data_2IHD
# 
_entry.id   2IHD 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2IHD         
RCSB  RCSB039572   
WWPDB D_1000039572 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2IHD 
_pdbx_database_status.recvd_initial_deposition_date   2006-09-26 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Turnbull, A.P.'                       1  
'Papagrigoriou, E.'                    2  
'Ugochukwu, E.'                        3  
'Salah, E.'                            4  
'Gileadi, C.'                          5  
'Burgess, N.'                          6  
'Bhatia, C.'                           7  
'Gileadi, O.'                          8  
'Bray, J.'                             9  
'Elkins, J.'                           10 
'von Delft, F.'                        11 
'Weigelt, J.'                          12 
'Edwards, A.'                          13 
'Arrowsmith, C.'                       14 
'Sundstrom, M.'                        15 
'Doyle, D.A.'                          16 
'Structural Genomics Consortium (SGC)' 17 
# 
_citation.id                        primary 
_citation.title                     
'Structural diversity in the RGS domain and its interaction with heterotrimeric G protein alpha-subunits.' 
_citation.journal_abbrev            Proc.Natl.Acad.Sci.Usa 
_citation.journal_volume            105 
_citation.page_first                6457 
_citation.page_last                 6462 
_citation.year                      2008 
_citation.journal_id_ASTM           PNASA6 
_citation.country                   US 
_citation.journal_id_ISSN           0027-8424 
_citation.journal_id_CSD            0040 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   18434541 
_citation.pdbx_database_id_DOI      10.1073/pnas.0801508105 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Soundararajan, M.' 1  
primary 'Willard, F.S.'     2  
primary 'Kimple, A.J.'      3  
primary 'Turnbull, A.P.'    4  
primary 'Ball, L.J.'        5  
primary 'Schoch, G.A.'      6  
primary 'Gileadi, C.'       7  
primary 'Fedorov, O.Y.'     8  
primary 'Dowler, E.F.'      9  
primary 'Higman, V.A.'      10 
primary 'Hutsell, S.Q.'     11 
primary 'Sundstrom, M.'     12 
primary 'Doyle, D.A.'       13 
primary 'Siderovski, D.P.'  14 
# 
_cell.entry_id           2IHD 
_cell.length_a           65.967 
_cell.length_b           65.967 
_cell.length_c           76.377 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         2IHD 
_symmetry.space_group_name_H-M             'I 41' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                80 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Regulator of G-protein signaling 8' 18232.605 1   ? ? ? ? 
2 non-polymer syn 'CHLORIDE ION'                       35.453    1   ? ? ? ? 
3 water       nat water                                18.015    170 ? ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        RGS8 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MHHHHHHSSGVDLGTENLYFQSMLKRLSTEEATRWADSFDVLLSHKYGVAAFRAFLKTEFSEENLEFWLACEEFKKTRST
AKLVSKAHRIFEEFVDVQAPREVNIDFQTREATRKNLQEPSLTCFDQAQGKVHSLMEKDSYPRFLRSKMYLDLLS
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MHHHHHHSSGVDLGTENLYFQSMLKRLSTEEATRWADSFDVLLSHKYGVAAFRAFLKTEFSEENLEFWLACEEFKKTRST
AKLVSKAHRIFEEFVDVQAPREVNIDFQTREATRKNLQEPSLTCFDQAQGKVHSLMEKDSYPRFLRSKMYLDLLS
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   HIS n 
1 3   HIS n 
1 4   HIS n 
1 5   HIS n 
1 6   HIS n 
1 7   HIS n 
1 8   SER n 
1 9   SER n 
1 10  GLY n 
1 11  VAL n 
1 12  ASP n 
1 13  LEU n 
1 14  GLY n 
1 15  THR n 
1 16  GLU n 
1 17  ASN n 
1 18  LEU n 
1 19  TYR n 
1 20  PHE n 
1 21  GLN n 
1 22  SER n 
1 23  MET n 
1 24  LEU n 
1 25  LYS n 
1 26  ARG n 
1 27  LEU n 
1 28  SER n 
1 29  THR n 
1 30  GLU n 
1 31  GLU n 
1 32  ALA n 
1 33  THR n 
1 34  ARG n 
1 35  TRP n 
1 36  ALA n 
1 37  ASP n 
1 38  SER n 
1 39  PHE n 
1 40  ASP n 
1 41  VAL n 
1 42  LEU n 
1 43  LEU n 
1 44  SER n 
1 45  HIS n 
1 46  LYS n 
1 47  TYR n 
1 48  GLY n 
1 49  VAL n 
1 50  ALA n 
1 51  ALA n 
1 52  PHE n 
1 53  ARG n 
1 54  ALA n 
1 55  PHE n 
1 56  LEU n 
1 57  LYS n 
1 58  THR n 
1 59  GLU n 
1 60  PHE n 
1 61  SER n 
1 62  GLU n 
1 63  GLU n 
1 64  ASN n 
1 65  LEU n 
1 66  GLU n 
1 67  PHE n 
1 68  TRP n 
1 69  LEU n 
1 70  ALA n 
1 71  CYS n 
1 72  GLU n 
1 73  GLU n 
1 74  PHE n 
1 75  LYS n 
1 76  LYS n 
1 77  THR n 
1 78  ARG n 
1 79  SER n 
1 80  THR n 
1 81  ALA n 
1 82  LYS n 
1 83  LEU n 
1 84  VAL n 
1 85  SER n 
1 86  LYS n 
1 87  ALA n 
1 88  HIS n 
1 89  ARG n 
1 90  ILE n 
1 91  PHE n 
1 92  GLU n 
1 93  GLU n 
1 94  PHE n 
1 95  VAL n 
1 96  ASP n 
1 97  VAL n 
1 98  GLN n 
1 99  ALA n 
1 100 PRO n 
1 101 ARG n 
1 102 GLU n 
1 103 VAL n 
1 104 ASN n 
1 105 ILE n 
1 106 ASP n 
1 107 PHE n 
1 108 GLN n 
1 109 THR n 
1 110 ARG n 
1 111 GLU n 
1 112 ALA n 
1 113 THR n 
1 114 ARG n 
1 115 LYS n 
1 116 ASN n 
1 117 LEU n 
1 118 GLN n 
1 119 GLU n 
1 120 PRO n 
1 121 SER n 
1 122 LEU n 
1 123 THR n 
1 124 CYS n 
1 125 PHE n 
1 126 ASP n 
1 127 GLN n 
1 128 ALA n 
1 129 GLN n 
1 130 GLY n 
1 131 LYS n 
1 132 VAL n 
1 133 HIS n 
1 134 SER n 
1 135 LEU n 
1 136 MET n 
1 137 GLU n 
1 138 LYS n 
1 139 ASP n 
1 140 SER n 
1 141 TYR n 
1 142 PRO n 
1 143 ARG n 
1 144 PHE n 
1 145 LEU n 
1 146 ARG n 
1 147 SER n 
1 148 LYS n 
1 149 MET n 
1 150 TYR n 
1 151 LEU n 
1 152 ASP n 
1 153 LEU n 
1 154 LEU n 
1 155 SER n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 RGS8 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)-R3/Rosetta' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pNIC28-Bsa4 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    RGS8_HUMAN 
_struct_ref.pdbx_db_accession          P57771 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;LKRLSTEEATRWADSFDVLLSHKYGVAAFRAFLKTEFSEENLEFWLACEEFKKTRSTAKLVSKAHRIFEEFVDVQAPREV
NIDFQTREATRKNLQEPSLTCFDQAQGKVHSLMEKDSYPRFLRSKMYLDLLS
;
_struct_ref.pdbx_align_begin           42 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2IHD 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 24 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 155 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P57771 
_struct_ref_seq.db_align_beg                  42 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  173 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       42 
_struct_ref_seq.pdbx_auth_seq_align_end       173 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2IHD MET A 1  ? UNP P57771 ? ? 'EXPRESSION TAG'   19 1  
1 2IHD HIS A 2  ? UNP P57771 ? ? 'EXPRESSION TAG'   20 2  
1 2IHD HIS A 3  ? UNP P57771 ? ? 'EXPRESSION TAG'   21 3  
1 2IHD HIS A 4  ? UNP P57771 ? ? 'EXPRESSION TAG'   22 4  
1 2IHD HIS A 5  ? UNP P57771 ? ? 'EXPRESSION TAG'   23 5  
1 2IHD HIS A 6  ? UNP P57771 ? ? 'EXPRESSION TAG'   24 6  
1 2IHD HIS A 7  ? UNP P57771 ? ? 'EXPRESSION TAG'   25 7  
1 2IHD SER A 8  ? UNP P57771 ? ? 'EXPRESSION TAG'   26 8  
1 2IHD SER A 9  ? UNP P57771 ? ? 'EXPRESSION TAG'   27 9  
1 2IHD GLY A 10 ? UNP P57771 ? ? 'CLONING ARTIFACT' 28 10 
1 2IHD VAL A 11 ? UNP P57771 ? ? 'CLONING ARTIFACT' 29 11 
1 2IHD ASP A 12 ? UNP P57771 ? ? 'CLONING ARTIFACT' 30 12 
1 2IHD LEU A 13 ? UNP P57771 ? ? 'CLONING ARTIFACT' 31 13 
1 2IHD GLY A 14 ? UNP P57771 ? ? 'CLONING ARTIFACT' 32 14 
1 2IHD THR A 15 ? UNP P57771 ? ? 'CLONING ARTIFACT' 33 15 
1 2IHD GLU A 16 ? UNP P57771 ? ? 'CLONING ARTIFACT' 34 16 
1 2IHD ASN A 17 ? UNP P57771 ? ? 'CLONING ARTIFACT' 35 17 
1 2IHD LEU A 18 ? UNP P57771 ? ? 'CLONING ARTIFACT' 36 18 
1 2IHD TYR A 19 ? UNP P57771 ? ? 'CLONING ARTIFACT' 37 19 
1 2IHD PHE A 20 ? UNP P57771 ? ? 'CLONING ARTIFACT' 38 20 
1 2IHD GLN A 21 ? UNP P57771 ? ? 'CLONING ARTIFACT' 39 21 
1 2IHD SER A 22 ? UNP P57771 ? ? 'CLONING ARTIFACT' 40 22 
1 2IHD MET A 23 ? UNP P57771 ? ? 'CLONING ARTIFACT' 41 23 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CL  non-polymer         . 'CHLORIDE ION'  ? 'Cl -1'          35.453  
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2IHD 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.28 
_exptl_crystal.density_percent_sol   46.01 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pdbx_details    
'0.20M NaI;  20.0% PEG 3350;  10.0% Ethylene Glycol, VAPOR DIFFUSION, SITTING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 225 mm CCD' 
_diffrn_detector.pdbx_collection_date   2006-08-16 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Si (111)' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.978 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SLS BEAMLINE X10SA' 
_diffrn_source.pdbx_synchrotron_site       SLS 
_diffrn_source.pdbx_synchrotron_beamline   X10SA 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.978 
# 
_reflns.entry_id                     2IHD 
_reflns.observed_criterion_sigma_F   0 
_reflns.observed_criterion_sigma_I   0 
_reflns.d_resolution_high            1.7 
_reflns.d_resolution_low             50 
_reflns.number_all                   17206 
_reflns.number_obs                   17199 
_reflns.percent_possible_obs         95.7 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             1.7 
_reflns_shell.d_res_low              1.76 
_reflns_shell.percent_possible_all   99.7 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 2IHD 
_refine.ls_number_reflns_obs                     16320 
_refine.ls_number_reflns_all                     16320 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             27.5 
_refine.ls_d_res_high                            1.70 
_refine.ls_percent_reflns_obs                    95.71 
_refine.ls_R_factor_obs                          0.17707 
_refine.ls_R_factor_all                          0.17707 
_refine.ls_R_factor_R_work                       0.17524 
_refine.ls_R_factor_R_free                       0.21119 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.1 
_refine.ls_number_reflns_R_free                  878 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.962 
_refine.correlation_coeff_Fo_to_Fc_free          0.950 
_refine.B_iso_mean                               12.144 
_refine.aniso_B[1][1]                            0.20 
_refine.aniso_B[2][2]                            0.20 
_refine.aniso_B[3][3]                            -0.41 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      'Swissmodel based on pdb entry 2BT2' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.101 
_refine.pdbx_overall_ESU_R_Free                  0.102 
_refine.overall_SU_ML                            0.067 
_refine.overall_SU_B                             3.803 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1043 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         1 
_refine_hist.number_atoms_solvent             170 
_refine_hist.number_atoms_total               1214 
_refine_hist.d_res_high                       1.70 
_refine_hist.d_res_low                        27.5 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d         0.010  0.022  ? 1090 'X-RAY DIFFRACTION' ? 
r_bond_other_d           0.001  0.020  ? 777  'X-RAY DIFFRACTION' ? 
r_angle_refined_deg      1.141  1.944  ? 1472 'X-RAY DIFFRACTION' ? 
r_angle_other_deg        0.901  3.000  ? 1877 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg   4.739  5.000  ? 134  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg   33.115 23.036 ? 56   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg   11.283 15.000 ? 201  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg   21.025 15.000 ? 10   'X-RAY DIFFRACTION' ? 
r_chiral_restr           0.067  0.200  ? 159  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined     0.004  0.020  ? 1210 'X-RAY DIFFRACTION' ? 
r_gen_planes_other       0.001  0.020  ? 250  'X-RAY DIFFRACTION' ? 
r_nbd_refined            0.213  0.200  ? 266  'X-RAY DIFFRACTION' ? 
r_nbd_other              0.175  0.200  ? 815  'X-RAY DIFFRACTION' ? 
r_nbtor_refined          0.181  0.200  ? 550  'X-RAY DIFFRACTION' ? 
r_nbtor_other            0.082  0.200  ? 517  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined    0.188  0.200  ? 108  'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined   0.135  0.200  ? 11   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other     0.294  0.200  ? 38   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined 0.192  0.200  ? 24   'X-RAY DIFFRACTION' ? 
r_mcbond_it              3.024  5.000  ? 647  'X-RAY DIFFRACTION' ? 
r_mcbond_other           1.192  5.000  ? 256  'X-RAY DIFFRACTION' ? 
r_mcangle_it             4.135  7.000  ? 1046 'X-RAY DIFFRACTION' ? 
r_scbond_it              6.384  9.000  ? 456  'X-RAY DIFFRACTION' ? 
r_scangle_it             8.632  12.000 ? 422  'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       1.70 
_refine_ls_shell.d_res_low                        1.746 
_refine_ls_shell.number_reflns_R_work             1256 
_refine_ls_shell.R_factor_R_work                  0.243 
_refine_ls_shell.percent_reflns_obs               99.62 
_refine_ls_shell.R_factor_R_free                  0.302 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             60 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2IHD 
_struct.title                     'Crystal structure of Human Regulator of G-protein signaling 8, RGS8' 
_struct.pdbx_descriptor           'Regulator of G-protein signaling 8' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2IHD 
_struct_keywords.pdbx_keywords   'SIGNALING PROTEIN' 
_struct_keywords.text            
'RGS8; RGS; signaling protein, Structural Genomics, Structural Genomics Consortium, SGC, SIGNALING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 SER A 28  ? TRP A 35  ? SER A 46  TRP A 53  1 ? 8  
HELX_P HELX_P2 2 SER A 38  ? SER A 44  ? SER A 56  SER A 62  1 ? 7  
HELX_P HELX_P3 3 HIS A 45  ? GLU A 59  ? HIS A 63  GLU A 77  1 ? 15 
HELX_P HELX_P4 4 GLU A 62  ? LYS A 75  ? GLU A 80  LYS A 93  1 ? 14 
HELX_P HELX_P5 5 SER A 79  ? VAL A 95  ? SER A 97  VAL A 113 1 ? 17 
HELX_P HELX_P6 6 ASP A 106 ? LEU A 117 ? ASP A 124 LEU A 135 1 ? 12 
HELX_P HELX_P7 7 PHE A 125 ? ASP A 139 ? PHE A 143 ASP A 157 1 ? 15 
HELX_P HELX_P8 8 ASP A 139 ? ARG A 146 ? ASP A 157 ARG A 164 1 ? 8  
HELX_P HELX_P9 9 SER A 147 ? ASP A 152 ? SER A 165 ASP A 170 1 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    2 
_struct_site.details              'BINDING SITE FOR RESIDUE CL A 1' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 2 TRP A 68 ? TRP A 86  . ? 1_555 ? 
2 AC1 2 HOH C .  ? HOH A 324 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2IHD 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2IHD 
_atom_sites.fract_transf_matrix[1][1]   0.015159 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.015159 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.013093 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CL 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . SER A 1 28  ? 17.546 6.275   -1.342  1.00 26.77 ? 46  SER A N   1 
ATOM   2    C  CA  . SER A 1 28  ? 17.014 4.895   -1.152  1.00 32.47 ? 46  SER A CA  1 
ATOM   3    C  C   . SER A 1 28  ? 17.416 4.010   -2.325  1.00 30.42 ? 46  SER A C   1 
ATOM   4    O  O   . SER A 1 28  ? 18.002 2.948   -2.125  1.00 39.44 ? 46  SER A O   1 
ATOM   5    C  CB  . SER A 1 28  ? 15.495 4.911   -0.990  1.00 34.10 ? 46  SER A CB  1 
ATOM   6    O  OG  . SER A 1 28  ? 15.049 3.705   -0.395  1.00 25.21 ? 46  SER A OG  1 
ATOM   7    N  N   . THR A 1 29  ? 17.101 4.448   -3.545  1.00 32.33 ? 47  THR A N   1 
ATOM   8    C  CA  . THR A 1 29  ? 17.678 3.834   -4.743  1.00 26.30 ? 47  THR A CA  1 
ATOM   9    C  C   . THR A 1 29  ? 19.190 4.035   -4.684  1.00 21.65 ? 47  THR A C   1 
ATOM   10   O  O   . THR A 1 29  ? 19.955 3.091   -4.896  1.00 19.67 ? 47  THR A O   1 
ATOM   11   C  CB  . THR A 1 29  ? 17.112 4.424   -6.059  1.00 22.20 ? 47  THR A CB  1 
ATOM   12   O  OG1 . THR A 1 29  ? 17.081 5.854   -5.977  1.00 36.45 ? 47  THR A OG1 1 
ATOM   13   C  CG2 . THR A 1 29  ? 15.699 3.897   -6.333  1.00 19.33 ? 47  THR A CG2 1 
ATOM   14   N  N   . GLU A 1 30  ? 19.606 5.263   -4.368  1.00 16.42 ? 48  GLU A N   1 
ATOM   15   C  CA  . GLU A 1 30  ? 21.015 5.573   -4.109  1.00 18.07 ? 48  GLU A CA  1 
ATOM   16   C  C   . GLU A 1 30  ? 21.627 4.646   -3.060  1.00 16.05 ? 48  GLU A C   1 
ATOM   17   O  O   . GLU A 1 30  ? 22.726 4.139   -3.259  1.00 15.89 ? 48  GLU A O   1 
ATOM   18   C  CB  . GLU A 1 30  ? 21.181 7.022   -3.642  1.00 18.71 ? 48  GLU A CB  1 
ATOM   19   C  CG  . GLU A 1 30  ? 22.609 7.381   -3.225  1.00 21.18 ? 48  GLU A CG  1 
ATOM   20   N  N   . GLU A 1 31  ? 20.926 4.447   -1.942  1.00 23.68 ? 49  GLU A N   1 
ATOM   21   C  CA  . GLU A 1 31  ? 21.442 3.602   -0.860  1.00 23.86 ? 49  GLU A CA  1 
ATOM   22   C  C   . GLU A 1 31  ? 21.609 2.161   -1.314  1.00 22.00 ? 49  GLU A C   1 
ATOM   23   O  O   . GLU A 1 31  ? 22.636 1.545   -1.044  1.00 20.54 ? 49  GLU A O   1 
ATOM   24   C  CB  . GLU A 1 31  ? 20.540 3.638   0.376   1.00 26.32 ? 49  GLU A CB  1 
ATOM   25   C  CG  . GLU A 1 31  ? 21.188 2.981   1.611   1.00 34.25 ? 49  GLU A CG  1 
ATOM   26   C  CD  . GLU A 1 31  ? 20.185 2.494   2.641   1.00 25.89 ? 49  GLU A CD  1 
ATOM   27   O  OE1 . GLU A 1 31  ? 19.086 3.074   2.743   1.00 49.12 ? 49  GLU A OE1 1 
ATOM   28   O  OE2 . GLU A 1 31  ? 20.505 1.533   3.361   1.00 14.51 ? 49  GLU A OE2 1 
ATOM   29   N  N   . ALA A 1 32  ? 20.601 1.625   -1.997  1.00 21.90 ? 50  ALA A N   1 
ATOM   30   C  CA  . ALA A 1 32  ? 20.674 0.263   -2.537  1.00 18.62 ? 50  ALA A CA  1 
ATOM   31   C  C   . ALA A 1 32  ? 21.864 0.114   -3.487  1.00 13.37 ? 50  ALA A C   1 
ATOM   32   O  O   . ALA A 1 32  ? 22.564 -0.893  -3.467  1.00 12.46 ? 50  ALA A O   1 
ATOM   33   C  CB  . ALA A 1 32  ? 19.370 -0.104  -3.242  1.00 21.30 ? 50  ALA A CB  1 
ATOM   34   N  N   . THR A 1 33  ? 22.115 1.135   -4.297  1.00 11.79 ? 51  THR A N   1 
ATOM   35   C  CA  . THR A 1 33  ? 23.286 1.137   -5.170  1.00 13.17 ? 51  THR A CA  1 
ATOM   36   C  C   . THR A 1 33  ? 24.588 1.073   -4.360  1.00 15.41 ? 51  THR A C   1 
ATOM   37   O  O   . THR A 1 33  ? 25.528 0.380   -4.749  1.00 15.05 ? 51  THR A O   1 
ATOM   38   C  CB  . THR A 1 33  ? 23.307 2.388   -6.084  1.00 19.39 ? 51  THR A CB  1 
ATOM   39   O  OG1 . THR A 1 33  ? 22.121 2.409   -6.889  1.00 15.62 ? 51  THR A OG1 1 
ATOM   40   C  CG2 . THR A 1 33  ? 24.526 2.372   -6.982  1.00 7.99  ? 51  THR A CG2 1 
ATOM   41   N  N   . ARG A 1 34  ? 24.623 1.786   -3.233  1.00 17.20 ? 52  ARG A N   1 
ATOM   42   C  CA  . ARG A 1 34  ? 25.795 1.817   -2.356  1.00 17.14 ? 52  ARG A CA  1 
ATOM   43   C  C   . ARG A 1 34  ? 26.170 0.441   -1.827  1.00 15.16 ? 52  ARG A C   1 
ATOM   44   O  O   . ARG A 1 34  ? 27.348 0.170   -1.600  1.00 17.27 ? 52  ARG A O   1 
ATOM   45   C  CB  . ARG A 1 34  ? 25.589 2.763   -1.152  1.00 19.93 ? 52  ARG A CB  1 
ATOM   46   C  CG  . ARG A 1 34  ? 25.632 4.274   -1.434  1.00 22.21 ? 52  ARG A CG  1 
ATOM   47   C  CD  . ARG A 1 34  ? 26.789 4.705   -2.344  1.00 20.80 ? 52  ARG A CD  1 
ATOM   48   N  NE  . ARG A 1 34  ? 26.305 5.016   -3.692  1.00 36.07 ? 52  ARG A NE  1 
ATOM   49   C  CZ  . ARG A 1 34  ? 26.929 4.726   -4.835  1.00 35.58 ? 52  ARG A CZ  1 
ATOM   50   N  NH1 . ARG A 1 34  ? 26.368 5.080   -5.987  1.00 34.97 ? 52  ARG A NH1 1 
ATOM   51   N  NH2 . ARG A 1 34  ? 28.094 4.080   -4.848  1.00 24.08 ? 52  ARG A NH2 1 
ATOM   52   N  N   . TRP A 1 35  ? 25.175 -0.426  -1.621  1.00 14.05 ? 53  TRP A N   1 
ATOM   53   C  CA  . TRP A 1 35  ? 25.435 -1.778  -1.113  1.00 16.76 ? 53  TRP A CA  1 
ATOM   54   C  C   . TRP A 1 35  ? 26.364 -2.558  -2.034  1.00 11.83 ? 53  TRP A C   1 
ATOM   55   O  O   . TRP A 1 35  ? 27.022 -3.488  -1.587  1.00 15.20 ? 53  TRP A O   1 
ATOM   56   C  CB  . TRP A 1 35  ? 24.153 -2.591  -0.935  1.00 15.07 ? 53  TRP A CB  1 
ATOM   57   C  CG  . TRP A 1 35  ? 23.103 -1.996  -0.042  1.00 11.23 ? 53  TRP A CG  1 
ATOM   58   C  CD1 . TRP A 1 35  ? 23.236 -0.936  0.820   1.00 17.10 ? 53  TRP A CD1 1 
ATOM   59   C  CD2 . TRP A 1 35  ? 21.758 -2.451  0.085   1.00 14.66 ? 53  TRP A CD2 1 
ATOM   60   N  NE1 . TRP A 1 35  ? 22.044 -0.700  1.459   1.00 14.64 ? 53  TRP A NE1 1 
ATOM   61   C  CE2 . TRP A 1 35  ? 21.120 -1.618  1.027   1.00 14.96 ? 53  TRP A CE2 1 
ATOM   62   C  CE3 . TRP A 1 35  ? 21.020 -3.483  -0.519  1.00 13.14 ? 53  TRP A CE3 1 
ATOM   63   C  CZ2 . TRP A 1 35  ? 19.778 -1.786  1.380   1.00 14.68 ? 53  TRP A CZ2 1 
ATOM   64   C  CZ3 . TRP A 1 35  ? 19.699 -3.648  -0.168  1.00 12.77 ? 53  TRP A CZ3 1 
ATOM   65   C  CH2 . TRP A 1 35  ? 19.089 -2.804  0.776   1.00 21.25 ? 53  TRP A CH2 1 
ATOM   66   N  N   . ALA A 1 36  ? 26.408 -2.188  -3.317  1.00 10.48 ? 54  ALA A N   1 
ATOM   67   C  CA  . ALA A 1 36  ? 27.289 -2.846  -4.284  1.00 10.93 ? 54  ALA A CA  1 
ATOM   68   C  C   . ALA A 1 36  ? 28.744 -2.368  -4.199  1.00 13.52 ? 54  ALA A C   1 
ATOM   69   O  O   . ALA A 1 36  ? 29.591 -2.920  -4.879  1.00 11.27 ? 54  ALA A O   1 
ATOM   70   C  CB  . ALA A 1 36  ? 26.755 -2.650  -5.706  1.00 15.88 ? 54  ALA A CB  1 
ATOM   71   N  N   . ASP A 1 37  ? 29.033 -1.348  -3.385  1.00 13.96 ? 55  ASP A N   1 
ATOM   72   C  CA  . ASP A 1 37  ? 30.411 -0.839  -3.244  1.00 14.59 ? 55  ASP A CA  1 
ATOM   73   C  C   . ASP A 1 37  ? 31.370 -1.904  -2.705  1.00 13.61 ? 55  ASP A C   1 
ATOM   74   O  O   . ASP A 1 37  ? 32.497 -2.041  -3.188  1.00 7.71  ? 55  ASP A O   1 
ATOM   75   C  CB  . ASP A 1 37  ? 30.451 0.388   -2.325  1.00 16.78 ? 55  ASP A CB  1 
ATOM   76   C  CG  . ASP A 1 37  ? 29.891 1.646   -2.987  1.00 21.02 ? 55  ASP A CG  1 
ATOM   77   O  OD1 . ASP A 1 37  ? 29.521 1.592   -4.186  1.00 19.68 ? 55  ASP A OD1 1 
ATOM   78   O  OD2 . ASP A 1 37  ? 29.835 2.695   -2.303  1.00 20.47 ? 55  ASP A OD2 1 
ATOM   79   N  N   . SER A 1 38  ? 30.912 -2.626  -1.685  1.00 11.17 ? 56  SER A N   1 
ATOM   80   C  CA  . SER A 1 38  ? 31.641 -3.746  -1.104  1.00 9.64  ? 56  SER A CA  1 
ATOM   81   C  C   . SER A 1 38  ? 30.725 -4.449  -0.123  1.00 10.59 ? 56  SER A C   1 
ATOM   82   O  O   . SER A 1 38  ? 29.725 -3.893  0.313   1.00 7.62  ? 56  SER A O   1 
ATOM   83   C  CB  . SER A 1 38  ? 32.902 -3.288  -0.362  1.00 8.52  ? 56  SER A CB  1 
ATOM   84   O  OG  . SER A 1 38  ? 32.589 -2.757  0.918   1.00 10.91 ? 56  SER A OG  1 
ATOM   85   N  N   . PHE A 1 39  ? 31.095 -5.657  0.254   1.00 10.85 ? 57  PHE A N   1 
ATOM   86   C  CA  . PHE A 1 39  ? 30.322 -6.400  1.224   1.00 12.26 ? 57  PHE A CA  1 
ATOM   87   C  C   . PHE A 1 39  ? 30.266 -5.658  2.570   1.00 9.10  ? 57  PHE A C   1 
ATOM   88   O  O   . PHE A 1 39  ? 29.216 -5.574  3.196   1.00 9.84  ? 57  PHE A O   1 
ATOM   89   C  CB  . PHE A 1 39  ? 30.920 -7.792  1.379   1.00 11.15 ? 57  PHE A CB  1 
ATOM   90   C  CG  . PHE A 1 39  ? 30.148 -8.677  2.297   1.00 8.51  ? 57  PHE A CG  1 
ATOM   91   C  CD1 . PHE A 1 39  ? 28.757 -8.731  2.243   1.00 8.85  ? 57  PHE A CD1 1 
ATOM   92   C  CD2 . PHE A 1 39  ? 30.815 -9.471  3.218   1.00 9.25  ? 57  PHE A CD2 1 
ATOM   93   C  CE1 . PHE A 1 39  ? 28.043 -9.547  3.103   1.00 12.28 ? 57  PHE A CE1 1 
ATOM   94   C  CE2 . PHE A 1 39  ? 30.102 -10.300 4.074   1.00 14.35 ? 57  PHE A CE2 1 
ATOM   95   C  CZ  . PHE A 1 39  ? 28.725 -10.342 4.023   1.00 9.29  ? 57  PHE A CZ  1 
ATOM   96   N  N   . ASP A 1 40  ? 31.385 -5.063  2.982   1.00 13.64 ? 58  ASP A N   1 
ATOM   97   C  CA  . ASP A 1 40  ? 31.430 -4.362  4.274   1.00 14.82 ? 58  ASP A CA  1 
ATOM   98   C  C   . ASP A 1 40  ? 30.568 -3.100  4.274   1.00 12.71 ? 58  ASP A C   1 
ATOM   99   O  O   . ASP A 1 40  ? 29.992 -2.731  5.302   1.00 16.05 ? 58  ASP A O   1 
ATOM   100  C  CB  . ASP A 1 40  ? 32.870 -4.063  4.688   1.00 14.17 ? 58  ASP A CB  1 
ATOM   101  C  CG  . ASP A 1 40  ? 33.619 -5.323  5.125   1.00 20.25 ? 58  ASP A CG  1 
ATOM   102  O  OD1 . ASP A 1 40  ? 33.048 -6.106  5.919   1.00 21.45 ? 58  ASP A OD1 1 
ATOM   103  O  OD2 . ASP A 1 40  ? 34.771 -5.523  4.672   1.00 26.14 ? 58  ASP A OD2 1 
ATOM   104  N  N   . VAL A 1 41  ? 30.466 -2.448  3.124   1.00 10.28 ? 59  VAL A N   1 
ATOM   105  C  CA  . VAL A 1 41  ? 29.519 -1.349  2.965   1.00 12.60 ? 59  VAL A CA  1 
ATOM   106  C  C   . VAL A 1 41  ? 28.065 -1.834  3.122   1.00 9.23  ? 59  VAL A C   1 
ATOM   107  O  O   . VAL A 1 41  ? 27.282 -1.228  3.866   1.00 10.89 ? 59  VAL A O   1 
ATOM   108  C  CB  . VAL A 1 41  ? 29.720 -0.609  1.629   1.00 11.18 ? 59  VAL A CB  1 
ATOM   109  C  CG1 . VAL A 1 41  ? 28.529 0.306   1.348   1.00 12.32 ? 59  VAL A CG1 1 
ATOM   110  C  CG2 . VAL A 1 41  ? 31.054 0.205   1.651   1.00 9.82  ? 59  VAL A CG2 1 
ATOM   111  N  N   . LEU A 1 42  ? 27.699 -2.930  2.454   1.00 11.85 ? 60  LEU A N   1 
ATOM   112  C  CA  . LEU A 1 42  ? 26.364 -3.515  2.656   1.00 10.91 ? 60  LEU A CA  1 
ATOM   113  C  C   . LEU A 1 42  ? 26.071 -3.750  4.137   1.00 9.99  ? 60  LEU A C   1 
ATOM   114  O  O   . LEU A 1 42  ? 25.007 -3.360  4.633   1.00 10.55 ? 60  LEU A O   1 
ATOM   115  C  CB  . LEU A 1 42  ? 26.188 -4.812  1.859   1.00 8.46  ? 60  LEU A CB  1 
ATOM   116  C  CG  . LEU A 1 42  ? 24.859 -5.581  1.997   1.00 10.45 ? 60  LEU A CG  1 
ATOM   117  C  CD1 . LEU A 1 42  ? 24.719 -6.593  0.878   1.00 19.30 ? 60  LEU A CD1 1 
ATOM   118  C  CD2 . LEU A 1 42  ? 24.754 -6.315  3.332   1.00 16.12 ? 60  LEU A CD2 1 
ATOM   119  N  N   . LEU A 1 43  ? 27.037 -4.335  4.839   1.00 10.06 ? 61  LEU A N   1 
ATOM   120  C  CA  . LEU A 1 43  ? 26.877 -4.693  6.249   1.00 10.26 ? 61  LEU A CA  1 
ATOM   121  C  C   . LEU A 1 43  ? 26.732 -3.477  7.183   1.00 9.31  ? 61  LEU A C   1 
ATOM   122  O  O   . LEU A 1 43  ? 26.176 -3.606  8.275   1.00 13.03 ? 61  LEU A O   1 
ATOM   123  C  CB  . LEU A 1 43  ? 28.050 -5.565  6.706   1.00 12.30 ? 61  LEU A CB  1 
ATOM   124  C  CG  . LEU A 1 43  ? 28.110 -6.972  6.112   1.00 18.05 ? 61  LEU A CG  1 
ATOM   125  C  CD1 . LEU A 1 43  ? 29.441 -7.624  6.454   1.00 18.82 ? 61  LEU A CD1 1 
ATOM   126  C  CD2 . LEU A 1 43  ? 26.943 -7.819  6.601   1.00 17.95 ? 61  LEU A CD2 1 
ATOM   127  N  N   . SER A 1 44  ? 27.224 -2.317  6.755   1.00 13.69 ? 62  SER A N   1 
ATOM   128  C  CA  . SER A 1 44  ? 27.117 -1.073  7.538   1.00 10.23 ? 62  SER A CA  1 
ATOM   129  C  C   . SER A 1 44  ? 25.741 -0.415  7.467   1.00 11.62 ? 62  SER A C   1 
ATOM   130  O  O   . SER A 1 44  ? 25.482 0.545   8.184   1.00 11.95 ? 62  SER A O   1 
ATOM   131  C  CB  . SER A 1 44  ? 28.180 -0.071  7.084   1.00 14.08 ? 62  SER A CB  1 
ATOM   132  O  OG  . SER A 1 44  ? 27.838 0.524   5.850   1.00 13.27 ? 62  SER A OG  1 
ATOM   133  N  N   . HIS A 1 45  ? 24.870 -0.923  6.597   1.00 13.43 ? 63  HIS A N   1 
ATOM   134  C  CA  . HIS A 1 45  ? 23.515 -0.391  6.432   1.00 11.62 ? 63  HIS A CA  1 
ATOM   135  C  C   . HIS A 1 45  ? 22.500 -1.402  6.986   1.00 4.55  ? 63  HIS A C   1 
ATOM   136  O  O   . HIS A 1 45  ? 22.463 -2.545  6.524   1.00 10.27 ? 63  HIS A O   1 
ATOM   137  C  CB  . HIS A 1 45  ? 23.226 -0.164  4.948   1.00 10.66 ? 63  HIS A CB  1 
ATOM   138  C  CG  . HIS A 1 45  ? 24.001 0.962   4.338   1.00 19.17 ? 63  HIS A CG  1 
ATOM   139  N  ND1 . HIS A 1 45  ? 23.791 2.280   4.678   1.00 30.71 ? 63  HIS A ND1 1 
ATOM   140  C  CD2 . HIS A 1 45  ? 24.970 0.969   3.389   1.00 20.09 ? 63  HIS A CD2 1 
ATOM   141  C  CE1 . HIS A 1 45  ? 24.606 3.050   3.977   1.00 19.00 ? 63  HIS A CE1 1 
ATOM   142  N  NE2 . HIS A 1 45  ? 25.329 2.279   3.185   1.00 16.48 ? 63  HIS A NE2 1 
ATOM   143  N  N   . LYS A 1 46  ? 21.686 -0.983  7.958   1.00 8.66  ? 64  LYS A N   1 
ATOM   144  C  CA  . LYS A 1 46  ? 20.658 -1.863  8.533   1.00 10.96 ? 64  LYS A CA  1 
ATOM   145  C  C   . LYS A 1 46  ? 19.727 -2.477  7.475   1.00 6.68  ? 64  LYS A C   1 
ATOM   146  O  O   . LYS A 1 46  ? 19.416 -3.656  7.539   1.00 9.33  ? 64  LYS A O   1 
ATOM   147  C  CB  . LYS A 1 46  ? 19.826 -1.116  9.582   1.00 11.30 ? 64  LYS A CB  1 
ATOM   148  C  CG  . LYS A 1 46  ? 20.550 -0.884  10.894  1.00 29.42 ? 64  LYS A CG  1 
ATOM   149  N  N   . TYR A 1 47  ? 19.276 -1.675  6.509   1.00 12.22 ? 65  TYR A N   1 
ATOM   150  C  CA  . TYR A 1 47  ? 18.425 -2.210  5.438   1.00 8.95  ? 65  TYR A CA  1 
ATOM   151  C  C   . TYR A 1 47  ? 19.222 -3.164  4.516   1.00 7.61  ? 65  TYR A C   1 
ATOM   152  O  O   . TYR A 1 47  ? 18.663 -4.126  3.985   1.00 9.54  ? 65  TYR A O   1 
ATOM   153  C  CB  . TYR A 1 47  ? 17.763 -1.075  4.632   1.00 8.35  ? 65  TYR A CB  1 
ATOM   154  C  CG  . TYR A 1 47  ? 16.698 -0.265  5.371   1.00 12.97 ? 65  TYR A CG  1 
ATOM   155  C  CD1 . TYR A 1 47  ? 15.808 -0.873  6.262   1.00 31.86 ? 65  TYR A CD1 1 
ATOM   156  C  CD2 . TYR A 1 47  ? 16.553 1.098   5.137   1.00 31.82 ? 65  TYR A CD2 1 
ATOM   157  C  CE1 . TYR A 1 47  ? 14.824 -0.132  6.921   1.00 27.55 ? 65  TYR A CE1 1 
ATOM   158  C  CE2 . TYR A 1 47  ? 15.571 1.844   5.788   1.00 32.11 ? 65  TYR A CE2 1 
ATOM   159  C  CZ  . TYR A 1 47  ? 14.709 1.220   6.677   1.00 29.31 ? 65  TYR A CZ  1 
ATOM   160  O  OH  . TYR A 1 47  ? 13.735 1.949   7.325   1.00 24.78 ? 65  TYR A OH  1 
ATOM   161  N  N   . GLY A 1 48  ? 20.522 -2.902  4.356   1.00 9.62  ? 66  GLY A N   1 
ATOM   162  C  CA  . GLY A 1 48  ? 21.425 -3.800  3.627   1.00 10.66 ? 66  GLY A CA  1 
ATOM   163  C  C   . GLY A 1 48  ? 21.515 -5.168  4.276   1.00 13.03 ? 66  GLY A C   1 
ATOM   164  O  O   . GLY A 1 48  ? 21.331 -6.185  3.617   1.00 9.25  ? 66  GLY A O   1 
ATOM   165  N  N   . VAL A 1 49  ? 21.775 -5.179  5.578   1.00 9.87  ? 67  VAL A N   1 
ATOM   166  C  CA  . VAL A 1 49  ? 21.748 -6.416  6.365   1.00 9.43  ? 67  VAL A CA  1 
ATOM   167  C  C   . VAL A 1 49  ? 20.414 -7.156  6.261   1.00 9.38  ? 67  VAL A C   1 
ATOM   168  O  O   . VAL A 1 49  ? 20.402 -8.355  6.034   1.00 8.90  ? 67  VAL A O   1 
ATOM   169  C  CB  . VAL A 1 49  ? 22.121 -6.152  7.847   1.00 12.14 ? 67  VAL A CB  1 
ATOM   170  C  CG1 . VAL A 1 49  ? 21.947 -7.419  8.686   1.00 9.53  ? 67  VAL A CG1 1 
ATOM   171  C  CG2 . VAL A 1 49  ? 23.567 -5.624  7.931   1.00 13.68 ? 67  VAL A CG2 1 
ATOM   172  N  N   . ALA A 1 50  ? 19.291 -6.446  6.407   1.00 8.64  ? 68  ALA A N   1 
ATOM   173  C  CA  . ALA A 1 50  ? 17.954 -7.076  6.313   1.00 7.86  ? 68  ALA A CA  1 
ATOM   174  C  C   . ALA A 1 50  ? 17.707 -7.726  4.951   1.00 8.86  ? 68  ALA A C   1 
ATOM   175  O  O   . ALA A 1 50  ? 17.173 -8.828  4.864   1.00 9.61  ? 68  ALA A O   1 
ATOM   176  C  CB  . ALA A 1 50  ? 16.845 -6.047  6.624   1.00 7.79  ? 68  ALA A CB  1 
ATOM   177  N  N   . ALA A 1 51  ? 18.088 -7.021  3.886   1.00 10.26 ? 69  ALA A N   1 
ATOM   178  C  CA  . ALA A 1 51  ? 17.905 -7.513  2.529   1.00 8.99  ? 69  ALA A CA  1 
ATOM   179  C  C   . ALA A 1 51  ? 18.757 -8.749  2.263   1.00 9.47  ? 69  ALA A C   1 
ATOM   180  O  O   . ALA A 1 51  ? 18.287 -9.717  1.674   1.00 9.31  ? 69  ALA A O   1 
ATOM   181  C  CB  . ALA A 1 51  ? 18.233 -6.433  1.526   1.00 11.51 ? 69  ALA A CB  1 
ATOM   182  N  N   . PHE A 1 52  ? 20.013 -8.689  2.707   1.00 6.39  ? 70  PHE A N   1 
ATOM   183  C  CA  . PHE A 1 52  ? 20.956 -9.779  2.545   1.00 8.54  ? 70  PHE A CA  1 
ATOM   184  C  C   . PHE A 1 52  ? 20.506 -10.990 3.341   1.00 6.01  ? 70  PHE A C   1 
ATOM   185  O  O   . PHE A 1 52  ? 20.620 -12.115 2.858   1.00 9.55  ? 70  PHE A O   1 
ATOM   186  C  CB  . PHE A 1 52  ? 22.371 -9.335  2.932   1.00 11.32 ? 70  PHE A CB  1 
ATOM   187  C  CG  . PHE A 1 52  ? 23.456 -10.335 2.574   1.00 9.06  ? 70  PHE A CG  1 
ATOM   188  C  CD1 . PHE A 1 52  ? 23.610 -10.793 1.283   1.00 11.07 ? 70  PHE A CD1 1 
ATOM   189  C  CD2 . PHE A 1 52  ? 24.328 -10.801 3.548   1.00 7.60  ? 70  PHE A CD2 1 
ATOM   190  C  CE1 . PHE A 1 52  ? 24.604 -11.701 0.953   1.00 10.79 ? 70  PHE A CE1 1 
ATOM   191  C  CE2 . PHE A 1 52  ? 25.331 -11.714 3.231   1.00 12.80 ? 70  PHE A CE2 1 
ATOM   192  C  CZ  . PHE A 1 52  ? 25.457 -12.173 1.932   1.00 10.61 ? 70  PHE A CZ  1 
ATOM   193  N  N   . ARG A 1 53  ? 20.006 -10.752 4.563   1.00 7.84  ? 71  ARG A N   1 
ATOM   194  C  CA  A ARG A 1 53  ? 19.481 -11.785 5.450   0.50 12.39 ? 71  ARG A CA  1 
ATOM   195  C  CA  B ARG A 1 53  ? 19.521 -11.847 5.408   0.50 6.86  ? 71  ARG A CA  1 
ATOM   196  C  C   . ARG A 1 53  ? 18.370 -12.557 4.712   1.00 8.56  ? 71  ARG A C   1 
ATOM   197  O  O   . ARG A 1 53  ? 18.346 -13.797 4.669   1.00 11.18 ? 71  ARG A O   1 
ATOM   198  C  CB  A ARG A 1 53  ? 18.960 -11.055 6.710   0.50 13.65 ? 71  ARG A CB  1 
ATOM   199  C  CB  B ARG A 1 53  ? 19.064 -11.349 6.783   0.50 5.63  ? 71  ARG A CB  1 
ATOM   200  C  CG  A ARG A 1 53  ? 18.356 -11.847 7.852   0.50 21.25 ? 71  ARG A CG  1 
ATOM   201  C  CG  B ARG A 1 53  ? 18.539 -12.449 7.717   0.50 2.64  ? 71  ARG A CG  1 
ATOM   202  C  CD  A ARG A 1 53  ? 17.842 -10.860 8.953   0.50 15.88 ? 71  ARG A CD  1 
ATOM   203  C  CD  B ARG A 1 53  ? 17.674 -11.849 8.829   0.50 5.86  ? 71  ARG A CD  1 
ATOM   204  N  NE  A ARG A 1 53  ? 18.904 -10.353 9.842   0.50 19.33 ? 71  ARG A NE  1 
ATOM   205  N  NE  B ARG A 1 53  ? 18.381 -10.846 9.614   0.50 4.62  ? 71  ARG A NE  1 
ATOM   206  C  CZ  A ARG A 1 53  ? 19.137 -9.074  10.208  0.50 22.91 ? 71  ARG A CZ  1 
ATOM   207  C  CZ  B ARG A 1 53  ? 19.207 -11.103 10.626  0.50 7.49  ? 71  ARG A CZ  1 
ATOM   208  N  NH1 A ARG A 1 53  ? 18.397 -8.026  9.814   0.50 2.00  ? 71  ARG A NH1 1 
ATOM   209  N  NH1 B ARG A 1 53  ? 19.475 -12.354 10.982  0.50 4.14  ? 71  ARG A NH1 1 
ATOM   210  N  NH2 A ARG A 1 53  ? 20.151 -8.838  11.027  0.50 28.32 ? 71  ARG A NH2 1 
ATOM   211  N  NH2 B ARG A 1 53  ? 19.788 -10.097 11.271  0.50 4.30  ? 71  ARG A NH2 1 
ATOM   212  N  N   . ALA A 1 54  ? 17.432 -11.801 4.144   1.00 9.60  ? 72  ALA A N   1 
ATOM   213  C  CA  . ALA A 1 54  ? 16.313 -12.395 3.414   1.00 11.14 ? 72  ALA A CA  1 
ATOM   214  C  C   . ALA A 1 54  ? 16.826 -13.256 2.269   1.00 8.74  ? 72  ALA A C   1 
ATOM   215  O  O   . ALA A 1 54  ? 16.351 -14.360 2.064   1.00 9.82  ? 72  ALA A O   1 
ATOM   216  C  CB  . ALA A 1 54  ? 15.396 -11.312 2.866   1.00 10.62 ? 72  ALA A CB  1 
ATOM   217  N  N   . PHE A 1 55  ? 17.789 -12.734 1.513   1.00 9.68  ? 73  PHE A N   1 
ATOM   218  C  CA  . PHE A 1 55  ? 18.409 -13.491 0.430   1.00 9.04  ? 73  PHE A CA  1 
ATOM   219  C  C   . PHE A 1 55  ? 19.036 -14.787 0.939   1.00 9.85  ? 73  PHE A C   1 
ATOM   220  O  O   . PHE A 1 55  ? 18.812 -15.851 0.373   1.00 10.00 ? 73  PHE A O   1 
ATOM   221  C  CB  . PHE A 1 55  ? 19.479 -12.640 -0.270  1.00 10.61 ? 73  PHE A CB  1 
ATOM   222  C  CG  . PHE A 1 55  ? 20.158 -13.353 -1.397  1.00 7.71  ? 73  PHE A CG  1 
ATOM   223  C  CD1 . PHE A 1 55  ? 19.475 -13.608 -2.575  1.00 7.84  ? 73  PHE A CD1 1 
ATOM   224  C  CD2 . PHE A 1 55  ? 21.460 -13.845 -1.249  1.00 11.99 ? 73  PHE A CD2 1 
ATOM   225  C  CE1 . PHE A 1 55  ? 20.082 -14.284 -3.607  1.00 10.97 ? 73  PHE A CE1 1 
ATOM   226  C  CE2 . PHE A 1 55  ? 22.073 -14.528 -2.281  1.00 10.28 ? 73  PHE A CE2 1 
ATOM   227  C  CZ  . PHE A 1 55  ? 21.377 -14.758 -3.460  1.00 9.80  ? 73  PHE A CZ  1 
ATOM   228  N  N   . LEU A 1 56  ? 19.824 -14.701 2.005   1.00 8.61  ? 74  LEU A N   1 
ATOM   229  C  CA  . LEU A 1 56  ? 20.490 -15.902 2.529   1.00 7.67  ? 74  LEU A CA  1 
ATOM   230  C  C   . LEU A 1 56  ? 19.467 -16.983 2.949   1.00 7.74  ? 74  LEU A C   1 
ATOM   231  O  O   . LEU A 1 56  ? 19.713 -18.171 2.771   1.00 9.21  ? 74  LEU A O   1 
ATOM   232  C  CB  . LEU A 1 56  ? 21.432 -15.560 3.682   1.00 11.28 ? 74  LEU A CB  1 
ATOM   233  C  CG  . LEU A 1 56  ? 22.659 -14.734 3.299   1.00 9.60  ? 74  LEU A CG  1 
ATOM   234  C  CD1 . LEU A 1 56  ? 23.579 -14.634 4.535   1.00 13.68 ? 74  LEU A CD1 1 
ATOM   235  C  CD2 . LEU A 1 56  ? 23.452 -15.326 2.185   1.00 9.42  ? 74  LEU A CD2 1 
ATOM   236  N  N   . LYS A 1 57  ? 18.326 -16.564 3.479   1.00 5.31  ? 75  LYS A N   1 
ATOM   237  C  CA  . LYS A 1 57  ? 17.251 -17.523 3.803   1.00 4.07  ? 75  LYS A CA  1 
ATOM   238  C  C   . LYS A 1 57  ? 16.835 -18.308 2.572   1.00 4.89  ? 75  LYS A C   1 
ATOM   239  O  O   . LYS A 1 57  ? 16.526 -19.489 2.671   1.00 7.94  ? 75  LYS A O   1 
ATOM   240  C  CB  . LYS A 1 57  ? 16.080 -16.846 4.480   1.00 6.83  ? 75  LYS A CB  1 
ATOM   241  C  CG  . LYS A 1 57  ? 16.371 -16.433 5.904   1.00 10.90 ? 75  LYS A CG  1 
ATOM   242  C  CD  . LYS A 1 57  ? 15.209 -15.628 6.469   1.00 13.09 ? 75  LYS A CD  1 
ATOM   243  C  CE  . LYS A 1 57  ? 15.475 -15.115 7.865   1.00 18.27 ? 75  LYS A CE  1 
ATOM   244  N  NZ  . LYS A 1 57  ? 14.344 -14.235 8.326   1.00 19.35 ? 75  LYS A NZ  1 
ATOM   245  N  N   . THR A 1 58  ? 16.836 -17.657 1.409   1.00 5.08  ? 76  THR A N   1 
ATOM   246  C  CA  . THR A 1 58  ? 16.447 -18.329 0.157   1.00 6.97  ? 76  THR A CA  1 
ATOM   247  C  C   . THR A 1 58  ? 17.494 -19.346 -0.327  1.00 8.09  ? 76  THR A C   1 
ATOM   248  O  O   . THR A 1 58  ? 17.169 -20.236 -1.109  1.00 8.72  ? 76  THR A O   1 
ATOM   249  C  CB  . THR A 1 58  ? 16.081 -17.341 -0.972  1.00 7.37  ? 76  THR A CB  1 
ATOM   250  O  OG1 . THR A 1 58  ? 17.264 -16.813 -1.584  1.00 6.47  ? 76  THR A OG1 1 
ATOM   251  C  CG2 . THR A 1 58  ? 15.175 -16.208 -0.456  1.00 10.42 ? 76  THR A CG2 1 
ATOM   252  N  N   . GLU A 1 59  ? 18.731 -19.224 0.153   1.00 8.33  ? 77  GLU A N   1 
ATOM   253  C  CA  . GLU A 1 59  ? 19.818 -20.159 -0.181  1.00 8.37  ? 77  GLU A CA  1 
ATOM   254  C  C   . GLU A 1 59  ? 20.194 -21.055 1.002   1.00 7.48  ? 77  GLU A C   1 
ATOM   255  O  O   . GLU A 1 59  ? 21.183 -21.810 0.938   1.00 7.64  ? 77  GLU A O   1 
ATOM   256  C  CB  . GLU A 1 59  ? 21.067 -19.357 -0.600  1.00 15.91 ? 77  GLU A CB  1 
ATOM   257  C  CG  . GLU A 1 59  ? 20.868 -18.555 -1.859  1.00 23.47 ? 77  GLU A CG  1 
ATOM   258  C  CD  . GLU A 1 59  ? 22.173 -18.188 -2.535  1.00 26.24 ? 77  GLU A CD  1 
ATOM   259  O  OE1 . GLU A 1 59  ? 23.153 -17.937 -1.816  1.00 15.49 ? 77  GLU A OE1 1 
ATOM   260  O  OE2 . GLU A 1 59  ? 22.206 -18.175 -3.787  1.00 25.99 ? 77  GLU A OE2 1 
ATOM   261  N  N   . PHE A 1 60  ? 19.441 -20.948 2.092   1.00 5.73  ? 78  PHE A N   1 
ATOM   262  C  CA  . PHE A 1 60  ? 19.614 -21.809 3.252   1.00 8.35  ? 78  PHE A CA  1 
ATOM   263  C  C   . PHE A 1 60  ? 21.001 -21.672 3.845   1.00 13.88 ? 78  PHE A C   1 
ATOM   264  O  O   . PHE A 1 60  ? 21.662 -22.669 4.150   1.00 10.14 ? 78  PHE A O   1 
ATOM   265  C  CB  . PHE A 1 60  ? 19.323 -23.278 2.894   1.00 5.37  ? 78  PHE A CB  1 
ATOM   266  C  CG  . PHE A 1 60  ? 18.032 -23.459 2.117   1.00 6.66  ? 78  PHE A CG  1 
ATOM   267  C  CD1 . PHE A 1 60  ? 16.813 -23.516 2.777   1.00 6.85  ? 78  PHE A CD1 1 
ATOM   268  C  CD2 . PHE A 1 60  ? 18.033 -23.476 0.724   1.00 4.29  ? 78  PHE A CD2 1 
ATOM   269  C  CE1 . PHE A 1 60  ? 15.617 -23.644 2.067   1.00 8.99  ? 78  PHE A CE1 1 
ATOM   270  C  CE2 . PHE A 1 60  ? 16.851 -23.582 0.010   1.00 6.93  ? 78  PHE A CE2 1 
ATOM   271  C  CZ  . PHE A 1 60  ? 15.642 -23.671 0.677   1.00 10.19 ? 78  PHE A CZ  1 
ATOM   272  N  N   . SER A 1 61  ? 21.440 -20.427 3.990   1.00 8.45  ? 79  SER A N   1 
ATOM   273  C  CA  . SER A 1 61  ? 22.771 -20.160 4.543   1.00 11.36 ? 79  SER A CA  1 
ATOM   274  C  C   . SER A 1 61  ? 22.803 -18.978 5.503   1.00 11.20 ? 79  SER A C   1 
ATOM   275  O  O   . SER A 1 61  ? 23.877 -18.450 5.799   1.00 11.37 ? 79  SER A O   1 
ATOM   276  C  CB  . SER A 1 61  ? 23.761 -19.947 3.396   1.00 14.61 ? 79  SER A CB  1 
ATOM   277  O  OG  . SER A 1 61  ? 23.452 -18.769 2.685   1.00 16.57 ? 79  SER A OG  1 
ATOM   278  N  N   . GLU A 1 62  ? 21.638 -18.557 5.995   1.00 8.97  ? 80  GLU A N   1 
ATOM   279  C  CA  . GLU A 1 62  ? 21.570 -17.373 6.836   1.00 11.51 ? 80  GLU A CA  1 
ATOM   280  C  C   . GLU A 1 62  ? 22.322 -17.535 8.163   1.00 10.93 ? 80  GLU A C   1 
ATOM   281  O  O   . GLU A 1 62  ? 22.650 -16.535 8.798   1.00 9.65  ? 80  GLU A O   1 
ATOM   282  C  CB  . GLU A 1 62  ? 20.111 -16.898 7.069   1.00 8.28  ? 80  GLU A CB  1 
ATOM   283  C  CG  . GLU A 1 62  ? 19.289 -17.657 8.086   1.00 10.74 ? 80  GLU A CG  1 
ATOM   284  C  CD  . GLU A 1 62  ? 18.766 -18.998 7.615   1.00 17.75 ? 80  GLU A CD  1 
ATOM   285  O  OE1 . GLU A 1 62  ? 18.886 -19.374 6.431   1.00 10.78 ? 80  GLU A OE1 1 
ATOM   286  O  OE2 . GLU A 1 62  ? 18.179 -19.687 8.464   1.00 12.16 ? 80  GLU A OE2 1 
ATOM   287  N  N   . GLU A 1 63  ? 22.574 -18.783 8.582   1.00 8.44  ? 81  GLU A N   1 
ATOM   288  C  CA  . GLU A 1 63  ? 23.412 -19.032 9.780   1.00 9.21  ? 81  GLU A CA  1 
ATOM   289  C  C   . GLU A 1 63  ? 24.770 -18.305 9.686   1.00 8.58  ? 81  GLU A C   1 
ATOM   290  O  O   . GLU A 1 63  ? 25.315 -17.877 10.700  1.00 8.70  ? 81  GLU A O   1 
ATOM   291  C  CB  . GLU A 1 63  ? 23.595 -20.526 10.046  1.00 12.92 ? 81  GLU A CB  1 
ATOM   292  C  CG  . GLU A 1 63  ? 24.266 -21.365 8.949   1.00 17.46 ? 81  GLU A CG  1 
ATOM   293  C  CD  . GLU A 1 63  ? 23.273 -21.987 7.939   1.00 23.70 ? 81  GLU A CD  1 
ATOM   294  O  OE1 . GLU A 1 63  ? 22.168 -21.442 7.696   1.00 13.94 ? 81  GLU A OE1 1 
ATOM   295  O  OE2 . GLU A 1 63  ? 23.615 -23.039 7.357   1.00 26.47 ? 81  GLU A OE2 1 
ATOM   296  N  N   . ASN A 1 64  ? 25.321 -18.189 8.473   1.00 8.98  ? 82  ASN A N   1 
ATOM   297  C  CA  . ASN A 1 64  ? 26.596 -17.481 8.310   1.00 13.83 ? 82  ASN A CA  1 
ATOM   298  C  C   . ASN A 1 64  ? 26.480 -16.040 8.809   1.00 11.13 ? 82  ASN A C   1 
ATOM   299  O  O   . ASN A 1 64  ? 27.355 -15.542 9.517   1.00 10.15 ? 82  ASN A O   1 
ATOM   300  C  CB  . ASN A 1 64  ? 27.039 -17.497 6.851   1.00 12.51 ? 82  ASN A CB  1 
ATOM   301  C  CG  . ASN A 1 64  ? 27.438 -18.880 6.372   1.00 12.45 ? 82  ASN A CG  1 
ATOM   302  O  OD1 . ASN A 1 64  ? 27.789 -19.739 7.169   1.00 11.60 ? 82  ASN A OD1 1 
ATOM   303  N  ND2 . ASN A 1 64  ? 27.415 -19.090 5.054   1.00 15.21 ? 82  ASN A ND2 1 
ATOM   304  N  N   . LEU A 1 65  ? 25.386 -15.380 8.444   1.00 9.87  ? 83  LEU A N   1 
ATOM   305  C  CA  . LEU A 1 65  ? 25.175 -13.985 8.821   1.00 10.53 ? 83  LEU A CA  1 
ATOM   306  C  C   . LEU A 1 65  ? 24.764 -13.871 10.284  1.00 10.24 ? 83  LEU A C   1 
ATOM   307  O  O   . LEU A 1 65  ? 25.193 -12.961 10.992  1.00 9.56  ? 83  LEU A O   1 
ATOM   308  C  CB  . LEU A 1 65  ? 24.120 -13.347 7.912   1.00 7.80  ? 83  LEU A CB  1 
ATOM   309  C  CG  . LEU A 1 65  ? 23.782 -11.894 8.199   1.00 10.01 ? 83  LEU A CG  1 
ATOM   310  C  CD1 . LEU A 1 65  ? 24.991 -10.983 7.926   1.00 8.55  ? 83  LEU A CD1 1 
ATOM   311  C  CD2 . LEU A 1 65  ? 22.549 -11.508 7.360   1.00 10.65 ? 83  LEU A CD2 1 
ATOM   312  N  N   . GLU A 1 66  ? 23.912 -14.790 10.739  1.00 8.22  ? 84  GLU A N   1 
ATOM   313  C  CA  . GLU A 1 66  ? 23.530 -14.840 12.161  1.00 6.72  ? 84  GLU A CA  1 
ATOM   314  C  C   . GLU A 1 66  ? 24.764 -14.977 13.066  1.00 5.90  ? 84  GLU A C   1 
ATOM   315  O  O   . GLU A 1 66  ? 24.896 -14.261 14.084  1.00 8.58  ? 84  GLU A O   1 
ATOM   316  C  CB  . GLU A 1 66  ? 22.494 -15.949 12.391  1.00 8.54  ? 84  GLU A CB  1 
ATOM   317  C  CG  . GLU A 1 66  ? 21.158 -15.680 11.655  1.00 9.53  ? 84  GLU A CG  1 
ATOM   318  C  CD  . GLU A 1 66  ? 20.177 -16.856 11.673  1.00 15.40 ? 84  GLU A CD  1 
ATOM   319  O  OE1 . GLU A 1 66  ? 20.619 -18.008 11.878  1.00 11.55 ? 84  GLU A OE1 1 
ATOM   320  O  OE2 . GLU A 1 66  ? 18.956 -16.626 11.444  1.00 13.74 ? 84  GLU A OE2 1 
ATOM   321  N  N   . PHE A 1 67  ? 25.686 -15.853 12.687  1.00 7.08  ? 85  PHE A N   1 
ATOM   322  C  CA  . PHE A 1 67  ? 26.921 -16.023 13.439  1.00 8.72  ? 85  PHE A CA  1 
ATOM   323  C  C   . PHE A 1 67  ? 27.770 -14.750 13.379  1.00 9.60  ? 85  PHE A C   1 
ATOM   324  O  O   . PHE A 1 67  ? 28.291 -14.283 14.395  1.00 9.74  ? 85  PHE A O   1 
ATOM   325  C  CB  . PHE A 1 67  ? 27.734 -17.196 12.888  1.00 10.22 ? 85  PHE A CB  1 
ATOM   326  C  CG  . PHE A 1 67  ? 29.073 -17.364 13.543  1.00 10.86 ? 85  PHE A CG  1 
ATOM   327  C  CD1 . PHE A 1 67  ? 29.182 -17.494 14.918  1.00 10.68 ? 85  PHE A CD1 1 
ATOM   328  C  CD2 . PHE A 1 67  ? 30.244 -17.409 12.779  1.00 8.59  ? 85  PHE A CD2 1 
ATOM   329  C  CE1 . PHE A 1 67  ? 30.438 -17.652 15.523  1.00 13.64 ? 85  PHE A CE1 1 
ATOM   330  C  CE2 . PHE A 1 67  ? 31.503 -17.575 13.389  1.00 11.30 ? 85  PHE A CE2 1 
ATOM   331  C  CZ  . PHE A 1 67  ? 31.596 -17.671 14.751  1.00 9.88  ? 85  PHE A CZ  1 
ATOM   332  N  N   . TRP A 1 68  ? 27.927 -14.197 12.183  1.00 8.35  ? 86  TRP A N   1 
ATOM   333  C  CA  . TRP A 1 68  ? 28.740 -12.981 12.037  1.00 8.73  ? 86  TRP A CA  1 
ATOM   334  C  C   . TRP A 1 68  ? 28.213 -11.836 12.926  1.00 10.04 ? 86  TRP A C   1 
ATOM   335  O  O   . TRP A 1 68  ? 28.996 -11.159 13.629  1.00 8.47  ? 86  TRP A O   1 
ATOM   336  C  CB  . TRP A 1 68  ? 28.831 -12.569 10.562  1.00 6.74  ? 86  TRP A CB  1 
ATOM   337  C  CG  . TRP A 1 68  ? 29.820 -11.490 10.317  1.00 7.59  ? 86  TRP A CG  1 
ATOM   338  C  CD1 . TRP A 1 68  ? 31.144 -11.657 10.061  1.00 11.53 ? 86  TRP A CD1 1 
ATOM   339  C  CD2 . TRP A 1 68  ? 29.596 -10.068 10.361  1.00 11.34 ? 86  TRP A CD2 1 
ATOM   340  N  NE1 . TRP A 1 68  ? 31.759 -10.444 9.921   1.00 12.06 ? 86  TRP A NE1 1 
ATOM   341  C  CE2 . TRP A 1 68  ? 30.832 -9.449  10.095  1.00 12.58 ? 86  TRP A CE2 1 
ATOM   342  C  CE3 . TRP A 1 68  ? 28.463 -9.263  10.569  1.00 11.44 ? 86  TRP A CE3 1 
ATOM   343  C  CZ2 . TRP A 1 68  ? 30.983 -8.049  10.036  1.00 12.86 ? 86  TRP A CZ2 1 
ATOM   344  C  CZ3 . TRP A 1 68  ? 28.610 -7.874  10.512  1.00 15.44 ? 86  TRP A CZ3 1 
ATOM   345  C  CH2 . TRP A 1 68  ? 29.860 -7.285  10.258  1.00 12.92 ? 86  TRP A CH2 1 
ATOM   346  N  N   . LEU A 1 69  ? 26.895 -11.635 12.910  1.00 9.10  ? 87  LEU A N   1 
ATOM   347  C  CA  . LEU A 1 69  ? 26.265 -10.589 13.707  1.00 7.00  ? 87  LEU A CA  1 
ATOM   348  C  C   . LEU A 1 69  ? 26.367 -10.859 15.216  1.00 8.74  ? 87  LEU A C   1 
ATOM   349  O  O   . LEU A 1 69  ? 26.550 -9.906  16.009  1.00 10.61 ? 87  LEU A O   1 
ATOM   350  C  CB  . LEU A 1 69  ? 24.818 -10.406 13.277  1.00 7.37  ? 87  LEU A CB  1 
ATOM   351  C  CG  . LEU A 1 69  ? 24.616 -9.874  11.862  1.00 9.24  ? 87  LEU A CG  1 
ATOM   352  C  CD1 . LEU A 1 69  ? 23.156 -10.108 11.456  1.00 12.22 ? 87  LEU A CD1 1 
ATOM   353  C  CD2 . LEU A 1 69  ? 25.005 -8.386  11.730  1.00 13.79 ? 87  LEU A CD2 1 
ATOM   354  N  N   . ALA A 1 70  ? 26.217 -12.126 15.603  1.00 8.45  ? 88  ALA A N   1 
ATOM   355  C  CA  . ALA A 1 70  ? 26.411 -12.516 17.007  1.00 11.12 ? 88  ALA A CA  1 
ATOM   356  C  C   . ALA A 1 70  ? 27.826 -12.168 17.485  1.00 8.07  ? 88  ALA A C   1 
ATOM   357  O  O   . ALA A 1 70  ? 28.018 -11.698 18.623  1.00 5.88  ? 88  ALA A O   1 
ATOM   358  C  CB  . ALA A 1 70  ? 26.142 -13.987 17.191  1.00 8.03  ? 88  ALA A CB  1 
ATOM   359  N  N   . CYS A 1 71  ? 28.821 -12.397 16.629  1.00 4.89  ? 89  CYS A N   1 
ATOM   360  C  CA  . CYS A 1 71  ? 30.207 -12.045 16.968  1.00 3.89  ? 89  CYS A CA  1 
ATOM   361  C  C   . CYS A 1 71  ? 30.369 -10.539 17.127  1.00 4.66  ? 89  CYS A C   1 
ATOM   362  O  O   . CYS A 1 71  ? 31.066 -10.077 18.016  1.00 6.48  ? 89  CYS A O   1 
ATOM   363  C  CB  . CYS A 1 71  ? 31.189 -12.584 15.929  1.00 8.45  ? 89  CYS A CB  1 
ATOM   364  S  SG  . CYS A 1 71  ? 31.316 -14.389 15.893  1.00 8.56  ? 89  CYS A SG  1 
ATOM   365  N  N   . GLU A 1 72  ? 29.695 -9.776  16.273  1.00 4.71  ? 90  GLU A N   1 
ATOM   366  C  CA  . GLU A 1 72  ? 29.764 -8.322  16.372  1.00 8.82  ? 90  GLU A CA  1 
ATOM   367  C  C   . GLU A 1 72  ? 29.186 -7.854  17.709  1.00 9.48  ? 90  GLU A C   1 
ATOM   368  O  O   . GLU A 1 72  ? 29.763 -6.983  18.376  1.00 13.16 ? 90  GLU A O   1 
ATOM   369  C  CB  . GLU A 1 72  ? 29.035 -7.673  15.196  1.00 7.77  ? 90  GLU A CB  1 
ATOM   370  C  CG  . GLU A 1 72  ? 29.788 -7.799  13.880  1.00 11.18 ? 90  GLU A CG  1 
ATOM   371  C  CD  . GLU A 1 72  ? 31.127 -7.079  13.896  1.00 15.92 ? 90  GLU A CD  1 
ATOM   372  O  OE1 . GLU A 1 72  ? 31.141 -5.832  13.801  1.00 15.56 ? 90  GLU A OE1 1 
ATOM   373  O  OE2 . GLU A 1 72  ? 32.168 -7.755  14.002  1.00 10.51 ? 90  GLU A OE2 1 
ATOM   374  N  N   . GLU A 1 73  ? 28.069 -8.451  18.115  1.00 6.34  ? 91  GLU A N   1 
ATOM   375  C  CA  . GLU A 1 73  ? 27.443 -8.129  19.402  1.00 8.50  ? 91  GLU A CA  1 
ATOM   376  C  C   . GLU A 1 73  ? 28.345 -8.567  20.550  1.00 6.03  ? 91  GLU A C   1 
ATOM   377  O  O   . GLU A 1 73  ? 28.511 -7.831  21.542  1.00 9.25  ? 91  GLU A O   1 
ATOM   378  C  CB  . GLU A 1 73  ? 26.094 -8.813  19.538  1.00 11.56 ? 91  GLU A CB  1 
ATOM   379  C  CG  . GLU A 1 73  ? 25.292 -8.360  20.755  1.00 25.94 ? 91  GLU A CG  1 
ATOM   380  N  N   . PHE A 1 74  ? 28.942 -9.753  20.407  1.00 6.72  ? 92  PHE A N   1 
ATOM   381  C  CA  . PHE A 1 74  ? 29.867 -10.275 21.420  1.00 5.36  ? 92  PHE A CA  1 
ATOM   382  C  C   . PHE A 1 74  ? 30.998 -9.292  21.726  1.00 7.61  ? 92  PHE A C   1 
ATOM   383  O  O   . PHE A 1 74  ? 31.383 -9.117  22.894  1.00 7.89  ? 92  PHE A O   1 
ATOM   384  C  CB  . PHE A 1 74  ? 30.448 -11.617 20.955  1.00 4.99  ? 92  PHE A CB  1 
ATOM   385  C  CG  . PHE A 1 74  ? 31.462 -12.197 21.896  1.00 2.45  ? 92  PHE A CG  1 
ATOM   386  C  CD1 . PHE A 1 74  ? 31.085 -12.694 23.133  1.00 3.95  ? 92  PHE A CD1 1 
ATOM   387  C  CD2 . PHE A 1 74  ? 32.801 -12.248 21.538  1.00 5.69  ? 92  PHE A CD2 1 
ATOM   388  C  CE1 . PHE A 1 74  ? 32.036 -13.250 23.985  1.00 6.32  ? 92  PHE A CE1 1 
ATOM   389  C  CE2 . PHE A 1 74  ? 33.766 -12.794 22.389  1.00 5.14  ? 92  PHE A CE2 1 
ATOM   390  C  CZ  . PHE A 1 74  ? 33.379 -13.278 23.620  1.00 4.89  ? 92  PHE A CZ  1 
ATOM   391  N  N   . LYS A 1 75  ? 31.528 -8.643  20.686  1.00 3.84  ? 93  LYS A N   1 
ATOM   392  C  CA  . LYS A 1 75  ? 32.642 -7.706  20.821  1.00 7.89  ? 93  LYS A CA  1 
ATOM   393  C  C   . LYS A 1 75  ? 32.317 -6.426  21.608  1.00 3.71  ? 93  LYS A C   1 
ATOM   394  O  O   . LYS A 1 75  ? 33.232 -5.717  22.028  1.00 5.22  ? 93  LYS A O   1 
ATOM   395  C  CB  . LYS A 1 75  ? 33.215 -7.359  19.438  1.00 9.15  ? 93  LYS A CB  1 
ATOM   396  C  CG  . LYS A 1 75  ? 33.995 -8.511  18.821  1.00 17.76 ? 93  LYS A CG  1 
ATOM   397  C  CD  . LYS A 1 75  ? 34.759 -8.098  17.565  1.00 23.76 ? 93  LYS A CD  1 
ATOM   398  C  CE  . LYS A 1 75  ? 33.877 -8.013  16.349  1.00 29.50 ? 93  LYS A CE  1 
ATOM   399  N  NZ  . LYS A 1 75  ? 34.691 -8.043  15.100  1.00 17.90 ? 93  LYS A NZ  1 
ATOM   400  N  N   . LYS A 1 76  ? 31.029 -6.157  21.824  1.00 5.07  ? 94  LYS A N   1 
ATOM   401  C  CA  . LYS A 1 76  ? 30.588 -5.038  22.629  1.00 6.12  ? 94  LYS A CA  1 
ATOM   402  C  C   . LYS A 1 76  ? 30.512 -5.350  24.112  1.00 4.10  ? 94  LYS A C   1 
ATOM   403  O  O   . LYS A 1 76  ? 30.220 -4.461  24.903  1.00 5.48  ? 94  LYS A O   1 
ATOM   404  C  CB  . LYS A 1 76  ? 29.235 -4.524  22.143  1.00 13.44 ? 94  LYS A CB  1 
ATOM   405  C  CG  . LYS A 1 76  ? 29.314 -3.861  20.775  1.00 17.90 ? 94  LYS A CG  1 
ATOM   406  C  CD  . LYS A 1 76  ? 27.937 -3.638  20.190  1.00 22.68 ? 94  LYS A CD  1 
ATOM   407  C  CE  . LYS A 1 76  ? 28.034 -3.128  18.764  1.00 33.26 ? 94  LYS A CE  1 
ATOM   408  N  NZ  . LYS A 1 76  ? 26.707 -3.101  18.092  1.00 23.56 ? 94  LYS A NZ  1 
ATOM   409  N  N   . THR A 1 77  ? 30.826 -6.584  24.494  1.00 2.03  ? 95  THR A N   1 
ATOM   410  C  CA  . THR A 1 77  ? 30.691 -7.024  25.876  1.00 3.26  ? 95  THR A CA  1 
ATOM   411  C  C   . THR A 1 77  ? 31.748 -6.384  26.772  1.00 3.72  ? 95  THR A C   1 
ATOM   412  O  O   . THR A 1 77  ? 32.919 -6.325  26.411  1.00 3.67  ? 95  THR A O   1 
ATOM   413  C  CB  . THR A 1 77  ? 30.798 -8.549  25.971  1.00 3.38  ? 95  THR A CB  1 
ATOM   414  O  OG1 . THR A 1 77  ? 29.820 -9.154  25.103  1.00 8.09  ? 95  THR A OG1 1 
ATOM   415  C  CG2 . THR A 1 77  ? 30.608 -9.027  27.420  1.00 6.10  ? 95  THR A CG2 1 
ATOM   416  N  N   . ARG A 1 78  ? 31.315 -5.907  27.928  1.00 3.80  ? 96  ARG A N   1 
ATOM   417  C  CA  . ARG A 1 78  ? 32.194 -5.239  28.886  1.00 2.00  ? 96  ARG A CA  1 
ATOM   418  C  C   . ARG A 1 78  ? 32.415 -6.160  30.066  1.00 7.18  ? 96  ARG A C   1 
ATOM   419  O  O   . ARG A 1 78  ? 33.559 -6.510  30.369  1.00 12.10 ? 96  ARG A O   1 
ATOM   420  C  CB  . ARG A 1 78  ? 31.611 -3.875  29.280  1.00 5.70  ? 96  ARG A CB  1 
ATOM   421  C  CG  . ARG A 1 78  ? 31.285 -3.015  28.032  1.00 16.97 ? 96  ARG A CG  1 
ATOM   422  C  CD  . ARG A 1 78  ? 30.535 -1.725  28.347  1.00 26.94 ? 96  ARG A CD  1 
ATOM   423  N  NE  . ARG A 1 78  ? 29.228 -1.973  28.958  1.00 40.64 ? 96  ARG A NE  1 
ATOM   424  C  CZ  . ARG A 1 78  ? 28.240 -1.083  29.038  1.00 41.83 ? 96  ARG A CZ  1 
ATOM   425  N  NH1 . ARG A 1 78  ? 28.367 0.134   28.519  1.00 43.98 ? 96  ARG A NH1 1 
ATOM   426  N  NH2 . ARG A 1 78  ? 27.103 -1.421  29.633  1.00 39.85 ? 96  ARG A NH2 1 
ATOM   427  N  N   . SER A 1 79  ? 31.319 -6.590  30.687  1.00 4.55  ? 97  SER A N   1 
ATOM   428  C  CA  . SER A 1 79  ? 31.356 -7.529  31.828  1.00 4.41  ? 97  SER A CA  1 
ATOM   429  C  C   . SER A 1 79  ? 32.058 -8.836  31.499  1.00 5.46  ? 97  SER A C   1 
ATOM   430  O  O   . SER A 1 79  ? 31.702 -9.514  30.529  1.00 4.53  ? 97  SER A O   1 
ATOM   431  C  CB  . SER A 1 79  ? 29.935 -7.851  32.291  1.00 2.00  ? 97  SER A CB  1 
ATOM   432  O  OG  . SER A 1 79  ? 29.952 -8.918  33.221  1.00 3.53  ? 97  SER A OG  1 
ATOM   433  N  N   . THR A 1 80  ? 33.031 -9.212  32.323  1.00 3.10  ? 98  THR A N   1 
ATOM   434  C  CA  . THR A 1 80  ? 33.790 -10.452 32.075  1.00 4.33  ? 98  THR A CA  1 
ATOM   435  C  C   . THR A 1 80  ? 32.937 -11.716 32.348  1.00 4.68  ? 98  THR A C   1 
ATOM   436  O  O   . THR A 1 80  ? 33.069 -12.727 31.664  1.00 7.49  ? 98  THR A O   1 
ATOM   437  C  CB  . THR A 1 80  ? 35.143 -10.472 32.847  1.00 12.89 ? 98  THR A CB  1 
ATOM   438  O  OG1 . THR A 1 80  ? 34.908 -10.498 34.249  1.00 18.98 ? 98  THR A OG1 1 
ATOM   439  C  CG2 . THR A 1 80  ? 35.963 -9.249  32.504  1.00 10.45 ? 98  THR A CG2 1 
ATOM   440  N  N   . ALA A 1 81  ? 32.011 -11.632 33.290  1.00 4.18  ? 99  ALA A N   1 
ATOM   441  C  CA  . ALA A 1 81  ? 31.071 -12.740 33.534  1.00 2.84  ? 99  ALA A CA  1 
ATOM   442  C  C   . ALA A 1 81  ? 30.136 -12.973 32.343  1.00 5.74  ? 99  ALA A C   1 
ATOM   443  O  O   . ALA A 1 81  ? 29.872 -14.108 31.953  1.00 4.61  ? 99  ALA A O   1 
ATOM   444  C  CB  . ALA A 1 81  ? 30.249 -12.464 34.808  1.00 4.97  ? 99  ALA A CB  1 
ATOM   445  N  N   . LYS A 1 82  ? 29.624 -11.884 31.776  1.00 4.85  ? 100 LYS A N   1 
ATOM   446  C  CA  . LYS A 1 82  ? 28.759 -11.959 30.594  1.00 3.40  ? 100 LYS A CA  1 
ATOM   447  C  C   . LYS A 1 82  ? 29.576 -12.444 29.398  1.00 5.57  ? 100 LYS A C   1 
ATOM   448  O  O   . LYS A 1 82  ? 29.092 -13.230 28.585  1.00 5.48  ? 100 LYS A O   1 
ATOM   449  C  CB  . LYS A 1 82  ? 28.132 -10.596 30.310  1.00 3.03  ? 100 LYS A CB  1 
ATOM   450  C  CG  . LYS A 1 82  ? 27.262 -10.527 29.065  1.00 7.19  ? 100 LYS A CG  1 
ATOM   451  C  CD  . LYS A 1 82  ? 26.775 -9.104  28.844  1.00 9.95  ? 100 LYS A CD  1 
ATOM   452  C  CE  . LYS A 1 82  ? 26.161 -8.922  27.493  1.00 13.11 ? 100 LYS A CE  1 
ATOM   453  N  NZ  . LYS A 1 82  ? 25.803 -7.492  27.231  1.00 14.35 ? 100 LYS A NZ  1 
ATOM   454  N  N   . LEU A 1 83  ? 30.806 -11.958 29.280  1.00 4.67  ? 101 LEU A N   1 
ATOM   455  C  CA  . LEU A 1 83  ? 31.697 -12.392 28.201  1.00 3.89  ? 101 LEU A CA  1 
ATOM   456  C  C   . LEU A 1 83  ? 31.800 -13.931 28.166  1.00 4.74  ? 101 LEU A C   1 
ATOM   457  O  O   . LEU A 1 83  ? 31.623 -14.552 27.120  1.00 5.84  ? 101 LEU A O   1 
ATOM   458  C  CB  . LEU A 1 83  ? 33.073 -11.745 28.361  1.00 4.43  ? 101 LEU A CB  1 
ATOM   459  C  CG  . LEU A 1 83  ? 34.075 -11.946 27.219  1.00 5.31  ? 101 LEU A CG  1 
ATOM   460  C  CD1 . LEU A 1 83  ? 35.256 -11.058 27.459  1.00 5.45  ? 101 LEU A CD1 1 
ATOM   461  C  CD2 . LEU A 1 83  ? 34.550 -13.401 27.115  1.00 11.95 ? 101 LEU A CD2 1 
ATOM   462  N  N   . VAL A 1 84  ? 32.053 -14.533 29.328  1.00 3.97  ? 102 VAL A N   1 
ATOM   463  C  CA  . VAL A 1 84  ? 32.193 -15.986 29.419  1.00 5.11  ? 102 VAL A CA  1 
ATOM   464  C  C   . VAL A 1 84  ? 30.895 -16.715 29.048  1.00 6.57  ? 102 VAL A C   1 
ATOM   465  O  O   . VAL A 1 84  ? 30.888 -17.615 28.201  1.00 5.62  ? 102 VAL A O   1 
ATOM   466  C  CB  . VAL A 1 84  ? 32.677 -16.405 30.809  1.00 7.98  ? 102 VAL A CB  1 
ATOM   467  C  CG1 . VAL A 1 84  ? 32.655 -17.921 30.943  1.00 6.92  ? 102 VAL A CG1 1 
ATOM   468  C  CG2 . VAL A 1 84  ? 34.092 -15.829 31.073  1.00 10.35 ? 102 VAL A CG2 1 
ATOM   469  N  N   . SER A 1 85  ? 29.776 -16.314 29.641  1.00 4.22  ? 103 SER A N   1 
ATOM   470  C  CA  . SER A 1 85  ? 28.514 -17.023 29.348  1.00 6.06  ? 103 SER A CA  1 
ATOM   471  C  C   . SER A 1 85  ? 28.120 -16.849 27.867  1.00 5.59  ? 103 SER A C   1 
ATOM   472  O  O   . SER A 1 85  ? 27.706 -17.810 27.194  1.00 5.66  ? 103 SER A O   1 
ATOM   473  C  CB  . SER A 1 85  ? 27.405 -16.585 30.306  1.00 11.59 ? 103 SER A CB  1 
ATOM   474  O  OG  . SER A 1 85  ? 27.088 -15.221 30.155  1.00 12.49 ? 103 SER A OG  1 
ATOM   475  N  N   . LYS A 1 86  ? 28.273 -15.636 27.341  1.00 4.89  ? 104 LYS A N   1 
ATOM   476  C  CA  A LYS A 1 86  ? 27.885 -15.371 25.944  0.50 3.92  ? 104 LYS A CA  1 
ATOM   477  C  CA  B LYS A 1 86  ? 27.903 -15.351 25.951  0.50 6.91  ? 104 LYS A CA  1 
ATOM   478  C  C   . LYS A 1 86  ? 28.796 -16.126 24.973  1.00 6.17  ? 104 LYS A C   1 
ATOM   479  O  O   . LYS A 1 86  ? 28.325 -16.627 23.952  1.00 5.22  ? 104 LYS A O   1 
ATOM   480  C  CB  A LYS A 1 86  ? 27.856 -13.868 25.633  0.50 6.41  ? 104 LYS A CB  1 
ATOM   481  C  CB  B LYS A 1 86  ? 27.968 -13.842 25.694  0.50 9.41  ? 104 LYS A CB  1 
ATOM   482  C  CG  A LYS A 1 86  ? 27.122 -13.554 24.324  0.50 5.90  ? 104 LYS A CG  1 
ATOM   483  C  CG  B LYS A 1 86  ? 27.347 -13.413 24.383  0.50 12.70 ? 104 LYS A CG  1 
ATOM   484  C  CD  A LYS A 1 86  ? 26.967 -12.055 24.044  0.50 9.68  ? 104 LYS A CD  1 
ATOM   485  C  CD  B LYS A 1 86  ? 26.873 -11.971 24.437  0.50 20.10 ? 104 LYS A CD  1 
ATOM   486  C  CE  A LYS A 1 86  ? 26.105 -11.321 25.082  0.50 9.68  ? 104 LYS A CE  1 
ATOM   487  C  CE  B LYS A 1 86  ? 26.260 -11.574 23.124  0.50 18.66 ? 104 LYS A CE  1 
ATOM   488  N  NZ  A LYS A 1 86  ? 24.724 -11.847 25.237  0.50 7.88  ? 104 LYS A NZ  1 
ATOM   489  N  NZ  B LYS A 1 86  ? 25.910 -10.137 23.050  0.50 16.85 ? 104 LYS A NZ  1 
ATOM   490  N  N   . ALA A 1 87  ? 30.090 -16.228 25.290  1.00 2.93  ? 105 ALA A N   1 
ATOM   491  C  CA  . ALA A 1 87  ? 31.034 -16.986 24.447  1.00 2.00  ? 105 ALA A CA  1 
ATOM   492  C  C   . ALA A 1 87  ? 30.586 -18.457 24.345  1.00 5.46  ? 105 ALA A C   1 
ATOM   493  O  O   . ALA A 1 87  ? 30.527 -19.032 23.256  1.00 6.11  ? 105 ALA A O   1 
ATOM   494  C  CB  . ALA A 1 87  ? 32.450 -16.875 24.945  1.00 5.03  ? 105 ALA A CB  1 
ATOM   495  N  N   . HIS A 1 88  ? 30.225 -19.056 25.476  1.00 6.20  ? 106 HIS A N   1 
ATOM   496  C  CA  . HIS A 1 88  ? 29.754 -20.445 25.446  1.00 4.43  ? 106 HIS A CA  1 
ATOM   497  C  C   . HIS A 1 88  ? 28.459 -20.616 24.656  1.00 3.23  ? 106 HIS A C   1 
ATOM   498  O  O   . HIS A 1 88  ? 28.312 -21.604 23.959  1.00 6.79  ? 106 HIS A O   1 
ATOM   499  C  CB  . HIS A 1 88  ? 29.629 -21.001 26.844  1.00 4.62  ? 106 HIS A CB  1 
ATOM   500  C  CG  . HIS A 1 88  ? 30.953 -21.355 27.441  1.00 5.25  ? 106 HIS A CG  1 
ATOM   501  N  ND1 . HIS A 1 88  ? 31.591 -22.544 27.161  1.00 10.23 ? 106 HIS A ND1 1 
ATOM   502  C  CD2 . HIS A 1 88  ? 31.777 -20.664 28.262  1.00 9.04  ? 106 HIS A CD2 1 
ATOM   503  C  CE1 . HIS A 1 88  ? 32.739 -22.585 27.818  1.00 17.72 ? 106 HIS A CE1 1 
ATOM   504  N  NE2 . HIS A 1 88  ? 32.876 -21.458 28.495  1.00 13.59 ? 106 HIS A NE2 1 
ATOM   505  N  N   . ARG A 1 89  ? 27.534 -19.663 24.753  1.00 3.02  ? 107 ARG A N   1 
ATOM   506  C  CA  . ARG A 1 89  ? 26.268 -19.773 24.025  1.00 2.14  ? 107 ARG A CA  1 
ATOM   507  C  C   . ARG A 1 89  ? 26.481 -19.706 22.514  1.00 2.00  ? 107 ARG A C   1 
ATOM   508  O  O   . ARG A 1 89  ? 25.918 -20.516 21.755  1.00 4.11  ? 107 ARG A O   1 
ATOM   509  C  CB  . ARG A 1 89  ? 25.308 -18.686 24.490  1.00 6.20  ? 107 ARG A CB  1 
ATOM   510  C  CG  . ARG A 1 89  ? 24.793 -19.001 25.880  1.00 7.91  ? 107 ARG A CG  1 
ATOM   511  C  CD  . ARG A 1 89  ? 23.724 -18.086 26.331  1.00 16.50 ? 107 ARG A CD  1 
ATOM   512  N  NE  . ARG A 1 89  ? 22.660 -17.881 25.348  1.00 20.47 ? 107 ARG A NE  1 
ATOM   513  C  CZ  . ARG A 1 89  ? 21.736 -16.937 25.497  1.00 19.58 ? 107 ARG A CZ  1 
ATOM   514  N  NH1 . ARG A 1 89  ? 21.767 -16.197 26.593  1.00 14.82 ? 107 ARG A NH1 1 
ATOM   515  N  NH2 . ARG A 1 89  ? 20.794 -16.739 24.573  1.00 9.49  ? 107 ARG A NH2 1 
ATOM   516  N  N   . ILE A 1 90  ? 27.315 -18.763 22.093  1.00 6.56  ? 108 ILE A N   1 
ATOM   517  C  CA  . ILE A 1 90  ? 27.593 -18.550 20.668  1.00 6.18  ? 108 ILE A CA  1 
ATOM   518  C  C   . ILE A 1 90  ? 28.355 -19.754 20.127  1.00 4.35  ? 108 ILE A C   1 
ATOM   519  O  O   . ILE A 1 90  ? 27.992 -20.287 19.078  1.00 5.20  ? 108 ILE A O   1 
ATOM   520  C  CB  . ILE A 1 90  ? 28.383 -17.219 20.429  1.00 4.53  ? 108 ILE A CB  1 
ATOM   521  C  CG1 . ILE A 1 90  ? 27.526 -16.001 20.753  1.00 5.42  ? 108 ILE A CG1 1 
ATOM   522  C  CG2 . ILE A 1 90  ? 28.906 -17.137 18.986  1.00 7.94  ? 108 ILE A CG2 1 
ATOM   523  C  CD1 . ILE A 1 90  ? 28.325 -14.710 20.714  1.00 6.87  ? 108 ILE A CD1 1 
ATOM   524  N  N   . PHE A 1 91  ? 29.372 -20.213 20.848  1.00 3.02  ? 109 PHE A N   1 
ATOM   525  C  CA  . PHE A 1 91  ? 30.121 -21.416 20.451  1.00 3.71  ? 109 PHE A CA  1 
ATOM   526  C  C   . PHE A 1 91  ? 29.198 -22.623 20.273  1.00 5.58  ? 109 PHE A C   1 
ATOM   527  O  O   . PHE A 1 91  ? 29.282 -23.345 19.265  1.00 4.22  ? 109 PHE A O   1 
ATOM   528  C  CB  . PHE A 1 91  ? 31.212 -21.734 21.464  1.00 3.62  ? 109 PHE A CB  1 
ATOM   529  C  CG  . PHE A 1 91  ? 32.065 -22.918 21.089  1.00 5.82  ? 109 PHE A CG  1 
ATOM   530  C  CD1 . PHE A 1 91  ? 33.109 -22.776 20.177  1.00 8.84  ? 109 PHE A CD1 1 
ATOM   531  C  CD2 . PHE A 1 91  ? 31.824 -24.164 21.642  1.00 9.54  ? 109 PHE A CD2 1 
ATOM   532  C  CE1 . PHE A 1 91  ? 33.908 -23.881 19.816  1.00 13.46 ? 109 PHE A CE1 1 
ATOM   533  C  CE2 . PHE A 1 91  ? 32.613 -25.252 21.293  1.00 13.00 ? 109 PHE A CE2 1 
ATOM   534  C  CZ  . PHE A 1 91  ? 33.658 -25.105 20.381  1.00 8.06  ? 109 PHE A CZ  1 
ATOM   535  N  N   . GLU A 1 92  ? 28.314 -22.838 21.247  1.00 4.45  ? 110 GLU A N   1 
ATOM   536  C  CA  . GLU A 1 92  ? 27.410 -24.001 21.227  1.00 3.92  ? 110 GLU A CA  1 
ATOM   537  C  C   . GLU A 1 92  ? 26.377 -23.923 20.098  1.00 4.32  ? 110 GLU A C   1 
ATOM   538  O  O   . GLU A 1 92  ? 25.990 -24.945 19.515  1.00 4.38  ? 110 GLU A O   1 
ATOM   539  C  CB  . GLU A 1 92  ? 26.739 -24.169 22.583  1.00 6.31  ? 110 GLU A CB  1 
ATOM   540  C  CG  . GLU A 1 92  ? 27.758 -24.619 23.643  1.00 6.12  ? 110 GLU A CG  1 
ATOM   541  C  CD  . GLU A 1 92  ? 27.155 -24.951 24.991  1.00 23.50 ? 110 GLU A CD  1 
ATOM   542  O  OE1 . GLU A 1 92  ? 25.921 -25.114 25.095  1.00 17.35 ? 110 GLU A OE1 1 
ATOM   543  O  OE2 . GLU A 1 92  ? 27.940 -25.073 25.953  1.00 25.00 ? 110 GLU A OE2 1 
ATOM   544  N  N   . GLU A 1 93  ? 25.976 -22.714 19.745  1.00 3.55  ? 111 GLU A N   1 
ATOM   545  C  CA  . GLU A 1 93  ? 24.942 -22.531 18.725  1.00 4.87  ? 111 GLU A CA  1 
ATOM   546  C  C   . GLU A 1 93  ? 25.478 -22.673 17.294  1.00 6.36  ? 111 GLU A C   1 
ATOM   547  O  O   . GLU A 1 93  ? 24.763 -23.182 16.412  1.00 6.14  ? 111 GLU A O   1 
ATOM   548  C  CB  . GLU A 1 93  ? 24.261 -21.178 18.922  1.00 6.56  ? 111 GLU A CB  1 
ATOM   549  C  CG  . GLU A 1 93  ? 23.052 -20.942 18.025  1.00 6.35  ? 111 GLU A CG  1 
ATOM   550  C  CD  . GLU A 1 93  ? 21.879 -21.932 18.243  1.00 15.24 ? 111 GLU A CD  1 
ATOM   551  O  OE1 . GLU A 1 93  ? 21.839 -22.648 19.267  1.00 16.03 ? 111 GLU A OE1 1 
ATOM   552  O  OE2 . GLU A 1 93  ? 20.976 -21.985 17.384  1.00 12.84 ? 111 GLU A OE2 1 
ATOM   553  N  N   . PHE A 1 94  ? 26.709 -22.202 17.065  1.00 4.18  ? 112 PHE A N   1 
ATOM   554  C  CA  . PHE A 1 94  ? 27.223 -22.063 15.700  1.00 2.00  ? 112 PHE A CA  1 
ATOM   555  C  C   . PHE A 1 94  ? 28.481 -22.866 15.380  1.00 6.85  ? 112 PHE A C   1 
ATOM   556  O  O   . PHE A 1 94  ? 28.750 -23.142 14.207  1.00 5.79  ? 112 PHE A O   1 
ATOM   557  C  CB  . PHE A 1 94  ? 27.510 -20.594 15.369  1.00 3.70  ? 112 PHE A CB  1 
ATOM   558  C  CG  . PHE A 1 94  ? 26.321 -19.689 15.416  1.00 4.60  ? 112 PHE A CG  1 
ATOM   559  C  CD1 . PHE A 1 94  ? 25.350 -19.686 14.405  1.00 4.81  ? 112 PHE A CD1 1 
ATOM   560  C  CD2 . PHE A 1 94  ? 26.206 -18.768 16.452  1.00 4.81  ? 112 PHE A CD2 1 
ATOM   561  C  CE1 . PHE A 1 94  ? 24.284 -18.802 14.464  1.00 5.24  ? 112 PHE A CE1 1 
ATOM   562  C  CE2 . PHE A 1 94  ? 25.162 -17.903 16.499  1.00 7.47  ? 112 PHE A CE2 1 
ATOM   563  C  CZ  . PHE A 1 94  ? 24.214 -17.896 15.512  1.00 7.74  ? 112 PHE A CZ  1 
ATOM   564  N  N   . VAL A 1 95  ? 29.293 -23.179 16.392  1.00 4.86  ? 113 VAL A N   1 
ATOM   565  C  CA  . VAL A 1 95  ? 30.650 -23.642 16.121  1.00 5.03  ? 113 VAL A CA  1 
ATOM   566  C  C   . VAL A 1 95  ? 30.886 -25.088 16.533  1.00 5.35  ? 113 VAL A C   1 
ATOM   567  O  O   . VAL A 1 95  ? 31.560 -25.833 15.827  1.00 5.57  ? 113 VAL A O   1 
ATOM   568  C  CB  . VAL A 1 95  ? 31.699 -22.746 16.805  1.00 4.29  ? 113 VAL A CB  1 
ATOM   569  C  CG1 . VAL A 1 95  ? 33.111 -23.153 16.396  1.00 4.97  ? 113 VAL A CG1 1 
ATOM   570  C  CG2 . VAL A 1 95  ? 31.450 -21.240 16.451  1.00 9.49  ? 113 VAL A CG2 1 
ATOM   571  N  N   . ASP A 1 96  ? 30.317 -25.491 17.660  1.00 6.46  ? 114 ASP A N   1 
ATOM   572  C  CA  . ASP A 1 96  ? 30.657 -26.777 18.228  1.00 10.52 ? 114 ASP A CA  1 
ATOM   573  C  C   . ASP A 1 96  ? 30.065 -27.885 17.375  1.00 10.65 ? 114 ASP A C   1 
ATOM   574  O  O   . ASP A 1 96  ? 29.187 -27.667 16.524  1.00 4.12  ? 114 ASP A O   1 
ATOM   575  C  CB  . ASP A 1 96  ? 30.150 -26.881 19.674  1.00 13.30 ? 114 ASP A CB  1 
ATOM   576  C  CG  . ASP A 1 96  ? 30.946 -27.889 20.522  1.00 17.36 ? 114 ASP A CG  1 
ATOM   577  O  OD1 . ASP A 1 96  ? 31.914 -28.500 20.019  1.00 15.72 ? 114 ASP A OD1 1 
ATOM   578  O  OD2 . ASP A 1 96  ? 30.605 -28.047 21.710  1.00 29.53 ? 114 ASP A OD2 1 
ATOM   579  N  N   . VAL A 1 97  ? 30.603 -29.068 17.604  1.00 11.68 ? 115 VAL A N   1 
ATOM   580  C  CA  . VAL A 1 97  ? 30.004 -30.293 17.172  1.00 11.12 ? 115 VAL A CA  1 
ATOM   581  C  C   . VAL A 1 97  ? 28.543 -30.271 17.598  1.00 21.36 ? 115 VAL A C   1 
ATOM   582  O  O   . VAL A 1 97  ? 28.190 -29.907 18.742  1.00 13.63 ? 115 VAL A O   1 
ATOM   583  C  CB  . VAL A 1 97  ? 30.754 -31.499 17.780  1.00 3.79  ? 115 VAL A CB  1 
ATOM   584  C  CG1 . VAL A 1 97  ? 30.127 -32.827 17.332  1.00 12.31 ? 115 VAL A CG1 1 
ATOM   585  C  CG2 . VAL A 1 97  ? 32.216 -31.382 17.408  1.00 7.90  ? 115 VAL A CG2 1 
ATOM   586  N  N   . GLN A 1 98  ? 27.693 -30.613 16.643  1.00 7.53  ? 116 GLN A N   1 
ATOM   587  C  CA  . GLN A 1 98  ? 26.254 -30.670 16.873  1.00 7.52  ? 116 GLN A CA  1 
ATOM   588  C  C   . GLN A 1 98  ? 25.547 -29.303 17.031  1.00 2.81  ? 116 GLN A C   1 
ATOM   589  O  O   . GLN A 1 98  ? 24.366 -29.278 17.332  1.00 4.86  ? 116 GLN A O   1 
ATOM   590  C  CB  . GLN A 1 98  ? 25.934 -31.635 18.023  1.00 14.39 ? 116 GLN A CB  1 
ATOM   591  C  CG  . GLN A 1 98  ? 26.247 -33.073 17.665  1.00 13.09 ? 116 GLN A CG  1 
ATOM   592  C  CD  . GLN A 1 98  ? 25.349 -33.573 16.534  1.00 10.25 ? 116 GLN A CD  1 
ATOM   593  O  OE1 . GLN A 1 98  ? 24.179 -33.879 16.740  1.00 30.08 ? 116 GLN A OE1 1 
ATOM   594  N  NE2 . GLN A 1 98  ? 25.887 -33.631 15.352  1.00 7.05  ? 116 GLN A NE2 1 
ATOM   595  N  N   . ALA A 1 99  ? 26.233 -28.186 16.741  1.00 3.66  ? 117 ALA A N   1 
ATOM   596  C  CA  . ALA A 1 99  ? 25.589 -26.881 16.746  1.00 4.83  ? 117 ALA A CA  1 
ATOM   597  C  C   . ALA A 1 99  ? 24.329 -26.884 15.864  1.00 5.97  ? 117 ALA A C   1 
ATOM   598  O  O   . ALA A 1 99  ? 24.383 -27.288 14.699  1.00 5.10  ? 117 ALA A O   1 
ATOM   599  C  CB  . ALA A 1 99  ? 26.582 -25.775 16.262  1.00 5.11  ? 117 ALA A CB  1 
ATOM   600  N  N   . PRO A 1 100 ? 23.192 -26.418 16.409  1.00 5.38  ? 118 PRO A N   1 
ATOM   601  C  CA  . PRO A 1 100 ? 21.963 -26.368 15.616  1.00 4.77  ? 118 PRO A CA  1 
ATOM   602  C  C   . PRO A 1 100 ? 22.054 -25.443 14.410  1.00 3.82  ? 118 PRO A C   1 
ATOM   603  O  O   . PRO A 1 100 ? 21.389 -25.678 13.407  1.00 8.06  ? 118 PRO A O   1 
ATOM   604  C  CB  . PRO A 1 100 ? 20.899 -25.865 16.604  1.00 9.99  ? 118 PRO A CB  1 
ATOM   605  C  CG  . PRO A 1 100 ? 21.530 -25.882 17.932  1.00 18.51 ? 118 PRO A CG  1 
ATOM   606  C  CD  . PRO A 1 100 ? 22.994 -25.941 17.787  1.00 10.87 ? 118 PRO A CD  1 
ATOM   607  N  N   . ARG A 1 101 ? 22.876 -24.405 14.493  1.00 5.05  ? 119 ARG A N   1 
ATOM   608  C  CA  . ARG A 1 101 ? 23.079 -23.480 13.390  1.00 5.48  ? 119 ARG A CA  1 
ATOM   609  C  C   . ARG A 1 101 ? 24.549 -23.486 12.964  1.00 5.78  ? 119 ARG A C   1 
ATOM   610  O  O   . ARG A 1 101 ? 25.156 -22.454 12.624  1.00 5.83  ? 119 ARG A O   1 
ATOM   611  C  CB  . ARG A 1 101 ? 22.569 -22.095 13.762  1.00 6.79  ? 119 ARG A CB  1 
ATOM   612  C  CG  . ARG A 1 101 ? 21.086 -22.009 13.850  1.00 7.05  ? 119 ARG A CG  1 
ATOM   613  C  CD  . ARG A 1 101 ? 20.639 -20.558 14.008  1.00 6.95  ? 119 ARG A CD  1 
ATOM   614  N  NE  . ARG A 1 101 ? 20.790 -20.077 15.381  1.00 8.07  ? 119 ARG A NE  1 
ATOM   615  C  CZ  . ARG A 1 101 ? 20.707 -18.809 15.757  1.00 10.33 ? 119 ARG A CZ  1 
ATOM   616  N  NH1 . ARG A 1 101 ? 20.583 -17.845 14.861  1.00 6.43  ? 119 ARG A NH1 1 
ATOM   617  N  NH2 . ARG A 1 101 ? 20.806 -18.501 17.044  1.00 5.76  ? 119 ARG A NH2 1 
ATOM   618  N  N   . GLU A 1 102 ? 25.095 -24.697 12.912  1.00 7.53  ? 120 GLU A N   1 
ATOM   619  C  CA  . GLU A 1 102 ? 26.489 -24.916 12.577  1.00 8.41  ? 120 GLU A CA  1 
ATOM   620  C  C   . GLU A 1 102 ? 26.890 -24.180 11.302  1.00 5.32  ? 120 GLU A C   1 
ATOM   621  O  O   . GLU A 1 102 ? 26.196 -24.252 10.274  1.00 6.63  ? 120 GLU A O   1 
ATOM   622  C  CB  . GLU A 1 102 ? 26.738 -26.394 12.395  1.00 6.97  ? 120 GLU A CB  1 
ATOM   623  C  CG  . GLU A 1 102 ? 28.190 -26.804 12.204  1.00 13.68 ? 120 GLU A CG  1 
ATOM   624  C  CD  . GLU A 1 102 ? 28.303 -28.297 12.016  1.00 21.74 ? 120 GLU A CD  1 
ATOM   625  O  OE1 . GLU A 1 102 ? 27.597 -28.839 11.131  1.00 10.05 ? 120 GLU A OE1 1 
ATOM   626  O  OE2 . GLU A 1 102 ? 29.087 -28.935 12.755  1.00 32.17 ? 120 GLU A OE2 1 
ATOM   627  N  N   . VAL A 1 103 ? 27.996 -23.450 11.391  1.00 4.32  ? 121 VAL A N   1 
ATOM   628  C  CA  . VAL A 1 103 ? 28.594 -22.802 10.228  1.00 2.33  ? 121 VAL A CA  1 
ATOM   629  C  C   . VAL A 1 103 ? 29.697 -23.709 9.648   1.00 6.09  ? 121 VAL A C   1 
ATOM   630  O  O   . VAL A 1 103 ? 30.487 -24.299 10.377  1.00 6.60  ? 121 VAL A O   1 
ATOM   631  C  CB  . VAL A 1 103 ? 29.088 -21.357 10.532  1.00 6.28  ? 121 VAL A CB  1 
ATOM   632  C  CG1 . VAL A 1 103 ? 27.884 -20.397 10.883  1.00 7.64  ? 121 VAL A CG1 1 
ATOM   633  C  CG2 . VAL A 1 103 ? 30.155 -21.340 11.635  1.00 12.04 ? 121 VAL A CG2 1 
ATOM   634  N  N   . ASN A 1 104 ? 29.736 -23.814 8.323   1.00 12.41 ? 122 ASN A N   1 
ATOM   635  C  CA  . ASN A 1 104 ? 30.694 -24.687 7.646   1.00 8.25  ? 122 ASN A CA  1 
ATOM   636  C  C   . ASN A 1 104 ? 32.069 -24.044 7.438   1.00 6.55  ? 122 ASN A C   1 
ATOM   637  O  O   . ASN A 1 104 ? 32.515 -23.852 6.308   1.00 13.99 ? 122 ASN A O   1 
ATOM   638  C  CB  . ASN A 1 104 ? 30.093 -25.202 6.333   1.00 11.43 ? 122 ASN A CB  1 
ATOM   639  C  CG  . ASN A 1 104 ? 28.982 -26.228 6.581   1.00 19.54 ? 122 ASN A CG  1 
ATOM   640  O  OD1 . ASN A 1 104 ? 28.994 -26.913 7.598   1.00 23.37 ? 122 ASN A OD1 1 
ATOM   641  N  ND2 . ASN A 1 104 ? 28.014 -26.303 5.681   1.00 25.88 ? 122 ASN A ND2 1 
ATOM   642  N  N   . ILE A 1 105 ? 32.722 -23.742 8.557   1.00 6.42  ? 123 ILE A N   1 
ATOM   643  C  CA  . ILE A 1 105 ? 34.105 -23.295 8.604   1.00 10.95 ? 123 ILE A CA  1 
ATOM   644  C  C   . ILE A 1 105 ? 35.001 -24.524 8.713   1.00 6.04  ? 123 ILE A C   1 
ATOM   645  O  O   . ILE A 1 105 ? 34.535 -25.599 9.091   1.00 7.61  ? 123 ILE A O   1 
ATOM   646  C  CB  . ILE A 1 105 ? 34.382 -22.335 9.791   1.00 12.47 ? 123 ILE A CB  1 
ATOM   647  C  CG1 . ILE A 1 105 ? 34.159 -23.010 11.147  1.00 11.52 ? 123 ILE A CG1 1 
ATOM   648  C  CG2 . ILE A 1 105 ? 33.517 -21.086 9.678   1.00 20.49 ? 123 ILE A CG2 1 
ATOM   649  C  CD1 . ILE A 1 105 ? 34.577 -22.136 12.327  1.00 21.59 ? 123 ILE A CD1 1 
ATOM   650  N  N   . ASP A 1 106 ? 36.282 -24.368 8.386   1.00 6.19  ? 124 ASP A N   1 
ATOM   651  C  CA  . ASP A 1 106 ? 37.221 -25.483 8.441   1.00 12.34 ? 124 ASP A CA  1 
ATOM   652  C  C   . ASP A 1 106 ? 37.412 -25.998 9.871   1.00 6.97  ? 124 ASP A C   1 
ATOM   653  O  O   . ASP A 1 106 ? 37.252 -25.259 10.844  1.00 3.30  ? 124 ASP A O   1 
ATOM   654  C  CB  . ASP A 1 106 ? 38.574 -25.094 7.844   1.00 14.55 ? 124 ASP A CB  1 
ATOM   655  C  CG  . ASP A 1 106 ? 39.339 -24.115 8.715   1.00 11.25 ? 124 ASP A CG  1 
ATOM   656  O  OD1 . ASP A 1 106 ? 39.017 -22.910 8.691   1.00 23.01 ? 124 ASP A OD1 1 
ATOM   657  O  OD2 . ASP A 1 106 ? 40.275 -24.557 9.413   1.00 15.22 ? 124 ASP A OD2 1 
ATOM   658  N  N   . PHE A 1 107 ? 37.783 -27.267 9.972   1.00 9.14  ? 125 PHE A N   1 
ATOM   659  C  CA  . PHE A 1 107 ? 37.866 -27.968 11.246  1.00 5.08  ? 125 PHE A CA  1 
ATOM   660  C  C   . PHE A 1 107 ? 38.960 -27.391 12.152  1.00 16.23 ? 125 PHE A C   1 
ATOM   661  O  O   . PHE A 1 107 ? 38.779 -27.286 13.360  1.00 8.41  ? 125 PHE A O   1 
ATOM   662  C  CB  . PHE A 1 107 ? 38.073 -29.470 11.012  1.00 11.46 ? 125 PHE A CB  1 
ATOM   663  C  CG  . PHE A 1 107 ? 36.921 -30.124 10.319  1.00 18.97 ? 125 PHE A CG  1 
ATOM   664  C  CD1 . PHE A 1 107 ? 35.756 -30.416 11.017  1.00 20.18 ? 125 PHE A CD1 1 
ATOM   665  C  CD2 . PHE A 1 107 ? 36.981 -30.429 8.966   1.00 15.32 ? 125 PHE A CD2 1 
ATOM   666  C  CE1 . PHE A 1 107 ? 34.682 -31.019 10.383  1.00 24.48 ? 125 PHE A CE1 1 
ATOM   667  C  CE2 . PHE A 1 107 ? 35.911 -31.033 8.330   1.00 18.84 ? 125 PHE A CE2 1 
ATOM   668  C  CZ  . PHE A 1 107 ? 34.760 -31.320 9.035   1.00 24.94 ? 125 PHE A CZ  1 
ATOM   669  N  N   . GLN A 1 108 ? 40.089 -27.002 11.566  1.00 2.69  ? 126 GLN A N   1 
ATOM   670  C  CA  . GLN A 1 108 ? 41.157 -26.374 12.347  1.00 8.22  ? 126 GLN A CA  1 
ATOM   671  C  C   . GLN A 1 108 ? 40.717 -25.068 13.000  1.00 6.76  ? 126 GLN A C   1 
ATOM   672  O  O   . GLN A 1 108 ? 41.118 -24.788 14.126  1.00 2.51  ? 126 GLN A O   1 
ATOM   673  C  CB  . GLN A 1 108 ? 42.405 -26.148 11.487  1.00 7.58  ? 126 GLN A CB  1 
ATOM   674  C  CG  . GLN A 1 108 ? 43.115 -27.401 11.146  1.00 6.29  ? 126 GLN A CG  1 
ATOM   675  C  CD  . GLN A 1 108 ? 44.339 -27.169 10.286  1.00 5.75  ? 126 GLN A CD  1 
ATOM   676  O  OE1 . GLN A 1 108 ? 44.274 -26.468 9.276   1.00 10.65 ? 126 GLN A OE1 1 
ATOM   677  N  NE2 . GLN A 1 108 ? 45.461 -27.784 10.669  1.00 4.90  ? 126 GLN A NE2 1 
ATOM   678  N  N   . THR A 1 109 ? 39.908 -24.266 12.308  1.00 4.78  ? 127 THR A N   1 
ATOM   679  C  CA  . THR A 1 109 ? 39.397 -23.014 12.892  1.00 3.20  ? 127 THR A CA  1 
ATOM   680  C  C   . THR A 1 109 ? 38.425 -23.325 14.009  1.00 5.23  ? 127 THR A C   1 
ATOM   681  O  O   . THR A 1 109 ? 38.478 -22.707 15.061  1.00 6.36  ? 127 THR A O   1 
ATOM   682  C  CB  . THR A 1 109 ? 38.732 -22.142 11.821  1.00 7.01  ? 127 THR A CB  1 
ATOM   683  O  OG1 . THR A 1 109 ? 39.734 -21.797 10.865  1.00 8.51  ? 127 THR A OG1 1 
ATOM   684  C  CG2 . THR A 1 109 ? 38.106 -20.863 12.406  1.00 7.35  ? 127 THR A CG2 1 
ATOM   685  N  N   . ARG A 1 110 ? 37.576 -24.324 13.810  1.00 7.19  ? 128 ARG A N   1 
ATOM   686  C  CA  . ARG A 1 110 ? 36.705 -24.742 14.905  1.00 5.79  ? 128 ARG A CA  1 
ATOM   687  C  C   . ARG A 1 110 ? 37.508 -25.145 16.147  1.00 6.74  ? 128 ARG A C   1 
ATOM   688  O  O   . ARG A 1 110 ? 37.193 -24.730 17.251  1.00 4.85  ? 128 ARG A O   1 
ATOM   689  C  CB  . ARG A 1 110 ? 35.798 -25.873 14.473  1.00 11.32 ? 128 ARG A CB  1 
ATOM   690  C  CG  . ARG A 1 110 ? 34.837 -26.283 15.555  1.00 14.87 ? 128 ARG A CG  1 
ATOM   691  C  CD  . ARG A 1 110 ? 34.134 -27.519 15.149  1.00 16.74 ? 128 ARG A CD  1 
ATOM   692  N  NE  . ARG A 1 110 ? 35.080 -28.615 15.061  1.00 16.43 ? 128 ARG A NE  1 
ATOM   693  C  CZ  . ARG A 1 110 ? 34.789 -29.825 14.613  1.00 7.18  ? 128 ARG A CZ  1 
ATOM   694  N  NH1 . ARG A 1 110 ? 33.564 -30.116 14.188  1.00 33.40 ? 128 ARG A NH1 1 
ATOM   695  N  NH2 . ARG A 1 110 ? 35.716 -30.738 14.600  1.00 11.08 ? 128 ARG A NH2 1 
ATOM   696  N  N   . GLU A 1 111 ? 38.563 -25.935 15.980  1.00 4.06  ? 129 GLU A N   1 
ATOM   697  C  CA  . GLU A 1 111 ? 39.318 -26.383 17.135  1.00 2.00  ? 129 GLU A CA  1 
ATOM   698  C  C   . GLU A 1 111 ? 40.142 -25.259 17.760  1.00 9.87  ? 129 GLU A C   1 
ATOM   699  O  O   . GLU A 1 111 ? 40.331 -25.242 18.977  1.00 9.07  ? 129 GLU A O   1 
ATOM   700  C  CB  . GLU A 1 111 ? 40.199 -27.577 16.767  1.00 10.76 ? 129 GLU A CB  1 
ATOM   701  C  CG  . GLU A 1 111 ? 39.384 -28.793 16.372  1.00 8.62  ? 129 GLU A CG  1 
ATOM   702  C  CD  . GLU A 1 111 ? 38.402 -29.238 17.451  1.00 18.93 ? 129 GLU A CD  1 
ATOM   703  O  OE1 . GLU A 1 111 ? 38.834 -29.401 18.611  1.00 13.78 ? 129 GLU A OE1 1 
ATOM   704  O  OE2 . GLU A 1 111 ? 37.198 -29.423 17.146  1.00 14.60 ? 129 GLU A OE2 1 
ATOM   705  N  N   . ALA A 1 112 ? 40.635 -24.329 16.936  1.00 3.55  ? 130 ALA A N   1 
ATOM   706  C  CA  . ALA A 1 112 ? 41.307 -23.137 17.469  1.00 8.52  ? 130 ALA A CA  1 
ATOM   707  C  C   . ALA A 1 112 ? 40.327 -22.358 18.330  1.00 11.57 ? 130 ALA A C   1 
ATOM   708  O  O   . ALA A 1 112 ? 40.686 -21.856 19.408  1.00 6.01  ? 130 ALA A O   1 
ATOM   709  C  CB  . ALA A 1 112 ? 41.831 -22.267 16.362  1.00 7.16  ? 130 ALA A CB  1 
ATOM   710  N  N   . THR A 1 113 ? 39.081 -22.282 17.857  1.00 4.69  ? 131 THR A N   1 
ATOM   711  C  CA  . THR A 1 113 ? 38.026 -21.555 18.562  1.00 4.70  ? 131 THR A CA  1 
ATOM   712  C  C   . THR A 1 113 ? 37.702 -22.250 19.893  1.00 4.17  ? 131 THR A C   1 
ATOM   713  O  O   . THR A 1 113 ? 37.597 -21.589 20.935  1.00 6.07  ? 131 THR A O   1 
ATOM   714  C  CB  . THR A 1 113 ? 36.752 -21.371 17.680  1.00 7.42  ? 131 THR A CB  1 
ATOM   715  O  OG1 . THR A 1 113 ? 37.102 -20.732 16.447  1.00 8.03  ? 131 THR A OG1 1 
ATOM   716  C  CG2 . THR A 1 113 ? 35.737 -20.484 18.387  1.00 5.57  ? 131 THR A CG2 1 
ATOM   717  N  N   . ARG A 1 114 ? 37.597 -23.576 19.868  1.00 8.28  ? 132 ARG A N   1 
ATOM   718  C  CA  . ARG A 1 114 ? 37.407 -24.369 21.097  1.00 6.16  ? 132 ARG A CA  1 
ATOM   719  C  C   . ARG A 1 114 ? 38.524 -24.127 22.125  1.00 6.82  ? 132 ARG A C   1 
ATOM   720  O  O   . ARG A 1 114 ? 38.245 -24.001 23.310  1.00 6.51  ? 132 ARG A O   1 
ATOM   721  C  CB  . ARG A 1 114 ? 37.311 -25.852 20.752  1.00 6.23  ? 132 ARG A CB  1 
ATOM   722  C  CG  . ARG A 1 114 ? 37.065 -26.798 21.928  1.00 5.88  ? 132 ARG A CG  1 
ATOM   723  C  CD  . ARG A 1 114 ? 37.284 -28.251 21.485  1.00 19.56 ? 132 ARG A CD  1 
ATOM   724  N  NE  . ARG A 1 114 ? 36.582 -28.511 20.224  1.00 28.89 ? 132 ARG A NE  1 
ATOM   725  C  CZ  . ARG A 1 114 ? 35.271 -28.727 20.117  1.00 28.07 ? 132 ARG A CZ  1 
ATOM   726  N  NH1 . ARG A 1 114 ? 34.503 -28.722 21.202  1.00 12.71 ? 132 ARG A NH1 1 
ATOM   727  N  NH2 . ARG A 1 114 ? 34.722 -28.933 18.911  1.00 14.60 ? 132 ARG A NH2 1 
ATOM   728  N  N   . LYS A 1 115 ? 39.774 -24.048 21.666  1.00 5.30  ? 133 LYS A N   1 
ATOM   729  C  CA  . LYS A 1 115 ? 40.916 -23.748 22.548  1.00 4.39  ? 133 LYS A CA  1 
ATOM   730  C  C   . LYS A 1 115 ? 40.795 -22.339 23.125  1.00 4.40  ? 133 LYS A C   1 
ATOM   731  O  O   . LYS A 1 115 ? 41.015 -22.118 24.341  1.00 5.93  ? 133 LYS A O   1 
ATOM   732  C  CB  . LYS A 1 115 ? 42.237 -23.917 21.779  1.00 6.72  ? 133 LYS A CB  1 
ATOM   733  C  CG  . LYS A 1 115 ? 43.491 -23.802 22.640  1.00 21.16 ? 133 LYS A CG  1 
ATOM   734  C  CD  . LYS A 1 115 ? 44.160 -22.431 22.515  1.00 31.95 ? 133 LYS A CD  1 
ATOM   735  C  CE  . LYS A 1 115 ? 45.154 -22.191 23.645  1.00 29.50 ? 133 LYS A CE  1 
ATOM   736  N  NZ  . LYS A 1 115 ? 46.129 -23.310 23.783  1.00 37.75 ? 133 LYS A NZ  1 
ATOM   737  N  N   . ASN A 1 116 ? 40.422 -21.390 22.265  1.00 3.25  ? 134 ASN A N   1 
ATOM   738  C  CA  . ASN A 1 116 ? 40.200 -20.016 22.710  1.00 9.75  ? 134 ASN A CA  1 
ATOM   739  C  C   . ASN A 1 116 ? 39.183 -19.961 23.833  1.00 6.59  ? 134 ASN A C   1 
ATOM   740  O  O   . ASN A 1 116 ? 39.351 -19.199 24.783  1.00 9.03  ? 134 ASN A O   1 
ATOM   741  C  CB  . ASN A 1 116 ? 39.730 -19.117 21.566  1.00 10.18 ? 134 ASN A CB  1 
ATOM   742  C  CG  . ASN A 1 116 ? 40.798 -18.869 20.538  1.00 11.64 ? 134 ASN A CG  1 
ATOM   743  O  OD1 . ASN A 1 116 ? 41.982 -19.189 20.740  1.00 11.40 ? 134 ASN A OD1 1 
ATOM   744  N  ND2 . ASN A 1 116 ? 40.397 -18.266 19.430  1.00 8.09  ? 134 ASN A ND2 1 
ATOM   745  N  N   . LEU A 1 117 ? 38.132 -20.778 23.719  1.00 8.50  ? 135 LEU A N   1 
ATOM   746  C  CA  . LEU A 1 117 ? 37.025 -20.793 24.677  1.00 9.40  ? 135 LEU A CA  1 
ATOM   747  C  C   . LEU A 1 117 ? 37.421 -21.312 26.074  1.00 9.41  ? 135 LEU A C   1 
ATOM   748  O  O   . LEU A 1 117 ? 36.675 -21.144 27.050  1.00 8.45  ? 135 LEU A O   1 
ATOM   749  C  CB  . LEU A 1 117 ? 35.853 -21.594 24.074  1.00 8.29  ? 135 LEU A CB  1 
ATOM   750  C  CG  . LEU A 1 117 ? 34.514 -21.654 24.820  1.00 16.92 ? 135 LEU A CG  1 
ATOM   751  C  CD1 . LEU A 1 117 ? 33.730 -20.337 24.702  1.00 16.09 ? 135 LEU A CD1 1 
ATOM   752  C  CD2 . LEU A 1 117 ? 33.694 -22.815 24.288  1.00 13.93 ? 135 LEU A CD2 1 
ATOM   753  N  N   . GLN A 1 118 ? 38.604 -21.919 26.196  1.00 5.93  ? 136 GLN A N   1 
ATOM   754  C  CA  . GLN A 1 118 ? 39.095 -22.372 27.507  1.00 7.50  ? 136 GLN A CA  1 
ATOM   755  C  C   . GLN A 1 118 ? 39.434 -21.189 28.420  1.00 13.49 ? 136 GLN A C   1 
ATOM   756  O  O   . GLN A 1 118 ? 39.267 -21.275 29.635  1.00 12.52 ? 136 GLN A O   1 
ATOM   757  C  CB  . GLN A 1 118 ? 40.272 -23.355 27.351  1.00 10.02 ? 136 GLN A CB  1 
ATOM   758  C  CG  . GLN A 1 118 ? 39.948 -24.550 26.420  1.00 16.87 ? 136 GLN A CG  1 
ATOM   759  C  CD  . GLN A 1 118 ? 38.517 -25.072 26.589  1.00 36.13 ? 136 GLN A CD  1 
ATOM   760  O  OE1 . GLN A 1 118 ? 38.149 -25.543 27.667  1.00 38.81 ? 136 GLN A OE1 1 
ATOM   761  N  NE2 . GLN A 1 118 ? 37.703 -24.973 25.528  1.00 20.56 ? 136 GLN A NE2 1 
ATOM   762  N  N   . GLU A 1 119 ? 39.878 -20.082 27.825  1.00 9.28  ? 137 GLU A N   1 
ATOM   763  C  CA  . GLU A 1 119 ? 40.014 -18.802 28.533  1.00 15.47 ? 137 GLU A CA  1 
ATOM   764  C  C   . GLU A 1 119 ? 39.423 -17.688 27.669  1.00 12.20 ? 137 GLU A C   1 
ATOM   765  O  O   . GLU A 1 119 ? 40.142 -16.991 26.955  1.00 9.42  ? 137 GLU A O   1 
ATOM   766  C  CB  . GLU A 1 119 ? 41.482 -18.515 28.867  1.00 17.38 ? 137 GLU A CB  1 
ATOM   767  C  CG  . GLU A 1 119 ? 41.975 -19.235 30.123  1.00 25.99 ? 137 GLU A CG  1 
ATOM   768  C  CD  . GLU A 1 119 ? 43.241 -18.620 30.696  1.00 33.87 ? 137 GLU A CD  1 
ATOM   769  O  OE1 . GLU A 1 119 ? 43.198 -18.135 31.848  1.00 40.89 ? 137 GLU A OE1 1 
ATOM   770  O  OE2 . GLU A 1 119 ? 44.275 -18.613 29.993  1.00 47.55 ? 137 GLU A OE2 1 
ATOM   771  N  N   . PRO A 1 120 ? 38.089 -17.523 27.714  1.00 8.24  ? 138 PRO A N   1 
ATOM   772  C  CA  . PRO A 1 120 ? 37.464 -16.625 26.745  1.00 9.72  ? 138 PRO A CA  1 
ATOM   773  C  C   . PRO A 1 120 ? 37.916 -15.166 26.867  1.00 7.32  ? 138 PRO A C   1 
ATOM   774  O  O   . PRO A 1 120 ? 38.111 -14.664 27.978  1.00 6.54  ? 138 PRO A O   1 
ATOM   775  C  CB  . PRO A 1 120 ? 35.967 -16.739 27.078  1.00 11.85 ? 138 PRO A CB  1 
ATOM   776  C  CG  . PRO A 1 120 ? 35.828 -17.979 27.876  1.00 15.29 ? 138 PRO A CG  1 
ATOM   777  C  CD  . PRO A 1 120 ? 37.100 -18.140 28.615  1.00 13.98 ? 138 PRO A CD  1 
ATOM   778  N  N   . SER A 1 121 ? 38.057 -14.514 25.721  1.00 4.54  ? 139 SER A N   1 
ATOM   779  C  CA  . SER A 1 121 ? 38.345 -13.082 25.612  1.00 6.98  ? 139 SER A CA  1 
ATOM   780  C  C   . SER A 1 121 ? 37.545 -12.528 24.431  1.00 2.00  ? 139 SER A C   1 
ATOM   781  O  O   . SER A 1 121 ? 36.919 -13.293 23.682  1.00 3.25  ? 139 SER A O   1 
ATOM   782  C  CB  . SER A 1 121 ? 39.823 -12.849 25.345  1.00 8.72  ? 139 SER A CB  1 
ATOM   783  O  OG  . SER A 1 121 ? 40.156 -13.289 24.051  1.00 7.32  ? 139 SER A OG  1 
ATOM   784  N  N   . LEU A 1 122 ? 37.632 -11.210 24.223  1.00 6.75  ? 140 LEU A N   1 
ATOM   785  C  CA  . LEU A 1 122 ? 36.918 -10.557 23.121  1.00 6.18  ? 140 LEU A CA  1 
ATOM   786  C  C   . LEU A 1 122 ? 37.388 -10.986 21.730  1.00 4.72  ? 140 LEU A C   1 
ATOM   787  O  O   . LEU A 1 122 ? 36.668 -10.788 20.771  1.00 7.41  ? 140 LEU A O   1 
ATOM   788  C  CB  . LEU A 1 122 ? 36.972 -9.021  23.248  1.00 6.92  ? 140 LEU A CB  1 
ATOM   789  C  CG  . LEU A 1 122 ? 36.126 -8.476  24.383  1.00 4.10  ? 140 LEU A CG  1 
ATOM   790  C  CD1 . LEU A 1 122 ? 36.348 -6.964  24.548  1.00 17.11 ? 140 LEU A CD1 1 
ATOM   791  C  CD2 . LEU A 1 122 ? 34.640 -8.833  24.177  1.00 9.69  ? 140 LEU A CD2 1 
ATOM   792  N  N   . THR A 1 123 ? 38.554 -11.622 21.637  1.00 5.09  ? 141 THR A N   1 
ATOM   793  C  CA  . THR A 1 123 ? 39.072 -12.106 20.347  1.00 11.61 ? 141 THR A CA  1 
ATOM   794  C  C   . THR A 1 123 ? 38.764 -13.590 20.064  1.00 8.05  ? 141 THR A C   1 
ATOM   795  O  O   . THR A 1 123 ? 39.189 -14.127 19.042  1.00 7.87  ? 141 THR A O   1 
ATOM   796  C  CB  . THR A 1 123 ? 40.604 -11.841 20.237  1.00 7.00  ? 141 THR A CB  1 
ATOM   797  O  OG1 . THR A 1 123 ? 41.302 -12.523 21.282  1.00 7.66  ? 141 THR A OG1 1 
ATOM   798  C  CG2 . THR A 1 123 ? 40.903 -10.349 20.346  1.00 12.21 ? 141 THR A CG2 1 
ATOM   799  N  N   . CYS A 1 124 ? 38.003 -14.227 20.953  1.00 6.54  ? 142 CYS A N   1 
ATOM   800  C  CA  . CYS A 1 124 ? 37.668 -15.647 20.893  1.00 8.36  ? 142 CYS A CA  1 
ATOM   801  C  C   . CYS A 1 124 ? 37.232 -16.115 19.504  1.00 6.87  ? 142 CYS A C   1 
ATOM   802  O  O   . CYS A 1 124 ? 37.689 -17.146 19.020  1.00 6.95  ? 142 CYS A O   1 
ATOM   803  C  CB  . CYS A 1 124 ? 36.540 -15.950 21.905  1.00 16.73 ? 142 CYS A CB  1 
ATOM   804  S  SG  . CYS A 1 124 ? 36.125 -17.697 22.103  1.00 19.56 ? 142 CYS A SG  1 
ATOM   805  N  N   . PHE A 1 125 ? 36.374 -15.325 18.860  1.00 5.80  ? 143 PHE A N   1 
ATOM   806  C  CA  . PHE A 1 125 ? 35.798 -15.706 17.573  1.00 7.87  ? 143 PHE A CA  1 
ATOM   807  C  C   . PHE A 1 125 ? 36.398 -15.031 16.345  1.00 6.90  ? 143 PHE A C   1 
ATOM   808  O  O   . PHE A 1 125 ? 35.877 -15.219 15.245  1.00 7.99  ? 143 PHE A O   1 
ATOM   809  C  CB  . PHE A 1 125 ? 34.290 -15.475 17.577  1.00 7.62  ? 143 PHE A CB  1 
ATOM   810  C  CG  . PHE A 1 125 ? 33.566 -16.243 18.651  1.00 4.17  ? 143 PHE A CG  1 
ATOM   811  C  CD1 . PHE A 1 125 ? 33.353 -17.606 18.515  1.00 7.76  ? 143 PHE A CD1 1 
ATOM   812  C  CD2 . PHE A 1 125 ? 33.110 -15.598 19.792  1.00 7.32  ? 143 PHE A CD2 1 
ATOM   813  C  CE1 . PHE A 1 125 ? 32.697 -18.327 19.504  1.00 6.44  ? 143 PHE A CE1 1 
ATOM   814  C  CE2 . PHE A 1 125 ? 32.447 -16.300 20.784  1.00 10.06 ? 143 PHE A CE2 1 
ATOM   815  C  CZ  . PHE A 1 125 ? 32.231 -17.674 20.635  1.00 10.26 ? 143 PHE A CZ  1 
ATOM   816  N  N   . ASP A 1 126 ? 37.479 -14.272 16.502  1.00 6.20  ? 144 ASP A N   1 
ATOM   817  C  CA  . ASP A 1 126 ? 38.023 -13.520 15.373  1.00 6.99  ? 144 ASP A CA  1 
ATOM   818  C  C   . ASP A 1 126 ? 38.299 -14.400 14.150  1.00 8.62  ? 144 ASP A C   1 
ATOM   819  O  O   . ASP A 1 126 ? 37.934 -14.044 13.018  1.00 7.60  ? 144 ASP A O   1 
ATOM   820  C  CB  . ASP A 1 126 ? 39.283 -12.749 15.770  1.00 10.27 ? 144 ASP A CB  1 
ATOM   821  C  CG  . ASP A 1 126 ? 38.986 -11.469 16.565  1.00 13.60 ? 144 ASP A CG  1 
ATOM   822  O  OD1 . ASP A 1 126 ? 37.805 -11.097 16.768  1.00 10.84 ? 144 ASP A OD1 1 
ATOM   823  O  OD2 . ASP A 1 126 ? 39.979 -10.817 16.980  1.00 17.16 ? 144 ASP A OD2 1 
ATOM   824  N  N   . GLN A 1 127 ? 38.954 -15.537 14.367  1.00 7.07  ? 145 GLN A N   1 
ATOM   825  C  CA  . GLN A 1 127 ? 39.347 -16.390 13.263  1.00 10.02 ? 145 GLN A CA  1 
ATOM   826  C  C   . GLN A 1 127 ? 38.082 -16.979 12.587  1.00 4.87  ? 145 GLN A C   1 
ATOM   827  O  O   . GLN A 1 127 ? 37.929 -16.928 11.361  1.00 7.84  ? 145 GLN A O   1 
ATOM   828  C  CB  . GLN A 1 127 ? 40.294 -17.485 13.768  1.00 9.96  ? 145 GLN A CB  1 
ATOM   829  C  CG  . GLN A 1 127 ? 40.847 -18.366 12.687  1.00 12.86 ? 145 GLN A CG  1 
ATOM   830  C  CD  . GLN A 1 127 ? 41.819 -19.408 13.215  1.00 18.37 ? 145 GLN A CD  1 
ATOM   831  O  OE1 . GLN A 1 127 ? 42.507 -19.196 14.221  1.00 21.43 ? 145 GLN A OE1 1 
ATOM   832  N  NE2 . GLN A 1 127 ? 41.881 -20.541 12.533  1.00 13.41 ? 145 GLN A NE2 1 
ATOM   833  N  N   . ALA A 1 128 ? 37.164 -17.473 13.406  1.00 5.92  ? 146 ALA A N   1 
ATOM   834  C  CA  . ALA A 1 128 ? 35.932 -18.090 12.899  1.00 6.05  ? 146 ALA A CA  1 
ATOM   835  C  C   . ALA A 1 128 ? 35.060 -17.058 12.178  1.00 6.32  ? 146 ALA A C   1 
ATOM   836  O  O   . ALA A 1 128 ? 34.495 -17.361 11.117  1.00 7.11  ? 146 ALA A O   1 
ATOM   837  C  CB  . ALA A 1 128 ? 35.133 -18.753 14.048  1.00 5.59  ? 146 ALA A CB  1 
ATOM   838  N  N   . GLN A 1 129 ? 34.943 -15.864 12.761  1.00 7.06  ? 147 GLN A N   1 
ATOM   839  C  CA  . GLN A 1 129 ? 34.171 -14.781 12.155  1.00 4.04  ? 147 GLN A CA  1 
ATOM   840  C  C   . GLN A 1 129 ? 34.792 -14.393 10.822  1.00 5.89  ? 147 GLN A C   1 
ATOM   841  O  O   . GLN A 1 129 ? 34.099 -14.174 9.830   1.00 6.94  ? 147 GLN A O   1 
ATOM   842  C  CB  . GLN A 1 129 ? 34.117 -13.573 13.103  1.00 9.11  ? 147 GLN A CB  1 
ATOM   843  C  CG  . GLN A 1 129 ? 33.167 -12.501 12.587  1.00 7.66  ? 147 GLN A CG  1 
ATOM   844  C  CD  . GLN A 1 129 ? 33.178 -11.239 13.405  1.00 7.62  ? 147 GLN A CD  1 
ATOM   845  O  OE1 . GLN A 1 129 ? 34.135 -10.954 14.161  1.00 9.84  ? 147 GLN A OE1 1 
ATOM   846  N  NE2 . GLN A 1 129 ? 32.134 -10.439 13.233  1.00 10.24 ? 147 GLN A NE2 1 
ATOM   847  N  N   . GLY A 1 130 ? 36.117 -14.326 10.787  1.00 6.70  ? 148 GLY A N   1 
ATOM   848  C  CA  . GLY A 1 130 ? 36.839 -14.046 9.543   1.00 7.89  ? 148 GLY A CA  1 
ATOM   849  C  C   . GLY A 1 130 ? 36.532 -15.032 8.434   1.00 8.81  ? 148 GLY A C   1 
ATOM   850  O  O   . GLY A 1 130 ? 36.310 -14.639 7.271   1.00 7.52  ? 148 GLY A O   1 
ATOM   851  N  N   . LYS A 1 131 ? 36.471 -16.314 8.789   1.00 7.96  ? 149 LYS A N   1 
ATOM   852  C  CA  . LYS A 1 131 ? 36.162 -17.363 7.807   1.00 11.23 ? 149 LYS A CA  1 
ATOM   853  C  C   . LYS A 1 131 ? 34.726 -17.242 7.257   1.00 9.09  ? 149 LYS A C   1 
ATOM   854  O  O   . LYS A 1 131 ? 34.503 -17.396 6.041   1.00 7.92  ? 149 LYS A O   1 
ATOM   855  C  CB  . LYS A 1 131 ? 36.361 -18.749 8.415   1.00 12.62 ? 149 LYS A CB  1 
ATOM   856  C  CG  . LYS A 1 131 ? 37.780 -19.069 8.873   1.00 19.20 ? 149 LYS A CG  1 
ATOM   857  C  CD  . LYS A 1 131 ? 38.776 -19.003 7.725   1.00 14.11 ? 149 LYS A CD  1 
ATOM   858  C  CE  . LYS A 1 131 ? 40.164 -19.463 8.156   1.00 24.77 ? 149 LYS A CE  1 
ATOM   859  N  NZ  . LYS A 1 131 ? 41.151 -19.308 7.054   1.00 22.16 ? 149 LYS A NZ  1 
ATOM   860  N  N   . VAL A 1 132 ? 33.756 -16.953 8.119   1.00 4.78  ? 150 VAL A N   1 
ATOM   861  C  CA  . VAL A 1 132 ? 32.351 -16.839 7.629   1.00 7.72  ? 150 VAL A CA  1 
ATOM   862  C  C   . VAL A 1 132 ? 32.162 -15.565 6.826   1.00 6.87  ? 150 VAL A C   1 
ATOM   863  O  O   . VAL A 1 132 ? 31.370 -15.528 5.896   1.00 7.44  ? 150 VAL A O   1 
ATOM   864  C  CB  . VAL A 1 132 ? 31.262 -16.891 8.732   1.00 9.71  ? 150 VAL A CB  1 
ATOM   865  C  CG1 . VAL A 1 132 ? 31.298 -18.237 9.439   1.00 20.36 ? 150 VAL A CG1 1 
ATOM   866  C  CG2 . VAL A 1 132 ? 31.385 -15.720 9.701   1.00 14.94 ? 150 VAL A CG2 1 
ATOM   867  N  N   . HIS A 1 133 ? 32.887 -14.512 7.201   1.00 7.42  ? 151 HIS A N   1 
ATOM   868  C  CA  . HIS A 1 133 ? 32.878 -13.267 6.445   1.00 6.44  ? 151 HIS A CA  1 
ATOM   869  C  C   . HIS A 1 133 ? 33.322 -13.547 5.014   1.00 6.96  ? 151 HIS A C   1 
ATOM   870  O  O   . HIS A 1 133 ? 32.687 -13.081 4.057   1.00 8.09  ? 151 HIS A O   1 
ATOM   871  C  CB  . HIS A 1 133 ? 33.783 -12.222 7.119   1.00 4.77  ? 151 HIS A CB  1 
ATOM   872  C  CG  . HIS A 1 133 ? 33.770 -10.876 6.442   1.00 8.22  ? 151 HIS A CG  1 
ATOM   873  N  ND1 . HIS A 1 133 ? 34.626 -10.554 5.408   1.00 11.64 ? 151 HIS A ND1 1 
ATOM   874  C  CD2 . HIS A 1 133 ? 33.000 -9.783  6.642   1.00 10.94 ? 151 HIS A CD2 1 
ATOM   875  C  CE1 . HIS A 1 133 ? 34.376 -9.325  4.992   1.00 11.20 ? 151 HIS A CE1 1 
ATOM   876  N  NE2 . HIS A 1 133 ? 33.410 -8.822  5.738   1.00 7.83  ? 151 HIS A NE2 1 
ATOM   877  N  N   . SER A 1 134 ? 34.407 -14.315 4.881   1.00 7.27  ? 152 SER A N   1 
ATOM   878  C  CA  A SER A 1 134 ? 34.976 -14.673 3.577   0.50 10.78 ? 152 SER A CA  1 
ATOM   879  C  CA  B SER A 1 134 ? 34.965 -14.654 3.565   0.50 11.54 ? 152 SER A CA  1 
ATOM   880  C  C   . SER A 1 134 ? 34.021 -15.518 2.736   1.00 6.87  ? 152 SER A C   1 
ATOM   881  O  O   . SER A 1 134 ? 33.882 -15.308 1.517   1.00 12.08 ? 152 SER A O   1 
ATOM   882  C  CB  A SER A 1 134 ? 36.289 -15.440 3.777   0.50 8.55  ? 152 SER A CB  1 
ATOM   883  C  CB  B SER A 1 134 ? 36.322 -15.353 3.715   0.50 11.95 ? 152 SER A CB  1 
ATOM   884  O  OG  A SER A 1 134 ? 36.955 -15.619 2.544   0.50 8.65  ? 152 SER A OG  1 
ATOM   885  O  OG  B SER A 1 134 ? 37.326 -14.417 4.064   0.50 12.52 ? 152 SER A OG  1 
ATOM   886  N  N   . LEU A 1 135 ? 33.376 -16.489 3.375   1.00 9.37  ? 153 LEU A N   1 
ATOM   887  C  CA  . LEU A 1 135 ? 32.371 -17.317 2.688   1.00 10.69 ? 153 LEU A CA  1 
ATOM   888  C  C   . LEU A 1 135 ? 31.255 -16.461 2.092   1.00 13.93 ? 153 LEU A C   1 
ATOM   889  O  O   . LEU A 1 135 ? 30.881 -16.638 0.926   1.00 15.53 ? 153 LEU A O   1 
ATOM   890  C  CB  . LEU A 1 135 ? 31.736 -18.330 3.642   1.00 20.22 ? 153 LEU A CB  1 
ATOM   891  C  CG  . LEU A 1 135 ? 32.564 -19.509 4.148   1.00 22.46 ? 153 LEU A CG  1 
ATOM   892  C  CD1 . LEU A 1 135 ? 31.739 -20.295 5.158   1.00 17.92 ? 153 LEU A CD1 1 
ATOM   893  C  CD2 . LEU A 1 135 ? 33.018 -20.404 2.983   1.00 23.76 ? 153 LEU A CD2 1 
ATOM   894  N  N   . MET A 1 136 ? 30.726 -15.545 2.900   1.00 7.15  ? 154 MET A N   1 
ATOM   895  C  CA  . MET A 1 136 ? 29.682 -14.627 2.437   1.00 4.64  ? 154 MET A CA  1 
ATOM   896  C  C   . MET A 1 136 ? 30.167 -13.670 1.342   1.00 5.67  ? 154 MET A C   1 
ATOM   897  O  O   . MET A 1 136 ? 29.493 -13.465 0.330   1.00 5.15  ? 154 MET A O   1 
ATOM   898  C  CB  . MET A 1 136 ? 29.093 -13.834 3.595   1.00 3.86  ? 154 MET A CB  1 
ATOM   899  C  CG  . MET A 1 136 ? 28.291 -14.683 4.581   1.00 4.67  ? 154 MET A CG  1 
ATOM   900  S  SD  . MET A 1 136 ? 27.505 -13.747 5.873   1.00 9.28  ? 154 MET A SD  1 
ATOM   901  C  CE  . MET A 1 136 ? 28.896 -12.997 6.738   1.00 6.67  ? 154 MET A CE  1 
ATOM   902  N  N   . GLU A 1 137 ? 31.329 -13.053 1.551   1.00 18.29 ? 155 GLU A N   1 
ATOM   903  C  CA  . GLU A 1 137 ? 31.859 -12.072 0.590   1.00 17.14 ? 155 GLU A CA  1 
ATOM   904  C  C   . GLU A 1 137 ? 32.146 -12.682 -0.789  1.00 23.51 ? 155 GLU A C   1 
ATOM   905  O  O   . GLU A 1 137 ? 31.937 -12.036 -1.821  1.00 25.51 ? 155 GLU A O   1 
ATOM   906  C  CB  . GLU A 1 137 ? 33.125 -11.398 1.146   1.00 20.40 ? 155 GLU A CB  1 
ATOM   907  C  CG  . GLU A 1 137 ? 33.664 -10.280 0.256   1.00 18.08 ? 155 GLU A CG  1 
ATOM   908  C  CD  . GLU A 1 137 ? 34.703 -9.392  0.925   1.00 22.13 ? 155 GLU A CD  1 
ATOM   909  O  OE1 . GLU A 1 137 ? 35.480 -9.872  1.782   1.00 29.37 ? 155 GLU A OE1 1 
ATOM   910  O  OE2 . GLU A 1 137 ? 34.754 -8.194  0.569   1.00 32.60 ? 155 GLU A OE2 1 
ATOM   911  N  N   . LYS A 1 138 ? 32.620 -13.921 -0.797  1.00 20.57 ? 156 LYS A N   1 
ATOM   912  C  CA  . LYS A 1 138 ? 33.081 -14.575 -2.030  1.00 21.02 ? 156 LYS A CA  1 
ATOM   913  C  C   . LYS A 1 138 ? 31.987 -15.348 -2.753  1.00 24.24 ? 156 LYS A C   1 
ATOM   914  O  O   . LYS A 1 138 ? 32.025 -15.488 -3.987  1.00 22.81 ? 156 LYS A O   1 
ATOM   915  C  CB  . LYS A 1 138 ? 34.234 -15.527 -1.702  1.00 24.64 ? 156 LYS A CB  1 
ATOM   916  C  CG  . LYS A 1 138 ? 35.524 -14.825 -1.293  1.00 26.28 ? 156 LYS A CG  1 
ATOM   917  C  CD  . LYS A 1 138 ? 36.542 -15.814 -0.735  1.00 36.80 ? 156 LYS A CD  1 
ATOM   918  C  CE  . LYS A 1 138 ? 37.860 -15.131 -0.402  1.00 39.85 ? 156 LYS A CE  1 
ATOM   919  N  NZ  . LYS A 1 138 ? 38.709 -15.958 0.495   1.00 47.90 ? 156 LYS A NZ  1 
ATOM   920  N  N   . ASP A 1 139 ? 31.041 -15.886 -1.987  1.00 21.81 ? 157 ASP A N   1 
ATOM   921  C  CA  . ASP A 1 139 ? 30.013 -16.758 -2.554  1.00 24.18 ? 157 ASP A CA  1 
ATOM   922  C  C   . ASP A 1 139 ? 28.640 -16.073 -2.616  1.00 22.71 ? 157 ASP A C   1 
ATOM   923  O  O   . ASP A 1 139 ? 28.168 -15.725 -3.702  1.00 24.97 ? 157 ASP A O   1 
ATOM   924  C  CB  . ASP A 1 139 ? 29.957 -18.073 -1.779  1.00 21.83 ? 157 ASP A CB  1 
ATOM   925  C  CG  . ASP A 1 139 ? 31.297 -18.804 -1.769  1.00 36.63 ? 157 ASP A CG  1 
ATOM   926  O  OD1 . ASP A 1 139 ? 32.024 -18.717 -2.779  1.00 33.12 ? 157 ASP A OD1 1 
ATOM   927  O  OD2 . ASP A 1 139 ? 31.624 -19.462 -0.754  1.00 34.35 ? 157 ASP A OD2 1 
ATOM   928  N  N   . SER A 1 140 ? 28.026 -15.835 -1.462  1.00 19.81 ? 158 SER A N   1 
ATOM   929  C  CA  A SER A 1 140 ? 26.653 -15.298 -1.372  0.50 20.51 ? 158 SER A CA  1 
ATOM   930  C  CA  B SER A 1 140 ? 26.645 -15.335 -1.458  0.50 20.47 ? 158 SER A CA  1 
ATOM   931  C  C   . SER A 1 140 ? 26.472 -13.861 -1.853  1.00 25.61 ? 158 SER A C   1 
ATOM   932  O  O   . SER A 1 140 ? 25.472 -13.521 -2.493  1.00 23.16 ? 158 SER A O   1 
ATOM   933  C  CB  A SER A 1 140 ? 26.167 -15.355 0.078   0.50 23.76 ? 158 SER A CB  1 
ATOM   934  C  CB  B SER A 1 140 ? 25.960 -15.630 -0.123  0.50 25.14 ? 158 SER A CB  1 
ATOM   935  O  OG  A SER A 1 140 ? 26.084 -16.686 0.537   0.50 25.73 ? 158 SER A OG  1 
ATOM   936  O  OG  B SER A 1 140 ? 26.849 -15.453 0.954   0.50 19.61 ? 158 SER A OG  1 
ATOM   937  N  N   . TYR A 1 141 ? 27.412 -12.998 -1.485  1.00 23.58 ? 159 TYR A N   1 
ATOM   938  C  CA  . TYR A 1 141 ? 27.310 -11.572 -1.809  1.00 23.06 ? 159 TYR A CA  1 
ATOM   939  C  C   . TYR A 1 141 ? 27.246 -11.312 -3.329  1.00 20.00 ? 159 TYR A C   1 
ATOM   940  O  O   . TYR A 1 141 ? 26.337 -10.608 -3.786  1.00 20.28 ? 159 TYR A O   1 
ATOM   941  C  CB  . TYR A 1 141 ? 28.427 -10.780 -1.108  1.00 23.40 ? 159 TYR A CB  1 
ATOM   942  C  CG  . TYR A 1 141 ? 28.520 -9.322  -1.488  1.00 24.46 ? 159 TYR A CG  1 
ATOM   943  C  CD1 . TYR A 1 141 ? 27.514 -8.413  -1.136  1.00 21.75 ? 159 TYR A CD1 1 
ATOM   944  C  CD2 . TYR A 1 141 ? 29.635 -8.835  -2.169  1.00 28.33 ? 159 TYR A CD2 1 
ATOM   945  C  CE1 . TYR A 1 141 ? 27.630 -7.053  -1.468  1.00 20.16 ? 159 TYR A CE1 1 
ATOM   946  C  CE2 . TYR A 1 141 ? 29.747 -7.487  -2.512  1.00 28.19 ? 159 TYR A CE2 1 
ATOM   947  C  CZ  . TYR A 1 141 ? 28.747 -6.600  -2.159  1.00 19.68 ? 159 TYR A CZ  1 
ATOM   948  O  OH  . TYR A 1 141 ? 28.885 -5.262  -2.509  1.00 21.29 ? 159 TYR A OH  1 
ATOM   949  N  N   . PRO A 1 142 ? 28.192 -11.864 -4.131  1.00 21.73 ? 160 PRO A N   1 
ATOM   950  C  CA  . PRO A 1 142 ? 28.061 -11.696 -5.588  1.00 23.12 ? 160 PRO A CA  1 
ATOM   951  C  C   . PRO A 1 142 ? 26.726 -12.197 -6.138  1.00 20.79 ? 160 PRO A C   1 
ATOM   952  O  O   . PRO A 1 142 ? 26.158 -11.558 -7.016  1.00 21.68 ? 160 PRO A O   1 
ATOM   953  C  CB  . PRO A 1 142 ? 29.217 -12.526 -6.157  1.00 24.72 ? 160 PRO A CB  1 
ATOM   954  C  CG  . PRO A 1 142 ? 30.211 -12.595 -5.076  1.00 26.06 ? 160 PRO A CG  1 
ATOM   955  C  CD  . PRO A 1 142 ? 29.440 -12.571 -3.777  1.00 21.23 ? 160 PRO A CD  1 
ATOM   956  N  N   . ARG A 1 143 ? 26.229 -13.322 -5.621  1.00 19.78 ? 161 ARG A N   1 
ATOM   957  C  CA  . ARG A 1 143 ? 24.928 -13.851 -6.040  1.00 18.89 ? 161 ARG A CA  1 
ATOM   958  C  C   . ARG A 1 143 ? 23.766 -12.920 -5.657  1.00 17.81 ? 161 ARG A C   1 
ATOM   959  O  O   . ARG A 1 143 ? 22.851 -12.720 -6.456  1.00 17.78 ? 161 ARG A O   1 
ATOM   960  C  CB  . ARG A 1 143 ? 24.681 -15.238 -5.455  1.00 23.13 ? 161 ARG A CB  1 
ATOM   961  C  CG  . ARG A 1 143 ? 25.601 -16.309 -6.025  1.00 21.54 ? 161 ARG A CG  1 
ATOM   962  C  CD  . ARG A 1 143 ? 25.117 -17.684 -5.671  1.00 23.20 ? 161 ARG A CD  1 
ATOM   963  N  NE  . ARG A 1 143 ? 25.218 -18.004 -4.245  1.00 23.09 ? 161 ARG A NE  1 
ATOM   964  C  CZ  . ARG A 1 143 ? 26.214 -18.688 -3.676  1.00 30.78 ? 161 ARG A CZ  1 
ATOM   965  N  NH1 . ARG A 1 143 ? 27.261 -19.099 -4.381  1.00 21.87 ? 161 ARG A NH1 1 
ATOM   966  N  NH2 . ARG A 1 143 ? 26.171 -18.954 -2.378  1.00 27.18 ? 161 ARG A NH2 1 
ATOM   967  N  N   . PHE A 1 144 ? 23.838 -12.349 -4.455  1.00 18.66 ? 162 PHE A N   1 
ATOM   968  C  CA  . PHE A 1 144 ? 22.848 -11.380 -3.992  1.00 19.72 ? 162 PHE A CA  1 
ATOM   969  C  C   . PHE A 1 144 ? 22.711 -10.210 -4.976  1.00 19.36 ? 162 PHE A C   1 
ATOM   970  O  O   . PHE A 1 144 ? 21.595 -9.774  -5.305  1.00 19.00 ? 162 PHE A O   1 
ATOM   971  C  CB  . PHE A 1 144 ? 23.248 -10.818 -2.627  1.00 21.29 ? 162 PHE A CB  1 
ATOM   972  C  CG  . PHE A 1 144 ? 22.374 -9.695  -2.162  1.00 19.77 ? 162 PHE A CG  1 
ATOM   973  C  CD1 . PHE A 1 144 ? 21.033 -9.915  -1.855  1.00 19.37 ? 162 PHE A CD1 1 
ATOM   974  C  CD2 . PHE A 1 144 ? 22.887 -8.407  -1.999  1.00 19.98 ? 162 PHE A CD2 1 
ATOM   975  C  CE1 . PHE A 1 144 ? 20.213 -8.858  -1.416  1.00 24.46 ? 162 PHE A CE1 1 
ATOM   976  C  CE2 . PHE A 1 144 ? 22.071 -7.360  -1.570  1.00 19.09 ? 162 PHE A CE2 1 
ATOM   977  C  CZ  . PHE A 1 144 ? 20.746 -7.586  -1.269  1.00 23.85 ? 162 PHE A CZ  1 
ATOM   978  N  N   . LEU A 1 145 ? 23.851 -9.695  -5.435  1.00 18.54 ? 163 LEU A N   1 
ATOM   979  C  CA  . LEU A 1 145 ? 23.861 -8.538  -6.347  1.00 21.12 ? 163 LEU A CA  1 
ATOM   980  C  C   . LEU A 1 145 ? 23.258 -8.816  -7.741  1.00 19.19 ? 163 LEU A C   1 
ATOM   981  O  O   . LEU A 1 145 ? 22.946 -7.873  -8.482  1.00 18.56 ? 163 LEU A O   1 
ATOM   982  C  CB  . LEU A 1 145 ? 25.284 -7.972  -6.481  1.00 20.38 ? 163 LEU A CB  1 
ATOM   983  C  CG  . LEU A 1 145 ? 25.947 -7.406  -5.213  1.00 24.85 ? 163 LEU A CG  1 
ATOM   984  C  CD1 . LEU A 1 145 ? 27.358 -6.892  -5.512  1.00 22.10 ? 163 LEU A CD1 1 
ATOM   985  C  CD2 . LEU A 1 145 ? 25.110 -6.314  -4.555  1.00 27.54 ? 163 LEU A CD2 1 
ATOM   986  N  N   . ARG A 1 146 ? 23.110 -10.094 -8.106  1.00 19.43 ? 164 ARG A N   1 
ATOM   987  C  CA  . ARG A 1 146 ? 22.441 -10.483 -9.360  1.00 22.49 ? 164 ARG A CA  1 
ATOM   988  C  C   . ARG A 1 146 ? 20.994 -10.957 -9.140  1.00 22.82 ? 164 ARG A C   1 
ATOM   989  O  O   . ARG A 1 146 ? 20.308 -11.341 -10.099 1.00 19.95 ? 164 ARG A O   1 
ATOM   990  C  CB  . ARG A 1 146 ? 23.239 -11.574 -10.091 1.00 20.60 ? 164 ARG A CB  1 
ATOM   991  C  CG  . ARG A 1 146 ? 24.738 -11.313 -10.186 1.00 26.26 ? 164 ARG A CG  1 
ATOM   992  C  CD  . ARG A 1 146 ? 25.460 -12.421 -10.951 1.00 37.67 ? 164 ARG A CD  1 
ATOM   993  N  NE  . ARG A 1 146 ? 26.907 -12.442 -10.701 1.00 43.98 ? 164 ARG A NE  1 
ATOM   994  C  CZ  . ARG A 1 146 ? 27.562 -13.316 -9.928  1.00 47.23 ? 164 ARG A CZ  1 
ATOM   995  N  NH1 . ARG A 1 146 ? 26.936 -14.305 -9.285  1.00 23.08 ? 164 ARG A NH1 1 
ATOM   996  N  NH2 . ARG A 1 146 ? 28.879 -13.199 -9.799  1.00 56.75 ? 164 ARG A NH2 1 
ATOM   997  N  N   . SER A 1 147 ? 20.521 -10.919 -7.895  1.00 17.60 ? 165 SER A N   1 
ATOM   998  C  CA  . SER A 1 147 ? 19.186 -11.424 -7.559  1.00 20.08 ? 165 SER A CA  1 
ATOM   999  C  C   . SER A 1 147 ? 18.107 -10.409 -7.921  1.00 19.74 ? 165 SER A C   1 
ATOM   1000 O  O   . SER A 1 147 ? 18.358 -9.200  -7.889  1.00 22.51 ? 165 SER A O   1 
ATOM   1001 C  CB  . SER A 1 147 ? 19.102 -11.782 -6.069  1.00 23.63 ? 165 SER A CB  1 
ATOM   1002 O  OG  . SER A 1 147 ? 19.074 -10.622 -5.244  1.00 21.64 ? 165 SER A OG  1 
ATOM   1003 N  N   . LYS A 1 148 ? 16.912 -10.897 -8.276  1.00 24.71 ? 166 LYS A N   1 
ATOM   1004 C  CA  . LYS A 1 148 ? 15.778 -9.999  -8.555  1.00 24.61 ? 166 LYS A CA  1 
ATOM   1005 C  C   . LYS A 1 148 ? 15.397 -9.217  -7.291  1.00 22.87 ? 166 LYS A C   1 
ATOM   1006 O  O   . LYS A 1 148 ? 14.970 -8.067  -7.377  1.00 22.77 ? 166 LYS A O   1 
ATOM   1007 C  CB  . LYS A 1 148 ? 14.567 -10.755 -9.134  1.00 32.89 ? 166 LYS A CB  1 
ATOM   1008 C  CG  . LYS A 1 148 ? 13.591 -11.347 -8.106  1.00 37.88 ? 166 LYS A CG  1 
ATOM   1009 C  CD  . LYS A 1 148 ? 12.406 -12.031 -8.787  1.00 36.26 ? 166 LYS A CD  1 
ATOM   1010 C  CE  . LYS A 1 148 ? 11.364 -11.032 -9.268  1.00 39.16 ? 166 LYS A CE  1 
ATOM   1011 N  NZ  . LYS A 1 148 ? 10.561 -11.577 -10.393 1.00 40.83 ? 166 LYS A NZ  1 
ATOM   1012 N  N   . MET A 1 149 ? 15.572 -9.847  -6.128  1.00 30.29 ? 167 MET A N   1 
ATOM   1013 C  CA  . MET A 1 149 ? 15.381 -9.183  -4.834  1.00 30.91 ? 167 MET A CA  1 
ATOM   1014 C  C   . MET A 1 149 ? 16.179 -7.869  -4.745  1.00 30.26 ? 167 MET A C   1 
ATOM   1015 O  O   . MET A 1 149 ? 15.632 -6.844  -4.346  1.00 26.38 ? 167 MET A O   1 
ATOM   1016 C  CB  . MET A 1 149 ? 15.781 -10.126 -3.686  1.00 32.32 ? 167 MET A CB  1 
ATOM   1017 C  CG  . MET A 1 149 ? 15.603 -9.544  -2.278  1.00 42.07 ? 167 MET A CG  1 
ATOM   1018 S  SD  . MET A 1 149 ? 16.306 -10.553 -0.943  1.00 41.01 ? 167 MET A SD  1 
ATOM   1019 C  CE  . MET A 1 149 ? 15.453 -12.109 -1.301  1.00 18.36 ? 167 MET A CE  1 
ATOM   1020 N  N   . TYR A 1 150 ? 17.460 -7.904  -5.106  1.00 25.03 ? 168 TYR A N   1 
ATOM   1021 C  CA  . TYR A 1 150 ? 18.311 -6.705  -5.061  1.00 24.56 ? 168 TYR A CA  1 
ATOM   1022 C  C   . TYR A 1 150 ? 18.033 -5.749  -6.232  1.00 26.10 ? 168 TYR A C   1 
ATOM   1023 O  O   . TYR A 1 150 ? 17.885 -4.530  -6.045  1.00 24.91 ? 168 TYR A O   1 
ATOM   1024 C  CB  . TYR A 1 150 ? 19.808 -7.080  -5.044  1.00 20.56 ? 168 TYR A CB  1 
ATOM   1025 C  CG  . TYR A 1 150 ? 20.723 -5.865  -5.136  1.00 20.45 ? 168 TYR A CG  1 
ATOM   1026 C  CD1 . TYR A 1 150 ? 20.827 -4.965  -4.082  1.00 16.60 ? 168 TYR A CD1 1 
ATOM   1027 C  CD2 . TYR A 1 150 ? 21.456 -5.604  -6.291  1.00 24.99 ? 168 TYR A CD2 1 
ATOM   1028 C  CE1 . TYR A 1 150 ? 21.638 -3.830  -4.168  1.00 18.28 ? 168 TYR A CE1 1 
ATOM   1029 C  CE2 . TYR A 1 150 ? 22.275 -4.486  -6.385  1.00 21.64 ? 168 TYR A CE2 1 
ATOM   1030 C  CZ  . TYR A 1 150 ? 22.366 -3.598  -5.325  1.00 22.83 ? 168 TYR A CZ  1 
ATOM   1031 O  OH  . TYR A 1 150 ? 23.182 -2.487  -5.434  1.00 22.72 ? 168 TYR A OH  1 
ATOM   1032 N  N   . LEU A 1 151 ? 17.960 -6.299  -7.440  1.00 22.39 ? 169 LEU A N   1 
ATOM   1033 C  CA  . LEU A 1 151 ? 17.837 -5.475  -8.646  1.00 23.45 ? 169 LEU A CA  1 
ATOM   1034 C  C   . LEU A 1 151 ? 16.520 -4.690  -8.692  1.00 24.50 ? 169 LEU A C   1 
ATOM   1035 O  O   . LEU A 1 151 ? 16.457 -3.633  -9.309  1.00 28.17 ? 169 LEU A O   1 
ATOM   1036 C  CB  . LEU A 1 151 ? 18.005 -6.333  -9.905  1.00 28.62 ? 169 LEU A CB  1 
ATOM   1037 C  CG  . LEU A 1 151 ? 19.382 -6.999  -10.068 1.00 34.30 ? 169 LEU A CG  1 
ATOM   1038 C  CD1 . LEU A 1 151 ? 19.356 -8.018  -11.194 1.00 30.05 ? 169 LEU A CD1 1 
ATOM   1039 C  CD2 . LEU A 1 151 ? 20.495 -5.979  -10.295 1.00 24.31 ? 169 LEU A CD2 1 
ATOM   1040 N  N   . ASP A 1 152 ? 15.485 -5.192  -8.020  1.00 25.88 ? 170 ASP A N   1 
ATOM   1041 C  CA  . ASP A 1 152 ? 14.198 -4.479  -7.911  1.00 24.42 ? 170 ASP A CA  1 
ATOM   1042 C  C   . ASP A 1 152 ? 14.265 -3.233  -7.015  1.00 25.03 ? 170 ASP A C   1 
ATOM   1043 O  O   . ASP A 1 152 ? 13.347 -2.392  -7.029  1.00 21.68 ? 170 ASP A O   1 
ATOM   1044 C  CB  . ASP A 1 152 ? 13.101 -5.429  -7.411  1.00 25.60 ? 170 ASP A CB  1 
ATOM   1045 C  CG  . ASP A 1 152 ? 12.660 -6.431  -8.473  1.00 30.74 ? 170 ASP A CG  1 
ATOM   1046 O  OD1 . ASP A 1 152 ? 13.011 -6.258  -9.658  1.00 27.86 ? 170 ASP A OD1 1 
ATOM   1047 O  OD2 . ASP A 1 152 ? 11.961 -7.404  -8.118  1.00 42.82 ? 170 ASP A OD2 1 
ATOM   1048 N  N   . LEU A 1 153 ? 15.342 -3.116  -6.243  1.00 23.37 ? 171 LEU A N   1 
ATOM   1049 C  CA  . LEU A 1 153 ? 15.625 -1.912  -5.456  1.00 26.97 ? 171 LEU A CA  1 
ATOM   1050 C  C   . LEU A 1 153 ? 16.387 -0.854  -6.261  1.00 31.72 ? 171 LEU A C   1 
ATOM   1051 O  O   . LEU A 1 153 ? 16.650 0.236   -5.746  1.00 35.87 ? 171 LEU A O   1 
ATOM   1052 C  CB  . LEU A 1 153 ? 16.450 -2.271  -4.217  1.00 24.34 ? 171 LEU A CB  1 
ATOM   1053 C  CG  . LEU A 1 153 ? 15.928 -3.397  -3.321  1.00 19.15 ? 171 LEU A CG  1 
ATOM   1054 C  CD1 . LEU A 1 153 ? 16.922 -3.684  -2.219  1.00 30.16 ? 171 LEU A CD1 1 
ATOM   1055 C  CD2 . LEU A 1 153 ? 14.571 -3.043  -2.750  1.00 25.45 ? 171 LEU A CD2 1 
ATOM   1056 N  N   . LEU A 1 154 ? 16.721 -1.177  -7.515  1.00 36.21 ? 172 LEU A N   1 
ATOM   1057 C  CA  . LEU A 1 154 ? 17.627 -0.378  -8.361  1.00 31.60 ? 172 LEU A CA  1 
ATOM   1058 C  C   . LEU A 1 154 ? 19.032 -0.285  -7.748  1.00 37.36 ? 172 LEU A C   1 
ATOM   1059 O  O   . LEU A 1 154 ? 19.630 -1.303  -7.357  1.00 28.33 ? 172 LEU A O   1 
ATOM   1060 C  CB  . LEU A 1 154 ? 17.060 1.028   -8.657  1.00 40.00 ? 172 LEU A CB  1 
ATOM   1061 C  CG  . LEU A 1 154 ? 15.734 1.162   -9.420  1.00 35.43 ? 172 LEU A CG  1 
ATOM   1062 C  CD1 . LEU A 1 154 ? 15.706 0.272   -10.659 1.00 41.31 ? 172 LEU A CD1 1 
ATOM   1063 C  CD2 . LEU A 1 154 ? 14.533 0.872   -8.526  1.00 39.08 ? 172 LEU A CD2 1 
HETATM 1064 CL CL  . CL  B 2 .   ? 35.259 -10.135 10.069  1.00 20.10 ? 1   CL  A CL  1 
HETATM 1065 O  O   . HOH C 3 .   ? 36.362 -21.836 5.663   1.00 15.27 ? 174 HOH A O   1 
HETATM 1066 O  O   . HOH C 3 .   ? 24.306 -15.542 -9.799  1.00 16.17 ? 175 HOH A O   1 
HETATM 1067 O  O   . HOH C 3 .   ? 37.775 -18.003 16.107  1.00 15.58 ? 176 HOH A O   1 
HETATM 1068 O  O   . HOH C 3 .   ? 22.684 -13.252 15.295  1.00 19.60 ? 177 HOH A O   1 
HETATM 1069 O  O   . HOH C 3 .   ? 26.402 -14.232 32.662  1.00 21.47 ? 178 HOH A O   1 
HETATM 1070 O  O   . HOH C 3 .   ? 33.671 -4.536  24.520  1.00 24.27 ? 179 HOH A O   1 
HETATM 1071 O  O   . HOH C 3 .   ? 15.206 -9.601  6.610   1.00 19.85 ? 180 HOH A O   1 
HETATM 1072 O  O   . HOH C 3 .   ? 33.165 -6.883  -1.283  1.00 26.23 ? 181 HOH A O   1 
HETATM 1073 O  O   . HOH C 3 .   ? 19.260 -20.230 11.019  1.00 22.94 ? 182 HOH A O   1 
HETATM 1074 O  O   . HOH C 3 .   ? 13.652 -14.656 2.583   1.00 24.21 ? 183 HOH A O   1 
HETATM 1075 O  O   . HOH C 3 .   ? 18.613 -22.971 16.694  1.00 23.86 ? 184 HOH A O   1 
HETATM 1076 O  O   . HOH C 3 .   ? 32.256 -32.539 12.791  0.50 12.56 ? 185 HOH A O   1 
HETATM 1077 O  O   . HOH C 3 .   ? 35.415 -12.675 19.191  1.00 19.17 ? 186 HOH A O   1 
HETATM 1078 O  O   . HOH C 3 .   ? 39.622 -16.226 23.604  1.00 26.61 ? 187 HOH A O   1 
HETATM 1079 O  O   . HOH C 3 .   ? 42.437 -26.941 7.191   1.00 21.12 ? 188 HOH A O   1 
HETATM 1080 O  O   . HOH C 3 .   ? 21.539 -23.121 -1.817  1.00 23.33 ? 189 HOH A O   1 
HETATM 1081 O  O   . HOH C 3 .   ? 35.216 -12.074 16.440  1.00 22.61 ? 190 HOH A O   1 
HETATM 1082 O  O   . HOH C 3 .   ? 18.038 -20.683 -3.745  1.00 19.57 ? 191 HOH A O   1 
HETATM 1083 O  O   . HOH C 3 .   ? 26.428 -19.858 28.772  1.00 26.39 ? 192 HOH A O   1 
HETATM 1084 O  O   . HOH C 3 .   ? 27.368 -7.883  24.352  1.00 27.31 ? 193 HOH A O   1 
HETATM 1085 O  O   . HOH C 3 .   ? 14.726 -12.261 6.478   1.00 22.90 ? 194 HOH A O   1 
HETATM 1086 O  O   . HOH C 3 .   ? 37.552 -28.236 6.878   1.00 35.28 ? 195 HOH A O   1 
HETATM 1087 O  O   . HOH C 3 .   ? 29.951 -16.343 33.405  1.00 26.64 ? 196 HOH A O   1 
HETATM 1088 O  O   . HOH C 3 .   ? 15.225 -13.882 11.176  1.00 28.67 ? 197 HOH A O   1 
HETATM 1089 O  O   . HOH C 3 .   ? 24.371 -14.337 26.058  1.00 29.72 ? 198 HOH A O   1 
HETATM 1090 O  O   . HOH C 3 .   ? 18.037 -14.764 10.203  1.00 27.16 ? 199 HOH A O   1 
HETATM 1091 O  O   . HOH C 3 .   ? 28.862 -31.322 13.904  1.00 27.26 ? 200 HOH A O   1 
HETATM 1092 O  O   . HOH C 3 .   ? 18.928 -5.022  9.784   1.00 27.74 ? 201 HOH A O   1 
HETATM 1093 O  O   . HOH C 3 .   ? 25.533 -7.341  15.439  1.00 29.95 ? 202 HOH A O   1 
HETATM 1094 O  O   . HOH C 3 .   ? 39.926 -15.840 9.783   1.00 24.70 ? 203 HOH A O   1 
HETATM 1095 O  O   . HOH C 3 .   ? 23.338 -16.824 29.252  1.00 37.65 ? 204 HOH A O   1 
HETATM 1096 O  O   . HOH C 3 .   ? 22.031 -14.725 -8.111  1.00 24.63 ? 205 HOH A O   1 
HETATM 1097 O  O   . HOH C 3 .   ? 26.164 -17.304 3.246   1.00 24.24 ? 206 HOH A O   1 
HETATM 1098 O  O   . HOH C 3 .   ? 27.811 -22.376 6.732   1.00 21.07 ? 207 HOH A O   1 
HETATM 1099 O  O   . HOH C 3 .   ? 40.139 -16.098 17.037  1.00 22.23 ? 208 HOH A O   1 
HETATM 1100 O  O   . HOH C 3 .   ? 26.362 -27.462 20.304  1.00 35.13 ? 209 HOH A O   1 
HETATM 1101 O  O   . HOH C 3 .   ? 37.408 -11.414 12.377  1.00 30.44 ? 210 HOH A O   1 
HETATM 1102 O  O   . HOH C 3 .   ? 23.739 -21.675 22.803  1.00 21.46 ? 211 HOH A O   1 
HETATM 1103 O  O   . HOH C 3 .   ? 25.076 -14.643 28.563  1.00 29.79 ? 212 HOH A O   1 
HETATM 1104 O  O   . HOH C 3 .   ? 20.782 -12.015 13.560  1.00 26.14 ? 213 HOH A O   1 
HETATM 1105 O  O   . HOH C 3 .   ? 27.240 -28.226 8.898   1.00 25.79 ? 214 HOH A O   1 
HETATM 1106 O  O   . HOH C 3 .   ? 25.923 -22.118 27.382  1.00 30.80 ? 215 HOH A O   1 
HETATM 1107 O  O   . HOH C 3 .   ? 30.956 -28.075 14.153  1.00 32.62 ? 216 HOH A O   1 
HETATM 1108 O  O   . HOH C 3 .   ? 40.590 -28.357 8.659   1.00 27.97 ? 217 HOH A O   1 
HETATM 1109 O  O   . HOH C 3 .   ? 19.505 -23.510 20.098  1.00 26.01 ? 218 HOH A O   1 
HETATM 1110 O  O   . HOH C 3 .   ? 43.538 -21.237 19.733  1.00 37.37 ? 219 HOH A O   1 
HETATM 1111 O  O   . HOH C 3 .   ? 24.210 -18.758 0.287   1.00 32.05 ? 220 HOH A O   1 
HETATM 1112 O  O   . HOH C 3 .   ? 22.999 -23.997 21.200  1.00 24.81 ? 221 HOH A O   1 
HETATM 1113 O  O   . HOH C 3 .   ? 31.236 -5.189  -4.729  1.00 50.31 ? 222 HOH A O   1 
HETATM 1114 O  O   . HOH C 3 .   ? 29.782 -2.026  24.920  1.00 39.47 ? 223 HOH A O   1 
HETATM 1115 O  O   . HOH C 3 .   ? 31.066 5.232   -2.927  1.00 40.56 ? 224 HOH A O   1 
HETATM 1116 O  O   . HOH C 3 .   ? 31.811 -25.204 12.970  1.00 29.92 ? 225 HOH A O   1 
HETATM 1117 O  O   . HOH C 3 .   ? 30.500 -24.530 25.531  1.00 34.98 ? 226 HOH A O   1 
HETATM 1118 O  O   . HOH C 3 .   ? 22.311 1.611   9.133   1.00 34.77 ? 227 HOH A O   1 
HETATM 1119 O  O   . HOH C 3 .   ? 28.549 -21.820 -3.275  1.00 43.67 ? 228 HOH A O   1 
HETATM 1120 O  O   . HOH C 3 .   ? 22.418 -30.319 18.911  1.00 31.63 ? 229 HOH A O   1 
HETATM 1121 O  O   . HOH C 3 .   ? 42.413 -11.646 16.765  1.00 33.69 ? 230 HOH A O   1 
HETATM 1122 O  O   . HOH C 3 .   ? 20.181 1.217   5.925   1.00 42.31 ? 231 HOH A O   1 
HETATM 1123 O  O   . HOH C 3 .   ? 27.562 -10.003 -8.632  1.00 30.98 ? 232 HOH A O   1 
HETATM 1124 O  O   . HOH C 3 .   ? 15.184 -18.580 9.380   1.00 35.93 ? 233 HOH A O   1 
HETATM 1125 O  O   . HOH C 3 .   ? 36.216 -19.017 4.635   1.00 28.65 ? 234 HOH A O   1 
HETATM 1126 O  O   . HOH C 3 .   ? 34.049 -5.895  2.048   1.00 33.31 ? 235 HOH A O   1 
HETATM 1127 O  O   . HOH C 3 .   ? 29.274 -16.650 -5.975  1.00 40.62 ? 236 HOH A O   1 
HETATM 1128 O  O   . HOH C 3 .   ? 21.680 -19.811 22.901  1.00 30.48 ? 237 HOH A O   1 
HETATM 1129 O  O   . HOH C 3 .   ? 17.826 -23.699 14.044  1.00 22.35 ? 238 HOH A O   1 
HETATM 1130 O  O   . HOH C 3 .   ? 19.768 -21.989 6.666   1.00 29.15 ? 239 HOH A O   1 
HETATM 1131 O  O   . HOH C 3 .   ? 34.715 -7.528  28.091  1.00 25.40 ? 240 HOH A O   1 
HETATM 1132 O  O   . HOH C 3 .   ? 40.816 -8.723  24.474  1.00 37.05 ? 241 HOH A O   1 
HETATM 1133 O  O   . HOH C 3 .   ? 29.091 -19.001 32.449  1.00 38.30 ? 242 HOH A O   1 
HETATM 1134 O  O   . HOH C 3 .   ? 27.501 -15.586 34.755  1.00 31.81 ? 243 HOH A O   1 
HETATM 1135 O  O   . HOH C 3 .   ? 17.778 -25.134 18.186  1.00 36.48 ? 244 HOH A O   1 
HETATM 1136 O  O   . HOH C 3 .   ? 37.383 -12.162 5.983   1.00 44.92 ? 245 HOH A O   1 
HETATM 1137 O  O   . HOH C 3 .   ? 13.299 -18.951 7.110   1.00 31.57 ? 246 HOH A O   1 
HETATM 1138 O  O   . HOH C 3 .   ? 17.550 -21.760 12.117  1.00 30.12 ? 247 HOH A O   1 
HETATM 1139 O  O   . HOH C 3 .   ? 31.003 -4.707  17.550  1.00 33.42 ? 248 HOH A O   1 
HETATM 1140 O  O   . HOH C 3 .   ? 20.546 -19.176 20.349  1.00 33.03 ? 249 HOH A O   1 
HETATM 1141 O  O   . HOH C 3 .   ? 22.955 -31.746 16.637  1.00 26.18 ? 250 HOH A O   1 
HETATM 1142 O  O   . HOH C 3 .   ? 17.293 -20.824 17.072  1.00 29.25 ? 251 HOH A O   1 
HETATM 1143 O  O   . HOH C 3 .   ? 37.542 -9.394  18.667  1.00 46.47 ? 252 HOH A O   1 
HETATM 1144 O  O   . HOH C 3 .   ? 24.251 -22.765 25.235  1.00 38.28 ? 253 HOH A O   1 
HETATM 1145 O  O   . HOH C 3 .   ? 32.659 -16.067 34.685  1.00 46.30 ? 254 HOH A O   1 
HETATM 1146 O  O   . HOH C 3 .   ? 28.744 -20.428 30.692  1.00 34.52 ? 255 HOH A O   1 
HETATM 1147 O  O   . HOH C 3 .   ? 36.201 -11.592 3.621   1.00 37.58 ? 256 HOH A O   1 
HETATM 1148 O  O   . HOH C 3 .   ? 24.473 -19.083 30.064  1.00 34.88 ? 257 HOH A O   1 
HETATM 1149 O  O   . HOH C 3 .   ? 12.788 -13.201 4.737   1.00 30.71 ? 258 HOH A O   1 
HETATM 1150 O  O   . HOH C 3 .   ? 29.862 2.551   4.633   1.00 33.53 ? 259 HOH A O   1 
HETATM 1151 O  O   . HOH C 3 .   ? 20.275 -24.555 11.127  1.00 33.41 ? 260 HOH A O   1 
HETATM 1152 O  O   . HOH C 3 .   ? 37.165 -9.621  14.342  1.00 35.91 ? 261 HOH A O   1 
HETATM 1153 O  O   . HOH C 3 .   ? 29.311 3.900   -0.005  1.00 30.22 ? 262 HOH A O   1 
HETATM 1154 O  O   . HOH C 3 .   ? 22.363 -23.778 0.269   1.00 39.51 ? 263 HOH A O   1 
HETATM 1155 O  O   . HOH C 3 .   ? 15.792 -12.912 -5.574  1.00 41.11 ? 264 HOH A O   1 
HETATM 1156 O  O   . HOH C 3 .   ? 24.195 -6.379  -10.039 1.00 33.35 ? 265 HOH A O   1 
HETATM 1157 O  O   . HOH C 3 .   ? 12.485 -17.136 3.033   1.00 29.86 ? 266 HOH A O   1 
HETATM 1158 O  O   . HOH C 3 .   ? 25.898 -11.778 20.428  1.00 37.45 ? 267 HOH A O   1 
HETATM 1159 O  O   . HOH C 3 .   ? 28.084 -27.855 22.499  1.00 54.71 ? 268 HOH A O   1 
HETATM 1160 O  O   A HOH C 3 .   ? 26.874 -21.293 -7.000  0.50 20.55 ? 269 HOH A O   1 
HETATM 1161 O  O   . HOH C 3 .   ? 18.328 -18.122 -3.856  1.00 28.57 ? 270 HOH A O   1 
HETATM 1162 O  O   . HOH C 3 .   ? 24.264 -1.652  -8.035  1.00 32.97 ? 271 HOH A O   1 
HETATM 1163 O  O   . HOH C 3 .   ? 36.136 -18.253 1.906   1.00 42.23 ? 272 HOH A O   1 
HETATM 1164 O  O   . HOH C 3 .   ? 23.080 -6.999  15.011  1.00 33.57 ? 273 HOH A O   1 
HETATM 1165 O  O   . HOH C 3 .   ? 25.679 -23.819 6.249   1.00 40.44 ? 274 HOH A O   1 
HETATM 1166 O  O   . HOH C 3 .   ? 34.226 -19.913 -0.114  1.00 42.02 ? 275 HOH A O   1 
HETATM 1167 O  O   . HOH C 3 .   ? 36.537 -29.855 5.177   1.00 31.84 ? 276 HOH A O   1 
HETATM 1168 O  O   . HOH C 3 .   ? 18.746 -20.573 19.576  1.00 38.01 ? 277 HOH A O   1 
HETATM 1169 O  O   . HOH C 3 .   ? 30.418 -2.928  8.148   1.00 39.31 ? 278 HOH A O   1 
HETATM 1170 O  O   . HOH C 3 .   ? 20.383 -22.556 10.032  1.00 34.11 ? 279 HOH A O   1 
HETATM 1171 O  O   . HOH C 3 .   ? 24.112 -2.530  9.711   1.00 46.55 ? 280 HOH A O   1 
HETATM 1172 O  O   . HOH C 3 .   ? 32.368 -2.039  24.162  1.00 31.49 ? 281 HOH A O   1 
HETATM 1173 O  O   . HOH C 3 .   ? 13.012 -8.399  5.003   1.00 42.48 ? 282 HOH A O   1 
HETATM 1174 O  O   . HOH C 3 .   ? 19.792 -29.341 19.075  1.00 43.87 ? 283 HOH A O   1 
HETATM 1175 O  O   . HOH C 3 .   ? 43.510 -25.798 15.109  1.00 33.13 ? 284 HOH A O   1 
HETATM 1176 O  O   . HOH C 3 .   ? 39.048 -17.269 4.451   1.00 46.59 ? 285 HOH A O   1 
HETATM 1177 O  O   . HOH C 3 .   ? 33.333 -10.921 -3.673  1.00 36.24 ? 286 HOH A O   1 
HETATM 1178 O  O   . HOH C 3 .   ? 35.361 -20.785 29.676  1.00 34.29 ? 287 HOH A O   1 
HETATM 1179 O  O   . HOH C 3 .   ? 39.770 -15.038 7.208   1.00 45.59 ? 288 HOH A O   1 
HETATM 1180 O  O   . HOH C 3 .   ? 32.224 -4.972  8.393   1.00 47.95 ? 289 HOH A O   1 
HETATM 1181 O  O   . HOH C 3 .   ? 34.924 -27.929 24.387  1.00 40.86 ? 290 HOH A O   1 
HETATM 1182 O  O   . HOH C 3 .   ? 16.409 -14.191 -8.085  1.00 36.91 ? 291 HOH A O   1 
HETATM 1183 O  O   . HOH C 3 .   ? 16.859 -19.178 14.963  1.00 30.62 ? 292 HOH A O   1 
HETATM 1184 O  O   . HOH C 3 .   ? 24.290 -17.976 33.224  1.00 41.31 ? 293 HOH A O   1 
HETATM 1185 O  O   . HOH C 3 .   ? 35.257 -3.488  2.033   1.00 36.71 ? 294 HOH A O   1 
HETATM 1186 O  O   . HOH C 3 .   ? 16.197 -6.592  -1.399  1.00 45.52 ? 295 HOH A O   1 
HETATM 1187 O  O   . HOH C 3 .   ? 23.748 -22.118 -2.846  1.00 41.44 ? 296 HOH A O   1 
HETATM 1188 O  O   . HOH C 3 .   ? 24.232 -21.966 0.013   1.00 42.20 ? 297 HOH A O   1 
HETATM 1189 O  O   . HOH C 3 .   ? 35.792 -5.500  21.086  1.00 39.67 ? 298 HOH A O   1 
HETATM 1190 O  O   . HOH C 3 .   ? 24.088 -23.450 4.170   1.00 36.61 ? 299 HOH A O   1 
HETATM 1191 O  O   . HOH C 3 .   ? 29.071 -3.351  10.218  1.00 46.70 ? 300 HOH A O   1 
HETATM 1192 O  O   . HOH C 3 .   ? 27.760 -34.149 14.100  1.00 38.87 ? 301 HOH A O   1 
HETATM 1193 O  O   . HOH C 3 .   ? 11.630 -7.656  -5.638  1.00 40.12 ? 302 HOH A O   1 
HETATM 1194 O  O   . HOH C 3 .   ? 26.708 -18.296 33.888  1.00 42.64 ? 303 HOH A O   1 
HETATM 1195 O  O   . HOH C 3 .   ? 26.558 -7.693  -10.103 1.00 48.44 ? 304 HOH A O   1 
HETATM 1196 O  O   . HOH C 3 .   ? 42.425 -22.934 9.519   1.00 44.25 ? 305 HOH A O   1 
HETATM 1197 O  O   . HOH C 3 .   ? 44.498 -24.833 17.933  1.00 40.55 ? 306 HOH A O   1 
HETATM 1198 O  O   . HOH C 3 .   ? 29.055 -16.283 -8.472  1.00 36.78 ? 307 HOH A O   1 
HETATM 1199 O  O   . HOH C 3 .   ? 11.225 -9.226  -11.909 1.00 50.05 ? 308 HOH A O   1 
HETATM 1200 O  O   . HOH C 3 .   ? 28.961 -4.437  13.198  1.00 34.97 ? 309 HOH A O   1 
HETATM 1201 O  O   . HOH C 3 .   ? 15.888 -4.053  3.442   1.00 34.77 ? 310 HOH A O   1 
HETATM 1202 O  O   . HOH C 3 .   ? 41.171 -29.441 19.570  1.00 39.43 ? 311 HOH A O   1 
HETATM 1203 O  O   . HOH C 3 .   ? 18.125 5.241   2.695   1.00 47.65 ? 312 HOH A O   1 
HETATM 1204 O  O   . HOH C 3 .   ? 31.963 0.612   5.839   1.00 41.22 ? 313 HOH A O   1 
HETATM 1205 O  O   . HOH C 3 .   ? 32.221 -23.857 3.587   1.00 43.58 ? 314 HOH A O   1 
HETATM 1206 O  O   . HOH C 3 .   ? 34.606 -7.593  12.146  1.00 37.61 ? 315 HOH A O   1 
HETATM 1207 O  O   . HOH C 3 .   ? 42.066 -10.968 23.594  1.00 57.23 ? 316 HOH A O   1 
HETATM 1208 O  O   . HOH C 3 .   ? 27.599 -23.877 28.261  1.00 42.79 ? 317 HOH A O   1 
HETATM 1209 O  O   . HOH C 3 .   ? 45.858 -24.139 9.381   1.00 43.73 ? 318 HOH A O   1 
HETATM 1210 O  O   . HOH C 3 .   ? 41.924 -14.184 13.355  1.00 42.81 ? 319 HOH A O   1 
HETATM 1211 O  O   . HOH C 3 .   ? 37.477 -10.143 34.954  1.00 56.60 ? 320 HOH A O   1 
HETATM 1212 O  O   . HOH C 3 .   ? 30.875 -19.111 -5.413  1.00 41.26 ? 321 HOH A O   1 
HETATM 1213 O  O   . HOH C 3 .   ? 13.062 -6.510  -3.967  1.00 37.62 ? 322 HOH A O   1 
HETATM 1214 O  O   . HOH C 3 .   ? 13.057 -13.432 0.293   1.00 49.37 ? 323 HOH A O   1 
HETATM 1215 O  O   . HOH C 3 .   ? 37.362 -10.497 7.874   1.00 44.17 ? 324 HOH A O   1 
HETATM 1216 O  O   . HOH C 3 .   ? 11.620 -14.971 7.292   1.00 48.61 ? 325 HOH A O   1 
HETATM 1217 O  O   . HOH C 3 .   ? 20.616 -18.085 -5.097  1.00 37.42 ? 326 HOH A O   1 
HETATM 1218 O  O   . HOH C 3 .   ? 40.650 -27.326 23.622  1.00 34.36 ? 327 HOH A O   1 
HETATM 1219 O  O   . HOH C 3 .   ? 37.830 -15.574 30.767  1.00 44.21 ? 328 HOH A O   1 
HETATM 1220 O  O   . HOH C 3 .   ? 14.328 -8.203  0.347   1.00 44.08 ? 329 HOH A O   1 
HETATM 1221 O  O   . HOH C 3 .   ? 38.052 -31.542 20.357  1.00 39.23 ? 330 HOH A O   1 
HETATM 1222 O  O   . HOH C 3 .   ? 42.368 -14.711 17.767  1.00 54.24 ? 331 HOH A O   1 
HETATM 1223 O  O   . HOH C 3 .   ? 36.311 -6.868  6.474   1.00 50.96 ? 332 HOH A O   1 
HETATM 1224 O  O   . HOH C 3 .   ? 18.040 -27.807 18.079  1.00 42.77 ? 333 HOH A O   1 
HETATM 1225 O  O   . HOH C 3 .   ? 14.281 -4.039  6.117   1.00 54.66 ? 334 HOH A O   1 
HETATM 1226 O  O   . HOH C 3 .   ? 35.501 -24.854 27.999  1.00 44.91 ? 335 HOH A O   1 
HETATM 1227 O  O   . HOH C 3 .   ? 26.656 -5.120  13.237  1.00 36.95 ? 336 HOH A O   1 
HETATM 1228 O  O   . HOH C 3 .   ? 24.646 -26.287 27.318  1.00 51.26 ? 337 HOH A O   1 
HETATM 1229 O  O   . HOH C 3 .   ? 32.732 -4.543  15.417  1.00 49.34 ? 338 HOH A O   1 
HETATM 1230 O  O   B HOH C 3 .   ? 28.392 -22.186 -7.198  0.50 29.50 ? 339 HOH A O   1 
HETATM 1231 O  O   . HOH C 3 .   ? 36.605 -12.046 0.765   1.00 53.10 ? 340 HOH A O   1 
HETATM 1232 O  O   . HOH C 3 .   ? 23.548 -8.180  -12.331 1.00 46.96 ? 341 HOH A O   1 
HETATM 1233 O  O   . HOH C 3 .   ? 32.989 -0.002  25.451  0.50 37.15 ? 342 HOH A O   1 
HETATM 1234 O  O   . HOH C 3 .   ? 35.417 -6.853  32.401  1.00 44.71 ? 343 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   19  ?   ?   ?   A . n 
A 1 2   HIS 2   20  ?   ?   ?   A . n 
A 1 3   HIS 3   21  ?   ?   ?   A . n 
A 1 4   HIS 4   22  ?   ?   ?   A . n 
A 1 5   HIS 5   23  ?   ?   ?   A . n 
A 1 6   HIS 6   24  ?   ?   ?   A . n 
A 1 7   HIS 7   25  ?   ?   ?   A . n 
A 1 8   SER 8   26  ?   ?   ?   A . n 
A 1 9   SER 9   27  ?   ?   ?   A . n 
A 1 10  GLY 10  28  ?   ?   ?   A . n 
A 1 11  VAL 11  29  ?   ?   ?   A . n 
A 1 12  ASP 12  30  ?   ?   ?   A . n 
A 1 13  LEU 13  31  ?   ?   ?   A . n 
A 1 14  GLY 14  32  ?   ?   ?   A . n 
A 1 15  THR 15  33  ?   ?   ?   A . n 
A 1 16  GLU 16  34  ?   ?   ?   A . n 
A 1 17  ASN 17  35  ?   ?   ?   A . n 
A 1 18  LEU 18  36  ?   ?   ?   A . n 
A 1 19  TYR 19  37  ?   ?   ?   A . n 
A 1 20  PHE 20  38  ?   ?   ?   A . n 
A 1 21  GLN 21  39  ?   ?   ?   A . n 
A 1 22  SER 22  40  ?   ?   ?   A . n 
A 1 23  MET 23  41  ?   ?   ?   A . n 
A 1 24  LEU 24  42  ?   ?   ?   A . n 
A 1 25  LYS 25  43  ?   ?   ?   A . n 
A 1 26  ARG 26  44  ?   ?   ?   A . n 
A 1 27  LEU 27  45  ?   ?   ?   A . n 
A 1 28  SER 28  46  46  SER SER A . n 
A 1 29  THR 29  47  47  THR THR A . n 
A 1 30  GLU 30  48  48  GLU GLU A . n 
A 1 31  GLU 31  49  49  GLU GLU A . n 
A 1 32  ALA 32  50  50  ALA ALA A . n 
A 1 33  THR 33  51  51  THR THR A . n 
A 1 34  ARG 34  52  52  ARG ARG A . n 
A 1 35  TRP 35  53  53  TRP TRP A . n 
A 1 36  ALA 36  54  54  ALA ALA A . n 
A 1 37  ASP 37  55  55  ASP ASP A . n 
A 1 38  SER 38  56  56  SER SER A . n 
A 1 39  PHE 39  57  57  PHE PHE A . n 
A 1 40  ASP 40  58  58  ASP ASP A . n 
A 1 41  VAL 41  59  59  VAL VAL A . n 
A 1 42  LEU 42  60  60  LEU LEU A . n 
A 1 43  LEU 43  61  61  LEU LEU A . n 
A 1 44  SER 44  62  62  SER SER A . n 
A 1 45  HIS 45  63  63  HIS HIS A . n 
A 1 46  LYS 46  64  64  LYS LYS A . n 
A 1 47  TYR 47  65  65  TYR TYR A . n 
A 1 48  GLY 48  66  66  GLY GLY A . n 
A 1 49  VAL 49  67  67  VAL VAL A . n 
A 1 50  ALA 50  68  68  ALA ALA A . n 
A 1 51  ALA 51  69  69  ALA ALA A . n 
A 1 52  PHE 52  70  70  PHE PHE A . n 
A 1 53  ARG 53  71  71  ARG ARG A . n 
A 1 54  ALA 54  72  72  ALA ALA A . n 
A 1 55  PHE 55  73  73  PHE PHE A . n 
A 1 56  LEU 56  74  74  LEU LEU A . n 
A 1 57  LYS 57  75  75  LYS LYS A . n 
A 1 58  THR 58  76  76  THR THR A . n 
A 1 59  GLU 59  77  77  GLU GLU A . n 
A 1 60  PHE 60  78  78  PHE PHE A . n 
A 1 61  SER 61  79  79  SER SER A . n 
A 1 62  GLU 62  80  80  GLU GLU A . n 
A 1 63  GLU 63  81  81  GLU GLU A . n 
A 1 64  ASN 64  82  82  ASN ASN A . n 
A 1 65  LEU 65  83  83  LEU LEU A . n 
A 1 66  GLU 66  84  84  GLU GLU A . n 
A 1 67  PHE 67  85  85  PHE PHE A . n 
A 1 68  TRP 68  86  86  TRP TRP A . n 
A 1 69  LEU 69  87  87  LEU LEU A . n 
A 1 70  ALA 70  88  88  ALA ALA A . n 
A 1 71  CYS 71  89  89  CYS CYS A . n 
A 1 72  GLU 72  90  90  GLU GLU A . n 
A 1 73  GLU 73  91  91  GLU GLU A . n 
A 1 74  PHE 74  92  92  PHE PHE A . n 
A 1 75  LYS 75  93  93  LYS LYS A . n 
A 1 76  LYS 76  94  94  LYS LYS A . n 
A 1 77  THR 77  95  95  THR THR A . n 
A 1 78  ARG 78  96  96  ARG ARG A . n 
A 1 79  SER 79  97  97  SER SER A . n 
A 1 80  THR 80  98  98  THR THR A . n 
A 1 81  ALA 81  99  99  ALA ALA A . n 
A 1 82  LYS 82  100 100 LYS LYS A . n 
A 1 83  LEU 83  101 101 LEU LEU A . n 
A 1 84  VAL 84  102 102 VAL VAL A . n 
A 1 85  SER 85  103 103 SER SER A . n 
A 1 86  LYS 86  104 104 LYS LYS A . n 
A 1 87  ALA 87  105 105 ALA ALA A . n 
A 1 88  HIS 88  106 106 HIS HIS A . n 
A 1 89  ARG 89  107 107 ARG ARG A . n 
A 1 90  ILE 90  108 108 ILE ILE A . n 
A 1 91  PHE 91  109 109 PHE PHE A . n 
A 1 92  GLU 92  110 110 GLU GLU A . n 
A 1 93  GLU 93  111 111 GLU GLU A . n 
A 1 94  PHE 94  112 112 PHE PHE A . n 
A 1 95  VAL 95  113 113 VAL VAL A . n 
A 1 96  ASP 96  114 114 ASP ASP A . n 
A 1 97  VAL 97  115 115 VAL VAL A . n 
A 1 98  GLN 98  116 116 GLN GLN A . n 
A 1 99  ALA 99  117 117 ALA ALA A . n 
A 1 100 PRO 100 118 118 PRO PRO A . n 
A 1 101 ARG 101 119 119 ARG ARG A . n 
A 1 102 GLU 102 120 120 GLU GLU A . n 
A 1 103 VAL 103 121 121 VAL VAL A . n 
A 1 104 ASN 104 122 122 ASN ASN A . n 
A 1 105 ILE 105 123 123 ILE ILE A . n 
A 1 106 ASP 106 124 124 ASP ASP A . n 
A 1 107 PHE 107 125 125 PHE PHE A . n 
A 1 108 GLN 108 126 126 GLN GLN A . n 
A 1 109 THR 109 127 127 THR THR A . n 
A 1 110 ARG 110 128 128 ARG ARG A . n 
A 1 111 GLU 111 129 129 GLU GLU A . n 
A 1 112 ALA 112 130 130 ALA ALA A . n 
A 1 113 THR 113 131 131 THR THR A . n 
A 1 114 ARG 114 132 132 ARG ARG A . n 
A 1 115 LYS 115 133 133 LYS LYS A . n 
A 1 116 ASN 116 134 134 ASN ASN A . n 
A 1 117 LEU 117 135 135 LEU LEU A . n 
A 1 118 GLN 118 136 136 GLN GLN A . n 
A 1 119 GLU 119 137 137 GLU GLU A . n 
A 1 120 PRO 120 138 138 PRO PRO A . n 
A 1 121 SER 121 139 139 SER SER A . n 
A 1 122 LEU 122 140 140 LEU LEU A . n 
A 1 123 THR 123 141 141 THR THR A . n 
A 1 124 CYS 124 142 142 CYS CYS A . n 
A 1 125 PHE 125 143 143 PHE PHE A . n 
A 1 126 ASP 126 144 144 ASP ASP A . n 
A 1 127 GLN 127 145 145 GLN GLN A . n 
A 1 128 ALA 128 146 146 ALA ALA A . n 
A 1 129 GLN 129 147 147 GLN GLN A . n 
A 1 130 GLY 130 148 148 GLY GLY A . n 
A 1 131 LYS 131 149 149 LYS LYS A . n 
A 1 132 VAL 132 150 150 VAL VAL A . n 
A 1 133 HIS 133 151 151 HIS HIS A . n 
A 1 134 SER 134 152 152 SER SER A . n 
A 1 135 LEU 135 153 153 LEU LEU A . n 
A 1 136 MET 136 154 154 MET MET A . n 
A 1 137 GLU 137 155 155 GLU GLU A . n 
A 1 138 LYS 138 156 156 LYS LYS A . n 
A 1 139 ASP 139 157 157 ASP ASP A . n 
A 1 140 SER 140 158 158 SER SER A . n 
A 1 141 TYR 141 159 159 TYR TYR A . n 
A 1 142 PRO 142 160 160 PRO PRO A . n 
A 1 143 ARG 143 161 161 ARG ARG A . n 
A 1 144 PHE 144 162 162 PHE PHE A . n 
A 1 145 LEU 145 163 163 LEU LEU A . n 
A 1 146 ARG 146 164 164 ARG ARG A . n 
A 1 147 SER 147 165 165 SER SER A . n 
A 1 148 LYS 148 166 166 LYS LYS A . n 
A 1 149 MET 149 167 167 MET MET A . n 
A 1 150 TYR 150 168 168 TYR TYR A . n 
A 1 151 LEU 151 169 169 LEU LEU A . n 
A 1 152 ASP 152 170 170 ASP ASP A . n 
A 1 153 LEU 153 171 171 LEU LEU A . n 
A 1 154 LEU 154 172 172 LEU LEU A . n 
A 1 155 SER 155 173 ?   ?   ?   A . n 
# 
_pdbx_SG_project.id                    1 
_pdbx_SG_project.project_name          ? 
_pdbx_SG_project.full_name_of_center   'Structural Genomics Consortium' 
_pdbx_SG_project.initial_of_center     SGC 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 CL  1   1   1   CL  CL  A . 
C 3 HOH 1   174 2   HOH HOH A . 
C 3 HOH 2   175 3   HOH HOH A . 
C 3 HOH 3   176 4   HOH HOH A . 
C 3 HOH 4   177 5   HOH HOH A . 
C 3 HOH 5   178 6   HOH HOH A . 
C 3 HOH 6   179 7   HOH HOH A . 
C 3 HOH 7   180 8   HOH HOH A . 
C 3 HOH 8   181 9   HOH HOH A . 
C 3 HOH 9   182 10  HOH HOH A . 
C 3 HOH 10  183 11  HOH HOH A . 
C 3 HOH 11  184 12  HOH HOH A . 
C 3 HOH 12  185 13  HOH HOH A . 
C 3 HOH 13  186 14  HOH HOH A . 
C 3 HOH 14  187 15  HOH HOH A . 
C 3 HOH 15  188 16  HOH HOH A . 
C 3 HOH 16  189 17  HOH HOH A . 
C 3 HOH 17  190 18  HOH HOH A . 
C 3 HOH 18  191 19  HOH HOH A . 
C 3 HOH 19  192 20  HOH HOH A . 
C 3 HOH 20  193 21  HOH HOH A . 
C 3 HOH 21  194 22  HOH HOH A . 
C 3 HOH 22  195 23  HOH HOH A . 
C 3 HOH 23  196 24  HOH HOH A . 
C 3 HOH 24  197 25  HOH HOH A . 
C 3 HOH 25  198 26  HOH HOH A . 
C 3 HOH 26  199 27  HOH HOH A . 
C 3 HOH 27  200 28  HOH HOH A . 
C 3 HOH 28  201 29  HOH HOH A . 
C 3 HOH 29  202 30  HOH HOH A . 
C 3 HOH 30  203 31  HOH HOH A . 
C 3 HOH 31  204 32  HOH HOH A . 
C 3 HOH 32  205 33  HOH HOH A . 
C 3 HOH 33  206 34  HOH HOH A . 
C 3 HOH 34  207 35  HOH HOH A . 
C 3 HOH 35  208 36  HOH HOH A . 
C 3 HOH 36  209 37  HOH HOH A . 
C 3 HOH 37  210 39  HOH HOH A . 
C 3 HOH 38  211 40  HOH HOH A . 
C 3 HOH 39  212 41  HOH HOH A . 
C 3 HOH 40  213 42  HOH HOH A . 
C 3 HOH 41  214 43  HOH HOH A . 
C 3 HOH 42  215 44  HOH HOH A . 
C 3 HOH 43  216 45  HOH HOH A . 
C 3 HOH 44  217 46  HOH HOH A . 
C 3 HOH 45  218 48  HOH HOH A . 
C 3 HOH 46  219 49  HOH HOH A . 
C 3 HOH 47  220 50  HOH HOH A . 
C 3 HOH 48  221 51  HOH HOH A . 
C 3 HOH 49  222 52  HOH HOH A . 
C 3 HOH 50  223 53  HOH HOH A . 
C 3 HOH 51  224 54  HOH HOH A . 
C 3 HOH 52  225 55  HOH HOH A . 
C 3 HOH 53  226 56  HOH HOH A . 
C 3 HOH 54  227 57  HOH HOH A . 
C 3 HOH 55  228 58  HOH HOH A . 
C 3 HOH 56  229 59  HOH HOH A . 
C 3 HOH 57  230 60  HOH HOH A . 
C 3 HOH 58  231 61  HOH HOH A . 
C 3 HOH 59  232 62  HOH HOH A . 
C 3 HOH 60  233 63  HOH HOH A . 
C 3 HOH 61  234 64  HOH HOH A . 
C 3 HOH 62  235 66  HOH HOH A . 
C 3 HOH 63  236 67  HOH HOH A . 
C 3 HOH 64  237 68  HOH HOH A . 
C 3 HOH 65  238 69  HOH HOH A . 
C 3 HOH 66  239 70  HOH HOH A . 
C 3 HOH 67  240 71  HOH HOH A . 
C 3 HOH 68  241 72  HOH HOH A . 
C 3 HOH 69  242 73  HOH HOH A . 
C 3 HOH 70  243 74  HOH HOH A . 
C 3 HOH 71  244 75  HOH HOH A . 
C 3 HOH 72  245 76  HOH HOH A . 
C 3 HOH 73  246 77  HOH HOH A . 
C 3 HOH 74  247 78  HOH HOH A . 
C 3 HOH 75  248 79  HOH HOH A . 
C 3 HOH 76  249 80  HOH HOH A . 
C 3 HOH 77  250 81  HOH HOH A . 
C 3 HOH 78  251 82  HOH HOH A . 
C 3 HOH 79  252 84  HOH HOH A . 
C 3 HOH 80  253 85  HOH HOH A . 
C 3 HOH 81  254 86  HOH HOH A . 
C 3 HOH 82  255 87  HOH HOH A . 
C 3 HOH 83  256 88  HOH HOH A . 
C 3 HOH 84  257 90  HOH HOH A . 
C 3 HOH 85  258 91  HOH HOH A . 
C 3 HOH 86  259 92  HOH HOH A . 
C 3 HOH 87  260 93  HOH HOH A . 
C 3 HOH 88  261 94  HOH HOH A . 
C 3 HOH 89  262 95  HOH HOH A . 
C 3 HOH 90  263 96  HOH HOH A . 
C 3 HOH 91  264 97  HOH HOH A . 
C 3 HOH 92  265 98  HOH HOH A . 
C 3 HOH 93  266 99  HOH HOH A . 
C 3 HOH 94  267 100 HOH HOH A . 
C 3 HOH 95  268 101 HOH HOH A . 
C 3 HOH 96  269 103 HOH HOH A . 
C 3 HOH 97  270 104 HOH HOH A . 
C 3 HOH 98  271 105 HOH HOH A . 
C 3 HOH 99  272 106 HOH HOH A . 
C 3 HOH 100 273 108 HOH HOH A . 
C 3 HOH 101 274 109 HOH HOH A . 
C 3 HOH 102 275 110 HOH HOH A . 
C 3 HOH 103 276 111 HOH HOH A . 
C 3 HOH 104 277 112 HOH HOH A . 
C 3 HOH 105 278 113 HOH HOH A . 
C 3 HOH 106 279 114 HOH HOH A . 
C 3 HOH 107 280 115 HOH HOH A . 
C 3 HOH 108 281 116 HOH HOH A . 
C 3 HOH 109 282 117 HOH HOH A . 
C 3 HOH 110 283 118 HOH HOH A . 
C 3 HOH 111 284 119 HOH HOH A . 
C 3 HOH 112 285 120 HOH HOH A . 
C 3 HOH 113 286 121 HOH HOH A . 
C 3 HOH 114 287 122 HOH HOH A . 
C 3 HOH 115 288 123 HOH HOH A . 
C 3 HOH 116 289 124 HOH HOH A . 
C 3 HOH 117 290 125 HOH HOH A . 
C 3 HOH 118 291 126 HOH HOH A . 
C 3 HOH 119 292 127 HOH HOH A . 
C 3 HOH 120 293 128 HOH HOH A . 
C 3 HOH 121 294 130 HOH HOH A . 
C 3 HOH 122 295 131 HOH HOH A . 
C 3 HOH 123 296 132 HOH HOH A . 
C 3 HOH 124 297 133 HOH HOH A . 
C 3 HOH 125 298 134 HOH HOH A . 
C 3 HOH 126 299 135 HOH HOH A . 
C 3 HOH 127 300 136 HOH HOH A . 
C 3 HOH 128 301 138 HOH HOH A . 
C 3 HOH 129 302 140 HOH HOH A . 
C 3 HOH 130 303 141 HOH HOH A . 
C 3 HOH 131 304 142 HOH HOH A . 
C 3 HOH 132 305 143 HOH HOH A . 
C 3 HOH 133 306 144 HOH HOH A . 
C 3 HOH 134 307 145 HOH HOH A . 
C 3 HOH 135 308 146 HOH HOH A . 
C 3 HOH 136 309 147 HOH HOH A . 
C 3 HOH 137 310 149 HOH HOH A . 
C 3 HOH 138 311 150 HOH HOH A . 
C 3 HOH 139 312 151 HOH HOH A . 
C 3 HOH 140 313 152 HOH HOH A . 
C 3 HOH 141 314 153 HOH HOH A . 
C 3 HOH 142 315 154 HOH HOH A . 
C 3 HOH 143 316 155 HOH HOH A . 
C 3 HOH 144 317 156 HOH HOH A . 
C 3 HOH 145 318 159 HOH HOH A . 
C 3 HOH 146 319 160 HOH HOH A . 
C 3 HOH 147 320 161 HOH HOH A . 
C 3 HOH 148 321 162 HOH HOH A . 
C 3 HOH 149 322 163 HOH HOH A . 
C 3 HOH 150 323 167 HOH HOH A . 
C 3 HOH 151 324 168 HOH HOH A . 
C 3 HOH 152 325 169 HOH HOH A . 
C 3 HOH 153 326 171 HOH HOH A . 
C 3 HOH 154 327 172 HOH HOH A . 
C 3 HOH 155 328 173 HOH HOH A . 
C 3 HOH 156 329 174 HOH HOH A . 
C 3 HOH 157 330 176 HOH HOH A . 
C 3 HOH 158 331 178 HOH HOH A . 
C 3 HOH 159 332 179 HOH HOH A . 
C 3 HOH 160 333 182 HOH HOH A . 
C 3 HOH 161 334 183 HOH HOH A . 
C 3 HOH 162 335 184 HOH HOH A . 
C 3 HOH 163 336 185 HOH HOH A . 
C 3 HOH 164 337 186 HOH HOH A . 
C 3 HOH 165 338 188 HOH HOH A . 
C 3 HOH 166 339 190 HOH HOH A . 
C 3 HOH 167 340 191 HOH HOH A . 
C 3 HOH 168 341 193 HOH HOH A . 
C 3 HOH 169 342 194 HOH HOH A . 
C 3 HOH 170 343 195 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
_pdbx_struct_special_symmetry.id              1 
_pdbx_struct_special_symmetry.PDB_model_num   1 
_pdbx_struct_special_symmetry.auth_asym_id    A 
_pdbx_struct_special_symmetry.auth_comp_id    HOH 
_pdbx_struct_special_symmetry.auth_seq_id     342 
_pdbx_struct_special_symmetry.PDB_ins_code    ? 
_pdbx_struct_special_symmetry.label_asym_id   C 
_pdbx_struct_special_symmetry.label_comp_id   HOH 
_pdbx_struct_special_symmetry.label_seq_id    . 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2006-11-21 
2 'Structure model' 1 1 2008-05-01 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' Advisory                    
3 3 'Structure model' 'Version format compliance' 
# 
loop_
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.pdbx_refine_id 
1 ? refined 23.1119 -4.0256  2.0716  0.1933 0.0513  0.1774  -0.0280 0.0147  0.0203  4.7685  4.4938 2.6785  0.8619  -0.1493 -1.7568 
0.0681  0.1923  0.8379  -0.0818 -0.0006 -0.0752 -0.5561 -0.0687 -0.0676 'X-RAY DIFFRACTION' 
2 ? refined 23.1978 -16.6517 7.4898  0.0753 0.0535  0.0459  -0.0240 -0.0171 0.0036  2.5122  0.7763 4.8464  0.4654  2.6109  1.4388  
-0.0568 0.0741  0.0283  -0.1410 0.1086  0.1026  0.0636  -0.1027 -0.0518 'X-RAY DIFFRACTION' 
3 ? refined 29.4288 -14.6905 23.2787 0.0760 0.1292  0.0880  0.0351  -0.0098 -0.0156 1.6910  1.7957 5.7165  0.6175  0.8996  1.8622  
-0.0565 -0.2132 0.0204  0.1355  0.0781  0.0350  -0.0232 0.1613  -0.0216 'X-RAY DIFFRACTION' 
4 ? refined 28.2783 -25.6984 12.8515 0.1650 0.0490  0.1486  0.0353  0.0305  -0.0199 4.9331  3.5058 4.2559  3.9049  0.2255  -1.1486 
-0.3076 -0.0344 -0.5031 -0.3470 0.1608  -0.4846 0.5239  0.1142  0.1468  'X-RAY DIFFRACTION' 
5 ? refined 37.1318 -19.2035 15.9492 0.1296 0.1458  0.1020  0.0523  0.0195  -0.0285 2.3252  2.5674 3.7784  -0.0560 -0.3540 -0.2587 
-0.1549 -0.1248 -0.0366 0.0450  0.0931  -0.2853 0.4557  0.4403  0.0619  'X-RAY DIFFRACTION' 
6 ? refined 23.1219 -9.7982  -4.9392 0.0808 -0.0304 -0.0547 0.0008  -0.0100 0.0289  12.3591 6.0480 10.8982 -5.3911 2.8675  -0.8905 
0.3584  0.8460  0.3025  -0.7821 -0.4222 0.2243  -0.4671 -0.0675 0.0638  'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.selection_details 
1 1 A 46  A 28  A 74  A 56  ? 'X-RAY DIFFRACTION' ? 
2 2 A 75  A 57  A 87  A 69  ? 'X-RAY DIFFRACTION' ? 
3 3 A 88  A 70  A 114 A 96  ? 'X-RAY DIFFRACTION' ? 
4 4 A 115 A 97  A 124 A 106 ? 'X-RAY DIFFRACTION' ? 
5 5 A 125 A 107 A 154 A 136 ? 'X-RAY DIFFRACTION' ? 
6 6 A 155 A 137 A 172 A 154 ? 'X-RAY DIFFRACTION' ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC   refinement       5.2.0019 ? 1 
HKL-2000 'data reduction' .        ? 2 
HKL-2000 'data scaling'   .        ? 3 
PHASER   phasing          .        ? 4 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   OE2 
_pdbx_validate_close_contact.auth_asym_id_1   A 
_pdbx_validate_close_contact.auth_comp_id_1   GLU 
_pdbx_validate_close_contact.auth_seq_id_1    77 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   O 
_pdbx_validate_close_contact.auth_asym_id_2   A 
_pdbx_validate_close_contact.auth_comp_id_2   HOH 
_pdbx_validate_close_contact.auth_seq_id_2    326 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.06 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             NE 
_pdbx_validate_rmsd_angle.auth_asym_id_1             A 
_pdbx_validate_rmsd_angle.auth_comp_id_1             ARG 
_pdbx_validate_rmsd_angle.auth_seq_id_1              71 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             A 
_pdbx_validate_rmsd_angle.auth_atom_id_2             CZ 
_pdbx_validate_rmsd_angle.auth_asym_id_2             A 
_pdbx_validate_rmsd_angle.auth_comp_id_2             ARG 
_pdbx_validate_rmsd_angle.auth_seq_id_2              71 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             A 
_pdbx_validate_rmsd_angle.auth_atom_id_3             NH1 
_pdbx_validate_rmsd_angle.auth_asym_id_3             A 
_pdbx_validate_rmsd_angle.auth_comp_id_3             ARG 
_pdbx_validate_rmsd_angle.auth_seq_id_3              71 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             A 
_pdbx_validate_rmsd_angle.angle_value                124.39 
_pdbx_validate_rmsd_angle.angle_target_value         120.30 
_pdbx_validate_rmsd_angle.angle_deviation            4.09 
_pdbx_validate_rmsd_angle.angle_standard_deviation   0.50 
_pdbx_validate_rmsd_angle.linker_flag                N 
# 
_pdbx_validate_torsion.id              1 
_pdbx_validate_torsion.PDB_model_num   1 
_pdbx_validate_torsion.auth_comp_id    ASP 
_pdbx_validate_torsion.auth_asym_id    A 
_pdbx_validate_torsion.auth_seq_id     157 
_pdbx_validate_torsion.PDB_ins_code    ? 
_pdbx_validate_torsion.label_alt_id    ? 
_pdbx_validate_torsion.phi             -107.35 
_pdbx_validate_torsion.psi             -69.22 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 A GLU 48 ? CD  ? A GLU 30 CD  
2 1 Y 1 A GLU 48 ? OE1 ? A GLU 30 OE1 
3 1 Y 1 A GLU 48 ? OE2 ? A GLU 30 OE2 
4 1 Y 1 A LYS 64 ? CD  ? A LYS 46 CD  
5 1 Y 1 A LYS 64 ? CE  ? A LYS 46 CE  
6 1 Y 1 A LYS 64 ? NZ  ? A LYS 46 NZ  
7 1 Y 1 A GLU 91 ? CD  ? A GLU 73 CD  
8 1 Y 1 A GLU 91 ? OE1 ? A GLU 73 OE1 
9 1 Y 1 A GLU 91 ? OE2 ? A GLU 73 OE2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 19  ? A MET 1   
2  1 Y 1 A HIS 20  ? A HIS 2   
3  1 Y 1 A HIS 21  ? A HIS 3   
4  1 Y 1 A HIS 22  ? A HIS 4   
5  1 Y 1 A HIS 23  ? A HIS 5   
6  1 Y 1 A HIS 24  ? A HIS 6   
7  1 Y 1 A HIS 25  ? A HIS 7   
8  1 Y 1 A SER 26  ? A SER 8   
9  1 Y 1 A SER 27  ? A SER 9   
10 1 Y 1 A GLY 28  ? A GLY 10  
11 1 Y 1 A VAL 29  ? A VAL 11  
12 1 Y 1 A ASP 30  ? A ASP 12  
13 1 Y 1 A LEU 31  ? A LEU 13  
14 1 Y 1 A GLY 32  ? A GLY 14  
15 1 Y 1 A THR 33  ? A THR 15  
16 1 Y 1 A GLU 34  ? A GLU 16  
17 1 Y 1 A ASN 35  ? A ASN 17  
18 1 Y 1 A LEU 36  ? A LEU 18  
19 1 Y 1 A TYR 37  ? A TYR 19  
20 1 Y 1 A PHE 38  ? A PHE 20  
21 1 Y 1 A GLN 39  ? A GLN 21  
22 1 Y 1 A SER 40  ? A SER 22  
23 1 Y 1 A MET 41  ? A MET 23  
24 1 Y 1 A LEU 42  ? A LEU 24  
25 1 Y 1 A LYS 43  ? A LYS 25  
26 1 Y 1 A ARG 44  ? A ARG 26  
27 1 Y 1 A LEU 45  ? A LEU 27  
28 1 Y 1 A SER 173 ? A SER 155 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'CHLORIDE ION' CL  
3 water          HOH 
#