLU B C     1 
ATOM   2643 O  O     . GLU B 2 43  ? -4.243  -3.307  -5.733  1.00 55.40 ? 42  GLU B O     1 
ATOM   2644 C  CB    . GLU B 2 43  ? -2.647  -1.708  -3.353  1.00 55.84 ? 42  GLU B CB    1 
ATOM   2645 C  CG    . GLU B 2 43  ? -3.087  -0.568  -4.298  1.00 56.75 ? 42  GLU B CG    1 
ATOM   2646 C  CD    . GLU B 2 43  ? -4.480  0.012   -3.992  1.00 58.18 ? 42  GLU B CD    1 
ATOM   2647 O  OE1   . GLU B 2 43  ? -4.733  0.451   -2.840  1.00 58.12 ? 42  GLU B OE1   1 
ATOM   2648 O  OE2   . GLU B 2 43  ? -5.316  0.052   -4.927  1.00 58.91 ? 42  GLU B OE2   1 
ATOM   2649 N  N     . GLY B 2 44  ? -2.282  -4.276  -5.212  1.00 54.96 ? 43  GLY B N     1 
ATOM   2650 C  CA    . GLY B 2 44  ? -2.151  -4.917  -6.508  1.00 54.87 ? 43  GLY B CA    1 
ATOM   2651 C  C     . GLY B 2 44  ? -3.292  -5.874  -6.769  1.00 54.81 ? 43  GLY B C     1 
ATOM   2652 O  O     . GLY B 2 44  ? -3.863  -5.883  -7.846  1.00 54.75 ? 43  GLY B O     1 
ATOM   2653 N  N     . VAL B 2 45  ? -3.620  -6.678  -5.767  1.00 55.15 ? 44  VAL B N     1 
ATOM   2654 C  CA    . VAL B 2 45  ? -4.731  -7.626  -5.846  1.00 55.21 ? 44  VAL B CA    1 
ATOM   2655 C  C     . VAL B 2 45  ? -6.080  -6.927  -6.103  1.00 55.21 ? 44  VAL B C     1 
ATOM   2656 O  O     . VAL B 2 45  ? -6.898  -7.407  -6.900  1.00 54.90 ? 44  VAL B O     1 
ATOM   2657 C  CB    . VAL B 2 45  ? -4.796  -8.499  -4.558  1.00 55.30 ? 44  VAL B CB    1 
ATOM   2658 C  CG1   . VAL B 2 45  ? -6.145  -9.224  -4.433  1.00 54.59 ? 44  VAL B CG1   1 
ATOM   2659 C  CG2   . VAL B 2 45  ? -3.635  -9.494  -4.560  1.00 54.76 ? 44  VAL B CG2   1 
ATOM   2660 N  N     . LYS B 2 46  ? -6.293  -5.788  -5.454  1.00 55.15 ? 45  LYS B N     1 
ATOM   2661 C  CA    . LYS B 2 46  ? -7.520  -5.014  -5.659  1.00 55.39 ? 45  LYS B CA    1 
ATOM   2662 C  C     . LYS B 2 46  ? -7.673  -4.573  -7.117  1.00 55.40 ? 45  LYS B C     1 
ATOM   2663 O  O     . LYS B 2 46  ? -8.727  -4.758  -7.718  1.00 55.40 ? 45  LYS B O     1 
ATOM   2664 C  CB    . LYS B 2 46  ? -7.543  -3.788  -4.738  1.00 55.28 ? 45  LYS B CB    1 
ATOM   2665 C  CG    . LYS B 2 46  ? -8.831  -2.987  -4.808  1.00 55.41 ? 45  LYS B CG    1 
ATOM   2666 C  CD    . LYS B 2 46  ? -8.847  -1.869  -3.764  1.00 55.56 ? 45  LYS B CD    1 
ATOM   2667 C  CE    . LYS B 2 46  ? -9.759  -0.716  -4.159  1.00 54.91 ? 45  LYS B CE    1 
ATOM   2668 N  NZ    . LYS B 2 46  ? -9.361  0.519   -3.453  1.00 55.06 ? 45  LYS B NZ    1 
ATOM   2669 N  N     . ARG B 2 47  ? -6.617  -3.985  -7.673  1.00 55.50 ? 46  ARG B N     1 
ATOM   2670 C  CA    . ARG B 2 47  ? -6.648  -3.480  -9.045  1.00 55.56 ? 46  ARG B CA    1 
ATOM   2671 C  C     . ARG B 2 47  ? -6.795  -4.621  -10.050 1.00 55.11 ? 46  ARG B C     1 
ATOM   2672 O  O     . ARG B 2 47  ? -7.401  -4.461  -11.105 1.00 55.08 ? 46  ARG B O     1 
ATOM   2673 C  CB    . ARG B 2 47  ? -5.382  -2.662  -9.351  1.00 55.82 ? 46  ARG B CB    1 
ATOM   2674 C  CG    . ARG B 2 47  ? -5.323  -1.293  -8.664  1.00 56.88 ? 46  ARG B CG    1 
ATOM   2675 C  CD    . ARG B 2 47  ? -6.074  -0.239  -9.458  1.00 59.06 ? 46  ARG B CD    1 
ATOM   2676 N  NE    . ARG B 2 47  ? -6.196  1.039   -8.747  1.00 60.64 ? 46  ARG B NE    1 
ATOM   2677 C  CZ    . ARG B 2 47  ? -7.047  1.289   -7.742  1.00 61.54 ? 46  ARG B CZ    1 
ATOM   2678 N  NH1   . ARG B 2 47  ? -7.874  0.348   -7.276  1.00 61.98 ? 46  ARG B NH1   1 
ATOM   2679 N  NH2   . ARG B 2 47  ? -7.070  2.499   -7.184  1.00 60.78 ? 46  ARG B NH2   1 
ATOM   2680 N  N     . PHE B 2 48  ? -6.231  -5.771  -9.713  1.00 54.80 ? 47  PHE B N     1 
ATOM   2681 C  CA    . PHE B 2 48  ? -6.270  -6.939  -10.578 1.00 54.46 ? 47  PHE B CA    1 
ATOM   2682 C  C     . PHE B 2 48  ? -7.651  -7.574  -10.524 1.00 54.38 ? 47  PHE B C     1 
ATOM   2683 O  O     . PHE B 2 48  ? -8.191  -7.973  -11.554 1.00 54.36 ? 47  PHE B O     1 
ATOM   2684 C  CB    . PHE B 2 48  ? -5.189  -7.929  -10.140 1.00 54.43 ? 47  PHE B CB    1 
ATOM   2685 C  CG    . PHE B 2 48  ? -5.045  -9.132  -11.030 1.00 54.16 ? 47  PHE B CG    1 
ATOM   2686 C  CD1   . PHE B 2 48  ? -5.024  -9.007  -12.410 1.00 53.92 ? 47  PHE B CD1   1 
ATOM   2687 C  CD2   . PHE B 2 48  ? -4.881  -10.388 -10.481 1.00 54.12 ? 47  PHE B CD2   1 
ATOM   2688 C  CE1   . PHE B 2 48  ? -4.883  -10.111 -13.217 1.00 53.40 ? 47  PHE B CE1   1 
ATOM   2689 C  CE2   . PHE B 2 48  ? -4.727  -11.496 -11.293 1.00 54.41 ? 47  PHE B CE2   1 
ATOM   2690 C  CZ    . PHE B 2 48  ? -4.735  -11.352 -12.660 1.00 53.81 ? 47  PHE B CZ    1 
ATOM   2691 N  N     . ARG B 2 49  ? -8.224  -7.661  -9.323  1.00 54.31 ? 48  ARG B N     1 
ATOM   2692 C  CA    . ARG B 2 49  ? -9.627  -8.060  -9.171  1.00 54.03 ? 48  ARG B CA    1 
ATOM   2693 C  C     . ARG B 2 49  ? -10.521 -7.234  -10.087 1.00 53.90 ? 48  ARG B C     1 
ATOM   2694 O  O     . ARG B 2 49  ? -11.364 -7.777  -10.786 1.00 53.75 ? 48  ARG B O     1 
ATOM   2695 C  CB    . ARG B 2 49  ? -10.101 -7.908  -7.717  1.00 53.99 ? 48  ARG B CB    1 
ATOM   2696 C  CG    . ARG B 2 49  ? -9.653  -9.023  -6.791  1.00 54.39 ? 48  ARG B CG    1 
ATOM   2697 C  CD    . ARG B 2 49  ? -10.809 -9.606  -6.002  1.00 55.60 ? 48  ARG B CD    1 
ATOM   2698 N  NE    . ARG B 2 49  ? -11.060 -8.896  -4.752  1.00 57.08 ? 48  ARG B NE    1 
ATOM   2699 C  CZ    . ARG B 2 49  ? -12.211 -8.904  -4.081  1.00 56.99 ? 48  ARG B CZ    1 
ATOM   2700 N  NH1   . ARG B 2 49  ? -12.311 -8.217  -2.953  1.00 56.89 ? 48  ARG B NH1   1 
ATOM   2701 N  NH2   . ARG B 2 49  ? -13.267 -9.575  -4.531  1.00 57.77 ? 48  ARG B NH2   1 
ATOM   2702 N  N     . GLU B 2 50  ? -10.326 -5.920  -10.086 1.00 54.10 ? 49  GLU B N     1 
ATOM   2703 C  CA    . GLU B 2 50  ? -11.163 -5.026  -10.887 1.00 54.58 ? 49  GLU B CA    1 
ATOM   2704 C  C     . GLU B 2 50  ? -11.029 -5.334  -12.369 1.00 54.14 ? 49  GLU B C     1 
ATOM   2705 O  O     . GLU B 2 50  ? -12.006 -5.248  -13.103 1.00 54.16 ? 49  GLU B O     1 
ATOM   2706 C  CB    . GLU B 2 50  ? -10.850 -3.549  -10.593 1.00 54.43 ? 49  GLU B CB    1 
ATOM   2707 C  CG    . GLU B 2 50  ? -11.374 -3.088  -9.226  1.00 55.50 ? 49  GLU B CG    1 
ATOM   2708 C  CD    . GLU B 2 50  ? -10.944 -1.669  -8.839  1.00 56.07 ? 49  GLU B CD    1 
ATOM   2709 O  OE1   . GLU B 2 50  ? -10.321 -0.967  -9.680  1.00 57.99 ? 49  GLU B OE1   1 
ATOM   2710 O  OE2   . GLU B 2 50  ? -11.235 -1.260  -7.681  1.00 57.11 ? 49  GLU B OE2   1 
ATOM   2711 N  N     . PHE B 2 51  ? -9.826  -5.713  -12.792 1.00 54.04 ? 50  PHE B N     1 
ATOM   2712 C  CA    . PHE B 2 51  ? -9.581  -6.101  -14.178 1.00 53.97 ? 50  PHE B CA    1 
ATOM   2713 C  C     . PHE B 2 51  ? -10.266 -7.421  -14.509 1.00 54.21 ? 50  PHE B C     1 
ATOM   2714 O  O     . PHE B 2 51  ? -10.901 -7.537  -15.556 1.00 54.75 ? 50  PHE B O     1 
ATOM   2715 C  CB    . PHE B 2 51  ? -8.081  -6.208  -14.473 1.00 53.76 ? 50  PHE B CB    1 
ATOM   2716 C  CG    . PHE B 2 51  ? -7.770  -6.569  -15.900 1.00 53.43 ? 50  PHE B CG    1 
ATOM   2717 C  CD1   . PHE B 2 51  ? -7.881  -5.621  -16.909 1.00 53.71 ? 50  PHE B CD1   1 
ATOM   2718 C  CD2   . PHE B 2 51  ? -7.367  -7.844  -16.235 1.00 52.99 ? 50  PHE B CD2   1 
ATOM   2719 C  CE1   . PHE B 2 51  ? -7.603  -5.943  -18.231 1.00 53.12 ? 50  PHE B CE1   1 
ATOM   2720 C  CE2   . PHE B 2 51  ? -7.088  -8.169  -17.555 1.00 53.81 ? 50  PHE B CE2   1 
ATOM   2721 C  CZ    . PHE B 2 51  ? -7.210  -7.210  -18.555 1.00 53.07 ? 50  PHE B CZ    1 
ATOM   2722 N  N     . LEU B 2 52  ? -10.144 -8.411  -13.628 1.00 54.10 ? 51  LEU B N     1 
ATOM   2723 C  CA    . LEU B 2 52  ? -10.789 -9.699  -13.860 1.00 54.19 ? 51  LEU B CA    1 
ATOM   2724 C  C     . LEU B 2 52  ? -12.318 -9.579  -13.897 1.00 54.46 ? 51  LEU B C     1 
ATOM   2725 O  O     . LEU B 2 52  ? -12.982 -10.263 -14.680 1.00 54.87 ? 51  LEU B O     1 
ATOM   2726 C  CB    . LEU B 2 52  ? -10.355 -10.728 -12.813 1.00 54.19 ? 51  LEU B CB    1 
ATOM   2727 C  CG    . LEU B 2 52  ? -8.848  -11.035 -12.720 1.00 53.82 ? 51  LEU B CG    1 
ATOM   2728 C  CD1   . LEU B 2 52  ? -8.566  -11.987 -11.544 1.00 51.75 ? 51  LEU B CD1   1 
ATOM   2729 C  CD2   . LEU B 2 52  ? -8.290  -11.579 -14.049 1.00 52.25 ? 51  LEU B CD2   1 
ATOM   2730 N  N     . LYS B 2 53  ? -12.888 -8.710  -13.072 1.00 54.63 ? 52  LYS B N     1 
ATOM   2731 C  CA    . LYS B 2 53  ? -14.330 -8.496  -13.112 1.00 54.88 ? 52  LYS B CA    1 
ATOM   2732 C  C     . LYS B 2 53  ? -14.785 -8.159  -14.532 1.00 54.56 ? 52  LYS B C     1 
ATOM   2733 O  O     . LYS B 2 53  ? -15.792 -8.692  -15.001 1.00 54.68 ? 52  LYS B O     1 
ATOM   2734 C  CB    . LYS B 2 53  ? -14.754 -7.385  -12.149 1.00 54.95 ? 52  LYS B CB    1 
ATOM   2735 C  CG    . LYS B 2 53  ? -14.774 -7.788  -10.674 1.00 55.78 ? 52  LYS B CG    1 
ATOM   2736 C  CD    . LYS B 2 53  ? -15.466 -6.709  -9.818  1.00 56.16 ? 52  LYS B CD    1 
ATOM   2737 C  CE    . LYS B 2 53  ? -15.111 -6.832  -8.324  1.00 57.92 ? 52  LYS B CE    1 
ATOM   2738 N  NZ    . LYS B 2 53  ? -15.892 -7.888  -7.594  1.00 58.23 ? 52  LYS B NZ    1 
ATOM   2739 N  N     . LYS B 2 54  ? -14.041 -7.288  -15.216 1.00 54.31 ? 53  LYS B N     1 
ATOM   2740 C  CA    . LYS B 2 54  ? -14.408 -6.855  -16.573 1.00 54.12 ? 53  LYS B CA    1 
ATOM   2741 C  C     . LYS B 2 54  ? -14.322 -7.999  -17.579 1.00 54.17 ? 53  LYS B C     1 
ATOM   2742 O  O     . LYS B 2 54  ? -15.037 -8.006  -18.566 1.00 54.23 ? 53  LYS B O     1 
ATOM   2743 C  CB    . LYS B 2 54  ? -13.546 -5.673  -17.042 1.00 54.00 ? 53  LYS B CB    1 
ATOM   2744 C  CG    . LYS B 2 54  ? -13.907 -4.331  -16.402 1.00 53.44 ? 53  LYS B CG    1 
ATOM   2745 N  N     . GLU B 2 55  ? -13.463 -8.974  -17.312 1.00 54.39 ? 54  GLU B N     1 
ATOM   2746 C  CA    . GLU B 2 55  ? -13.305 -10.129 -18.188 1.00 54.55 ? 54  GLU B CA    1 
ATOM   2747 C  C     . GLU B 2 55  ? -13.981 -11.391 -17.673 1.00 54.85 ? 54  GLU B C     1 
ATOM   2748 O  O     . GLU B 2 55  ? -13.755 -12.471 -18.214 1.00 54.93 ? 54  GLU B O     1 
ATOM   2749 C  CB    . GLU B 2 55  ? -11.825 -10.413 -18.389 1.00 54.62 ? 54  GLU B CB    1 
ATOM   2750 C  CG    . GLU B 2 55  ? -11.149 -9.440  -19.341 1.00 54.58 ? 54  GLU B CG    1 
ATOM   2751 C  CD    . GLU B 2 55  ? -9.729  -9.833  -19.646 1.00 54.15 ? 54  GLU B CD    1 
ATOM   2752 O  OE1   . GLU B 2 55  ? -9.193  -10.731 -18.949 1.00 52.74 ? 54  GLU B OE1   1 
ATOM   2753 O  OE2   . GLU B 2 55  ? -9.148  -9.242  -20.583 1.00 54.88 ? 54  GLU B OE2   1 
ATOM   2754 N  N     . PHE B 2 56  ? -14.806 -11.263 -16.637 1.00 54.97 ? 55  PHE B N     1 
ATOM   2755 C  CA    . PHE B 2 56  ? -15.542 -12.399 -16.097 1.00 55.23 ? 55  PHE B CA    1 
ATOM   2756 C  C     . PHE B 2 56  ? -14.636 -13.588 -15.744 1.00 55.94 ? 55  PHE B C     1 
ATOM   2757 O  O     . PHE B 2 56  ? -14.941 -14.730 -16.073 1.00 56.00 ? 55  PHE B O     1 
ATOM   2758 C  CB    . PHE B 2 56  ? -16.632 -12.833 -17.078 1.00 54.70 ? 55  PHE B CB    1 
ATOM   2759 C  CG    . PHE B 2 56  ? -17.542 -11.718 -17.503 1.00 54.68 ? 55  PHE B CG    1 
ATOM   2760 C  CD1   . PHE B 2 56  ? -17.216 -10.906 -18.585 1.00 54.16 ? 55  PHE B CD1   1 
ATOM   2761 C  CD2   . PHE B 2 56  ? -18.735 -11.480 -16.826 1.00 54.38 ? 55  PHE B CD2   1 
ATOM   2762 C  CE1   . PHE B 2 56  ? -18.055 -9.881  -18.982 1.00 53.68 ? 55  PHE B CE1   1 
ATOM   2763 C  CE2   . PHE B 2 56  ? -19.578 -10.454 -17.218 1.00 53.95 ? 55  PHE B CE2   1 
ATOM   2764 C  CZ    . PHE B 2 56  ? -19.234 -9.651  -18.296 1.00 53.98 ? 55  PHE B CZ    1 
ATOM   2765 N  N     . SER B 2 57  ? -13.527 -13.320 -15.067 1.00 56.75 ? 56  SER B N     1 
ATOM   2766 C  CA    . SER B 2 57  ? -12.655 -14.390 -14.603 1.00 57.57 ? 56  SER B CA    1 
ATOM   2767 C  C     . SER B 2 57  ? -12.137 -14.134 -13.188 1.00 57.98 ? 56  SER B C     1 
ATOM   2768 O  O     . SER B 2 57  ? -11.048 -14.587 -12.828 1.00 58.08 ? 56  SER B O     1 
ATOM   2769 C  CB    . SER B 2 57  ? -11.493 -14.575 -15.584 1.00 57.96 ? 56  SER B CB    1 
ATOM   2770 O  OG    . SER B 2 57  ? -10.758 -13.374 -15.752 1.00 59.21 ? 56  SER B OG    1 
ATOM   2771 N  N     . GLU B 2 58  ? -12.935 -13.437 -12.378 1.00 58.48 ? 57  GLU B N     1 
ATOM   2772 C  CA    . GLU B 2 58  ? -12.533 -13.086 -11.020 1.00 58.82 ? 57  GLU B CA    1 
ATOM   2773 C  C     . GLU B 2 58  ? -12.451 -14.315 -10.128 1.00 58.84 ? 57  GLU B C     1 
ATOM   2774 O  O     . GLU B 2 58  ? -11.695 -14.320 -9.153  1.00 58.93 ? 57  GLU B O     1 
ATOM   2775 C  CB    . GLU B 2 58  ? -13.488 -12.061 -10.408 1.00 58.81 ? 57  GLU B CB    1 
ATOM   2776 C  CG    . GLU B 2 58  ? -12.956 -11.388 -9.121  1.00 59.43 ? 57  GLU B CG    1 
ATOM   2777 C  CD    . GLU B 2 58  ? -13.992 -10.484 -8.406  1.00 60.03 ? 57  GLU B CD    1 
ATOM   2778 O  OE1   . GLU B 2 58  ? -15.205 -10.524 -8.747  1.00 59.63 ? 57  GLU B OE1   1 
ATOM   2779 O  OE2   . GLU B 2 58  ? -13.581 -9.727  -7.493  1.00 61.25 ? 57  GLU B OE2   1 
ATOM   2780 N  N     . GLU B 2 59  ? -13.208 -15.361 -10.458 1.00 58.99 ? 58  GLU B N     1 
ATOM   2781 C  CA    . GLU B 2 59  ? -13.159 -16.607 -9.679  1.00 59.31 ? 58  GLU B CA    1 
ATOM   2782 C  C     . GLU B 2 59  ? -11.731 -17.137 -9.524  1.00 58.87 ? 58  GLU B C     1 
ATOM   2783 O  O     . GLU B 2 59  ? -11.376 -17.704 -8.492  1.00 58.82 ? 58  GLU B O     1 
ATOM   2784 C  CB    . GLU B 2 59  ? -14.079 -17.688 -10.271 1.00 59.65 ? 58  GLU B CB    1 
ATOM   2785 C  CG    . GLU B 2 59  ? -13.589 -18.397 -11.558 1.00 62.05 ? 58  GLU B CG    1 
ATOM   2786 C  CD    . GLU B 2 59  ? -13.888 -17.627 -12.858 1.00 65.20 ? 58  GLU B CD    1 
ATOM   2787 O  OE1   . GLU B 2 59  ? -13.562 -18.178 -13.947 1.00 65.07 ? 58  GLU B OE1   1 
ATOM   2788 O  OE2   . GLU B 2 59  ? -14.443 -16.489 -12.785 1.00 66.69 ? 58  GLU B OE2   1 
ATOM   2789 N  N     . ASN B 2 60  ? -10.910 -16.931 -10.546 1.00 58.51 ? 59  ASN B N     1 
ATOM   2790 C  CA    . ASN B 2 60  ? -9.531  -17.380 -10.502 1.00 58.29 ? 59  ASN B CA    1 
ATOM   2791 C  C     . ASN B 2 60  ? -8.730  -16.799 -9.331  1.00 57.78 ? 59  ASN B C     1 
ATOM   2792 O  O     . ASN B 2 60  ? -8.142  -17.554 -8.561  1.00 57.82 ? 59  ASN B O     1 
ATOM   2793 C  CB    . ASN B 2 60  ? -8.839  -17.083 -11.829 1.00 58.49 ? 59  ASN B CB    1 
ATOM   2794 C  CG    . ASN B 2 60  ? -9.404  -17.903 -12.971 1.00 59.04 ? 59  ASN B CG    1 
ATOM   2795 O  OD1   . ASN B 2 60  ? -9.745  -19.071 -12.798 1.00 59.30 ? 59  ASN B OD1   1 
ATOM   2796 N  ND2   . ASN B 2 60  ? -9.501  -17.293 -14.148 1.00 60.30 ? 59  ASN B ND2   1 
ATOM   2797 N  N     . VAL B 2 61  ? -8.710  -15.478 -9.185  1.00 56.95 ? 60  VAL B N     1 
ATOM   2798 C  CA    . VAL B 2 61  ? -7.947  -14.878 -8.105  1.00 56.47 ? 60  VAL B CA    1 
ATOM   2799 C  C     . VAL B 2 61  ? -8.593  -15.213 -6.768  1.00 56.33 ? 60  VAL B C     1 
ATOM   2800 O  O     . VAL B 2 61  ? -7.900  -15.513 -5.803  1.00 56.32 ? 60  VAL B O     1 
ATOM   2801 C  CB    . VAL B 2 61  ? -7.766  -13.329 -8.268  1.00 56.71 ? 60  VAL B CB    1 
ATOM   2802 C  CG1   . VAL B 2 61  ? -9.097  -12.576 -8.179  1.00 55.95 ? 60  VAL B CG1   1 
ATOM   2803 C  CG2   . VAL B 2 61  ? -6.795  -12.797 -7.237  1.00 55.67 ? 60  VAL B CG2   1 
ATOM   2804 N  N     . LEU B 2 62  ? -9.918  -15.184 -6.709  1.00 56.13 ? 61  LEU B N     1 
ATOM   2805 C  CA    . LEU B 2 62  ? -10.606 -15.468 -5.454  1.00 56.06 ? 61  LEU B CA    1 
ATOM   2806 C  C     . LEU B 2 62  ? -10.248 -16.867 -4.978  1.00 55.94 ? 61  LEU B C     1 
ATOM   2807 O  O     . LEU B 2 62  ? -9.924  -17.068 -3.813  1.00 55.90 ? 61  LEU B O     1 
ATOM   2808 C  CB    . LEU B 2 62  ? -12.125 -15.328 -5.603  1.00 56.03 ? 61  LEU B CB    1 
ATOM   2809 C  CG    . LEU B 2 62  ? -12.627 -13.893 -5.782  1.00 56.09 ? 61  LEU B CG    1 
ATOM   2810 C  CD1   . LEU B 2 62  ? -14.116 -13.877 -6.076  1.00 55.20 ? 61  LEU B CD1   1 
ATOM   2811 C  CD2   . LEU B 2 62  ? -12.299 -13.030 -4.560  1.00 55.26 ? 61  LEU B CD2   1 
ATOM   2812 N  N     . PHE B 2 63  ? -10.287 -17.828 -5.890  1.00 55.86 ? 62  PHE B N     1 
ATOM   2813 C  CA    . PHE B 2 63  ? -9.919  -19.187 -5.548  1.00 55.93 ? 62  PHE B CA    1 
ATOM   2814 C  C     . PHE B 2 63  ? -8.473  -19.264 -5.066  1.00 56.02 ? 62  PHE B C     1 
ATOM   2815 O  O     . PHE B 2 63  ? -8.168  -19.973 -4.105  1.00 56.19 ? 62  PHE B O     1 
ATOM   2816 C  CB    . PHE B 2 63  ? -10.103 -20.125 -6.738  1.00 55.98 ? 62  PHE B CB    1 
ATOM   2817 C  CG    . PHE B 2 63  ? -9.467  -21.475 -6.537  1.00 55.82 ? 62  PHE B CG    1 
ATOM   2818 C  CD1   . PHE B 2 63  ? -9.977  -22.361 -5.604  1.00 55.63 ? 62  PHE B CD1   1 
ATOM   2819 C  CD2   . PHE B 2 63  ? -8.348  -21.843 -7.257  1.00 55.18 ? 62  PHE B CD2   1 
ATOM   2820 C  CE1   . PHE B 2 63  ? -9.393  -23.596 -5.404  1.00 55.46 ? 62  PHE B CE1   1 
ATOM   2821 C  CE2   . PHE B 2 63  ? -7.768  -23.079 -7.068  1.00 55.83 ? 62  PHE B CE2   1 
ATOM   2822 C  CZ    . PHE B 2 63  ? -8.293  -23.959 -6.140  1.00 55.76 ? 62  PHE B CZ    1 
ATOM   2823 N  N     . TRP B 2 64  ? -7.584  -18.544 -5.736  1.00 56.07 ? 63  TRP B N     1 
ATOM   2824 C  CA    . TRP B 2 64  ? -6.185  -18.523 -5.333  1.00 56.28 ? 63  TRP B CA    1 
ATOM   2825 C  C     . TRP B 2 64  ? -6.008  -17.968 -3.904  1.00 56.48 ? 63  TRP B C     1 
ATOM   2826 O  O     . TRP B 2 64  ? -5.347  -18.597 -3.066  1.00 56.40 ? 63  TRP B O     1 
ATOM   2827 C  CB    . TRP B 2 64  ? -5.356  -17.714 -6.330  1.00 56.39 ? 63  TRP B CB    1 
ATOM   2828 C  CG    . TRP B 2 64  ? -3.911  -17.921 -6.151  1.00 56.42 ? 63  TRP B CG    1 
ATOM   2829 C  CD1   . TRP B 2 64  ? -3.149  -18.906 -6.704  1.00 56.69 ? 63  TRP B CD1   1 
ATOM   2830 C  CD2   . TRP B 2 64  ? -3.041  -17.143 -5.333  1.00 56.28 ? 63  TRP B CD2   1 
ATOM   2831 N  NE1   . TRP B 2 64  ? -1.847  -18.784 -6.282  1.00 57.14 ? 63  TRP B NE1   1 
ATOM   2832 C  CE2   . TRP B 2 64  ? -1.756  -17.708 -5.438  1.00 56.28 ? 63  TRP B CE2   1 
ATOM   2833 C  CE3   . TRP B 2 64  ? -3.225  -16.021 -4.518  1.00 56.92 ? 63  TRP B CE3   1 
ATOM   2834 C  CZ2   . TRP B 2 64  ? -0.658  -17.190 -4.767  1.00 56.23 ? 63  TRP B CZ2   1 
ATOM   2835 C  CZ3   . TRP B 2 64  ? -2.126  -15.499 -3.845  1.00 56.85 ? 63  TRP B CZ3   1 
ATOM   2836 C  CH2   . TRP B 2 64  ? -0.860  -16.084 -3.978  1.00 56.70 ? 63  TRP B CH2   1 
ATOM   2837 N  N     . LEU B 2 65  ? -6.608  -16.807 -3.627  1.00 56.44 ? 64  LEU B N     1 
ATOM   2838 C  CA    . LEU B 2 65  ? -6.527  -16.195 -2.291  1.00 56.51 ? 64  LEU B CA    1 
ATOM   2839 C  C     . LEU B 2 65  ? -7.110  -17.120 -1.212  1.00 56.77 ? 64  LEU B C     1 
ATOM   2840 O  O     . LEU B 2 65  ? -6.566  -17.205 -0.097  1.00 56.72 ? 64  LEU B O     1 
ATOM   2841 C  CB    . LEU B 2 65  ? -7.233  -14.832 -2.257  1.00 56.20 ? 64  LEU B CB    1 
ATOM   2842 C  CG    . LEU B 2 65  ? -6.599  -13.713 -3.093  1.00 55.99 ? 64  LEU B CG    1 
ATOM   2843 C  CD1   . LEU B 2 65  ? -7.531  -12.519 -3.203  1.00 54.40 ? 64  LEU B CD1   1 
ATOM   2844 C  CD2   . LEU B 2 65  ? -5.251  -13.289 -2.522  1.00 55.16 ? 64  LEU B CD2   1 
ATOM   2845 N  N     . ALA B 2 66  ? -8.201  -17.810 -1.555  1.00 56.78 ? 65  ALA B N     1 
ATOM   2846 C  CA    . ALA B 2 66  ? -8.822  -18.781 -0.659  1.00 57.03 ? 65  ALA B CA    1 
ATOM   2847 C  C     . ALA B 2 66  ? -7.851  -19.908 -0.283  1.00 57.40 ? 65  ALA B C     1 
ATOM   2848 O  O     . ALA B 2 66  ? -7.801  -20.327 0.881   1.00 57.16 ? 65  ALA B O     1 
ATOM   2849 C  CB    . ALA B 2 66  ? -10.082 -19.347 -1.274  1.00 56.80 ? 65  ALA B CB    1 
ATOM   2850 N  N     . CYS B 2 67  ? -7.062  -20.377 -1.248  1.00 57.84 ? 66  CYS B N     1 
ATOM   2851 C  CA    . CYS B 2 67  ? -6.075  -21.425 -0.960  1.00 58.34 ? 66  CYS B CA    1 
ATOM   2852 C  C     . CYS B 2 67  ? -4.945  -20.928 -0.050  1.00 58.73 ? 66  CYS B C     1 
ATOM   2853 O  O     . CYS B 2 67  ? -4.483  -21.665 0.823   1.00 58.31 ? 66  CYS B O     1 
ATOM   2854 C  CB    . CYS B 2 67  ? -5.511  -22.008 -2.249  1.00 58.37 ? 66  CYS B CB    1 
ATOM   2855 S  SG    . CYS B 2 67  ? -6.767  -22.816 -3.280  1.00 58.85 ? 66  CYS B SG    1 
ATOM   2856 N  N     . GLU B 2 68  ? -4.518  -19.678 -0.241  1.00 59.33 ? 67  GLU B N     1 
ATOM   2857 C  CA    . GLU B 2 68  ? -3.499  -19.071 0.623   1.00 59.76 ? 67  GLU B CA    1 
ATOM   2858 C  C     . GLU B 2 68  ? -3.987  -18.901 2.054   1.00 60.19 ? 67  GLU B C     1 
ATOM   2859 O  O     . GLU B 2 68  ? -3.197  -19.021 2.990   1.00 60.37 ? 67  GLU B O     1 
ATOM   2860 C  CB    . GLU B 2 68  ? -3.064  -17.710 0.086   1.00 59.93 ? 67  GLU B CB    1 
ATOM   2861 C  CG    . GLU B 2 68  ? -2.264  -17.776 -1.187  1.00 60.00 ? 67  GLU B CG    1 
ATOM   2862 C  CD    . GLU B 2 68  ? -0.896  -18.379 -0.982  1.00 60.71 ? 67  GLU B CD    1 
ATOM   2863 O  OE1   . GLU B 2 68  ? -0.083  -17.801 -0.230  1.00 61.82 ? 67  GLU B OE1   1 
ATOM   2864 O  OE2   . GLU B 2 68  ? -0.633  -19.437 -1.578  1.00 61.32 ? 67  GLU B OE2   1 
ATOM   2865 N  N     . ASP B 2 69  ? -5.275  -18.597 2.223   1.00 60.50 ? 68  ASP B N     1 
ATOM   2866 C  CA    . ASP B 2 69  ? -5.884  -18.577 3.553   1.00 60.80 ? 68  ASP B CA    1 
ATOM   2867 C  C     . ASP B 2 69  ? -5.844  -19.969 4.155   1.00 60.39 ? 68  ASP B C     1 
ATOM   2868 O  O     . ASP B 2 69  ? -5.377  -20.158 5.268   1.00 60.54 ? 68  ASP B O     1 
ATOM   2869 C  CB    . ASP B 2 69  ? -7.346  -18.123 3.491   1.00 61.35 ? 68  ASP B CB    1 
ATOM   2870 C  CG    . ASP B 2 69  ? -7.514  -16.639 3.747   1.00 63.05 ? 68  ASP B CG    1 
ATOM   2871 O  OD1   . ASP B 2 69  ? -7.312  -16.213 4.918   1.00 64.51 ? 68  ASP B OD1   1 
ATOM   2872 O  OD2   . ASP B 2 69  ? -7.875  -15.915 2.778   1.00 65.13 ? 68  ASP B OD2   1 
ATOM   2873 N  N     . PHE B 2 70  ? -6.353  -20.933 3.400   1.00 60.01 ? 69  PHE B N     1 
ATOM   2874 C  CA    . PHE B 2 70  ? -6.435  -22.320 3.838   1.00 59.78 ? 69  PHE B CA    1 
ATOM   2875 C  C     . PHE B 2 70  ? -5.104  -22.864 4.368   1.00 59.90 ? 69  PHE B C     1 
ATOM   2876 O  O     . PHE B 2 70  ? -5.075  -23.488 5.420   1.00 59.76 ? 69  PHE B O     1 
ATOM   2877 C  CB    . PHE B 2 70  ? -6.926  -23.173 2.677   1.00 59.59 ? 69  PHE B CB    1 
ATOM   2878 C  CG    . PHE B 2 70  ? -7.355  -24.543 3.072   1.00 59.39 ? 69  PHE B CG    1 
ATOM   2879 C  CD1   . PHE B 2 70  ? -8.514  -24.732 3.805   1.00 59.75 ? 69  PHE B CD1   1 
ATOM   2880 C  CD2   . PHE B 2 70  ? -6.620  -25.648 2.693   1.00 58.82 ? 69  PHE B CD2   1 
ATOM   2881 C  CE1   . PHE B 2 70  ? -8.929  -26.002 4.171   1.00 59.25 ? 69  PHE B CE1   1 
ATOM   2882 C  CE2   . PHE B 2 70  ? -7.027  -26.919 3.049   1.00 59.64 ? 69  PHE B CE2   1 
ATOM   2883 C  CZ    . PHE B 2 70  ? -8.190  -27.096 3.794   1.00 59.45 ? 69  PHE B CZ    1 
ATOM   2884 N  N     . LYS B 2 71  ? -4.016  -22.612 3.639   1.00 60.26 ? 70  LYS B N     1 
ATOM   2885 C  CA    . LYS B 2 71  ? -2.656  -23.009 4.046   1.00 60.64 ? 70  LYS B CA    1 
ATOM   2886 C  C     . LYS B 2 71  ? -2.294  -22.616 5.469   1.00 60.87 ? 70  LYS B C     1 
ATOM   2887 O  O     . LYS B 2 71  ? -1.726  -23.411 6.208   1.00 60.85 ? 70  LYS B O     1 
ATOM   2888 C  CB    . LYS B 2 71  ? -1.613  -22.355 3.139   1.00 60.79 ? 70  LYS B CB    1 
ATOM   2889 C  CG    . LYS B 2 71  ? -1.470  -22.984 1.794   1.00 61.12 ? 70  LYS B CG    1 
ATOM   2890 C  CD    . LYS B 2 71  ? -0.449  -22.240 0.955   1.00 62.18 ? 70  LYS B CD    1 
ATOM   2891 C  CE    . LYS B 2 71  ? -0.798  -22.387 -0.518  1.00 63.82 ? 70  LYS B CE    1 
ATOM   2892 N  NZ    . LYS B 2 71  ? 0.308   -22.037 -1.456  1.00 65.23 ? 70  LYS B NZ    1 
ATOM   2893 N  N     . LYS B 2 72  ? -2.605  -21.374 5.825   1.00 61.28 ? 71  LYS B N     1 
ATOM   2894 C  CA    . LYS B 2 72  ? -2.177  -20.782 7.091   1.00 61.56 ? 71  LYS B CA    1 
ATOM   2895 C  C     . LYS B 2 72  ? -2.838  -21.431 8.308   1.00 61.86 ? 71  LYS B C     1 
ATOM   2896 O  O     . LYS B 2 72  ? -2.204  -21.555 9.364   1.00 61.92 ? 71  LYS B O     1 
ATOM   2897 C  CB    . LYS B 2 72  ? -2.480  -19.270 7.106   1.00 61.64 ? 71  LYS B CB    1 
ATOM   2898 C  CG    . LYS B 2 72  ? -1.739  -18.433 6.057   1.00 61.66 ? 71  LYS B CG    1 
ATOM   2899 C  CD    . LYS B 2 72  ? -2.297  -17.007 5.979   1.00 61.52 ? 71  LYS B CD    1 
ATOM   2900 N  N     . MET B 2 73  ? -4.101  -21.837 8.171   1.00 62.13 ? 72  MET B N     1 
ATOM   2901 C  CA    . MET B 2 73  ? -4.897  -22.243 9.346   1.00 62.46 ? 72  MET B CA    1 
ATOM   2902 C  C     . MET B 2 73  ? -4.544  -23.633 9.889   1.00 62.38 ? 72  MET B C     1 
ATOM   2903 O  O     . MET B 2 73  ? -4.256  -24.565 9.137   1.00 62.39 ? 72  MET B O     1 
ATOM   2904 C  CB    . MET B 2 73  ? -6.416  -22.097 9.107   1.00 62.45 ? 72  MET B CB    1 
ATOM   2905 C  CG    . MET B 2 73  ? -6.975  -22.710 7.833   1.00 62.78 ? 72  MET B CG    1 
ATOM   2906 S  SD    . MET B 2 73  ? -8.763  -22.453 7.640   1.00 63.07 ? 72  MET B SD    1 
ATOM   2907 C  CE    . MET B 2 73  ? -8.865  -20.674 7.376   1.00 63.43 ? 72  MET B CE    1 
ATOM   2908 N  N     . GLN B 2 74  ? -4.574  -23.747 11.215  1.00 62.44 ? 73  GLN B N     1 
ATOM   2909 C  CA    . GLN B 2 74  ? -4.131  -24.949 11.919  1.00 62.40 ? 73  GLN B CA    1 
ATOM   2910 C  C     . GLN B 2 74  ? -5.271  -25.749 12.573  1.00 62.19 ? 73  GLN B C     1 
ATOM   2911 O  O     . GLN B 2 74  ? -5.100  -26.934 12.873  1.00 62.29 ? 73  GLN B O     1 
ATOM   2912 C  CB    . GLN B 2 74  ? -3.086  -24.565 12.978  1.00 62.42 ? 73  GLN B CB    1 
ATOM   2913 C  CG    . GLN B 2 74  ? -3.654  -23.853 14.214  1.00 62.57 ? 73  GLN B CG    1 
ATOM   2914 C  CD    . GLN B 2 74  ? -2.580  -23.163 15.040  1.00 62.63 ? 73  GLN B CD    1 
ATOM   2915 O  OE1   . GLN B 2 74  ? -2.387  -23.471 16.223  1.00 61.29 ? 73  GLN B OE1   1 
ATOM   2916 N  NE2   . GLN B 2 74  ? -1.868  -22.226 14.412  1.00 62.87 ? 73  GLN B NE2   1 
ATOM   2917 N  N     . ASP B 2 75  ? -6.421  -25.114 12.801  1.00 61.80 ? 74  ASP B N     1 
ATOM   2918 C  CA    . ASP B 2 75  ? -7.522  -25.772 13.510  1.00 61.61 ? 74  ASP B CA    1 
ATOM   2919 C  C     . ASP B 2 75  ? -8.217  -26.805 12.622  1.00 61.27 ? 74  ASP B C     1 
ATOM   2920 O  O     . ASP B 2 75  ? -8.823  -26.451 11.616  1.00 61.25 ? 74  ASP B O     1 
ATOM   2921 C  CB    . ASP B 2 75  ? -8.534  -24.738 14.022  1.00 61.65 ? 74  ASP B CB    1 
ATOM   2922 C  CG    . ASP B 2 75  ? -9.590  -25.351 14.932  1.00 61.76 ? 74  ASP B CG    1 
ATOM   2923 O  OD1   . ASP B 2 75  ? -10.508 -26.023 14.416  1.00 62.16 ? 74  ASP B OD1   1 
ATOM   2924 O  OD2   . ASP B 2 75  ? -9.508  -25.155 16.164  1.00 61.62 ? 74  ASP B OD2   1 
ATOM   2925 N  N     . LYS B 2 76  ? -8.141  -28.075 13.015  1.00 60.93 ? 75  LYS B N     1 
ATOM   2926 C  CA    . LYS B 2 76  ? -8.717  -29.175 12.232  1.00 60.64 ? 75  LYS B CA    1 
ATOM   2927 C  C     . LYS B 2 76  ? -10.201 -28.978 11.876  1.00 60.41 ? 75  LYS B C     1 
ATOM   2928 O  O     . LYS B 2 76  ? -10.616 -29.312 10.769  1.00 60.31 ? 75  LYS B O     1 
ATOM   2929 C  CB    . LYS B 2 76  ? -8.519  -30.512 12.960  1.00 60.55 ? 75  LYS B CB    1 
ATOM   2930 C  CG    . LYS B 2 76  ? -7.075  -30.996 12.970  1.00 60.39 ? 75  LYS B CG    1 
ATOM   2931 N  N     . THR B 2 77  ? -10.991 -28.437 12.803  1.00 60.20 ? 76  THR B N     1 
ATOM   2932 C  CA    . THR B 2 77  ? -12.424 -28.214 12.562  1.00 59.99 ? 76  THR B CA    1 
ATOM   2933 C  C     . THR B 2 77  ? -12.682 -26.991 11.671  1.00 59.90 ? 76  THR B C     1 
ATOM   2934 O  O     . THR B 2 77  ? -13.582 -27.014 10.827  1.00 59.79 ? 76  THR B O     1 
ATOM   2935 C  CB    . THR B 2 77  ? -13.208 -28.048 13.879  1.00 59.95 ? 76  THR B CB    1 
ATOM   2936 O  OG1   . THR B 2 77  ? -12.855 -29.098 14.786  1.00 59.81 ? 76  THR B OG1   1 
ATOM   2937 C  CG2   . THR B 2 77  ? -14.711 -28.092 13.618  1.00 59.81 ? 76  THR B CG2   1 
ATOM   2938 N  N     . GLN B 2 78  ? -11.903 -25.928 11.872  1.00 59.79 ? 77  GLN B N     1 
ATOM   2939 C  CA    . GLN B 2 78  ? -11.978 -24.728 11.021  1.00 59.75 ? 77  GLN B CA    1 
ATOM   2940 C  C     . GLN B 2 78  ? -11.445 -25.001 9.603   1.00 59.61 ? 77  GLN B C     1 
ATOM   2941 O  O     . GLN B 2 78  ? -11.835 -24.333 8.643   1.00 59.47 ? 77  GLN B O     1 
ATOM   2942 C  CB    . GLN B 2 78  ? -11.214 -23.557 11.660  1.00 59.73 ? 77  GLN B CB    1 
ATOM   2943 N  N     . MET B 2 79  ? -10.564 -25.994 9.490   1.00 59.41 ? 78  MET B N     1 
ATOM   2944 C  CA    . MET B 2 79  ? -9.983  -26.407 8.217   1.00 59.25 ? 78  MET B CA    1 
ATOM   2945 C  C     . MET B 2 79  ? -10.950 -27.291 7.414   1.00 58.81 ? 78  MET B C     1 
ATOM   2946 O  O     . MET B 2 79  ? -11.103 -27.112 6.212   1.00 58.87 ? 78  MET B O     1 
ATOM   2947 C  CB    . MET B 2 79  ? -8.680  -27.161 8.488   1.00 59.23 ? 78  MET B CB    1 
ATOM   2948 C  CG    . MET B 2 79  ? -7.797  -27.390 7.280   1.00 59.62 ? 78  MET B CG    1 
ATOM   2949 S  SD    . MET B 2 79  ? -6.617  -28.731 7.541   1.00 60.20 ? 78  MET B SD    1 
ATOM   2950 C  CE    . MET B 2 79  ? -5.995  -28.360 9.195   1.00 60.31 ? 78  MET B CE    1 
ATOM   2951 N  N     . GLN B 2 80  ? -11.602 -28.241 8.075   1.00 58.40 ? 79  GLN B N     1 
ATOM   2952 C  CA    . GLN B 2 80  ? -12.537 -29.143 7.392   1.00 58.05 ? 79  GLN B CA    1 
ATOM   2953 C  C     . GLN B 2 80  ? -13.732 -28.395 6.784   1.00 57.76 ? 79  GLN B C     1 
ATOM   2954 O  O     . GLN B 2 80  ? -14.149 -28.699 5.668   1.00 57.63 ? 79  GLN B O     1 
ATOM   2955 C  CB    . GLN B 2 80  ? -13.006 -30.264 8.335   1.00 57.96 ? 79  GLN B CB    1 
ATOM   2956 C  CG    . GLN B 2 80  ? -11.949 -31.354 8.541   1.00 57.98 ? 79  GLN B CG    1 
ATOM   2957 C  CD    . GLN B 2 80  ? -12.201 -32.237 9.758   1.00 58.11 ? 79  GLN B CD    1 
ATOM   2958 O  OE1   . GLN B 2 80  ? -13.277 -32.211 10.353  1.00 58.44 ? 79  GLN B OE1   1 
ATOM   2959 N  NE2   . GLN B 2 80  ? -11.198 -33.026 10.130  1.00 57.71 ? 79  GLN B NE2   1 
ATOM   2960 N  N     . GLU B 2 81  ? -14.272 -27.417 7.507   1.00 57.51 ? 80  GLU B N     1 
ATOM   2961 C  CA    . GLU B 2 81  ? -15.396 -26.630 6.997   1.00 57.33 ? 80  GLU B CA    1 
ATOM   2962 C  C     . GLU B 2 81  ? -14.962 -25.785 5.801   1.00 57.28 ? 80  GLU B C     1 
ATOM   2963 O  O     . GLU B 2 81  ? -15.657 -25.744 4.786   1.00 57.21 ? 80  GLU B O     1 
ATOM   2964 C  CB    . GLU B 2 81  ? -16.015 -25.750 8.097   1.00 57.31 ? 80  GLU B CB    1 
ATOM   2965 C  CG    . GLU B 2 81  ? -16.796 -26.530 9.150   1.00 56.91 ? 80  GLU B CG    1 
ATOM   2966 N  N     . LYS B 2 82  ? -13.805 -25.134 5.912   1.00 57.32 ? 81  LYS B N     1 
ATOM   2967 C  CA    . LYS B 2 82  ? -13.279 -24.292 4.829   1.00 57.33 ? 81  LYS B CA    1 
ATOM   2968 C  C     . LYS B 2 82  ? -12.917 -25.116 3.588   1.00 57.08 ? 81  LYS B C     1 
ATOM   2969 O  O     . LYS B 2 82  ? -13.104 -24.656 2.461   1.00 57.25 ? 81  LYS B O     1 
ATOM   2970 C  CB    . LYS B 2 82  ? -12.077 -23.473 5.323   1.00 57.51 ? 81  LYS B CB    1 
ATOM   2971 C  CG    . LYS B 2 82  ? -11.425 -22.533 4.294   1.00 58.33 ? 81  LYS B CG    1 
ATOM   2972 C  CD    . LYS B 2 82  ? -12.167 -21.201 4.071   1.00 59.24 ? 81  LYS B CD    1 
ATOM   2973 C  CE    . LYS B 2 82  ? -11.379 -20.303 3.065   1.00 59.58 ? 81  LYS B CE    1 
ATOM   2974 N  NZ    . LYS B 2 82  ? -12.087 -19.044 2.619   1.00 59.73 ? 81  LYS B NZ    1 
ATOM   2975 N  N     . ALA B 2 83  ? -12.413 -26.330 3.787   1.00 56.83 ? 82  ALA B N     1 
ATOM   2976 C  CA    . ALA B 2 83  ? -12.100 -27.215 2.661   1.00 56.78 ? 82  ALA B CA    1 
ATOM   2977 C  C     . ALA B 2 83  ? -13.368 -27.576 1.873   1.00 56.72 ? 82  ALA B C     1 
ATOM   2978 O  O     . ALA B 2 83  ? -13.378 -27.499 0.641   1.00 56.42 ? 82  ALA B O     1 
ATOM   2979 C  CB    . ALA B 2 83  ? -11.387 -28.473 3.147   1.00 56.67 ? 82  ALA B CB    1 
ATOM   2980 N  N     . LYS B 2 84  ? -14.425 -27.964 2.591   1.00 56.68 ? 83  LYS B N     1 
ATOM   2981 C  CA    . LYS B 2 84  ? -15.754 -28.158 1.994   1.00 56.88 ? 83  LYS B CA    1 
ATOM   2982 C  C     . LYS B 2 84  ? -16.174 -26.899 1.252   1.00 57.00 ? 83  LYS B C     1 
ATOM   2983 O  O     . LYS B 2 84  ? -16.605 -26.963 0.112   1.00 56.95 ? 83  LYS B O     1 
ATOM   2984 C  CB    . LYS B 2 84  ? -16.827 -28.486 3.061   1.00 57.00 ? 83  LYS B CB    1 
ATOM   2985 C  CG    . LYS B 2 84  ? -17.010 -29.973 3.385   1.00 56.78 ? 83  LYS B CG    1 
ATOM   2986 N  N     . GLU B 2 85  ? -16.025 -25.760 1.918   1.00 57.29 ? 84  GLU B N     1 
ATOM   2987 C  CA    . GLU B 2 85  ? -16.472 -24.465 1.407   1.00 57.78 ? 84  GLU B CA    1 
ATOM   2988 C  C     . GLU B 2 85  ? -15.755 -24.036 0.122   1.00 57.50 ? 84  GLU B C     1 
ATOM   2989 O  O     . GLU B 2 85  ? -16.372 -23.467 -0.785  1.00 57.42 ? 84  GLU B O     1 
ATOM   2990 C  CB    . GLU B 2 85  ? -16.263 -23.416 2.499   1.00 57.94 ? 84  GLU B CB    1 
ATOM   2991 C  CG    . GLU B 2 85  ? -16.946 -22.078 2.276   1.00 58.73 ? 84  GLU B CG    1 
ATOM   2992 C  CD    . GLU B 2 85  ? -16.883 -21.191 3.526   1.00 59.08 ? 84  GLU B CD    1 
ATOM   2993 O  OE1   . GLU B 2 85  ? -17.139 -21.713 4.646   1.00 57.67 ? 84  GLU B OE1   1 
ATOM   2994 O  OE2   . GLU B 2 85  ? -16.570 -19.977 3.376   1.00 61.49 ? 84  GLU B OE2   1 
ATOM   2995 N  N     . ILE B 2 86  ? -14.453 -24.303 0.051   1.00 57.27 ? 85  ILE B N     1 
ATOM   2996 C  CA    . ILE B 2 86  ? -13.693 -24.046 -1.166  1.00 57.08 ? 85  ILE B CA    1 
ATOM   2997 C  C     . ILE B 2 86  ? -14.164 -24.980 -2.282  1.00 57.25 ? 85  ILE B C     1 
ATOM   2998 O  O     . ILE B 2 86  ? -14.241 -24.578 -3.445  1.00 57.61 ? 85  ILE B O     1 
ATOM   2999 C  CB    . ILE B 2 86  ? -12.180 -24.254 -0.952  1.00 57.04 ? 85  ILE B CB    1 
ATOM   3000 C  CG1   . ILE B 2 86  ? -11.589 -23.138 -0.099  1.00 56.48 ? 85  ILE B CG1   1 
ATOM   3001 C  CG2   . ILE B 2 86  ? -11.438 -24.310 -2.287  1.00 56.73 ? 85  ILE B CG2   1 
ATOM   3002 C  CD1   . ILE B 2 86  ? -10.115 -23.346 0.214   1.00 56.04 ? 85  ILE B CD1   1 
ATOM   3003 N  N     . TYR B 2 87  ? -14.466 -26.227 -1.931  1.00 57.14 ? 86  TYR B N     1 
ATOM   3004 C  CA    . TYR B 2 87  ? -14.896 -27.203 -2.920  1.00 57.00 ? 86  TYR B CA    1 
ATOM   3005 C  C     . TYR B 2 87  ? -16.240 -26.821 -3.538  1.00 56.72 ? 86  TYR B C     1 
ATOM   3006 O  O     . TYR B 2 87  ? -16.430 -26.987 -4.737  1.00 56.55 ? 86  TYR B O     1 
ATOM   3007 C  CB    . TYR B 2 87  ? -14.975 -28.605 -2.310  1.00 57.34 ? 86  TYR B CB    1 
ATOM   3008 C  CG    . TYR B 2 87  ? -15.362 -29.668 -3.311  1.00 57.64 ? 86  TYR B CG    1 
ATOM   3009 C  CD1   . TYR B 2 87  ? -14.395 -30.323 -4.059  1.00 58.00 ? 86  TYR B CD1   1 
ATOM   3010 C  CD2   . TYR B 2 87  ? -16.700 -30.003 -3.523  1.00 58.03 ? 86  TYR B CD2   1 
ATOM   3011 C  CE1   . TYR B 2 87  ? -14.743 -31.290 -4.990  1.00 58.30 ? 86  TYR B CE1   1 
ATOM   3012 C  CE2   . TYR B 2 87  ? -17.061 -30.963 -4.455  1.00 58.00 ? 86  TYR B CE2   1 
ATOM   3013 C  CZ    . TYR B 2 87  ? -16.077 -31.604 -5.186  1.00 58.17 ? 86  TYR B CZ    1 
ATOM   3014 O  OH    . TYR B 2 87  ? -16.415 -32.570 -6.108  1.00 58.46 ? 86  TYR B OH    1 
ATOM   3015 N  N     . MET B 2 88  ? -17.159 -26.317 -2.717  1.00 56.52 ? 87  MET B N     1 
ATOM   3016 C  CA    . MET B 2 88  ? -18.517 -25.986 -3.169  1.00 56.47 ? 87  MET B CA    1 
ATOM   3017 C  C     . MET B 2 88  ? -18.562 -24.685 -3.955  1.00 55.76 ? 87  MET B C     1 
ATOM   3018 O  O     . MET B 2 88  ? -19.385 -24.542 -4.854  1.00 55.94 ? 87  MET B O     1 
ATOM   3019 C  CB    . MET B 2 88  ? -19.483 -25.883 -1.983  1.00 56.77 ? 87  MET B CB    1 
ATOM   3020 C  CG    . MET B 2 88  ? -19.632 -27.177 -1.187  1.00 58.42 ? 87  MET B CG    1 
ATOM   3021 S  SD    . MET B 2 88  ? -20.630 -28.457 -1.991  1.00 62.18 ? 87  MET B SD    1 
ATOM   3022 C  CE    . MET B 2 88  ? -22.223 -28.246 -1.157  1.00 60.57 ? 87  MET B CE    1 
ATOM   3023 N  N     . THR B 2 89  ? -17.693 -23.740 -3.605  1.00 54.92 ? 88  THR B N     1 
ATOM   3024 C  CA    . THR B 2 89  ? -17.647 -22.440 -4.277  1.00 54.18 ? 88  THR B CA    1 
ATOM   3025 C  C     . THR B 2 89  ? -16.924 -22.498 -5.625  1.00 53.90 ? 88  THR B C     1 
ATOM   3026 O  O     . THR B 2 89  ? -17.362 -21.844 -6.573  1.00 53.93 ? 88  THR B O     1 
ATOM   3027 C  CB    . THR B 2 89  ? -16.926 -21.375 -3.411  1.00 54.07 ? 88  THR B CB    1 
ATOM   3028 O  OG1   . THR B 2 89  ? -17.533 -21.305 -2.125  1.00 52.84 ? 88  THR B OG1   1 
ATOM   3029 C  CG2   . THR B 2 89  ? -16.970 -19.999 -4.070  1.00 53.76 ? 88  THR B CG2   1 
ATOM   3030 N  N     . PHE B 2 90  ? -15.833 -23.271 -5.700  1.00 53.32 ? 89  PHE B N     1 
ATOM   3031 C  CA    . PHE B 2 90  ? -14.882 -23.199 -6.824  1.00 53.24 ? 89  PHE B CA    1 
ATOM   3032 C  C     . PHE B 2 90  ? -14.658 -24.479 -7.659  1.00 53.35 ? 89  PHE B C     1 
ATOM   3033 O  O     . PHE B 2 90  ? -14.280 -24.388 -8.833  1.00 53.10 ? 89  PHE B O     1 
ATOM   3034 C  CB    . PHE B 2 90  ? -13.519 -22.737 -6.301  1.00 53.09 ? 89  PHE B CB    1 
ATOM   3035 C  CG    . PHE B 2 90  ? -13.541 -21.380 -5.679  1.00 52.90 ? 89  PHE B CG    1 
ATOM   3036 C  CD1   . PHE B 2 90  ? -13.645 -20.245 -6.470  1.00 53.25 ? 89  PHE B CD1   1 
ATOM   3037 C  CD2   . PHE B 2 90  ? -13.462 -21.228 -4.312  1.00 52.07 ? 89  PHE B CD2   1 
ATOM   3038 C  CE1   . PHE B 2 90  ? -13.666 -18.974 -5.898  1.00 53.54 ? 89  PHE B CE1   1 
ATOM   3039 C  CE2   . PHE B 2 90  ? -13.484 -19.965 -3.736  1.00 52.59 ? 89  PHE B CE2   1 
ATOM   3040 C  CZ    . PHE B 2 90  ? -13.585 -18.838 -4.524  1.00 52.60 ? 89  PHE B CZ    1 
ATOM   3041 N  N     . LEU B 2 91  ? -14.863 -25.655 -7.057  1.00 53.32 ? 90  LEU B N     1 
ATOM   3042 C  CA    . LEU B 2 91  ? -14.449 -26.926 -7.664  1.00 53.26 ? 90  LEU B CA    1 
ATOM   3043 C  C     . LEU B 2 91  ? -15.591 -27.820 -8.144  1.00 53.68 ? 90  LEU B C     1 
ATOM   3044 O  O     . LEU B 2 91  ? -15.380 -28.657 -9.012  1.00 53.80 ? 90  LEU B O     1 
ATOM   3045 C  CB    . LEU B 2 91  ? -13.577 -27.712 -6.681  1.00 53.05 ? 90  LEU B CB    1 
ATOM   3046 C  CG    . LEU B 2 91  ? -12.257 -27.042 -6.285  1.00 52.55 ? 90  LEU B CG    1 
ATOM   3047 C  CD1   . LEU B 2 91  ? -11.490 -27.913 -5.296  1.00 52.41 ? 90  LEU B CD1   1 
ATOM   3048 C  CD2   . LEU B 2 91  ? -11.406 -26.754 -7.501  1.00 51.07 ? 90  LEU B CD2   1 
ATOM   3049 N  N     . SER B 2 92  ? -16.788 -27.658 -7.587  1.00 54.09 ? 91  SER B N     1 
ATOM   3050 C  CA    . SER B 2 92  ? -17.934 -28.490 -7.956  1.00 54.22 ? 91  SER B CA    1 
ATOM   3051 C  C     . SER B 2 92  ? -18.423 -28.189 -9.370  1.00 54.61 ? 91  SER B C     1 
ATOM   3052 O  O     . SER B 2 92  ? -18.392 -27.041 -9.813  1.00 54.34 ? 91  SER B O     1 
ATOM   3053 C  CB    . SER B 2 92  ? -19.082 -28.272 -6.965  1.00 54.19 ? 91  SER B CB    1 
ATOM   3054 O  OG    . SER B 2 92  ? -20.251 -28.967 -7.361  1.00 53.99 ? 91  SER B OG    1 
ATOM   3055 N  N     . SER B 2 93  ? -18.891 -29.227 -10.064 1.00 55.29 ? 92  SER B N     1 
ATOM   3056 C  CA    . SER B 2 93  ? -19.560 -29.065 -11.369 1.00 55.70 ? 92  SER B CA    1 
ATOM   3057 C  C     . SER B 2 93  ? -20.840 -28.224 -11.290 1.00 55.83 ? 92  SER B C     1 
ATOM   3058 O  O     . SER B 2 93  ? -21.254 -27.631 -12.283 1.00 55.79 ? 92  SER B O     1 
ATOM   3059 C  CB    . SER B 2 93  ? -19.894 -30.427 -11.981 1.00 55.76 ? 92  SER B CB    1 
ATOM   3060 O  OG    . SER B 2 93  ? -18.750 -30.983 -12.596 1.00 56.28 ? 92  SER B OG    1 
ATOM   3061 N  N     . LYS B 2 94  ? -21.467 -28.195 -10.116 1.00 55.96 ? 93  LYS B N     1 
ATOM   3062 C  CA    . LYS B 2 94  ? -22.621 -27.340 -9.879  1.00 56.08 ? 93  LYS B CA    1 
ATOM   3063 C  C     . LYS B 2 94  ? -22.217 -25.947 -9.365  1.00 56.24 ? 93  LYS B C     1 
ATOM   3064 O  O     . LYS B 2 94  ? -23.061 -25.060 -9.264  1.00 56.22 ? 93  LYS B O     1 
ATOM   3065 C  CB    . LYS B 2 94  ? -23.585 -28.019 -8.894  1.00 56.09 ? 93  LYS B CB    1 
ATOM   3066 C  CG    . LYS B 2 94  ? -24.062 -29.405 -9.350  1.00 55.97 ? 93  LYS B CG    1 
ATOM   3067 C  CD    . LYS B 2 94  ? -25.449 -29.741 -8.813  1.00 55.75 ? 93  LYS B CD    1 
ATOM   3068 N  N     . ALA B 2 95  ? -20.935 -25.746 -9.065  1.00 56.40 ? 94  ALA B N     1 
ATOM   3069 C  CA    . ALA B 2 95  ? -20.481 -24.506 -8.420  1.00 56.68 ? 94  ALA B CA    1 
ATOM   3070 C  C     . ALA B 2 95  ? -20.646 -23.293 -9.326  1.00 56.90 ? 94  ALA B C     1 
ATOM   3071 O  O     . ALA B 2 95  ? -20.350 -23.355 -10.510 1.00 56.81 ? 94  ALA B O     1 
ATOM   3072 C  CB    . ALA B 2 95  ? -19.029 -24.629 -7.975  1.00 56.55 ? 94  ALA B CB    1 
ATOM   3073 N  N     . SER B 2 96  ? -21.110 -22.189 -8.754  1.00 57.30 ? 95  SER B N     1 
ATOM   3074 C  CA    . SER B 2 96  ? -21.346 -20.964 -9.514  1.00 57.50 ? 95  SER B CA    1 
ATOM   3075 C  C     . SER B 2 96  ? -20.036 -20.284 -9.972  1.00 57.75 ? 95  SER B C     1 
ATOM   3076 O  O     . SER B 2 96  ? -19.964 -19.734 -11.074 1.00 57.54 ? 95  SER B O     1 
ATOM   3077 C  CB    . SER B 2 96  ? -22.191 -19.999 -8.686  1.00 57.38 ? 95  SER B CB    1 
ATOM   3078 O  OG    . SER B 2 96  ? -22.361 -18.780 -9.373  1.00 57.34 ? 95  SER B OG    1 
ATOM   3079 N  N     . SER B 2 97  ? -19.009 -20.325 -9.129  1.00 58.01 ? 96  SER B N     1 
ATOM   3080 C  CA    . SER B 2 97  ? -17.703 -19.786 -9.487  1.00 58.17 ? 96  SER B CA    1 
ATOM   3081 C  C     . SER B 2 97  ? -16.728 -20.915 -9.795  1.00 58.24 ? 96  SER B C     1 
ATOM   3082 O  O     . SER B 2 97  ? -15.619 -20.939 -9.273  1.00 58.17 ? 96  SER B O     1 
ATOM   3083 C  CB    . SER B 2 97  ? -17.159 -18.922 -8.351  1.00 58.28 ? 96  SER B CB    1 
ATOM   3084 O  OG    . SER B 2 97  ? -17.854 -17.696 -8.282  1.00 59.21 ? 96  SER B OG    1 
ATOM   3085 N  N     . GLN B 2 98  ? -17.130 -21.849 -10.654 1.00 58.46 ? 97  GLN B N     1 
ATOM   3086 C  CA    . GLN B 2 98  ? -16.272 -22.988 -10.955 1.00 58.64 ? 97  GLN B CA    1 
ATOM   3087 C  C     . GLN B 2 98  ? -15.023 -22.536 -11.706 1.00 58.69 ? 97  GLN B C     1 
ATOM   3088 O  O     . GLN B 2 98  ? -15.127 -21.845 -12.706 1.00 59.14 ? 97  GLN B O     1 
ATOM   3089 C  CB    . GLN B 2 98  ? -17.009 -24.042 -11.766 1.00 58.56 ? 97  GLN B CB    1 
ATOM   3090 C  CG    . GLN B 2 98  ? -16.283 -25.378 -11.774 1.00 58.71 ? 97  GLN B CG    1 
ATOM   3091 C  CD    . GLN B 2 98  ? -16.911 -26.389 -12.700 1.00 58.86 ? 97  GLN B CD    1 
ATOM   3092 O  OE1   . GLN B 2 98  ? -17.978 -26.156 -13.284 1.00 59.66 ? 97  GLN B OE1   1 
ATOM   3093 N  NE2   . GLN B 2 98  ? -16.253 -27.526 -12.840 1.00 58.28 ? 97  GLN B NE2   1 
ATOM   3094 N  N     . VAL B 2 99  ? -13.853 -22.929 -11.216 1.00 58.70 ? 98  VAL B N     1 
ATOM   3095 C  CA    . VAL B 2 99  ? -12.586 -22.513 -11.812 1.00 58.84 ? 98  VAL B CA    1 
ATOM   3096 C  C     . VAL B 2 99  ? -12.132 -23.494 -12.903 1.00 59.62 ? 98  VAL B C     1 
ATOM   3097 O  O     . VAL B 2 99  ? -12.382 -24.697 -12.814 1.00 59.50 ? 98  VAL B O     1 
ATOM   3098 C  CB    . VAL B 2 99  ? -11.472 -22.345 -10.745 1.00 58.57 ? 98  VAL B CB    1 
ATOM   3099 C  CG1   . VAL B 2 99  ? -11.836 -21.236 -9.777  1.00 57.40 ? 98  VAL B CG1   1 
ATOM   3100 C  CG2   . VAL B 2 99  ? -11.214 -23.646 -10.008 1.00 57.53 ? 98  VAL B CG2   1 
ATOM   3101 N  N     . ASN B 2 100 ? -11.464 -22.964 -13.929 1.00 60.30 ? 99  ASN B N     1 
ATOM   3102 C  CA    . ASN B 2 100 ? -11.058 -23.754 -15.091 1.00 60.74 ? 99  ASN B CA    1 
ATOM   3103 C  C     . ASN B 2 100 ? -9.769  -24.528 -14.847 1.00 61.70 ? 99  ASN B C     1 
ATOM   3104 O  O     . ASN B 2 100 ? -8.676  -24.089 -15.207 1.00 62.07 ? 99  ASN B O     1 
ATOM   3105 C  CB    . ASN B 2 100 ? -10.894 -22.846 -16.305 1.00 60.54 ? 99  ASN B CB    1 
ATOM   3106 C  CG    . ASN B 2 100 ? -10.712 -23.617 -17.579 1.00 59.29 ? 99  ASN B CG    1 
ATOM   3107 O  OD1   . ASN B 2 100 ? -10.554 -24.834 -17.566 1.00 57.22 ? 99  ASN B OD1   1 
ATOM   3108 N  ND2   . ASN B 2 100 ? -10.731 -22.912 -18.697 1.00 59.34 ? 99  ASN B ND2   1 
ATOM   3109 N  N     . VAL B 2 101 ? -9.918  -25.705 -14.263 1.00 62.69 ? 100 VAL B N     1 
ATOM   3110 C  CA    . VAL B 2 101 ? -8.797  -26.488 -13.785 1.00 63.55 ? 100 VAL B CA    1 
ATOM   3111 C  C     . VAL B 2 101 ? -8.756  -27.774 -14.608 1.00 64.39 ? 100 VAL B C     1 
ATOM   3112 O  O     . VAL B 2 101 ? -9.806  -28.235 -15.045 1.00 64.46 ? 100 VAL B O     1 
ATOM   3113 C  CB    . VAL B 2 101 ? -8.996  -26.758 -12.282 1.00 63.54 ? 100 VAL B CB    1 
ATOM   3114 C  CG1   . VAL B 2 101 ? -9.934  -27.954 -12.043 1.00 63.01 ? 100 VAL B CG1   1 
ATOM   3115 C  CG2   . VAL B 2 101 ? -7.674  -26.948 -11.612 1.00 64.43 ? 100 VAL B CG2   1 
ATOM   3116 N  N     . GLU B 2 102 ? -7.572  -28.342 -14.849 1.00 65.41 ? 101 GLU B N     1 
ATOM   3117 C  CA    . GLU B 2 102 ? -7.472  -29.518 -15.756 1.00 66.31 ? 101 GLU B CA    1 
ATOM   3118 C  C     . GLU B 2 102 ? -7.987  -30.772 -15.038 1.00 66.57 ? 101 GLU B C     1 
ATOM   3119 O  O     . GLU B 2 102 ? -7.224  -31.530 -14.455 1.00 66.96 ? 101 GLU B O     1 
ATOM   3120 C  CB    . GLU B 2 102 ? -6.065  -29.706 -16.404 1.00 66.13 ? 101 GLU B CB    1 
ATOM   3121 C  CG    . GLU B 2 102 ? -4.833  -29.200 -15.609 1.00 66.96 ? 101 GLU B CG    1 
ATOM   3122 C  CD    . GLU B 2 102 ? -3.485  -29.271 -16.391 1.00 67.58 ? 101 GLU B CD    1 
ATOM   3123 O  OE1   . GLU B 2 102 ? -2.716  -28.275 -16.344 1.00 67.89 ? 101 GLU B OE1   1 
ATOM   3124 O  OE2   . GLU B 2 102 ? -3.182  -30.317 -17.033 1.00 68.66 ? 101 GLU B OE2   1 
ATOM   3125 N  N     . GLY B 2 103 ? -9.307  -30.961 -15.093 1.00 67.04 ? 102 GLY B N     1 
ATOM   3126 C  CA    . GLY B 2 103 ? -10.017 -31.965 -14.294 1.00 67.07 ? 102 GLY B CA    1 
ATOM   3127 C  C     . GLY B 2 103 ? -9.424  -33.352 -14.409 1.00 67.27 ? 102 GLY B C     1 
ATOM   3128 O  O     . GLY B 2 103 ? -9.387  -34.094 -13.430 1.00 67.59 ? 102 GLY B O     1 
ATOM   3129 N  N     . PRO B 2 115 ? -8.290  -34.464 4.781   1.00 59.30 ? 114 PRO B N     1 
ATOM   3130 C  CA    . PRO B 2 115 ? -7.978  -33.037 4.654   1.00 59.20 ? 114 PRO B CA    1 
ATOM   3131 C  C     . PRO B 2 115 ? -6.612  -32.680 5.239   1.00 59.14 ? 114 PRO B C     1 
ATOM   3132 O  O     . PRO B 2 115 ? -6.115  -33.395 6.111   1.00 59.05 ? 114 PRO B O     1 
ATOM   3133 C  CB    . PRO B 2 115 ? -9.099  -32.363 5.449   1.00 59.11 ? 114 PRO B CB    1 
ATOM   3134 C  CG    . PRO B 2 115 ? -10.244 -33.307 5.339   1.00 59.24 ? 114 PRO B CG    1 
ATOM   3135 C  CD    . PRO B 2 115 ? -9.645  -34.688 5.316   1.00 59.39 ? 114 PRO B CD    1 
ATOM   3136 N  N     . HIS B 2 116 ? -6.012  -31.598 4.738   1.00 58.98 ? 115 HIS B N     1 
ATOM   3137 C  CA    . HIS B 2 116 ? -4.741  -31.067 5.259   1.00 58.91 ? 115 HIS B CA    1 
ATOM   3138 C  C     . HIS B 2 116 ? -4.378  -29.757 4.545   1.00 58.36 ? 115 HIS B C     1 
ATOM   3139 O  O     . HIS B 2 116 ? -4.927  -29.455 3.485   1.00 58.19 ? 115 HIS B O     1 
ATOM   3140 C  CB    . HIS B 2 116 ? -3.608  -32.092 5.130   1.00 59.34 ? 115 HIS B CB    1 
ATOM   3141 C  CG    . HIS B 2 116 ? -3.347  -32.526 3.726   1.00 60.63 ? 115 HIS B CG    1 
ATOM   3142 N  ND1   . HIS B 2 116 ? -4.215  -33.336 3.027   1.00 62.34 ? 115 HIS B ND1   1 
ATOM   3143 C  CD2   . HIS B 2 116 ? -2.314  -32.265 2.889   1.00 61.79 ? 115 HIS B CD2   1 
ATOM   3144 C  CE1   . HIS B 2 116 ? -3.730  -33.553 1.816   1.00 62.62 ? 115 HIS B CE1   1 
ATOM   3145 N  NE2   . HIS B 2 116 ? -2.577  -32.915 1.706   1.00 62.09 ? 115 HIS B NE2   1 
ATOM   3146 N  N     . PRO B 2 117 ? -3.455  -28.966 5.124   1.00 57.74 ? 116 PRO B N     1 
ATOM   3147 C  CA    . PRO B 2 117 ? -3.286  -27.595 4.631   1.00 57.25 ? 116 PRO B CA    1 
ATOM   3148 C  C     . PRO B 2 117 ? -2.968  -27.469 3.153   1.00 56.62 ? 116 PRO B C     1 
ATOM   3149 O  O     . PRO B 2 117 ? -3.552  -26.624 2.493   1.00 56.89 ? 116 PRO B O     1 
ATOM   3150 C  CB    . PRO B 2 117 ? -2.120  -27.055 5.471   1.00 57.21 ? 116 PRO B CB    1 
ATOM   3151 C  CG    . PRO B 2 117 ? -2.121  -27.887 6.686   1.00 57.47 ? 116 PRO B CG    1 
ATOM   3152 C  CD    . PRO B 2 117 ? -2.534  -29.249 6.237   1.00 57.61 ? 116 PRO B CD    1 
ATOM   3153 N  N     . LEU B 2 118 ? -2.057  -28.289 2.636   1.00 56.00 ? 117 LEU B N     1 
ATOM   3154 C  CA    . LEU B 2 118 ? -1.582  -28.120 1.256   1.00 55.64 ? 117 LEU B CA    1 
ATOM   3155 C  C     . LEU B 2 118 ? -2.297  -29.019 0.236   1.00 55.16 ? 117 LEU B C     1 
ATOM   3156 O  O     . LEU B 2 118 ? -1.760  -29.312 -0.836  1.00 54.73 ? 117 LEU B O     1 
ATOM   3157 C  CB    . LEU B 2 118 ? -0.060  -28.311 1.187   1.00 55.66 ? 117 LEU B CB    1 
ATOM   3158 C  CG    . LEU B 2 118 ? 0.736   -27.426 2.155   1.00 55.79 ? 117 LEU B CG    1 
ATOM   3159 C  CD1   . LEU B 2 118 ? 1.064   -28.188 3.438   1.00 56.21 ? 117 LEU B CD1   1 
ATOM   3160 C  CD2   . LEU B 2 118 ? 2.009   -26.896 1.514   1.00 55.73 ? 117 LEU B CD2   1 
ATOM   3161 N  N     . MET B 2 119 ? -3.528  -29.413 0.548   1.00 54.74 ? 118 MET B N     1 
ATOM   3162 C  CA    . MET B 2 119 ? -4.255  -30.363 -0.287  1.00 54.48 ? 118 MET B CA    1 
ATOM   3163 C  C     . MET B 2 119 ? -4.694  -29.765 -1.630  1.00 54.31 ? 118 MET B C     1 
ATOM   3164 O  O     . MET B 2 119 ? -5.000  -30.506 -2.556  1.00 54.45 ? 118 MET B O     1 
ATOM   3165 C  CB    . MET B 2 119 ? -5.463  -30.929 0.465   1.00 54.45 ? 118 MET B CB    1 
ATOM   3166 C  CG    . MET B 2 119 ? -6.671  -30.003 0.487   1.00 54.67 ? 118 MET B CG    1 
ATOM   3167 S  SD    . MET B 2 119 ? -7.857  -30.390 1.782   1.00 54.03 ? 118 MET B SD    1 
ATOM   3168 C  CE    . MET B 2 119 ? -9.353  -30.398 0.808   1.00 54.87 ? 118 MET B CE    1 
ATOM   3169 N  N     . PHE B 2 120 ? -4.729  -28.440 -1.743  1.00 54.14 ? 119 PHE B N     1 
ATOM   3170 C  CA    . PHE B 2 120 ? -5.098  -27.805 -3.012  1.00 53.89 ? 119 PHE B CA    1 
ATOM   3171 C  C     . PHE B 2 120 ? -3.902  -27.345 -3.839  1.00 53.48 ? 119 PHE B C     1 
ATOM   3172 O  O     . PHE B 2 120 ? -4.100  -26.636 -4.806  1.00 53.33 ? 119 PHE B O     1 
ATOM   3173 C  CB    . PHE B 2 120 ? -6.042  -26.608 -2.780  1.00 54.19 ? 119 PHE B CB    1 
ATOM   3174 C  CG    . PHE B 2 120 ? -7.305  -26.954 -2.014  1.00 54.47 ? 119 PHE B CG    1 
ATOM   3175 C  CD1   . PHE B 2 120 ? -8.242  -27.828 -2.547  1.00 54.73 ? 119 PHE B CD1   1 
ATOM   3176 C  CD2   . PHE B 2 120 ? -7.553  -26.404 -0.763  1.00 54.59 ? 119 PHE B CD2   1 
ATOM   3177 C  CE1   . PHE B 2 120 ? -9.397  -28.153 -1.839  1.00 54.76 ? 119 PHE B CE1   1 
ATOM   3178 C  CE2   . PHE B 2 120 ? -8.701  -26.730 -0.056  1.00 54.61 ? 119 PHE B CE2   1 
ATOM   3179 C  CZ    . PHE B 2 120 ? -9.623  -27.602 -0.598  1.00 54.47 ? 119 PHE B CZ    1 
ATOM   3180 N  N     . GLN B 2 121 ? -2.675  -27.748 -3.500  1.00 53.48 ? 120 GLN B N     1 
ATOM   3181 C  CA    . GLN B 2 121 ? -1.487  -27.251 -4.239  1.00 53.60 ? 120 GLN B CA    1 
ATOM   3182 C  C     . GLN B 2 121 ? -1.577  -27.368 -5.770  1.00 53.46 ? 120 GLN B C     1 
ATOM   3183 O  O     . GLN B 2 121 ? -1.483  -26.347 -6.456  1.00 53.47 ? 120 GLN B O     1 
ATOM   3184 C  CB    . GLN B 2 121 ? -0.174  -27.910 -3.782  1.00 53.52 ? 120 GLN B CB    1 
ATOM   3185 C  CG    . GLN B 2 121 ? 0.713   -27.077 -2.850  1.00 54.33 ? 120 GLN B CG    1 
ATOM   3186 C  CD    . GLN B 2 121 ? 0.708   -25.578 -3.131  1.00 54.80 ? 120 GLN B CD    1 
ATOM   3187 O  OE1   . GLN B 2 121 ? 0.372   -24.781 -2.253  1.00 55.83 ? 120 GLN B OE1   1 
ATOM   3188 N  NE2   . GLN B 2 121 ? 1.065   -25.193 -4.348  1.00 54.47 ? 120 GLN B NE2   1 
ATOM   3189 N  N     . LYS B 2 122 ? -1.724  -28.593 -6.291  1.00 53.21 ? 121 LYS B N     1 
ATOM   3190 C  CA    . LYS B 2 122 ? -1.847  -28.817 -7.739  1.00 53.30 ? 121 LYS B CA    1 
ATOM   3191 C  C     . LYS B 2 122 ? -2.833  -27.834 -8.378  1.00 53.51 ? 121 LYS B C     1 
ATOM   3192 O  O     . LYS B 2 122 ? -2.528  -27.190 -9.390  1.00 53.56 ? 121 LYS B O     1 
ATOM   3193 C  CB    . LYS B 2 122 ? -2.304  -30.249 -8.063  1.00 53.17 ? 121 LYS B CB    1 
ATOM   3194 C  CG    . LYS B 2 122 ? -1.227  -31.158 -8.636  1.00 53.67 ? 121 LYS B CG    1 
ATOM   3195 C  CD    . LYS B 2 122 ? -1.805  -32.273 -9.522  1.00 53.96 ? 121 LYS B CD    1 
ATOM   3196 N  N     . LEU B 2 123 ? -4.010  -27.720 -7.773  1.00 53.40 ? 122 LEU B N     1 
ATOM   3197 C  CA    . LEU B 2 123 ? -5.073  -26.902 -8.325  1.00 53.48 ? 122 LEU B CA    1 
ATOM   3198 C  C     . LEU B 2 123 ? -4.743  -25.413 -8.235  1.00 53.83 ? 122 LEU B C     1 
ATOM   3199 O  O     . LEU B 2 123 ? -4.940  -24.679 -9.199  1.00 53.98 ? 122 LEU B O     1 
ATOM   3200 C  CB    . LEU B 2 123 ? -6.401  -27.218 -7.631  1.00 53.29 ? 122 LEU B CB    1 
ATOM   3201 C  CG    . LEU B 2 123 ? -6.870  -28.673 -7.784  1.00 52.67 ? 122 LEU B CG    1 
ATOM   3202 C  CD1   . LEU B 2 123 ? -8.092  -28.954 -6.904  1.00 52.41 ? 122 LEU B CD1   1 
ATOM   3203 C  CD2   . LEU B 2 123 ? -7.174  -29.002 -9.233  1.00 50.63 ? 122 LEU B CD2   1 
ATOM   3204 N  N     . GLN B 2 124 ? -4.235  -24.971 -7.090  1.00 54.10 ? 123 GLN B N     1 
ATOM   3205 C  CA    . GLN B 2 124 ? -3.801  -23.586 -6.928  1.00 54.54 ? 123 GLN B CA    1 
ATOM   3206 C  C     . GLN B 2 124 ? -2.710  -23.207 -7.933  1.00 54.63 ? 123 GLN B C     1 
ATOM   3207 O  O     . GLN B 2 124 ? -2.763  -22.142 -8.539  1.00 54.69 ? 123 GLN B O     1 
ATOM   3208 C  CB    . GLN B 2 124 ? -3.276  -23.351 -5.512  1.00 54.61 ? 123 GLN B CB    1 
ATOM   3209 C  CG    . GLN B 2 124 ? -2.925  -21.894 -5.223  1.00 54.89 ? 123 GLN B CG    1 
ATOM   3210 C  CD    . GLN B 2 124 ? -2.298  -21.694 -3.867  1.00 55.14 ? 123 GLN B CD    1 
ATOM   3211 O  OE1   . GLN B 2 124 ? -1.843  -22.648 -3.222  1.00 56.56 ? 123 GLN B OE1   1 
ATOM   3212 N  NE2   . GLN B 2 124 ? -2.263  -20.443 -3.422  1.00 55.66 ? 123 GLN B NE2   1 
ATOM   3213 N  N     . ASP B 2 125 ? -1.714  -24.070 -8.089  1.00 54.88 ? 124 ASP B N     1 
ATOM   3214 C  CA    . ASP B 2 125 ? -0.675  -23.848 -9.090  1.00 55.30 ? 124 ASP B CA    1 
ATOM   3215 C  C     . ASP B 2 125 ? -1.254  -23.736 -10.511 1.00 55.30 ? 124 ASP B C     1 
ATOM   3216 O  O     . ASP B 2 125 ? -0.824  -22.892 -11.294 1.00 55.65 ? 124 ASP B O     1 
ATOM   3217 C  CB    . ASP B 2 125 ? 0.379   -24.958 -9.039  1.00 55.47 ? 124 ASP B CB    1 
ATOM   3218 C  CG    . ASP B 2 125 ? 1.231   -24.910 -7.771  1.00 56.32 ? 124 ASP B CG    1 
ATOM   3219 O  OD1   . ASP B 2 125 ? 1.214   -23.867 -7.086  1.00 58.16 ? 124 ASP B OD1   1 
ATOM   3220 O  OD2   . ASP B 2 125 ? 1.916   -25.915 -7.458  1.00 55.79 ? 124 ASP B OD2   1 
ATOM   3221 N  N     . GLN B 2 126 ? -2.232  -24.576 -10.840 1.00 55.05 ? 125 GLN B N     1 
ATOM   3222 C  CA    . GLN B 2 126 ? -2.847  -24.544 -12.172 1.00 54.72 ? 125 GLN B CA    1 
ATOM   3223 C  C     . GLN B 2 126 ? -3.536  -23.210 -12.446 1.00 54.53 ? 125 GLN B C     1 
ATOM   3224 O  O     . GLN B 2 126 ? -3.368  -22.641 -13.518 1.00 54.60 ? 125 GLN B O     1 
ATOM   3225 C  CB    . GLN B 2 126 ? -3.849  -25.688 -12.348 1.00 54.62 ? 125 GLN B CB    1 
ATOM   3226 C  CG    . GLN B 2 126 ? -3.214  -27.026 -12.631 1.00 54.40 ? 125 GLN B CG    1 
ATOM   3227 C  CD    . GLN B 2 126 ? -4.211  -28.158 -12.568 1.00 55.16 ? 125 GLN B CD    1 
ATOM   3228 O  OE1   . GLN B 2 126 ? -5.422  -27.942 -12.657 1.00 55.54 ? 125 GLN B OE1   1 
ATOM   3229 N  NE2   . GLN B 2 126 ? -3.710  -29.380 -12.424 1.00 55.07 ? 125 GLN B NE2   1 
ATOM   3230 N  N     . ILE B 2 127 ? -4.299  -22.719 -11.474 1.00 54.22 ? 126 ILE B N     1 
ATOM   3231 C  CA    . ILE B 2 127 ? -5.002  -21.449 -11.624 1.00 54.11 ? 126 ILE B CA    1 
ATOM   3232 C  C     . ILE B 2 127 ? -4.009  -20.302 -11.618 1.00 54.01 ? 126 ILE B C     1 
ATOM   3233 O  O     . ILE B 2 127 ? -4.198  -19.307 -12.323 1.00 53.81 ? 126 ILE B O     1 
ATOM   3234 C  CB    . ILE B 2 127 ? -6.097  -21.249 -10.533 1.00 54.05 ? 126 ILE B CB    1 
ATOM   3235 C  CG1   . ILE B 2 127 ? -7.197  -22.315 -10.671 1.00 53.91 ? 126 ILE B CG1   1 
ATOM   3236 C  CG2   . ILE B 2 127 ? -6.730  -19.867 -10.622 1.00 54.03 ? 126 ILE B CG2   1 
ATOM   3237 C  CD1   . ILE B 2 127 ? -7.744  -22.528 -12.089 1.00 53.04 ? 126 ILE B CD1   1 
ATOM   3238 N  N     . PHE B 2 128 ? -2.932  -20.453 -10.855 1.00 54.04 ? 127 PHE B N     1 
ATOM   3239 C  CA    . PHE B 2 128 ? -1.865  -19.470 -10.883 1.00 53.96 ? 127 PHE B CA    1 
ATOM   3240 C  C     . PHE B 2 128 ? -1.306  -19.330 -12.297 1.00 54.43 ? 127 PHE B C     1 
ATOM   3241 O  O     . PHE B 2 128 ? -1.152  -18.220 -12.790 1.00 54.39 ? 127 PHE B O     1 
ATOM   3242 C  CB    . PHE B 2 128 ? -0.749  -19.854 -9.930  1.00 53.69 ? 127 PHE B CB    1 
ATOM   3243 C  CG    . PHE B 2 128 ? 0.370   -18.872 -9.915  1.00 53.60 ? 127 PHE B CG    1 
ATOM   3244 C  CD1   . PHE B 2 128 ? 0.303   -17.743 -9.113  1.00 53.19 ? 127 PHE B CD1   1 
ATOM   3245 C  CD2   . PHE B 2 128 ? 1.480   -19.053 -10.728 1.00 53.65 ? 127 PHE B CD2   1 
ATOM   3246 C  CE1   . PHE B 2 128 ? 1.325   -16.816 -9.106  1.00 53.21 ? 127 PHE B CE1   1 
ATOM   3247 C  CE2   . PHE B 2 128 ? 2.506   -18.129 -10.736 1.00 53.78 ? 127 PHE B CE2   1 
ATOM   3248 C  CZ    . PHE B 2 128 ? 2.430   -17.005 -9.917  1.00 53.73 ? 127 PHE B CZ    1 
ATOM   3249 N  N     . ASN B 2 129 ? -1.017  -20.458 -12.944 1.00 54.90 ? 128 ASN B N     1 
ATOM   3250 C  CA    . ASN B 2 129 ? -0.449  -20.445 -14.291 1.00 55.73 ? 128 ASN B CA    1 
ATOM   3251 C  C     . ASN B 2 129 ? -1.444  -19.997 -15.373 1.00 55.91 ? 128 ASN B C     1 
ATOM   3252 O  O     . ASN B 2 129 ? -1.044  -19.454 -16.406 1.00 55.74 ? 128 ASN B O     1 
ATOM   3253 C  CB    . ASN B 2 129 ? 0.156   -21.814 -14.638 1.00 55.96 ? 128 ASN B CB    1 
ATOM   3254 C  CG    . ASN B 2 129 ? 1.411   -22.125 -13.815 1.00 57.20 ? 128 ASN B CG    1 
ATOM   3255 O  OD1   . ASN B 2 129 ? 2.221   -21.244 -13.551 1.00 59.39 ? 128 ASN B OD1   1 
ATOM   3256 N  ND2   . ASN B 2 129 ? 1.567   -23.380 -13.407 1.00 58.86 ? 128 ASN B ND2   1 
ATOM   3257 N  N     . LEU B 2 130 ? -2.729  -20.232 -15.124 1.00 56.29 ? 129 LEU B N     1 
ATOM   3258 C  CA    . LEU B 2 130 ? -3.798  -19.797 -16.018 1.00 56.62 ? 129 LEU B CA    1 
ATOM   3259 C  C     . LEU B 2 130 ? -3.817  -18.276 -16.065 1.00 57.12 ? 129 LEU B C     1 
ATOM   3260 O  O     . LEU B 2 130 ? -3.789  -17.679 -17.146 1.00 57.45 ? 129 LEU B O     1 
ATOM   3261 C  CB    . LEU B 2 130 ? -5.147  -20.324 -15.521 1.00 56.66 ? 129 LEU B CB    1 
ATOM   3262 C  CG    . LEU B 2 130 ? -6.388  -20.053 -16.370 1.00 56.89 ? 129 LEU B CG    1 
ATOM   3263 C  CD1   . LEU B 2 130 ? -6.235  -20.707 -17.746 1.00 57.53 ? 129 LEU B CD1   1 
ATOM   3264 C  CD2   . LEU B 2 130 ? -7.642  -20.557 -15.654 1.00 56.20 ? 129 LEU B CD2   1 
ATOM   3265 N  N     . MET B 2 131 ? -3.840  -17.663 -14.882 1.00 57.40 ? 130 MET B N     1 
ATOM   3266 C  CA    . MET B 2 131 ? -3.745  -16.210 -14.743 1.00 57.56 ? 130 MET B CA    1 
ATOM   3267 C  C     . MET B 2 131 ? -2.435  -15.678 -15.322 1.00 57.10 ? 130 MET B C     1 
ATOM   3268 O  O     . MET B 2 131 ? -2.446  -14.718 -16.079 1.00 57.38 ? 130 MET B O     1 
ATOM   3269 C  CB    . MET B 2 131 ? -3.860  -15.793 -13.267 1.00 57.54 ? 130 MET B CB    1 
ATOM   3270 C  CG    . MET B 2 131 ? -5.245  -16.038 -12.642 1.00 58.09 ? 130 MET B CG    1 
ATOM   3271 S  SD    . MET B 2 131 ? -5.372  -15.532 -10.900 1.00 58.78 ? 130 MET B SD    1 
ATOM   3272 C  CE    . MET B 2 131 ? -4.186  -16.614 -10.092 1.00 56.57 ? 130 MET B CE    1 
ATOM   3273 N  N     . LYS B 2 132 ? -1.314  -16.302 -14.981 1.00 56.54 ? 131 LYS B N     1 
ATOM   3274 C  CA    . LYS B 2 132 ? -0.002  -15.758 -15.351 1.00 56.44 ? 131 LYS B CA    1 
ATOM   3275 C  C     . LYS B 2 132 ? 0.147   -15.542 -16.849 1.00 56.33 ? 131 LYS B C     1 
ATOM   3276 O  O     . LYS B 2 132 ? 0.595   -14.487 -17.293 1.00 56.44 ? 131 LYS B O     1 
ATOM   3277 C  CB    . LYS B 2 132 ? 1.125   -16.673 -14.849 1.00 56.45 ? 131 LYS B CB    1 
ATOM   3278 C  CG    . LYS B 2 132 ? 2.500   -16.456 -15.491 1.00 56.52 ? 131 LYS B CG    1 
ATOM   3279 C  CD    . LYS B 2 132 ? 3.625   -16.849 -14.516 1.00 57.29 ? 131 LYS B CD    1 
ATOM   3280 C  CE    . LYS B 2 132 ? 4.913   -17.274 -15.223 1.00 57.33 ? 131 LYS B CE    1 
ATOM   3281 N  NZ    . LYS B 2 132 ? 5.931   -17.803 -14.278 1.00 57.47 ? 131 LYS B NZ    1 
ATOM   3282 N  N     . TYR B 2 133 ? -0.220  -16.545 -17.630 1.00 56.07 ? 132 TYR B N     1 
ATOM   3283 C  CA    . TYR B 2 133 ? 0.075   -16.512 -19.050 1.00 56.00 ? 132 TYR B CA    1 
ATOM   3284 C  C     . TYR B 2 133 ? -1.037  -15.856 -19.865 1.00 55.76 ? 132 TYR B C     1 
ATOM   3285 O  O     . TYR B 2 133 ? -0.822  -15.508 -21.011 1.00 55.66 ? 132 TYR B O     1 
ATOM   3286 C  CB    . TYR B 2 133 ? 0.391   -17.924 -19.546 1.00 56.19 ? 132 TYR B CB    1 
ATOM   3287 C  CG    . TYR B 2 133 ? 1.752   -18.413 -19.086 1.00 56.82 ? 132 TYR B CG    1 
ATOM   3288 C  CD1   . TYR B 2 133 ? 2.918   -17.871 -19.618 1.00 56.98 ? 132 TYR B CD1   1 
ATOM   3289 C  CD2   . TYR B 2 133 ? 1.881   -19.403 -18.107 1.00 57.74 ? 132 TYR B CD2   1 
ATOM   3290 C  CE1   . TYR B 2 133 ? 4.173   -18.297 -19.199 1.00 57.44 ? 132 TYR B CE1   1 
ATOM   3291 C  CE2   . TYR B 2 133 ? 3.146   -19.848 -17.681 1.00 57.12 ? 132 TYR B CE2   1 
ATOM   3292 C  CZ    . TYR B 2 133 ? 4.286   -19.291 -18.238 1.00 57.38 ? 132 TYR B CZ    1 
ATOM   3293 O  OH    . TYR B 2 133 ? 5.547   -19.704 -17.842 1.00 57.34 ? 132 TYR B OH    1 
ATOM   3294 N  N     . ASP B 2 134 ? -2.206  -15.659 -19.258 1.00 55.63 ? 133 ASP B N     1 
ATOM   3295 C  CA    . ASP B 2 134 ? -3.388  -15.191 -19.974 1.00 55.55 ? 133 ASP B CA    1 
ATOM   3296 C  C     . ASP B 2 134 ? -3.904  -13.804 -19.506 1.00 55.91 ? 133 ASP B C     1 
ATOM   3297 O  O     . ASP B 2 134 ? -3.644  -12.781 -20.159 1.00 56.07 ? 133 ASP B O     1 
ATOM   3298 C  CB    . ASP B 2 134 ? -4.492  -16.252 -19.864 1.00 55.29 ? 133 ASP B CB    1 
ATOM   3299 C  CG    . ASP B 2 134 ? -5.657  -15.992 -20.805 1.00 54.70 ? 133 ASP B CG    1 
ATOM   3300 O  OD1   . ASP B 2 134 ? -5.449  -15.943 -22.041 1.00 53.75 ? 133 ASP B OD1   1 
ATOM   3301 O  OD2   . ASP B 2 134 ? -6.794  -15.846 -20.309 1.00 54.78 ? 133 ASP B OD2   1 
ATOM   3302 N  N     . SER B 2 135 ? -4.634  -13.759 -18.396 1.00 55.80 ? 134 SER B N     1 
ATOM   3303 C  CA    . SER B 2 135 ? -5.291  -12.525 -18.003 1.00 56.39 ? 134 SER B CA    1 
ATOM   3304 C  C     . SER B 2 135 ? -4.314  -11.478 -17.439 1.00 56.18 ? 134 SER B C     1 
ATOM   3305 O  O     . SER B 2 135 ? -4.444  -10.291 -17.743 1.00 56.14 ? 134 SER B O     1 
ATOM   3306 C  CB    . SER B 2 135 ? -6.459  -12.804 -17.044 1.00 56.57 ? 134 SER B CB    1 
ATOM   3307 O  OG    . SER B 2 135 ? -6.194  -13.909 -16.212 1.00 58.19 ? 134 SER B OG    1 
ATOM   3308 N  N     . TYR B 2 136 ? -3.348  -11.929 -16.636 1.00 55.91 ? 135 TYR B N     1 
ATOM   3309 C  CA    . TYR B 2 136 ? -2.240  -11.092 -16.155 1.00 55.46 ? 135 TYR B CA    1 
ATOM   3310 C  C     . TYR B 2 136 ? -1.479  -10.468 -17.314 1.00 55.41 ? 135 TYR B C     1 
ATOM   3311 O  O     . TYR B 2 136 ? -1.050  -9.317  -17.247 1.00 55.74 ? 135 TYR B O     1 
ATOM   3312 C  CB    . TYR B 2 136 ? -1.272  -11.940 -15.324 1.00 55.26 ? 135 TYR B CB    1 
ATOM   3313 C  CG    . TYR B 2 136 ? 0.008   -11.252 -14.876 1.00 54.74 ? 135 TYR B CG    1 
ATOM   3314 C  CD1   . TYR B 2 136 ? -0.011  -10.266 -13.890 1.00 55.01 ? 135 TYR B CD1   1 
ATOM   3315 C  CD2   . TYR B 2 136 ? 1.239   -11.619 -15.406 1.00 53.77 ? 135 TYR B CD2   1 
ATOM   3316 C  CE1   . TYR B 2 136 ? 1.162   -9.645  -13.463 1.00 54.67 ? 135 TYR B CE1   1 
ATOM   3317 C  CE2   . TYR B 2 136 ? 2.414   -11.007 -14.986 1.00 54.10 ? 135 TYR B CE2   1 
ATOM   3318 C  CZ    . TYR B 2 136 ? 2.368   -10.022 -14.018 1.00 54.59 ? 135 TYR B CZ    1 
ATOM   3319 O  OH    . TYR B 2 136 ? 3.524   -9.413  -13.607 1.00 54.42 ? 135 TYR B OH    1 
ATOM   3320 N  N     . SER B 2 137 ? -1.304  -11.226 -18.382 1.00 55.07 ? 136 SER B N     1 
ATOM   3321 C  CA    . SER B 2 137 ? -0.604  -10.702 -19.539 1.00 55.05 ? 136 SER B CA    1 
ATOM   3322 C  C     . SER B 2 137 ? -1.346  -9.489  -20.102 1.00 54.90 ? 136 SER B C     1 
ATOM   3323 O  O     . SER B 2 137 ? -0.738  -8.487  -20.454 1.00 54.89 ? 136 SER B O     1 
ATOM   3324 C  CB    . SER B 2 137 ? -0.461  -11.779 -20.608 1.00 54.97 ? 136 SER B CB    1 
ATOM   3325 O  OG    . SER B 2 137 ? 0.545   -11.424 -21.533 1.00 55.48 ? 136 SER B OG    1 
ATOM   3326 N  N     . ARG B 2 138 ? -2.666  -9.589  -20.173 1.00 54.90 ? 137 ARG B N     1 
ATOM   3327 C  CA    . ARG B 2 138 ? -3.496  -8.494  -20.671 1.00 54.71 ? 137 ARG B CA    1 
ATOM   3328 C  C     . ARG B 2 138 ? -3.635  -7.358  -19.665 1.00 54.51 ? 137 ARG B C     1 
ATOM   3329 O  O     . ARG B 2 138 ? -3.777  -6.196  -20.053 1.00 54.39 ? 137 ARG B O     1 
ATOM   3330 C  CB    . ARG B 2 138 ? -4.887  -9.008  -21.053 1.00 54.76 ? 137 ARG B CB    1 
ATOM   3331 C  CG    . ARG B 2 138 ? -4.970  -9.569  -22.452 1.00 54.23 ? 137 ARG B CG    1 
ATOM   3332 C  CD    . ARG B 2 138 ? -6.368  -10.086 -22.747 1.00 54.52 ? 137 ARG B CD    1 
ATOM   3333 N  NE    . ARG B 2 138 ? -6.457  -11.546 -22.673 1.00 54.48 ? 137 ARG B NE    1 
ATOM   3334 C  CZ    . ARG B 2 138 ? -6.984  -12.249 -21.672 1.00 54.85 ? 137 ARG B CZ    1 
ATOM   3335 N  NH1   . ARG B 2 138 ? -7.502  -11.672 -20.612 1.00 55.30 ? 137 ARG B NH1   1 
ATOM   3336 N  NH2   . ARG B 2 138 ? -7.003  -13.557 -21.735 1.00 55.60 ? 137 ARG B NH2   1 
ATOM   3337 N  N     . PHE B 2 139 ? -3.610  -7.702  -18.380 1.00 54.49 ? 138 PHE B N     1 
ATOM   3338 C  CA    . PHE B 2 139 ? -3.657  -6.719  -17.300 1.00 54.63 ? 138 PHE B CA    1 
ATOM   3339 C  C     . PHE B 2 139 ? -2.567  -5.665  -17.463 1.00 55.00 ? 138 PHE B C     1 
ATOM   3340 O  O     . PHE B 2 139 ? -2.843  -4.467  -17.386 1.00 54.66 ? 138 PHE B O     1 
ATOM   3341 C  CB    . PHE B 2 139 ? -3.513  -7.423  -15.952 1.00 54.54 ? 138 PHE B CB    1 
ATOM   3342 C  CG    . PHE B 2 139 ? -3.588  -6.497  -14.764 1.00 54.39 ? 138 PHE B CG    1 
ATOM   3343 C  CD1   . PHE B 2 139 ? -4.691  -5.688  -14.570 1.00 54.14 ? 138 PHE B CD1   1 
ATOM   3344 C  CD2   . PHE B 2 139 ? -2.559  -6.456  -13.831 1.00 53.80 ? 138 PHE B CD2   1 
ATOM   3345 C  CE1   . PHE B 2 139 ? -4.768  -4.842  -13.481 1.00 54.34 ? 138 PHE B CE1   1 
ATOM   3346 C  CE2   . PHE B 2 139 ? -2.625  -5.619  -12.738 1.00 54.22 ? 138 PHE B CE2   1 
ATOM   3347 C  CZ    . PHE B 2 139 ? -3.730  -4.805  -12.560 1.00 54.49 ? 138 PHE B CZ    1 
ATOM   3348 N  N     . LEU B 2 140 ? -1.343  -6.120  -17.732 1.00 55.47 ? 139 LEU B N     1 
ATOM   3349 C  CA    . LEU B 2 140 ? -0.188  -5.230  -17.896 1.00 56.07 ? 139 LEU B CA    1 
ATOM   3350 C  C     . LEU B 2 140 ? -0.288  -4.293  -19.100 1.00 56.76 ? 139 LEU B C     1 
ATOM   3351 O  O     . LEU B 2 140 ? 0.417   -3.286  -19.155 1.00 56.92 ? 139 LEU B O     1 
ATOM   3352 C  CB    . LEU B 2 140 ? 1.112   -6.040  -18.002 1.00 56.06 ? 139 LEU B CB    1 
ATOM   3353 C  CG    . LEU B 2 140 ? 1.444   -7.039  -16.880 1.00 56.47 ? 139 LEU B CG    1 
ATOM   3354 C  CD1   . LEU B 2 140 ? 2.727   -7.826  -17.196 1.00 54.60 ? 139 LEU B CD1   1 
ATOM   3355 C  CD2   . LEU B 2 140 ? 1.525   -6.348  -15.506 1.00 55.81 ? 139 LEU B CD2   1 
ATOM   3356 N  N     . LYS B 2 141 ? -1.142  -4.628  -20.066 1.00 57.81 ? 140 LYS B N     1 
ATOM   3357 C  CA    . LYS B 2 141 ? -1.371  -3.776  -21.239 1.00 58.49 ? 140 LYS B CA    1 
ATOM   3358 C  C     . LYS B 2 141 ? -2.569  -2.831  -21.043 1.00 59.42 ? 140 LYS B C     1 
ATOM   3359 O  O     . LYS B 2 141 ? -2.855  -2.005  -21.910 1.00 59.24 ? 140 LYS B O     1 
ATOM   3360 C  CB    . LYS B 2 141 ? -1.579  -4.642  -22.498 1.00 58.45 ? 140 LYS B CB    1 
ATOM   3361 C  CG    . LYS B 2 141 ? -0.336  -5.403  -22.974 1.00 57.85 ? 140 LYS B CG    1 
ATOM   3362 N  N     . SER B 2 142 ? -3.247  -2.940  -19.898 1.00 60.69 ? 141 SER B N     1 
ATOM   3363 C  CA    . SER B 2 142 ? -4.524  -2.255  -19.674 1.00 61.85 ? 141 SER B CA    1 
ATOM   3364 C  C     . SER B 2 142 ? -4.383  -0.815  -19.192 1.00 62.86 ? 141 SER B C     1 
ATOM   3365 O  O     . SER B 2 142 ? -3.317  -0.402  -18.736 1.00 62.85 ? 141 SER B O     1 
ATOM   3366 C  CB    . SER B 2 142 ? -5.342  -3.020  -18.641 1.00 61.96 ? 141 SER B CB    1 
ATOM   3367 O  OG    . SER B 2 142 ? -4.870  -2.743  -17.334 1.00 62.60 ? 141 SER B OG    1 
ATOM   3368 N  N     . ASP B 2 143 ? -5.483  -0.065  -19.281 1.00 64.22 ? 142 ASP B N     1 
ATOM   3369 C  CA    . ASP B 2 143 ? -5.530  1.311   -18.774 1.00 65.32 ? 142 ASP B CA    1 
ATOM   3370 C  C     . ASP B 2 143 ? -5.435  1.302   -17.243 1.00 66.33 ? 142 ASP B C     1 
ATOM   3371 O  O     . ASP B 2 143 ? -4.694  2.106   -16.665 1.00 66.61 ? 142 ASP B O     1 
ATOM   3372 C  CB    . ASP B 2 143 ? -6.801  2.038   -19.242 1.00 65.25 ? 142 ASP B CB    1 
ATOM   3373 N  N     . LEU B 2 144 ? -6.164  0.379   -16.602 1.00 67.33 ? 143 LEU B N     1 
ATOM   3374 C  CA    . LEU B 2 144 ? -6.081  0.143   -15.138 1.00 68.15 ? 143 LEU B CA    1 
ATOM   3375 C  C     . LEU B 2 144 ? -4.644  0.219   -14.580 1.00 68.51 ? 143 LEU B C     1 
ATOM   3376 O  O     . LEU B 2 144 ? -4.412  0.698   -13.463 1.00 68.44 ? 143 LEU B O     1 
ATOM   3377 C  CB    . LEU B 2 144 ? -6.680  -1.235  -14.774 1.00 68.29 ? 143 LEU B CB    1 
ATOM   3378 C  CG    . LEU B 2 144 ? -8.210  -1.386  -14.680 1.00 68.91 ? 143 LEU B CG    1 
ATOM   3379 C  CD1   . LEU B 2 144 ? -8.834  -1.702  -16.047 1.00 70.04 ? 143 LEU B CD1   1 
ATOM   3380 C  CD2   . LEU B 2 144 ? -8.596  -2.465  -13.666 1.00 68.37 ? 143 LEU B CD2   1 
ATOM   3381 N  N     . PHE B 2 145 ? -3.699  -0.275  -15.374 1.00 68.90 ? 144 PHE B N     1 
ATOM   3382 C  CA    . PHE B 2 145 ? -2.287  -0.327  -15.013 1.00 69.04 ? 144 PHE B CA    1 
ATOM   3383 C  C     . PHE B 2 145 ? -1.532  0.931   -15.477 1.00 68.95 ? 144 PHE B C     1 
ATOM   3384 O  O     . PHE B 2 145 ? -0.776  1.518   -14.711 1.00 68.74 ? 144 PHE B O     1 
ATOM   3385 C  CB    . PHE B 2 145 ? -1.675  -1.599  -15.634 1.00 69.09 ? 144 PHE B CB    1 
ATOM   3386 C  CG    . PHE B 2 145 ? -0.299  -1.913  -15.143 1.00 69.05 ? 144 PHE B CG    1 
ATOM   3387 C  CD1   . PHE B 2 145 ? -0.109  -2.744  -14.052 1.00 68.58 ? 144 PHE B CD1   1 
ATOM   3388 C  CD2   . PHE B 2 145 ? 0.807   -1.365  -15.769 1.00 68.90 ? 144 PHE B CD2   1 
ATOM   3389 C  CE1   . PHE B 2 145 ? 1.162   -3.020  -13.596 1.00 68.68 ? 144 PHE B CE1   1 
ATOM   3390 C  CE2   . PHE B 2 145 ? 2.079   -1.636  -15.322 1.00 68.96 ? 144 PHE B CE2   1 
ATOM   3391 C  CZ    . PHE B 2 145 ? 2.259   -2.467  -14.229 1.00 68.82 ? 144 PHE B CZ    1 
ATOM   3392 N  N     . LEU B 2 146 ? -1.738  1.321   -16.734 1.00 69.15 ? 145 LEU B N     1 
ATOM   3393 C  CA    . LEU B 2 146 ? -1.100  2.507   -17.320 1.00 69.45 ? 145 LEU B CA    1 
ATOM   3394 C  C     . LEU B 2 146 ? -2.052  3.699   -17.297 1.00 69.43 ? 145 LEU B C     1 
ATOM   3395 O  O     . LEU B 2 146 ? -2.221  4.351   -16.270 1.00 69.45 ? 145 LEU B O     1 
ATOM   3396 C  CB    . LEU B 2 146 ? -0.664  2.234   -18.770 1.00 69.58 ? 145 LEU B CB    1 
ATOM   3397 C  CG    . LEU B 2 146 ? 0.748   1.705   -19.055 1.00 69.66 ? 145 LEU B CG    1 
ATOM   3398 C  CD1   . LEU B 2 146 ? 1.185   0.705   -18.018 1.00 69.10 ? 145 LEU B CD1   1 
ATOM   3399 C  CD2   . LEU B 2 146 ? 0.818   1.089   -20.461 1.00 69.55 ? 145 LEU B CD2   1 
HETATM 3400 AL AL    . ALF C 3 .   ? -9.424  -22.303 -24.804 1.00 50.98 ? 354 ALF A AL    1 
HETATM 3401 F  F1    . ALF C 3 .   ? -9.887  -20.709 -25.453 1.00 52.12 ? 354 ALF A F1    1 
HETATM 3402 F  F2    . ALF C 3 .   ? -8.873  -23.905 -24.229 1.00 48.54 ? 354 ALF A F2    1 
HETATM 3403 F  F3    . ALF C 3 .   ? -7.844  -21.585 -24.408 1.00 53.08 ? 354 ALF A F3    1 
HETATM 3404 F  F4    . ALF C 3 .   ? -11.079 -22.914 -25.082 1.00 51.18 ? 354 ALF A F4    1 
HETATM 3405 MG MG    . MG  D 4 .   ? -8.511  -19.582 -26.311 1.00 45.94 ? 355 MG  A MG    1 
HETATM 3406 P  PB    . GDP E 5 .   ? -8.748  -22.277 -27.983 1.00 37.85 ? 356 GDP A PB    1 
HETATM 3407 O  O1B   . GDP E 5 .   ? -8.632  -20.770 -28.006 1.00 34.94 ? 356 GDP A O1B   1 
HETATM 3408 O  O2B   . GDP E 5 .   ? -8.821  -22.863 -26.593 1.00 34.45 ? 356 GDP A O2B   1 
HETATM 3409 O  O3B   . GDP E 5 .   ? -9.994  -22.650 -28.746 1.00 37.56 ? 356 GDP A O3B   1 
HETATM 3410 O  O3A   . GDP E 5 .   ? -7.525  -22.985 -28.749 1.00 38.91 ? 356 GDP A O3A   1 
HETATM 3411 P  PA    . GDP E 5 .   ? -6.205  -22.189 -29.175 1.00 38.68 ? 356 GDP A PA    1 
HETATM 3412 O  O1A   . GDP E 5 .   ? -5.528  -21.806 -27.882 1.00 40.18 ? 356 GDP A O1A   1 
HETATM 3413 O  O2A   . GDP E 5 .   ? -6.503  -21.032 -30.097 1.00 37.16 ? 356 GDP A O2A   1 
HETATM 3414 O  "O5'" . GDP E 5 .   ? -5.306  -23.249 -29.957 1.00 39.58 ? 356 GDP A "O5'" 1 
HETATM 3415 C  "C5'" . GDP E 5 .   ? -4.924  -24.458 -29.313 1.00 40.78 ? 356 GDP A "C5'" 1 
HETATM 3416 C  "C4'" . GDP E 5 .   ? -3.574  -24.907 -29.844 1.00 41.33 ? 356 GDP A "C4'" 1 
HETATM 3417 O  "O4'" . GDP E 5 .   ? -3.729  -25.506 -31.135 1.00 41.68 ? 356 GDP A "O4'" 1 
HETATM 3418 C  "C3'" . GDP E 5 .   ? -2.604  -23.751 -30.006 1.00 41.62 ? 356 GDP A "C3'" 1 
HETATM 3419 O  "O3'" . GDP E 5 .   ? -1.284  -24.186 -29.664 1.00 42.21 ? 356 GDP A "O3'" 1 
HETATM 3420 C  "C2'" . GDP E 5 .   ? -2.679  -23.412 -31.474 1.00 42.43 ? 356 GDP A "C2'" 1 
HETATM 3421 O  "O2'" . GDP E 5 .   ? -1.455  -22.884 -31.991 1.00 43.51 ? 356 GDP A "O2'" 1 
HETATM 3422 C  "C1'" . GDP E 5 .   ? -2.986  -24.758 -32.100 1.00 43.07 ? 356 GDP A "C1'" 1 
HETATM 3423 N  N9    . GDP E 5 .   ? -3.812  -24.684 -33.318 1.00 43.00 ? 356 GDP A N9    1 
HETATM 3424 C  C8    . GDP E 5 .   ? -4.977  -24.045 -33.447 1.00 43.12 ? 356 GDP A C8    1 
HETATM 3425 N  N7    . GDP E 5 .   ? -5.469  -24.209 -34.694 1.00 43.21 ? 356 GDP A N7    1 
HETATM 3426 C  C5    . GDP E 5 .   ? -4.623  -24.985 -35.363 1.00 42.85 ? 356 GDP A C5    1 
HETATM 3427 C  C6    . GDP E 5 .   ? -4.563  -25.550 -36.715 1.00 43.55 ? 356 GDP A C6    1 
HETATM 3428 O  O6    . GDP E 5 .   ? -5.465  -25.318 -37.534 1.00 43.69 ? 356 GDP A O6    1 
HETATM 3429 N  N1    . GDP E 5 .   ? -3.506  -26.308 -37.033 1.00 44.20 ? 356 GDP A N1    1 
HETATM 3430 C  C2    . GDP E 5 .   ? -2.511  -26.564 -36.146 1.00 43.50 ? 356 GDP A C2    1 
HETATM 3431 N  N2    . GDP E 5 .   ? -1.471  -27.338 -36.532 1.00 43.60 ? 356 GDP A N2    1 
HETATM 3432 N  N3    . GDP E 5 .   ? -2.508  -26.077 -34.882 1.00 42.43 ? 356 GDP A N3    1 
HETATM 3433 C  C4    . GDP E 5 .   ? -3.522  -25.296 -34.455 1.00 42.72 ? 356 GDP A C4    1 
HETATM 3434 O  O     . HOH F 6 .   ? 2.075   -22.282 -20.847 1.00 45.86 ? 357 HOH A O     1 
HETATM 3435 O  O     . HOH F 6 .   ? -10.022 -21.840 -22.967 1.00 41.97 ? 358 HOH A O     1 
HETATM 3436 O  O     . HOH F 6 .   ? -10.063 -18.623 -26.639 1.00 44.66 ? 359 HOH A O     1 
HETATM 3437 O  O     . HOH F 6 .   ? -6.691  -19.958 -26.032 1.00 41.42 ? 360 HOH A O     1 
HETATM 3438 O  O     . HOH F 6 .   ? -6.149  -17.196 -24.308 1.00 54.33 ? 361 HOH A O     1 
HETATM 3439 O  O     . HOH F 6 .   ? -1.363  -11.954 -29.108 1.00 57.52 ? 362 HOH A O     1 
HETATM 3440 O  O     . HOH F 6 .   ? 18.541  -41.208 -26.862 1.00 47.54 ? 363 HOH A O     1 
HETATM 3441 O  O     . HOH F 6 .   ? 13.106  -17.084 -34.843 1.00 44.07 ? 364 HOH A O     1 
HETATM 3442 O  O     . HOH F 6 .   ? 15.294  -15.776 -34.050 1.00 37.70 ? 365 HOH A O     1 
HETATM 3443 O  O     . HOH F 6 .   ? -0.939  -10.968 -43.998 1.00 59.10 ? 366 HOH A O     1 
HETATM 3444 O  O     . HOH F 6 .   ? -7.250  -14.718 -26.132 1.00 51.16 ? 367 HOH A O     1 
HETATM 3445 O  O     . HOH F 6 .   ? 9.542   -13.566 -23.303 1.00 42.74 ? 368 HOH A O     1 
HETATM 3446 O  O     . HOH F 6 .   ? 13.587  -25.718 -12.088 1.00 64.90 ? 369 HOH A O     1 
HETATM 3447 O  O     . HOH F 6 .   ? 13.704  -46.704 -18.912 1.00 62.23 ? 370 HOH A O     1 
HETATM 3448 O  O     . HOH F 6 .   ? 1.925   -30.204 -23.300 1.00 47.45 ? 371 HOH A O     1 
HETATM 3449 O  O     . HOH G 6 .   ? 2.152   -12.520 -23.844 1.00 40.57 ? 153 HOH B O     1 
HETATM 3450 O  O     . HOH G 6 .   ? -11.566 -20.211 -14.178 1.00 48.00 ? 154 HOH B O     1 
HETATM 3451 O  O     . HOH G 6 .   ? 5.132   -14.559 -12.959 1.00 65.56 ? 155 HOH B O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   LYS 1   32  ?   ?   ?   A . n 
A 1 2   GLU 2   33  33  GLU GLU A . n 
A 1 3   VAL 3   34  34  VAL VAL A . n 
A 1 4   LYS 4   35  35  LYS LYS A . n 
A 1 5   LEU 5   36  36  LEU LEU A . n 
A 1 6   LEU 6   37  37  LEU LEU A . n 
A 1 7   LEU 7   38  38  LEU LEU A . n 
A 1 8   LEU 8   39  39  LEU LEU A . n 
A 1 9   GLY 9   40  40  GLY GLY A . n 
A 1 10  ALA 10  41  41  ALA ALA A . n 
A 1 11  GLY 11  42  42  GLY GLY A . n 
A 1 12  GLU 12  43  43  GLU GLU A . n 
A 1 13  SER 13  44  44  SER SER A . n 
A 1 14  GLY 14  45  45  GLY GLY A . n 
A 1 15  LYS 15  46  46  LYS LYS A . n 
A 1 16  SER 16  47  47  SER SER A . n 
A 1 17  THR 17  48  48  THR THR A . n 
A 1 18  ILE 18  49  49  ILE ILE A . n 
A 1 19  VAL 19  50  50  VAL VAL A . n 
A 1 20  LYS 20  51  51  LYS LYS A . n 
A 1 21  GLN 21  52  52  GLN GLN A . n 
A 1 22  MET 22  53  53  MET MET A . n 
A 1 23  LYS 23  54  54  LYS LYS A . n 
A 1 24  ILE 24  55  55  ILE ILE A . n 
A 1 25  ILE 25  56  56  ILE ILE A . n 
A 1 26  HIS 26  57  57  HIS HIS A . n 
A 1 27  GLU 27  58  58  GLU GLU A . n 
A 1 28  ASP 28  59  59  ASP ASP A . n 
A 1 29  GLY 29  60  60  GLY GLY A . n 
A 1 30  TYR 30  61  61  TYR TYR A . n 
A 1 31  SER 31  62  62  SER SER A . n 
A 1 32  GLU 32  63  63  GLU GLU A . n 
A 1 33  ASP 33  64  64  ASP ASP A . n 
A 1 34  GLU 34  65  65  GLU GLU A . n 
A 1 35  CYS 35  66  66  CYS CYS A . n 
A 1 36  LYS 36  67  67  LYS LYS A . n 
A 1 37  GLN 37  68  68  GLN GLN A . n 
A 1 38  TYR 38  69  69  TYR TYR A . n 
A 1 39  LYS 39  70  70  LYS LYS A . n 
A 1 40  VAL 40  71  71  VAL VAL A . n 
A 1 41  VAL 41  72  72  VAL VAL A . n 
A 1 42  VAL 42  73  73  VAL VAL A . n 
A 1 43  TYR 43  74  74  TYR TYR A . n 
A 1 44  SER 44  75  75  SER SER A . n 
A 1 45  ASN 45  76  76  ASN ASN A . n 
A 1 46  THR 46  77  77  THR THR A . n 
A 1 47  ILE 47  78  78  ILE ILE A . n 
A 1 48  GLN 48  79  79  GLN GLN A . n 
A 1 49  SER 49  80  80  SER SER A . n 
A 1 50  ILE 50  81  81  ILE ILE A . n 
A 1 51  ILE 51  82  82  ILE ILE A . n 
A 1 52  ALA 52  83  83  ALA ALA A . n 
A 1 53  ILE 53  84  84  ILE ILE A . n 
A 1 54  ILE 54  85  85  ILE ILE A . n 
A 1 55  ARG 55  86  86  ARG ARG A . n 
A 1 56  ALA 56  87  87  ALA ALA A . n 
A 1 57  MET 57  88  88  MET MET A . n 
A 1 58  GLY 58  89  89  GLY GLY A . n 
A 1 59  ARG 59  90  90  ARG ARG A . n 
A 1 60  LEU 60  91  91  LEU LEU A . n 
A 1 61  LYS 61  92  92  LYS LYS A . n 
A 1 62  ILE 62  93  93  ILE ILE A . n 
A 1 63  ASP 63  94  94  ASP ASP A . n 
A 1 64  PHE 64  95  95  PHE PHE A . n 
A 1 65  GLY 65  96  96  GLY GLY A . n 
A 1 66  GLU 66  97  97  GLU GLU A . n 
A 1 67  ALA 67  98  98  ALA ALA A . n 
A 1 68  ALA 68  99  99  ALA ALA A . n 
A 1 69  ARG 69  100 100 ARG ARG A . n 
A 1 70  ALA 70  101 101 ALA ALA A . n 
A 1 71  ASP 71  102 102 ASP ASP A . n 
A 1 72  ASP 72  103 103 ASP ASP A . n 
A 1 73  ALA 73  104 104 ALA ALA A . n 
A 1 74  ARG 74  105 105 ARG ARG A . n 
A 1 75  GLN 75  106 106 GLN GLN A . n 
A 1 76  LEU 76  107 107 LEU LEU A . n 
A 1 77  PHE 77  108 108 PHE PHE A . n 
A 1 78  VAL 78  109 109 VAL VAL A . n 
A 1 79  LEU 79  110 110 LEU LEU A . n 
A 1 80  ALA 80  111 111 ALA ALA A . n 
A 1 81  GLY 81  112 112 GLY GLY A . n 
A 1 82  SER 82  113 113 SER SER A . n 
A 1 83  ALA 83  114 114 ALA ALA A . n 
A 1 84  GLU 84  115 115 GLU GLU A . n 
A 1 85  GLU 85  116 116 GLU GLU A . n 
A 1 86  GLY 86  117 117 GLY GLY A . n 
A 1 87  VAL 87  118 118 VAL VAL A . n 
A 1 88  MET 88  119 119 MET MET A . n 
A 1 89  THR 89  120 120 THR THR A . n 
A 1 90  PRO 90  121 121 PRO PRO A . n 
A 1 91  GLU 91  122 122 GLU GLU A . n 
A 1 92  LEU 92  123 123 LEU LEU A . n 
A 1 93  ALA 93  124 124 ALA ALA A . n 
A 1 94  GLY 94  125 125 GLY GLY A . n 
A 1 95  VAL 95  126 126 VAL VAL A . n 
A 1 96  ILE 96  127 127 ILE ILE A . n 
A 1 97  LYS 97  128 128 LYS LYS A . n 
A 1 98  ARG 98  129 129 ARG ARG A . n 
A 1 99  LEU 99  130 130 LEU LEU A . n 
A 1 100 TRP 100 131 131 TRP TRP A . n 
A 1 101 ARG 101 132 132 ARG ARG A . n 
A 1 102 ASP 102 133 133 ASP ASP A . n 
A 1 103 GLY 103 134 134 GLY GLY A . n 
A 1 104 GLY 104 135 135 GLY GLY A . n 
A 1 105 VAL 105 136 136 VAL VAL A . n 
A 1 106 GLN 106 137 137 GLN GLN A . n 
A 1 107 ALA 107 138 138 ALA ALA A . n 
A 1 108 CYS 108 139 139 CYS CYS A . n 
A 1 109 PHE 109 140 140 PHE PHE A . n 
A 1 110 SER 110 141 141 SER SER A . n 
A 1 111 ARG 111 142 142 ARG ARG A . n 
A 1 112 SER 112 143 143 SER SER A . n 
A 1 113 ARG 113 144 144 ARG ARG A . n 
A 1 114 GLU 114 145 145 GLU GLU A . n 
A 1 115 TYR 115 146 146 TYR TYR A . n 
A 1 116 GLN 116 147 147 GLN GLN A . n 
A 1 117 LEU 117 148 148 LEU LEU A . n 
A 1 118 ASN 118 149 149 ASN ASN A . n 
A 1 119 ASP 119 150 150 ASP ASP A . n 
A 1 120 SER 120 151 151 SER SER A . n 
A 1 121 ALA 121 152 152 ALA ALA A . n 
A 1 122 SER 122 153 153 SER SER A . n 
A 1 123 TYR 123 154 154 TYR TYR A . n 
A 1 124 TYR 124 155 155 TYR TYR A . n 
A 1 125 LEU 125 156 156 LEU LEU A . n 
A 1 126 ASN 126 157 157 ASN ASN A . n 
A 1 127 ASP 127 158 158 ASP ASP A . n 
A 1 128 LEU 128 159 159 LEU LEU A . n 
A 1 129 ASP 129 160 160 ASP ASP A . n 
A 1 130 ARG 130 161 161 ARG ARG A . n 
A 1 131 ILE 131 162 162 ILE ILE A . n 
A 1 132 SER 132 163 163 SER SER A . n 
A 1 133 GLN 133 164 164 GLN GLN A . n 
A 1 134 SER 134 165 165 SER SER A . n 
A 1 135 ASN 135 166 166 ASN ASN A . n 
A 1 136 TYR 136 167 167 TYR TYR A . n 
A 1 137 ILE 137 168 168 ILE ILE A . n 
A 1 138 PRO 138 169 169 PRO PRO A . n 
A 1 139 THR 139 170 170 THR THR A . n 
A 1 140 GLN 140 171 171 GLN GLN A . n 
A 1 141 GLN 141 172 172 GLN GLN A . n 
A 1 142 ASP 142 173 173 ASP ASP A . n 
A 1 143 VAL 143 174 174 VAL VAL A . n 
A 1 144 LEU 144 175 175 LEU LEU A . n 
A 1 145 ARG 145 176 176 ARG ARG A . n 
A 1 146 THR 146 177 177 THR THR A . n 
A 1 147 ARG 147 178 178 ARG ARG A . n 
A 1 148 VAL 148 179 179 VAL VAL A . n 
A 1 149 LYS 149 180 180 LYS LYS A . n 
A 1 150 THR 150 181 181 THR THR A . n 
A 1 151 THR 151 182 182 THR THR A . n 
A 1 152 GLY 152 183 183 GLY GLY A . n 
A 1 153 ILE 153 184 184 ILE ILE A . n 
A 1 154 VAL 154 185 185 VAL VAL A . n 
A 1 155 GLU 155 186 186 GLU GLU A . n 
A 1 156 THR 156 187 187 THR THR A . n 
A 1 157 HIS 157 188 188 HIS HIS A . n 
A 1 158 PHE 158 189 189 PHE PHE A . n 
A 1 159 THR 159 190 190 THR THR A . n 
A 1 160 PHE 160 191 191 PHE PHE A . n 
A 1 161 LYS 161 192 192 LYS LYS A . n 
A 1 162 ASP 162 193 193 ASP ASP A . n 
A 1 163 LEU 163 194 194 LEU LEU A . n 
A 1 164 TYR 164 195 195 TYR TYR A . n 
A 1 165 PHE 165 196 196 PHE PHE A . n 
A 1 166 LYS 166 197 197 LYS LYS A . n 
A 1 167 MET 167 198 198 MET MET A . n 
A 1 168 PHE 168 199 199 PHE PHE A . n 
A 1 169 ASP 169 200 200 ASP ASP A . n 
A 1 170 VAL 170 201 201 VAL VAL A . n 
A 1 171 GLY 171 202 202 GLY GLY A . n 
A 1 172 GLY 172 203 203 GLY GLY A . n 
A 1 173 GLN 173 204 204 GLN GLN A . n 
A 1 174 ARG 174 205 205 ARG ARG A . n 
A 1 175 SER 175 206 206 SER SER A . n 
A 1 176 GLU 176 207 207 GLU GLU A . n 
A 1 177 ARG 177 208 208 ARG ARG A . n 
A 1 178 LYS 178 209 209 LYS LYS A . n 
A 1 179 LYS 179 210 210 LYS LYS A . n 
A 1 180 TRP 180 211 211 TRP TRP A . n 
A 1 181 ILE 181 212 212 ILE ILE A . n 
A 1 182 HIS 182 213 213 HIS HIS A . n 
A 1 183 CYS 183 214 214 CYS CYS A . n 
A 1 184 PHE 184 215 215 PHE PHE A . n 
A 1 185 GLU 185 216 216 GLU GLU A . n 
A 1 186 GLY 186 217 217 GLY GLY A . n 
A 1 187 VAL 187 218 218 VAL VAL A . n 
A 1 188 THR 188 219 219 THR THR A . n 
A 1 189 ALA 189 220 220 ALA ALA A . n 
A 1 190 ILE 190 221 221 ILE ILE A . n 
A 1 191 ILE 191 222 222 ILE ILE A . n 
A 1 192 PHE 192 223 223 PHE PHE A . n 
A 1 193 CYS 193 224 224 CYS CYS A . n 
A 1 194 VAL 194 225 225 VAL VAL A . n 
A 1 195 ALA 195 226 226 ALA ALA A . n 
A 1 196 LEU 196 227 227 LEU LEU A . n 
A 1 197 SER 197 228 228 SER SER A . n 
A 1 198 ASP 198 229 229 ASP ASP A . n 
A 1 199 TYR 199 230 230 TYR TYR A . n 
A 1 200 ASP 200 231 231 ASP ASP A . n 
A 1 201 LEU 201 232 232 LEU LEU A . n 
A 1 202 VAL 202 233 233 VAL VAL A . n 
A 1 203 LEU 203 234 234 LEU LEU A . n 
A 1 204 ALA 204 235 235 ALA ALA A . n 
A 1 205 GLU 205 236 236 GLU GLU A . n 
A 1 206 ASP 206 237 237 ASP ASP A . n 
A 1 207 GLU 207 238 238 GLU GLU A . n 
A 1 208 GLU 208 239 239 GLU GLU A . n 
A 1 209 MET 209 240 240 MET MET A . n 
A 1 210 ASN 210 241 241 ASN ASN A . n 
A 1 211 ARG 211 242 242 ARG ARG A . n 
A 1 212 MET 212 243 243 MET MET A . n 
A 1 213 HIS 213 244 244 HIS HIS A . n 
A 1 214 GLU 214 245 245 GLU GLU A . n 
A 1 215 SER 215 246 246 SER SER A . n 
A 1 216 MET 216 247 247 MET MET A . n 
A 1 217 LYS 217 248 248 LYS LYS A . n 
A 1 218 LEU 218 249 249 LEU LEU A . n 
A 1 219 PHE 219 250 250 PHE PHE A . n 
A 1 220 ASP 220 251 251 ASP ASP A . n 
A 1 221 SER 221 252 252 SER SER A . n 
A 1 222 ILE 222 253 253 ILE ILE A . n 
A 1 223 CYS 223 254 254 CYS CYS A . n 
A 1 224 ASN 224 255 255 ASN ASN A . n 
A 1 225 ASN 225 256 256 ASN ASN A . n 
A 1 226 LYS 226 257 257 LYS LYS A . n 
A 1 227 TRP 227 258 258 TRP TRP A . n 
A 1 228 PHE 228 259 259 PHE PHE A . n 
A 1 229 THR 229 260 260 THR THR A . n 
A 1 230 GLU 230 261 261 GLU GLU A . n 
A 1 231 THR 231 262 262 THR THR A . n 
A 1 232 SER 232 263 263 SER SER A . n 
A 1 233 ILE 233 264 264 ILE ILE A . n 
A 1 234 ILE 234 265 265 ILE ILE A . n 
A 1 235 LEU 235 266 266 LEU LEU A . n 
A 1 236 PHE 236 267 267 PHE PHE A . n 
A 1 237 LEU 237 268 268 LEU LEU A . n 
A 1 238 ASN 238 269 269 ASN ASN A . n 
A 1 239 LYS 239 270 270 LYS LYS A . n 
A 1 240 LYS 240 271 271 LYS LYS A . n 
A 1 241 ASP 241 272 272 ASP ASP A . n 
A 1 242 LEU 242 273 273 LEU LEU A . n 
A 1 243 PHE 243 274 274 PHE PHE A . n 
A 1 244 GLU 244 275 275 GLU GLU A . n 
A 1 245 GLU 245 276 276 GLU GLU A . n 
A 1 246 LYS 246 277 277 LYS LYS A . n 
A 1 247 ILE 247 278 278 ILE ILE A . n 
A 1 248 LYS 248 279 279 LYS LYS A . n 
A 1 249 ARG 249 280 280 ARG ARG A . n 
A 1 250 SER 250 281 281 SER SER A . n 
A 1 251 PRO 251 282 282 PRO PRO A . n 
A 1 252 LEU 252 283 283 LEU LEU A . n 
A 1 253 THR 253 284 284 THR THR A . n 
A 1 254 ILE 254 285 285 ILE ILE A . n 
A 1 255 CYS 255 286 286 CYS CYS A . n 
A 1 256 TYR 256 287 287 TYR TYR A . n 
A 1 257 PRO 257 288 288 PRO PRO A . n 
A 1 258 GLU 258 289 289 GLU GLU A . n 
A 1 259 TYR 259 290 290 TYR TYR A . n 
A 1 260 THR 260 291 291 THR THR A . n 
A 1 261 GLY 261 292 292 GLY GLY A . n 
A 1 262 SER 262 293 293 SER SER A . n 
A 1 263 ASN 263 294 294 ASN ASN A . n 
A 1 264 THR 264 295 295 THR THR A . n 
A 1 265 TYR 265 296 296 TYR TYR A . n 
A 1 266 GLU 266 297 297 GLU GLU A . n 
A 1 267 GLU 267 298 298 GLU GLU A . n 
A 1 268 ALA 268 299 299 ALA ALA A . n 
A 1 269 ALA 269 300 300 ALA ALA A . n 
A 1 270 ALA 270 301 301 ALA ALA A . n 
A 1 271 TYR 271 302 302 TYR TYR A . n 
A 1 272 ILE 272 303 303 ILE ILE A . n 
A 1 273 GLN 273 304 304 GLN GLN A . n 
A 1 274 CYS 274 305 305 CYS CYS A . n 
A 1 275 GLN 275 306 306 GLN GLN A . n 
A 1 276 PHE 276 307 307 PHE PHE A . n 
A 1 277 GLU 277 308 308 GLU GLU A . n 
A 1 278 ASP 278 309 309 ASP ASP A . n 
A 1 279 LEU 279 310 310 LEU LEU A . n 
A 1 280 ASN 280 311 311 ASN ASN A . n 
A 1 281 ARG 281 312 312 ARG ARG A . n 
A 1 282 ARG 282 313 313 ARG ARG A . n 
A 1 283 LYS 283 314 314 LYS LYS A . n 
A 1 284 ASP 284 315 315 ASP ASP A . n 
A 1 285 THR 285 316 316 THR THR A . n 
A 1 286 LYS 286 317 317 LYS LYS A . n 
A 1 287 GLU 287 318 318 GLU GLU A . n 
A 1 288 ILE 288 319 319 ILE ILE A . n 
A 1 289 TYR 289 320 320 TYR TYR A . n 
A 1 290 THR 290 321 321 THR THR A . n 
A 1 291 HIS 291 322 322 HIS HIS A . n 
A 1 292 PHE 292 323 323 PHE PHE A . n 
A 1 293 THR 293 324 324 THR THR A . n 
A 1 294 CYS 294 325 325 CYS CYS A . n 
A 1 295 ALA 295 326 326 ALA ALA A . n 
A 1 296 THR 296 327 327 THR THR A . n 
A 1 297 ASP 297 328 328 ASP ASP A . n 
A 1 298 THR 298 329 329 THR THR A . n 
A 1 299 LYS 299 330 330 LYS LYS A . n 
A 1 300 ASN 300 331 331 ASN ASN A . n 
A 1 301 VAL 301 332 332 VAL VAL A . n 
A 1 302 GLN 302 333 333 GLN GLN A . n 
A 1 303 PHE 303 334 334 PHE PHE A . n 
A 1 304 VAL 304 335 335 VAL VAL A . n 
A 1 305 PHE 305 336 336 PHE PHE A . n 
A 1 306 ASP 306 337 337 ASP ASP A . n 
A 1 307 ALA 307 338 338 ALA ALA A . n 
A 1 308 VAL 308 339 339 VAL VAL A . n 
A 1 309 THR 309 340 340 THR THR A . n 
A 1 310 ASP 310 341 341 ASP ASP A . n 
A 1 311 VAL 311 342 342 VAL VAL A . n 
A 1 312 ILE 312 343 343 ILE ILE A . n 
A 1 313 ILE 313 344 344 ILE ILE A . n 
A 1 314 LYS 314 345 345 LYS LYS A . n 
A 1 315 ASN 315 346 346 ASN ASN A . n 
A 1 316 ASN 316 347 347 ASN ASN A . n 
A 1 317 LEU 317 348 348 LEU LEU A . n 
A 1 318 LYS 318 349 349 LYS LYS A . n 
A 1 319 GLU 319 350 ?   ?   ?   A . n 
A 1 320 CYS 320 351 ?   ?   ?   A . n 
A 1 321 GLY 321 352 ?   ?   ?   A . n 
A 1 322 LEU 322 353 ?   ?   ?   A . n 
A 1 323 TYR 323 354 ?   ?   ?   A . n 
B 2 1   SER 1   0   ?   ?   ?   B . n 
B 2 2   MET 2   1   ?   ?   ?   B . n 
B 2 3   SER 3   2   ?   ?   ?   B . n 
B 2 4   ARG 4   3   ?   ?   ?   B . n 
B 2 5   LYS 5   4   ?   ?   ?   B . n 
B 2 6   ARG 6   5   ?   ?   ?   B . n 
B 2 7   PRO 7   6   ?   ?   ?   B . n 
B 2 8   PRO 8   7   ?   ?   ?   B . n 
B 2 9   SER 9   8   ?   ?   ?   B . n 
B 2 10  ASP 10  9   ?   ?   ?   B . n 
B 2 11  ILE 11  10  ?   ?   ?   B . n 
B 2 12  HIS 12  11  ?   ?   ?   B . n 
B 2 13  ASP 13  12  ?   ?   ?   B . n 
B 2 14  SER 14  13  ?   ?   ?   B . n 
B 2 15  ASP 15  14  ?   ?   ?   B . n 
B 2 16  GLY 16  15  ?   ?   ?   B . n 
B 2 17  SER 17  16  ?   ?   ?   B . n 
B 2 18  SER 18  17  ?   ?   ?   B . n 
B 2 19  SER 19  18  ?   ?   ?   B . n 
B 2 20  SER 20  19  ?   ?   ?   B . n 
B 2 21  SER 21  20  ?   ?   ?   B . n 
B 2 22  HIS 22  21  ?   ?   ?   B . n 
B 2 23  GLN 23  22  ?   ?   ?   B . n 
B 2 24  SER 24  23  ?   ?   ?   B . n 
B 2 25  LEU 25  24  24  LEU LEU B . n 
B 2 26  LYS 26  25  25  LYS LYS B . n 
B 2 27  SER 27  26  26  SER SER B . n 
B 2 28  THR 28  27  27  THR THR B . n 
B 2 29  ALA 29  28  28  ALA ALA B . n 
B 2 30  LYS 30  29  29  LYS LYS B . n 
B 2 31  TRP 31  30  30  TRP TRP B . n 
B 2 32  ALA 32  31  31  ALA ALA B . n 
B 2 33  ALA 33  32  32  ALA ALA B . n 
B 2 34  SER 34  33  33  SER SER B . n 
B 2 35  LEU 35  34  34  LEU LEU B . n 
B 2 36  GLU 36  35  35  GLU GLU B . n 
B 2 37  ASN 37  36  36  ASN ASN B . n 
B 2 38  LEU 38  37  37  LEU LEU B . n 
B 2 39  LEU 39  38  38  LEU LEU B . n 
B 2 40  GLU 40  39  39  GLU GLU B . n 
B 2 41  ASP 41  40  40  ASP ASP B . n 
B 2 42  PRO 42  41  41  PRO PRO B . n 
B 2 43  GLU 43  42  42  GLU GLU B . n 
B 2 44  GLY 44  43  43  GLY GLY B . n 
B 2 45  VAL 45  44  44  VAL VAL B . n 
B 2 46  LYS 46  45  45  LYS LYS B . n 
B 2 47  ARG 47  46  46  ARG ARG B . n 
B 2 48  PHE 48  47  47  PHE PHE B . n 
B 2 49  ARG 49  48  48  ARG ARG B . n 
B 2 50  GLU 50  49  49  GLU GLU B . n 
B 2 51  PHE 51  50  50  PHE PHE B . n 
B 2 52  LEU 52  51  51  LEU LEU B . n 
B 2 53  LYS 53  52  52  LYS LYS B . n 
B 2 54  LYS 54  53  53  LYS LYS B . n 
B 2 55  GLU 55  54  54  GLU GLU B . n 
B 2 56  PHE 56  55  55  PHE PHE B . n 
B 2 57  SER 57  56  56  SER SER B . n 
B 2 58  GLU 58  57  57  GLU GLU B . n 
B 2 59  GLU 59  58  58  GLU GLU B . n 
B 2 60  ASN 60  59  59  ASN ASN B . n 
B 2 61  VAL 61  60  60  VAL VAL B . n 
B 2 62  LEU 62  61  61  LEU LEU B . n 
B 2 63  PHE 63  62  62  PHE PHE B . n 
B 2 64  TRP 64  63  63  TRP TRP B . n 
B 2 65  LEU 65  64  64  LEU LEU B . n 
B 2 66  ALA 66  65  65  ALA ALA B . n 
B 2 67  CYS 67  66  66  CYS CYS B . n 
B 2 68  GLU 68  67  67  GLU GLU B . n 
B 2 69  ASP 69  68  68  ASP ASP B . n 
B 2 70  PHE 70  69  69  PHE PHE B . n 
B 2 71  LYS 71  70  70  LYS LYS B . n 
B 2 72  LYS 72  71  71  LYS LYS B . n 
B 2 73  MET 73  72  72  MET MET B . n 
B 2 74  GLN 74  73  73  GLN GLN B . n 
B 2 75  ASP 75  74  74  ASP ASP B . n 
B 2 76  LYS 76  75  75  LYS LYS B . n 
B 2 77  THR 77  76  76  THR THR B . n 
B 2 78  GLN 78  77  77  GLN GLN B . n 
B 2 79  MET 79  78  78  MET MET B . n 
B 2 80  GLN 80  79  79  GLN GLN B . n 
B 2 81  GLU 81  80  80  GLU GLU B . n 
B 2 82  LYS 82  81  81  LYS LYS B . n 
B 2 83  ALA 83  82  82  ALA ALA B . n 
B 2 84  LYS 84  83  83  LYS LYS B . n 
B 2 85  GLU 85  84  84  GLU GLU B . n 
B 2 86  ILE 86  85  85  ILE ILE B . n 
B 2 87  TYR 87  86  86  TYR TYR B . n 
B 2 88  MET 88  87  87  MET MET B . n 
B 2 89  THR 89  88  88  THR THR B . n 
B 2 90  PHE 90  89  89  PHE PHE B . n 
B 2 91  LEU 91  90  90  LEU LEU B . n 
B 2 92  SER 92  91  91  SER SER B . n 
B 2 93  SER 93  92  92  SER SER B . n 
B 2 94  LYS 94  93  93  LYS LYS B . n 
B 2 95  ALA 95  94  94  ALA ALA B . n 
B 2 96  SER 96  95  95  SER SER B . n 
B 2 97  SER 97  96  96  SER SER B . n 
B 2 98  GLN 98  97  97  GLN GLN B . n 
B 2 99  VAL 99  98  98  VAL VAL B . n 
B 2 100 ASN 100 99  99  ASN ASN B . n 
B 2 101 VAL 101 100 100 VAL VAL B . n 
B 2 102 GLU 102 101 101 GLU GLU B . n 
B 2 103 GLY 103 102 102 GLY GLY B . n 
B 2 104 GLN 104 103 ?   ?   ?   B . n 
B 2 105 SER 105 104 ?   ?   ?   B . n 
B 2 106 ARG 106 105 ?   ?   ?   B . n 
B 2 107 LEU 107 106 ?   ?   ?   B . n 
B 2 108 ASN 108 107 ?   ?   ?   B . n 
B 2 109 GLU 109 108 ?   ?   ?   B . n 
B 2 110 LYS 110 109 ?   ?   ?   B . n 
B 2 111 ILE 111 110 ?   ?   ?   B . n 
B 2 112 LEU 112 111 ?   ?   ?   B . n 
B 2 113 GLU 113 112 ?   ?   ?   B . n 
B 2 114 GLU 114 113 ?   ?   ?   B . n 
B 2 115 PRO 115 114 114 PRO PRO B . n 
B 2 116 HIS 116 115 115 HIS HIS B . n 
B 2 117 PRO 117 116 116 PRO PRO B . n 
B 2 118 LEU 118 117 117 LEU LEU B . n 
B 2 119 MET 119 118 118 MET MET B . n 
B 2 120 PHE 120 119 119 PHE PHE B . n 
B 2 121 GLN 121 120 120 GLN GLN B . n 
B 2 122 LYS 122 121 121 LYS LYS B . n 
B 2 123 LEU 123 122 122 LEU LEU B . n 
B 2 124 GLN 124 123 123 GLN GLN B . n 
B 2 125 ASP 125 124 124 ASP ASP B . n 
B 2 126 GLN 126 125 125 GLN GLN B . n 
B 2 127 ILE 127 126 126 ILE ILE B . n 
B 2 128 PHE 128 127 127 PHE PHE B . n 
B 2 129 ASN 129 128 128 ASN ASN B . n 
B 2 130 LEU 130 129 129 LEU LEU B . n 
B 2 131 MET 131 130 130 MET MET B . n 
B 2 132 LYS 132 131 131 LYS LYS B . n 
B 2 133 TYR 133 132 132 TYR TYR B . n 
B 2 134 ASP 134 133 133 ASP ASP B . n 
B 2 135 SER 135 134 134 SER SER B . n 
B 2 136 TYR 136 135 135 TYR TYR B . n 
B 2 137 SER 137 136 136 SER SER B . n 
B 2 138 ARG 138 137 137 ARG ARG B . n 
B 2 139 PHE 139 138 138 PHE PHE B . n 
B 2 140 LEU 140 139 139 LEU LEU B . n 
B 2 141 LYS 141 140 140 LYS LYS B . n 
B 2 142 SER 142 141 141 SER SER B . n 
B 2 143 ASP 143 142 142 ASP ASP B . n 
B 2 144 LEU 144 143 143 LEU LEU B . n 
B 2 145 PHE 145 144 144 PHE PHE B . n 
B 2 146 LEU 146 145 145 LEU LEU B . n 
B 2 147 LYS 147 146 ?   ?   ?   B . n 
B 2 148 HIS 148 147 ?   ?   ?   B . n 
B 2 149 LYS 149 148 ?   ?   ?   B . n 
B 2 150 ARG 150 149 ?   ?   ?   B . n 
B 2 151 THR 151 150 ?   ?   ?   B . n 
B 2 152 GLU 152 151 ?   ?   ?   B . n 
B 2 153 GLU 153 152 ?   ?   ?   B . n 
# 
_pdbx_SG_project.id                    1 
_pdbx_SG_project.project_name          ? 
_pdbx_SG_project.full_name_of_center   'Structural Genomics Consortium' 
_pdbx_SG_project.initial_of_center     SGC 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 ALF 1  354 354 ALF ALF A . 
D 4 MG  1  355 355 MG  MG  A . 
E 5 GDP 1  356 356 GDP GDP A . 
F 6 HOH 1  357 357 HOH HOH A . 
F 6 HOH 2  358 358 HOH HOH A . 
F 6 HOH 3  359 359 HOH HOH A . 
F 6 HOH 4  360 360 HOH HOH A . 
F 6 HOH 5  361 361 HOH HOH A . 
F 6 HOH 6  362 362 HOH HOH A . 
F 6 HOH 7  363 363 HOH HOH A . 
F 6 HOH 8  364 364 HOH HOH A . 
F 6 HOH 9  365 365 HOH HOH A . 
F 6 HOH 10 366 366 HOH HOH A . 
F 6 HOH 11 367 367 HOH HOH A . 
F 6 HOH 12 368 368 HOH HOH A . 
F 6 HOH 13 369 369 HOH HOH A . 
F 6 HOH 14 370 370 HOH HOH A . 
F 6 HOH 15 371 371 HOH HOH A . 
G 6 HOH 1  153 153 HOH HOH B . 
G 6 HOH 2  154 154 HOH HOH B . 
G 6 HOH 3  155 155 HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  O1B ? E GDP .  ? A GDP 356 ? 1_555 MG ? D MG . ? A MG 355 ? 1_555 O   ? F HOH .   ? A HOH 360 ? 1_555 93.6  ? 
2  O1B ? E GDP .  ? A GDP 356 ? 1_555 MG ? D MG . ? A MG 355 ? 1_555 O   ? F HOH .   ? A HOH 359 ? 1_555 95.9  ? 
3  O   ? F HOH .  ? A HOH 360 ? 1_555 MG ? D MG . ? A MG 355 ? 1_555 O   ? F HOH .   ? A HOH 359 ? 1_555 160.2 ? 
4  O1B ? E GDP .  ? A GDP 356 ? 1_555 MG ? D MG . ? A MG 355 ? 1_555 OG  ? A SER 16  ? A SER 47  ? 1_555 95.1  ? 
5  O   ? F HOH .  ? A HOH 360 ? 1_555 MG ? D MG . ? A MG 355 ? 1_555 OG  ? A SER 16  ? A SER 47  ? 1_555 84.5  ? 
6  O   ? F HOH .  ? A HOH 359 ? 1_555 MG ? D MG . ? A MG 355 ? 1_555 OG  ? A SER 16  ? A SER 47  ? 1_555 77.4  ? 
7  O1B ? E GDP .  ? A GDP 356 ? 1_555 MG ? D MG . ? A MG 355 ? 1_555 OG1 ? A THR 150 ? A THR 181 ? 1_555 174.1 ? 
8  O   ? F HOH .  ? A HOH 360 ? 1_555 MG ? D MG . ? A MG 355 ? 1_555 OG1 ? A THR 150 ? A THR 181 ? 1_555 80.8  ? 
9  O   ? F HOH .  ? A HOH 359 ? 1_555 MG ? D MG . ? A MG 355 ? 1_555 OG1 ? A THR 150 ? A THR 181 ? 1_555 88.9  ? 
10 OG  ? A SER 16 ? A SER 47  ? 1_555 MG ? D MG . ? A MG 355 ? 1_555 OG1 ? A THR 150 ? A THR 181 ? 1_555 82.6  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2006-11-21 
2 'Structure model' 1 1 2007-10-10 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' Advisory                    
3 3 'Structure model' 'Version format compliance' 
# 
loop_
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.pdbx_refine_id 
1 ? refined -6.4394 -25.4049 -31.3374 -0.1741 -0.1096 -0.2642 -0.0266 0.0169 -0.0021 3.4671 1.9755 3.1447 0.4301 1.0510  0.5556  
-0.0392 0.0019  -0.0201 -0.0515 -0.0507 0.2177 0.0105  -0.1076 0.0899 'X-RAY DIFFRACTION' 
2 ? refined -6.3296 -16.4536 -7.1103  -0.1290 -0.0353 -0.2083 0.0503  0.0443 -0.0840 5.7723 5.8487 6.4491 0.4006 -1.4485 -0.8734 
-0.0457 -0.3831 0.0060  0.4323  0.0121  0.1024 -0.2032 0.1367  0.0335 'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.selection_details 
1 1 A 33  A 2   A 348 A 317 ? 'X-RAY DIFFRACTION' ? 
2 2 B 24  B 25  B 102 B 103 ? 'X-RAY DIFFRACTION' ? 
3 2 B 114 B 115 B 145 B 146 ? 'X-RAY DIFFRACTION' ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC   refinement       5.2.0019 ? 1 
HKL-2000 'data reduction' .        ? 2 
HKL-2000 'data scaling'   .        ? 3 
PHASER   phasing          .        ? 4 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 AL A ALF 354 ? ? O2B A GDP 356 ? ? 1.97 
2 1 AL A ALF 354 ? ? O   A HOH 358 ? ? 1.99 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 GLU A 58  ? ? -109.34 -115.93 
2 1 SER B 96  ? ? -104.96 50.40   
3 1 ASP B 133 ? ? -116.42 -79.77  
4 1 LEU B 143 ? ? -39.72  -37.03  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A GLU 33  ? CG  ? A GLU 2   CG  
2  1 Y 1 A GLU 33  ? CD  ? A GLU 2   CD  
3  1 Y 1 A GLU 33  ? OE1 ? A GLU 2   OE1 
4  1 Y 1 A GLU 33  ? OE2 ? A GLU 2   OE2 
5  1 Y 1 A LYS 92  ? CG  ? A LYS 61  CG  
6  1 Y 1 A LYS 92  ? CD  ? A LYS 61  CD  
7  1 Y 1 A LYS 92  ? CE  ? A LYS 61  CE  
8  1 Y 1 A LYS 92  ? NZ  ? A LYS 61  NZ  
9  1 Y 1 A GLU 116 ? CD  ? A GLU 85  CD  
10 1 Y 1 A GLU 116 ? OE1 ? A GLU 85  OE1 
11 1 Y 1 A GLU 116 ? OE2 ? A GLU 85  OE2 
12 1 Y 1 A LYS 128 ? NZ  ? A LYS 97  NZ  
13 1 Y 1 A ARG 132 ? CD  ? A ARG 101 CD  
14 1 Y 1 A ARG 132 ? NE  ? A ARG 101 NE  
15 1 Y 1 A ARG 132 ? CZ  ? A ARG 101 CZ  
16 1 Y 1 A ARG 132 ? NH1 ? A ARG 101 NH1 
17 1 Y 1 A ARG 132 ? NH2 ? A ARG 101 NH2 
18 1 Y 1 A ASP 193 ? CG  ? A ASP 162 CG  
19 1 Y 1 A ASP 193 ? OD1 ? A ASP 162 OD1 
20 1 Y 1 A ASP 193 ? OD2 ? A ASP 162 OD2 
21 1 Y 1 A LYS 197 ? CD  ? A LYS 166 CD  
22 1 Y 1 A LYS 197 ? CE  ? A LYS 166 CE  
23 1 Y 1 A LYS 197 ? NZ  ? A LYS 166 NZ  
24 1 Y 1 A GLU 238 ? CD  ? A GLU 207 CD  
25 1 Y 1 A GLU 238 ? OE1 ? A GLU 207 OE1 
26 1 Y 1 A GLU 238 ? OE2 ? A GLU 207 OE2 
27 1 Y 1 A LYS 248 ? NZ  ? A LYS 217 NZ  
28 1 Y 1 A LYS 257 ? CD  ? A LYS 226 CD  
29 1 Y 1 A LYS 257 ? CE  ? A LYS 226 CE  
30 1 Y 1 A LYS 257 ? NZ  ? A LYS 226 NZ  
31 1 Y 1 A GLU 276 ? CG  ? A GLU 245 CG  
32 1 Y 1 A GLU 276 ? CD  ? A GLU 245 CD  
33 1 Y 1 A GLU 276 ? OE1 ? A GLU 245 OE1 
34 1 Y 1 A GLU 276 ? OE2 ? A GLU 245 OE2 
35 1 Y 1 A ARG 280 ? CD  ? A ARG 249 CD  
36 1 Y 1 A ARG 280 ? NE  ? A ARG 249 NE  
37 1 Y 1 A ARG 280 ? CZ  ? A ARG 249 CZ  
38 1 Y 1 A ARG 280 ? NH1 ? A ARG 249 NH1 
39 1 Y 1 A ARG 280 ? NH2 ? A ARG 249 NH2 
40 1 Y 1 A ASP 315 ? CG  ? A ASP 284 CG  
41 1 Y 1 A ASP 315 ? OD1 ? A ASP 284 OD1 
42 1 Y 1 A ASP 315 ? OD2 ? A ASP 284 OD2 
43 1 Y 1 A LYS 330 ? CD  ? A LYS 299 CD  
44 1 Y 1 A LYS 330 ? CE  ? A LYS 299 CE  
45 1 Y 1 A LYS 330 ? NZ  ? A LYS 299 NZ  
46 1 Y 1 A LYS 345 ? CD  ? A LYS 314 CD  
47 1 Y 1 A LYS 345 ? CE  ? A LYS 314 CE  
48 1 Y 1 A LYS 345 ? NZ  ? A LYS 314 NZ  
49 1 Y 1 A LYS 349 ? CG  ? A LYS 318 CG  
50 1 Y 1 A LYS 349 ? CD  ? A LYS 318 CD  
51 1 Y 1 A LYS 349 ? CE  ? A LYS 318 CE  
52 1 Y 1 A LYS 349 ? NZ  ? A LYS 318 NZ  
53 1 Y 1 B LEU 24  ? CG  ? B LEU 25  CG  
54 1 Y 1 B LEU 24  ? CD1 ? B LEU 25  CD1 
55 1 Y 1 B LEU 24  ? CD2 ? B LEU 25  CD2 
56 1 Y 1 B LYS 25  ? CE  ? B LYS 26  CE  
57 1 Y 1 B LYS 25  ? NZ  ? B LYS 26  NZ  
58 1 Y 1 B SER 26  ? OG  ? B SER 27  OG  
59 1 Y 1 B LYS 29  ? CD  ? B LYS 30  CD  
60 1 Y 1 B LYS 29  ? CE  ? B LYS 30  CE  
61 1 Y 1 B LYS 29  ? NZ  ? B LYS 30  NZ  
62 1 Y 1 B LYS 53  ? CD  ? B LYS 54  CD  
63 1 Y 1 B LYS 53  ? CE  ? B LYS 54  CE  
64 1 Y 1 B LYS 53  ? NZ  ? B LYS 54  NZ  
65 1 Y 1 B LYS 71  ? CE  ? B LYS 72  CE  
66 1 Y 1 B LYS 71  ? NZ  ? B LYS 72  NZ  
67 1 Y 1 B LYS 75  ? CD  ? B LYS 76  CD  
68 1 Y 1 B LYS 75  ? CE  ? B LYS 76  CE  
69 1 Y 1 B LYS 75  ? NZ  ? B LYS 76  NZ  
70 1 Y 1 B GLN 77  ? CG  ? B GLN 78  CG  
71 1 Y 1 B GLN 77  ? CD  ? B GLN 78  CD  
72 1 Y 1 B GLN 77  ? OE1 ? B GLN 78  OE1 
73 1 Y 1 B GLN 77  ? NE2 ? B GLN 78  NE2 
74 1 Y 1 B GLU 80  ? CD  ? B GLU 81  CD  
75 1 Y 1 B GLU 80  ? OE1 ? B GLU 81  OE1 
76 1 Y 1 B GLU 80  ? OE2 ? B GLU 81  OE2 
77 1 Y 1 B LYS 83  ? CD  ? B LYS 84  CD  
78 1 Y 1 B LYS 83  ? CE  ? B LYS 84  CE  
79 1 Y 1 B LYS 83  ? NZ  ? B LYS 84  NZ  
80 1 Y 1 B LYS 93  ? CE  ? B LYS 94  CE  
81 1 Y 1 B LYS 93  ? NZ  ? B LYS 94  NZ  
82 1 Y 1 B LYS 121 ? CE  ? B LYS 122 CE  
83 1 Y 1 B LYS 121 ? NZ  ? B LYS 122 NZ  
84 1 Y 1 B LYS 140 ? CD  ? B LYS 141 CD  
85 1 Y 1 B LYS 140 ? CE  ? B LYS 141 CE  
86 1 Y 1 B LYS 140 ? NZ  ? B LYS 141 NZ  
87 1 Y 1 B ASP 142 ? CG  ? B ASP 143 CG  
88 1 Y 1 B ASP 142 ? OD1 ? B ASP 143 OD1 
89 1 Y 1 B ASP 142 ? OD2 ? B ASP 143 OD2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A LYS 32  ? A LYS 1   
2  1 Y 1 A GLU 350 ? A GLU 319 
3  1 Y 1 A CYS 351 ? A CYS 320 
4  1 Y 1 A GLY 352 ? A GLY 321 
5  1 Y 1 A LEU 353 ? A LEU 322 
6  1 Y 1 A TYR 354 ? A TYR 323 
7  1 Y 1 B SER 0   ? B SER 1   
8  1 Y 1 B MET 1   ? B MET 2   
9  1 Y 1 B SER 2   ? B SER 3   
10 1 Y 1 B ARG 3   ? B ARG 4   
11 1 Y 1 B LYS 4   ? B LYS 5   
12 1 Y 1 B ARG 5   ? B ARG 6   
13 1 Y 1 B PRO 6   ? B PRO 7   
14 1 Y 1 B PRO 7   ? B PRO 8   
15 1 Y 1 B SER 8   ? B SER 9   
16 1 Y 1 B ASP 9   ? B ASP 10  
17 1 Y 1 B ILE 10  ? B ILE 11  
18 1 Y 1 B HIS 11  ? B HIS 12  
19 1 Y 1 B ASP 12  ? B ASP 13  
20 1 Y 1 B SER 13  ? B SER 14  
21 1 Y 1 B ASP 14  ? B ASP 15  
22 1 Y 1 B GLY 15  ? B GLY 16  
23 1 Y 1 B SER 16  ? B SER 17  
24 1 Y 1 B SER 17  ? B SER 18  
25 1 Y 1 B SER 18  ? B SER 19  
26 1 Y 1 B SER 19  ? B SER 20  
27 1 Y 1 B SER 20  ? B SER 21  
28 1 Y 1 B HIS 21  ? B HIS 22  
29 1 Y 1 B GLN 22  ? B GLN 23  
30 1 Y 1 B SER 23  ? B SER 24  
31 1 Y 1 B GLN 103 ? B GLN 104 
32 1 Y 1 B SER 104 ? B SER 105 
33 1 Y 1 B ARG 105 ? B ARG 106 
34 1 Y 1 B LEU 106 ? B LEU 107 
35 1 Y 1 B ASN 107 ? B ASN 108 
36 1 Y 1 B GLU 108 ? B GLU 109 
37 1 Y 1 B LYS 109 ? B LYS 110 
38 1 Y 1 B ILE 110 ? B ILE 111 
39 1 Y 1 B LEU 111 ? B LEU 112 
40 1 Y 1 B GLU 112 ? B GLU 113 
41 1 Y 1 B GLU 113 ? B GLU 114 
42 1 Y 1 B LYS 146 ? B LYS 147 
43 1 Y 1 B HIS 147 ? B HIS 148 
44 1 Y 1 B LYS 148 ? B LYS 149 
45 1 Y 1 B ARG 149 ? B ARG 150 
46 1 Y 1 B THR 150 ? B THR 151 
47 1 Y 1 B GLU 151 ? B GLU 152 
48 1 Y 1 B GLU 152 ? B GLU 153 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 'TETRAFLUOROALUMINATE ION' ALF 
4 'MAGNESIUM ION'            MG  
5 "GUANOSINE-5'-DIPHOSPHATE" GDP 
6 water                      HOH 
#