data_2IK8
# 
_entry.id   2IK8 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2IK8         
RCSB  RCSB039674   
WWPDB D_1000039674 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2IK8 
_pdbx_database_status.recvd_initial_deposition_date   2006-10-02 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Soundararajan, M.'                    1  
'Turnbull, A.P.'                       2  
'Papagrigoriou, E.'                    3  
'Debreczeni, J.'                       4  
'Gorrec, F.'                           5  
'von Delft, F.'                        6  
'Weigelt, J.'                          7  
'Edwards, A.'                          8  
'Arrowsmith, C.'                       9  
'Sundstrom, M.'                        10 
'Doyle, D.A.'                          11 
'Structural Genomics Consortium (SGC)' 12 
# 
_citation.id                        primary 
_citation.title                     
'Structural diversity in the RGS domain and its interaction with heterotrimeric G protein alpha-subunits.' 
_citation.journal_abbrev            Proc.Natl.Acad.Sci.Usa 
_citation.journal_volume            105 
_citation.page_first                6457 
_citation.page_last                 6462 
_citation.year                      2008 
_citation.journal_id_ASTM           PNASA6 
_citation.country                   US 
_citation.journal_id_ISSN           0027-8424 
_citation.journal_id_CSD            0040 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   18434541 
_citation.pdbx_database_id_DOI      10.1073/pnas.0801508105 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Soundararajan, M.' 1  
primary 'Willard, F.S.'     2  
primary 'Kimple, A.J.'      3  
primary 'Turnbull, A.P.'    4  
primary 'Ball, L.J.'        5  
primary 'Schoch, G.A.'      6  
primary 'Gileadi, C.'       7  
primary 'Fedorov, O.Y.'     8  
primary 'Dowler, E.F.'      9  
primary 'Higman, V.A.'      10 
primary 'Hutsell, S.Q.'     11 
primary 'Sundstrom, M.'     12 
primary 'Doyle, D.A.'       13 
primary 'Siderovski, D.P.'  14 
# 
_cell.entry_id           2IK8 
_cell.length_a           82.656 
_cell.length_b           104.312 
_cell.length_c           124.048 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         2IK8 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Guanine nucleotide-binding protein G(i), alpha-1 subunit' 37102.297 2  ? ? ? ? 
2 polymer     man 'Regulator of G-protein signaling 16'                      15917.886 2  ? ? ? ? 
3 non-polymer syn 'TETRAFLUOROALUMINATE ION'                                 102.975   2  ? ? ? ? 
4 non-polymer syn 'MAGNESIUM ION'                                            24.305    2  ? ? ? ? 
5 non-polymer syn 'SULFATE ION'                                              96.063    8  ? ? ? ? 
6 non-polymer syn "GUANOSINE-5'-DIPHOSPHATE"                                 443.201   2  ? ? ? ? 
7 water       nat water                                                      18.015    36 ? ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'Adenylate cyclase-inhibiting G alpha protein'                                  
2 'RGS16, Retinally abundant regulator of G-protein signaling, RGS-R, A28-RGS14P' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;AREVKLLLLGAGESGKSTIVKQMKIIHEAGYSEEECKQYKAVVYSNTIQSIIAIIRAMGRLKIDFGDSARADDARQLFVL
AGAAEEGFMTAELAGVIKRLWKDSGVQACFNRSREYQLNDSAAYYLNDLDRIAQPNYIPTQQDVLRTRVKTTGIVETHFT
FKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILFLNK
KDLFEEKIKKSPLTICYPEYAGSNTYEEAAAYIQCQFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKD
CGLF
;
;AREVKLLLLGAGESGKSTIVKQMKIIHEAGYSEEECKQYKAVVYSNTIQSIIAIIRAMGRLKIDFGDSARADDARQLFVL
AGAAEEGFMTAELAGVIKRLWKDSGVQACFNRSREYQLNDSAAYYLNDLDRIAQPNYIPTQQDVLRTRVKTTGIVETHFT
FKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILFLNK
KDLFEEKIKKSPLTICYPEYAGSNTYEEAAAYIQCQFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKD
CGLF
;
A,C ? 
2 'polypeptide(L)' no no 
;SMRNFSEDVLGWRESFDLLLSSKNGVAAFHAFLKTEFSEENLEFWLACEEFKKIRSATKLASRAHQIFEEFICSEAPKEV
NIDHETRELTRMNLQTATATCFDAAQGKTRTLMEKDSYPRFLKSPAYRDLAAQASAASAT
;
;SMRNFSEDVLGWRESFDLLLSSKNGVAAFHAFLKTEFSEENLEFWLACEEFKKIRSATKLASRAHQIFEEFICSEAPKEV
NIDHETRELTRMNLQTATATCFDAAQGKTRTLMEKDSYPRFLKSPAYRDLAAQASAASAT
;
B,D ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ALA n 
1 2   ARG n 
1 3   GLU n 
1 4   VAL n 
1 5   LYS n 
1 6   LEU n 
1 7   LEU n 
1 8   LEU n 
1 9   LEU n 
1 10  GLY n 
1 11  ALA n 
1 12  GLY n 
1 13  GLU n 
1 14  SER n 
1 15  GLY n 
1 16  LYS n 
1 17  SER n 
1 18  THR n 
1 19  ILE n 
1 20  VAL n 
1 21  LYS n 
1 22  GLN n 
1 23  MET n 
1 24  LYS n 
1 25  ILE n 
1 26  ILE n 
1 27  HIS n 
1 28  GLU n 
1 29  ALA n 
1 30  GLY n 
1 31  TYR n 
1 32  SER n 
1 33  GLU n 
1 34  GLU n 
1 35  GLU n 
1 36  CYS n 
1 37  LYS n 
1 38  GLN n 
1 39  TYR n 
1 40  LYS n 
1 41  ALA n 
1 42  VAL n 
1 43  VAL n 
1 44  TYR n 
1 45  SER n 
1 46  ASN n 
1 47  THR n 
1 48  ILE n 
1 49  GLN n 
1 50  SER n 
1 51  ILE n 
1 52  ILE n 
1 53  ALA n 
1 54  ILE n 
1 55  ILE n 
1 56  ARG n 
1 57  ALA n 
1 58  MET n 
1 59  GLY n 
1 60  ARG n 
1 61  LEU n 
1 62  LYS n 
1 63  ILE n 
1 64  ASP n 
1 65  PHE n 
1 66  GLY n 
1 67  ASP n 
1 68  SER n 
1 69  ALA n 
1 70  ARG n 
1 71  ALA n 
1 72  ASP n 
1 73  ASP n 
1 74  ALA n 
1 75  ARG n 
1 76  GLN n 
1 77  LEU n 
1 78  PHE n 
1 79  VAL n 
1 80  LEU n 
1 81  ALA n 
1 82  GLY n 
1 83  ALA n 
1 84  ALA n 
1 85  GLU n 
1 86  GLU n 
1 87  GLY n 
1 88  PHE n 
1 89  MET n 
1 90  THR n 
1 91  ALA n 
1 92  GLU n 
1 93  LEU n 
1 94  ALA n 
1 95  GLY n 
1 96  VAL n 
1 97  ILE n 
1 98  LYS n 
1 99  ARG n 
1 100 LEU n 
1 101 TRP n 
1 102 LYS n 
1 103 ASP n 
1 104 SER n 
1 105 GLY n 
1 106 VAL n 
1 107 GLN n 
1 108 ALA n 
1 109 CYS n 
1 110 PHE n 
1 111 ASN n 
1 112 ARG n 
1 113 SER n 
1 114 ARG n 
1 115 GLU n 
1 116 TYR n 
1 117 GLN n 
1 118 LEU n 
1 119 ASN n 
1 120 ASP n 
1 121 SER n 
1 122 ALA n 
1 123 ALA n 
1 124 TYR n 
1 125 TYR n 
1 126 LEU n 
1 127 ASN n 
1 128 ASP n 
1 129 LEU n 
1 130 ASP n 
1 131 ARG n 
1 132 ILE n 
1 133 ALA n 
1 134 GLN n 
1 135 PRO n 
1 136 ASN n 
1 137 TYR n 
1 138 ILE n 
1 139 PRO n 
1 140 THR n 
1 141 GLN n 
1 142 GLN n 
1 143 ASP n 
1 144 VAL n 
1 145 LEU n 
1 146 ARG n 
1 147 THR n 
1 148 ARG n 
1 149 VAL n 
1 150 LYS n 
1 151 THR n 
1 152 THR n 
1 153 GLY n 
1 154 ILE n 
1 155 VAL n 
1 156 GLU n 
1 157 THR n 
1 158 HIS n 
1 159 PHE n 
1 160 THR n 
1 161 PHE n 
1 162 LYS n 
1 163 ASP n 
1 164 LEU n 
1 165 HIS n 
1 166 PHE n 
1 167 LYS n 
1 168 MET n 
1 169 PHE n 
1 170 ASP n 
1 171 VAL n 
1 172 GLY n 
1 173 GLY n 
1 174 GLN n 
1 175 ARG n 
1 176 SER n 
1 177 GLU n 
1 178 ARG n 
1 179 LYS n 
1 180 LYS n 
1 181 TRP n 
1 182 ILE n 
1 183 HIS n 
1 184 CYS n 
1 185 PHE n 
1 186 GLU n 
1 187 GLY n 
1 188 VAL n 
1 189 THR n 
1 190 ALA n 
1 191 ILE n 
1 192 ILE n 
1 193 PHE n 
1 194 CYS n 
1 195 VAL n 
1 196 ALA n 
1 197 LEU n 
1 198 SER n 
1 199 ASP n 
1 200 TYR n 
1 201 ASP n 
1 202 LEU n 
1 203 VAL n 
1 204 LEU n 
1 205 ALA n 
1 206 GLU n 
1 207 ASP n 
1 208 GLU n 
1 209 GLU n 
1 210 MET n 
1 211 ASN n 
1 212 ARG n 
1 213 MET n 
1 214 HIS n 
1 215 GLU n 
1 216 SER n 
1 217 MET n 
1 218 LYS n 
1 219 LEU n 
1 220 PHE n 
1 221 ASP n 
1 222 SER n 
1 223 ILE n 
1 224 CYS n 
1 225 ASN n 
1 226 ASN n 
1 227 LYS n 
1 228 TRP n 
1 229 PHE n 
1 230 THR n 
1 231 ASP n 
1 232 THR n 
1 233 SER n 
1 234 ILE n 
1 235 ILE n 
1 236 LEU n 
1 237 PHE n 
1 238 LEU n 
1 239 ASN n 
1 240 LYS n 
1 241 LYS n 
1 242 ASP n 
1 243 LEU n 
1 244 PHE n 
1 245 GLU n 
1 246 GLU n 
1 247 LYS n 
1 248 ILE n 
1 249 LYS n 
1 250 LYS n 
1 251 SER n 
1 252 PRO n 
1 253 LEU n 
1 254 THR n 
1 255 ILE n 
1 256 CYS n 
1 257 TYR n 
1 258 PRO n 
1 259 GLU n 
1 260 TYR n 
1 261 ALA n 
1 262 GLY n 
1 263 SER n 
1 264 ASN n 
1 265 THR n 
1 266 TYR n 
1 267 GLU n 
1 268 GLU n 
1 269 ALA n 
1 270 ALA n 
1 271 ALA n 
1 272 TYR n 
1 273 ILE n 
1 274 GLN n 
1 275 CYS n 
1 276 GLN n 
1 277 PHE n 
1 278 GLU n 
1 279 ASP n 
1 280 LEU n 
1 281 ASN n 
1 282 LYS n 
1 283 ARG n 
1 284 LYS n 
1 285 ASP n 
1 286 THR n 
1 287 LYS n 
1 288 GLU n 
1 289 ILE n 
1 290 TYR n 
1 291 THR n 
1 292 HIS n 
1 293 PHE n 
1 294 THR n 
1 295 CYS n 
1 296 ALA n 
1 297 THR n 
1 298 ASP n 
1 299 THR n 
1 300 LYS n 
1 301 ASN n 
1 302 VAL n 
1 303 GLN n 
1 304 PHE n 
1 305 VAL n 
1 306 PHE n 
1 307 ASP n 
1 308 ALA n 
1 309 VAL n 
1 310 THR n 
1 311 ASP n 
1 312 VAL n 
1 313 ILE n 
1 314 ILE n 
1 315 LYS n 
1 316 ASN n 
1 317 ASN n 
1 318 LEU n 
1 319 LYS n 
1 320 ASP n 
1 321 CYS n 
1 322 GLY n 
1 323 LEU n 
1 324 PHE n 
2 1   SER n 
2 2   MET n 
2 3   ARG n 
2 4   ASN n 
2 5   PHE n 
2 6   SER n 
2 7   GLU n 
2 8   ASP n 
2 9   VAL n 
2 10  LEU n 
2 11  GLY n 
2 12  TRP n 
2 13  ARG n 
2 14  GLU n 
2 15  SER n 
2 16  PHE n 
2 17  ASP n 
2 18  LEU n 
2 19  LEU n 
2 20  LEU n 
2 21  SER n 
2 22  SER n 
2 23  LYS n 
2 24  ASN n 
2 25  GLY n 
2 26  VAL n 
2 27  ALA n 
2 28  ALA n 
2 29  PHE n 
2 30  HIS n 
2 31  ALA n 
2 32  PHE n 
2 33  LEU n 
2 34  LYS n 
2 35  THR n 
2 36  GLU n 
2 37  PHE n 
2 38  SER n 
2 39  GLU n 
2 40  GLU n 
2 41  ASN n 
2 42  LEU n 
2 43  GLU n 
2 44  PHE n 
2 45  TRP n 
2 46  LEU n 
2 47  ALA n 
2 48  CYS n 
2 49  GLU n 
2 50  GLU n 
2 51  PHE n 
2 52  LYS n 
2 53  LYS n 
2 54  ILE n 
2 55  ARG n 
2 56  SER n 
2 57  ALA n 
2 58  THR n 
2 59  LYS n 
2 60  LEU n 
2 61  ALA n 
2 62  SER n 
2 63  ARG n 
2 64  ALA n 
2 65  HIS n 
2 66  GLN n 
2 67  ILE n 
2 68  PHE n 
2 69  GLU n 
2 70  GLU n 
2 71  PHE n 
2 72  ILE n 
2 73  CYS n 
2 74  SER n 
2 75  GLU n 
2 76  ALA n 
2 77  PRO n 
2 78  LYS n 
2 79  GLU n 
2 80  VAL n 
2 81  ASN n 
2 82  ILE n 
2 83  ASP n 
2 84  HIS n 
2 85  GLU n 
2 86  THR n 
2 87  ARG n 
2 88  GLU n 
2 89  LEU n 
2 90  THR n 
2 91  ARG n 
2 92  MET n 
2 93  ASN n 
2 94  LEU n 
2 95  GLN n 
2 96  THR n 
2 97  ALA n 
2 98  THR n 
2 99  ALA n 
2 100 THR n 
2 101 CYS n 
2 102 PHE n 
2 103 ASP n 
2 104 ALA n 
2 105 ALA n 
2 106 GLN n 
2 107 GLY n 
2 108 LYS n 
2 109 THR n 
2 110 ARG n 
2 111 THR n 
2 112 LEU n 
2 113 MET n 
2 114 GLU n 
2 115 LYS n 
2 116 ASP n 
2 117 SER n 
2 118 TYR n 
2 119 PRO n 
2 120 ARG n 
2 121 PHE n 
2 122 LEU n 
2 123 LYS n 
2 124 SER n 
2 125 PRO n 
2 126 ALA n 
2 127 TYR n 
2 128 ARG n 
2 129 ASP n 
2 130 LEU n 
2 131 ALA n 
2 132 ALA n 
2 133 GLN n 
2 134 ALA n 
2 135 SER n 
2 136 ALA n 
2 137 ALA n 
2 138 SER n 
2 139 ALA n 
2 140 THR n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? human Homo GNAI1         ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 Escherichia ? ? ? 
? ? 'BL21(DE3)R3' ? ? ? ? ? ? ? PLASMID ? ? ? pNIC28-Bsa4 ? ? 
2 1 sample ? ? ? human Homo 'RGS16, RGSR' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 Escherichia ? ? ? 
? ? 'BL21(DE3)R3' ? ? ? ? ? ? ? PLASMID ? ? ? pNIC28-Bsa4 ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP GNAI1_HUMAN P63096 1 
;AREVKLLLLGAGESGKSTIVKQMKIIHEAGYSEEECKQYKAVVYSNTIQSIIAIIRAMGRLKIDFGDSARADDARQLFVL
AGAAEEGFMTAELAGVIKRLWKDSGVQACFNRSREYQLNDSAAYYLNDLDRIAQPNYIPTQQDVLRTRVKTTGIVETHFT
FKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILFLNK
KDLFEEKIKKSPLTICYPEYAGSNTYEEAAAYIQCQFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKD
CGLF
;
30 ? 
2 UNP RGS16_HUMAN O15492 2 
;RNFSEDVLGWRESFDLLLSSKNGVAAFHAFLKTEFSEENLEFWLACEEFKKIRSATKLASRAHQIFEEFICSEAPKEVNI
DHETRELTRMNLQTATATCFDAAQGKTRTLMEKDSYPRFLKSPAYRDLAAQASAASAT
;
53 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2IK8 A 1 ? 324 ? P63096 30 ? 353 ? 31 354 
2 1 2IK8 C 1 ? 324 ? P63096 30 ? 353 ? 31 354 
3 2 2IK8 B 3 ? 140 ? O15492 53 ? 190 ? 53 190 
4 2 2IK8 D 3 ? 140 ? O15492 53 ? 190 ? 53 190 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
3 2IK8 SER B 1 ? UNP O15492 ? ? 'CLONING ARTIFACT' 51 1 
3 2IK8 MET B 2 ? UNP O15492 ? ? 'CLONING ARTIFACT' 52 2 
4 2IK8 SER D 1 ? UNP O15492 ? ? 'CLONING ARTIFACT' 51 3 
4 2IK8 MET D 2 ? UNP O15492 ? ? 'CLONING ARTIFACT' 52 4 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                    ? 'C3 H7 N O2'        89.093  
ALF non-polymer         . 'TETRAFLUOROALUMINATE ION' ? 'Al F4 -1'          102.975 
ARG 'L-peptide linking' y ARGININE                   ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                 ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'            ? 'C4 H7 N O4'        133.103 
CYS 'L-peptide linking' y CYSTEINE                   ? 'C3 H7 N O2 S'      121.158 
GDP 'RNA linking'       n "GUANOSINE-5'-DIPHOSPHATE" ? 'C10 H15 N5 O11 P2' 443.201 
GLN 'L-peptide linking' y GLUTAMINE                  ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'            ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                    ? 'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                  ? 'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                      ? 'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                 ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                    ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                     ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                 ? 'C5 H11 N O2 S'     149.211 
MG  non-polymer         . 'MAGNESIUM ION'            ? 'Mg 2'              24.305  
PHE 'L-peptide linking' y PHENYLALANINE              ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                    ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                     ? 'C3 H7 N O3'        105.093 
SO4 non-polymer         . 'SULFATE ION'              ? 'O4 S -2'           96.063  
THR 'L-peptide linking' y THREONINE                  ? 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                 ? 'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                   ? 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                     ? 'C5 H11 N O2'       117.146 
# 
_exptl.entry_id          2IK8 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.52 
_exptl_crystal.density_percent_sol   51.21 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              5.5 
_exptl_crystal_grow.pdbx_details    
'0.2M (NH4)2SO4, 0.1M Bis-Tris, pH 5.5, 25% PEG3350 , VAPOR DIFFUSION, SITTING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 225 mm CCD' 
_diffrn_detector.pdbx_collection_date   2006-03-24 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Si (111)' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9198 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SLS BEAMLINE X10SA' 
_diffrn_source.pdbx_synchrotron_site       SLS 
_diffrn_source.pdbx_synchrotron_beamline   X10SA 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.9198 
# 
_reflns.entry_id                     2IK8 
_reflns.observed_criterion_sigma_F   0 
_reflns.observed_criterion_sigma_I   0 
_reflns.d_resolution_high            2.7 
_reflns.d_resolution_low             50 
_reflns.number_all                   29438 
_reflns.number_obs                   27900 
_reflns.percent_possible_obs         99.3 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.7 
_reflns_shell.d_res_low              2.8 
_reflns_shell.percent_possible_all   99.2 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 2IK8 
_refine.ls_number_reflns_obs                     27900 
_refine.ls_number_reflns_all                     27900 
_refine.pdbx_ls_sigma_I                          0 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             49.6 
_refine.ls_d_res_high                            2.71 
_refine.ls_percent_reflns_obs                    98.73 
_refine.ls_R_factor_obs                          0.23544 
_refine.ls_R_factor_all                          0.23544 
_refine.ls_R_factor_R_work                       0.2325 
_refine.ls_R_factor_R_free                       0.29106 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.1 
_refine.ls_number_reflns_R_free                  1491 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.928 
_refine.correlation_coeff_Fo_to_Fc_free          0.895 
_refine.B_iso_mean                               52.189 
_refine.aniso_B[1][1]                            5.15 
_refine.aniso_B[2][2]                            -4.39 
_refine.aniso_B[3][3]                            -0.76 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      'PDB ID = 2GTP' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       2.095 
_refine.pdbx_overall_ESU_R_Free                  0.398 
_refine.overall_SU_ML                            0.317 
_refine.overall_SU_B                             31.847 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        6670 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         108 
_refine_hist.number_atoms_solvent             36 
_refine_hist.number_atoms_total               6814 
_refine_hist.d_res_high                       2.71 
_refine_hist.d_res_low                        49.6 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.008  0.022  ? 6891  'X-RAY DIFFRACTION' ? 
r_bond_other_d               0.001  0.020  ? 4437  'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.060  1.956  ? 9355  'X-RAY DIFFRACTION' ? 
r_angle_other_deg            0.820  3.000  ? 10811 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       5.529  5.000  ? 863   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       35.138 24.328 ? 305   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       14.991 15.000 ? 1108  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       15.315 15.000 ? 34    'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.054  0.200  ? 1069  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.003  0.020  ? 7690  'X-RAY DIFFRACTION' ? 
r_gen_planes_other           0.001  0.020  ? 1444  'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.214  0.200  ? 1657  'X-RAY DIFFRACTION' ? 
r_nbd_other                  0.174  0.200  ? 4621  'X-RAY DIFFRACTION' ? 
r_nbtor_refined              0.183  0.200  ? 3469  'X-RAY DIFFRACTION' ? 
r_nbtor_other                0.085  0.200  ? 3477  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.144  0.200  ? 202   'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          0.184  0.200  ? 9     'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.074  0.200  ? 15    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         0.208  0.200  ? 49    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.216  0.200  ? 2     'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcbond_it                  0.279  1.500  ? 4435  'X-RAY DIFFRACTION' ? 
r_mcbond_other               0.056  1.500  ? 1751  'X-RAY DIFFRACTION' ? 
r_mcangle_it                 0.485  2.000  ? 6903  'X-RAY DIFFRACTION' ? 
r_scbond_it                  0.768  3.000  ? 2811  'X-RAY DIFFRACTION' ? 
r_scangle_it                 1.210  4.500  ? 2452  'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_restr_ncs.dom_id 
_refine_ls_restr_ncs.pdbx_auth_asym_id 
_refine_ls_restr_ncs.pdbx_number 
_refine_ls_restr_ncs.rms_dev_position 
_refine_ls_restr_ncs.weight_position 
_refine_ls_restr_ncs.pdbx_type 
_refine_ls_restr_ncs.pdbx_ens_id 
_refine_ls_restr_ncs.pdbx_refine_id 
_refine_ls_restr_ncs.pdbx_ordinal 
_refine_ls_restr_ncs.ncs_model_details 
_refine_ls_restr_ncs.rms_dev_B_iso 
_refine_ls_restr_ncs.weight_B_iso 
1 A 1836 0.26 0.50  'medium positional' 1 'X-RAY DIFFRACTION' 1 ? ? ? 
1 B 714  0.24 0.50  'medium positional' 2 'X-RAY DIFFRACTION' 2 ? ? ? 
1 A 2041 0.53 5.00  'loose positional'  1 'X-RAY DIFFRACTION' 3 ? ? ? 
1 B 734  0.41 5.00  'loose positional'  2 'X-RAY DIFFRACTION' 4 ? ? ? 
1 A 1836 0.29 2.00  'medium thermal'    1 'X-RAY DIFFRACTION' 5 ? ? ? 
1 B 714  0.23 2.00  'medium thermal'    2 'X-RAY DIFFRACTION' 6 ? ? ? 
1 A 2041 0.74 10.00 'loose thermal'     1 'X-RAY DIFFRACTION' 7 ? ? ? 
1 B 734  0.50 10.00 'loose thermal'     2 'X-RAY DIFFRACTION' 8 ? ? ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.71 
_refine_ls_shell.d_res_low                        2.781 
_refine_ls_shell.number_reflns_R_work             1863 
_refine_ls_shell.R_factor_R_work                  0.285 
_refine_ls_shell.percent_reflns_obs               91.42 
_refine_ls_shell.R_factor_R_free                  0.378 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             97 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
loop_
_struct_ncs_dom.pdbx_ens_id 
_struct_ncs_dom.id 
_struct_ncs_dom.details 
1 1 A 
1 2 C 
1 3 A 
1 4 C 
2 1 B 
2 2 D 
# 
loop_
_struct_ncs_dom_lim.dom_id 
_struct_ncs_dom_lim.beg_auth_asym_id 
_struct_ncs_dom_lim.beg_auth_seq_id 
_struct_ncs_dom_lim.end_auth_asym_id 
_struct_ncs_dom_lim.end_auth_seq_id 
_struct_ncs_dom_lim.pdbx_component_id 
_struct_ncs_dom_lim.pdbx_refine_code 
_struct_ncs_dom_lim.beg_label_asym_id 
_struct_ncs_dom_lim.beg_label_comp_id 
_struct_ncs_dom_lim.beg_label_seq_id 
_struct_ncs_dom_lim.beg_label_alt_id 
_struct_ncs_dom_lim.end_label_asym_id 
_struct_ncs_dom_lim.end_label_comp_id 
_struct_ncs_dom_lim.end_label_seq_id 
_struct_ncs_dom_lim.end_label_alt_id 
_struct_ncs_dom_lim.pdbx_ens_id 
_struct_ncs_dom_lim.selection_details 
1 A 32  A 111 1 5 A ARG 2  ? A ALA 81  ? 1 ? 
2 C 33  C 111 1 5 C GLU 3  ? C ALA 81  ? 1 ? 
3 A 119 A 348 2 5 A MET 89 ? A LEU 318 ? 1 ? 
4 C 119 C 348 2 5 C MET 89 ? C LEU 318 ? 1 ? 
1 B 65  B 184 1 5 B SER 15 ? B ALA 134 ? 2 ? 
2 D 65  D 184 1 5 D SER 15 ? D ALA 134 ? 2 ? 
# 
loop_
_struct_ncs_ens.id 
_struct_ncs_ens.details 
1 ? 
2 ? 
# 
_struct.entry_id                  2IK8 
_struct.title                     'Crystal structure of the heterodimeric complex of human RGS16 and activated Gi alpha 1' 
_struct.pdbx_descriptor           'Guanine nucleotide-binding protein G(i), alpha-1 subunit, Regulator of G-protein signaling 16' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2IK8 
_struct_keywords.pdbx_keywords   'SIGNALING PROTEIN' 
_struct_keywords.text            
;G protein signalling, RGS, heterotrimeric G protein, signalling complex, Structural Genomics, Structural Genomics Consortium, SGC, SIGNALING PROTEIN
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 1 ? 
D N N 2 ? 
E N N 3 ? 
F N N 4 ? 
G N N 5 ? 
H N N 5 ? 
I N N 5 ? 
J N N 5 ? 
K N N 6 ? 
L N N 5 ? 
M N N 3 ? 
N N N 4 ? 
O N N 5 ? 
P N N 5 ? 
Q N N 6 ? 
R N N 5 ? 
S N N 7 ? 
T N N 7 ? 
U N N 7 ? 
V N N 7 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLY A 15  ? HIS A 27  ? GLY A 45  HIS A 57  1 ? 13 
HELX_P HELX_P2  2  SER A 32  ? GLN A 38  ? SER A 62  GLN A 68  1 ? 7  
HELX_P HELX_P3  3  TYR A 39  ? LYS A 62  ? TYR A 69  LYS A 92  1 ? 24 
HELX_P HELX_P4  4  ALA A 69  ? ALA A 81  ? ALA A 99  ALA A 111 1 ? 13 
HELX_P HELX_P5  5  THR A 90  ? ASP A 103 ? THR A 120 ASP A 133 1 ? 14 
HELX_P HELX_P6  6  ASP A 103 ? ASN A 111 ? ASP A 133 ASN A 141 1 ? 9  
HELX_P HELX_P7  7  ARG A 112 ? TYR A 116 ? ARG A 142 TYR A 146 5 ? 5  
HELX_P HELX_P8  8  SER A 121 ? ASN A 127 ? SER A 151 ASN A 157 1 ? 7  
HELX_P HELX_P9  9  ASP A 128 ? ALA A 133 ? ASP A 158 ALA A 163 1 ? 6  
HELX_P HELX_P10 10 THR A 140 ? THR A 147 ? THR A 170 THR A 177 1 ? 8  
HELX_P HELX_P11 11 GLN A 174 ? PHE A 185 ? GLN A 204 PHE A 215 5 ? 12 
HELX_P HELX_P12 12 SER A 198 ? ASP A 201 ? SER A 228 ASP A 231 5 ? 4  
HELX_P HELX_P13 13 ARG A 212 ? ASN A 225 ? ARG A 242 ASN A 255 1 ? 14 
HELX_P HELX_P14 14 ASN A 226 ? THR A 230 ? ASN A 256 THR A 260 5 ? 5  
HELX_P HELX_P15 15 LYS A 240 ? ILE A 248 ? LYS A 270 ILE A 278 1 ? 9  
HELX_P HELX_P16 16 PRO A 252 ? CYS A 256 ? PRO A 282 CYS A 286 5 ? 5  
HELX_P HELX_P17 17 THR A 265 ? LEU A 280 ? THR A 295 LEU A 310 1 ? 16 
HELX_P HELX_P18 18 ASP A 298 ? ASN A 316 ? ASP A 328 ASN A 346 1 ? 19 
HELX_P HELX_P19 19 SER B 15  ? SER B 22  ? SER B 65  SER B 72  1 ? 8  
HELX_P HELX_P20 20 SER B 22  ? GLU B 36  ? SER B 72  GLU B 86  1 ? 15 
HELX_P HELX_P21 21 SER B 38  ? LYS B 52  ? SER B 88  LYS B 102 1 ? 15 
HELX_P HELX_P22 22 SER B 56  ? ILE B 72  ? SER B 106 ILE B 122 1 ? 17 
HELX_P HELX_P23 23 ASP B 83  ? GLN B 95  ? ASP B 133 GLN B 145 1 ? 13 
HELX_P HELX_P24 24 PHE B 102 ? ASP B 116 ? PHE B 152 ASP B 166 1 ? 15 
HELX_P HELX_P25 25 ASP B 116 ? LYS B 123 ? ASP B 166 LYS B 173 1 ? 8  
HELX_P HELX_P26 26 SER B 124 ? ALA B 134 ? SER B 174 ALA B 184 1 ? 11 
HELX_P HELX_P27 27 GLY C 15  ? GLU C 28  ? GLY C 45  GLU C 58  1 ? 14 
HELX_P HELX_P28 28 SER C 32  ? TYR C 39  ? SER C 62  TYR C 69  1 ? 8  
HELX_P HELX_P29 29 TYR C 39  ? LEU C 61  ? TYR C 69  LEU C 91  1 ? 23 
HELX_P HELX_P30 30 ALA C 69  ? ALA C 81  ? ALA C 99  ALA C 111 1 ? 13 
HELX_P HELX_P31 31 THR C 90  ? ASP C 103 ? THR C 120 ASP C 133 1 ? 14 
HELX_P HELX_P32 32 ASP C 103 ? ARG C 112 ? ASP C 133 ARG C 142 1 ? 10 
HELX_P HELX_P33 33 SER C 113 ? TYR C 116 ? SER C 143 TYR C 146 5 ? 4  
HELX_P HELX_P34 34 SER C 121 ? ASN C 127 ? SER C 151 ASN C 157 1 ? 7  
HELX_P HELX_P35 35 ASP C 128 ? GLN C 134 ? ASP C 158 GLN C 164 1 ? 7  
HELX_P HELX_P36 36 THR C 140 ? ARG C 146 ? THR C 170 ARG C 176 1 ? 7  
HELX_P HELX_P37 37 GLN C 174 ? PHE C 185 ? GLN C 204 PHE C 215 5 ? 12 
HELX_P HELX_P38 38 SER C 198 ? LEU C 202 ? SER C 228 LEU C 232 5 ? 5  
HELX_P HELX_P39 39 ASN C 211 ? ASN C 226 ? ASN C 241 ASN C 256 1 ? 16 
HELX_P HELX_P40 40 LYS C 240 ? ILE C 248 ? LYS C 270 ILE C 278 1 ? 9  
HELX_P HELX_P41 41 PRO C 252 ? CYS C 256 ? PRO C 282 CYS C 286 5 ? 5  
HELX_P HELX_P42 42 THR C 265 ? ASP C 279 ? THR C 295 ASP C 309 1 ? 15 
HELX_P HELX_P43 43 ASP C 298 ? ASN C 316 ? ASP C 328 ASN C 346 1 ? 19 
HELX_P HELX_P44 44 PHE D 5   ? SER D 15  ? PHE D 55  SER D 65  1 ? 11 
HELX_P HELX_P45 45 SER D 15  ? LEU D 20  ? SER D 65  LEU D 70  1 ? 6  
HELX_P HELX_P46 46 SER D 22  ? GLU D 36  ? SER D 72  GLU D 86  1 ? 15 
HELX_P HELX_P47 47 GLU D 39  ? LYS D 53  ? GLU D 89  LYS D 103 1 ? 15 
HELX_P HELX_P48 48 SER D 56  ? ILE D 72  ? SER D 106 ILE D 122 1 ? 17 
HELX_P HELX_P49 49 ASP D 83  ? LEU D 94  ? ASP D 133 LEU D 144 1 ? 12 
HELX_P HELX_P50 50 GLN D 95  ? ALA D 97  ? GLN D 145 ALA D 147 5 ? 3  
HELX_P HELX_P51 51 PHE D 102 ? ASP D 116 ? PHE D 152 ASP D 166 1 ? 15 
HELX_P HELX_P52 52 ASP D 116 ? LYS D 123 ? ASP D 166 LYS D 173 1 ? 8  
HELX_P HELX_P53 53 SER D 124 ? ALA D 134 ? SER D 174 ALA D 184 1 ? 11 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? E ALF . AL ? ? ? 1_555 K GDP .   O2B ? ? A ALF 355 A GDP 401 1_555 ? ? ? ? ? ? ? 1.810 ? 
metalc2  metalc ? ? E ALF . F1 ? ? ? 1_555 F MG  .   MG  ? ? A ALF 355 A MG  356 1_555 ? ? ? ? ? ? ? 2.021 ? 
metalc3  metalc ? ? E ALF . AL ? ? ? 1_555 K GDP .   O1B ? ? A ALF 355 A GDP 401 1_555 ? ? ? ? ? ? ? 3.596 ? 
metalc4  metalc ? ? E ALF . AL ? ? ? 1_555 F MG  .   MG  ? ? A ALF 355 A MG  356 1_555 ? ? ? ? ? ? ? 3.337 ? 
metalc5  metalc ? ? E ALF . AL ? ? ? 1_555 S HOH .   O   ? ? A ALF 355 A HOH 416 1_555 ? ? ? ? ? ? ? 1.931 ? 
metalc6  metalc ? ? E ALF . AL ? ? ? 1_555 S HOH .   O   ? ? A ALF 355 A HOH 408 1_555 ? ? ? ? ? ? ? 3.717 ? 
metalc7  metalc ? ? F MG  . MG ? ? ? 1_555 E ALF .   F3  ? ? A MG  356 A ALF 355 1_555 ? ? ? ? ? ? ? 3.058 ? 
metalc8  metalc ? ? F MG  . MG ? ? ? 1_555 K GDP .   O1B ? ? A MG  356 A GDP 401 1_555 ? ? ? ? ? ? ? 2.165 ? 
metalc9  metalc ? ? F MG  . MG ? ? ? 1_555 A THR 151 OG1 ? ? A MG  356 A THR 181 1_555 ? ? ? ? ? ? ? 1.657 ? 
metalc10 metalc ? ? F MG  . MG ? ? ? 1_555 A SER 17  OG  ? ? A MG  356 A SER 47  1_555 ? ? ? ? ? ? ? 1.938 ? 
metalc11 metalc ? ? F MG  . MG ? ? ? 1_555 S HOH .   O   ? ? A MG  356 A HOH 408 1_555 ? ? ? ? ? ? ? 1.659 ? 
metalc12 metalc ? ? F MG  . MG ? ? ? 1_555 S HOH .   O   ? ? A MG  356 A HOH 417 1_555 ? ? ? ? ? ? ? 1.956 ? 
metalc13 metalc ? ? M ALF . AL ? ? ? 1_555 Q GDP .   O2B ? ? C ALF 355 C GDP 402 1_555 ? ? ? ? ? ? ? 1.727 ? 
metalc14 metalc ? ? M ALF . AL ? ? ? 1_555 Q GDP .   O1B ? ? C ALF 355 C GDP 402 1_555 ? ? ? ? ? ? ? 3.569 ? 
metalc15 metalc ? ? M ALF . AL ? ? ? 1_555 N MG  .   MG  ? ? C ALF 355 C MG  356 1_555 ? ? ? ? ? ? ? 3.235 ? 
metalc16 metalc ? ? M ALF . AL ? ? ? 1_555 U HOH .   O   ? ? C ALF 355 C HOH 413 1_555 ? ? ? ? ? ? ? 3.522 ? 
metalc17 metalc ? ? M ALF . AL ? ? ? 1_555 U HOH .   O   ? ? C ALF 355 C HOH 407 1_555 ? ? ? ? ? ? ? 1.938 ? 
metalc18 metalc ? ? M ALF . F3 ? ? ? 1_555 N MG  .   MG  ? ? C ALF 355 C MG  356 1_555 ? ? ? ? ? ? ? 1.716 ? 
metalc19 metalc ? ? N MG  . MG ? ? ? 1_555 C THR 151 OG1 ? ? C MG  356 C THR 181 1_555 ? ? ? ? ? ? ? 2.186 ? 
metalc20 metalc ? ? N MG  . MG ? ? ? 1_555 Q GDP .   O1B ? ? C MG  356 C GDP 402 1_555 ? ? ? ? ? ? ? 1.934 ? 
metalc21 metalc ? ? N MG  . MG ? ? ? 1_555 U HOH .   O   ? ? C MG  356 C HOH 405 1_555 ? ? ? ? ? ? ? 2.123 ? 
metalc22 metalc ? ? N MG  . MG ? ? ? 1_555 C SER 17  OG  ? ? C MG  356 C SER 47  1_555 ? ? ? ? ? ? ? 1.907 ? 
metalc23 metalc ? ? N MG  . MG ? ? ? 1_555 U HOH .   O   ? ? C MG  356 C HOH 413 1_555 ? ? ? ? ? ? ? 1.815 ? 
metalc24 metalc ? ? N MG  . MG ? ? ? 1_555 Q GDP .   O2B ? ? C MG  356 C GDP 402 1_555 ? ? ? ? ? ? ? 3.074 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 6 ? 
B ? 2 ? 
C ? 6 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? parallel      
A 3 4 ? parallel      
A 4 5 ? parallel      
A 5 6 ? parallel      
B 1 2 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? parallel      
C 3 4 ? parallel      
C 4 5 ? parallel      
C 5 6 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ILE A 154 ? THR A 160 ? ILE A 184 THR A 190 
A 2 HIS A 165 ? VAL A 171 ? HIS A 195 VAL A 201 
A 3 GLU A 3   ? LEU A 9   ? GLU A 33  LEU A 39  
A 4 ALA A 190 ? ALA A 196 ? ALA A 220 ALA A 226 
A 5 SER A 233 ? ASN A 239 ? SER A 263 ASN A 269 
A 6 TYR A 290 ? PHE A 293 ? TYR A 320 PHE A 323 
B 1 VAL A 203 ? LEU A 204 ? VAL A 233 LEU A 234 
B 2 ASP A 207 ? ASN A 211 ? ASP A 237 ASN A 241 
C 1 ILE C 154 ? THR C 160 ? ILE C 184 THR C 190 
C 2 HIS C 165 ? VAL C 171 ? HIS C 195 VAL C 201 
C 3 VAL C 4   ? LEU C 9   ? VAL C 34  LEU C 39  
C 4 ALA C 190 ? ALA C 196 ? ALA C 220 ALA C 226 
C 5 SER C 233 ? ASN C 239 ? SER C 263 ASN C 269 
C 6 TYR C 290 ? PHE C 293 ? TYR C 320 PHE C 323 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N PHE A 159 ? N PHE A 189 O PHE A 166 ? O PHE A 196 
A 2 3 O LYS A 167 ? O LYS A 197 N VAL A 4   ? N VAL A 34  
A 3 4 N LEU A 7   ? N LEU A 37  O ILE A 192 ? O ILE A 222 
A 4 5 N VAL A 195 ? N VAL A 225 O ASN A 239 ? O ASN A 269 
A 5 6 N LEU A 236 ? N LEU A 266 O TYR A 290 ? O TYR A 320 
B 1 2 N LEU A 204 ? N LEU A 234 O MET A 210 ? O MET A 240 
C 1 2 N VAL C 155 ? N VAL C 185 O ASP C 170 ? O ASP C 200 
C 2 3 O PHE C 169 ? O PHE C 199 N LEU C 6   ? N LEU C 36  
C 3 4 N LEU C 7   ? N LEU C 37  O ILE C 192 ? O ILE C 222 
C 4 5 N PHE C 193 ? N PHE C 223 O ILE C 235 ? O ILE C 265 
C 5 6 N LEU C 238 ? N LEU C 268 O HIS C 292 ? O HIS C 322 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE ALF A 355' 
AC2 Software ? ? ? ? 15 'BINDING SITE FOR RESIDUE ALF C 355' 
AC3 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG A 356'  
AC4 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG C 356'  
AC5 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE SO4 C 357' 
AC6 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE SO4 B 302' 
AC7 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE SO4 D 303' 
AC8 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE SO4 A 357' 
AC9 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE SO4 A 358' 
BC1 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE SO4 A 359' 
BC2 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE SO4 C 358' 
BC3 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE SO4 A 360' 
BC4 Software ? ? ? ? 22 'BINDING SITE FOR RESIDUE GDP A 401' 
BC5 Software ? ? ? ? 23 'BINDING SITE FOR RESIDUE GDP C 402' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 14 GLY A 12  ? GLY A 42  . ? 1_555 ? 
2   AC1 14 GLU A 13  ? GLU A 43  . ? 1_555 ? 
3   AC1 14 LYS A 16  ? LYS A 46  . ? 1_555 ? 
4   AC1 14 ARG A 148 ? ARG A 178 . ? 1_555 ? 
5   AC1 14 LYS A 150 ? LYS A 180 . ? 1_555 ? 
6   AC1 14 THR A 151 ? THR A 181 . ? 1_555 ? 
7   AC1 14 VAL A 171 ? VAL A 201 . ? 1_555 ? 
8   AC1 14 GLY A 173 ? GLY A 203 . ? 1_555 ? 
9   AC1 14 GLN A 174 ? GLN A 204 . ? 1_555 ? 
10  AC1 14 MG  F .   ? MG  A 356 . ? 1_555 ? 
11  AC1 14 GDP K .   ? GDP A 401 . ? 1_555 ? 
12  AC1 14 HOH S .   ? HOH A 408 . ? 1_555 ? 
13  AC1 14 HOH S .   ? HOH A 416 . ? 1_555 ? 
14  AC1 14 HOH S .   ? HOH A 417 . ? 1_555 ? 
15  AC2 15 GLY C 12  ? GLY C 42  . ? 1_555 ? 
16  AC2 15 GLU C 13  ? GLU C 43  . ? 1_555 ? 
17  AC2 15 LYS C 16  ? LYS C 46  . ? 1_555 ? 
18  AC2 15 SER C 17  ? SER C 47  . ? 1_555 ? 
19  AC2 15 ARG C 148 ? ARG C 178 . ? 1_555 ? 
20  AC2 15 VAL C 149 ? VAL C 179 . ? 1_555 ? 
21  AC2 15 LYS C 150 ? LYS C 180 . ? 1_555 ? 
22  AC2 15 THR C 151 ? THR C 181 . ? 1_555 ? 
23  AC2 15 GLY C 173 ? GLY C 203 . ? 1_555 ? 
24  AC2 15 GLN C 174 ? GLN C 204 . ? 1_555 ? 
25  AC2 15 MG  N .   ? MG  C 356 . ? 1_555 ? 
26  AC2 15 GDP Q .   ? GDP C 402 . ? 1_555 ? 
27  AC2 15 HOH U .   ? HOH C 405 . ? 1_555 ? 
28  AC2 15 HOH U .   ? HOH C 407 . ? 1_555 ? 
29  AC2 15 HOH U .   ? HOH C 413 . ? 1_555 ? 
30  AC3 6  SER A 17  ? SER A 47  . ? 1_555 ? 
31  AC3 6  THR A 151 ? THR A 181 . ? 1_555 ? 
32  AC3 6  ALF E .   ? ALF A 355 . ? 1_555 ? 
33  AC3 6  GDP K .   ? GDP A 401 . ? 1_555 ? 
34  AC3 6  HOH S .   ? HOH A 408 . ? 1_555 ? 
35  AC3 6  HOH S .   ? HOH A 417 . ? 1_555 ? 
36  AC4 6  SER C 17  ? SER C 47  . ? 1_555 ? 
37  AC4 6  THR C 151 ? THR C 181 . ? 1_555 ? 
38  AC4 6  ALF M .   ? ALF C 355 . ? 1_555 ? 
39  AC4 6  GDP Q .   ? GDP C 402 . ? 1_555 ? 
40  AC4 6  HOH U .   ? HOH C 405 . ? 1_555 ? 
41  AC4 6  HOH U .   ? HOH C 413 . ? 1_555 ? 
42  AC5 3  ILE A 63  ? ILE A 93  . ? 4_455 ? 
43  AC5 3  ASP A 64  ? ASP A 94  . ? 4_455 ? 
44  AC5 3  GLU C 267 ? GLU C 297 . ? 1_555 ? 
45  AC6 3  ILE B 54  ? ILE B 104 . ? 1_555 ? 
46  AC6 3  ARG B 55  ? ARG B 105 . ? 1_555 ? 
47  AC6 3  SER B 56  ? SER B 106 . ? 1_555 ? 
48  AC7 4  LYS D 53  ? LYS D 103 . ? 1_555 ? 
49  AC7 4  ILE D 54  ? ILE D 104 . ? 1_555 ? 
50  AC7 4  ARG D 55  ? ARG D 105 . ? 1_555 ? 
51  AC7 4  SER D 56  ? SER D 106 . ? 1_555 ? 
52  AC8 3  ARG A 75  ? ARG A 105 . ? 1_555 ? 
53  AC8 3  HIS C 292 ? HIS C 322 . ? 4_555 ? 
54  AC8 3  PHE C 293 ? PHE C 323 . ? 4_555 ? 
55  AC9 3  SER A 263 ? SER A 293 . ? 1_555 ? 
56  AC9 3  ASN A 264 ? ASN A 294 . ? 1_555 ? 
57  AC9 3  ARG C 60  ? ARG C 90  . ? 3_444 ? 
58  BC1 2  LYS A 5   ? LYS A 35  . ? 1_555 ? 
59  BC1 2  PHE A 169 ? PHE A 199 . ? 1_555 ? 
60  BC2 1  GLN C 76  ? GLN C 106 . ? 1_555 ? 
61  BC3 2  HIS A 183 ? HIS A 213 . ? 1_555 ? 
62  BC3 2  GLY C 187 ? GLY C 217 . ? 1_555 ? 
63  BC4 22 GLU A 13  ? GLU A 43  . ? 1_555 ? 
64  BC4 22 SER A 14  ? SER A 44  . ? 1_555 ? 
65  BC4 22 GLY A 15  ? GLY A 45  . ? 1_555 ? 
66  BC4 22 LYS A 16  ? LYS A 46  . ? 1_555 ? 
67  BC4 22 SER A 17  ? SER A 47  . ? 1_555 ? 
68  BC4 22 THR A 18  ? THR A 48  . ? 1_555 ? 
69  BC4 22 SER A 121 ? SER A 151 . ? 1_555 ? 
70  BC4 22 LEU A 145 ? LEU A 175 . ? 1_555 ? 
71  BC4 22 ARG A 146 ? ARG A 176 . ? 1_555 ? 
72  BC4 22 THR A 147 ? THR A 177 . ? 1_555 ? 
73  BC4 22 ARG A 148 ? ARG A 178 . ? 1_555 ? 
74  BC4 22 ASN A 239 ? ASN A 269 . ? 1_555 ? 
75  BC4 22 LYS A 240 ? LYS A 270 . ? 1_555 ? 
76  BC4 22 ASP A 242 ? ASP A 272 . ? 1_555 ? 
77  BC4 22 CYS A 295 ? CYS A 325 . ? 1_555 ? 
78  BC4 22 ALA A 296 ? ALA A 326 . ? 1_555 ? 
79  BC4 22 THR A 297 ? THR A 327 . ? 1_555 ? 
80  BC4 22 ALF E .   ? ALF A 355 . ? 1_555 ? 
81  BC4 22 MG  F .   ? MG  A 356 . ? 1_555 ? 
82  BC4 22 HOH S .   ? HOH A 405 . ? 1_555 ? 
83  BC4 22 HOH S .   ? HOH A 408 . ? 1_555 ? 
84  BC4 22 HOH S .   ? HOH A 417 . ? 1_555 ? 
85  BC5 23 GLU C 13  ? GLU C 43  . ? 1_555 ? 
86  BC5 23 SER C 14  ? SER C 44  . ? 1_555 ? 
87  BC5 23 GLY C 15  ? GLY C 45  . ? 1_555 ? 
88  BC5 23 LYS C 16  ? LYS C 46  . ? 1_555 ? 
89  BC5 23 SER C 17  ? SER C 47  . ? 1_555 ? 
90  BC5 23 THR C 18  ? THR C 48  . ? 1_555 ? 
91  BC5 23 ASP C 120 ? ASP C 150 . ? 1_555 ? 
92  BC5 23 SER C 121 ? SER C 151 . ? 1_555 ? 
93  BC5 23 LEU C 145 ? LEU C 175 . ? 1_555 ? 
94  BC5 23 ARG C 146 ? ARG C 176 . ? 1_555 ? 
95  BC5 23 THR C 147 ? THR C 177 . ? 1_555 ? 
96  BC5 23 ARG C 148 ? ARG C 178 . ? 1_555 ? 
97  BC5 23 ASN C 239 ? ASN C 269 . ? 1_555 ? 
98  BC5 23 LYS C 240 ? LYS C 270 . ? 1_555 ? 
99  BC5 23 ASP C 242 ? ASP C 272 . ? 1_555 ? 
100 BC5 23 LEU C 243 ? LEU C 273 . ? 1_555 ? 
101 BC5 23 CYS C 295 ? CYS C 325 . ? 1_555 ? 
102 BC5 23 ALA C 296 ? ALA C 326 . ? 1_555 ? 
103 BC5 23 THR C 297 ? THR C 327 . ? 1_555 ? 
104 BC5 23 ALF M .   ? ALF C 355 . ? 1_555 ? 
105 BC5 23 MG  N .   ? MG  C 356 . ? 1_555 ? 
106 BC5 23 HOH U .   ? HOH C 405 . ? 1_555 ? 
107 BC5 23 HOH U .   ? HOH C 413 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2IK8 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2IK8 
_atom_sites.fract_transf_matrix[1][1]   0.012098 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009587 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.008061 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
AL 
C  
F  
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . ARG A 1 2   ? -7.748  57.054 -33.694 1.00 69.62  ? 32  ARG A N     1 
ATOM   2    C  CA    . ARG A 1 2   ? -8.770  56.022 -34.087 1.00 69.68  ? 32  ARG A CA    1 
ATOM   3    C  C     . ARG A 1 2   ? -8.687  54.702 -33.267 1.00 68.89  ? 32  ARG A C     1 
ATOM   4    O  O     . ARG A 1 2   ? -9.073  53.626 -33.771 1.00 68.85  ? 32  ARG A O     1 
ATOM   5    C  CB    . ARG A 1 2   ? -8.638  55.718 -35.587 1.00 69.73  ? 32  ARG A CB    1 
ATOM   6    C  CG    . ARG A 1 2   ? -9.933  55.262 -36.254 1.00 70.41  ? 32  ARG A CG    1 
ATOM   7    C  CD    . ARG A 1 2   ? -9.706  54.795 -37.697 1.00 70.90  ? 32  ARG A CD    1 
ATOM   8    N  NE    . ARG A 1 2   ? -10.889 55.009 -38.539 1.00 72.35  ? 32  ARG A NE    1 
ATOM   9    C  CZ    . ARG A 1 2   ? -10.993 54.649 -39.821 1.00 72.77  ? 32  ARG A CZ    1 
ATOM   10   N  NH1   . ARG A 1 2   ? -9.988  54.032 -40.443 1.00 73.28  ? 32  ARG A NH1   1 
ATOM   11   N  NH2   . ARG A 1 2   ? -12.120 54.902 -40.486 1.00 72.63  ? 32  ARG A NH2   1 
ATOM   12   N  N     . GLU A 1 3   ? -8.215  54.788 -32.013 1.00 67.66  ? 33  GLU A N     1 
ATOM   13   C  CA    . GLU A 1 3   ? -8.018  53.596 -31.170 1.00 66.78  ? 33  GLU A CA    1 
ATOM   14   C  C     . GLU A 1 3   ? -9.350  52.935 -30.802 1.00 66.09  ? 33  GLU A C     1 
ATOM   15   O  O     . GLU A 1 3   ? -10.245 53.581 -30.253 1.00 66.30  ? 33  GLU A O     1 
ATOM   16   C  CB    . GLU A 1 3   ? -7.242  53.943 -29.901 1.00 66.66  ? 33  GLU A CB    1 
ATOM   17   N  N     . VAL A 1 4   ? -9.471  51.648 -31.117 1.00 64.95  ? 34  VAL A N     1 
ATOM   18   C  CA    . VAL A 1 4   ? -10.680 50.868 -30.853 1.00 64.14  ? 34  VAL A CA    1 
ATOM   19   C  C     . VAL A 1 4   ? -10.465 50.018 -29.597 1.00 63.50  ? 34  VAL A C     1 
ATOM   20   O  O     . VAL A 1 4   ? -9.365  49.529 -29.373 1.00 63.81  ? 34  VAL A O     1 
ATOM   21   C  CB    . VAL A 1 4   ? -11.004 49.959 -32.074 1.00 64.09  ? 34  VAL A CB    1 
ATOM   22   C  CG1   . VAL A 1 4   ? -11.810 48.740 -31.673 1.00 63.71  ? 34  VAL A CG1   1 
ATOM   23   C  CG2   . VAL A 1 4   ? -11.718 50.754 -33.148 1.00 63.92  ? 34  VAL A CG2   1 
ATOM   24   N  N     . LYS A 1 5   ? -11.503 49.859 -28.776 1.00 62.69  ? 35  LYS A N     1 
ATOM   25   C  CA    . LYS A 1 5   ? -11.445 49.001 -27.586 1.00 62.05  ? 35  LYS A CA    1 
ATOM   26   C  C     . LYS A 1 5   ? -12.309 47.778 -27.825 1.00 61.66  ? 35  LYS A C     1 
ATOM   27   O  O     . LYS A 1 5   ? -13.513 47.899 -28.083 1.00 61.41  ? 35  LYS A O     1 
ATOM   28   C  CB    . LYS A 1 5   ? -11.935 49.741 -26.337 1.00 62.15  ? 35  LYS A CB    1 
ATOM   29   C  CG    . LYS A 1 5   ? -11.965 48.891 -25.053 1.00 61.94  ? 35  LYS A CG    1 
ATOM   30   C  CD    . LYS A 1 5   ? -12.224 49.751 -23.814 1.00 61.97  ? 35  LYS A CD    1 
ATOM   31   C  CE    . LYS A 1 5   ? -12.207 48.929 -22.526 1.00 61.91  ? 35  LYS A CE    1 
ATOM   32   N  NZ    . LYS A 1 5   ? -12.528 49.736 -21.298 1.00 61.84  ? 35  LYS A NZ    1 
ATOM   33   N  N     . LEU A 1 6   ? -11.691 46.606 -27.709 1.00 61.15  ? 36  LEU A N     1 
ATOM   34   C  CA    . LEU A 1 6   ? -12.309 45.352 -28.096 1.00 60.83  ? 36  LEU A CA    1 
ATOM   35   C  C     . LEU A 1 6   ? -12.267 44.353 -26.951 1.00 60.49  ? 36  LEU A C     1 
ATOM   36   O  O     . LEU A 1 6   ? -11.276 44.271 -26.246 1.00 60.19  ? 36  LEU A O     1 
ATOM   37   C  CB    . LEU A 1 6   ? -11.558 44.797 -29.300 1.00 60.90  ? 36  LEU A CB    1 
ATOM   38   C  CG    . LEU A 1 6   ? -12.094 43.529 -29.953 1.00 61.64  ? 36  LEU A CG    1 
ATOM   39   C  CD1   . LEU A 1 6   ? -13.462 43.759 -30.584 1.00 61.11  ? 36  LEU A CD1   1 
ATOM   40   C  CD2   . LEU A 1 6   ? -11.087 43.054 -30.991 1.00 62.65  ? 36  LEU A CD2   1 
ATOM   41   N  N     . LEU A 1 7   ? -13.347 43.594 -26.782 1.00 60.55  ? 37  LEU A N     1 
ATOM   42   C  CA    . LEU A 1 7   ? -13.458 42.575 -25.724 1.00 60.41  ? 37  LEU A CA    1 
ATOM   43   C  C     . LEU A 1 7   ? -13.657 41.158 -26.276 1.00 60.44  ? 37  LEU A C     1 
ATOM   44   O  O     . LEU A 1 7   ? -14.476 40.936 -27.179 1.00 60.23  ? 37  LEU A O     1 
ATOM   45   C  CB    . LEU A 1 7   ? -14.641 42.883 -24.808 1.00 60.40  ? 37  LEU A CB    1 
ATOM   46   C  CG    . LEU A 1 7   ? -14.393 43.667 -23.527 1.00 60.41  ? 37  LEU A CG    1 
ATOM   47   C  CD1   . LEU A 1 7   ? -13.590 44.918 -23.807 1.00 59.93  ? 37  LEU A CD1   1 
ATOM   48   C  CD2   . LEU A 1 7   ? -15.749 43.990 -22.876 1.00 60.30  ? 37  LEU A CD2   1 
ATOM   49   N  N     . LEU A 1 8   ? -12.907 40.207 -25.717 1.00 60.32  ? 38  LEU A N     1 
ATOM   50   C  CA    . LEU A 1 8   ? -13.172 38.790 -25.925 1.00 60.34  ? 38  LEU A CA    1 
ATOM   51   C  C     . LEU A 1 8   ? -13.856 38.224 -24.676 1.00 60.17  ? 38  LEU A C     1 
ATOM   52   O  O     . LEU A 1 8   ? -13.241 38.061 -23.618 1.00 59.97  ? 38  LEU A O     1 
ATOM   53   C  CB    . LEU A 1 8   ? -11.880 38.041 -26.233 1.00 60.50  ? 38  LEU A CB    1 
ATOM   54   C  CG    . LEU A 1 8   ? -11.097 38.597 -27.422 1.00 60.91  ? 38  LEU A CG    1 
ATOM   55   C  CD1   . LEU A 1 8   ? -9.602  38.306 -27.260 1.00 62.03  ? 38  LEU A CD1   1 
ATOM   56   C  CD2   . LEU A 1 8   ? -11.632 38.065 -28.742 1.00 59.33  ? 38  LEU A CD2   1 
ATOM   57   N  N     . LEU A 1 9   ? -15.148 37.964 -24.803 1.00 60.20  ? 39  LEU A N     1 
ATOM   58   C  CA    . LEU A 1 9   ? -15.939 37.417 -23.723 1.00 60.35  ? 39  LEU A CA    1 
ATOM   59   C  C     . LEU A 1 9   ? -16.410 36.036 -24.126 1.00 60.74  ? 39  LEU A C     1 
ATOM   60   O  O     . LEU A 1 9   ? -16.407 35.701 -25.303 1.00 60.99  ? 39  LEU A O     1 
ATOM   61   C  CB    . LEU A 1 9   ? -17.139 38.314 -23.441 1.00 60.15  ? 39  LEU A CB    1 
ATOM   62   C  CG    . LEU A 1 9   ? -16.870 39.746 -22.994 1.00 59.98  ? 39  LEU A CG    1 
ATOM   63   C  CD1   . LEU A 1 9   ? -18.193 40.523 -22.897 1.00 59.72  ? 39  LEU A CD1   1 
ATOM   64   C  CD2   . LEU A 1 9   ? -16.114 39.783 -21.673 1.00 58.82  ? 39  LEU A CD2   1 
ATOM   65   N  N     . GLY A 1 10  ? -16.817 35.241 -23.147 1.00 61.34  ? 40  GLY A N     1 
ATOM   66   C  CA    . GLY A 1 10  ? -17.364 33.913 -23.404 1.00 61.94  ? 40  GLY A CA    1 
ATOM   67   C  C     . GLY A 1 10  ? -17.131 33.003 -22.222 1.00 62.35  ? 40  GLY A C     1 
ATOM   68   O  O     . GLY A 1 10  ? -16.281 33.278 -21.396 1.00 61.97  ? 40  GLY A O     1 
ATOM   69   N  N     . ALA A 1 11  ? -17.905 31.927 -22.128 1.00 63.27  ? 41  ALA A N     1 
ATOM   70   C  CA    . ALA A 1 11  ? -17.676 30.914 -21.097 1.00 63.64  ? 41  ALA A CA    1 
ATOM   71   C  C     . ALA A 1 11  ? -16.285 30.255 -21.252 1.00 64.05  ? 41  ALA A C     1 
ATOM   72   O  O     . ALA A 1 11  ? -15.619 30.389 -22.281 1.00 64.08  ? 41  ALA A O     1 
ATOM   73   C  CB    . ALA A 1 11  ? -18.767 29.866 -21.143 1.00 63.51  ? 41  ALA A CB    1 
ATOM   74   N  N     . GLY A 1 12  ? -15.855 29.553 -20.212 1.00 64.53  ? 42  GLY A N     1 
ATOM   75   C  CA    . GLY A 1 12  ? -14.543 28.917 -20.188 1.00 64.72  ? 42  GLY A CA    1 
ATOM   76   C  C     . GLY A 1 12  ? -14.302 28.024 -21.383 1.00 64.78  ? 42  GLY A C     1 
ATOM   77   O  O     . GLY A 1 12  ? -15.220 27.401 -21.870 1.00 64.75  ? 42  GLY A O     1 
ATOM   78   N  N     . GLU A 1 13  ? -13.066 28.000 -21.874 1.00 65.24  ? 43  GLU A N     1 
ATOM   79   C  CA    . GLU A 1 13  ? -12.655 27.102 -22.968 1.00 65.74  ? 43  GLU A CA    1 
ATOM   80   C  C     . GLU A 1 13  ? -13.358 27.344 -24.303 1.00 64.96  ? 43  GLU A C     1 
ATOM   81   O  O     . GLU A 1 13  ? -13.236 26.521 -25.207 1.00 64.99  ? 43  GLU A O     1 
ATOM   82   C  CB    . GLU A 1 13  ? -12.822 25.616 -22.574 1.00 65.86  ? 43  GLU A CB    1 
ATOM   83   C  CG    . GLU A 1 13  ? -12.030 25.171 -21.337 1.00 67.15  ? 43  GLU A CG    1 
ATOM   84   C  CD    . GLU A 1 13  ? -12.292 23.714 -20.950 1.00 67.72  ? 43  GLU A CD    1 
ATOM   85   O  OE1   . GLU A 1 13  ? -12.823 22.968 -21.800 1.00 69.76  ? 43  GLU A OE1   1 
ATOM   86   O  OE2   . GLU A 1 13  ? -11.962 23.310 -19.802 1.00 70.76  ? 43  GLU A OE2   1 
ATOM   87   N  N     . SER A 1 14  ? -14.068 28.458 -24.449 1.00 64.50  ? 44  SER A N     1 
ATOM   88   C  CA    . SER A 1 14  ? -14.738 28.753 -25.719 1.00 64.11  ? 44  SER A CA    1 
ATOM   89   C  C     . SER A 1 14  ? -13.746 29.155 -26.797 1.00 63.80  ? 44  SER A C     1 
ATOM   90   O  O     . SER A 1 14  ? -14.039 29.001 -27.972 1.00 63.95  ? 44  SER A O     1 
ATOM   91   C  CB    . SER A 1 14  ? -15.821 29.825 -25.556 1.00 64.12  ? 44  SER A CB    1 
ATOM   92   O  OG    . SER A 1 14  ? -15.282 31.050 -25.121 1.00 64.01  ? 44  SER A OG    1 
ATOM   93   N  N     . GLY A 1 15  ? -12.581 29.676 -26.401 1.00 63.57  ? 45  GLY A N     1 
ATOM   94   C  CA    . GLY A 1 15  ? -11.498 29.964 -27.351 1.00 63.29  ? 45  GLY A CA    1 
ATOM   95   C  C     . GLY A 1 15  ? -10.979 31.392 -27.464 1.00 63.05  ? 45  GLY A C     1 
ATOM   96   O  O     . GLY A 1 15  ? -10.379 31.751 -28.485 1.00 63.09  ? 45  GLY A O     1 
ATOM   97   N  N     . LYS A 1 16  ? -11.166 32.199 -26.423 1.00 62.42  ? 46  LYS A N     1 
ATOM   98   C  CA    . LYS A 1 16  ? -10.762 33.596 -26.460 1.00 62.14  ? 46  LYS A CA    1 
ATOM   99   C  C     . LYS A 1 16  ? -9.237  33.763 -26.585 1.00 61.80  ? 46  LYS A C     1 
ATOM   100  O  O     . LYS A 1 16  ? -8.750  34.526 -27.420 1.00 62.03  ? 46  LYS A O     1 
ATOM   101  C  CB    . LYS A 1 16  ? -11.224 34.326 -25.200 1.00 62.23  ? 46  LYS A CB    1 
ATOM   102  C  CG    . LYS A 1 16  ? -12.718 34.204 -24.850 1.00 62.57  ? 46  LYS A CG    1 
ATOM   103  C  CD    . LYS A 1 16  ? -12.968 34.713 -23.417 1.00 62.48  ? 46  LYS A CD    1 
ATOM   104  C  CE    . LYS A 1 16  ? -13.679 33.687 -22.558 1.00 62.45  ? 46  LYS A CE    1 
ATOM   105  N  NZ    . LYS A 1 16  ? -13.027 32.350 -22.454 1.00 61.35  ? 46  LYS A NZ    1 
ATOM   106  N  N     . SER A 1 17  ? -8.486  33.063 -25.747 1.00 61.26  ? 47  SER A N     1 
ATOM   107  C  CA    . SER A 1 17  ? -7.029  33.223 -25.712 1.00 60.83  ? 47  SER A CA    1 
ATOM   108  C  C     . SER A 1 17  ? -6.359  32.803 -27.031 1.00 61.22  ? 47  SER A C     1 
ATOM   109  O  O     . SER A 1 17  ? -5.320  33.343 -27.416 1.00 61.04  ? 47  SER A O     1 
ATOM   110  C  CB    . SER A 1 17  ? -6.448  32.435 -24.542 1.00 60.50  ? 47  SER A CB    1 
ATOM   111  O  OG    . SER A 1 17  ? -6.946  32.932 -23.307 1.00 59.09  ? 47  SER A OG    1 
ATOM   112  N  N     . THR A 1 18  ? -6.976  31.844 -27.715 1.00 61.52  ? 48  THR A N     1 
ATOM   113  C  CA    . THR A 1 18  ? -6.507  31.364 -28.999 1.00 61.78  ? 48  THR A CA    1 
ATOM   114  C  C     . THR A 1 18  ? -6.679  32.455 -30.056 1.00 61.79  ? 48  THR A C     1 
ATOM   115  O  O     . THR A 1 18  ? -5.801  32.641 -30.907 1.00 61.79  ? 48  THR A O     1 
ATOM   116  C  CB    . THR A 1 18  ? -7.272  30.074 -29.410 1.00 62.00  ? 48  THR A CB    1 
ATOM   117  O  OG1   . THR A 1 18  ? -7.146  29.100 -28.371 1.00 63.00  ? 48  THR A OG1   1 
ATOM   118  C  CG2   . THR A 1 18  ? -6.743  29.480 -30.698 1.00 61.33  ? 48  THR A CG2   1 
ATOM   119  N  N     . ILE A 1 19  ? -7.786  33.194 -29.997 1.00 61.71  ? 49  ILE A N     1 
ATOM   120  C  CA    . ILE A 1 19  ? -7.978  34.307 -30.929 1.00 61.86  ? 49  ILE A CA    1 
ATOM   121  C  C     . ILE A 1 19  ? -6.913  35.367 -30.669 1.00 62.12  ? 49  ILE A C     1 
ATOM   122  O  O     . ILE A 1 19  ? -6.373  35.942 -31.605 1.00 62.18  ? 49  ILE A O     1 
ATOM   123  C  CB    . ILE A 1 19  ? -9.385  34.912 -30.840 1.00 61.83  ? 49  ILE A CB    1 
ATOM   124  C  CG1   . ILE A 1 19  ? -10.428 33.923 -31.365 1.00 61.53  ? 49  ILE A CG1   1 
ATOM   125  C  CG2   . ILE A 1 19  ? -9.473  36.195 -31.651 1.00 61.83  ? 49  ILE A CG2   1 
ATOM   126  C  CD1   . ILE A 1 19  ? -10.511 33.854 -32.887 1.00 60.30  ? 49  ILE A CD1   1 
ATOM   127  N  N     . VAL A 1 20  ? -6.580  35.593 -29.399 1.00 62.39  ? 50  VAL A N     1 
ATOM   128  C  CA    . VAL A 1 20  ? -5.489  36.505 -29.056 1.00 62.60  ? 50  VAL A CA    1 
ATOM   129  C  C     . VAL A 1 20  ? -4.158  36.043 -29.643 1.00 62.75  ? 50  VAL A C     1 
ATOM   130  O  O     . VAL A 1 20  ? -3.343  36.874 -30.061 1.00 62.99  ? 50  VAL A O     1 
ATOM   131  C  CB    . VAL A 1 20  ? -5.328  36.708 -27.521 1.00 62.67  ? 50  VAL A CB    1 
ATOM   132  C  CG1   . VAL A 1 20  ? -4.059  37.499 -27.212 1.00 62.76  ? 50  VAL A CG1   1 
ATOM   133  C  CG2   . VAL A 1 20  ? -6.538  37.427 -26.938 1.00 62.40  ? 50  VAL A CG2   1 
ATOM   134  N  N     . LYS A 1 21  ? -3.927  34.734 -29.667 1.00 62.80  ? 51  LYS A N     1 
ATOM   135  C  CA    . LYS A 1 21  ? -2.697  34.199 -30.261 1.00 63.05  ? 51  LYS A CA    1 
ATOM   136  C  C     . LYS A 1 21  ? -2.663  34.470 -31.767 1.00 63.29  ? 51  LYS A C     1 
ATOM   137  O  O     . LYS A 1 21  ? -1.622  34.855 -32.318 1.00 62.97  ? 51  LYS A O     1 
ATOM   138  C  CB    . LYS A 1 21  ? -2.539  32.700 -29.956 1.00 62.90  ? 51  LYS A CB    1 
ATOM   139  C  CG    . LYS A 1 21  ? -2.139  32.466 -28.524 1.00 62.86  ? 51  LYS A CG    1 
ATOM   140  C  CD    . LYS A 1 21  ? -1.960  31.009 -28.135 1.00 62.95  ? 51  LYS A CD    1 
ATOM   141  C  CE    . LYS A 1 21  ? -1.684  30.913 -26.631 1.00 62.41  ? 51  LYS A CE    1 
ATOM   142  N  NZ    . LYS A 1 21  ? -1.829  29.549 -26.090 1.00 62.74  ? 51  LYS A NZ    1 
ATOM   143  N  N     . GLN A 1 22  ? -3.819  34.300 -32.411 1.00 63.52  ? 52  GLN A N     1 
ATOM   144  C  CA    . GLN A 1 22  ? -3.944  34.512 -33.852 1.00 63.73  ? 52  GLN A CA    1 
ATOM   145  C  C     . GLN A 1 22  ? -3.731  35.972 -34.248 1.00 64.01  ? 52  GLN A C     1 
ATOM   146  O  O     . GLN A 1 22  ? -3.457  36.267 -35.411 1.00 64.21  ? 52  GLN A O     1 
ATOM   147  C  CB    . GLN A 1 22  ? -5.312  34.033 -34.365 1.00 63.77  ? 52  GLN A CB    1 
ATOM   148  C  CG    . GLN A 1 22  ? -5.552  32.529 -34.267 1.00 63.33  ? 52  GLN A CG    1 
ATOM   149  C  CD    . GLN A 1 22  ? -4.761  31.717 -35.282 1.00 62.86  ? 52  GLN A CD    1 
ATOM   150  O  OE1   . GLN A 1 22  ? -3.681  32.116 -35.721 1.00 61.43  ? 52  GLN A OE1   1 
ATOM   151  N  NE2   . GLN A 1 22  ? -5.297  30.557 -35.648 1.00 63.42  ? 52  GLN A NE2   1 
ATOM   152  N  N     . MET A 1 23  ? -3.858  36.890 -33.300 1.00 64.29  ? 53  MET A N     1 
ATOM   153  C  CA    . MET A 1 23  ? -3.497  38.274 -33.579 1.00 64.70  ? 53  MET A CA    1 
ATOM   154  C  C     . MET A 1 23  ? -1.971  38.362 -33.628 1.00 65.01  ? 53  MET A C     1 
ATOM   155  O  O     . MET A 1 23  ? -1.413  38.934 -34.563 1.00 65.00  ? 53  MET A O     1 
ATOM   156  C  CB    . MET A 1 23  ? -4.069  39.234 -32.531 1.00 64.68  ? 53  MET A CB    1 
ATOM   157  C  CG    . MET A 1 23  ? -5.580  39.111 -32.272 1.00 64.82  ? 53  MET A CG    1 
ATOM   158  S  SD    . MET A 1 23  ? -6.660  39.595 -33.637 1.00 65.26  ? 53  MET A SD    1 
ATOM   159  C  CE    . MET A 1 23  ? -6.599  38.169 -34.719 1.00 62.54  ? 53  MET A CE    1 
ATOM   160  N  N     . LYS A 1 24  ? -1.295  37.767 -32.645 1.00 65.42  ? 54  LYS A N     1 
ATOM   161  C  CA    . LYS A 1 24  ? 0.175   37.807 -32.605 1.00 65.81  ? 54  LYS A CA    1 
ATOM   162  C  C     . LYS A 1 24  ? 0.766   37.215 -33.881 1.00 66.02  ? 54  LYS A C     1 
ATOM   163  O  O     . LYS A 1 24  ? 1.782   37.693 -34.378 1.00 65.87  ? 54  LYS A O     1 
ATOM   164  C  CB    . LYS A 1 24  ? 0.733   37.081 -31.368 1.00 65.73  ? 54  LYS A CB    1 
ATOM   165  C  CG    . LYS A 1 24  ? 2.271   37.061 -31.286 1.00 66.09  ? 54  LYS A CG    1 
ATOM   166  C  CD    . LYS A 1 24  ? 2.783   36.455 -29.968 1.00 65.92  ? 54  LYS A CD    1 
ATOM   167  N  N     . ILE A 1 25  ? 0.114   36.185 -34.415 1.00 66.42  ? 55  ILE A N     1 
ATOM   168  C  CA    . ILE A 1 25  ? 0.590   35.530 -35.629 1.00 66.63  ? 55  ILE A CA    1 
ATOM   169  C  C     . ILE A 1 25  ? 0.282   36.361 -36.864 1.00 66.83  ? 55  ILE A C     1 
ATOM   170  O  O     . ILE A 1 25  ? 1.184   36.659 -37.646 1.00 66.96  ? 55  ILE A O     1 
ATOM   171  C  CB    . ILE A 1 25  ? -0.027  34.139 -35.798 1.00 66.71  ? 55  ILE A CB    1 
ATOM   172  C  CG1   . ILE A 1 25  ? 0.455   33.218 -34.674 1.00 66.31  ? 55  ILE A CG1   1 
ATOM   173  C  CG2   . ILE A 1 25  ? 0.346   33.556 -37.170 1.00 66.69  ? 55  ILE A CG2   1 
ATOM   174  C  CD1   . ILE A 1 25  ? -0.575  32.210 -34.255 1.00 66.31  ? 55  ILE A CD1   1 
ATOM   175  N  N     . ILE A 1 26  ? -0.987  36.734 -37.035 1.00 67.03  ? 56  ILE A N     1 
ATOM   176  C  CA    . ILE A 1 26  ? -1.399  37.533 -38.196 1.00 67.14  ? 56  ILE A CA    1 
ATOM   177  C  C     . ILE A 1 26  ? -0.749  38.905 -38.168 1.00 67.41  ? 56  ILE A C     1 
ATOM   178  O  O     . ILE A 1 26  ? 0.098   39.214 -39.004 1.00 67.73  ? 56  ILE A O     1 
ATOM   179  C  CB    . ILE A 1 26  ? -2.932  37.758 -38.258 1.00 67.19  ? 56  ILE A CB    1 
ATOM   180  C  CG1   . ILE A 1 26  ? -3.687  36.449 -38.481 1.00 67.39  ? 56  ILE A CG1   1 
ATOM   181  C  CG2   . ILE A 1 26  ? -3.274  38.713 -39.382 1.00 66.92  ? 56  ILE A CG2   1 
ATOM   182  C  CD1   . ILE A 1 26  ? -5.193  36.573 -38.252 1.00 67.19  ? 56  ILE A CD1   1 
ATOM   183  N  N     . HIS A 1 27  ? -1.132  39.710 -37.181 1.00 67.81  ? 57  HIS A N     1 
ATOM   184  C  CA    . HIS A 1 27  ? -0.879  41.160 -37.206 1.00 68.20  ? 57  HIS A CA    1 
ATOM   185  C  C     . HIS A 1 27  ? 0.420   41.598 -36.493 1.00 68.28  ? 57  HIS A C     1 
ATOM   186  O  O     . HIS A 1 27  ? 0.708   42.792 -36.419 1.00 68.48  ? 57  HIS A O     1 
ATOM   187  C  CB    . HIS A 1 27  ? -2.108  41.918 -36.663 1.00 68.11  ? 57  HIS A CB    1 
ATOM   188  N  N     . GLU A 1 28  ? 1.164   40.638 -35.942 1.00 68.56  ? 58  GLU A N     1 
ATOM   189  C  CA    . GLU A 1 28  ? 2.609   40.775 -35.737 1.00 68.67  ? 58  GLU A CA    1 
ATOM   190  C  C     . GLU A 1 28  ? 3.175   39.855 -36.810 1.00 68.97  ? 58  GLU A C     1 
ATOM   191  O  O     . GLU A 1 28  ? 2.583   39.778 -37.888 1.00 69.08  ? 58  GLU A O     1 
ATOM   192  C  CB    . GLU A 1 28  ? 3.035   40.363 -34.330 1.00 68.54  ? 58  GLU A CB    1 
ATOM   193  N  N     . ALA A 1 29  ? 4.272   39.142 -36.544 1.00 69.25  ? 59  ALA A N     1 
ATOM   194  C  CA    . ALA A 1 29  ? 4.879   38.274 -37.573 1.00 69.57  ? 59  ALA A CA    1 
ATOM   195  C  C     . ALA A 1 29  ? 5.187   36.859 -37.079 1.00 69.96  ? 59  ALA A C     1 
ATOM   196  O  O     . ALA A 1 29  ? 6.368   36.480 -36.945 1.00 70.13  ? 59  ALA A O     1 
ATOM   197  C  CB    . ALA A 1 29  ? 6.142   38.918 -38.129 1.00 69.62  ? 59  ALA A CB    1 
ATOM   198  N  N     . GLY A 1 30  ? 4.126   36.085 -36.822 1.00 70.03  ? 60  GLY A N     1 
ATOM   199  C  CA    . GLY A 1 30  ? 4.246   34.682 -36.413 1.00 69.96  ? 60  GLY A CA    1 
ATOM   200  C  C     . GLY A 1 30  ? 4.883   34.503 -35.044 1.00 70.04  ? 60  GLY A C     1 
ATOM   201  O  O     . GLY A 1 30  ? 5.131   35.483 -34.334 1.00 70.02  ? 60  GLY A O     1 
ATOM   202  N  N     . TYR A 1 31  ? 5.120   33.246 -34.667 1.00 70.03  ? 61  TYR A N     1 
ATOM   203  C  CA    . TYR A 1 31  ? 5.978   32.917 -33.524 1.00 70.06  ? 61  TYR A CA    1 
ATOM   204  C  C     . TYR A 1 31  ? 7.423   32.697 -34.007 1.00 70.13  ? 61  TYR A C     1 
ATOM   205  O  O     . TYR A 1 31  ? 7.660   32.201 -35.122 1.00 69.94  ? 61  TYR A O     1 
ATOM   206  C  CB    . TYR A 1 31  ? 5.464   31.674 -32.781 1.00 70.07  ? 61  TYR A CB    1 
ATOM   207  C  CG    . TYR A 1 31  ? 4.358   31.972 -31.786 1.00 70.59  ? 61  TYR A CG    1 
ATOM   208  C  CD1   . TYR A 1 31  ? 4.656   32.424 -30.499 1.00 70.84  ? 61  TYR A CD1   1 
ATOM   209  C  CD2   . TYR A 1 31  ? 3.007   31.810 -32.128 1.00 70.41  ? 61  TYR A CD2   1 
ATOM   210  C  CE1   . TYR A 1 31  ? 3.637   32.706 -29.577 1.00 70.56  ? 61  TYR A CE1   1 
ATOM   211  C  CE2   . TYR A 1 31  ? 1.984   32.099 -31.209 1.00 69.36  ? 61  TYR A CE2   1 
ATOM   212  C  CZ    . TYR A 1 31  ? 2.310   32.543 -29.943 1.00 69.59  ? 61  TYR A CZ    1 
ATOM   213  O  OH    . TYR A 1 31  ? 1.325   32.828 -29.029 1.00 70.00  ? 61  TYR A OH    1 
ATOM   214  N  N     . SER A 1 32  ? 8.387   33.089 -33.176 1.00 70.13  ? 62  SER A N     1 
ATOM   215  C  CA    . SER A 1 32  ? 9.793   32.779 -33.439 1.00 70.07  ? 62  SER A CA    1 
ATOM   216  C  C     . SER A 1 32  ? 9.989   31.290 -33.220 1.00 70.00  ? 62  SER A C     1 
ATOM   217  O  O     . SER A 1 32  ? 9.041   30.591 -32.867 1.00 69.72  ? 62  SER A O     1 
ATOM   218  C  CB    . SER A 1 32  ? 10.713  33.568 -32.504 1.00 69.97  ? 62  SER A CB    1 
ATOM   219  N  N     . GLU A 1 33  ? 11.205  30.796 -33.436 1.00 70.12  ? 63  GLU A N     1 
ATOM   220  C  CA    . GLU A 1 33  ? 11.518  29.428 -33.030 1.00 70.21  ? 63  GLU A CA    1 
ATOM   221  C  C     . GLU A 1 33  ? 11.789  29.401 -31.528 1.00 70.15  ? 63  GLU A C     1 
ATOM   222  O  O     . GLU A 1 33  ? 11.375  28.467 -30.837 1.00 70.42  ? 63  GLU A O     1 
ATOM   223  C  CB    . GLU A 1 33  ? 12.692  28.833 -33.811 1.00 70.16  ? 63  GLU A CB    1 
ATOM   224  C  CG    . GLU A 1 33  ? 13.010  27.403 -33.377 1.00 70.68  ? 63  GLU A CG    1 
ATOM   225  C  CD    . GLU A 1 33  ? 13.420  26.489 -34.521 1.00 71.92  ? 63  GLU A CD    1 
ATOM   226  O  OE1   . GLU A 1 33  ? 12.533  25.765 -35.034 1.00 71.29  ? 63  GLU A OE1   1 
ATOM   227  O  OE2   . GLU A 1 33  ? 14.626  26.479 -34.890 1.00 73.39  ? 63  GLU A OE2   1 
ATOM   228  N  N     . GLU A 1 34  ? 12.454  30.434 -31.020 1.00 70.00  ? 64  GLU A N     1 
ATOM   229  C  CA    . GLU A 1 34  ? 12.711  30.532 -29.588 1.00 70.07  ? 64  GLU A CA    1 
ATOM   230  C  C     . GLU A 1 34  ? 11.408  30.582 -28.813 1.00 70.03  ? 64  GLU A C     1 
ATOM   231  O  O     . GLU A 1 34  ? 11.249  29.880 -27.812 1.00 70.21  ? 64  GLU A O     1 
ATOM   232  C  CB    . GLU A 1 34  ? 13.538  31.769 -29.254 1.00 70.10  ? 64  GLU A CB    1 
ATOM   233  C  CG    . GLU A 1 34  ? 14.286  31.648 -27.933 1.00 70.46  ? 64  GLU A CG    1 
ATOM   234  C  CD    . GLU A 1 34  ? 15.587  30.862 -28.062 1.00 70.41  ? 64  GLU A CD    1 
ATOM   235  O  OE1   . GLU A 1 34  ? 16.663  31.487 -27.949 1.00 69.20  ? 64  GLU A OE1   1 
ATOM   236  O  OE2   . GLU A 1 34  ? 15.531  29.630 -28.288 1.00 70.33  ? 64  GLU A OE2   1 
ATOM   237  N  N     . GLU A 1 35  ? 10.481  31.409 -29.289 1.00 69.90  ? 65  GLU A N     1 
ATOM   238  C  CA    . GLU A 1 35  ? 9.162   31.528 -28.672 1.00 69.95  ? 65  GLU A CA    1 
ATOM   239  C  C     . GLU A 1 35  ? 8.411   30.185 -28.646 1.00 69.93  ? 65  GLU A C     1 
ATOM   240  O  O     . GLU A 1 35  ? 7.698   29.885 -27.679 1.00 70.03  ? 65  GLU A O     1 
ATOM   241  C  CB    . GLU A 1 35  ? 8.332   32.601 -29.389 1.00 69.99  ? 65  GLU A CB    1 
ATOM   242  N  N     . CYS A 1 36  ? 8.583   29.379 -29.696 1.00 69.91  ? 66  CYS A N     1 
ATOM   243  C  CA    . CYS A 1 36  ? 7.943   28.052 -29.779 1.00 69.89  ? 66  CYS A CA    1 
ATOM   244  C  C     . CYS A 1 36  ? 8.534   27.062 -28.779 1.00 69.81  ? 66  CYS A C     1 
ATOM   245  O  O     . CYS A 1 36  ? 7.793   26.315 -28.137 1.00 69.65  ? 66  CYS A O     1 
ATOM   246  C  CB    . CYS A 1 36  ? 8.066   27.470 -31.189 1.00 69.90  ? 66  CYS A CB    1 
ATOM   247  S  SG    . CYS A 1 36  ? 7.072   28.310 -32.422 1.00 70.25  ? 66  CYS A SG    1 
ATOM   248  N  N     . LYS A 1 37  ? 9.865   27.065 -28.652 1.00 69.66  ? 67  LYS A N     1 
ATOM   249  C  CA    . LYS A 1 37  ? 10.556  26.187 -27.710 1.00 69.48  ? 67  LYS A CA    1 
ATOM   250  C  C     . LYS A 1 37  ? 10.097  26.445 -26.268 1.00 69.44  ? 67  LYS A C     1 
ATOM   251  O  O     . LYS A 1 37  ? 10.173  25.559 -25.422 1.00 69.55  ? 67  LYS A O     1 
ATOM   252  C  CB    . LYS A 1 37  ? 12.079  26.335 -27.839 1.00 69.43  ? 67  LYS A CB    1 
ATOM   253  N  N     . GLN A 1 38  ? 9.604   27.649 -25.994 1.00 69.44  ? 68  GLN A N     1 
ATOM   254  C  CA    . GLN A 1 38  ? 9.016   27.960 -24.682 1.00 69.60  ? 68  GLN A CA    1 
ATOM   255  C  C     . GLN A 1 38  ? 7.667   27.259 -24.403 1.00 69.07  ? 68  GLN A C     1 
ATOM   256  O  O     . GLN A 1 38  ? 7.306   27.058 -23.236 1.00 69.14  ? 68  GLN A O     1 
ATOM   257  C  CB    . GLN A 1 38  ? 8.887   29.479 -24.500 1.00 69.64  ? 68  GLN A CB    1 
ATOM   258  C  CG    . GLN A 1 38  ? 10.246  30.201 -24.516 1.00 70.14  ? 68  GLN A CG    1 
ATOM   259  C  CD    . GLN A 1 38  ? 10.148  31.676 -24.158 1.00 70.60  ? 68  GLN A CD    1 
ATOM   260  O  OE1   . GLN A 1 38  ? 9.097   32.300 -24.329 1.00 72.06  ? 68  GLN A OE1   1 
ATOM   261  N  NE2   . GLN A 1 38  ? 11.252  32.246 -23.658 1.00 72.56  ? 68  GLN A NE2   1 
ATOM   262  N  N     . TYR A 1 39  ? 6.942   26.871 -25.454 1.00 68.40  ? 69  TYR A N     1 
ATOM   263  C  CA    . TYR A 1 39  ? 5.673   26.135 -25.286 1.00 67.92  ? 69  TYR A CA    1 
ATOM   264  C  C     . TYR A 1 39  ? 5.815   24.608 -25.140 1.00 67.46  ? 69  TYR A C     1 
ATOM   265  O  O     . TYR A 1 39  ? 4.805   23.914 -24.969 1.00 67.18  ? 69  TYR A O     1 
ATOM   266  C  CB    . TYR A 1 39  ? 4.707   26.460 -26.429 1.00 67.93  ? 69  TYR A CB    1 
ATOM   267  C  CG    . TYR A 1 39  ? 4.012   27.790 -26.262 1.00 68.05  ? 69  TYR A CG    1 
ATOM   268  C  CD1   . TYR A 1 39  ? 4.644   28.977 -26.621 1.00 68.30  ? 69  TYR A CD1   1 
ATOM   269  C  CD2   . TYR A 1 39  ? 2.728   27.863 -25.738 1.00 67.89  ? 69  TYR A CD2   1 
ATOM   270  C  CE1   . TYR A 1 39  ? 4.011   30.203 -26.466 1.00 68.10  ? 69  TYR A CE1   1 
ATOM   271  C  CE2   . TYR A 1 39  ? 2.088   29.078 -25.584 1.00 67.98  ? 69  TYR A CE2   1 
ATOM   272  C  CZ    . TYR A 1 39  ? 2.731   30.246 -25.945 1.00 67.76  ? 69  TYR A CZ    1 
ATOM   273  O  OH    . TYR A 1 39  ? 2.088   31.453 -25.786 1.00 67.80  ? 69  TYR A OH    1 
ATOM   274  N  N     . LYS A 1 40  ? 7.050   24.090 -25.203 1.00 66.90  ? 70  LYS A N     1 
ATOM   275  C  CA    . LYS A 1 40  ? 7.323   22.666 -24.923 1.00 66.44  ? 70  LYS A CA    1 
ATOM   276  C  C     . LYS A 1 40  ? 6.604   22.200 -23.661 1.00 65.88  ? 70  LYS A C     1 
ATOM   277  O  O     . LYS A 1 40  ? 5.703   21.370 -23.725 1.00 66.10  ? 70  LYS A O     1 
ATOM   278  C  CB    . LYS A 1 40  ? 8.826   22.403 -24.738 1.00 66.60  ? 70  LYS A CB    1 
ATOM   279  C  CG    . LYS A 1 40  ? 9.505   21.631 -25.839 1.00 66.72  ? 70  LYS A CG    1 
ATOM   280  C  CD    . LYS A 1 40  ? 10.782  20.972 -25.316 1.00 66.94  ? 70  LYS A CD    1 
ATOM   281  C  CE    . LYS A 1 40  ? 11.435  20.079 -26.364 1.00 67.32  ? 70  LYS A CE    1 
ATOM   282  N  NZ    . LYS A 1 40  ? 12.192  18.932 -25.781 1.00 67.68  ? 70  LYS A NZ    1 
ATOM   283  N  N     . ALA A 1 41  ? 7.002   22.752 -22.519 1.00 65.19  ? 71  ALA A N     1 
ATOM   284  C  CA    . ALA A 1 41  ? 6.439   22.369 -21.232 1.00 64.78  ? 71  ALA A CA    1 
ATOM   285  C  C     . ALA A 1 41  ? 4.919   22.286 -21.285 1.00 64.54  ? 71  ALA A C     1 
ATOM   286  O  O     . ALA A 1 41  ? 4.325   21.332 -20.774 1.00 64.76  ? 71  ALA A O     1 
ATOM   287  C  CB    . ALA A 1 41  ? 6.876   23.351 -20.147 1.00 64.69  ? 71  ALA A CB    1 
ATOM   288  N  N     . VAL A 1 42  ? 4.289   23.273 -21.911 1.00 64.00  ? 72  VAL A N     1 
ATOM   289  C  CA    . VAL A 1 42  ? 2.837   23.319 -21.947 1.00 63.79  ? 72  VAL A CA    1 
ATOM   290  C  C     . VAL A 1 42  ? 2.269   22.162 -22.770 1.00 63.44  ? 72  VAL A C     1 
ATOM   291  O  O     . VAL A 1 42  ? 1.367   21.451 -22.315 1.00 63.28  ? 72  VAL A O     1 
ATOM   292  C  CB    . VAL A 1 42  ? 2.335   24.655 -22.493 1.00 63.88  ? 72  VAL A CB    1 
ATOM   293  C  CG1   . VAL A 1 42  ? 0.809   24.638 -22.649 1.00 63.57  ? 72  VAL A CG1   1 
ATOM   294  C  CG2   . VAL A 1 42  ? 2.774   25.769 -21.564 1.00 63.83  ? 72  VAL A CG2   1 
ATOM   295  N  N     . VAL A 1 43  ? 2.807   21.973 -23.967 1.00 62.90  ? 73  VAL A N     1 
ATOM   296  C  CA    . VAL A 1 43  ? 2.423   20.842 -24.787 1.00 62.62  ? 73  VAL A CA    1 
ATOM   297  C  C     . VAL A 1 43  ? 2.605   19.534 -24.008 1.00 62.67  ? 73  VAL A C     1 
ATOM   298  O  O     . VAL A 1 43  ? 1.688   18.711 -23.956 1.00 62.87  ? 73  VAL A O     1 
ATOM   299  C  CB    . VAL A 1 43  ? 3.217   20.798 -26.115 1.00 62.64  ? 73  VAL A CB    1 
ATOM   300  C  CG1   . VAL A 1 43  ? 3.140   19.408 -26.751 1.00 62.30  ? 73  VAL A CG1   1 
ATOM   301  C  CG2   . VAL A 1 43  ? 2.708   21.863 -27.081 1.00 62.01  ? 73  VAL A CG2   1 
ATOM   302  N  N     . TYR A 1 44  ? 3.771   19.340 -23.396 1.00 62.46  ? 74  TYR A N     1 
ATOM   303  C  CA    . TYR A 1 44  ? 4.014   18.116 -22.624 1.00 62.27  ? 74  TYR A CA    1 
ATOM   304  C  C     . TYR A 1 44  ? 3.009   17.987 -21.496 1.00 62.66  ? 74  TYR A C     1 
ATOM   305  O  O     . TYR A 1 44  ? 2.360   16.952 -21.369 1.00 63.35  ? 74  TYR A O     1 
ATOM   306  C  CB    . TYR A 1 44  ? 5.429   18.071 -22.054 1.00 61.79  ? 74  TYR A CB    1 
ATOM   307  C  CG    . TYR A 1 44  ? 6.518   17.861 -23.076 1.00 60.99  ? 74  TYR A CG    1 
ATOM   308  C  CD1   . TYR A 1 44  ? 6.299   17.092 -24.209 1.00 60.03  ? 74  TYR A CD1   1 
ATOM   309  C  CD2   . TYR A 1 44  ? 7.779   18.404 -22.891 1.00 60.74  ? 74  TYR A CD2   1 
ATOM   310  C  CE1   . TYR A 1 44  ? 7.281   16.893 -25.137 1.00 59.83  ? 74  TYR A CE1   1 
ATOM   311  C  CE2   . TYR A 1 44  ? 8.783   18.201 -23.824 1.00 61.15  ? 74  TYR A CE2   1 
ATOM   312  C  CZ    . TYR A 1 44  ? 8.519   17.436 -24.947 1.00 60.73  ? 74  TYR A CZ    1 
ATOM   313  O  OH    . TYR A 1 44  ? 9.483   17.194 -25.894 1.00 61.16  ? 74  TYR A OH    1 
ATOM   314  N  N     . SER A 1 45  ? 2.854   19.040 -20.702 1.00 62.67  ? 75  SER A N     1 
ATOM   315  C  CA    . SER A 1 45  ? 1.862   19.033 -19.637 1.00 62.76  ? 75  SER A CA    1 
ATOM   316  C  C     . SER A 1 45  ? 0.431   18.878 -20.153 1.00 62.71  ? 75  SER A C     1 
ATOM   317  O  O     . SER A 1 45  ? -0.362  18.145 -19.554 1.00 62.64  ? 75  SER A O     1 
ATOM   318  C  CB    . SER A 1 45  ? 1.954   20.291 -18.789 1.00 62.87  ? 75  SER A CB    1 
ATOM   319  O  OG    . SER A 1 45  ? 0.871   20.308 -17.876 1.00 63.41  ? 75  SER A OG    1 
ATOM   320  N  N     . ASN A 1 46  ? 0.089   19.565 -21.244 1.00 62.78  ? 76  ASN A N     1 
ATOM   321  C  CA    . ASN A 1 46  ? -1.230  19.363 -21.886 1.00 62.96  ? 76  ASN A CA    1 
ATOM   322  C  C     . ASN A 1 46  ? -1.463  17.882 -22.224 1.00 62.93  ? 76  ASN A C     1 
ATOM   323  O  O     . ASN A 1 46  ? -2.553  17.342 -22.030 1.00 62.82  ? 76  ASN A O     1 
ATOM   324  C  CB    . ASN A 1 46  ? -1.373  20.189 -23.175 1.00 62.92  ? 76  ASN A CB    1 
ATOM   325  C  CG    . ASN A 1 46  ? -1.689  21.672 -22.925 1.00 63.31  ? 76  ASN A CG    1 
ATOM   326  O  OD1   . ASN A 1 46  ? -1.527  22.496 -23.827 1.00 63.82  ? 76  ASN A OD1   1 
ATOM   327  N  ND2   . ASN A 1 46  ? -2.146  22.010 -21.724 1.00 62.68  ? 76  ASN A ND2   1 
ATOM   328  N  N     . THR A 1 47  ? -0.411  17.231 -22.713 1.00 62.65  ? 77  THR A N     1 
ATOM   329  C  CA    . THR A 1 47  ? -0.495  15.849 -23.152 1.00 62.42  ? 77  THR A CA    1 
ATOM   330  C  C     . THR A 1 47  ? -0.685  14.904 -21.966 1.00 62.18  ? 77  THR A C     1 
ATOM   331  O  O     . THR A 1 47  ? -1.614  14.075 -21.945 1.00 61.90  ? 77  THR A O     1 
ATOM   332  C  CB    . THR A 1 47  ? 0.770   15.481 -23.933 1.00 62.29  ? 77  THR A CB    1 
ATOM   333  O  OG1   . THR A 1 47  ? 0.913   16.395 -25.020 1.00 62.04  ? 77  THR A OG1   1 
ATOM   334  C  CG2   . THR A 1 47  ? 0.695   14.074 -24.471 1.00 62.14  ? 77  THR A CG2   1 
ATOM   335  N  N     . ILE A 1 48  ? 0.196   15.056 -20.983 1.00 61.70  ? 78  ILE A N     1 
ATOM   336  C  CA    . ILE A 1 48  ? 0.141   14.276 -19.753 1.00 61.54  ? 78  ILE A CA    1 
ATOM   337  C  C     . ILE A 1 48  ? -1.215  14.460 -19.039 1.00 61.56  ? 78  ILE A C     1 
ATOM   338  O  O     . ILE A 1 48  ? -1.777  13.504 -18.521 1.00 61.27  ? 78  ILE A O     1 
ATOM   339  C  CB    . ILE A 1 48  ? 1.291   14.676 -18.794 1.00 61.19  ? 78  ILE A CB    1 
ATOM   340  C  CG1   . ILE A 1 48  ? 2.641   14.311 -19.399 1.00 60.82  ? 78  ILE A CG1   1 
ATOM   341  C  CG2   . ILE A 1 48  ? 1.148   13.978 -17.460 1.00 60.94  ? 78  ILE A CG2   1 
ATOM   342  C  CD1   . ILE A 1 48  ? 3.824   14.944 -18.681 1.00 60.70  ? 78  ILE A CD1   1 
ATOM   343  N  N     . GLN A 1 49  ? -1.733  15.687 -19.021 1.00 61.61  ? 79  GLN A N     1 
ATOM   344  C  CA    . GLN A 1 49  ? -3.001  15.956 -18.343 1.00 61.68  ? 79  GLN A CA    1 
ATOM   345  C  C     . GLN A 1 49  ? -4.165  15.303 -19.088 1.00 61.47  ? 79  GLN A C     1 
ATOM   346  O  O     . GLN A 1 49  ? -5.031  14.702 -18.469 1.00 61.26  ? 79  GLN A O     1 
ATOM   347  C  CB    . GLN A 1 49  ? -3.234  17.462 -18.173 1.00 61.61  ? 79  GLN A CB    1 
ATOM   348  N  N     . SER A 1 50  ? -4.160  15.401 -20.415 1.00 61.48  ? 80  SER A N     1 
ATOM   349  C  CA    . SER A 1 50  ? -5.204  14.787 -21.244 1.00 61.53  ? 80  SER A CA    1 
ATOM   350  C  C     . SER A 1 50  ? -5.354  13.303 -20.948 1.00 61.60  ? 80  SER A C     1 
ATOM   351  O  O     . SER A 1 50  ? -6.467  12.828 -20.726 1.00 61.85  ? 80  SER A O     1 
ATOM   352  C  CB    . SER A 1 50  ? -4.898  14.967 -22.738 1.00 61.59  ? 80  SER A CB    1 
ATOM   353  O  OG    . SER A 1 50  ? -5.052  16.319 -23.158 1.00 62.12  ? 80  SER A OG    1 
ATOM   354  N  N     . ILE A 1 51  ? -4.229  12.579 -20.933 1.00 61.53  ? 81  ILE A N     1 
ATOM   355  C  CA    . ILE A 1 51  ? -4.243  11.122 -20.783 1.00 61.19  ? 81  ILE A CA    1 
ATOM   356  C  C     . ILE A 1 51  ? -4.614  10.677 -19.345 1.00 60.97  ? 81  ILE A C     1 
ATOM   357  O  O     . ILE A 1 51  ? -5.390  9.738  -19.155 1.00 61.19  ? 81  ILE A O     1 
ATOM   358  C  CB    . ILE A 1 51  ? -2.893  10.500 -21.259 1.00 61.14  ? 81  ILE A CB    1 
ATOM   359  C  CG1   . ILE A 1 51  ? -2.986  8.970  -21.377 1.00 61.21  ? 81  ILE A CG1   1 
ATOM   360  C  CG2   . ILE A 1 51  ? -1.763  10.862 -20.313 1.00 61.40  ? 81  ILE A CG2   1 
ATOM   361  C  CD1   . ILE A 1 51  ? -4.149  8.447  -22.211 1.00 60.05  ? 81  ILE A CD1   1 
ATOM   362  N  N     . ILE A 1 52  ? -4.070  11.350 -18.341 1.00 60.45  ? 82  ILE A N     1 
ATOM   363  C  CA    . ILE A 1 52  ? -4.520  11.159 -16.970 1.00 60.19  ? 82  ILE A CA    1 
ATOM   364  C  C     . ILE A 1 52  ? -6.043  11.282 -16.896 1.00 60.05  ? 82  ILE A C     1 
ATOM   365  O  O     . ILE A 1 52  ? -6.722  10.418 -16.340 1.00 59.71  ? 82  ILE A O     1 
ATOM   366  C  CB    . ILE A 1 52  ? -3.873  12.184 -16.024 1.00 60.15  ? 82  ILE A CB    1 
ATOM   367  C  CG1   . ILE A 1 52  ? -2.469  11.718 -15.626 1.00 60.24  ? 82  ILE A CG1   1 
ATOM   368  C  CG2   . ILE A 1 52  ? -4.731  12.398 -14.785 1.00 60.65  ? 82  ILE A CG2   1 
ATOM   369  C  CD1   . ILE A 1 52  ? -1.548  12.841 -15.156 1.00 59.28  ? 82  ILE A CD1   1 
ATOM   370  N  N     . ALA A 1 53  ? -6.571  12.352 -17.482 1.00 60.04  ? 83  ALA A N     1 
ATOM   371  C  CA    . ALA A 1 53  ? -8.019  12.593 -17.514 1.00 60.13  ? 83  ALA A CA    1 
ATOM   372  C  C     . ALA A 1 53  ? -8.836  11.363 -17.972 1.00 60.18  ? 83  ALA A C     1 
ATOM   373  O  O     . ALA A 1 53  ? -9.829  11.009 -17.325 1.00 59.80  ? 83  ALA A O     1 
ATOM   374  C  CB    . ALA A 1 53  ? -8.333  13.796 -18.396 1.00 59.84  ? 83  ALA A CB    1 
ATOM   375  N  N     . ILE A 1 54  ? -8.404  10.720 -19.062 1.00 60.04  ? 84  ILE A N     1 
ATOM   376  C  CA    . ILE A 1 54  ? -9.095  9.548  -19.600 1.00 60.17  ? 84  ILE A CA    1 
ATOM   377  C  C     . ILE A 1 54  ? -9.017  8.379  -18.619 1.00 60.72  ? 84  ILE A C     1 
ATOM   378  O  O     . ILE A 1 54  ? -10.040 7.776  -18.278 1.00 60.84  ? 84  ILE A O     1 
ATOM   379  C  CB    . ILE A 1 54  ? -8.534  9.134  -20.987 1.00 60.28  ? 84  ILE A CB    1 
ATOM   380  C  CG1   . ILE A 1 54  ? -8.766  10.250 -22.014 1.00 60.53  ? 84  ILE A CG1   1 
ATOM   381  C  CG2   . ILE A 1 54  ? -9.195  7.865  -21.506 1.00 59.68  ? 84  ILE A CG2   1 
ATOM   382  C  CD1   . ILE A 1 54  ? -8.192  9.971  -23.381 1.00 59.95  ? 84  ILE A CD1   1 
ATOM   383  N  N     . ILE A 1 55  ? -7.818  8.092  -18.125 1.00 61.15  ? 85  ILE A N     1 
ATOM   384  C  CA    . ILE A 1 55  ? -7.615  6.956  -17.220 1.00 61.46  ? 85  ILE A CA    1 
ATOM   385  C  C     . ILE A 1 55  ? -8.383  7.056  -15.897 1.00 61.66  ? 85  ILE A C     1 
ATOM   386  O  O     . ILE A 1 55  ? -8.935  6.071  -15.426 1.00 61.93  ? 85  ILE A O     1 
ATOM   387  C  CB    . ILE A 1 55  ? -6.134  6.767  -16.917 1.00 61.59  ? 85  ILE A CB    1 
ATOM   388  C  CG1   . ILE A 1 55  ? -5.409  6.310  -18.173 1.00 62.51  ? 85  ILE A CG1   1 
ATOM   389  C  CG2   . ILE A 1 55  ? -5.928  5.738  -15.828 1.00 61.37  ? 85  ILE A CG2   1 
ATOM   390  C  CD1   . ILE A 1 55  ? -3.922  6.256  -17.981 1.00 64.88  ? 85  ILE A CD1   1 
ATOM   391  N  N     . ARG A 1 56  ? -8.420  8.239  -15.295 1.00 61.91  ? 86  ARG A N     1 
ATOM   392  C  CA    . ARG A 1 56  ? -9.193  8.440  -14.073 1.00 62.14  ? 86  ARG A CA    1 
ATOM   393  C  C     . ARG A 1 56  ? -10.678 8.244  -14.343 1.00 62.07  ? 86  ARG A C     1 
ATOM   394  O  O     . ARG A 1 56  ? -11.406 7.770  -13.486 1.00 62.38  ? 86  ARG A O     1 
ATOM   395  C  CB    . ARG A 1 56  ? -8.915  9.823  -13.460 1.00 62.21  ? 86  ARG A CB    1 
ATOM   396  C  CG    . ARG A 1 56  ? -7.465  9.976  -13.014 1.00 62.37  ? 86  ARG A CG    1 
ATOM   397  C  CD    . ARG A 1 56  ? -7.149  11.268 -12.291 1.00 63.09  ? 86  ARG A CD    1 
ATOM   398  N  NE    . ARG A 1 56  ? -5.822  11.168 -11.664 1.00 65.40  ? 86  ARG A NE    1 
ATOM   399  C  CZ    . ARG A 1 56  ? -5.271  12.069 -10.844 1.00 66.51  ? 86  ARG A CZ    1 
ATOM   400  N  NH1   . ARG A 1 56  ? -5.914  13.183 -10.512 1.00 67.99  ? 86  ARG A NH1   1 
ATOM   401  N  NH2   . ARG A 1 56  ? -4.056  11.853 -10.341 1.00 66.25  ? 86  ARG A NH2   1 
ATOM   402  N  N     . ALA A 1 57  ? -11.111 8.575  -15.554 1.00 62.30  ? 87  ALA A N     1 
ATOM   403  C  CA    . ALA A 1 57  ? -12.492 8.372  -15.972 1.00 62.36  ? 87  ALA A CA    1 
ATOM   404  C  C     . ALA A 1 57  ? -12.859 6.890  -16.101 1.00 62.75  ? 87  ALA A C     1 
ATOM   405  O  O     . ALA A 1 57  ? -14.023 6.525  -15.954 1.00 62.98  ? 87  ALA A O     1 
ATOM   406  C  CB    . ALA A 1 57  ? -12.749 9.098  -17.283 1.00 62.23  ? 87  ALA A CB    1 
ATOM   407  N  N     . MET A 1 58  ? -11.869 6.042  -16.362 1.00 63.09  ? 88  MET A N     1 
ATOM   408  C  CA    . MET A 1 58  ? -12.104 4.610  -16.513 1.00 63.44  ? 88  MET A CA    1 
ATOM   409  C  C     . MET A 1 58  ? -12.487 3.924  -15.207 1.00 63.47  ? 88  MET A C     1 
ATOM   410  O  O     . MET A 1 58  ? -13.322 3.014  -15.210 1.00 63.58  ? 88  MET A O     1 
ATOM   411  C  CB    . MET A 1 58  ? -10.879 3.926  -17.105 1.00 63.37  ? 88  MET A CB    1 
ATOM   412  C  CG    . MET A 1 58  ? -10.530 4.427  -18.476 1.00 63.68  ? 88  MET A CG    1 
ATOM   413  S  SD    . MET A 1 58  ? -9.312  3.403  -19.276 1.00 64.52  ? 88  MET A SD    1 
ATOM   414  C  CE    . MET A 1 58  ? -10.331 2.002  -19.757 1.00 65.20  ? 88  MET A CE    1 
ATOM   415  N  N     . GLY A 1 59  ? -11.873 4.342  -14.104 1.00 63.38  ? 89  GLY A N     1 
ATOM   416  C  CA    . GLY A 1 59  ? -12.227 3.817  -12.788 1.00 63.40  ? 89  GLY A CA    1 
ATOM   417  C  C     . GLY A 1 59  ? -13.589 4.311  -12.330 1.00 63.50  ? 89  GLY A C     1 
ATOM   418  O  O     . GLY A 1 59  ? -14.344 3.581  -11.680 1.00 63.56  ? 89  GLY A O     1 
ATOM   419  N  N     . ARG A 1 60  ? -13.894 5.563  -12.655 1.00 63.68  ? 90  ARG A N     1 
ATOM   420  C  CA    . ARG A 1 60  ? -15.199 6.145  -12.352 1.00 63.83  ? 90  ARG A CA    1 
ATOM   421  C  C     . ARG A 1 60  ? -16.280 5.465  -13.190 1.00 63.75  ? 90  ARG A C     1 
ATOM   422  O  O     . ARG A 1 60  ? -17.266 4.966  -12.659 1.00 63.58  ? 90  ARG A O     1 
ATOM   423  C  CB    . ARG A 1 60  ? -15.209 7.660  -12.623 1.00 63.84  ? 90  ARG A CB    1 
ATOM   424  C  CG    . ARG A 1 60  ? -15.235 8.554  -11.384 1.00 64.28  ? 90  ARG A CG    1 
ATOM   425  C  CD    . ARG A 1 60  ? -15.933 9.899  -11.680 1.00 64.47  ? 90  ARG A CD    1 
ATOM   426  N  N     . LEU A 1 61  ? -16.073 5.445  -14.504 1.00 63.61  ? 91  LEU A N     1 
ATOM   427  C  CA    . LEU A 1 61  ? -17.055 4.903  -15.429 1.00 63.55  ? 91  LEU A CA    1 
ATOM   428  C  C     . LEU A 1 61  ? -17.052 3.390  -15.453 1.00 63.63  ? 91  LEU A C     1 
ATOM   429  O  O     . LEU A 1 61  ? -17.969 2.788  -16.004 1.00 63.81  ? 91  LEU A O     1 
ATOM   430  C  CB    . LEU A 1 61  ? -16.812 5.435  -16.841 1.00 63.50  ? 91  LEU A CB    1 
ATOM   431  C  CG    . LEU A 1 61  ? -16.981 6.946  -16.990 1.00 63.20  ? 91  LEU A CG    1 
ATOM   432  C  CD1   . LEU A 1 61  ? -16.502 7.398  -18.346 1.00 62.12  ? 91  LEU A CD1   1 
ATOM   433  C  CD2   . LEU A 1 61  ? -18.442 7.333  -16.760 1.00 62.26  ? 91  LEU A CD2   1 
ATOM   434  N  N     . LYS A 1 62  ? -16.020 2.783  -14.866 1.00 63.72  ? 92  LYS A N     1 
ATOM   435  C  CA    . LYS A 1 62  ? -15.897 1.326  -14.769 1.00 63.58  ? 92  LYS A CA    1 
ATOM   436  C  C     . LYS A 1 62  ? -15.702 0.711  -16.163 1.00 63.32  ? 92  LYS A C     1 
ATOM   437  O  O     . LYS A 1 62  ? -16.476 -0.128 -16.600 1.00 63.29  ? 92  LYS A O     1 
ATOM   438  C  CB    . LYS A 1 62  ? -17.111 0.707  -14.055 1.00 63.52  ? 92  LYS A CB    1 
ATOM   439  C  CG    . LYS A 1 62  ? -17.581 1.452  -12.807 1.00 63.87  ? 92  LYS A CG    1 
ATOM   440  C  CD    . LYS A 1 62  ? -16.940 0.969  -11.502 1.00 64.17  ? 92  LYS A CD    1 
ATOM   441  C  CE    . LYS A 1 62  ? -17.397 1.857  -10.325 1.00 63.89  ? 92  LYS A CE    1 
ATOM   442  N  NZ    . LYS A 1 62  ? -17.373 1.168  -9.006  1.00 63.78  ? 92  LYS A NZ    1 
ATOM   443  N  N     . ILE A 1 63  ? -14.661 1.157  -16.854 1.00 63.10  ? 93  ILE A N     1 
ATOM   444  C  CA    . ILE A 1 63  ? -14.294 0.608  -18.145 1.00 62.89  ? 93  ILE A CA    1 
ATOM   445  C  C     . ILE A 1 63  ? -12.985 -0.151 -18.017 1.00 63.29  ? 93  ILE A C     1 
ATOM   446  O  O     . ILE A 1 63  ? -12.004 0.370  -17.489 1.00 63.07  ? 93  ILE A O     1 
ATOM   447  C  CB    . ILE A 1 63  ? -14.126 1.714  -19.189 1.00 62.72  ? 93  ILE A CB    1 
ATOM   448  C  CG1   . ILE A 1 63  ? -15.485 2.373  -19.455 1.00 62.46  ? 93  ILE A CG1   1 
ATOM   449  C  CG2   . ILE A 1 63  ? -13.514 1.139  -20.462 1.00 61.73  ? 93  ILE A CG2   1 
ATOM   450  C  CD1   . ILE A 1 63  ? -15.433 3.682  -20.215 1.00 61.66  ? 93  ILE A CD1   1 
ATOM   451  N  N     . ASP A 1 64  ? -12.969 -1.383 -18.510 1.00 63.76  ? 94  ASP A N     1 
ATOM   452  C  CA    . ASP A 1 64  ? -11.757 -2.189 -18.482 1.00 64.19  ? 94  ASP A CA    1 
ATOM   453  C  C     . ASP A 1 64  ? -10.791 -1.804 -19.583 1.00 64.51  ? 94  ASP A C     1 
ATOM   454  O  O     . ASP A 1 64  ? -11.203 -1.318 -20.649 1.00 64.77  ? 94  ASP A O     1 
ATOM   455  C  CB    . ASP A 1 64  ? -12.104 -3.662 -18.643 1.00 64.40  ? 94  ASP A CB    1 
ATOM   456  C  CG    . ASP A 1 64  ? -13.031 -4.165 -17.557 1.00 64.49  ? 94  ASP A CG    1 
ATOM   457  O  OD1   . ASP A 1 64  ? -13.411 -3.373 -16.663 1.00 63.36  ? 94  ASP A OD1   1 
ATOM   458  O  OD2   . ASP A 1 64  ? -13.381 -5.360 -17.617 1.00 65.09  ? 94  ASP A OD2   1 
ATOM   459  N  N     . PHE A 1 65  ? -9.504  -2.018 -19.318 1.00 64.73  ? 95  PHE A N     1 
ATOM   460  C  CA    . PHE A 1 65  ? -8.495  -1.992 -20.370 1.00 64.92  ? 95  PHE A CA    1 
ATOM   461  C  C     . PHE A 1 65  ? -8.795  -3.179 -21.263 1.00 65.24  ? 95  PHE A C     1 
ATOM   462  O  O     . PHE A 1 65  ? -9.275  -4.203 -20.784 1.00 65.54  ? 95  PHE A O     1 
ATOM   463  C  CB    . PHE A 1 65  ? -7.074  -2.167 -19.809 1.00 64.89  ? 95  PHE A CB    1 
ATOM   464  C  CG    . PHE A 1 65  ? -6.641  -1.075 -18.875 1.00 64.55  ? 95  PHE A CG    1 
ATOM   465  C  CD1   . PHE A 1 65  ? -6.442  0.214  -19.338 1.00 64.80  ? 95  PHE A CD1   1 
ATOM   466  C  CD2   . PHE A 1 65  ? -6.413  -1.341 -17.541 1.00 64.02  ? 95  PHE A CD2   1 
ATOM   467  C  CE1   . PHE A 1 65  ? -6.042  1.220  -18.482 1.00 64.00  ? 95  PHE A CE1   1 
ATOM   468  C  CE2   . PHE A 1 65  ? -6.014  -0.343 -16.685 1.00 63.98  ? 95  PHE A CE2   1 
ATOM   469  C  CZ    . PHE A 1 65  ? -5.828  0.940  -17.157 1.00 64.24  ? 95  PHE A CZ    1 
ATOM   470  N  N     . GLY A 1 66  ? -8.520  -3.045 -22.556 1.00 65.68  ? 96  GLY A N     1 
ATOM   471  C  CA    . GLY A 1 66  ? -8.573  -4.185 -23.470 1.00 65.82  ? 96  GLY A CA    1 
ATOM   472  C  C     . GLY A 1 66  ? -7.530  -5.223 -23.089 1.00 66.06  ? 96  GLY A C     1 
ATOM   473  O  O     . GLY A 1 66  ? -7.782  -6.424 -23.190 1.00 66.44  ? 96  GLY A O     1 
ATOM   474  N  N     . ASP A 1 67  ? -6.369  -4.747 -22.637 1.00 66.21  ? 97  ASP A N     1 
ATOM   475  C  CA    . ASP A 1 67  ? -5.209  -5.578 -22.319 1.00 66.53  ? 97  ASP A CA    1 
ATOM   476  C  C     . ASP A 1 67  ? -4.831  -5.271 -20.865 1.00 66.47  ? 97  ASP A C     1 
ATOM   477  O  O     . ASP A 1 67  ? -4.486  -4.128 -20.534 1.00 66.60  ? 97  ASP A O     1 
ATOM   478  C  CB    . ASP A 1 67  ? -4.071  -5.215 -23.289 1.00 66.87  ? 97  ASP A CB    1 
ATOM   479  C  CG    . ASP A 1 67  ? -2.953  -6.253 -23.334 1.00 68.31  ? 97  ASP A CG    1 
ATOM   480  O  OD1   . ASP A 1 67  ? -2.518  -6.605 -24.456 1.00 69.97  ? 97  ASP A OD1   1 
ATOM   481  O  OD2   . ASP A 1 67  ? -2.487  -6.707 -22.265 1.00 70.91  ? 97  ASP A OD2   1 
ATOM   482  N  N     . SER A 1 68  ? -4.903  -6.271 -19.987 1.00 66.24  ? 98  SER A N     1 
ATOM   483  C  CA    . SER A 1 68  ? -4.796  -6.004 -18.539 1.00 66.12  ? 98  SER A CA    1 
ATOM   484  C  C     . SER A 1 68  ? -3.429  -5.475 -18.094 1.00 65.55  ? 98  SER A C     1 
ATOM   485  O  O     . SER A 1 68  ? -3.338  -4.876 -17.030 1.00 65.43  ? 98  SER A O     1 
ATOM   486  C  CB    . SER A 1 68  ? -5.189  -7.234 -17.693 1.00 66.41  ? 98  SER A CB    1 
ATOM   487  O  OG    . SER A 1 68  ? -4.079  -8.095 -17.426 1.00 67.01  ? 98  SER A OG    1 
ATOM   488  N  N     . ALA A 1 69  ? -2.380  -5.679 -18.892 1.00 65.14  ? 99  ALA A N     1 
ATOM   489  C  CA    . ALA A 1 69  ? -1.035  -5.142 -18.561 1.00 64.79  ? 99  ALA A CA    1 
ATOM   490  C  C     . ALA A 1 69  ? -0.934  -3.606 -18.614 1.00 64.30  ? 99  ALA A C     1 
ATOM   491  O  O     . ALA A 1 69  ? 0.061   -3.041 -18.160 1.00 64.28  ? 99  ALA A O     1 
ATOM   492  C  CB    . ALA A 1 69  ? 0.046   -5.775 -19.452 1.00 64.60  ? 99  ALA A CB    1 
ATOM   493  N  N     . ARG A 1 70  ? -1.958  -2.943 -19.158 1.00 63.80  ? 100 ARG A N     1 
ATOM   494  C  CA    . ARG A 1 70  ? -2.026  -1.474 -19.189 1.00 63.35  ? 100 ARG A CA    1 
ATOM   495  C  C     . ARG A 1 70  ? -2.195  -0.844 -17.803 1.00 63.25  ? 100 ARG A C     1 
ATOM   496  O  O     . ARG A 1 70  ? -1.714  0.260  -17.568 1.00 63.10  ? 100 ARG A O     1 
ATOM   497  C  CB    . ARG A 1 70  ? -3.165  -1.002 -20.108 1.00 63.27  ? 100 ARG A CB    1 
ATOM   498  C  CG    . ARG A 1 70  ? -3.031  -1.386 -21.582 1.00 62.39  ? 100 ARG A CG    1 
ATOM   499  C  CD    . ARG A 1 70  ? -1.915  -0.631 -22.263 1.00 61.29  ? 100 ARG A CD    1 
ATOM   500  N  NE    . ARG A 1 70  ? -0.613  -1.047 -21.749 1.00 60.64  ? 100 ARG A NE    1 
ATOM   501  C  CZ    . ARG A 1 70  ? 0.046   -2.133 -22.145 1.00 60.28  ? 100 ARG A CZ    1 
ATOM   502  N  NH1   . ARG A 1 70  ? -0.440  -2.934 -23.088 1.00 60.90  ? 100 ARG A NH1   1 
ATOM   503  N  NH2   . ARG A 1 70  ? 1.211   -2.420 -21.596 1.00 60.76  ? 100 ARG A NH2   1 
ATOM   504  N  N     . ALA A 1 71  ? -2.899  -1.530 -16.904 1.00 63.31  ? 101 ALA A N     1 
ATOM   505  C  CA    . ALA A 1 71  ? -2.949  -1.146 -15.490 1.00 63.52  ? 101 ALA A CA    1 
ATOM   506  C  C     . ALA A 1 71  ? -1.562  -0.759 -14.950 1.00 63.72  ? 101 ALA A C     1 
ATOM   507  O  O     . ALA A 1 71  ? -1.410  0.247  -14.265 1.00 63.99  ? 101 ALA A O     1 
ATOM   508  C  CB    . ALA A 1 71  ? -3.530  -2.282 -14.664 1.00 63.29  ? 101 ALA A CB    1 
ATOM   509  N  N     . ASP A 1 72  ? -0.551  -1.545 -15.287 1.00 63.80  ? 102 ASP A N     1 
ATOM   510  C  CA    . ASP A 1 72  ? 0.809   -1.279 -14.831 1.00 64.27  ? 102 ASP A CA    1 
ATOM   511  C  C     . ASP A 1 72  ? 1.425   -0.004 -15.426 1.00 64.22  ? 102 ASP A C     1 
ATOM   512  O  O     . ASP A 1 72  ? 2.230   0.668  -14.777 1.00 64.23  ? 102 ASP A O     1 
ATOM   513  C  CB    . ASP A 1 72  ? 1.706   -2.478 -15.148 1.00 64.60  ? 102 ASP A CB    1 
ATOM   514  C  CG    . ASP A 1 72  ? 2.715   -2.741 -14.064 1.00 65.86  ? 102 ASP A CG    1 
ATOM   515  O  OD1   . ASP A 1 72  ? 3.349   -1.767 -13.606 1.00 68.04  ? 102 ASP A OD1   1 
ATOM   516  O  OD2   . ASP A 1 72  ? 2.872   -3.919 -13.667 1.00 68.10  ? 102 ASP A OD2   1 
ATOM   517  N  N     . ASP A 1 73  ? 1.072   0.315  -16.668 1.00 64.13  ? 103 ASP A N     1 
ATOM   518  C  CA    . ASP A 1 73  ? 1.501   1.576  -17.268 1.00 63.91  ? 103 ASP A CA    1 
ATOM   519  C  C     . ASP A 1 73  ? 0.746   2.731  -16.613 1.00 63.98  ? 103 ASP A C     1 
ATOM   520  O  O     . ASP A 1 73  ? 1.346   3.736  -16.243 1.00 64.18  ? 103 ASP A O     1 
ATOM   521  C  CB    . ASP A 1 73  ? 1.275   1.576  -18.785 1.00 63.91  ? 103 ASP A CB    1 
ATOM   522  C  CG    . ASP A 1 73  ? 2.387   0.872  -19.552 1.00 63.49  ? 103 ASP A CG    1 
ATOM   523  O  OD1   . ASP A 1 73  ? 3.554   0.902  -19.109 1.00 63.59  ? 103 ASP A OD1   1 
ATOM   524  O  OD2   . ASP A 1 73  ? 2.097   0.307  -20.619 1.00 62.40  ? 103 ASP A OD2   1 
ATOM   525  N  N     . ALA A 1 74  ? -0.569  2.577  -16.469 1.00 63.95  ? 104 ALA A N     1 
ATOM   526  C  CA    . ALA A 1 74  ? -1.408  3.571  -15.798 1.00 63.76  ? 104 ALA A CA    1 
ATOM   527  C  C     . ALA A 1 74  ? -0.811  3.973  -14.451 1.00 63.48  ? 104 ALA A C     1 
ATOM   528  O  O     . ALA A 1 74  ? -0.694  5.160  -14.146 1.00 63.30  ? 104 ALA A O     1 
ATOM   529  C  CB    . ALA A 1 74  ? -2.822  3.031  -15.608 1.00 63.81  ? 104 ALA A CB    1 
ATOM   530  N  N     . ARG A 1 75  ? -0.433  2.980  -13.652 1.00 63.28  ? 105 ARG A N     1 
ATOM   531  C  CA    . ARG A 1 75  ? 0.219   3.229  -12.367 1.00 63.29  ? 105 ARG A CA    1 
ATOM   532  C  C     . ARG A 1 75  ? 1.406   4.163  -12.559 1.00 63.22  ? 105 ARG A C     1 
ATOM   533  O  O     . ARG A 1 75  ? 1.504   5.198  -11.898 1.00 62.99  ? 105 ARG A O     1 
ATOM   534  C  CB    . ARG A 1 75  ? 0.691   1.915  -11.761 1.00 63.36  ? 105 ARG A CB    1 
ATOM   535  C  CG    . ARG A 1 75  ? 1.460   2.027  -10.459 1.00 64.23  ? 105 ARG A CG    1 
ATOM   536  C  CD    . ARG A 1 75  ? 2.369   0.815  -10.290 1.00 66.15  ? 105 ARG A CD    1 
ATOM   537  N  NE    . ARG A 1 75  ? 3.664   0.984  -10.956 1.00 67.21  ? 105 ARG A NE    1 
ATOM   538  C  CZ    . ARG A 1 75  ? 4.462   -0.012 -11.363 1.00 68.20  ? 105 ARG A CZ    1 
ATOM   539  N  NH1   . ARG A 1 75  ? 5.621   0.267  -11.956 1.00 68.37  ? 105 ARG A NH1   1 
ATOM   540  N  NH2   . ARG A 1 75  ? 4.122   -1.289 -11.192 1.00 68.74  ? 105 ARG A NH2   1 
ATOM   541  N  N     . GLN A 1 76  ? 2.301   3.781  -13.471 1.00 63.37  ? 106 GLN A N     1 
ATOM   542  C  CA    . GLN A 1 76  ? 3.502   4.566  -13.772 1.00 63.53  ? 106 GLN A CA    1 
ATOM   543  C  C     . GLN A 1 76  ? 3.179   5.975  -14.258 1.00 63.42  ? 106 GLN A C     1 
ATOM   544  O  O     . GLN A 1 76  ? 3.789   6.947  -13.818 1.00 63.63  ? 106 GLN A O     1 
ATOM   545  C  CB    . GLN A 1 76  ? 4.376   3.854  -14.810 1.00 63.79  ? 106 GLN A CB    1 
ATOM   546  C  CG    . GLN A 1 76  ? 5.400   2.905  -14.218 1.00 64.58  ? 106 GLN A CG    1 
ATOM   547  C  CD    . GLN A 1 76  ? 6.417   2.454  -15.241 1.00 65.94  ? 106 GLN A CD    1 
ATOM   548  O  OE1   . GLN A 1 76  ? 7.567   2.896  -15.229 1.00 68.12  ? 106 GLN A OE1   1 
ATOM   549  N  NE2   . GLN A 1 76  ? 5.995   1.580  -16.147 1.00 66.69  ? 106 GLN A NE2   1 
ATOM   550  N  N     . LEU A 1 77  ? 2.230   6.085  -15.176 1.00 63.30  ? 107 LEU A N     1 
ATOM   551  C  CA    . LEU A 1 77  ? 1.746   7.390  -15.600 1.00 63.21  ? 107 LEU A CA    1 
ATOM   552  C  C     . LEU A 1 77  ? 1.505   8.292  -14.387 1.00 63.29  ? 107 LEU A C     1 
ATOM   553  O  O     . LEU A 1 77  ? 2.176   9.304  -14.238 1.00 63.44  ? 107 LEU A O     1 
ATOM   554  C  CB    . LEU A 1 77  ? 0.461   7.241  -16.417 1.00 63.10  ? 107 LEU A CB    1 
ATOM   555  C  CG    . LEU A 1 77  ? -0.287  8.513  -16.778 1.00 62.36  ? 107 LEU A CG    1 
ATOM   556  C  CD1   . LEU A 1 77  ? 0.564   9.342  -17.725 1.00 62.54  ? 107 LEU A CD1   1 
ATOM   557  C  CD2   . LEU A 1 77  ? -1.614  8.152  -17.392 1.00 61.33  ? 107 LEU A CD2   1 
ATOM   558  N  N     . PHE A 1 78  ? 0.570   7.905  -13.518 1.00 63.54  ? 108 PHE A N     1 
ATOM   559  C  CA    . PHE A 1 78  ? 0.210   8.713  -12.347 1.00 63.47  ? 108 PHE A CA    1 
ATOM   560  C  C     . PHE A 1 78  ? 1.440   9.147  -11.561 1.00 63.59  ? 108 PHE A C     1 
ATOM   561  O  O     . PHE A 1 78  ? 1.560   10.307 -11.185 1.00 63.68  ? 108 PHE A O     1 
ATOM   562  C  CB    . PHE A 1 78  ? -0.710  7.950  -11.395 1.00 63.54  ? 108 PHE A CB    1 
ATOM   563  C  CG    . PHE A 1 78  ? -2.065  7.625  -11.956 1.00 63.35  ? 108 PHE A CG    1 
ATOM   564  C  CD1   . PHE A 1 78  ? -2.860  8.603  -12.511 1.00 64.38  ? 108 PHE A CD1   1 
ATOM   565  C  CD2   . PHE A 1 78  ? -2.567  6.339  -11.871 1.00 63.58  ? 108 PHE A CD2   1 
ATOM   566  C  CE1   . PHE A 1 78  ? -4.119  8.294  -13.017 1.00 64.76  ? 108 PHE A CE1   1 
ATOM   567  C  CE2   . PHE A 1 78  ? -3.822  6.027  -12.361 1.00 63.95  ? 108 PHE A CE2   1 
ATOM   568  C  CZ    . PHE A 1 78  ? -4.599  7.003  -12.934 1.00 64.21  ? 108 PHE A CZ    1 
ATOM   569  N  N     . VAL A 1 79  ? 2.348   8.212  -11.315 1.00 63.87  ? 109 VAL A N     1 
ATOM   570  C  CA    . VAL A 1 79  ? 3.549   8.491  -10.529 1.00 64.15  ? 109 VAL A CA    1 
ATOM   571  C  C     . VAL A 1 79  ? 4.535   9.412  -11.268 1.00 64.68  ? 109 VAL A C     1 
ATOM   572  O  O     . VAL A 1 79  ? 5.100   10.329 -10.669 1.00 64.96  ? 109 VAL A O     1 
ATOM   573  C  CB    . VAL A 1 79  ? 4.285   7.189  -10.136 1.00 64.07  ? 109 VAL A CB    1 
ATOM   574  C  CG1   . VAL A 1 79  ? 5.596   7.509  -9.410  1.00 63.64  ? 109 VAL A CG1   1 
ATOM   575  C  CG2   . VAL A 1 79  ? 3.388   6.299  -9.283  1.00 63.47  ? 109 VAL A CG2   1 
ATOM   576  N  N     . LEU A 1 80  ? 4.753   9.166  -12.558 1.00 65.09  ? 110 LEU A N     1 
ATOM   577  C  CA    . LEU A 1 80  ? 5.730   9.944  -13.322 1.00 65.25  ? 110 LEU A CA    1 
ATOM   578  C  C     . LEU A 1 80  ? 5.331   11.413 -13.417 1.00 65.51  ? 110 LEU A C     1 
ATOM   579  O  O     . LEU A 1 80  ? 6.186   12.291 -13.297 1.00 65.65  ? 110 LEU A O     1 
ATOM   580  C  CB    . LEU A 1 80  ? 5.922   9.361  -14.719 1.00 65.24  ? 110 LEU A CB    1 
ATOM   581  C  CG    . LEU A 1 80  ? 6.655   8.030  -14.801 1.00 64.90  ? 110 LEU A CG    1 
ATOM   582  C  CD1   . LEU A 1 80  ? 6.607   7.522  -16.238 1.00 64.49  ? 110 LEU A CD1   1 
ATOM   583  C  CD2   . LEU A 1 80  ? 8.089   8.166  -14.296 1.00 64.11  ? 110 LEU A CD2   1 
ATOM   584  N  N     . ALA A 1 81  ? 4.038   11.671 -13.628 1.00 65.66  ? 111 ALA A N     1 
ATOM   585  C  CA    . ALA A 1 81  ? 3.497   13.036 -13.581 1.00 65.82  ? 111 ALA A CA    1 
ATOM   586  C  C     . ALA A 1 81  ? 3.068   13.432 -12.158 1.00 65.96  ? 111 ALA A C     1 
ATOM   587  O  O     . ALA A 1 81  ? 3.888   13.785 -11.306 1.00 65.76  ? 111 ALA A O     1 
ATOM   588  C  CB    . ALA A 1 81  ? 2.320   13.159 -14.529 1.00 65.82  ? 111 ALA A CB    1 
ATOM   589  N  N     . MET A 1 89  ? 9.002   15.447 -20.270 1.00 64.79  ? 119 MET A N     1 
ATOM   590  C  CA    . MET A 1 89  ? 8.916   14.238 -21.086 1.00 64.98  ? 119 MET A CA    1 
ATOM   591  C  C     . MET A 1 89  ? 10.219  13.445 -21.149 1.00 64.68  ? 119 MET A C     1 
ATOM   592  O  O     . MET A 1 89  ? 11.303  14.014 -21.176 1.00 64.90  ? 119 MET A O     1 
ATOM   593  C  CB    . MET A 1 89  ? 8.496   14.578 -22.514 1.00 65.18  ? 119 MET A CB    1 
ATOM   594  C  CG    . MET A 1 89  ? 8.145   13.361 -23.360 1.00 65.89  ? 119 MET A CG    1 
ATOM   595  S  SD    . MET A 1 89  ? 6.760   12.407 -22.675 1.00 68.37  ? 119 MET A SD    1 
ATOM   596  C  CE    . MET A 1 89  ? 5.337   13.294 -23.313 1.00 67.75  ? 119 MET A CE    1 
ATOM   597  N  N     . THR A 1 90  ? 10.082  12.124 -21.189 1.00 64.31  ? 120 THR A N     1 
ATOM   598  C  CA    . THR A 1 90  ? 11.202  11.187 -21.256 1.00 63.85  ? 120 THR A CA    1 
ATOM   599  C  C     . THR A 1 90  ? 10.729  9.998  -22.081 1.00 63.82  ? 120 THR A C     1 
ATOM   600  O  O     . THR A 1 90  ? 9.526   9.874  -22.348 1.00 63.66  ? 120 THR A O     1 
ATOM   601  C  CB    . THR A 1 90  ? 11.603  10.678 -19.858 1.00 63.62  ? 120 THR A CB    1 
ATOM   602  O  OG1   . THR A 1 90  ? 10.514  9.953  -19.270 1.00 63.28  ? 120 THR A OG1   1 
ATOM   603  C  CG2   . THR A 1 90  ? 11.961  11.823 -18.955 1.00 63.51  ? 120 THR A CG2   1 
ATOM   604  N  N     . ALA A 1 91  ? 11.652  9.122  -22.474 1.00 63.60  ? 121 ALA A N     1 
ATOM   605  C  CA    . ALA A 1 91  ? 11.282  7.923  -23.244 1.00 63.54  ? 121 ALA A CA    1 
ATOM   606  C  C     . ALA A 1 91  ? 10.262  7.050  -22.483 1.00 63.42  ? 121 ALA A C     1 
ATOM   607  O  O     . ALA A 1 91  ? 9.224   6.659  -23.042 1.00 63.44  ? 121 ALA A O     1 
ATOM   608  C  CB    . ALA A 1 91  ? 12.525  7.112  -23.613 1.00 63.30  ? 121 ALA A CB    1 
ATOM   609  N  N     . GLU A 1 92  ? 10.552  6.789  -21.205 1.00 63.02  ? 122 GLU A N     1 
ATOM   610  C  CA    . GLU A 1 92  ? 9.724   5.923  -20.360 1.00 62.91  ? 122 GLU A CA    1 
ATOM   611  C  C     . GLU A 1 92  ? 8.270   6.374  -20.372 1.00 62.33  ? 122 GLU A C     1 
ATOM   612  O  O     . GLU A 1 92  ? 7.369   5.582  -20.644 1.00 62.31  ? 122 GLU A O     1 
ATOM   613  C  CB    . GLU A 1 92  ? 10.259  5.906  -18.920 1.00 62.94  ? 122 GLU A CB    1 
ATOM   614  C  CG    . GLU A 1 92  ? 9.812   4.708  -18.076 1.00 63.41  ? 122 GLU A CG    1 
ATOM   615  C  CD    . GLU A 1 92  ? 10.525  4.635  -16.717 1.00 63.87  ? 122 GLU A CD    1 
ATOM   616  O  OE1   . GLU A 1 92  ? 10.173  5.420  -15.802 1.00 64.96  ? 122 GLU A OE1   1 
ATOM   617  O  OE2   . GLU A 1 92  ? 11.433  3.780  -16.564 1.00 64.82  ? 122 GLU A OE2   1 
ATOM   618  N  N     . LEU A 1 93  ? 8.058   7.654  -20.097 1.00 61.87  ? 123 LEU A N     1 
ATOM   619  C  CA    . LEU A 1 93  ? 6.716   8.224  -20.032 1.00 61.46  ? 123 LEU A CA    1 
ATOM   620  C  C     . LEU A 1 93  ? 6.026   8.157  -21.387 1.00 61.05  ? 123 LEU A C     1 
ATOM   621  O  O     . LEU A 1 93  ? 4.863   7.771  -21.472 1.00 61.18  ? 123 LEU A O     1 
ATOM   622  C  CB    . LEU A 1 93  ? 6.783   9.670  -19.525 1.00 61.59  ? 123 LEU A CB    1 
ATOM   623  C  CG    . LEU A 1 93  ? 5.486   10.484 -19.448 1.00 61.73  ? 123 LEU A CG    1 
ATOM   624  C  CD1   . LEU A 1 93  ? 4.422   9.801  -18.582 1.00 61.47  ? 123 LEU A CD1   1 
ATOM   625  C  CD2   . LEU A 1 93  ? 5.787   11.884 -18.939 1.00 61.13  ? 123 LEU A CD2   1 
ATOM   626  N  N     . ALA A 1 94  ? 6.754   8.513  -22.443 1.00 60.65  ? 124 ALA A N     1 
ATOM   627  C  CA    . ALA A 1 94  ? 6.231   8.465  -23.813 1.00 60.23  ? 124 ALA A CA    1 
ATOM   628  C  C     . ALA A 1 94  ? 5.705   7.074  -24.141 1.00 60.11  ? 124 ALA A C     1 
ATOM   629  O  O     . ALA A 1 94  ? 4.552   6.918  -24.550 1.00 59.75  ? 124 ALA A O     1 
ATOM   630  C  CB    . ALA A 1 94  ? 7.316   8.865  -24.806 1.00 60.08  ? 124 ALA A CB    1 
ATOM   631  N  N     . GLY A 1 95  ? 6.564   6.068  -23.951 1.00 59.97  ? 125 GLY A N     1 
ATOM   632  C  CA    . GLY A 1 95  ? 6.184   4.668  -24.158 1.00 59.80  ? 125 GLY A CA    1 
ATOM   633  C  C     . GLY A 1 95  ? 4.915   4.264  -23.411 1.00 59.55  ? 125 GLY A C     1 
ATOM   634  O  O     . GLY A 1 95  ? 4.015   3.646  -23.988 1.00 59.32  ? 125 GLY A O     1 
ATOM   635  N  N     . VAL A 1 96  ? 4.880   4.602  -22.120 1.00 59.17  ? 126 VAL A N     1 
ATOM   636  C  CA    . VAL A 1 96  ? 3.710   4.438  -21.255 1.00 58.78  ? 126 VAL A CA    1 
ATOM   637  C  C     . VAL A 1 96  ? 2.477   5.071  -21.873 1.00 58.53  ? 126 VAL A C     1 
ATOM   638  O  O     . VAL A 1 96  ? 1.435   4.430  -22.009 1.00 58.20  ? 126 VAL A O     1 
ATOM   639  C  CB    . VAL A 1 96  ? 3.941   5.112  -19.864 1.00 58.72  ? 126 VAL A CB    1 
ATOM   640  C  CG1   . VAL A 1 96  ? 2.612   5.495  -19.204 1.00 58.48  ? 126 VAL A CG1   1 
ATOM   641  C  CG2   . VAL A 1 96  ? 4.759   4.218  -18.960 1.00 57.75  ? 126 VAL A CG2   1 
ATOM   642  N  N     . ILE A 1 97  ? 2.617   6.341  -22.235 1.00 58.28  ? 127 ILE A N     1 
ATOM   643  C  CA    . ILE A 1 97  ? 1.509   7.130  -22.757 1.00 58.06  ? 127 ILE A CA    1 
ATOM   644  C  C     . ILE A 1 97  ? 1.009   6.571  -24.080 1.00 57.95  ? 127 ILE A C     1 
ATOM   645  O  O     . ILE A 1 97  ? -0.198  6.509  -24.329 1.00 57.98  ? 127 ILE A O     1 
ATOM   646  C  CB    . ILE A 1 97  ? 1.930   8.601  -22.965 1.00 57.89  ? 127 ILE A CB    1 
ATOM   647  C  CG1   . ILE A 1 97  ? 2.067   9.306  -21.610 1.00 57.32  ? 127 ILE A CG1   1 
ATOM   648  C  CG2   . ILE A 1 97  ? 0.914   9.322  -23.842 1.00 58.23  ? 127 ILE A CG2   1 
ATOM   649  C  CD1   . ILE A 1 97  ? 2.789   10.634 -21.664 1.00 54.93  ? 127 ILE A CD1   1 
ATOM   650  N  N     . LYS A 1 98  ? 1.943   6.183  -24.936 1.00 57.80  ? 128 LYS A N     1 
ATOM   651  C  CA    . LYS A 1 98  ? 1.588   5.658  -26.237 1.00 57.76  ? 128 LYS A CA    1 
ATOM   652  C  C     . LYS A 1 98  ? 0.772   4.387  -26.057 1.00 57.58  ? 128 LYS A C     1 
ATOM   653  O  O     . LYS A 1 98  ? -0.326  4.241  -26.602 1.00 56.98  ? 128 LYS A O     1 
ATOM   654  C  CB    . LYS A 1 98  ? 2.849   5.370  -27.043 1.00 57.80  ? 128 LYS A CB    1 
ATOM   655  C  CG    . LYS A 1 98  ? 2.569   4.839  -28.433 1.00 58.24  ? 128 LYS A CG    1 
ATOM   656  C  CD    . LYS A 1 98  ? 3.538   5.421  -29.465 1.00 58.78  ? 128 LYS A CD    1 
ATOM   657  C  CE    . LYS A 1 98  ? 3.131   5.052  -30.887 1.00 58.15  ? 128 LYS A CE    1 
ATOM   658  N  NZ    . LYS A 1 98  ? 3.410   6.168  -31.811 1.00 57.45  ? 128 LYS A NZ    1 
ATOM   659  N  N     . ARG A 1 99  ? 1.320   3.482  -25.254 1.00 57.70  ? 129 ARG A N     1 
ATOM   660  C  CA    . ARG A 1 99  ? 0.710   2.183  -25.044 1.00 57.62  ? 129 ARG A CA    1 
ATOM   661  C  C     . ARG A 1 99  ? -0.694  2.333  -24.491 1.00 57.57  ? 129 ARG A C     1 
ATOM   662  O  O     . ARG A 1 99  ? -1.599  1.678  -24.967 1.00 57.49  ? 129 ARG A O     1 
ATOM   663  C  CB    . ARG A 1 99  ? 1.594   1.300  -24.158 1.00 57.33  ? 129 ARG A CB    1 
ATOM   664  C  CG    . ARG A 1 99  ? 2.792   0.739  -24.902 1.00 56.88  ? 129 ARG A CG    1 
ATOM   665  C  CD    . ARG A 1 99  ? 3.490   -0.359 -24.117 1.00 57.23  ? 129 ARG A CD    1 
ATOM   666  N  NE    . ARG A 1 99  ? 3.945   0.102  -22.814 1.00 57.10  ? 129 ARG A NE    1 
ATOM   667  C  CZ    . ARG A 1 99  ? 5.019   0.867  -22.621 1.00 58.78  ? 129 ARG A CZ    1 
ATOM   668  N  NH1   . ARG A 1 99  ? 5.344   1.246  -21.392 1.00 58.79  ? 129 ARG A NH1   1 
ATOM   669  N  NH2   . ARG A 1 99  ? 5.793   1.242  -23.641 1.00 59.96  ? 129 ARG A NH2   1 
ATOM   670  N  N     . LEU A 1 100 ? -0.865  3.223  -23.522 1.00 58.02  ? 130 LEU A N     1 
ATOM   671  C  CA    . LEU A 1 100 ? -2.185  3.565  -22.997 1.00 58.56  ? 130 LEU A CA    1 
ATOM   672  C  C     . LEU A 1 100 ? -3.138  4.060  -24.073 1.00 59.04  ? 130 LEU A C     1 
ATOM   673  O  O     . LEU A 1 100 ? -4.245  3.572  -24.195 1.00 59.05  ? 130 LEU A O     1 
ATOM   674  C  CB    . LEU A 1 100 ? -2.068  4.607  -21.886 1.00 58.57  ? 130 LEU A CB    1 
ATOM   675  C  CG    . LEU A 1 100 ? -1.515  4.021  -20.579 1.00 59.07  ? 130 LEU A CG    1 
ATOM   676  C  CD1   . LEU A 1 100 ? -1.088  5.107  -19.609 1.00 58.33  ? 130 LEU A CD1   1 
ATOM   677  C  CD2   . LEU A 1 100 ? -2.537  3.091  -19.931 1.00 59.32  ? 130 LEU A CD2   1 
ATOM   678  N  N     . TRP A 1 101 ? -2.690  5.011  -24.873 1.00 60.08  ? 131 TRP A N     1 
ATOM   679  C  CA    . TRP A 1 101 ? -3.529  5.594  -25.929 1.00 60.65  ? 131 TRP A CA    1 
ATOM   680  C  C     . TRP A 1 101 ? -4.005  4.531  -26.937 1.00 60.88  ? 131 TRP A C     1 
ATOM   681  O  O     . TRP A 1 101 ? -5.184  4.496  -27.287 1.00 61.46  ? 131 TRP A O     1 
ATOM   682  C  CB    . TRP A 1 101 ? -2.757  6.736  -26.612 1.00 60.91  ? 131 TRP A CB    1 
ATOM   683  C  CG    . TRP A 1 101 ? -3.490  7.551  -27.667 1.00 61.00  ? 131 TRP A CG    1 
ATOM   684  C  CD1   . TRP A 1 101 ? -3.039  7.822  -28.920 1.00 61.37  ? 131 TRP A CD1   1 
ATOM   685  C  CD2   . TRP A 1 101 ? -4.747  8.243  -27.539 1.00 61.37  ? 131 TRP A CD2   1 
ATOM   686  N  NE1   . TRP A 1 101 ? -3.937  8.611  -29.592 1.00 61.60  ? 131 TRP A NE1   1 
ATOM   687  C  CE2   . TRP A 1 101 ? -4.998  8.882  -28.773 1.00 61.50  ? 131 TRP A CE2   1 
ATOM   688  C  CE3   . TRP A 1 101 ? -5.693  8.369  -26.513 1.00 61.89  ? 131 TRP A CE3   1 
ATOM   689  C  CZ2   . TRP A 1 101 ? -6.159  9.629  -29.017 1.00 61.28  ? 131 TRP A CZ2   1 
ATOM   690  C  CZ3   . TRP A 1 101 ? -6.853  9.120  -26.758 1.00 61.44  ? 131 TRP A CZ3   1 
ATOM   691  C  CH2   . TRP A 1 101 ? -7.071  9.735  -28.001 1.00 61.05  ? 131 TRP A CH2   1 
ATOM   692  N  N     . LYS A 1 102 ? -3.115  3.648  -27.378 1.00 60.86  ? 132 LYS A N     1 
ATOM   693  C  CA    . LYS A 1 102 ? -3.494  2.633  -28.365 1.00 60.80  ? 132 LYS A CA    1 
ATOM   694  C  C     . LYS A 1 102 ? -4.494  1.589  -27.810 1.00 61.03  ? 132 LYS A C     1 
ATOM   695  O  O     . LYS A 1 102 ? -5.228  0.958  -28.594 1.00 60.88  ? 132 LYS A O     1 
ATOM   696  C  CB    . LYS A 1 102 ? -2.249  1.946  -28.945 1.00 60.65  ? 132 LYS A CB    1 
ATOM   697  C  CG    . LYS A 1 102 ? -1.357  2.866  -29.767 1.00 60.22  ? 132 LYS A CG    1 
ATOM   698  N  N     . ASP A 1 103 ? -4.538  1.425  -26.481 1.00 60.97  ? 133 ASP A N     1 
ATOM   699  C  CA    . ASP A 1 103 ? -5.426  0.442  -25.846 1.00 61.14  ? 133 ASP A CA    1 
ATOM   700  C  C     . ASP A 1 103 ? -6.899  0.705  -26.130 1.00 61.16  ? 133 ASP A C     1 
ATOM   701  O  O     . ASP A 1 103 ? -7.352  1.841  -26.077 1.00 60.89  ? 133 ASP A O     1 
ATOM   702  C  CB    . ASP A 1 103 ? -5.226  0.397  -24.325 1.00 61.24  ? 133 ASP A CB    1 
ATOM   703  C  CG    . ASP A 1 103 ? -6.007  -0.755 -23.660 1.00 61.44  ? 133 ASP A CG    1 
ATOM   704  O  OD1   . ASP A 1 103 ? -5.533  -1.926 -23.684 1.00 61.17  ? 133 ASP A OD1   1 
ATOM   705  O  OD2   . ASP A 1 103 ? -7.093  -0.485 -23.113 1.00 60.03  ? 133 ASP A OD2   1 
ATOM   706  N  N     . SER A 1 104 ? -7.633  -0.373 -26.393 1.00 61.52  ? 134 SER A N     1 
ATOM   707  C  CA    . SER A 1 104 ? -9.031  -0.311 -26.821 1.00 61.79  ? 134 SER A CA    1 
ATOM   708  C  C     . SER A 1 104 ? -9.985  0.121  -25.703 1.00 62.06  ? 134 SER A C     1 
ATOM   709  O  O     . SER A 1 104 ? -11.010 0.756  -25.959 1.00 62.13  ? 134 SER A O     1 
ATOM   710  C  CB    . SER A 1 104 ? -9.474  -1.667 -27.378 1.00 61.70  ? 134 SER A CB    1 
ATOM   711  O  OG    . SER A 1 104 ? -9.729  -2.592 -26.332 1.00 61.96  ? 134 SER A OG    1 
ATOM   712  N  N     . GLY A 1 105 ? -9.660  -0.243 -24.470 1.00 62.25  ? 135 GLY A N     1 
ATOM   713  C  CA    . GLY A 1 105 ? -10.399 0.261  -23.317 1.00 62.45  ? 135 GLY A CA    1 
ATOM   714  C  C     . GLY A 1 105 ? -10.174 1.756  -23.139 1.00 62.46  ? 135 GLY A C     1 
ATOM   715  O  O     . GLY A 1 105 ? -11.105 2.502  -22.861 1.00 63.22  ? 135 GLY A O     1 
ATOM   716  N  N     . VAL A 1 106 ? -8.936  2.201  -23.307 1.00 62.20  ? 136 VAL A N     1 
ATOM   717  C  CA    . VAL A 1 106 ? -8.628  3.627  -23.245 1.00 61.93  ? 136 VAL A CA    1 
ATOM   718  C  C     . VAL A 1 106 ? -9.426  4.377  -24.306 1.00 61.99  ? 136 VAL A C     1 
ATOM   719  O  O     . VAL A 1 106 ? -9.921  5.467  -24.061 1.00 62.30  ? 136 VAL A O     1 
ATOM   720  C  CB    . VAL A 1 106 ? -7.110  3.895  -23.429 1.00 61.60  ? 136 VAL A CB    1 
ATOM   721  C  CG1   . VAL A 1 106 ? -6.807  5.373  -23.382 1.00 60.04  ? 136 VAL A CG1   1 
ATOM   722  C  CG2   . VAL A 1 106 ? -6.317  3.160  -22.351 1.00 61.72  ? 136 VAL A CG2   1 
ATOM   723  N  N     . GLN A 1 107 ? -9.569  3.776  -25.478 1.00 62.00  ? 137 GLN A N     1 
ATOM   724  C  CA    . GLN A 1 107 ? -10.223 4.438  -26.588 1.00 61.91  ? 137 GLN A CA    1 
ATOM   725  C  C     . GLN A 1 107 ? -11.733 4.468  -26.419 1.00 62.07  ? 137 GLN A C     1 
ATOM   726  O  O     . GLN A 1 107 ? -12.387 5.407  -26.863 1.00 62.09  ? 137 GLN A O     1 
ATOM   727  C  CB    . GLN A 1 107 ? -9.824  3.771  -27.895 1.00 61.65  ? 137 GLN A CB    1 
ATOM   728  C  CG    . GLN A 1 107 ? -8.420  4.143  -28.324 1.00 61.91  ? 137 GLN A CG    1 
ATOM   729  C  CD    . GLN A 1 107 ? -8.311  5.599  -28.750 1.00 62.28  ? 137 GLN A CD    1 
ATOM   730  O  OE1   . GLN A 1 107 ? -9.197  6.118  -29.444 1.00 62.95  ? 137 GLN A OE1   1 
ATOM   731  N  NE2   . GLN A 1 107 ? -7.231  6.269  -28.337 1.00 60.09  ? 137 GLN A NE2   1 
ATOM   732  N  N     . ALA A 1 108 ? -12.277 3.445  -25.767 1.00 62.29  ? 138 ALA A N     1 
ATOM   733  C  CA    . ALA A 1 108 ? -13.697 3.402  -25.435 1.00 62.43  ? 138 ALA A CA    1 
ATOM   734  C  C     . ALA A 1 108 ? -14.025 4.534  -24.471 1.00 62.73  ? 138 ALA A C     1 
ATOM   735  O  O     . ALA A 1 108 ? -15.077 5.165  -24.576 1.00 62.60  ? 138 ALA A O     1 
ATOM   736  C  CB    . ALA A 1 108 ? -14.048 2.063  -24.814 1.00 62.46  ? 138 ALA A CB    1 
ATOM   737  N  N     . CYS A 1 109 ? -13.098 4.793  -23.547 1.00 62.94  ? 139 CYS A N     1 
ATOM   738  C  CA    . CYS A 1 109 ? -13.218 5.896  -22.592 1.00 63.29  ? 139 CYS A CA    1 
ATOM   739  C  C     . CYS A 1 109 ? -13.067 7.270  -23.261 1.00 64.07  ? 139 CYS A C     1 
ATOM   740  O  O     . CYS A 1 109 ? -13.846 8.203  -22.977 1.00 64.74  ? 139 CYS A O     1 
ATOM   741  C  CB    . CYS A 1 109 ? -12.179 5.745  -21.496 1.00 63.12  ? 139 CYS A CB    1 
ATOM   742  S  SG    . CYS A 1 109 ? -12.497 6.750  -20.074 1.00 61.94  ? 139 CYS A SG    1 
ATOM   743  N  N     . PHE A 1 110 ? -12.086 7.392  -24.153 1.00 64.21  ? 140 PHE A N     1 
ATOM   744  C  CA    . PHE A 1 110 ? -11.907 8.616  -24.938 1.00 64.57  ? 140 PHE A CA    1 
ATOM   745  C  C     . PHE A 1 110 ? -13.151 8.946  -25.772 1.00 64.73  ? 140 PHE A C     1 
ATOM   746  O  O     . PHE A 1 110 ? -13.524 10.105 -25.889 1.00 64.66  ? 140 PHE A O     1 
ATOM   747  C  CB    . PHE A 1 110 ? -10.665 8.498  -25.840 1.00 64.71  ? 140 PHE A CB    1 
ATOM   748  C  CG    . PHE A 1 110 ? -10.611 9.516  -26.945 1.00 64.75  ? 140 PHE A CG    1 
ATOM   749  C  CD1   . PHE A 1 110 ? -10.313 10.842 -26.674 1.00 65.32  ? 140 PHE A CD1   1 
ATOM   750  C  CD2   . PHE A 1 110 ? -10.855 9.147  -28.260 1.00 64.92  ? 140 PHE A CD2   1 
ATOM   751  C  CE1   . PHE A 1 110 ? -10.259 11.786 -27.702 1.00 65.54  ? 140 PHE A CE1   1 
ATOM   752  C  CE2   . PHE A 1 110 ? -10.804 10.089 -29.287 1.00 65.45  ? 140 PHE A CE2   1 
ATOM   753  C  CZ    . PHE A 1 110 ? -10.505 11.407 -29.007 1.00 64.93  ? 140 PHE A CZ    1 
ATOM   754  N  N     . ASN A 1 111 ? -13.786 7.924  -26.342 1.00 65.03  ? 141 ASN A N     1 
ATOM   755  C  CA    . ASN A 1 111 ? -15.020 8.110  -27.106 1.00 65.28  ? 141 ASN A CA    1 
ATOM   756  C  C     . ASN A 1 111 ? -16.246 8.405  -26.221 1.00 65.49  ? 141 ASN A C     1 
ATOM   757  O  O     . ASN A 1 111 ? -17.338 8.636  -26.734 1.00 65.49  ? 141 ASN A O     1 
ATOM   758  C  CB    . ASN A 1 111 ? -15.287 6.888  -27.993 1.00 65.26  ? 141 ASN A CB    1 
ATOM   759  C  CG    . ASN A 1 111 ? -14.246 6.727  -29.104 1.00 65.54  ? 141 ASN A CG    1 
ATOM   760  O  OD1   . ASN A 1 111 ? -13.744 7.712  -29.652 1.00 65.54  ? 141 ASN A OD1   1 
ATOM   761  N  ND2   . ASN A 1 111 ? -13.926 5.480  -29.443 1.00 64.71  ? 141 ASN A ND2   1 
ATOM   762  N  N     . ARG A 1 112 ? -16.067 8.395  -24.899 1.00 65.61  ? 142 ARG A N     1 
ATOM   763  C  CA    . ARG A 1 112 ? -17.116 8.836  -23.965 1.00 65.65  ? 142 ARG A CA    1 
ATOM   764  C  C     . ARG A 1 112 ? -16.715 10.089 -23.165 1.00 65.52  ? 142 ARG A C     1 
ATOM   765  O  O     . ARG A 1 112 ? -17.294 10.366 -22.111 1.00 65.36  ? 142 ARG A O     1 
ATOM   766  C  CB    . ARG A 1 112 ? -17.471 7.707  -22.996 1.00 65.65  ? 142 ARG A CB    1 
ATOM   767  C  CG    . ARG A 1 112 ? -18.311 6.616  -23.601 1.00 65.42  ? 142 ARG A CG    1 
ATOM   768  C  CD    . ARG A 1 112 ? -18.347 5.392  -22.707 1.00 65.08  ? 142 ARG A CD    1 
ATOM   769  N  NE    . ARG A 1 112 ? -19.055 5.617  -21.444 1.00 65.10  ? 142 ARG A NE    1 
ATOM   770  C  CZ    . ARG A 1 112 ? -19.235 4.681  -20.512 1.00 64.83  ? 142 ARG A CZ    1 
ATOM   771  N  NH1   . ARG A 1 112 ? -18.748 3.458  -20.680 1.00 64.53  ? 142 ARG A NH1   1 
ATOM   772  N  NH2   . ARG A 1 112 ? -19.892 4.970  -19.395 1.00 65.01  ? 142 ARG A NH2   1 
ATOM   773  N  N     . SER A 1 113 ? -15.762 10.865 -23.679 1.00 65.32  ? 143 SER A N     1 
ATOM   774  C  CA    . SER A 1 113 ? -15.258 12.039 -22.960 1.00 65.35  ? 143 SER A CA    1 
ATOM   775  C  C     . SER A 1 113 ? -16.329 13.039 -22.503 1.00 65.37  ? 143 SER A C     1 
ATOM   776  O  O     . SER A 1 113 ? -16.100 13.788 -21.558 1.00 65.33  ? 143 SER A O     1 
ATOM   777  C  CB    . SER A 1 113 ? -14.190 12.759 -23.782 1.00 65.23  ? 143 SER A CB    1 
ATOM   778  O  OG    . SER A 1 113 ? -14.743 13.285 -24.965 1.00 65.57  ? 143 SER A OG    1 
ATOM   779  N  N     . ARG A 1 114 ? -17.495 13.041 -23.137 1.00 65.32  ? 144 ARG A N     1 
ATOM   780  C  CA    . ARG A 1 114 ? -18.555 13.953 -22.720 1.00 65.65  ? 144 ARG A CA    1 
ATOM   781  C  C     . ARG A 1 114 ? -19.001 13.775 -21.262 1.00 65.67  ? 144 ARG A C     1 
ATOM   782  O  O     . ARG A 1 114 ? -19.657 14.663 -20.701 1.00 66.05  ? 144 ARG A O     1 
ATOM   783  C  CB    . ARG A 1 114 ? -19.782 13.828 -23.629 1.00 65.81  ? 144 ARG A CB    1 
ATOM   784  C  CG    . ARG A 1 114 ? -20.758 12.720 -23.258 1.00 65.98  ? 144 ARG A CG    1 
ATOM   785  C  CD    . ARG A 1 114 ? -22.077 12.934 -23.963 1.00 67.53  ? 144 ARG A CD    1 
ATOM   786  N  NE    . ARG A 1 114 ? -23.104 12.001 -23.501 1.00 68.89  ? 144 ARG A NE    1 
ATOM   787  C  CZ    . ARG A 1 114 ? -24.145 12.303 -22.723 1.00 69.30  ? 144 ARG A CZ    1 
ATOM   788  N  NH1   . ARG A 1 114 ? -25.004 11.344 -22.380 1.00 69.47  ? 144 ARG A NH1   1 
ATOM   789  N  NH2   . ARG A 1 114 ? -24.354 13.545 -22.296 1.00 69.90  ? 144 ARG A NH2   1 
ATOM   790  N  N     . GLU A 1 115 ? -18.683 12.633 -20.660 1.00 65.34  ? 145 GLU A N     1 
ATOM   791  C  CA    . GLU A 1 115 ? -19.135 12.344 -19.302 1.00 65.31  ? 145 GLU A CA    1 
ATOM   792  C  C     . GLU A 1 115 ? -18.103 12.759 -18.270 1.00 65.06  ? 145 GLU A C     1 
ATOM   793  O  O     . GLU A 1 115 ? -18.289 12.544 -17.083 1.00 65.38  ? 145 GLU A O     1 
ATOM   794  C  CB    . GLU A 1 115 ? -19.431 10.856 -19.145 1.00 65.50  ? 145 GLU A CB    1 
ATOM   795  C  CG    . GLU A 1 115 ? -20.438 10.313 -20.136 1.00 65.73  ? 145 GLU A CG    1 
ATOM   796  C  CD    . GLU A 1 115 ? -20.477 8.809  -20.143 1.00 65.80  ? 145 GLU A CD    1 
ATOM   797  O  OE1   . GLU A 1 115 ? -20.426 8.217  -19.049 1.00 65.46  ? 145 GLU A OE1   1 
ATOM   798  O  OE2   . GLU A 1 115 ? -20.566 8.223  -21.245 1.00 67.47  ? 145 GLU A OE2   1 
ATOM   799  N  N     . TYR A 1 116 ? -17.000 13.328 -18.725 1.00 64.77  ? 146 TYR A N     1 
ATOM   800  C  CA    . TYR A 1 116 ? -15.998 13.865 -17.831 1.00 64.30  ? 146 TYR A CA    1 
ATOM   801  C  C     . TYR A 1 116 ? -15.368 15.074 -18.517 1.00 64.13  ? 146 TYR A C     1 
ATOM   802  O  O     . TYR A 1 116 ? -15.937 15.585 -19.471 1.00 63.85  ? 146 TYR A O     1 
ATOM   803  C  CB    . TYR A 1 116 ? -14.995 12.773 -17.434 1.00 64.15  ? 146 TYR A CB    1 
ATOM   804  C  CG    . TYR A 1 116 ? -14.261 12.071 -18.569 1.00 64.45  ? 146 TYR A CG    1 
ATOM   805  C  CD1   . TYR A 1 116 ? -14.823 10.972 -19.220 1.00 64.25  ? 146 TYR A CD1   1 
ATOM   806  C  CD2   . TYR A 1 116 ? -12.980 12.476 -18.956 1.00 64.46  ? 146 TYR A CD2   1 
ATOM   807  C  CE1   . TYR A 1 116 ? -14.142 10.310 -20.238 1.00 63.84  ? 146 TYR A CE1   1 
ATOM   808  C  CE2   . TYR A 1 116 ? -12.296 11.827 -19.975 1.00 64.63  ? 146 TYR A CE2   1 
ATOM   809  C  CZ    . TYR A 1 116 ? -12.878 10.743 -20.617 1.00 64.32  ? 146 TYR A CZ    1 
ATOM   810  O  OH    . TYR A 1 116 ? -12.194 10.102 -21.634 1.00 63.49  ? 146 TYR A OH    1 
ATOM   811  N  N     . GLN A 1 117 ? -14.227 15.549 -18.025 1.00 64.16  ? 147 GLN A N     1 
ATOM   812  C  CA    . GLN A 1 117 ? -13.609 16.764 -18.548 1.00 64.19  ? 147 GLN A CA    1 
ATOM   813  C  C     . GLN A 1 117 ? -12.276 16.410 -19.204 1.00 64.65  ? 147 GLN A C     1 
ATOM   814  O  O     . GLN A 1 117 ? -11.332 15.992 -18.531 1.00 65.09  ? 147 GLN A O     1 
ATOM   815  C  CB    . GLN A 1 117 ? -13.414 17.799 -17.426 1.00 63.81  ? 147 GLN A CB    1 
ATOM   816  C  CG    . GLN A 1 117 ? -14.712 18.241 -16.728 1.00 63.13  ? 147 GLN A CG    1 
ATOM   817  C  CD    . GLN A 1 117 ? -15.564 19.205 -17.562 1.00 62.89  ? 147 GLN A CD    1 
ATOM   818  O  OE1   . GLN A 1 117 ? -15.032 20.108 -18.199 1.00 63.75  ? 147 GLN A OE1   1 
ATOM   819  N  NE2   . GLN A 1 117 ? -16.890 19.028 -17.538 1.00 59.92  ? 147 GLN A NE2   1 
ATOM   820  N  N     . LEU A 1 118 ? -12.218 16.577 -20.522 1.00 64.98  ? 148 LEU A N     1 
ATOM   821  C  CA    . LEU A 1 118 ? -11.025 16.304 -21.310 1.00 65.20  ? 148 LEU A CA    1 
ATOM   822  C  C     . LEU A 1 118 ? -10.690 17.494 -22.212 1.00 65.49  ? 148 LEU A C     1 
ATOM   823  O  O     . LEU A 1 118 ? -11.535 17.953 -22.964 1.00 65.62  ? 148 LEU A O     1 
ATOM   824  C  CB    . LEU A 1 118 ? -11.268 15.065 -22.175 1.00 65.08  ? 148 LEU A CB    1 
ATOM   825  C  CG    . LEU A 1 118 ? -10.130 14.551 -23.067 1.00 65.24  ? 148 LEU A CG    1 
ATOM   826  C  CD1   . LEU A 1 118 ? -8.875  14.161 -22.279 1.00 63.61  ? 148 LEU A CD1   1 
ATOM   827  C  CD2   . LEU A 1 118 ? -10.637 13.380 -23.920 1.00 65.30  ? 148 LEU A CD2   1 
ATOM   828  N  N     . ASN A 1 119 ? -9.454  17.978 -22.135 1.00 65.94  ? 149 ASN A N     1 
ATOM   829  C  CA    . ASN A 1 119 ? -8.925  18.952 -23.088 1.00 66.10  ? 149 ASN A CA    1 
ATOM   830  C  C     . ASN A 1 119 ? -9.243  18.592 -24.539 1.00 66.62  ? 149 ASN A C     1 
ATOM   831  O  O     . ASN A 1 119 ? -9.086  17.435 -24.947 1.00 66.54  ? 149 ASN A O     1 
ATOM   832  C  CB    . ASN A 1 119 ? -7.411  19.028 -22.951 1.00 66.16  ? 149 ASN A CB    1 
ATOM   833  C  CG    . ASN A 1 119 ? -6.973  19.563 -21.609 1.00 66.68  ? 149 ASN A CG    1 
ATOM   834  O  OD1   . ASN A 1 119 ? -7.676  20.375 -20.983 1.00 67.00  ? 149 ASN A OD1   1 
ATOM   835  N  ND2   . ASN A 1 119 ? -5.802  19.118 -21.155 1.00 65.03  ? 149 ASN A ND2   1 
ATOM   836  N  N     . ASP A 1 120 ? -9.662  19.584 -25.328 1.00 66.88  ? 150 ASP A N     1 
ATOM   837  C  CA    . ASP A 1 120 ? -10.029 19.320 -26.713 1.00 67.13  ? 150 ASP A CA    1 
ATOM   838  C  C     . ASP A 1 120 ? -8.833  18.948 -27.565 1.00 66.63  ? 150 ASP A C     1 
ATOM   839  O  O     . ASP A 1 120 ? -8.990  18.217 -28.534 1.00 67.34  ? 150 ASP A O     1 
ATOM   840  C  CB    . ASP A 1 120 ? -10.785 20.502 -27.333 1.00 67.75  ? 150 ASP A CB    1 
ATOM   841  C  CG    . ASP A 1 120 ? -12.264 20.533 -26.931 1.00 69.36  ? 150 ASP A CG    1 
ATOM   842  O  OD1   . ASP A 1 120 ? -12.818 19.464 -26.582 1.00 70.31  ? 150 ASP A OD1   1 
ATOM   843  O  OD2   . ASP A 1 120 ? -12.869 21.631 -26.960 1.00 71.41  ? 150 ASP A OD2   1 
ATOM   844  N  N     . SER A 1 121 ? -7.647  19.426 -27.206 1.00 65.89  ? 151 SER A N     1 
ATOM   845  C  CA    . SER A 1 121 ? -6.437  19.117 -27.964 1.00 65.65  ? 151 SER A CA    1 
ATOM   846  C  C     . SER A 1 121 ? -5.873  17.708 -27.688 1.00 65.26  ? 151 SER A C     1 
ATOM   847  O  O     . SER A 1 121 ? -4.907  17.297 -28.316 1.00 65.38  ? 151 SER A O     1 
ATOM   848  C  CB    . SER A 1 121 ? -5.357  20.176 -27.696 1.00 65.72  ? 151 SER A CB    1 
ATOM   849  O  OG    . SER A 1 121 ? -5.767  21.447 -28.180 1.00 65.98  ? 151 SER A OG    1 
ATOM   850  N  N     . ALA A 1 122 ? -6.466  16.968 -26.759 1.00 64.72  ? 152 ALA A N     1 
ATOM   851  C  CA    . ALA A 1 122 ? -5.997  15.627 -26.443 1.00 64.28  ? 152 ALA A CA    1 
ATOM   852  C  C     . ALA A 1 122 ? -5.681  14.818 -27.708 1.00 64.12  ? 152 ALA A C     1 
ATOM   853  O  O     . ALA A 1 122 ? -4.517  14.510 -27.982 1.00 64.23  ? 152 ALA A O     1 
ATOM   854  C  CB    . ALA A 1 122 ? -7.024  14.908 -25.591 1.00 64.07  ? 152 ALA A CB    1 
ATOM   855  N  N     . ALA A 1 123 ? -6.709  14.489 -28.487 1.00 63.63  ? 153 ALA A N     1 
ATOM   856  C  CA    . ALA A 1 123 ? -6.514  13.733 -29.727 1.00 63.37  ? 153 ALA A CA    1 
ATOM   857  C  C     . ALA A 1 123 ? -5.345  14.258 -30.573 1.00 63.15  ? 153 ALA A C     1 
ATOM   858  O  O     . ALA A 1 123 ? -4.546  13.482 -31.085 1.00 63.21  ? 153 ALA A O     1 
ATOM   859  C  CB    . ALA A 1 123 ? -7.787  13.734 -30.547 1.00 63.36  ? 153 ALA A CB    1 
ATOM   860  N  N     . TYR A 1 124 ? -5.242  15.574 -30.704 1.00 62.97  ? 154 TYR A N     1 
ATOM   861  C  CA    . TYR A 1 124 ? -4.206  16.186 -31.545 1.00 62.86  ? 154 TYR A CA    1 
ATOM   862  C  C     . TYR A 1 124 ? -2.789  15.870 -31.042 1.00 62.60  ? 154 TYR A C     1 
ATOM   863  O  O     . TYR A 1 124 ? -1.916  15.461 -31.821 1.00 62.99  ? 154 TYR A O     1 
ATOM   864  C  CB    . TYR A 1 124 ? -4.433  17.702 -31.664 1.00 62.76  ? 154 TYR A CB    1 
ATOM   865  C  CG    . TYR A 1 124 ? -3.330  18.451 -32.373 1.00 63.02  ? 154 TYR A CG    1 
ATOM   866  C  CD1   . TYR A 1 124 ? -3.370  18.673 -33.752 1.00 62.90  ? 154 TYR A CD1   1 
ATOM   867  C  CD2   . TYR A 1 124 ? -2.246  18.947 -31.662 1.00 62.91  ? 154 TYR A CD2   1 
ATOM   868  C  CE1   . TYR A 1 124 ? -2.344  19.358 -34.388 1.00 61.89  ? 154 TYR A CE1   1 
ATOM   869  C  CE2   . TYR A 1 124 ? -1.229  19.624 -32.290 1.00 62.62  ? 154 TYR A CE2   1 
ATOM   870  C  CZ    . TYR A 1 124 ? -1.282  19.828 -33.640 1.00 61.84  ? 154 TYR A CZ    1 
ATOM   871  O  OH    . TYR A 1 124 ? -0.249  20.500 -34.221 1.00 62.33  ? 154 TYR A OH    1 
ATOM   872  N  N     . TYR A 1 125 ? -2.569  16.037 -29.747 1.00 61.94  ? 155 TYR A N     1 
ATOM   873  C  CA    . TYR A 1 125 ? -1.256  15.785 -29.168 1.00 61.75  ? 155 TYR A CA    1 
ATOM   874  C  C     . TYR A 1 125 ? -0.944  14.286 -29.075 1.00 61.78  ? 155 TYR A C     1 
ATOM   875  O  O     . TYR A 1 125 ? 0.137   13.841 -29.475 1.00 61.93  ? 155 TYR A O     1 
ATOM   876  C  CB    . TYR A 1 125 ? -1.147  16.448 -27.785 1.00 61.52  ? 155 TYR A CB    1 
ATOM   877  C  CG    . TYR A 1 125 ? -1.042  17.959 -27.836 1.00 61.12  ? 155 TYR A CG    1 
ATOM   878  C  CD1   . TYR A 1 125 ? -0.057  18.587 -28.618 1.00 60.39  ? 155 TYR A CD1   1 
ATOM   879  C  CD2   . TYR A 1 125 ? -1.915  18.762 -27.112 1.00 60.89  ? 155 TYR A CD2   1 
ATOM   880  C  CE1   . TYR A 1 125 ? 0.051   19.961 -28.677 1.00 59.98  ? 155 TYR A CE1   1 
ATOM   881  C  CE2   . TYR A 1 125 ? -1.813  20.158 -27.161 1.00 61.90  ? 155 TYR A CE2   1 
ATOM   882  C  CZ    . TYR A 1 125 ? -0.820  20.751 -27.946 1.00 61.52  ? 155 TYR A CZ    1 
ATOM   883  O  OH    . TYR A 1 125 ? -0.710  22.132 -28.001 1.00 61.12  ? 155 TYR A OH    1 
ATOM   884  N  N     . LEU A 1 126 ? -1.898  13.518 -28.556 1.00 61.71  ? 156 LEU A N     1 
ATOM   885  C  CA    . LEU A 1 126 ? -1.723  12.086 -28.355 1.00 61.50  ? 156 LEU A CA    1 
ATOM   886  C  C     . LEU A 1 126 ? -1.493  11.339 -29.674 1.00 61.78  ? 156 LEU A C     1 
ATOM   887  O  O     . LEU A 1 126 ? -0.611  10.478 -29.758 1.00 61.77  ? 156 LEU A O     1 
ATOM   888  C  CB    . LEU A 1 126 ? -2.921  11.516 -27.593 1.00 61.29  ? 156 LEU A CB    1 
ATOM   889  C  CG    . LEU A 1 126 ? -2.961  11.933 -26.120 1.00 60.22  ? 156 LEU A CG    1 
ATOM   890  C  CD1   . LEU A 1 126 ? -4.291  11.595 -25.460 1.00 58.62  ? 156 LEU A CD1   1 
ATOM   891  C  CD2   . LEU A 1 126 ? -1.819  11.287 -25.362 1.00 58.32  ? 156 LEU A CD2   1 
ATOM   892  N  N     . ASN A 1 127 ? -2.261  11.689 -30.706 1.00 61.97  ? 157 ASN A N     1 
ATOM   893  C  CA    . ASN A 1 127 ? -2.032  11.137 -32.045 1.00 62.06  ? 157 ASN A CA    1 
ATOM   894  C  C     . ASN A 1 127 ? -0.702  11.527 -32.669 1.00 62.27  ? 157 ASN A C     1 
ATOM   895  O  O     . ASN A 1 127 ? -0.337  10.965 -33.688 1.00 62.05  ? 157 ASN A O     1 
ATOM   896  C  CB    . ASN A 1 127 ? -3.153  11.528 -32.999 1.00 61.79  ? 157 ASN A CB    1 
ATOM   897  C  CG    . ASN A 1 127 ? -4.410  10.773 -32.730 1.00 62.11  ? 157 ASN A CG    1 
ATOM   898  O  OD1   . ASN A 1 127 ? -4.370  9.703  -32.140 1.00 62.98  ? 157 ASN A OD1   1 
ATOM   899  N  ND2   . ASN A 1 127 ? -5.545  11.316 -33.154 1.00 62.34  ? 157 ASN A ND2   1 
ATOM   900  N  N     . ASP A 1 128 ? 0.003   12.486 -32.071 1.00 62.75  ? 158 ASP A N     1 
ATOM   901  C  CA    . ASP A 1 128 ? 1.275   12.960 -32.593 1.00 63.36  ? 158 ASP A CA    1 
ATOM   902  C  C     . ASP A 1 128 ? 2.425   12.719 -31.637 1.00 63.58  ? 158 ASP A C     1 
ATOM   903  O  O     . ASP A 1 128 ? 3.488   13.319 -31.783 1.00 63.32  ? 158 ASP A O     1 
ATOM   904  C  CB    . ASP A 1 128 ? 1.181   14.446 -32.927 1.00 63.70  ? 158 ASP A CB    1 
ATOM   905  C  CG    . ASP A 1 128 ? 0.597   14.689 -34.296 1.00 64.79  ? 158 ASP A CG    1 
ATOM   906  O  OD1   . ASP A 1 128 ? -0.477  14.108 -34.590 1.00 67.47  ? 158 ASP A OD1   1 
ATOM   907  O  OD2   . ASP A 1 128 ? 1.219   15.444 -35.076 1.00 64.45  ? 158 ASP A OD2   1 
ATOM   908  N  N     . LEU A 1 129 ? 2.219   11.817 -30.684 1.00 64.02  ? 159 LEU A N     1 
ATOM   909  C  CA    . LEU A 1 129 ? 3.255   11.468 -29.716 1.00 64.47  ? 159 LEU A CA    1 
ATOM   910  C  C     . LEU A 1 129 ? 4.651   11.220 -30.319 1.00 64.53  ? 159 LEU A C     1 
ATOM   911  O  O     . LEU A 1 129 ? 5.641   11.669 -29.752 1.00 64.79  ? 159 LEU A O     1 
ATOM   912  C  CB    . LEU A 1 129 ? 2.825   10.272 -28.853 1.00 64.28  ? 159 LEU A CB    1 
ATOM   913  C  CG    . LEU A 1 129 ? 2.728   10.570 -27.351 1.00 64.90  ? 159 LEU A CG    1 
ATOM   914  C  CD1   . LEU A 1 129 ? 1.576   11.505 -27.032 1.00 64.31  ? 159 LEU A CD1   1 
ATOM   915  C  CD2   . LEU A 1 129 ? 2.591   9.276  -26.555 1.00 65.16  ? 159 LEU A CD2   1 
ATOM   916  N  N     . ASP A 1 130 ? 4.739   10.536 -31.453 1.00 64.66  ? 160 ASP A N     1 
ATOM   917  C  CA    . ASP A 1 130 ? 6.052   10.223 -32.046 1.00 65.19  ? 160 ASP A CA    1 
ATOM   918  C  C     . ASP A 1 130 ? 6.936   11.448 -32.276 1.00 65.00  ? 160 ASP A C     1 
ATOM   919  O  O     . ASP A 1 130 ? 8.140   11.443 -31.986 1.00 65.02  ? 160 ASP A O     1 
ATOM   920  C  CB    . ASP A 1 130 ? 5.884   9.499  -33.381 1.00 65.51  ? 160 ASP A CB    1 
ATOM   921  C  CG    . ASP A 1 130 ? 5.482   8.060  -33.205 1.00 66.87  ? 160 ASP A CG    1 
ATOM   922  O  OD1   . ASP A 1 130 ? 6.315   7.277  -32.688 1.00 68.72  ? 160 ASP A OD1   1 
ATOM   923  O  OD2   . ASP A 1 130 ? 4.336   7.717  -33.579 1.00 68.41  ? 160 ASP A OD2   1 
ATOM   924  N  N     . ARG A 1 131 ? 6.322   12.484 -32.824 1.00 64.75  ? 161 ARG A N     1 
ATOM   925  C  CA    . ARG A 1 131 ? 6.994   13.736 -33.101 1.00 64.46  ? 161 ARG A CA    1 
ATOM   926  C  C     . ARG A 1 131 ? 7.316   14.476 -31.802 1.00 64.22  ? 161 ARG A C     1 
ATOM   927  O  O     . ARG A 1 131 ? 8.432   14.954 -31.615 1.00 63.88  ? 161 ARG A O     1 
ATOM   928  C  CB    . ARG A 1 131 ? 6.079   14.585 -33.982 1.00 64.52  ? 161 ARG A CB    1 
ATOM   929  C  CG    . ARG A 1 131 ? 6.729   15.792 -34.611 1.00 64.52  ? 161 ARG A CG    1 
ATOM   930  C  CD    . ARG A 1 131 ? 5.842   16.333 -35.712 1.00 64.45  ? 161 ARG A CD    1 
ATOM   931  N  NE    . ARG A 1 131 ? 4.500   16.683 -35.244 1.00 64.21  ? 161 ARG A NE    1 
ATOM   932  C  CZ    . ARG A 1 131 ? 4.188   17.822 -34.624 1.00 64.84  ? 161 ARG A CZ    1 
ATOM   933  N  NH1   . ARG A 1 131 ? 5.119   18.736 -34.359 1.00 66.76  ? 161 ARG A NH1   1 
ATOM   934  N  NH2   . ARG A 1 131 ? 2.941   18.052 -34.253 1.00 64.17  ? 161 ARG A NH2   1 
ATOM   935  N  N     . ILE A 1 132 ? 6.324   14.540 -30.913 1.00 63.99  ? 162 ILE A N     1 
ATOM   936  C  CA    . ILE A 1 132 ? 6.383   15.327 -29.675 1.00 63.93  ? 162 ILE A CA    1 
ATOM   937  C  C     . ILE A 1 132 ? 7.449   14.778 -28.725 1.00 63.98  ? 162 ILE A C     1 
ATOM   938  O  O     . ILE A 1 132 ? 8.234   15.526 -28.136 1.00 63.61  ? 162 ILE A O     1 
ATOM   939  C  CB    . ILE A 1 132 ? 5.005   15.299 -28.942 1.00 63.79  ? 162 ILE A CB    1 
ATOM   940  C  CG1   . ILE A 1 132 ? 3.876   15.838 -29.825 1.00 63.71  ? 162 ILE A CG1   1 
ATOM   941  C  CG2   . ILE A 1 132 ? 5.047   16.100 -27.674 1.00 63.50  ? 162 ILE A CG2   1 
ATOM   942  C  CD1   . ILE A 1 132 ? 3.943   17.295 -30.098 1.00 63.43  ? 162 ILE A CD1   1 
ATOM   943  N  N     . ALA A 1 133 ? 7.456   13.458 -28.593 1.00 64.21  ? 163 ALA A N     1 
ATOM   944  C  CA    . ALA A 1 133 ? 8.354   12.754 -27.700 1.00 64.51  ? 163 ALA A CA    1 
ATOM   945  C  C     . ALA A 1 133 ? 9.825   12.813 -28.116 1.00 64.73  ? 163 ALA A C     1 
ATOM   946  O  O     . ALA A 1 133 ? 10.704  12.506 -27.314 1.00 64.90  ? 163 ALA A O     1 
ATOM   947  C  CB    . ALA A 1 133 ? 7.917   11.304 -27.586 1.00 64.67  ? 163 ALA A CB    1 
ATOM   948  N  N     . GLN A 1 134 ? 10.103  13.187 -29.359 1.00 64.87  ? 164 GLN A N     1 
ATOM   949  C  CA    . GLN A 1 134 ? 11.487  13.344 -29.805 1.00 65.02  ? 164 GLN A CA    1 
ATOM   950  C  C     . GLN A 1 134 ? 12.253  14.283 -28.869 1.00 65.10  ? 164 GLN A C     1 
ATOM   951  O  O     . GLN A 1 134 ? 11.677  15.249 -28.368 1.00 65.06  ? 164 GLN A O     1 
ATOM   952  C  CB    . GLN A 1 134 ? 11.537  13.914 -31.224 1.00 65.14  ? 164 GLN A CB    1 
ATOM   953  C  CG    . GLN A 1 134 ? 10.990  12.996 -32.287 1.00 65.59  ? 164 GLN A CG    1 
ATOM   954  C  CD    . GLN A 1 134 ? 11.888  11.817 -32.529 1.00 66.88  ? 164 GLN A CD    1 
ATOM   955  O  OE1   . GLN A 1 134 ? 12.816  11.895 -33.337 1.00 68.94  ? 164 GLN A OE1   1 
ATOM   956  N  NE2   . GLN A 1 134 ? 11.631  10.711 -31.825 1.00 66.50  ? 164 GLN A NE2   1 
ATOM   957  N  N     . PRO A 1 135 ? 13.551  13.999 -28.623 1.00 65.16  ? 165 PRO A N     1 
ATOM   958  C  CA    . PRO A 1 135 ? 14.380  14.908 -27.818 1.00 65.05  ? 165 PRO A CA    1 
ATOM   959  C  C     . PRO A 1 135 ? 14.538  16.289 -28.446 1.00 64.92  ? 165 PRO A C     1 
ATOM   960  O  O     . PRO A 1 135 ? 14.327  17.296 -27.763 1.00 65.22  ? 165 PRO A O     1 
ATOM   961  C  CB    . PRO A 1 135 ? 15.741  14.200 -27.753 1.00 65.13  ? 165 PRO A CB    1 
ATOM   962  C  CG    . PRO A 1 135 ? 15.733  13.218 -28.881 1.00 65.31  ? 165 PRO A CG    1 
ATOM   963  C  CD    . PRO A 1 135 ? 14.306  12.811 -29.067 1.00 65.19  ? 165 PRO A CD    1 
ATOM   964  N  N     . ASN A 1 136 ? 14.888  16.339 -29.731 1.00 64.54  ? 166 ASN A N     1 
ATOM   965  C  CA    . ASN A 1 136 ? 15.094  17.615 -30.423 1.00 64.34  ? 166 ASN A CA    1 
ATOM   966  C  C     . ASN A 1 136 ? 13.789  18.189 -30.996 1.00 63.87  ? 166 ASN A C     1 
ATOM   967  O  O     . ASN A 1 136 ? 13.753  18.688 -32.116 1.00 63.97  ? 166 ASN A O     1 
ATOM   968  C  CB    . ASN A 1 136 ? 16.169  17.458 -31.503 1.00 64.42  ? 166 ASN A CB    1 
ATOM   969  C  CG    . ASN A 1 136 ? 17.598  17.493 -30.922 1.00 65.66  ? 166 ASN A CG    1 
ATOM   970  O  OD1   . ASN A 1 136 ? 18.077  18.553 -30.509 1.00 66.84  ? 166 ASN A OD1   1 
ATOM   971  N  ND2   . ASN A 1 136 ? 18.280  16.339 -30.906 1.00 65.67  ? 166 ASN A ND2   1 
ATOM   972  N  N     . TYR A 1 137 ? 12.728  18.138 -30.198 1.00 63.18  ? 167 TYR A N     1 
ATOM   973  C  CA    . TYR A 1 137 ? 11.394  18.520 -30.642 1.00 62.75  ? 167 TYR A CA    1 
ATOM   974  C  C     . TYR A 1 137 ? 11.170  20.009 -30.421 1.00 62.44  ? 167 TYR A C     1 
ATOM   975  O  O     . TYR A 1 137 ? 11.442  20.536 -29.343 1.00 62.40  ? 167 TYR A O     1 
ATOM   976  C  CB    . TYR A 1 137 ? 10.317  17.704 -29.902 1.00 62.50  ? 167 TYR A CB    1 
ATOM   977  C  CG    . TYR A 1 137 ? 8.953   18.367 -29.853 1.00 62.14  ? 167 TYR A CG    1 
ATOM   978  C  CD1   . TYR A 1 137 ? 8.166   18.479 -30.997 1.00 62.06  ? 167 TYR A CD1   1 
ATOM   979  C  CD2   . TYR A 1 137 ? 8.454   18.890 -28.667 1.00 61.42  ? 167 TYR A CD2   1 
ATOM   980  C  CE1   . TYR A 1 137 ? 6.910   19.103 -30.958 1.00 61.46  ? 167 TYR A CE1   1 
ATOM   981  C  CE2   . TYR A 1 137 ? 7.206   19.508 -28.616 1.00 61.37  ? 167 TYR A CE2   1 
ATOM   982  C  CZ    . TYR A 1 137 ? 6.436   19.614 -29.761 1.00 61.41  ? 167 TYR A CZ    1 
ATOM   983  O  OH    . TYR A 1 137 ? 5.193   20.227 -29.704 1.00 61.43  ? 167 TYR A OH    1 
ATOM   984  N  N     . ILE A 1 138 ? 10.679  20.681 -31.454 1.00 61.95  ? 168 ILE A N     1 
ATOM   985  C  CA    . ILE A 1 138 ? 10.334  22.089 -31.359 1.00 61.65  ? 168 ILE A CA    1 
ATOM   986  C  C     . ILE A 1 138 ? 8.894   22.216 -31.801 1.00 61.29  ? 168 ILE A C     1 
ATOM   987  O  O     . ILE A 1 138 ? 8.569   21.820 -32.915 1.00 61.46  ? 168 ILE A O     1 
ATOM   988  C  CB    . ILE A 1 138 ? 11.204  22.966 -32.277 1.00 61.60  ? 168 ILE A CB    1 
ATOM   989  C  CG1   . ILE A 1 138 ? 12.686  22.743 -31.995 1.00 61.33  ? 168 ILE A CG1   1 
ATOM   990  C  CG2   . ILE A 1 138 ? 10.863  24.438 -32.082 1.00 61.63  ? 168 ILE A CG2   1 
ATOM   991  C  CD1   . ILE A 1 138 ? 13.567  23.626 -32.806 1.00 61.46  ? 168 ILE A CD1   1 
ATOM   992  N  N     . PRO A 1 139 ? 8.019   22.737 -30.927 1.00 60.81  ? 169 PRO A N     1 
ATOM   993  C  CA    . PRO A 1 139 ? 6.618   22.926 -31.328 1.00 60.77  ? 169 PRO A CA    1 
ATOM   994  C  C     . PRO A 1 139 ? 6.449   23.678 -32.643 1.00 60.46  ? 169 PRO A C     1 
ATOM   995  O  O     . PRO A 1 139 ? 7.290   24.500 -33.006 1.00 60.42  ? 169 PRO A O     1 
ATOM   996  C  CB    . PRO A 1 139 ? 6.021   23.730 -30.166 1.00 60.77  ? 169 PRO A CB    1 
ATOM   997  C  CG    . PRO A 1 139 ? 6.865   23.356 -28.994 1.00 61.04  ? 169 PRO A CG    1 
ATOM   998  C  CD    . PRO A 1 139 ? 8.250   23.127 -29.525 1.00 60.57  ? 169 PRO A CD    1 
ATOM   999  N  N     . THR A 1 140 ? 5.378   23.356 -33.354 1.00 60.20  ? 170 THR A N     1 
ATOM   1000 C  CA    . THR A 1 140 ? 4.995   24.070 -34.559 1.00 60.06  ? 170 THR A CA    1 
ATOM   1001 C  C     . THR A 1 140 ? 4.035   25.185 -34.157 1.00 60.19  ? 170 THR A C     1 
ATOM   1002 O  O     . THR A 1 140 ? 3.584   25.243 -33.010 1.00 60.42  ? 170 THR A O     1 
ATOM   1003 C  CB    . THR A 1 140 ? 4.311   23.127 -35.577 1.00 60.17  ? 170 THR A CB    1 
ATOM   1004 O  OG1   . THR A 1 140 ? 3.046   22.659 -35.059 1.00 59.74  ? 170 THR A OG1   1 
ATOM   1005 C  CG2   . THR A 1 140 ? 5.217   21.936 -35.888 1.00 59.39  ? 170 THR A CG2   1 
ATOM   1006 N  N     . GLN A 1 141 ? 3.722   26.070 -35.096 1.00 60.12  ? 171 GLN A N     1 
ATOM   1007 C  CA    . GLN A 1 141 ? 2.764   27.143 -34.842 1.00 59.97  ? 171 GLN A CA    1 
ATOM   1008 C  C     . GLN A 1 141 ? 1.426   26.577 -34.362 1.00 59.84  ? 171 GLN A C     1 
ATOM   1009 O  O     . GLN A 1 141 ? 0.844   27.087 -33.415 1.00 59.84  ? 171 GLN A O     1 
ATOM   1010 C  CB    . GLN A 1 141 ? 2.567   28.003 -36.097 1.00 59.91  ? 171 GLN A CB    1 
ATOM   1011 N  N     . GLN A 1 142 ? 0.961   25.512 -35.005 1.00 59.68  ? 172 GLN A N     1 
ATOM   1012 C  CA    . GLN A 1 142 ? -0.300  24.871 -34.642 1.00 59.55  ? 172 GLN A CA    1 
ATOM   1013 C  C     . GLN A 1 142 ? -0.229  24.237 -33.242 1.00 59.76  ? 172 GLN A C     1 
ATOM   1014 O  O     . GLN A 1 142 ? -1.160  24.395 -32.451 1.00 59.75  ? 172 GLN A O     1 
ATOM   1015 C  CB    . GLN A 1 142 ? -0.677  23.834 -35.709 1.00 59.34  ? 172 GLN A CB    1 
ATOM   1016 C  CG    . GLN A 1 142 ? -2.027  23.154 -35.542 1.00 59.06  ? 172 GLN A CG    1 
ATOM   1017 C  CD    . GLN A 1 142 ? -3.233  24.078 -35.716 1.00 59.15  ? 172 GLN A CD    1 
ATOM   1018 O  OE1   . GLN A 1 142 ? -4.349  23.733 -35.305 1.00 60.32  ? 172 GLN A OE1   1 
ATOM   1019 N  NE2   . GLN A 1 142 ? -3.024  25.232 -36.329 1.00 56.72  ? 172 GLN A NE2   1 
ATOM   1020 N  N     . ASP A 1 143 ? 0.872   23.544 -32.923 1.00 59.88  ? 173 ASP A N     1 
ATOM   1021 C  CA    . ASP A 1 143 ? 1.058   22.983 -31.574 1.00 59.64  ? 173 ASP A CA    1 
ATOM   1022 C  C     . ASP A 1 143 ? 0.855   24.092 -30.555 1.00 59.77  ? 173 ASP A C     1 
ATOM   1023 O  O     . ASP A 1 143 ? 0.083   23.950 -29.603 1.00 60.30  ? 173 ASP A O     1 
ATOM   1024 C  CB    . ASP A 1 143 ? 2.455   22.403 -31.383 1.00 59.50  ? 173 ASP A CB    1 
ATOM   1025 C  CG    . ASP A 1 143 ? 2.714   21.191 -32.244 1.00 59.79  ? 173 ASP A CG    1 
ATOM   1026 O  OD1   . ASP A 1 143 ? 1.747   20.634 -32.804 1.00 60.10  ? 173 ASP A OD1   1 
ATOM   1027 O  OD2   . ASP A 1 143 ? 3.893   20.793 -32.359 1.00 58.66  ? 173 ASP A OD2   1 
ATOM   1028 N  N     . VAL A 1 144 ? 1.538   25.208 -30.774 1.00 59.38  ? 174 VAL A N     1 
ATOM   1029 C  CA    . VAL A 1 144 ? 1.396   26.361 -29.903 1.00 59.14  ? 174 VAL A CA    1 
ATOM   1030 C  C     . VAL A 1 144 ? -0.081  26.790 -29.799 1.00 59.19  ? 174 VAL A C     1 
ATOM   1031 O  O     . VAL A 1 144 ? -0.591  27.022 -28.702 1.00 58.65  ? 174 VAL A O     1 
ATOM   1032 C  CB    . VAL A 1 144 ? 2.278   27.534 -30.381 1.00 58.76  ? 174 VAL A CB    1 
ATOM   1033 C  CG1   . VAL A 1 144 ? 2.134   28.716 -29.453 1.00 58.23  ? 174 VAL A CG1   1 
ATOM   1034 C  CG2   . VAL A 1 144 ? 3.720   27.101 -30.448 1.00 58.08  ? 174 VAL A CG2   1 
ATOM   1035 N  N     . LEU A 1 145 ? -0.755  26.865 -30.946 1.00 59.42  ? 175 LEU A N     1 
ATOM   1036 C  CA    . LEU A 1 145 ? -2.167  27.267 -31.008 1.00 59.46  ? 175 LEU A CA    1 
ATOM   1037 C  C     . LEU A 1 145 ? -3.050  26.303 -30.242 1.00 59.49  ? 175 LEU A C     1 
ATOM   1038 O  O     . LEU A 1 145 ? -4.041  26.695 -29.629 1.00 59.45  ? 175 LEU A O     1 
ATOM   1039 C  CB    . LEU A 1 145 ? -2.651  27.347 -32.459 1.00 59.34  ? 175 LEU A CB    1 
ATOM   1040 C  CG    . LEU A 1 145 ? -2.154  28.523 -33.302 1.00 59.11  ? 175 LEU A CG    1 
ATOM   1041 C  CD1   . LEU A 1 145 ? -2.343  28.223 -34.788 1.00 58.89  ? 175 LEU A CD1   1 
ATOM   1042 C  CD2   . LEU A 1 145 ? -2.871  29.800 -32.913 1.00 58.22  ? 175 LEU A CD2   1 
ATOM   1043 N  N     . ARG A 1 146 ? -2.671  25.035 -30.275 1.00 59.79  ? 176 ARG A N     1 
ATOM   1044 C  CA    . ARG A 1 146 ? -3.450  23.988 -29.629 1.00 60.01  ? 176 ARG A CA    1 
ATOM   1045 C  C     . ARG A 1 146 ? -3.258  23.948 -28.120 1.00 59.98  ? 176 ARG A C     1 
ATOM   1046 O  O     . ARG A 1 146 ? -3.959  23.205 -27.441 1.00 60.08  ? 176 ARG A O     1 
ATOM   1047 C  CB    . ARG A 1 146 ? -3.069  22.636 -30.215 1.00 59.97  ? 176 ARG A CB    1 
ATOM   1048 C  CG    . ARG A 1 146 ? -3.511  22.467 -31.645 1.00 60.31  ? 176 ARG A CG    1 
ATOM   1049 C  CD    . ARG A 1 146 ? -4.929  21.934 -31.748 1.00 60.55  ? 176 ARG A CD    1 
ATOM   1050 N  NE    . ARG A 1 146 ? -5.237  21.665 -33.145 1.00 60.87  ? 176 ARG A NE    1 
ATOM   1051 C  CZ    . ARG A 1 146 ? -6.213  20.876 -33.573 1.00 59.57  ? 176 ARG A CZ    1 
ATOM   1052 N  NH1   . ARG A 1 146 ? -7.014  20.255 -32.730 1.00 59.10  ? 176 ARG A NH1   1 
ATOM   1053 N  NH2   . ARG A 1 146 ? -6.375  20.706 -34.870 1.00 60.60  ? 176 ARG A NH2   1 
ATOM   1054 N  N     . THR A 1 147 ? -2.310  24.725 -27.596 1.00 59.95  ? 177 THR A N     1 
ATOM   1055 C  CA    . THR A 1 147 ? -1.962  24.612 -26.192 1.00 59.90  ? 177 THR A CA    1 
ATOM   1056 C  C     . THR A 1 147 ? -3.092  25.168 -25.372 1.00 60.01  ? 177 THR A C     1 
ATOM   1057 O  O     . THR A 1 147 ? -3.808  26.042 -25.831 1.00 60.67  ? 177 THR A O     1 
ATOM   1058 C  CB    . THR A 1 147 ? -0.655  25.343 -25.820 1.00 59.90  ? 177 THR A CB    1 
ATOM   1059 O  OG1   . THR A 1 147 ? -0.753  26.736 -26.151 1.00 58.54  ? 177 THR A OG1   1 
ATOM   1060 C  CG2   . THR A 1 147 ? 0.543   24.698 -26.520 1.00 59.17  ? 177 THR A CG2   1 
ATOM   1061 N  N     . ARG A 1 148 ? -3.249  24.635 -24.166 1.00 59.94  ? 178 ARG A N     1 
ATOM   1062 C  CA    . ARG A 1 148 ? -4.271  25.068 -23.234 1.00 59.77  ? 178 ARG A CA    1 
ATOM   1063 C  C     . ARG A 1 148 ? -3.645  25.598 -21.953 1.00 59.37  ? 178 ARG A C     1 
ATOM   1064 O  O     . ARG A 1 148 ? -3.014  24.855 -21.223 1.00 59.16  ? 178 ARG A O     1 
ATOM   1065 C  CB    . ARG A 1 148 ? -5.192  23.895 -22.890 1.00 59.96  ? 178 ARG A CB    1 
ATOM   1066 C  CG    . ARG A 1 148 ? -6.122  24.118 -21.692 1.00 59.64  ? 178 ARG A CG    1 
ATOM   1067 C  CD    . ARG A 1 148 ? -7.007  25.324 -21.878 1.00 61.16  ? 178 ARG A CD    1 
ATOM   1068 N  NE    . ARG A 1 148 ? -7.961  25.436 -20.786 1.00 62.91  ? 178 ARG A NE    1 
ATOM   1069 C  CZ    . ARG A 1 148 ? -8.857  26.414 -20.634 1.00 65.41  ? 178 ARG A CZ    1 
ATOM   1070 N  NH1   . ARG A 1 148 ? -8.955  27.423 -21.501 1.00 66.40  ? 178 ARG A NH1   1 
ATOM   1071 N  NH2   . ARG A 1 148 ? -9.665  26.383 -19.585 1.00 66.37  ? 178 ARG A NH2   1 
ATOM   1072 N  N     . VAL A 1 149 ? -3.845  26.883 -21.688 1.00 59.42  ? 179 VAL A N     1 
ATOM   1073 C  CA    . VAL A 1 149 ? -3.612  27.454 -20.366 1.00 59.33  ? 179 VAL A CA    1 
ATOM   1074 C  C     . VAL A 1 149 ? -4.851  28.215 -19.901 1.00 59.42  ? 179 VAL A C     1 
ATOM   1075 O  O     . VAL A 1 149 ? -5.324  29.105 -20.587 1.00 59.37  ? 179 VAL A O     1 
ATOM   1076 C  CB    . VAL A 1 149 ? -2.424  28.405 -20.358 1.00 59.09  ? 179 VAL A CB    1 
ATOM   1077 C  CG1   . VAL A 1 149 ? -2.313  29.064 -18.987 1.00 59.42  ? 179 VAL A CG1   1 
ATOM   1078 C  CG2   . VAL A 1 149 ? -1.142  27.656 -20.723 1.00 58.34  ? 179 VAL A CG2   1 
ATOM   1079 N  N     . LYS A 1 150 ? -5.365  27.859 -18.729 1.00 59.79  ? 180 LYS A N     1 
ATOM   1080 C  CA    . LYS A 1 150 ? -6.490  28.567 -18.129 1.00 59.95  ? 180 LYS A CA    1 
ATOM   1081 C  C     . LYS A 1 150 ? -6.099  30.024 -17.936 1.00 60.20  ? 180 LYS A C     1 
ATOM   1082 O  O     . LYS A 1 150 ? -5.116  30.324 -17.278 1.00 60.11  ? 180 LYS A O     1 
ATOM   1083 C  CB    . LYS A 1 150 ? -6.872  27.939 -16.781 1.00 59.99  ? 180 LYS A CB    1 
ATOM   1084 C  CG    . LYS A 1 150 ? -8.305  28.209 -16.298 1.00 60.32  ? 180 LYS A CG    1 
ATOM   1085 C  CD    . LYS A 1 150 ? -8.696  27.288 -15.108 1.00 59.74  ? 180 LYS A CD    1 
ATOM   1086 N  N     . THR A 1 151 ? -6.854  30.927 -18.543 1.00 60.82  ? 181 THR A N     1 
ATOM   1087 C  CA    . THR A 1 151 ? -6.665  32.342 -18.297 1.00 61.14  ? 181 THR A CA    1 
ATOM   1088 C  C     . THR A 1 151 ? -7.362  32.700 -16.997 1.00 61.28  ? 181 THR A C     1 
ATOM   1089 O  O     . THR A 1 151 ? -8.549  32.418 -16.839 1.00 60.90  ? 181 THR A O     1 
ATOM   1090 C  CB    . THR A 1 151 ? -7.284  33.206 -19.417 1.00 61.53  ? 181 THR A CB    1 
ATOM   1091 O  OG1   . THR A 1 151 ? -7.270  32.484 -20.664 1.00 61.56  ? 181 THR A OG1   1 
ATOM   1092 C  CG2   . THR A 1 151 ? -6.527  34.530 -19.539 1.00 60.75  ? 181 THR A CG2   1 
ATOM   1093 N  N     . THR A 1 152 ? -6.626  33.320 -16.077 1.00 61.80  ? 182 THR A N     1 
ATOM   1094 C  CA    . THR A 1 152 ? -7.210  33.859 -14.841 1.00 62.10  ? 182 THR A CA    1 
ATOM   1095 C  C     . THR A 1 152 ? -7.025  35.357 -14.808 1.00 62.41  ? 182 THR A C     1 
ATOM   1096 O  O     . THR A 1 152 ? -5.898  35.852 -14.784 1.00 62.98  ? 182 THR A O     1 
ATOM   1097 C  CB    . THR A 1 152 ? -6.575  33.257 -13.552 1.00 62.17  ? 182 THR A CB    1 
ATOM   1098 O  OG1   . THR A 1 152 ? -7.289  33.729 -12.400 1.00 62.12  ? 182 THR A OG1   1 
ATOM   1099 C  CG2   . THR A 1 152 ? -5.085  33.626 -13.419 1.00 61.50  ? 182 THR A CG2   1 
ATOM   1100 N  N     . GLY A 1 153 ? -8.132  36.083 -14.802 1.00 62.78  ? 183 GLY A N     1 
ATOM   1101 C  CA    . GLY A 1 153 ? -8.087  37.535 -14.687 1.00 62.95  ? 183 GLY A CA    1 
ATOM   1102 C  C     . GLY A 1 153 ? -8.446  38.248 -15.984 1.00 63.20  ? 183 GLY A C     1 
ATOM   1103 O  O     . GLY A 1 153 ? -9.401  37.867 -16.690 1.00 63.30  ? 183 GLY A O     1 
ATOM   1104 N  N     . ILE A 1 154 ? -7.687  39.300 -16.274 1.00 63.21  ? 184 ILE A N     1 
ATOM   1105 C  CA    . ILE A 1 154 ? -7.964  40.197 -17.386 1.00 63.24  ? 184 ILE A CA    1 
ATOM   1106 C  C     . ILE A 1 154 ? -6.632  40.667 -17.973 1.00 63.26  ? 184 ILE A C     1 
ATOM   1107 O  O     . ILE A 1 154 ? -5.867  41.360 -17.302 1.00 62.65  ? 184 ILE A O     1 
ATOM   1108 C  CB    . ILE A 1 154 ? -8.793  41.419 -16.919 1.00 63.28  ? 184 ILE A CB    1 
ATOM   1109 C  CG1   . ILE A 1 154 ? -10.188 40.974 -16.467 1.00 62.99  ? 184 ILE A CG1   1 
ATOM   1110 C  CG2   . ILE A 1 154 ? -8.899  42.458 -18.028 1.00 63.22  ? 184 ILE A CG2   1 
ATOM   1111 C  CD1   . ILE A 1 154 ? -11.043 42.085 -15.970 1.00 62.66  ? 184 ILE A CD1   1 
ATOM   1112 N  N     . VAL A 1 155 ? -6.383  40.265 -19.221 1.00 63.47  ? 185 VAL A N     1 
ATOM   1113 C  CA    . VAL A 1 155 ? -5.148  40.548 -19.939 1.00 63.74  ? 185 VAL A CA    1 
ATOM   1114 C  C     . VAL A 1 155 ? -5.417  41.549 -21.055 1.00 64.10  ? 185 VAL A C     1 
ATOM   1115 O  O     . VAL A 1 155 ? -6.201  41.283 -21.964 1.00 64.09  ? 185 VAL A O     1 
ATOM   1116 C  CB    . VAL A 1 155 ? -4.584  39.269 -20.592 1.00 63.89  ? 185 VAL A CB    1 
ATOM   1117 C  CG1   . VAL A 1 155 ? -3.124  39.468 -20.989 1.00 63.87  ? 185 VAL A CG1   1 
ATOM   1118 C  CG2   . VAL A 1 155 ? -4.733  38.080 -19.654 1.00 63.85  ? 185 VAL A CG2   1 
ATOM   1119 N  N     . GLU A 1 156 ? -4.762  42.700 -20.978 1.00 64.57  ? 186 GLU A N     1 
ATOM   1120 C  CA    . GLU A 1 156 ? -4.843  43.722 -22.014 1.00 64.93  ? 186 GLU A CA    1 
ATOM   1121 C  C     . GLU A 1 156 ? -3.653  43.569 -22.970 1.00 64.95  ? 186 GLU A C     1 
ATOM   1122 O  O     . GLU A 1 156 ? -2.514  43.408 -22.532 1.00 65.00  ? 186 GLU A O     1 
ATOM   1123 C  CB    . GLU A 1 156 ? -4.827  45.108 -21.369 1.00 64.78  ? 186 GLU A CB    1 
ATOM   1124 C  CG    . GLU A 1 156 ? -5.168  46.251 -22.305 1.00 65.12  ? 186 GLU A CG    1 
ATOM   1125 C  CD    . GLU A 1 156 ? -4.900  47.621 -21.691 1.00 65.71  ? 186 GLU A CD    1 
ATOM   1126 O  OE1   . GLU A 1 156 ? -4.448  47.687 -20.525 1.00 66.73  ? 186 GLU A OE1   1 
ATOM   1127 O  OE2   . GLU A 1 156 ? -5.130  48.640 -22.380 1.00 67.13  ? 186 GLU A OE2   1 
ATOM   1128 N  N     . THR A 1 157 ? -3.929  43.600 -24.272 1.00 65.10  ? 187 THR A N     1 
ATOM   1129 C  CA    . THR A 1 157 ? -2.887  43.539 -25.289 1.00 65.27  ? 187 THR A CA    1 
ATOM   1130 C  C     . THR A 1 157 ? -3.229  44.487 -26.435 1.00 65.24  ? 187 THR A C     1 
ATOM   1131 O  O     . THR A 1 157 ? -4.381  44.535 -26.887 1.00 65.45  ? 187 THR A O     1 
ATOM   1132 C  CB    . THR A 1 157 ? -2.738  42.120 -25.850 1.00 65.39  ? 187 THR A CB    1 
ATOM   1133 O  OG1   . THR A 1 157 ? -3.673  41.930 -26.913 1.00 66.59  ? 187 THR A OG1   1 
ATOM   1134 C  CG2   . THR A 1 157 ? -2.995  41.065 -24.769 1.00 65.50  ? 187 THR A CG2   1 
ATOM   1135 N  N     . HIS A 1 158 ? -2.222  45.225 -26.902 1.00 65.25  ? 188 HIS A N     1 
ATOM   1136 C  CA    . HIS A 1 158 ? -2.378  46.230 -27.957 1.00 65.20  ? 188 HIS A CA    1 
ATOM   1137 C  C     . HIS A 1 158 ? -2.014  45.680 -29.353 1.00 64.87  ? 188 HIS A C     1 
ATOM   1138 O  O     . HIS A 1 158 ? -1.049  44.929 -29.499 1.00 64.86  ? 188 HIS A O     1 
ATOM   1139 C  CB    . HIS A 1 158 ? -1.512  47.443 -27.627 1.00 65.45  ? 188 HIS A CB    1 
ATOM   1140 C  CG    . HIS A 1 158 ? -1.869  48.107 -26.328 1.00 66.58  ? 188 HIS A CG    1 
ATOM   1141 N  ND1   . HIS A 1 158 ? -3.127  48.611 -26.068 1.00 67.46  ? 188 HIS A ND1   1 
ATOM   1142 C  CD2   . HIS A 1 158 ? -1.129  48.362 -25.221 1.00 67.02  ? 188 HIS A CD2   1 
ATOM   1143 C  CE1   . HIS A 1 158 ? -3.147  49.143 -24.859 1.00 66.85  ? 188 HIS A CE1   1 
ATOM   1144 N  NE2   . HIS A 1 158 ? -1.948  49.004 -24.324 1.00 67.16  ? 188 HIS A NE2   1 
ATOM   1145 N  N     . PHE A 1 159 ? -2.790  46.054 -30.372 1.00 64.56  ? 189 PHE A N     1 
ATOM   1146 C  CA    . PHE A 1 159 ? -2.604  45.533 -31.734 1.00 64.37  ? 189 PHE A CA    1 
ATOM   1147 C  C     . PHE A 1 159 ? -2.868  46.574 -32.808 1.00 64.11  ? 189 PHE A C     1 
ATOM   1148 O  O     . PHE A 1 159 ? -3.747  47.406 -32.657 1.00 64.04  ? 189 PHE A O     1 
ATOM   1149 C  CB    . PHE A 1 159 ? -3.547  44.349 -32.001 1.00 64.52  ? 189 PHE A CB    1 
ATOM   1150 C  CG    . PHE A 1 159 ? -3.138  43.083 -31.326 1.00 64.55  ? 189 PHE A CG    1 
ATOM   1151 C  CD1   . PHE A 1 159 ? -3.974  42.470 -30.410 1.00 64.82  ? 189 PHE A CD1   1 
ATOM   1152 C  CD2   . PHE A 1 159 ? -1.904  42.505 -31.596 1.00 65.22  ? 189 PHE A CD2   1 
ATOM   1153 C  CE1   . PHE A 1 159 ? -3.591  41.298 -29.781 1.00 64.97  ? 189 PHE A CE1   1 
ATOM   1154 C  CE2   . PHE A 1 159 ? -1.511  41.337 -30.965 1.00 64.89  ? 189 PHE A CE2   1 
ATOM   1155 C  CZ    . PHE A 1 159 ? -2.357  40.734 -30.053 1.00 64.77  ? 189 PHE A CZ    1 
ATOM   1156 N  N     . THR A 1 160 ? -2.128  46.478 -33.911 1.00 63.91  ? 190 THR A N     1 
ATOM   1157 C  CA    . THR A 1 160 ? -2.341  47.320 -35.077 1.00 63.84  ? 190 THR A CA    1 
ATOM   1158 C  C     . THR A 1 160 ? -2.593  46.478 -36.341 1.00 63.99  ? 190 THR A C     1 
ATOM   1159 O  O     . THR A 1 160 ? -1.655  45.911 -36.920 1.00 64.06  ? 190 THR A O     1 
ATOM   1160 C  CB    . THR A 1 160 ? -1.132  48.237 -35.307 1.00 63.67  ? 190 THR A CB    1 
ATOM   1161 O  OG1   . THR A 1 160 ? -0.772  48.853 -34.071 1.00 63.69  ? 190 THR A OG1   1 
ATOM   1162 C  CG2   . THR A 1 160 ? -1.459  49.308 -36.315 1.00 63.15  ? 190 THR A CG2   1 
ATOM   1163 N  N     . PHE A 1 161 ? -3.863  46.414 -36.758 1.00 64.03  ? 191 PHE A N     1 
ATOM   1164 C  CA    . PHE A 1 161 ? -4.259  45.808 -38.043 1.00 63.99  ? 191 PHE A CA    1 
ATOM   1165 C  C     . PHE A 1 161 ? -4.098  46.826 -39.198 1.00 64.11  ? 191 PHE A C     1 
ATOM   1166 O  O     . PHE A 1 161 ? -3.655  47.957 -38.981 1.00 64.06  ? 191 PHE A O     1 
ATOM   1167 C  CB    . PHE A 1 161 ? -5.702  45.278 -37.969 1.00 63.87  ? 191 PHE A CB    1 
ATOM   1168 C  CG    . PHE A 1 161 ? -5.863  44.069 -37.081 1.00 63.66  ? 191 PHE A CG    1 
ATOM   1169 N  N     . LYS A 1 162 ? -4.450  46.418 -40.417 1.00 64.12  ? 192 LYS A N     1 
ATOM   1170 C  CA    . LYS A 1 162 ? -4.313  47.259 -41.608 1.00 63.88  ? 192 LYS A CA    1 
ATOM   1171 C  C     . LYS A 1 162 ? -4.902  48.666 -41.492 1.00 63.89  ? 192 LYS A C     1 
ATOM   1172 O  O     . LYS A 1 162 ? -4.283  49.631 -41.940 1.00 64.01  ? 192 LYS A O     1 
ATOM   1173 N  N     . ASP A 1 163 ? -6.089  48.783 -40.902 1.00 63.91  ? 193 ASP A N     1 
ATOM   1174 C  CA    . ASP A 1 163 ? -6.789  50.070 -40.834 1.00 64.01  ? 193 ASP A CA    1 
ATOM   1175 C  C     . ASP A 1 163 ? -7.244  50.488 -39.425 1.00 64.13  ? 193 ASP A C     1 
ATOM   1176 O  O     . ASP A 1 163 ? -7.866  51.543 -39.275 1.00 64.37  ? 193 ASP A O     1 
ATOM   1177 C  CB    . ASP A 1 163 ? -7.990  50.056 -41.789 1.00 63.89  ? 193 ASP A CB    1 
ATOM   1178 N  N     . LEU A 1 164 ? -6.916  49.687 -38.409 1.00 64.19  ? 194 LEU A N     1 
ATOM   1179 C  CA    . LEU A 1 164 ? -7.368  49.906 -37.030 1.00 64.30  ? 194 LEU A CA    1 
ATOM   1180 C  C     . LEU A 1 164 ? -6.219  49.655 -36.038 1.00 64.56  ? 194 LEU A C     1 
ATOM   1181 O  O     . LEU A 1 164 ? -5.425  48.726 -36.235 1.00 64.22  ? 194 LEU A O     1 
ATOM   1182 C  CB    . LEU A 1 164 ? -8.516  48.932 -36.696 1.00 64.26  ? 194 LEU A CB    1 
ATOM   1183 C  CG    . LEU A 1 164 ? -9.966  49.140 -37.171 1.00 64.15  ? 194 LEU A CG    1 
ATOM   1184 C  CD1   . LEU A 1 164 ? -10.691 50.190 -36.337 1.00 63.68  ? 194 LEU A CD1   1 
ATOM   1185 C  CD2   . LEU A 1 164 ? -10.064 49.493 -38.650 1.00 64.15  ? 194 LEU A CD2   1 
ATOM   1186 N  N     . HIS A 1 165 ? -6.127  50.475 -34.985 1.00 64.85  ? 195 HIS A N     1 
ATOM   1187 C  CA    . HIS A 1 165 ? -5.368  50.095 -33.783 1.00 65.16  ? 195 HIS A CA    1 
ATOM   1188 C  C     . HIS A 1 165 ? -6.349  49.601 -32.722 1.00 64.90  ? 195 HIS A C     1 
ATOM   1189 O  O     . HIS A 1 165 ? -7.401  50.202 -32.531 1.00 65.06  ? 195 HIS A O     1 
ATOM   1190 C  CB    . HIS A 1 165 ? -4.539  51.247 -33.211 1.00 65.62  ? 195 HIS A CB    1 
ATOM   1191 C  CG    . HIS A 1 165 ? -3.971  50.948 -31.851 1.00 66.77  ? 195 HIS A CG    1 
ATOM   1192 N  ND1   . HIS A 1 165 ? -4.512  51.454 -30.685 1.00 68.28  ? 195 HIS A ND1   1 
ATOM   1193 C  CD2   . HIS A 1 165 ? -2.937  50.158 -31.472 1.00 67.01  ? 195 HIS A CD2   1 
ATOM   1194 C  CE1   . HIS A 1 165 ? -3.823  51.004 -29.650 1.00 67.73  ? 195 HIS A CE1   1 
ATOM   1195 N  NE2   . HIS A 1 165 ? -2.863  50.214 -30.101 1.00 67.50  ? 195 HIS A NE2   1 
ATOM   1196 N  N     . PHE A 1 166 ? -5.992  48.519 -32.032 1.00 64.75  ? 196 PHE A N     1 
ATOM   1197 C  CA    . PHE A 1 166 ? -6.890  47.845 -31.090 1.00 64.62  ? 196 PHE A CA    1 
ATOM   1198 C  C     . PHE A 1 166 ? -6.284  47.777 -29.688 1.00 64.43  ? 196 PHE A C     1 
ATOM   1199 O  O     . PHE A 1 166 ? -5.152  47.327 -29.508 1.00 64.15  ? 196 PHE A O     1 
ATOM   1200 C  CB    . PHE A 1 166 ? -7.201  46.410 -31.559 1.00 64.53  ? 196 PHE A CB    1 
ATOM   1201 C  CG    . PHE A 1 166 ? -8.158  46.335 -32.718 1.00 64.51  ? 196 PHE A CG    1 
ATOM   1202 N  N     . LYS A 1 167 ? -7.044  48.233 -28.701 1.00 64.18  ? 197 LYS A N     1 
ATOM   1203 C  CA    . LYS A 1 167 ? -6.838  47.797 -27.336 1.00 64.29  ? 197 LYS A CA    1 
ATOM   1204 C  C     . LYS A 1 167 ? -7.731  46.560 -27.192 1.00 64.41  ? 197 LYS A C     1 
ATOM   1205 O  O     . LYS A 1 167 ? -8.934  46.641 -27.426 1.00 63.97  ? 197 LYS A O     1 
ATOM   1206 C  CB    . LYS A 1 167 ? -7.214  48.894 -26.337 1.00 64.15  ? 197 LYS A CB    1 
ATOM   1207 N  N     . MET A 1 168 ? -7.132  45.415 -26.860 1.00 64.79  ? 198 MET A N     1 
ATOM   1208 C  CA    . MET A 1 168 ? -7.856  44.142 -26.792 1.00 65.22  ? 198 MET A CA    1 
ATOM   1209 C  C     . MET A 1 168 ? -7.689  43.504 -25.427 1.00 64.72  ? 198 MET A C     1 
ATOM   1210 O  O     . MET A 1 168 ? -6.565  43.171 -25.024 1.00 64.63  ? 198 MET A O     1 
ATOM   1211 C  CB    . MET A 1 168 ? -7.342  43.180 -27.856 1.00 65.29  ? 198 MET A CB    1 
ATOM   1212 C  CG    . MET A 1 168 ? -8.283  42.031 -28.157 1.00 65.94  ? 198 MET A CG    1 
ATOM   1213 S  SD    . MET A 1 168 ? -7.521  40.849 -29.296 1.00 67.69  ? 198 MET A SD    1 
ATOM   1214 C  CE    . MET A 1 168 ? -7.951  41.490 -30.923 1.00 68.53  ? 198 MET A CE    1 
ATOM   1215 N  N     . PHE A 1 169 ? -8.815  43.330 -24.733 1.00 64.22  ? 199 PHE A N     1 
ATOM   1216 C  CA    . PHE A 1 169 ? -8.848  42.775 -23.378 1.00 63.72  ? 199 PHE A CA    1 
ATOM   1217 C  C     . PHE A 1 169 ? -9.388  41.361 -23.388 1.00 63.51  ? 199 PHE A C     1 
ATOM   1218 O  O     . PHE A 1 169 ? -10.537 41.141 -23.778 1.00 63.30  ? 199 PHE A O     1 
ATOM   1219 C  CB    . PHE A 1 169 ? -9.745  43.604 -22.473 1.00 63.54  ? 199 PHE A CB    1 
ATOM   1220 C  CG    . PHE A 1 169 ? -9.234  44.984 -22.209 1.00 63.34  ? 199 PHE A CG    1 
ATOM   1221 C  CD1   . PHE A 1 169 ? -8.702  45.314 -20.975 1.00 62.66  ? 199 PHE A CD1   1 
ATOM   1222 C  CD2   . PHE A 1 169 ? -9.312  45.962 -23.185 1.00 63.44  ? 199 PHE A CD2   1 
ATOM   1223 C  CE1   . PHE A 1 169 ? -8.243  46.585 -20.724 1.00 62.93  ? 199 PHE A CE1   1 
ATOM   1224 C  CE2   . PHE A 1 169 ? -8.853  47.247 -22.936 1.00 63.40  ? 199 PHE A CE2   1 
ATOM   1225 C  CZ    . PHE A 1 169 ? -8.318  47.556 -21.706 1.00 63.13  ? 199 PHE A CZ    1 
ATOM   1226 N  N     . ASP A 1 170 ? -8.556  40.417 -22.941 1.00 63.40  ? 200 ASP A N     1 
ATOM   1227 C  CA    . ASP A 1 170 ? -8.912  39.002 -22.851 1.00 63.42  ? 200 ASP A CA    1 
ATOM   1228 C  C     . ASP A 1 170 ? -9.174  38.638 -21.391 1.00 62.98  ? 200 ASP A C     1 
ATOM   1229 O  O     . ASP A 1 170 ? -8.383  38.988 -20.513 1.00 63.08  ? 200 ASP A O     1 
ATOM   1230 C  CB    . ASP A 1 170 ? -7.767  38.155 -23.410 1.00 63.76  ? 200 ASP A CB    1 
ATOM   1231 C  CG    . ASP A 1 170 ? -8.043  36.659 -23.346 1.00 65.52  ? 200 ASP A CG    1 
ATOM   1232 O  OD1   . ASP A 1 170 ? -9.230  36.244 -23.454 1.00 68.80  ? 200 ASP A OD1   1 
ATOM   1233 O  OD2   . ASP A 1 170 ? -7.058  35.892 -23.203 1.00 67.44  ? 200 ASP A OD2   1 
ATOM   1234 N  N     . VAL A 1 171 ? -10.279 37.932 -21.148 1.00 62.42  ? 201 VAL A N     1 
ATOM   1235 C  CA    . VAL A 1 171 ? -10.745 37.593 -19.796 1.00 61.92  ? 201 VAL A CA    1 
ATOM   1236 C  C     . VAL A 1 171 ? -10.921 36.090 -19.601 1.00 61.90  ? 201 VAL A C     1 
ATOM   1237 O  O     . VAL A 1 171 ? -10.871 35.323 -20.560 1.00 62.06  ? 201 VAL A O     1 
ATOM   1238 C  CB    . VAL A 1 171 ? -12.106 38.267 -19.481 1.00 61.83  ? 201 VAL A CB    1 
ATOM   1239 C  CG1   . VAL A 1 171 ? -12.010 39.764 -19.707 1.00 60.85  ? 201 VAL A CG1   1 
ATOM   1240 C  CG2   . VAL A 1 171 ? -13.236 37.636 -20.306 1.00 60.39  ? 201 VAL A CG2   1 
ATOM   1241 N  N     . GLY A 1 172 ? -11.130 35.679 -18.355 1.00 61.84  ? 202 GLY A N     1 
ATOM   1242 C  CA    . GLY A 1 172 ? -11.418 34.281 -18.043 1.00 62.07  ? 202 GLY A CA    1 
ATOM   1243 C  C     . GLY A 1 172 ? -12.912 34.005 -18.103 1.00 62.04  ? 202 GLY A C     1 
ATOM   1244 O  O     . GLY A 1 172 ? -13.703 34.818 -17.656 1.00 62.17  ? 202 GLY A O     1 
ATOM   1245 N  N     . GLY A 1 173 ? -13.298 32.858 -18.654 1.00 61.94  ? 203 GLY A N     1 
ATOM   1246 C  CA    . GLY A 1 173 ? -14.715 32.542 -18.858 1.00 61.94  ? 203 GLY A CA    1 
ATOM   1247 C  C     . GLY A 1 173 ? -15.446 31.862 -17.710 1.00 61.77  ? 203 GLY A C     1 
ATOM   1248 O  O     . GLY A 1 173 ? -16.670 31.896 -17.639 1.00 61.58  ? 203 GLY A O     1 
ATOM   1249 N  N     . GLN A 1 174 ? -14.700 31.250 -16.800 1.00 61.70  ? 204 GLN A N     1 
ATOM   1250 C  CA    . GLN A 1 174 ? -15.292 30.515 -15.694 1.00 61.48  ? 204 GLN A CA    1 
ATOM   1251 C  C     . GLN A 1 174 ? -16.133 31.455 -14.832 1.00 61.84  ? 204 GLN A C     1 
ATOM   1252 O  O     . GLN A 1 174 ? -15.934 32.668 -14.846 1.00 61.82  ? 204 GLN A O     1 
ATOM   1253 C  CB    . GLN A 1 174 ? -14.204 29.839 -14.858 1.00 61.18  ? 204 GLN A CB    1 
ATOM   1254 C  CG    . GLN A 1 174 ? -13.510 28.651 -15.542 1.00 61.13  ? 204 GLN A CG    1 
ATOM   1255 C  CD    . GLN A 1 174 ? -12.476 29.030 -16.623 1.00 61.37  ? 204 GLN A CD    1 
ATOM   1256 O  OE1   . GLN A 1 174 ? -11.908 30.126 -16.619 1.00 62.25  ? 204 GLN A OE1   1 
ATOM   1257 N  NE2   . GLN A 1 174 ? -12.228 28.107 -17.544 1.00 59.42  ? 204 GLN A NE2   1 
ATOM   1258 N  N     . ARG A 1 175 ? -17.073 30.892 -14.082 1.00 62.19  ? 205 ARG A N     1 
ATOM   1259 C  CA    . ARG A 1 175 ? -17.966 31.692 -13.241 1.00 62.54  ? 205 ARG A CA    1 
ATOM   1260 C  C     . ARG A 1 175 ? -17.239 32.616 -12.252 1.00 62.59  ? 205 ARG A C     1 
ATOM   1261 O  O     . ARG A 1 175 ? -17.617 33.776 -12.098 1.00 63.46  ? 205 ARG A O     1 
ATOM   1262 C  CB    . ARG A 1 175 ? -18.946 30.792 -12.489 1.00 62.55  ? 205 ARG A CB    1 
ATOM   1263 C  CG    . ARG A 1 175 ? -19.927 30.083 -13.393 1.00 62.62  ? 205 ARG A CG    1 
ATOM   1264 C  CD    . ARG A 1 175 ? -20.972 29.361 -12.584 1.00 63.01  ? 205 ARG A CD    1 
ATOM   1265 N  NE    . ARG A 1 175 ? -21.996 28.774 -13.442 1.00 63.65  ? 205 ARG A NE    1 
ATOM   1266 C  CZ    . ARG A 1 175 ? -22.974 27.977 -13.013 1.00 63.73  ? 205 ARG A CZ    1 
ATOM   1267 N  NH1   . ARG A 1 175 ? -23.076 27.633 -11.726 1.00 64.09  ? 205 ARG A NH1   1 
ATOM   1268 N  NH2   . ARG A 1 175 ? -23.851 27.505 -13.884 1.00 63.13  ? 205 ARG A NH2   1 
ATOM   1269 N  N     . SER A 1 176 ? -16.204 32.112 -11.594 1.00 62.48  ? 206 SER A N     1 
ATOM   1270 C  CA    . SER A 1 176 ? -15.410 32.921 -10.652 1.00 62.46  ? 206 SER A CA    1 
ATOM   1271 C  C     . SER A 1 176 ? -14.668 34.110 -11.290 1.00 62.38  ? 206 SER A C     1 
ATOM   1272 O  O     . SER A 1 176 ? -14.303 35.050 -10.592 1.00 62.69  ? 206 SER A O     1 
ATOM   1273 C  CB    . SER A 1 176 ? -14.392 32.035 -9.929  1.00 62.45  ? 206 SER A CB    1 
ATOM   1274 O  OG    . SER A 1 176 ? -13.572 31.354 -10.858 1.00 62.23  ? 206 SER A OG    1 
ATOM   1275 N  N     . GLU A 1 177 ? -14.426 34.055 -12.597 1.00 62.43  ? 207 GLU A N     1 
ATOM   1276 C  CA    . GLU A 1 177 ? -13.777 35.154 -13.330 1.00 62.28  ? 207 GLU A CA    1 
ATOM   1277 C  C     . GLU A 1 177 ? -14.738 36.263 -13.757 1.00 62.06  ? 207 GLU A C     1 
ATOM   1278 O  O     . GLU A 1 177 ? -14.305 37.378 -14.027 1.00 61.82  ? 207 GLU A O     1 
ATOM   1279 C  CB    . GLU A 1 177 ? -13.075 34.618 -14.585 1.00 62.27  ? 207 GLU A CB    1 
ATOM   1280 C  CG    . GLU A 1 177 ? -11.997 33.594 -14.307 1.00 62.93  ? 207 GLU A CG    1 
ATOM   1281 C  CD    . GLU A 1 177 ? -10.851 34.140 -13.470 1.00 63.59  ? 207 GLU A CD    1 
ATOM   1282 O  OE1   . GLU A 1 177 ? -10.072 33.319 -12.926 1.00 63.42  ? 207 GLU A OE1   1 
ATOM   1283 O  OE2   . GLU A 1 177 ? -10.728 35.383 -13.364 1.00 63.25  ? 207 GLU A OE2   1 
ATOM   1284 N  N     . ARG A 1 178 ? -16.033 35.959 -13.818 1.00 62.07  ? 208 ARG A N     1 
ATOM   1285 C  CA    . ARG A 1 178 ? -17.019 36.901 -14.368 1.00 62.15  ? 208 ARG A CA    1 
ATOM   1286 C  C     . ARG A 1 178 ? -17.281 38.144 -13.529 1.00 62.08  ? 208 ARG A C     1 
ATOM   1287 O  O     . ARG A 1 178 ? -17.722 39.147 -14.072 1.00 61.97  ? 208 ARG A O     1 
ATOM   1288 C  CB    . ARG A 1 178 ? -18.336 36.188 -14.663 1.00 62.19  ? 208 ARG A CB    1 
ATOM   1289 C  CG    . ARG A 1 178 ? -18.231 35.225 -15.833 1.00 61.99  ? 208 ARG A CG    1 
ATOM   1290 C  CD    . ARG A 1 178 ? -19.393 34.271 -15.852 1.00 61.86  ? 208 ARG A CD    1 
ATOM   1291 N  NE    . ARG A 1 178 ? -19.118 33.069 -16.631 1.00 60.91  ? 208 ARG A NE    1 
ATOM   1292 C  CZ    . ARG A 1 178 ? -19.955 32.039 -16.688 1.00 61.36  ? 208 ARG A CZ    1 
ATOM   1293 N  NH1   . ARG A 1 178 ? -21.112 32.091 -16.031 1.00 59.99  ? 208 ARG A NH1   1 
ATOM   1294 N  NH2   . ARG A 1 178 ? -19.646 30.960 -17.410 1.00 61.96  ? 208 ARG A NH2   1 
ATOM   1295 N  N     . LYS A 1 179 ? -17.014 38.084 -12.226 1.00 62.40  ? 209 LYS A N     1 
ATOM   1296 C  CA    . LYS A 1 179 ? -17.036 39.295 -11.386 1.00 62.81  ? 209 LYS A CA    1 
ATOM   1297 C  C     . LYS A 1 179 ? -16.155 40.365 -12.026 1.00 62.71  ? 209 LYS A C     1 
ATOM   1298 O  O     . LYS A 1 179 ? -16.572 41.510 -12.169 1.00 63.07  ? 209 LYS A O     1 
ATOM   1299 C  CB    . LYS A 1 179 ? -16.496 39.058 -9.965  1.00 62.84  ? 209 LYS A CB    1 
ATOM   1300 C  CG    . LYS A 1 179 ? -16.926 37.776 -9.259  1.00 63.50  ? 209 LYS A CG    1 
ATOM   1301 C  CD    . LYS A 1 179 ? -16.305 37.687 -7.855  1.00 63.56  ? 209 LYS A CD    1 
ATOM   1302 C  CE    . LYS A 1 179 ? -15.888 36.249 -7.482  1.00 64.38  ? 209 LYS A CE    1 
ATOM   1303 N  NZ    . LYS A 1 179 ? -16.943 35.217 -7.761  1.00 63.79  ? 209 LYS A NZ    1 
ATOM   1304 N  N     . LYS A 1 180 ? -14.950 39.967 -12.436 1.00 62.45  ? 210 LYS A N     1 
ATOM   1305 C  CA    . LYS A 1 180 ? -13.905 40.901 -12.893 1.00 62.30  ? 210 LYS A CA    1 
ATOM   1306 C  C     . LYS A 1 180 ? -14.219 41.645 -14.215 1.00 62.18  ? 210 LYS A C     1 
ATOM   1307 O  O     . LYS A 1 180 ? -13.678 42.719 -14.472 1.00 62.20  ? 210 LYS A O     1 
ATOM   1308 C  CB    . LYS A 1 180 ? -12.571 40.150 -13.035 1.00 62.15  ? 210 LYS A CB    1 
ATOM   1309 C  CG    . LYS A 1 180 ? -12.095 39.457 -11.765 1.00 61.66  ? 210 LYS A CG    1 
ATOM   1310 C  CD    . LYS A 1 180 ? -11.324 38.181 -12.076 1.00 61.37  ? 210 LYS A CD    1 
ATOM   1311 C  CE    . LYS A 1 180 ? -10.996 37.393 -10.811 1.00 61.17  ? 210 LYS A CE    1 
ATOM   1312 N  NZ    . LYS A 1 180 ? -9.830  36.470 -10.983 1.00 60.60  ? 210 LYS A NZ    1 
ATOM   1313 N  N     . TRP A 1 181 ? -15.103 41.082 -15.029 1.00 62.05  ? 211 TRP A N     1 
ATOM   1314 C  CA    . TRP A 1 181 ? -15.444 41.627 -16.359 1.00 62.25  ? 211 TRP A CA    1 
ATOM   1315 C  C     . TRP A 1 181 ? -15.884 43.099 -16.403 1.00 62.49  ? 211 TRP A C     1 
ATOM   1316 O  O     . TRP A 1 181 ? -15.807 43.758 -17.440 1.00 62.28  ? 211 TRP A O     1 
ATOM   1317 C  CB    . TRP A 1 181 ? -16.573 40.778 -16.963 1.00 62.02  ? 211 TRP A CB    1 
ATOM   1318 C  CG    . TRP A 1 181 ? -16.148 39.419 -17.429 1.00 61.49  ? 211 TRP A CG    1 
ATOM   1319 C  CD1   . TRP A 1 181 ? -14.984 38.762 -17.133 1.00 61.38  ? 211 TRP A CD1   1 
ATOM   1320 C  CD2   . TRP A 1 181 ? -16.905 38.538 -18.252 1.00 61.42  ? 211 TRP A CD2   1 
ATOM   1321 N  NE1   . TRP A 1 181 ? -14.970 37.534 -17.732 1.00 61.23  ? 211 TRP A NE1   1 
ATOM   1322 C  CE2   . TRP A 1 181 ? -16.136 37.373 -18.433 1.00 61.18  ? 211 TRP A CE2   1 
ATOM   1323 C  CE3   . TRP A 1 181 ? -18.159 38.627 -18.869 1.00 61.06  ? 211 TRP A CE3   1 
ATOM   1324 C  CZ2   . TRP A 1 181 ? -16.576 36.314 -19.207 1.00 61.28  ? 211 TRP A CZ2   1 
ATOM   1325 C  CZ3   . TRP A 1 181 ? -18.591 37.579 -19.632 1.00 61.24  ? 211 TRP A CZ3   1 
ATOM   1326 C  CH2   . TRP A 1 181 ? -17.810 36.432 -19.792 1.00 61.61  ? 211 TRP A CH2   1 
ATOM   1327 N  N     . ILE A 1 182 ? -16.371 43.595 -15.277 1.00 63.13  ? 212 ILE A N     1 
ATOM   1328 C  CA    . ILE A 1 182 ? -16.930 44.930 -15.190 1.00 63.59  ? 212 ILE A CA    1 
ATOM   1329 C  C     . ILE A 1 182 ? -15.851 46.017 -15.263 1.00 63.52  ? 212 ILE A C     1 
ATOM   1330 O  O     . ILE A 1 182 ? -16.167 47.182 -15.529 1.00 63.42  ? 212 ILE A O     1 
ATOM   1331 C  CB    . ILE A 1 182 ? -17.770 45.064 -13.886 1.00 63.94  ? 212 ILE A CB    1 
ATOM   1332 C  CG1   . ILE A 1 182 ? -18.984 45.972 -14.100 1.00 64.63  ? 212 ILE A CG1   1 
ATOM   1333 C  CG2   . ILE A 1 182 ? -16.890 45.532 -12.705 1.00 65.03  ? 212 ILE A CG2   1 
ATOM   1334 C  CD1   . ILE A 1 182 ? -20.301 45.247 -13.792 1.00 65.97  ? 212 ILE A CD1   1 
ATOM   1335 N  N     . HIS A 1 183 ? -14.590 45.636 -15.038 1.00 63.46  ? 213 HIS A N     1 
ATOM   1336 C  CA    . HIS A 1 183 ? -13.462 46.569 -15.159 1.00 63.60  ? 213 HIS A CA    1 
ATOM   1337 C  C     . HIS A 1 183 ? -13.221 47.106 -16.582 1.00 63.23  ? 213 HIS A C     1 
ATOM   1338 O  O     . HIS A 1 183 ? -12.732 48.222 -16.738 1.00 62.72  ? 213 HIS A O     1 
ATOM   1339 C  CB    . HIS A 1 183 ? -12.181 45.947 -14.584 1.00 63.89  ? 213 HIS A CB    1 
ATOM   1340 C  CG    . HIS A 1 183 ? -12.229 45.781 -13.095 1.00 65.61  ? 213 HIS A CG    1 
ATOM   1341 N  ND1   . HIS A 1 183 ? -12.398 44.555 -12.483 1.00 67.61  ? 213 HIS A ND1   1 
ATOM   1342 C  CD2   . HIS A 1 183 ? -12.179 46.695 -12.096 1.00 66.50  ? 213 HIS A CD2   1 
ATOM   1343 C  CE1   . HIS A 1 183 ? -12.432 44.722 -11.172 1.00 67.07  ? 213 HIS A CE1   1 
ATOM   1344 N  NE2   . HIS A 1 183 ? -12.299 46.010 -10.912 1.00 66.72  ? 213 HIS A NE2   1 
ATOM   1345 N  N     . CYS A 1 184 ? -13.582 46.339 -17.612 1.00 63.02  ? 214 CYS A N     1 
ATOM   1346 C  CA    . CYS A 1 184 ? -13.390 46.801 -18.992 1.00 63.02  ? 214 CYS A CA    1 
ATOM   1347 C  C     . CYS A 1 184 ? -14.684 47.079 -19.804 1.00 62.57  ? 214 CYS A C     1 
ATOM   1348 O  O     . CYS A 1 184 ? -14.636 47.194 -21.032 1.00 62.39  ? 214 CYS A O     1 
ATOM   1349 C  CB    . CYS A 1 184 ? -12.456 45.840 -19.734 1.00 63.06  ? 214 CYS A CB    1 
ATOM   1350 S  SG    . CYS A 1 184 ? -12.794 44.119 -19.473 1.00 64.76  ? 214 CYS A SG    1 
ATOM   1351 N  N     . PHE A 1 185 ? -15.821 47.243 -19.127 1.00 61.94  ? 215 PHE A N     1 
ATOM   1352 C  CA    . PHE A 1 185 ? -17.081 47.486 -19.827 1.00 61.49  ? 215 PHE A CA    1 
ATOM   1353 C  C     . PHE A 1 185 ? -17.261 48.931 -20.317 1.00 61.58  ? 215 PHE A C     1 
ATOM   1354 O  O     . PHE A 1 185 ? -18.224 49.217 -21.037 1.00 61.70  ? 215 PHE A O     1 
ATOM   1355 C  CB    . PHE A 1 185 ? -18.288 47.087 -18.951 1.00 61.35  ? 215 PHE A CB    1 
ATOM   1356 C  CG    . PHE A 1 185 ? -18.563 45.588 -18.867 1.00 60.91  ? 215 PHE A CG    1 
ATOM   1357 C  CD1   . PHE A 1 185 ? -19.499 45.119 -17.964 1.00 60.45  ? 215 PHE A CD1   1 
ATOM   1358 C  CD2   . PHE A 1 185 ? -17.894 44.657 -19.657 1.00 60.94  ? 215 PHE A CD2   1 
ATOM   1359 C  CE1   . PHE A 1 185 ? -19.783 43.766 -17.860 1.00 60.83  ? 215 PHE A CE1   1 
ATOM   1360 C  CE2   . PHE A 1 185 ? -18.182 43.301 -19.552 1.00 60.84  ? 215 PHE A CE2   1 
ATOM   1361 C  CZ    . PHE A 1 185 ? -19.127 42.860 -18.654 1.00 60.29  ? 215 PHE A CZ    1 
ATOM   1362 N  N     . GLU A 1 186 ? -16.360 49.841 -19.942 1.00 61.71  ? 216 GLU A N     1 
ATOM   1363 C  CA    . GLU A 1 186 ? -16.522 51.273 -20.277 1.00 61.66  ? 216 GLU A CA    1 
ATOM   1364 C  C     . GLU A 1 186 ? -16.030 51.586 -21.686 1.00 61.37  ? 216 GLU A C     1 
ATOM   1365 O  O     . GLU A 1 186 ? -14.931 51.175 -22.062 1.00 61.21  ? 216 GLU A O     1 
ATOM   1366 C  CB    . GLU A 1 186 ? -15.760 52.147 -19.280 1.00 61.60  ? 216 GLU A CB    1 
ATOM   1367 C  CG    . GLU A 1 186 ? -16.112 53.628 -19.350 1.00 61.73  ? 216 GLU A CG    1 
ATOM   1368 C  CD    . GLU A 1 186 ? -15.064 54.531 -18.693 1.00 62.22  ? 216 GLU A CD    1 
ATOM   1369 O  OE1   . GLU A 1 186 ? -13.849 54.264 -18.841 1.00 61.53  ? 216 GLU A OE1   1 
ATOM   1370 O  OE2   . GLU A 1 186 ? -15.462 55.524 -18.035 1.00 63.66  ? 216 GLU A OE2   1 
ATOM   1371 N  N     . GLY A 1 187 ? -16.839 52.327 -22.448 1.00 61.11  ? 217 GLY A N     1 
ATOM   1372 C  CA    . GLY A 1 187 ? -16.476 52.763 -23.802 1.00 60.99  ? 217 GLY A CA    1 
ATOM   1373 C  C     . GLY A 1 187 ? -16.018 51.613 -24.676 1.00 60.99  ? 217 GLY A C     1 
ATOM   1374 O  O     . GLY A 1 187 ? -14.928 51.643 -25.251 1.00 60.74  ? 217 GLY A O     1 
ATOM   1375 N  N     . VAL A 1 188 ? -16.861 50.589 -24.750 1.00 61.09  ? 218 VAL A N     1 
ATOM   1376 C  CA    . VAL A 1 188 ? -16.536 49.358 -25.446 1.00 60.92  ? 218 VAL A CA    1 
ATOM   1377 C  C     . VAL A 1 188 ? -17.023 49.463 -26.871 1.00 60.78  ? 218 VAL A C     1 
ATOM   1378 O  O     . VAL A 1 188 ? -18.218 49.588 -27.112 1.00 60.88  ? 218 VAL A O     1 
ATOM   1379 C  CB    . VAL A 1 188 ? -17.207 48.168 -24.777 1.00 60.95  ? 218 VAL A CB    1 
ATOM   1380 C  CG1   . VAL A 1 188 ? -16.851 46.880 -25.501 1.00 61.61  ? 218 VAL A CG1   1 
ATOM   1381 C  CG2   . VAL A 1 188 ? -16.785 48.084 -23.340 1.00 60.97  ? 218 VAL A CG2   1 
ATOM   1382 N  N     . THR A 1 189 ? -16.087 49.428 -27.812 1.00 60.64  ? 219 THR A N     1 
ATOM   1383 C  CA    . THR A 1 189 ? -16.405 49.534 -29.235 1.00 60.41  ? 219 THR A CA    1 
ATOM   1384 C  C     . THR A 1 189 ? -17.065 48.252 -29.749 1.00 60.08  ? 219 THR A C     1 
ATOM   1385 O  O     . THR A 1 189 ? -18.095 48.304 -30.393 1.00 59.57  ? 219 THR A O     1 
ATOM   1386 C  CB    . THR A 1 189 ? -15.121 49.808 -30.052 1.00 60.41  ? 219 THR A CB    1 
ATOM   1387 O  OG1   . THR A 1 189 ? -14.343 50.805 -29.382 1.00 60.29  ? 219 THR A OG1   1 
ATOM   1388 C  CG2   . THR A 1 189 ? -15.450 50.286 -31.456 1.00 60.40  ? 219 THR A CG2   1 
ATOM   1389 N  N     . ALA A 1 190 ? -16.456 47.109 -29.445 1.00 60.06  ? 220 ALA A N     1 
ATOM   1390 C  CA    . ALA A 1 190 ? -16.921 45.826 -29.934 1.00 59.98  ? 220 ALA A CA    1 
ATOM   1391 C  C     . ALA A 1 190 ? -16.630 44.708 -28.936 1.00 60.33  ? 220 ALA A C     1 
ATOM   1392 O  O     . ALA A 1 190 ? -15.633 44.739 -28.216 1.00 59.97  ? 220 ALA A O     1 
ATOM   1393 C  CB    . ALA A 1 190 ? -16.276 45.511 -31.272 1.00 59.86  ? 220 ALA A CB    1 
ATOM   1394 N  N     . ILE A 1 191 ? -17.532 43.724 -28.917 1.00 60.84  ? 221 ILE A N     1 
ATOM   1395 C  CA    . ILE A 1 191 ? -17.396 42.500 -28.146 1.00 60.88  ? 221 ILE A CA    1 
ATOM   1396 C  C     . ILE A 1 191 ? -17.430 41.333 -29.124 1.00 61.01  ? 221 ILE A C     1 
ATOM   1397 O  O     . ILE A 1 191 ? -18.421 41.142 -29.821 1.00 61.27  ? 221 ILE A O     1 
ATOM   1398 C  CB    . ILE A 1 191 ? -18.575 42.313 -27.147 1.00 60.99  ? 221 ILE A CB    1 
ATOM   1399 C  CG1   . ILE A 1 191 ? -18.696 43.521 -26.211 1.00 61.29  ? 221 ILE A CG1   1 
ATOM   1400 C  CG2   . ILE A 1 191 ? -18.401 41.023 -26.340 1.00 60.86  ? 221 ILE A CG2   1 
ATOM   1401 C  CD1   . ILE A 1 191 ? -19.951 43.525 -25.338 1.00 60.68  ? 221 ILE A CD1   1 
ATOM   1402 N  N     . ILE A 1 192 ? -16.341 40.576 -29.191 1.00 61.33  ? 222 ILE A N     1 
ATOM   1403 C  CA    . ILE A 1 192 ? -16.347 39.286 -29.856 1.00 61.27  ? 222 ILE A CA    1 
ATOM   1404 C  C     . ILE A 1 192 ? -16.715 38.301 -28.758 1.00 61.47  ? 222 ILE A C     1 
ATOM   1405 O  O     . ILE A 1 192 ? -16.022 38.224 -27.742 1.00 61.00  ? 222 ILE A O     1 
ATOM   1406 C  CB    . ILE A 1 192 ? -14.971 38.893 -30.438 1.00 61.33  ? 222 ILE A CB    1 
ATOM   1407 C  CG1   . ILE A 1 192 ? -14.383 40.012 -31.302 1.00 61.63  ? 222 ILE A CG1   1 
ATOM   1408 C  CG2   . ILE A 1 192 ? -15.100 37.618 -31.259 1.00 60.82  ? 222 ILE A CG2   1 
ATOM   1409 C  CD1   . ILE A 1 192 ? -13.102 39.599 -32.056 1.00 61.33  ? 222 ILE A CD1   1 
ATOM   1410 N  N     . PHE A 1 193 ? -17.818 37.575 -28.952 1.00 61.74  ? 223 PHE A N     1 
ATOM   1411 C  CA    . PHE A 1 193 ? -18.317 36.631 -27.960 1.00 61.89  ? 223 PHE A CA    1 
ATOM   1412 C  C     . PHE A 1 193 ? -18.123 35.222 -28.481 1.00 62.37  ? 223 PHE A C     1 
ATOM   1413 O  O     . PHE A 1 193 ? -18.757 34.825 -29.465 1.00 62.89  ? 223 PHE A O     1 
ATOM   1414 C  CB    . PHE A 1 193 ? -19.796 36.870 -27.670 1.00 61.81  ? 223 PHE A CB    1 
ATOM   1415 C  CG    . PHE A 1 193 ? -20.321 36.057 -26.528 1.00 61.58  ? 223 PHE A CG    1 
ATOM   1416 C  CD1   . PHE A 1 193 ? -20.325 36.573 -25.238 1.00 61.82  ? 223 PHE A CD1   1 
ATOM   1417 C  CD2   . PHE A 1 193 ? -20.796 34.781 -26.733 1.00 60.91  ? 223 PHE A CD2   1 
ATOM   1418 C  CE1   . PHE A 1 193 ? -20.803 35.829 -24.180 1.00 61.89  ? 223 PHE A CE1   1 
ATOM   1419 C  CE2   . PHE A 1 193 ? -21.274 34.029 -25.674 1.00 61.35  ? 223 PHE A CE2   1 
ATOM   1420 C  CZ    . PHE A 1 193 ? -21.282 34.554 -24.399 1.00 61.54  ? 223 PHE A CZ    1 
ATOM   1421 N  N     . CYS A 1 194 ? -17.265 34.462 -27.809 1.00 62.48  ? 224 CYS A N     1 
ATOM   1422 C  CA    . CYS A 1 194 ? -16.916 33.140 -28.262 1.00 62.48  ? 224 CYS A CA    1 
ATOM   1423 C  C     . CYS A 1 194 ? -17.842 32.128 -27.650 1.00 62.79  ? 224 CYS A C     1 
ATOM   1424 O  O     . CYS A 1 194 ? -18.189 32.228 -26.478 1.00 62.91  ? 224 CYS A O     1 
ATOM   1425 C  CB    . CYS A 1 194 ? -15.488 32.811 -27.875 1.00 62.62  ? 224 CYS A CB    1 
ATOM   1426 S  SG    . CYS A 1 194 ? -14.353 33.895 -28.645 1.00 62.24  ? 224 CYS A SG    1 
ATOM   1427 N  N     . VAL A 1 195 ? -18.248 31.174 -28.482 1.00 63.27  ? 225 VAL A N     1 
ATOM   1428 C  CA    . VAL A 1 195 ? -19.022 30.020 -28.084 1.00 63.63  ? 225 VAL A CA    1 
ATOM   1429 C  C     . VAL A 1 195 ? -18.354 28.784 -28.702 1.00 64.29  ? 225 VAL A C     1 
ATOM   1430 O  O     . VAL A 1 195 ? -18.048 28.767 -29.895 1.00 64.51  ? 225 VAL A O     1 
ATOM   1431 C  CB    . VAL A 1 195 ? -20.454 30.134 -28.588 1.00 63.42  ? 225 VAL A CB    1 
ATOM   1432 C  CG1   . VAL A 1 195 ? -21.200 28.811 -28.399 1.00 63.40  ? 225 VAL A CG1   1 
ATOM   1433 C  CG2   . VAL A 1 195 ? -21.151 31.261 -27.879 1.00 62.78  ? 225 VAL A CG2   1 
ATOM   1434 N  N     . ALA A 1 196 ? -18.099 27.768 -27.887 1.00 64.78  ? 226 ALA A N     1 
ATOM   1435 C  CA    . ALA A 1 196 ? -17.573 26.510 -28.395 1.00 65.07  ? 226 ALA A CA    1 
ATOM   1436 C  C     . ALA A 1 196 ? -18.757 25.663 -28.823 1.00 65.14  ? 226 ALA A C     1 
ATOM   1437 O  O     . ALA A 1 196 ? -19.484 25.161 -27.966 1.00 65.43  ? 226 ALA A O     1 
ATOM   1438 C  CB    . ALA A 1 196 ? -16.750 25.785 -27.318 1.00 65.00  ? 226 ALA A CB    1 
ATOM   1439 N  N     . LEU A 1 197 ? -18.953 25.518 -30.137 1.00 65.03  ? 227 LEU A N     1 
ATOM   1440 C  CA    . LEU A 1 197 ? -20.046 24.705 -30.682 1.00 65.10  ? 227 LEU A CA    1 
ATOM   1441 C  C     . LEU A 1 197 ? -19.991 23.277 -30.171 1.00 65.34  ? 227 LEU A C     1 
ATOM   1442 O  O     . LEU A 1 197 ? -21.009 22.665 -29.881 1.00 65.36  ? 227 LEU A O     1 
ATOM   1443 C  CB    . LEU A 1 197 ? -19.994 24.680 -32.205 1.00 64.99  ? 227 LEU A CB    1 
ATOM   1444 C  CG    . LEU A 1 197 ? -20.484 25.938 -32.916 1.00 64.72  ? 227 LEU A CG    1 
ATOM   1445 C  CD1   . LEU A 1 197 ? -20.154 25.858 -34.405 1.00 63.54  ? 227 LEU A CD1   1 
ATOM   1446 C  CD2   . LEU A 1 197 ? -21.975 26.129 -32.675 1.00 63.28  ? 227 LEU A CD2   1 
ATOM   1447 N  N     . SER A 1 198 ? -18.781 22.760 -30.056 1.00 65.68  ? 228 SER A N     1 
ATOM   1448 C  CA    . SER A 1 198 ? -18.561 21.413 -29.592 1.00 65.86  ? 228 SER A CA    1 
ATOM   1449 C  C     . SER A 1 198 ? -18.983 21.182 -28.124 1.00 65.88  ? 228 SER A C     1 
ATOM   1450 O  O     . SER A 1 198 ? -18.951 20.051 -27.659 1.00 65.82  ? 228 SER A O     1 
ATOM   1451 C  CB    . SER A 1 198 ? -17.088 21.084 -29.772 1.00 65.78  ? 228 SER A CB    1 
ATOM   1452 O  OG    . SER A 1 198 ? -16.297 21.990 -29.012 1.00 67.06  ? 228 SER A OG    1 
ATOM   1453 N  N     . ASP A 1 199 ? -19.381 22.229 -27.402 1.00 66.00  ? 229 ASP A N     1 
ATOM   1454 C  CA    . ASP A 1 199 ? -19.852 22.084 -26.003 1.00 66.28  ? 229 ASP A CA    1 
ATOM   1455 C  C     . ASP A 1 199 ? -21.293 21.572 -25.829 1.00 65.35  ? 229 ASP A C     1 
ATOM   1456 O  O     . ASP A 1 199 ? -21.707 21.339 -24.715 1.00 64.92  ? 229 ASP A O     1 
ATOM   1457 C  CB    . ASP A 1 199 ? -19.756 23.431 -25.254 1.00 66.84  ? 229 ASP A CB    1 
ATOM   1458 C  CG    . ASP A 1 199 ? -18.334 23.798 -24.856 1.00 69.49  ? 229 ASP A CG    1 
ATOM   1459 O  OD1   . ASP A 1 199 ? -17.361 23.160 -25.342 1.00 73.62  ? 229 ASP A OD1   1 
ATOM   1460 O  OD2   . ASP A 1 199 ? -18.190 24.745 -24.038 1.00 73.03  ? 229 ASP A OD2   1 
ATOM   1461 N  N     . TYR A 1 200 ? -22.056 21.408 -26.902 1.00 65.07  ? 230 TYR A N     1 
ATOM   1462 C  CA    . TYR A 1 200 ? -23.497 21.085 -26.781 1.00 64.96  ? 230 TYR A CA    1 
ATOM   1463 C  C     . TYR A 1 200 ? -23.808 19.856 -25.918 1.00 64.95  ? 230 TYR A C     1 
ATOM   1464 O  O     . TYR A 1 200 ? -24.824 19.834 -25.233 1.00 64.80  ? 230 TYR A O     1 
ATOM   1465 C  CB    . TYR A 1 200 ? -24.166 20.945 -28.153 1.00 64.64  ? 230 TYR A CB    1 
ATOM   1466 C  CG    . TYR A 1 200 ? -23.716 19.743 -28.943 1.00 64.91  ? 230 TYR A CG    1 
ATOM   1467 C  CD1   . TYR A 1 200 ? -22.497 19.750 -29.628 1.00 65.18  ? 230 TYR A CD1   1 
ATOM   1468 C  CD2   . TYR A 1 200 ? -24.502 18.596 -29.015 1.00 63.99  ? 230 TYR A CD2   1 
ATOM   1469 C  CE1   . TYR A 1 200 ? -22.073 18.647 -30.362 1.00 64.54  ? 230 TYR A CE1   1 
ATOM   1470 C  CE2   . TYR A 1 200 ? -24.083 17.490 -29.735 1.00 63.98  ? 230 TYR A CE2   1 
ATOM   1471 C  CZ    . TYR A 1 200 ? -22.865 17.523 -30.408 1.00 64.43  ? 230 TYR A CZ    1 
ATOM   1472 O  OH    . TYR A 1 200 ? -22.432 16.443 -31.137 1.00 64.78  ? 230 TYR A OH    1 
ATOM   1473 N  N     . ASP A 1 201 ? -22.922 18.858 -25.927 1.00 64.99  ? 231 ASP A N     1 
ATOM   1474 C  CA    . ASP A 1 201 ? -23.144 17.606 -25.176 1.00 64.81  ? 231 ASP A CA    1 
ATOM   1475 C  C     . ASP A 1 201 ? -22.351 17.515 -23.858 1.00 64.03  ? 231 ASP A C     1 
ATOM   1476 O  O     . ASP A 1 201 ? -22.391 16.476 -23.193 1.00 63.96  ? 231 ASP A O     1 
ATOM   1477 C  CB    . ASP A 1 201 ? -22.811 16.392 -26.062 1.00 65.08  ? 231 ASP A CB    1 
ATOM   1478 C  CG    . ASP A 1 201 ? -21.320 16.302 -26.398 1.00 66.58  ? 231 ASP A CG    1 
ATOM   1479 O  OD1   . ASP A 1 201 ? -20.574 17.199 -25.952 1.00 67.71  ? 231 ASP A OD1   1 
ATOM   1480 O  OD2   . ASP A 1 201 ? -20.892 15.351 -27.103 1.00 68.70  ? 231 ASP A OD2   1 
ATOM   1481 N  N     . LEU A 1 202 ? -21.651 18.590 -23.489 1.00 63.24  ? 232 LEU A N     1 
ATOM   1482 C  CA    . LEU A 1 202 ? -20.766 18.601 -22.320 1.00 62.79  ? 232 LEU A CA    1 
ATOM   1483 C  C     . LEU A 1 202 ? -21.353 19.356 -21.115 1.00 62.75  ? 232 LEU A C     1 
ATOM   1484 O  O     . LEU A 1 202 ? -22.267 20.170 -21.259 1.00 62.95  ? 232 LEU A O     1 
ATOM   1485 C  CB    . LEU A 1 202 ? -19.425 19.238 -22.683 1.00 62.66  ? 232 LEU A CB    1 
ATOM   1486 C  CG    . LEU A 1 202 ? -18.651 18.792 -23.930 1.00 62.40  ? 232 LEU A CG    1 
ATOM   1487 C  CD1   . LEU A 1 202 ? -17.360 19.587 -24.049 1.00 61.20  ? 232 LEU A CD1   1 
ATOM   1488 C  CD2   . LEU A 1 202 ? -18.360 17.319 -23.917 1.00 62.13  ? 232 LEU A CD2   1 
ATOM   1489 N  N     . VAL A 1 203 ? -20.804 19.088 -19.930 1.00 62.51  ? 233 VAL A N     1 
ATOM   1490 C  CA    . VAL A 1 203 ? -21.166 19.814 -18.711 1.00 62.49  ? 233 VAL A CA    1 
ATOM   1491 C  C     . VAL A 1 203 ? -20.046 20.786 -18.321 1.00 62.58  ? 233 VAL A C     1 
ATOM   1492 O  O     . VAL A 1 203 ? -18.934 20.688 -18.837 1.00 62.53  ? 233 VAL A O     1 
ATOM   1493 C  CB    . VAL A 1 203 ? -21.446 18.846 -17.535 1.00 62.78  ? 233 VAL A CB    1 
ATOM   1494 C  CG1   . VAL A 1 203 ? -22.574 17.866 -17.895 1.00 62.05  ? 233 VAL A CG1   1 
ATOM   1495 C  CG2   . VAL A 1 203 ? -20.174 18.090 -17.133 1.00 62.48  ? 233 VAL A CG2   1 
ATOM   1496 N  N     . LEU A 1 204 ? -20.344 21.728 -17.426 1.00 62.89  ? 234 LEU A N     1 
ATOM   1497 C  CA    . LEU A 1 204 ? -19.366 22.750 -17.010 1.00 63.16  ? 234 LEU A CA    1 
ATOM   1498 C  C     . LEU A 1 204 ? -18.306 22.149 -16.088 1.00 63.57  ? 234 LEU A C     1 
ATOM   1499 O  O     . LEU A 1 204 ? -18.607 21.299 -15.238 1.00 63.33  ? 234 LEU A O     1 
ATOM   1500 C  CB    . LEU A 1 204 ? -20.036 23.930 -16.281 1.00 63.09  ? 234 LEU A CB    1 
ATOM   1501 C  CG    . LEU A 1 204 ? -20.646 25.093 -17.066 1.00 63.11  ? 234 LEU A CG    1 
ATOM   1502 C  CD1   . LEU A 1 204 ? -21.238 26.091 -16.088 1.00 62.21  ? 234 LEU A CD1   1 
ATOM   1503 C  CD2   . LEU A 1 204 ? -19.652 25.783 -18.008 1.00 61.91  ? 234 LEU A CD2   1 
ATOM   1504 N  N     . ALA A 1 205 ? -17.074 22.626 -16.231 1.00 63.91  ? 235 ALA A N     1 
ATOM   1505 C  CA    . ALA A 1 205 ? -15.970 22.128 -15.415 1.00 64.41  ? 235 ALA A CA    1 
ATOM   1506 C  C     . ALA A 1 205 ? -16.120 22.596 -13.972 1.00 64.92  ? 235 ALA A C     1 
ATOM   1507 O  O     . ALA A 1 205 ? -15.495 22.037 -13.058 1.00 65.00  ? 235 ALA A O     1 
ATOM   1508 C  CB    . ALA A 1 205 ? -14.631 22.577 -15.995 1.00 64.33  ? 235 ALA A CB    1 
ATOM   1509 N  N     . GLU A 1 206 ? -16.958 23.615 -13.779 1.00 65.31  ? 236 GLU A N     1 
ATOM   1510 C  CA    . GLU A 1 206 ? -17.218 24.190 -12.466 1.00 65.71  ? 236 GLU A CA    1 
ATOM   1511 C  C     . GLU A 1 206 ? -18.661 23.949 -12.009 1.00 66.04  ? 236 GLU A C     1 
ATOM   1512 O  O     . GLU A 1 206 ? -19.081 24.485 -10.998 1.00 66.19  ? 236 GLU A O     1 
ATOM   1513 C  CB    . GLU A 1 206 ? -16.886 25.692 -12.470 1.00 65.72  ? 236 GLU A CB    1 
ATOM   1514 C  CG    . GLU A 1 206 ? -17.801 26.595 -13.344 1.00 66.17  ? 236 GLU A CG    1 
ATOM   1515 C  CD    . GLU A 1 206 ? -17.393 26.673 -14.828 1.00 66.52  ? 236 GLU A CD    1 
ATOM   1516 O  OE1   . GLU A 1 206 ? -17.806 27.631 -15.510 1.00 66.54  ? 236 GLU A OE1   1 
ATOM   1517 O  OE2   . GLU A 1 206 ? -16.668 25.785 -15.321 1.00 68.38  ? 236 GLU A OE2   1 
ATOM   1518 N  N     . ASP A 1 207 ? -19.425 23.173 -12.771 1.00 66.42  ? 237 ASP A N     1 
ATOM   1519 C  CA    . ASP A 1 207 ? -20.679 22.601 -12.282 1.00 66.71  ? 237 ASP A CA    1 
ATOM   1520 C  C     . ASP A 1 207 ? -21.043 21.427 -13.182 1.00 66.89  ? 237 ASP A C     1 
ATOM   1521 O  O     . ASP A 1 207 ? -21.303 21.614 -14.362 1.00 67.20  ? 237 ASP A O     1 
ATOM   1522 C  CB    . ASP A 1 207 ? -21.817 23.631 -12.254 1.00 66.68  ? 237 ASP A CB    1 
ATOM   1523 C  CG    . ASP A 1 207 ? -23.060 23.121 -11.506 1.00 67.55  ? 237 ASP A CG    1 
ATOM   1524 O  OD1   . ASP A 1 207 ? -23.041 21.974 -11.012 1.00 69.51  ? 237 ASP A OD1   1 
ATOM   1525 O  OD2   . ASP A 1 207 ? -24.066 23.860 -11.394 1.00 67.92  ? 237 ASP A OD2   1 
ATOM   1526 N  N     . GLU A 1 208 ? -21.051 20.218 -12.628 1.00 67.12  ? 238 GLU A N     1 
ATOM   1527 C  CA    . GLU A 1 208 ? -21.361 19.017 -13.405 1.00 67.38  ? 238 GLU A CA    1 
ATOM   1528 C  C     . GLU A 1 208 ? -22.858 18.882 -13.721 1.00 67.70  ? 238 GLU A C     1 
ATOM   1529 O  O     . GLU A 1 208 ? -23.244 18.033 -14.518 1.00 67.50  ? 238 GLU A O     1 
ATOM   1530 C  CB    . GLU A 1 208 ? -20.860 17.764 -12.679 1.00 67.29  ? 238 GLU A CB    1 
ATOM   1531 N  N     . GLU A 1 209 ? -23.694 19.707 -13.093 1.00 68.28  ? 239 GLU A N     1 
ATOM   1532 C  CA    . GLU A 1 209 ? -25.141 19.671 -13.322 1.00 69.05  ? 239 GLU A CA    1 
ATOM   1533 C  C     . GLU A 1 209 ? -25.546 20.588 -14.469 1.00 68.95  ? 239 GLU A C     1 
ATOM   1534 O  O     . GLU A 1 209 ? -26.713 20.619 -14.859 1.00 69.06  ? 239 GLU A O     1 
ATOM   1535 C  CB    . GLU A 1 209 ? -25.918 20.101 -12.061 1.00 69.44  ? 239 GLU A CB    1 
ATOM   1536 C  CG    . GLU A 1 209 ? -25.557 19.340 -10.778 1.00 71.16  ? 239 GLU A CG    1 
ATOM   1537 C  CD    . GLU A 1 209 ? -25.908 17.859 -10.848 1.00 73.72  ? 239 GLU A CD    1 
ATOM   1538 O  OE1   . GLU A 1 209 ? -27.075 17.505 -10.531 1.00 74.38  ? 239 GLU A OE1   1 
ATOM   1539 O  OE2   . GLU A 1 209 ? -25.007 17.055 -11.208 1.00 74.79  ? 239 GLU A OE2   1 
ATOM   1540 N  N     . MET A 1 210 ? -24.593 21.344 -15.003 1.00 68.85  ? 240 MET A N     1 
ATOM   1541 C  CA    . MET A 1 210 ? -24.925 22.416 -15.920 1.00 68.59  ? 240 MET A CA    1 
ATOM   1542 C  C     . MET A 1 210 ? -24.333 22.178 -17.294 1.00 68.21  ? 240 MET A C     1 
ATOM   1543 O  O     . MET A 1 210 ? -23.114 22.123 -17.446 1.00 68.06  ? 240 MET A O     1 
ATOM   1544 C  CB    . MET A 1 210 ? -24.419 23.747 -15.367 1.00 68.62  ? 240 MET A CB    1 
ATOM   1545 C  CG    . MET A 1 210 ? -24.860 24.963 -16.180 1.00 69.22  ? 240 MET A CG    1 
ATOM   1546 S  SD    . MET A 1 210 ? -26.619 24.966 -16.633 1.00 69.15  ? 240 MET A SD    1 
ATOM   1547 C  CE    . MET A 1 210 ? -26.951 26.733 -16.631 1.00 69.33  ? 240 MET A CE    1 
ATOM   1548 N  N     . ASN A 1 211 ? -25.215 22.060 -18.286 1.00 67.66  ? 241 ASN A N     1 
ATOM   1549 C  CA    . ASN A 1 211 ? -24.818 21.940 -19.686 1.00 67.36  ? 241 ASN A CA    1 
ATOM   1550 C  C     . ASN A 1 211 ? -24.104 23.212 -20.210 1.00 67.24  ? 241 ASN A C     1 
ATOM   1551 O  O     . ASN A 1 211 ? -24.659 24.311 -20.151 1.00 67.33  ? 241 ASN A O     1 
ATOM   1552 C  CB    . ASN A 1 211 ? -26.058 21.617 -20.529 1.00 67.04  ? 241 ASN A CB    1 
ATOM   1553 C  CG    . ASN A 1 211 ? -25.748 21.481 -22.005 1.00 66.58  ? 241 ASN A CG    1 
ATOM   1554 O  OD1   . ASN A 1 211 ? -25.684 22.470 -22.719 1.00 66.49  ? 241 ASN A OD1   1 
ATOM   1555 N  ND2   . ASN A 1 211 ? -25.571 20.250 -22.470 1.00 66.02  ? 241 ASN A ND2   1 
ATOM   1556 N  N     . ARG A 1 212 ? -22.893 23.048 -20.740 1.00 66.80  ? 242 ARG A N     1 
ATOM   1557 C  CA    . ARG A 1 212 ? -22.064 24.187 -21.176 1.00 66.76  ? 242 ARG A CA    1 
ATOM   1558 C  C     . ARG A 1 212 ? -22.686 25.115 -22.223 1.00 66.51  ? 242 ARG A C     1 
ATOM   1559 O  O     . ARG A 1 212 ? -22.361 26.302 -22.261 1.00 66.57  ? 242 ARG A O     1 
ATOM   1560 C  CB    . ARG A 1 212 ? -20.723 23.695 -21.729 1.00 66.72  ? 242 ARG A CB    1 
ATOM   1561 C  CG    . ARG A 1 212 ? -19.798 23.132 -20.693 1.00 66.39  ? 242 ARG A CG    1 
ATOM   1562 C  CD    . ARG A 1 212 ? -18.588 22.539 -21.344 1.00 66.55  ? 242 ARG A CD    1 
ATOM   1563 N  NE    . ARG A 1 212 ? -17.464 22.430 -20.424 1.00 67.57  ? 242 ARG A NE    1 
ATOM   1564 C  CZ    . ARG A 1 212 ? -16.183 22.535 -20.772 1.00 68.01  ? 242 ARG A CZ    1 
ATOM   1565 N  NH1   . ARG A 1 212 ? -15.827 22.770 -22.029 1.00 69.46  ? 242 ARG A NH1   1 
ATOM   1566 N  NH2   . ARG A 1 212 ? -15.247 22.416 -19.845 1.00 67.96  ? 242 ARG A NH2   1 
ATOM   1567 N  N     . MET A 1 213 ? -23.534 24.577 -23.090 1.00 66.20  ? 243 MET A N     1 
ATOM   1568 C  CA    . MET A 1 213 ? -24.179 25.388 -24.118 1.00 66.40  ? 243 MET A CA    1 
ATOM   1569 C  C     . MET A 1 213 ? -25.297 26.235 -23.477 1.00 66.07  ? 243 MET A C     1 
ATOM   1570 O  O     . MET A 1 213 ? -25.438 27.414 -23.783 1.00 65.67  ? 243 MET A O     1 
ATOM   1571 C  CB    . MET A 1 213 ? -24.710 24.490 -25.251 1.00 66.79  ? 243 MET A CB    1 
ATOM   1572 C  CG    . MET A 1 213 ? -25.209 25.195 -26.533 1.00 67.65  ? 243 MET A CG    1 
ATOM   1573 S  SD    . MET A 1 213 ? -23.896 25.724 -27.663 1.00 72.02  ? 243 MET A SD    1 
ATOM   1574 C  CE    . MET A 1 213 ? -23.375 24.197 -28.440 1.00 70.04  ? 243 MET A CE    1 
ATOM   1575 N  N     . HIS A 1 214 ? -26.079 25.646 -22.579 1.00 65.86  ? 244 HIS A N     1 
ATOM   1576 C  CA    . HIS A 1 214 ? -27.112 26.406 -21.880 1.00 65.93  ? 244 HIS A CA    1 
ATOM   1577 C  C     . HIS A 1 214 ? -26.493 27.500 -21.032 1.00 65.69  ? 244 HIS A C     1 
ATOM   1578 O  O     . HIS A 1 214 ? -27.107 28.547 -20.815 1.00 65.40  ? 244 HIS A O     1 
ATOM   1579 C  CB    . HIS A 1 214 ? -27.991 25.499 -21.018 1.00 66.29  ? 244 HIS A CB    1 
ATOM   1580 C  CG    . HIS A 1 214 ? -28.933 24.650 -21.812 1.00 67.08  ? 244 HIS A CG    1 
ATOM   1581 N  ND1   . HIS A 1 214 ? -29.072 23.294 -21.601 1.00 68.60  ? 244 HIS A ND1   1 
ATOM   1582 C  CD2   . HIS A 1 214 ? -29.775 24.963 -22.826 1.00 67.83  ? 244 HIS A CD2   1 
ATOM   1583 C  CE1   . HIS A 1 214 ? -29.965 22.810 -22.449 1.00 68.81  ? 244 HIS A CE1   1 
ATOM   1584 N  NE2   . HIS A 1 214 ? -30.405 23.802 -23.204 1.00 68.39  ? 244 HIS A NE2   1 
ATOM   1585 N  N     . GLU A 1 215 ? -25.273 27.249 -20.559 1.00 65.73  ? 245 GLU A N     1 
ATOM   1586 C  CA    . GLU A 1 215 ? -24.487 28.251 -19.854 1.00 65.49  ? 245 GLU A CA    1 
ATOM   1587 C  C     . GLU A 1 215 ? -24.095 29.408 -20.762 1.00 65.27  ? 245 GLU A C     1 
ATOM   1588 O  O     . GLU A 1 215 ? -24.356 30.562 -20.421 1.00 65.54  ? 245 GLU A O     1 
ATOM   1589 C  CB    . GLU A 1 215 ? -23.235 27.621 -19.253 1.00 65.56  ? 245 GLU A CB    1 
ATOM   1590 C  CG    . GLU A 1 215 ? -22.408 28.570 -18.400 1.00 66.04  ? 245 GLU A CG    1 
ATOM   1591 C  CD    . GLU A 1 215 ? -23.091 28.960 -17.102 1.00 66.30  ? 245 GLU A CD    1 
ATOM   1592 O  OE1   . GLU A 1 215 ? -24.277 28.645 -16.899 1.00 67.79  ? 245 GLU A OE1   1 
ATOM   1593 O  OE2   . GLU A 1 215 ? -22.429 29.585 -16.264 1.00 67.05  ? 245 GLU A OE2   1 
ATOM   1594 N  N     . SER A 1 216 ? -23.463 29.106 -21.899 1.00 64.91  ? 246 SER A N     1 
ATOM   1595 C  CA    . SER A 1 216 ? -23.121 30.133 -22.902 1.00 64.73  ? 246 SER A CA    1 
ATOM   1596 C  C     . SER A 1 216 ? -24.328 30.948 -23.357 1.00 64.22  ? 246 SER A C     1 
ATOM   1597 O  O     . SER A 1 216 ? -24.203 32.131 -23.631 1.00 64.44  ? 246 SER A O     1 
ATOM   1598 C  CB    . SER A 1 216 ? -22.473 29.506 -24.142 1.00 64.76  ? 246 SER A CB    1 
ATOM   1599 O  OG    . SER A 1 216 ? -21.060 29.505 -24.042 1.00 65.99  ? 246 SER A OG    1 
ATOM   1600 N  N     . MET A 1 217 ? -25.489 30.305 -23.460 1.00 63.78  ? 247 MET A N     1 
ATOM   1601 C  CA    . MET A 1 217 ? -26.711 30.980 -23.882 1.00 63.12  ? 247 MET A CA    1 
ATOM   1602 C  C     . MET A 1 217 ? -27.166 31.999 -22.825 1.00 63.27  ? 247 MET A C     1 
ATOM   1603 O  O     . MET A 1 217 ? -27.450 33.148 -23.153 1.00 63.42  ? 247 MET A O     1 
ATOM   1604 C  CB    . MET A 1 217 ? -27.826 29.968 -24.161 1.00 63.04  ? 247 MET A CB    1 
ATOM   1605 C  CG    . MET A 1 217 ? -27.680 29.164 -25.450 1.00 62.19  ? 247 MET A CG    1 
ATOM   1606 S  SD    . MET A 1 217 ? -29.092 28.034 -25.691 1.00 61.71  ? 247 MET A SD    1 
ATOM   1607 C  CE    . MET A 1 217 ? -30.433 29.168 -26.044 1.00 60.23  ? 247 MET A CE    1 
ATOM   1608 N  N     . LYS A 1 218 ? -27.224 31.592 -21.560 1.00 63.06  ? 248 LYS A N     1 
ATOM   1609 C  CA    . LYS A 1 218 ? -27.571 32.532 -20.481 1.00 62.90  ? 248 LYS A CA    1 
ATOM   1610 C  C     . LYS A 1 218 ? -26.572 33.691 -20.428 1.00 62.59  ? 248 LYS A C     1 
ATOM   1611 O  O     . LYS A 1 218 ? -26.963 34.848 -20.240 1.00 62.66  ? 248 LYS A O     1 
ATOM   1612 C  CB    . LYS A 1 218 ? -27.662 31.827 -19.115 1.00 62.76  ? 248 LYS A CB    1 
ATOM   1613 C  CG    . LYS A 1 218 ? -28.961 31.047 -18.904 1.00 63.18  ? 248 LYS A CG    1 
ATOM   1614 C  CD    . LYS A 1 218 ? -28.862 30.059 -17.730 1.00 63.23  ? 248 LYS A CD    1 
ATOM   1615 N  N     . LEU A 1 219 ? -25.291 33.377 -20.606 1.00 62.21  ? 249 LEU A N     1 
ATOM   1616 C  CA    . LEU A 1 219 ? -24.243 34.395 -20.628 1.00 62.08  ? 249 LEU A CA    1 
ATOM   1617 C  C     . LEU A 1 219 ? -24.467 35.345 -21.790 1.00 62.01  ? 249 LEU A C     1 
ATOM   1618 O  O     . LEU A 1 219 ? -24.327 36.560 -21.649 1.00 61.83  ? 249 LEU A O     1 
ATOM   1619 C  CB    . LEU A 1 219 ? -22.854 33.749 -20.748 1.00 61.95  ? 249 LEU A CB    1 
ATOM   1620 C  CG    . LEU A 1 219 ? -21.655 34.540 -20.231 1.00 61.67  ? 249 LEU A CG    1 
ATOM   1621 C  CD1   . LEU A 1 219 ? -21.856 34.972 -18.791 1.00 59.39  ? 249 LEU A CD1   1 
ATOM   1622 C  CD2   . LEU A 1 219 ? -20.384 33.690 -20.370 1.00 62.14  ? 249 LEU A CD2   1 
ATOM   1623 N  N     . PHE A 1 220 ? -24.830 34.789 -22.941 1.00 62.08  ? 250 PHE A N     1 
ATOM   1624 C  CA    . PHE A 1 220 ? -25.041 35.607 -24.122 1.00 62.21  ? 250 PHE A CA    1 
ATOM   1625 C  C     . PHE A 1 220 ? -26.305 36.446 -23.998 1.00 62.52  ? 250 PHE A C     1 
ATOM   1626 O  O     . PHE A 1 220 ? -26.328 37.586 -24.440 1.00 62.84  ? 250 PHE A O     1 
ATOM   1627 C  CB    . PHE A 1 220 ? -25.085 34.756 -25.385 1.00 62.05  ? 250 PHE A CB    1 
ATOM   1628 C  CG    . PHE A 1 220 ? -25.207 35.560 -26.643 1.00 61.50  ? 250 PHE A CG    1 
ATOM   1629 C  CD1   . PHE A 1 220 ? -24.115 36.237 -27.148 1.00 61.47  ? 250 PHE A CD1   1 
ATOM   1630 C  CD2   . PHE A 1 220 ? -26.419 35.646 -27.316 1.00 61.47  ? 250 PHE A CD2   1 
ATOM   1631 C  CE1   . PHE A 1 220 ? -24.223 36.989 -28.307 1.00 61.53  ? 250 PHE A CE1   1 
ATOM   1632 C  CE2   . PHE A 1 220 ? -26.531 36.386 -28.475 1.00 61.26  ? 250 PHE A CE2   1 
ATOM   1633 C  CZ    . PHE A 1 220 ? -25.434 37.061 -28.970 1.00 61.17  ? 250 PHE A CZ    1 
ATOM   1634 N  N     . ASP A 1 221 ? -27.350 35.906 -23.385 1.00 62.94  ? 251 ASP A N     1 
ATOM   1635 C  CA    . ASP A 1 221 ? -28.562 36.686 -23.189 1.00 63.52  ? 251 ASP A CA    1 
ATOM   1636 C  C     . ASP A 1 221 ? -28.209 37.961 -22.427 1.00 63.82  ? 251 ASP A C     1 
ATOM   1637 O  O     . ASP A 1 221 ? -28.624 39.056 -22.802 1.00 63.92  ? 251 ASP A O     1 
ATOM   1638 C  CB    . ASP A 1 221 ? -29.636 35.880 -22.450 1.00 63.70  ? 251 ASP A CB    1 
ATOM   1639 C  CG    . ASP A 1 221 ? -30.984 36.599 -22.399 1.00 64.62  ? 251 ASP A CG    1 
ATOM   1640 O  OD1   . ASP A 1 221 ? -31.204 37.557 -23.173 1.00 65.20  ? 251 ASP A OD1   1 
ATOM   1641 O  OD2   . ASP A 1 221 ? -31.835 36.207 -21.575 1.00 66.38  ? 251 ASP A OD2   1 
ATOM   1642 N  N     . SER A 1 222 ? -27.399 37.809 -21.385 1.00 64.30  ? 252 SER A N     1 
ATOM   1643 C  CA    . SER A 1 222 ? -27.009 38.926 -20.517 1.00 64.51  ? 252 SER A CA    1 
ATOM   1644 C  C     . SER A 1 222 ? -26.014 39.934 -21.112 1.00 64.21  ? 252 SER A C     1 
ATOM   1645 O  O     . SER A 1 222 ? -26.033 41.091 -20.715 1.00 64.36  ? 252 SER A O     1 
ATOM   1646 C  CB    . SER A 1 222 ? -26.437 38.395 -19.205 1.00 64.63  ? 252 SER A CB    1 
ATOM   1647 O  OG    . SER A 1 222 ? -25.566 39.354 -18.628 1.00 66.37  ? 252 SER A OG    1 
ATOM   1648 N  N     . ILE A 1 223 ? -25.129 39.514 -22.013 1.00 63.85  ? 253 ILE A N     1 
ATOM   1649 C  CA    . ILE A 1 223 ? -24.226 40.471 -22.670 1.00 63.68  ? 253 ILE A CA    1 
ATOM   1650 C  C     . ILE A 1 223 ? -24.909 41.129 -23.873 1.00 63.83  ? 253 ILE A C     1 
ATOM   1651 O  O     . ILE A 1 223 ? -24.892 42.342 -24.016 1.00 63.48  ? 253 ILE A O     1 
ATOM   1652 C  CB    . ILE A 1 223 ? -22.897 39.809 -23.121 1.00 63.62  ? 253 ILE A CB    1 
ATOM   1653 C  CG1   . ILE A 1 223 ? -22.070 39.318 -21.912 1.00 63.00  ? 253 ILE A CG1   1 
ATOM   1654 C  CG2   . ILE A 1 223 ? -22.099 40.755 -23.997 1.00 62.71  ? 253 ILE A CG2   1 
ATOM   1655 C  CD1   . ILE A 1 223 ? -21.828 40.326 -20.827 1.00 61.78  ? 253 ILE A CD1   1 
ATOM   1656 N  N     . CYS A 1 224 ? -25.515 40.319 -24.733 1.00 64.44  ? 254 CYS A N     1 
ATOM   1657 C  CA    . CYS A 1 224 ? -26.247 40.833 -25.894 1.00 64.60  ? 254 CYS A CA    1 
ATOM   1658 C  C     . CYS A 1 224 ? -27.208 41.963 -25.521 1.00 64.27  ? 254 CYS A C     1 
ATOM   1659 O  O     . CYS A 1 224 ? -27.258 42.978 -26.200 1.00 64.32  ? 254 CYS A O     1 
ATOM   1660 C  CB    . CYS A 1 224 ? -27.046 39.711 -26.569 1.00 64.72  ? 254 CYS A CB    1 
ATOM   1661 S  SG    . CYS A 1 224 ? -27.944 40.218 -28.075 1.00 65.68  ? 254 CYS A SG    1 
ATOM   1662 N  N     . ASN A 1 225 ? -27.961 41.783 -24.440 1.00 63.91  ? 255 ASN A N     1 
ATOM   1663 C  CA    . ASN A 1 225 ? -29.043 42.705 -24.097 1.00 63.62  ? 255 ASN A CA    1 
ATOM   1664 C  C     . ASN A 1 225 ? -28.671 43.715 -23.005 1.00 63.72  ? 255 ASN A C     1 
ATOM   1665 O  O     . ASN A 1 225 ? -29.507 44.528 -22.606 1.00 63.55  ? 255 ASN A O     1 
ATOM   1666 C  CB    . ASN A 1 225 ? -30.302 41.912 -23.709 1.00 63.30  ? 255 ASN A CB    1 
ATOM   1667 C  CG    . ASN A 1 225 ? -30.762 40.972 -24.815 1.00 62.20  ? 255 ASN A CG    1 
ATOM   1668 O  OD1   . ASN A 1 225 ? -31.071 41.398 -25.924 1.00 59.74  ? 255 ASN A OD1   1 
ATOM   1669 N  ND2   . ASN A 1 225 ? -30.798 39.685 -24.515 1.00 62.12  ? 255 ASN A ND2   1 
ATOM   1670 N  N     . ASN A 1 226 ? -27.413 43.682 -22.555 1.00 63.83  ? 256 ASN A N     1 
ATOM   1671 C  CA    . ASN A 1 226 ? -26.948 44.550 -21.472 1.00 63.79  ? 256 ASN A CA    1 
ATOM   1672 C  C     . ASN A 1 226 ? -26.990 46.015 -21.864 1.00 63.64  ? 256 ASN A C     1 
ATOM   1673 O  O     . ASN A 1 226 ? -26.595 46.369 -22.971 1.00 63.69  ? 256 ASN A O     1 
ATOM   1674 C  CB    . ASN A 1 226 ? -25.517 44.198 -21.067 1.00 63.76  ? 256 ASN A CB    1 
ATOM   1675 C  CG    . ASN A 1 226 ? -25.096 44.850 -19.751 1.00 64.29  ? 256 ASN A CG    1 
ATOM   1676 O  OD1   . ASN A 1 226 ? -25.248 46.065 -19.548 1.00 64.78  ? 256 ASN A OD1   1 
ATOM   1677 N  ND2   . ASN A 1 226 ? -24.554 44.042 -18.852 1.00 64.37  ? 256 ASN A ND2   1 
ATOM   1678 N  N     . LYS A 1 227 ? -27.447 46.856 -20.939 1.00 63.52  ? 257 LYS A N     1 
ATOM   1679 C  CA    . LYS A 1 227 ? -27.527 48.301 -21.172 1.00 63.48  ? 257 LYS A CA    1 
ATOM   1680 C  C     . LYS A 1 227 ? -26.175 48.904 -21.596 1.00 63.66  ? 257 LYS A C     1 
ATOM   1681 O  O     . LYS A 1 227 ? -26.137 49.788 -22.464 1.00 63.86  ? 257 LYS A O     1 
ATOM   1682 C  CB    . LYS A 1 227 ? -28.115 49.036 -19.946 1.00 63.33  ? 257 LYS A CB    1 
ATOM   1683 C  CG    . LYS A 1 227 ? -27.393 48.799 -18.610 1.00 63.29  ? 257 LYS A CG    1 
ATOM   1684 C  CD    . LYS A 1 227 ? -28.062 49.538 -17.451 1.00 62.93  ? 257 LYS A CD    1 
ATOM   1685 N  N     . TRP A 1 228 ? -25.075 48.403 -21.025 1.00 63.45  ? 258 TRP A N     1 
ATOM   1686 C  CA    . TRP A 1 228 ? -23.734 48.940 -21.313 1.00 63.28  ? 258 TRP A CA    1 
ATOM   1687 C  C     . TRP A 1 228 ? -23.399 48.966 -22.799 1.00 63.02  ? 258 TRP A C     1 
ATOM   1688 O  O     . TRP A 1 228 ? -22.598 49.788 -23.236 1.00 62.59  ? 258 TRP A O     1 
ATOM   1689 C  CB    . TRP A 1 228 ? -22.619 48.123 -20.634 1.00 63.45  ? 258 TRP A CB    1 
ATOM   1690 C  CG    . TRP A 1 228 ? -22.721 47.855 -19.140 1.00 63.44  ? 258 TRP A CG    1 
ATOM   1691 C  CD1   . TRP A 1 228 ? -22.323 46.713 -18.488 1.00 63.50  ? 258 TRP A CD1   1 
ATOM   1692 C  CD2   . TRP A 1 228 ? -23.230 48.729 -18.128 1.00 63.56  ? 258 TRP A CD2   1 
ATOM   1693 N  NE1   . TRP A 1 228 ? -22.549 46.827 -17.137 1.00 63.39  ? 258 TRP A NE1   1 
ATOM   1694 C  CE2   . TRP A 1 228 ? -23.116 48.049 -16.891 1.00 63.44  ? 258 TRP A CE2   1 
ATOM   1695 C  CE3   . TRP A 1 228 ? -23.775 50.016 -18.143 1.00 63.17  ? 258 TRP A CE3   1 
ATOM   1696 C  CZ2   . TRP A 1 228 ? -23.524 48.614 -15.694 1.00 63.28  ? 258 TRP A CZ2   1 
ATOM   1697 C  CZ3   . TRP A 1 228 ? -24.178 50.570 -16.958 1.00 63.57  ? 258 TRP A CZ3   1 
ATOM   1698 C  CH2   . TRP A 1 228 ? -24.049 49.872 -15.744 1.00 63.65  ? 258 TRP A CH2   1 
ATOM   1699 N  N     . PHE A 1 229 ? -24.003 48.059 -23.564 1.00 62.99  ? 259 PHE A N     1 
ATOM   1700 C  CA    . PHE A 1 229 ? -23.548 47.762 -24.922 1.00 62.99  ? 259 PHE A CA    1 
ATOM   1701 C  C     . PHE A 1 229 ? -24.527 48.120 -26.035 1.00 62.96  ? 259 PHE A C     1 
ATOM   1702 O  O     . PHE A 1 229 ? -24.399 47.643 -27.162 1.00 62.81  ? 259 PHE A O     1 
ATOM   1703 C  CB    . PHE A 1 229 ? -23.180 46.291 -24.991 1.00 62.89  ? 259 PHE A CB    1 
ATOM   1704 C  CG    . PHE A 1 229 ? -22.193 45.875 -23.940 1.00 63.11  ? 259 PHE A CG    1 
ATOM   1705 C  CD1   . PHE A 1 229 ? -21.016 46.596 -23.745 1.00 62.81  ? 259 PHE A CD1   1 
ATOM   1706 C  CD2   . PHE A 1 229 ? -22.432 44.765 -23.148 1.00 62.87  ? 259 PHE A CD2   1 
ATOM   1707 C  CE1   . PHE A 1 229 ? -20.099 46.213 -22.785 1.00 62.77  ? 259 PHE A CE1   1 
ATOM   1708 C  CE2   . PHE A 1 229 ? -21.511 44.370 -22.191 1.00 63.46  ? 259 PHE A CE2   1 
ATOM   1709 C  CZ    . PHE A 1 229 ? -20.343 45.096 -22.010 1.00 63.02  ? 259 PHE A CZ    1 
ATOM   1710 N  N     . THR A 1 230 ? -25.473 48.998 -25.727 1.00 63.15  ? 260 THR A N     1 
ATOM   1711 C  CA    . THR A 1 230 ? -26.384 49.545 -26.725 1.00 63.38  ? 260 THR A CA    1 
ATOM   1712 C  C     . THR A 1 230 ? -25.616 50.117 -27.920 1.00 63.47  ? 260 THR A C     1 
ATOM   1713 O  O     . THR A 1 230 ? -26.061 50.025 -29.062 1.00 63.66  ? 260 THR A O     1 
ATOM   1714 C  CB    . THR A 1 230 ? -27.265 50.655 -26.104 1.00 63.41  ? 260 THR A CB    1 
ATOM   1715 O  OG1   . THR A 1 230 ? -27.957 50.137 -24.955 1.00 63.31  ? 260 THR A OG1   1 
ATOM   1716 C  CG2   . THR A 1 230 ? -28.266 51.172 -27.115 1.00 63.02  ? 260 THR A CG2   1 
ATOM   1717 N  N     . ASP A 1 231 ? -24.451 50.688 -27.634 1.00 63.64  ? 261 ASP A N     1 
ATOM   1718 C  CA    . ASP A 1 231 ? -23.597 51.310 -28.636 1.00 63.58  ? 261 ASP A CA    1 
ATOM   1719 C  C     . ASP A 1 231 ? -22.381 50.437 -29.031 1.00 63.06  ? 261 ASP A C     1 
ATOM   1720 O  O     . ASP A 1 231 ? -21.464 50.929 -29.679 1.00 63.04  ? 261 ASP A O     1 
ATOM   1721 C  CB    . ASP A 1 231 ? -23.121 52.662 -28.081 1.00 63.77  ? 261 ASP A CB    1 
ATOM   1722 C  CG    . ASP A 1 231 ? -22.995 53.730 -29.150 1.00 64.96  ? 261 ASP A CG    1 
ATOM   1723 O  OD1   . ASP A 1 231 ? -23.049 53.393 -30.352 1.00 66.83  ? 261 ASP A OD1   1 
ATOM   1724 O  OD2   . ASP A 1 231 ? -22.843 54.916 -28.783 1.00 66.37  ? 261 ASP A OD2   1 
ATOM   1725 N  N     . THR A 1 232 ? -22.378 49.157 -28.655 1.00 62.40  ? 262 THR A N     1 
ATOM   1726 C  CA    . THR A 1 232 ? -21.268 48.250 -28.970 1.00 61.95  ? 262 THR A CA    1 
ATOM   1727 C  C     . THR A 1 232 ? -21.645 47.241 -30.056 1.00 61.73  ? 262 THR A C     1 
ATOM   1728 O  O     . THR A 1 232 ? -22.776 46.762 -30.106 1.00 61.95  ? 262 THR A O     1 
ATOM   1729 C  CB    . THR A 1 232 ? -20.822 47.451 -27.732 1.00 61.85  ? 262 THR A CB    1 
ATOM   1730 O  OG1   . THR A 1 232 ? -20.460 48.345 -26.676 1.00 61.59  ? 262 THR A OG1   1 
ATOM   1731 C  CG2   . THR A 1 232 ? -19.639 46.568 -28.058 1.00 61.37  ? 262 THR A CG2   1 
ATOM   1732 N  N     . SER A 1 233 ? -20.679 46.909 -30.908 1.00 61.30  ? 263 SER A N     1 
ATOM   1733 C  CA    . SER A 1 233 ? -20.871 45.930 -31.974 1.00 60.95  ? 263 SER A CA    1 
ATOM   1734 C  C     . SER A 1 233 ? -20.793 44.517 -31.411 1.00 60.88  ? 263 SER A C     1 
ATOM   1735 O  O     . SER A 1 233 ? -19.710 44.032 -31.065 1.00 60.74  ? 263 SER A O     1 
ATOM   1736 C  CB    . SER A 1 233 ? -19.820 46.113 -33.078 1.00 60.84  ? 263 SER A CB    1 
ATOM   1737 O  OG    . SER A 1 233 ? -19.995 47.349 -33.767 1.00 60.83  ? 263 SER A OG    1 
ATOM   1738 N  N     . ILE A 1 234 ? -21.945 43.855 -31.310 1.00 60.61  ? 264 ILE A N     1 
ATOM   1739 C  CA    . ILE A 1 234 ? -21.984 42.491 -30.803 1.00 60.20  ? 264 ILE A CA    1 
ATOM   1740 C  C     . ILE A 1 234 ? -21.640 41.516 -31.916 1.00 59.99  ? 264 ILE A C     1 
ATOM   1741 O  O     . ILE A 1 234 ? -22.386 41.382 -32.892 1.00 59.73  ? 264 ILE A O     1 
ATOM   1742 C  CB    . ILE A 1 234 ? -23.340 42.135 -30.219 1.00 60.08  ? 264 ILE A CB    1 
ATOM   1743 C  CG1   . ILE A 1 234 ? -23.633 43.018 -29.007 1.00 60.65  ? 264 ILE A CG1   1 
ATOM   1744 C  CG2   . ILE A 1 234 ? -23.356 40.686 -29.794 1.00 60.12  ? 264 ILE A CG2   1 
ATOM   1745 C  CD1   . ILE A 1 234 ? -22.753 42.743 -27.817 1.00 60.47  ? 264 ILE A CD1   1 
ATOM   1746 N  N     . ILE A 1 235 ? -20.492 40.853 -31.760 1.00 59.62  ? 265 ILE A N     1 
ATOM   1747 C  CA    . ILE A 1 235 ? -20.014 39.872 -32.718 1.00 59.20  ? 265 ILE A CA    1 
ATOM   1748 C  C     . ILE A 1 235 ? -19.982 38.516 -32.040 1.00 59.56  ? 265 ILE A C     1 
ATOM   1749 O  O     . ILE A 1 235 ? -19.462 38.387 -30.930 1.00 59.42  ? 265 ILE A O     1 
ATOM   1750 C  CB    . ILE A 1 235 ? -18.611 40.207 -33.214 1.00 59.07  ? 265 ILE A CB    1 
ATOM   1751 C  CG1   . ILE A 1 235 ? -18.593 41.603 -33.842 1.00 58.07  ? 265 ILE A CG1   1 
ATOM   1752 C  CG2   . ILE A 1 235 ? -18.139 39.149 -34.207 1.00 58.73  ? 265 ILE A CG2   1 
ATOM   1753 C  CD1   . ILE A 1 235 ? -17.241 42.042 -34.246 1.00 57.74  ? 265 ILE A CD1   1 
ATOM   1754 N  N     . LEU A 1 236 ? -20.535 37.515 -32.729 1.00 59.76  ? 266 LEU A N     1 
ATOM   1755 C  CA    . LEU A 1 236 ? -20.736 36.178 -32.199 1.00 59.51  ? 266 LEU A CA    1 
ATOM   1756 C  C     . LEU A 1 236 ? -19.906 35.184 -32.999 1.00 59.65  ? 266 LEU A C     1 
ATOM   1757 O  O     . LEU A 1 236 ? -20.187 34.924 -34.163 1.00 59.75  ? 266 LEU A O     1 
ATOM   1758 C  CB    . LEU A 1 236 ? -22.221 35.823 -32.295 1.00 59.63  ? 266 LEU A CB    1 
ATOM   1759 C  CG    . LEU A 1 236 ? -22.689 34.458 -31.789 1.00 59.62  ? 266 LEU A CG    1 
ATOM   1760 C  CD1   . LEU A 1 236 ? -22.154 34.179 -30.380 1.00 58.79  ? 266 LEU A CD1   1 
ATOM   1761 C  CD2   . LEU A 1 236 ? -24.223 34.385 -31.843 1.00 59.19  ? 266 LEU A CD2   1 
ATOM   1762 N  N     . PHE A 1 237 ? -18.870 34.650 -32.367 1.00 59.69  ? 267 PHE A N     1 
ATOM   1763 C  CA    . PHE A 1 237 ? -18.035 33.618 -32.953 1.00 59.46  ? 267 PHE A CA    1 
ATOM   1764 C  C     . PHE A 1 237 ? -18.573 32.260 -32.540 1.00 59.49  ? 267 PHE A C     1 
ATOM   1765 O  O     . PHE A 1 237 ? -18.517 31.905 -31.368 1.00 59.50  ? 267 PHE A O     1 
ATOM   1766 C  CB    . PHE A 1 237 ? -16.604 33.759 -32.437 1.00 59.40  ? 267 PHE A CB    1 
ATOM   1767 C  CG    . PHE A 1 237 ? -15.769 34.748 -33.192 1.00 59.38  ? 267 PHE A CG    1 
ATOM   1768 C  CD1   . PHE A 1 237 ? -16.344 35.717 -34.007 1.00 59.67  ? 267 PHE A CD1   1 
ATOM   1769 C  CD2   . PHE A 1 237 ? -14.382 34.714 -33.067 1.00 58.71  ? 267 PHE A CD2   1 
ATOM   1770 C  CE1   . PHE A 1 237 ? -15.550 36.614 -34.690 1.00 59.24  ? 267 PHE A CE1   1 
ATOM   1771 C  CE2   . PHE A 1 237 ? -13.592 35.607 -33.736 1.00 57.90  ? 267 PHE A CE2   1 
ATOM   1772 C  CZ    . PHE A 1 237 ? -14.173 36.561 -34.544 1.00 59.23  ? 267 PHE A CZ    1 
ATOM   1773 N  N     . LEU A 1 238 ? -19.109 31.509 -33.493 1.00 59.60  ? 268 LEU A N     1 
ATOM   1774 C  CA    . LEU A 1 238 ? -19.483 30.129 -33.247 1.00 59.75  ? 268 LEU A CA    1 
ATOM   1775 C  C     . LEU A 1 238 ? -18.244 29.287 -33.561 1.00 60.22  ? 268 LEU A C     1 
ATOM   1776 O  O     . LEU A 1 238 ? -17.934 28.978 -34.718 1.00 60.34  ? 268 LEU A O     1 
ATOM   1777 C  CB    . LEU A 1 238 ? -20.706 29.752 -34.081 1.00 59.59  ? 268 LEU A CB    1 
ATOM   1778 C  CG    . LEU A 1 238 ? -21.939 30.603 -33.727 1.00 59.60  ? 268 LEU A CG    1 
ATOM   1779 C  CD1   . LEU A 1 238 ? -23.186 30.188 -34.519 1.00 58.47  ? 268 LEU A CD1   1 
ATOM   1780 C  CD2   . LEU A 1 238 ? -22.221 30.563 -32.216 1.00 58.47  ? 268 LEU A CD2   1 
ATOM   1781 N  N     . ASN A 1 239 ? -17.521 28.947 -32.506 1.00 60.57  ? 269 ASN A N     1 
ATOM   1782 C  CA    . ASN A 1 239 ? -16.145 28.506 -32.620 1.00 61.02  ? 269 ASN A CA    1 
ATOM   1783 C  C     . ASN A 1 239 ? -16.017 26.990 -32.515 1.00 61.47  ? 269 ASN A C     1 
ATOM   1784 O  O     . ASN A 1 239 ? -17.012 26.301 -32.314 1.00 61.77  ? 269 ASN A O     1 
ATOM   1785 C  CB    . ASN A 1 239 ? -15.326 29.189 -31.532 1.00 61.08  ? 269 ASN A CB    1 
ATOM   1786 C  CG    . ASN A 1 239 ? -13.854 29.008 -31.723 1.00 61.02  ? 269 ASN A CG    1 
ATOM   1787 O  OD1   . ASN A 1 239 ? -13.364 28.994 -32.851 1.00 61.30  ? 269 ASN A OD1   1 
ATOM   1788 N  ND2   . ASN A 1 239 ? -13.132 28.855 -30.622 1.00 60.18  ? 269 ASN A ND2   1 
ATOM   1789 N  N     . LYS A 1 240 ? -14.798 26.473 -32.669 1.00 61.98  ? 270 LYS A N     1 
ATOM   1790 C  CA    . LYS A 1 240 ? -14.551 25.030 -32.677 1.00 62.24  ? 270 LYS A CA    1 
ATOM   1791 C  C     . LYS A 1 240 ? -15.491 24.285 -33.648 1.00 62.81  ? 270 LYS A C     1 
ATOM   1792 O  O     . LYS A 1 240 ? -16.008 23.209 -33.333 1.00 62.92  ? 270 LYS A O     1 
ATOM   1793 C  CB    . LYS A 1 240 ? -14.646 24.462 -31.253 1.00 62.21  ? 270 LYS A CB    1 
ATOM   1794 C  CG    . LYS A 1 240 ? -13.474 24.850 -30.339 1.00 61.28  ? 270 LYS A CG    1 
ATOM   1795 C  CD    . LYS A 1 240 ? -13.829 24.627 -28.877 1.00 59.77  ? 270 LYS A CD    1 
ATOM   1796 C  CE    . LYS A 1 240 ? -12.604 24.630 -27.976 1.00 59.18  ? 270 LYS A CE    1 
ATOM   1797 N  NZ    . LYS A 1 240 ? -12.929 24.245 -26.564 1.00 57.73  ? 270 LYS A NZ    1 
ATOM   1798 N  N     . LYS A 1 241 ? -15.696 24.854 -34.837 1.00 63.39  ? 271 LYS A N     1 
ATOM   1799 C  CA    . LYS A 1 241 ? -16.554 24.221 -35.847 1.00 63.86  ? 271 LYS A CA    1 
ATOM   1800 C  C     . LYS A 1 241 ? -15.947 22.912 -36.331 1.00 64.17  ? 271 LYS A C     1 
ATOM   1801 O  O     . LYS A 1 241 ? -16.671 21.959 -36.642 1.00 64.62  ? 271 LYS A O     1 
ATOM   1802 C  CB    . LYS A 1 241 ? -16.845 25.158 -37.031 1.00 63.81  ? 271 LYS A CB    1 
ATOM   1803 C  CG    . LYS A 1 241 ? -15.659 25.532 -37.902 1.00 64.04  ? 271 LYS A CG    1 
ATOM   1804 C  CD    . LYS A 1 241 ? -16.040 26.621 -38.907 1.00 64.20  ? 271 LYS A CD    1 
ATOM   1805 C  CE    . LYS A 1 241 ? -15.008 26.794 -40.024 1.00 64.80  ? 271 LYS A CE    1 
ATOM   1806 N  NZ    . LYS A 1 241 ? -15.679 27.118 -41.335 1.00 66.24  ? 271 LYS A NZ    1 
ATOM   1807 N  N     . ASP A 1 242 ? -14.620 22.854 -36.377 1.00 64.34  ? 272 ASP A N     1 
ATOM   1808 C  CA    . ASP A 1 242 ? -13.946 21.627 -36.785 1.00 64.60  ? 272 ASP A CA    1 
ATOM   1809 C  C     . ASP A 1 242 ? -14.242 20.499 -35.802 1.00 64.56  ? 272 ASP A C     1 
ATOM   1810 O  O     . ASP A 1 242 ? -14.540 19.386 -36.224 1.00 64.85  ? 272 ASP A O     1 
ATOM   1811 C  CB    . ASP A 1 242 ? -12.437 21.844 -36.952 1.00 64.59  ? 272 ASP A CB    1 
ATOM   1812 C  CG    . ASP A 1 242 ? -11.739 22.147 -35.654 1.00 65.40  ? 272 ASP A CG    1 
ATOM   1813 O  OD1   . ASP A 1 242 ? -12.372 22.754 -34.753 1.00 65.49  ? 272 ASP A OD1   1 
ATOM   1814 O  OD2   . ASP A 1 242 ? -10.549 21.774 -35.542 1.00 66.20  ? 272 ASP A OD2   1 
ATOM   1815 N  N     . LEU A 1 243 ? -14.192 20.793 -34.503 1.00 64.56  ? 273 LEU A N     1 
ATOM   1816 C  CA    . LEU A 1 243 ? -14.494 19.788 -33.481 1.00 64.70  ? 273 LEU A CA    1 
ATOM   1817 C  C     . LEU A 1 243 ? -15.964 19.381 -33.497 1.00 64.80  ? 273 LEU A C     1 
ATOM   1818 O  O     . LEU A 1 243 ? -16.293 18.222 -33.250 1.00 64.51  ? 273 LEU A O     1 
ATOM   1819 C  CB    . LEU A 1 243 ? -14.114 20.290 -32.089 1.00 64.59  ? 273 LEU A CB    1 
ATOM   1820 C  CG    . LEU A 1 243 ? -12.613 20.481 -31.889 1.00 64.74  ? 273 LEU A CG    1 
ATOM   1821 C  CD1   . LEU A 1 243 ? -12.331 21.194 -30.554 1.00 64.72  ? 273 LEU A CD1   1 
ATOM   1822 C  CD2   . LEU A 1 243 ? -11.879 19.138 -31.989 1.00 62.79  ? 273 LEU A CD2   1 
ATOM   1823 N  N     . PHE A 1 244 ? -16.829 20.348 -33.793 1.00 65.16  ? 274 PHE A N     1 
ATOM   1824 C  CA    . PHE A 1 244 ? -18.270 20.126 -33.871 1.00 65.40  ? 274 PHE A CA    1 
ATOM   1825 C  C     . PHE A 1 244 ? -18.580 19.211 -35.043 1.00 66.01  ? 274 PHE A C     1 
ATOM   1826 O  O     . PHE A 1 244 ? -19.337 18.246 -34.904 1.00 65.90  ? 274 PHE A O     1 
ATOM   1827 C  CB    . PHE A 1 244 ? -18.983 21.477 -34.001 1.00 65.28  ? 274 PHE A CB    1 
ATOM   1828 C  CG    . PHE A 1 244 ? -20.470 21.386 -34.275 1.00 65.04  ? 274 PHE A CG    1 
ATOM   1829 C  CD1   . PHE A 1 244 ? -21.361 21.060 -33.274 1.00 64.42  ? 274 PHE A CD1   1 
ATOM   1830 C  CD2   . PHE A 1 244 ? -20.972 21.693 -35.529 1.00 64.82  ? 274 PHE A CD2   1 
ATOM   1831 C  CE1   . PHE A 1 244 ? -22.716 21.011 -33.524 1.00 64.77  ? 274 PHE A CE1   1 
ATOM   1832 C  CE2   . PHE A 1 244 ? -22.331 21.652 -35.791 1.00 64.74  ? 274 PHE A CE2   1 
ATOM   1833 C  CZ    . PHE A 1 244 ? -23.204 21.312 -34.788 1.00 64.99  ? 274 PHE A CZ    1 
ATOM   1834 N  N     . GLU A 1 245 ? -17.963 19.504 -36.188 1.00 66.74  ? 275 GLU A N     1 
ATOM   1835 C  CA    . GLU A 1 245 ? -18.157 18.723 -37.421 1.00 67.47  ? 275 GLU A CA    1 
ATOM   1836 C  C     . GLU A 1 245 ? -17.963 17.224 -37.204 1.00 67.37  ? 275 GLU A C     1 
ATOM   1837 O  O     . GLU A 1 245 ? -18.756 16.427 -37.690 1.00 67.53  ? 275 GLU A O     1 
ATOM   1838 C  CB    . GLU A 1 245 ? -17.181 19.195 -38.499 1.00 67.50  ? 275 GLU A CB    1 
ATOM   1839 C  CG    . GLU A 1 245 ? -17.527 18.764 -39.906 1.00 68.42  ? 275 GLU A CG    1 
ATOM   1840 C  CD    . GLU A 1 245 ? -16.409 19.040 -40.903 1.00 69.20  ? 275 GLU A CD    1 
ATOM   1841 O  OE1   . GLU A 1 245 ? -15.280 19.395 -40.477 1.00 71.75  ? 275 GLU A OE1   1 
ATOM   1842 O  OE2   . GLU A 1 245 ? -16.663 18.890 -42.124 1.00 72.27  ? 275 GLU A OE2   1 
ATOM   1843 N  N     . GLU A 1 246 ? -16.913 16.846 -36.476 1.00 67.66  ? 276 GLU A N     1 
ATOM   1844 C  CA    . GLU A 1 246 ? -16.582 15.430 -36.279 1.00 67.81  ? 276 GLU A CA    1 
ATOM   1845 C  C     . GLU A 1 246 ? -17.272 14.844 -35.048 1.00 67.80  ? 276 GLU A C     1 
ATOM   1846 O  O     . GLU A 1 246 ? -17.238 13.637 -34.834 1.00 68.03  ? 276 GLU A O     1 
ATOM   1847 C  CB    . GLU A 1 246 ? -15.060 15.231 -36.210 1.00 68.07  ? 276 GLU A CB    1 
ATOM   1848 C  CG    . GLU A 1 246 ? -14.363 15.306 -37.586 1.00 68.09  ? 276 GLU A CG    1 
ATOM   1849 N  N     . LYS A 1 247 ? -17.905 15.703 -34.250 1.00 67.79  ? 277 LYS A N     1 
ATOM   1850 C  CA    . LYS A 1 247 ? -18.756 15.266 -33.141 1.00 67.55  ? 277 LYS A CA    1 
ATOM   1851 C  C     . LYS A 1 247 ? -20.140 14.845 -33.603 1.00 67.37  ? 277 LYS A C     1 
ATOM   1852 O  O     . LYS A 1 247 ? -20.618 13.774 -33.256 1.00 67.65  ? 277 LYS A O     1 
ATOM   1853 C  CB    . LYS A 1 247 ? -18.953 16.393 -32.124 1.00 67.56  ? 277 LYS A CB    1 
ATOM   1854 C  CG    . LYS A 1 247 ? -18.104 16.291 -30.884 1.00 68.08  ? 277 LYS A CG    1 
ATOM   1855 C  CD    . LYS A 1 247 ? -18.852 16.834 -29.675 1.00 68.09  ? 277 LYS A CD    1 
ATOM   1856 C  CE    . LYS A 1 247 ? -17.888 17.140 -28.562 1.00 68.70  ? 277 LYS A CE    1 
ATOM   1857 N  NZ    . LYS A 1 247 ? -18.594 17.570 -27.340 1.00 69.12  ? 277 LYS A NZ    1 
ATOM   1858 N  N     . ILE A 1 248 ? -20.776 15.706 -34.382 1.00 67.06  ? 278 ILE A N     1 
ATOM   1859 C  CA    . ILE A 1 248 ? -22.231 15.724 -34.492 1.00 66.99  ? 278 ILE A CA    1 
ATOM   1860 C  C     . ILE A 1 248 ? -22.873 14.423 -35.016 1.00 67.25  ? 278 ILE A C     1 
ATOM   1861 O  O     . ILE A 1 248 ? -23.995 14.079 -34.631 1.00 67.79  ? 278 ILE A O     1 
ATOM   1862 C  CB    . ILE A 1 248 ? -22.685 16.959 -35.319 1.00 67.03  ? 278 ILE A CB    1 
ATOM   1863 C  CG1   . ILE A 1 248 ? -24.161 17.273 -35.064 1.00 66.85  ? 278 ILE A CG1   1 
ATOM   1864 C  CG2   . ILE A 1 248 ? -22.357 16.792 -36.812 1.00 66.45  ? 278 ILE A CG2   1 
ATOM   1865 C  CD1   . ILE A 1 248 ? -24.430 17.794 -33.681 1.00 65.77  ? 278 ILE A CD1   1 
ATOM   1866 N  N     . LYS A 1 249 ? -22.167 13.691 -35.872 1.00 67.26  ? 279 LYS A N     1 
ATOM   1867 C  CA    . LYS A 1 249 ? -22.673 12.408 -36.358 1.00 66.95  ? 279 LYS A CA    1 
ATOM   1868 C  C     . LYS A 1 249 ? -22.570 11.325 -35.275 1.00 66.91  ? 279 LYS A C     1 
ATOM   1869 O  O     . LYS A 1 249 ? -23.298 10.328 -35.327 1.00 67.09  ? 279 LYS A O     1 
ATOM   1870 C  CB    . LYS A 1 249 ? -21.920 11.979 -37.617 1.00 67.10  ? 279 LYS A CB    1 
ATOM   1871 C  CG    . LYS A 1 249 ? -22.197 12.846 -38.841 1.00 66.94  ? 279 LYS A CG    1 
ATOM   1872 C  CD    . LYS A 1 249 ? -21.270 12.489 -40.003 1.00 66.81  ? 279 LYS A CD    1 
ATOM   1873 N  N     . LYS A 1 250 ? -21.675 11.526 -34.304 1.00 66.67  ? 280 LYS A N     1 
ATOM   1874 C  CA    . LYS A 1 250 ? -21.492 10.599 -33.175 1.00 66.73  ? 280 LYS A CA    1 
ATOM   1875 C  C     . LYS A 1 250 ? -22.430 10.902 -31.982 1.00 66.44  ? 280 LYS A C     1 
ATOM   1876 O  O     . LYS A 1 250 ? -22.959 9.976  -31.377 1.00 66.64  ? 280 LYS A O     1 
ATOM   1877 C  CB    . LYS A 1 250 ? -20.034 10.605 -32.672 1.00 66.86  ? 280 LYS A CB    1 
ATOM   1878 C  CG    . LYS A 1 250 ? -18.939 10.407 -33.750 1.00 67.69  ? 280 LYS A CG    1 
ATOM   1879 C  CD    . LYS A 1 250 ? -17.502 10.477 -33.154 1.00 66.75  ? 280 LYS A CD    1 
ATOM   1880 N  N     . SER A 1 251 ? -22.626 12.176 -31.636 1.00 65.90  ? 281 SER A N     1 
ATOM   1881 C  CA    . SER A 1 251 ? -23.444 12.545 -30.468 1.00 65.43  ? 281 SER A CA    1 
ATOM   1882 C  C     . SER A 1 251 ? -24.550 13.546 -30.835 1.00 64.88  ? 281 SER A C     1 
ATOM   1883 O  O     . SER A 1 251 ? -24.273 14.631 -31.348 1.00 64.64  ? 281 SER A O     1 
ATOM   1884 C  CB    . SER A 1 251 ? -22.567 13.131 -29.365 1.00 65.70  ? 281 SER A CB    1 
ATOM   1885 O  OG    . SER A 1 251 ? -23.358 13.588 -28.277 1.00 66.76  ? 281 SER A OG    1 
ATOM   1886 N  N     . PRO A 1 252 ? -25.812 13.189 -30.551 1.00 64.12  ? 282 PRO A N     1 
ATOM   1887 C  CA    . PRO A 1 252 ? -26.920 13.993 -31.036 1.00 63.51  ? 282 PRO A CA    1 
ATOM   1888 C  C     . PRO A 1 252 ? -27.140 15.300 -30.273 1.00 62.97  ? 282 PRO A C     1 
ATOM   1889 O  O     . PRO A 1 252 ? -26.916 15.381 -29.071 1.00 62.93  ? 282 PRO A O     1 
ATOM   1890 C  CB    . PRO A 1 252 ? -28.123 13.064 -30.869 1.00 63.56  ? 282 PRO A CB    1 
ATOM   1891 C  CG    . PRO A 1 252 ? -27.761 12.181 -29.727 1.00 63.87  ? 282 PRO A CG    1 
ATOM   1892 C  CD    . PRO A 1 252 ? -26.268 12.028 -29.762 1.00 64.09  ? 282 PRO A CD    1 
ATOM   1893 N  N     . LEU A 1 253 ? -27.618 16.301 -31.000 1.00 62.60  ? 283 LEU A N     1 
ATOM   1894 C  CA    . LEU A 1 253 ? -27.847 17.635 -30.475 1.00 62.29  ? 283 LEU A CA    1 
ATOM   1895 C  C     . LEU A 1 253 ? -28.992 17.683 -29.465 1.00 62.09  ? 283 LEU A C     1 
ATOM   1896 O  O     . LEU A 1 253 ? -29.102 18.644 -28.707 1.00 62.14  ? 283 LEU A O     1 
ATOM   1897 C  CB    . LEU A 1 253 ? -28.137 18.588 -31.645 1.00 62.36  ? 283 LEU A CB    1 
ATOM   1898 C  CG    . LEU A 1 253 ? -28.233 20.089 -31.374 1.00 62.12  ? 283 LEU A CG    1 
ATOM   1899 C  CD1   . LEU A 1 253 ? -27.073 20.547 -30.520 1.00 62.05  ? 283 LEU A CD1   1 
ATOM   1900 C  CD2   . LEU A 1 253 ? -28.286 20.881 -32.676 1.00 61.96  ? 283 LEU A CD2   1 
ATOM   1901 N  N     . THR A 1 254 ? -29.837 16.654 -29.461 1.00 61.70  ? 284 THR A N     1 
ATOM   1902 C  CA    . THR A 1 254 ? -30.955 16.558 -28.526 1.00 61.59  ? 284 THR A CA    1 
ATOM   1903 C  C     . THR A 1 254 ? -30.509 16.551 -27.069 1.00 61.65  ? 284 THR A C     1 
ATOM   1904 O  O     . THR A 1 254 ? -31.282 16.895 -26.174 1.00 61.19  ? 284 THR A O     1 
ATOM   1905 C  CB    . THR A 1 254 ? -31.746 15.284 -28.770 1.00 61.67  ? 284 THR A CB    1 
ATOM   1906 O  OG1   . THR A 1 254 ? -30.824 14.196 -28.894 1.00 61.94  ? 284 THR A OG1   1 
ATOM   1907 C  CG2   . THR A 1 254 ? -32.598 15.404 -30.043 1.00 60.96  ? 284 THR A CG2   1 
ATOM   1908 N  N     . ILE A 1 255 ? -29.266 16.134 -26.838 1.00 62.08  ? 285 ILE A N     1 
ATOM   1909 C  CA    . ILE A 1 255 ? -28.637 16.264 -25.535 1.00 62.26  ? 285 ILE A CA    1 
ATOM   1910 C  C     . ILE A 1 255 ? -28.788 17.705 -25.071 1.00 62.71  ? 285 ILE A C     1 
ATOM   1911 O  O     . ILE A 1 255 ? -29.193 17.967 -23.944 1.00 63.13  ? 285 ILE A O     1 
ATOM   1912 C  CB    . ILE A 1 255 ? -27.149 15.945 -25.598 1.00 62.32  ? 285 ILE A CB    1 
ATOM   1913 C  CG1   . ILE A 1 255 ? -26.926 14.461 -25.888 1.00 62.78  ? 285 ILE A CG1   1 
ATOM   1914 C  CG2   . ILE A 1 255 ? -26.470 16.317 -24.291 1.00 61.80  ? 285 ILE A CG2   1 
ATOM   1915 C  CD1   . ILE A 1 255 ? -25.462 14.100 -26.086 1.00 63.31  ? 285 ILE A CD1   1 
ATOM   1916 N  N     . CYS A 1 256 ? -28.485 18.637 -25.966 1.00 62.98  ? 286 CYS A N     1 
ATOM   1917 C  CA    . CYS A 1 256 ? -28.548 20.056 -25.658 1.00 62.85  ? 286 CYS A CA    1 
ATOM   1918 C  C     . CYS A 1 256 ? -29.902 20.725 -25.918 1.00 62.92  ? 286 CYS A C     1 
ATOM   1919 O  O     . CYS A 1 256 ? -30.251 21.703 -25.249 1.00 62.90  ? 286 CYS A O     1 
ATOM   1920 C  CB    . CYS A 1 256 ? -27.522 20.775 -26.491 1.00 62.83  ? 286 CYS A CB    1 
ATOM   1921 S  SG    . CYS A 1 256 ? -27.339 22.418 -25.947 1.00 63.94  ? 286 CYS A SG    1 
ATOM   1922 N  N     . TYR A 1 257 ? -30.630 20.233 -26.920 1.00 62.66  ? 287 TYR A N     1 
ATOM   1923 C  CA    . TYR A 1 257 ? -31.925 20.793 -27.298 1.00 62.47  ? 287 TYR A CA    1 
ATOM   1924 C  C     . TYR A 1 257 ? -32.915 19.653 -27.547 1.00 61.82  ? 287 TYR A C     1 
ATOM   1925 O  O     . TYR A 1 257 ? -33.057 19.164 -28.667 1.00 61.00  ? 287 TYR A O     1 
ATOM   1926 C  CB    . TYR A 1 257 ? -31.798 21.659 -28.552 1.00 62.94  ? 287 TYR A CB    1 
ATOM   1927 C  CG    . TYR A 1 257 ? -30.857 22.842 -28.429 1.00 63.58  ? 287 TYR A CG    1 
ATOM   1928 C  CD1   . TYR A 1 257 ? -31.283 24.046 -27.866 1.00 64.12  ? 287 TYR A CD1   1 
ATOM   1929 C  CD2   . TYR A 1 257 ? -29.544 22.765 -28.900 1.00 63.78  ? 287 TYR A CD2   1 
ATOM   1930 C  CE1   . TYR A 1 257 ? -30.420 25.141 -27.759 1.00 63.96  ? 287 TYR A CE1   1 
ATOM   1931 C  CE2   . TYR A 1 257 ? -28.673 23.845 -28.798 1.00 63.84  ? 287 TYR A CE2   1 
ATOM   1932 C  CZ    . TYR A 1 257 ? -29.115 25.036 -28.231 1.00 64.25  ? 287 TYR A CZ    1 
ATOM   1933 O  OH    . TYR A 1 257 ? -28.250 26.119 -28.141 1.00 64.38  ? 287 TYR A OH    1 
ATOM   1934 N  N     . PRO A 1 258 ? -33.598 19.214 -26.489 1.00 61.43  ? 288 PRO A N     1 
ATOM   1935 C  CA    . PRO A 1 258 ? -34.555 18.126 -26.615 1.00 61.23  ? 288 PRO A CA    1 
ATOM   1936 C  C     . PRO A 1 258 ? -35.597 18.379 -27.706 1.00 61.14  ? 288 PRO A C     1 
ATOM   1937 O  O     . PRO A 1 258 ? -36.048 17.441 -28.345 1.00 61.25  ? 288 PRO A O     1 
ATOM   1938 C  CB    . PRO A 1 258 ? -35.215 18.089 -25.238 1.00 61.16  ? 288 PRO A CB    1 
ATOM   1939 C  CG    . PRO A 1 258 ? -34.246 18.665 -24.331 1.00 61.34  ? 288 PRO A CG    1 
ATOM   1940 C  CD    . PRO A 1 258 ? -33.501 19.702 -25.106 1.00 61.32  ? 288 PRO A CD    1 
ATOM   1941 N  N     . GLU A 1 259 ? -35.954 19.643 -27.919 1.00 61.05  ? 289 GLU A N     1 
ATOM   1942 C  CA    . GLU A 1 259 ? -36.920 20.047 -28.953 1.00 60.91  ? 289 GLU A CA    1 
ATOM   1943 C  C     . GLU A 1 259 ? -36.555 19.673 -30.409 1.00 60.64  ? 289 GLU A C     1 
ATOM   1944 O  O     . GLU A 1 259 ? -37.443 19.614 -31.271 1.00 60.25  ? 289 GLU A O     1 
ATOM   1945 C  CB    . GLU A 1 259 ? -37.118 21.570 -28.875 1.00 60.85  ? 289 GLU A CB    1 
ATOM   1946 N  N     . TYR A 1 260 ? -35.268 19.409 -30.657 1.00 60.46  ? 290 TYR A N     1 
ATOM   1947 C  CA    . TYR A 1 260 ? -34.678 19.388 -32.002 1.00 60.47  ? 290 TYR A CA    1 
ATOM   1948 C  C     . TYR A 1 260 ? -35.230 18.304 -32.926 1.00 60.51  ? 290 TYR A C     1 
ATOM   1949 O  O     . TYR A 1 260 ? -35.097 17.111 -32.646 1.00 60.73  ? 290 TYR A O     1 
ATOM   1950 C  CB    . TYR A 1 260 ? -33.160 19.242 -31.888 1.00 60.69  ? 290 TYR A CB    1 
ATOM   1951 C  CG    . TYR A 1 260 ? -32.375 19.377 -33.186 1.00 61.11  ? 290 TYR A CG    1 
ATOM   1952 C  CD1   . TYR A 1 260 ? -32.637 20.406 -34.096 1.00 61.26  ? 290 TYR A CD1   1 
ATOM   1953 C  CD2   . TYR A 1 260 ? -31.329 18.496 -33.478 1.00 61.74  ? 290 TYR A CD2   1 
ATOM   1954 C  CE1   . TYR A 1 260 ? -31.901 20.530 -35.279 1.00 61.46  ? 290 TYR A CE1   1 
ATOM   1955 C  CE2   . TYR A 1 260 ? -30.585 18.612 -34.656 1.00 61.27  ? 290 TYR A CE2   1 
ATOM   1956 C  CZ    . TYR A 1 260 ? -30.871 19.629 -35.549 1.00 61.51  ? 290 TYR A CZ    1 
ATOM   1957 O  OH    . TYR A 1 260 ? -30.130 19.735 -36.709 1.00 61.00  ? 290 TYR A OH    1 
ATOM   1958 N  N     . ALA A 1 261 ? -35.838 18.738 -34.033 1.00 60.15  ? 291 ALA A N     1 
ATOM   1959 C  CA    . ALA A 1 261 ? -36.448 17.838 -35.003 1.00 59.76  ? 291 ALA A CA    1 
ATOM   1960 C  C     . ALA A 1 261 ? -35.539 17.583 -36.199 1.00 59.54  ? 291 ALA A C     1 
ATOM   1961 O  O     . ALA A 1 261 ? -35.838 16.739 -37.015 1.00 59.33  ? 291 ALA A O     1 
ATOM   1962 C  CB    . ALA A 1 261 ? -37.761 18.409 -35.471 1.00 59.71  ? 291 ALA A CB    1 
ATOM   1963 N  N     . GLY A 1 262 ? -34.425 18.302 -36.290 1.00 59.62  ? 292 GLY A N     1 
ATOM   1964 C  CA    . GLY A 1 262 ? -33.542 18.234 -37.453 1.00 59.54  ? 292 GLY A CA    1 
ATOM   1965 C  C     . GLY A 1 262 ? -32.470 17.168 -37.382 1.00 59.51  ? 292 GLY A C     1 
ATOM   1966 O  O     . GLY A 1 262 ? -32.264 16.546 -36.342 1.00 59.75  ? 292 GLY A O     1 
ATOM   1967 N  N     . SER A 1 263 ? -31.769 16.977 -38.497 1.00 59.43  ? 293 SER A N     1 
ATOM   1968 C  CA    . SER A 1 263 ? -30.743 15.939 -38.615 1.00 59.50  ? 293 SER A CA    1 
ATOM   1969 C  C     . SER A 1 263 ? -29.477 16.267 -37.843 1.00 59.58  ? 293 SER A C     1 
ATOM   1970 O  O     . SER A 1 263 ? -29.071 17.421 -37.783 1.00 59.83  ? 293 SER A O     1 
ATOM   1971 C  CB    . SER A 1 263 ? -30.365 15.728 -40.079 1.00 59.41  ? 293 SER A CB    1 
ATOM   1972 O  OG    . SER A 1 263 ? -29.605 16.812 -40.574 1.00 59.25  ? 293 SER A OG    1 
ATOM   1973 N  N     . ASN A 1 264 ? -28.827 15.245 -37.294 1.00 59.79  ? 294 ASN A N     1 
ATOM   1974 C  CA    . ASN A 1 264 ? -27.570 15.440 -36.569 1.00 60.12  ? 294 ASN A CA    1 
ATOM   1975 C  C     . ASN A 1 264 ? -26.412 15.532 -37.550 1.00 60.25  ? 294 ASN A C     1 
ATOM   1976 O  O     . ASN A 1 264 ? -25.473 14.750 -37.480 1.00 60.75  ? 294 ASN A O     1 
ATOM   1977 C  CB    . ASN A 1 264 ? -27.329 14.326 -35.532 1.00 60.02  ? 294 ASN A CB    1 
ATOM   1978 C  CG    . ASN A 1 264 ? -28.471 14.202 -34.525 1.00 59.39  ? 294 ASN A CG    1 
ATOM   1979 O  OD1   . ASN A 1 264 ? -28.643 15.048 -33.640 1.00 57.94  ? 294 ASN A OD1   1 
ATOM   1980 N  ND2   . ASN A 1 264 ? -29.257 13.142 -34.661 1.00 57.46  ? 294 ASN A ND2   1 
ATOM   1981 N  N     . THR A 1 265 ? -26.503 16.507 -38.455 1.00 60.33  ? 295 THR A N     1 
ATOM   1982 C  CA    . THR A 1 265 ? -25.466 16.815 -39.433 1.00 60.17  ? 295 THR A CA    1 
ATOM   1983 C  C     . THR A 1 265 ? -24.946 18.231 -39.215 1.00 60.20  ? 295 THR A C     1 
ATOM   1984 O  O     . THR A 1 265 ? -25.651 19.096 -38.713 1.00 60.05  ? 295 THR A O     1 
ATOM   1985 C  CB    . THR A 1 265 ? -26.015 16.740 -40.848 1.00 60.22  ? 295 THR A CB    1 
ATOM   1986 O  OG1   . THR A 1 265 ? -27.267 17.433 -40.896 1.00 60.52  ? 295 THR A OG1   1 
ATOM   1987 C  CG2   . THR A 1 265 ? -26.221 15.298 -41.273 1.00 59.88  ? 295 THR A CG2   1 
ATOM   1988 N  N     . TYR A 1 266 ? -23.711 18.448 -39.643 1.00 60.53  ? 296 TYR A N     1 
ATOM   1989 C  CA    . TYR A 1 266 ? -22.925 19.654 -39.355 1.00 60.55  ? 296 TYR A CA    1 
ATOM   1990 C  C     . TYR A 1 266 ? -23.546 21.009 -39.682 1.00 60.19  ? 296 TYR A C     1 
ATOM   1991 O  O     . TYR A 1 266 ? -23.526 21.909 -38.853 1.00 60.44  ? 296 TYR A O     1 
ATOM   1992 C  CB    . TYR A 1 266 ? -21.604 19.538 -40.100 1.00 61.16  ? 296 TYR A CB    1 
ATOM   1993 C  CG    . TYR A 1 266 ? -20.757 20.775 -40.089 1.00 61.83  ? 296 TYR A CG    1 
ATOM   1994 C  CD1   . TYR A 1 266 ? -20.382 21.367 -38.900 1.00 62.41  ? 296 TYR A CD1   1 
ATOM   1995 C  CD2   . TYR A 1 266 ? -20.310 21.338 -41.274 1.00 62.60  ? 296 TYR A CD2   1 
ATOM   1996 C  CE1   . TYR A 1 266 ? -19.594 22.496 -38.887 1.00 62.59  ? 296 TYR A CE1   1 
ATOM   1997 C  CE2   . TYR A 1 266 ? -19.524 22.462 -41.278 1.00 62.92  ? 296 TYR A CE2   1 
ATOM   1998 C  CZ    . TYR A 1 266 ? -19.160 23.037 -40.082 1.00 62.98  ? 296 TYR A CZ    1 
ATOM   1999 O  OH    . TYR A 1 266 ? -18.358 24.161 -40.091 1.00 63.54  ? 296 TYR A OH    1 
ATOM   2000 N  N     . GLU A 1 267 ? -24.059 21.178 -40.887 1.00 59.88  ? 297 GLU A N     1 
ATOM   2001 C  CA    . GLU A 1 267 ? -24.566 22.486 -41.298 1.00 59.99  ? 297 GLU A CA    1 
ATOM   2002 C  C     . GLU A 1 267 ? -25.900 22.818 -40.632 1.00 59.57  ? 297 GLU A C     1 
ATOM   2003 O  O     . GLU A 1 267 ? -26.069 23.909 -40.079 1.00 59.55  ? 297 GLU A O     1 
ATOM   2004 C  CB    . GLU A 1 267 ? -24.720 22.573 -42.817 1.00 60.20  ? 297 GLU A CB    1 
ATOM   2005 C  CG    . GLU A 1 267 ? -23.415 22.429 -43.581 1.00 61.38  ? 297 GLU A CG    1 
ATOM   2006 C  CD    . GLU A 1 267 ? -23.032 20.985 -43.834 1.00 63.31  ? 297 GLU A CD    1 
ATOM   2007 O  OE1   . GLU A 1 267 ? -23.932 20.111 -43.789 1.00 64.11  ? 297 GLU A OE1   1 
ATOM   2008 O  OE2   . GLU A 1 267 ? -21.828 20.727 -44.076 1.00 64.46  ? 297 GLU A OE2   1 
ATOM   2009 N  N     . GLU A 1 268 ? -26.845 21.885 -40.703 1.00 59.01  ? 298 GLU A N     1 
ATOM   2010 C  CA    . GLU A 1 268 ? -28.172 22.110 -40.157 1.00 58.60  ? 298 GLU A CA    1 
ATOM   2011 C  C     . GLU A 1 268 ? -28.159 22.319 -38.649 1.00 58.31  ? 298 GLU A C     1 
ATOM   2012 O  O     . GLU A 1 268 ? -28.897 23.163 -38.131 1.00 58.12  ? 298 GLU A O     1 
ATOM   2013 C  CB    . GLU A 1 268 ? -29.104 20.952 -40.478 1.00 58.58  ? 298 GLU A CB    1 
ATOM   2014 C  CG    . GLU A 1 268 ? -30.449 21.133 -39.808 1.00 58.59  ? 298 GLU A CG    1 
ATOM   2015 C  CD    . GLU A 1 268 ? -31.453 20.094 -40.168 1.00 58.36  ? 298 GLU A CD    1 
ATOM   2016 O  OE1   . GLU A 1 268 ? -32.619 20.317 -39.809 1.00 59.52  ? 298 GLU A OE1   1 
ATOM   2017 O  OE2   . GLU A 1 268 ? -31.099 19.064 -40.783 1.00 57.50  ? 298 GLU A OE2   1 
ATOM   2018 N  N     . ALA A 1 269 ? -27.349 21.527 -37.954 1.00 58.16  ? 299 ALA A N     1 
ATOM   2019 C  CA    . ALA A 1 269 ? -27.238 21.615 -36.501 1.00 58.11  ? 299 ALA A CA    1 
ATOM   2020 C  C     . ALA A 1 269 ? -26.542 22.920 -36.121 1.00 58.29  ? 299 ALA A C     1 
ATOM   2021 O  O     . ALA A 1 269 ? -26.859 23.535 -35.105 1.00 58.24  ? 299 ALA A O     1 
ATOM   2022 C  CB    . ALA A 1 269 ? -26.484 20.412 -35.959 1.00 57.77  ? 299 ALA A CB    1 
ATOM   2023 N  N     . ALA A 1 270 ? -25.602 23.348 -36.965 1.00 58.54  ? 300 ALA A N     1 
ATOM   2024 C  CA    . ALA A 1 270 ? -24.880 24.600 -36.760 1.00 58.23  ? 300 ALA A CA    1 
ATOM   2025 C  C     . ALA A 1 270 ? -25.795 25.784 -37.015 1.00 57.90  ? 300 ALA A C     1 
ATOM   2026 O  O     . ALA A 1 270 ? -25.728 26.782 -36.322 1.00 57.79  ? 300 ALA A O     1 
ATOM   2027 C  CB    . ALA A 1 270 ? -23.678 24.659 -37.662 1.00 58.18  ? 300 ALA A CB    1 
ATOM   2028 N  N     . ALA A 1 271 ? -26.667 25.670 -38.005 1.00 57.96  ? 301 ALA A N     1 
ATOM   2029 C  CA    . ALA A 1 271 ? -27.642 26.732 -38.284 1.00 57.97  ? 301 ALA A CA    1 
ATOM   2030 C  C     . ALA A 1 271 ? -28.620 26.874 -37.121 1.00 57.90  ? 301 ALA A C     1 
ATOM   2031 O  O     . ALA A 1 271 ? -29.140 27.959 -36.855 1.00 57.86  ? 301 ALA A O     1 
ATOM   2032 C  CB    . ALA A 1 271 ? -28.390 26.436 -39.564 1.00 57.80  ? 301 ALA A CB    1 
ATOM   2033 N  N     . TYR A 1 272 ? -28.839 25.762 -36.426 1.00 57.77  ? 302 TYR A N     1 
ATOM   2034 C  CA    . TYR A 1 272 ? -29.791 25.691 -35.343 1.00 57.73  ? 302 TYR A CA    1 
ATOM   2035 C  C     . TYR A 1 272 ? -29.221 26.283 -34.076 1.00 57.89  ? 302 TYR A C     1 
ATOM   2036 O  O     . TYR A 1 272 ? -29.880 27.089 -33.424 1.00 58.52  ? 302 TYR A O     1 
ATOM   2037 C  CB    . TYR A 1 272 ? -30.190 24.244 -35.092 1.00 57.60  ? 302 TYR A CB    1 
ATOM   2038 C  CG    . TYR A 1 272 ? -31.366 24.133 -34.184 1.00 57.33  ? 302 TYR A CG    1 
ATOM   2039 C  CD1   . TYR A 1 272 ? -32.653 24.318 -34.668 1.00 55.91  ? 302 TYR A CD1   1 
ATOM   2040 C  CD2   . TYR A 1 272 ? -31.197 23.859 -32.834 1.00 57.17  ? 302 TYR A CD2   1 
ATOM   2041 C  CE1   . TYR A 1 272 ? -33.735 24.227 -33.843 1.00 56.29  ? 302 TYR A CE1   1 
ATOM   2042 C  CE2   . TYR A 1 272 ? -32.291 23.767 -31.994 1.00 57.64  ? 302 TYR A CE2   1 
ATOM   2043 C  CZ    . TYR A 1 272 ? -33.554 23.955 -32.508 1.00 56.49  ? 302 TYR A CZ    1 
ATOM   2044 O  OH    . TYR A 1 272 ? -34.636 23.867 -31.680 1.00 56.91  ? 302 TYR A OH    1 
ATOM   2045 N  N     . ILE A 1 273 ? -28.010 25.881 -33.712 1.00 57.70  ? 303 ILE A N     1 
ATOM   2046 C  CA    . ILE A 1 273 ? -27.324 26.542 -32.615 1.00 57.78  ? 303 ILE A CA    1 
ATOM   2047 C  C     . ILE A 1 273 ? -27.404 28.060 -32.845 1.00 58.12  ? 303 ILE A C     1 
ATOM   2048 O  O     . ILE A 1 273 ? -27.958 28.780 -32.020 1.00 58.08  ? 303 ILE A O     1 
ATOM   2049 C  CB    . ILE A 1 273 ? -25.847 26.095 -32.487 1.00 57.66  ? 303 ILE A CB    1 
ATOM   2050 C  CG1   . ILE A 1 273 ? -25.775 24.638 -32.020 1.00 57.91  ? 303 ILE A CG1   1 
ATOM   2051 C  CG2   . ILE A 1 273 ? -25.101 26.979 -31.507 1.00 55.96  ? 303 ILE A CG2   1 
ATOM   2052 C  CD1   . ILE A 1 273 ? -24.375 24.040 -32.054 1.00 58.21  ? 303 ILE A CD1   1 
ATOM   2053 N  N     . GLN A 1 274 ? -26.890 28.523 -33.987 1.00 58.41  ? 304 GLN A N     1 
ATOM   2054 C  CA    . GLN A 1 274 ? -26.868 29.959 -34.338 1.00 58.37  ? 304 GLN A CA    1 
ATOM   2055 C  C     . GLN A 1 274 ? -28.188 30.676 -34.013 1.00 58.87  ? 304 GLN A C     1 
ATOM   2056 O  O     . GLN A 1 274 ? -28.187 31.737 -33.378 1.00 58.39  ? 304 GLN A O     1 
ATOM   2057 C  CB    . GLN A 1 274 ? -26.526 30.143 -35.829 1.00 58.28  ? 304 GLN A CB    1 
ATOM   2058 C  CG    . GLN A 1 274 ? -26.312 31.603 -36.266 1.00 58.23  ? 304 GLN A CG    1 
ATOM   2059 C  CD    . GLN A 1 274 ? -26.162 31.788 -37.781 1.00 57.50  ? 304 GLN A CD    1 
ATOM   2060 O  OE1   . GLN A 1 274 ? -26.008 30.832 -38.536 1.00 54.52  ? 304 GLN A OE1   1 
ATOM   2061 N  NE2   . GLN A 1 274 ? -26.196 33.037 -38.218 1.00 56.75  ? 304 GLN A NE2   1 
ATOM   2062 N  N     . CYS A 1 275 ? -29.305 30.094 -34.456 1.00 59.39  ? 305 CYS A N     1 
ATOM   2063 C  CA    . CYS A 1 275 ? -30.623 30.701 -34.254 1.00 59.79  ? 305 CYS A CA    1 
ATOM   2064 C  C     . CYS A 1 275 ? -30.986 30.809 -32.789 1.00 60.09  ? 305 CYS A C     1 
ATOM   2065 O  O     . CYS A 1 275 ? -31.636 31.762 -32.384 1.00 60.22  ? 305 CYS A O     1 
ATOM   2066 C  CB    . CYS A 1 275 ? -31.705 29.894 -34.966 1.00 59.81  ? 305 CYS A CB    1 
ATOM   2067 S  SG    . CYS A 1 275 ? -31.653 30.065 -36.742 1.00 60.10  ? 305 CYS A SG    1 
ATOM   2068 N  N     . GLN A 1 276 ? -30.575 29.821 -32.003 1.00 60.55  ? 306 GLN A N     1 
ATOM   2069 C  CA    . GLN A 1 276 ? -30.867 29.805 -30.577 1.00 61.00  ? 306 GLN A CA    1 
ATOM   2070 C  C     . GLN A 1 276 ? -30.233 30.984 -29.874 1.00 61.59  ? 306 GLN A C     1 
ATOM   2071 O  O     . GLN A 1 276 ? -30.925 31.745 -29.196 1.00 62.17  ? 306 GLN A O     1 
ATOM   2072 C  CB    . GLN A 1 276 ? -30.395 28.501 -29.945 1.00 61.08  ? 306 GLN A CB    1 
ATOM   2073 C  CG    . GLN A 1 276 ? -31.243 27.324 -30.348 1.00 60.88  ? 306 GLN A CG    1 
ATOM   2074 C  CD    . GLN A 1 276 ? -32.641 27.460 -29.826 1.00 60.43  ? 306 GLN A CD    1 
ATOM   2075 O  OE1   . GLN A 1 276 ? -32.851 27.463 -28.618 1.00 60.11  ? 306 GLN A OE1   1 
ATOM   2076 N  NE2   . GLN A 1 276 ? -33.606 27.605 -30.727 1.00 59.92  ? 306 GLN A NE2   1 
ATOM   2077 N  N     . PHE A 1 277 ? -28.925 31.144 -30.050 1.00 61.94  ? 307 PHE A N     1 
ATOM   2078 C  CA    . PHE A 1 277 ? -28.220 32.326 -29.571 1.00 62.20  ? 307 PHE A CA    1 
ATOM   2079 C  C     . PHE A 1 277 ? -28.827 33.626 -30.105 1.00 62.65  ? 307 PHE A C     1 
ATOM   2080 O  O     . PHE A 1 277 ? -29.194 34.505 -29.330 1.00 62.47  ? 307 PHE A O     1 
ATOM   2081 C  CB    . PHE A 1 277 ? -26.748 32.243 -29.950 1.00 62.16  ? 307 PHE A CB    1 
ATOM   2082 C  CG    . PHE A 1 277 ? -25.968 31.337 -29.072 1.00 62.15  ? 307 PHE A CG    1 
ATOM   2083 C  CD1   . PHE A 1 277 ? -25.773 30.014 -29.419 1.00 62.48  ? 307 PHE A CD1   1 
ATOM   2084 C  CD2   . PHE A 1 277 ? -25.437 31.802 -27.875 1.00 62.55  ? 307 PHE A CD2   1 
ATOM   2085 C  CE1   . PHE A 1 277 ? -25.043 29.172 -28.600 1.00 62.45  ? 307 PHE A CE1   1 
ATOM   2086 C  CE2   . PHE A 1 277 ? -24.712 30.966 -27.045 1.00 62.60  ? 307 PHE A CE2   1 
ATOM   2087 C  CZ    . PHE A 1 277 ? -24.510 29.648 -27.411 1.00 62.82  ? 307 PHE A CZ    1 
ATOM   2088 N  N     . GLU A 1 278 ? -28.941 33.737 -31.426 1.00 63.23  ? 308 GLU A N     1 
ATOM   2089 C  CA    . GLU A 1 278 ? -29.523 34.932 -32.053 1.00 63.80  ? 308 GLU A CA    1 
ATOM   2090 C  C     . GLU A 1 278 ? -30.961 35.244 -31.589 1.00 64.00  ? 308 GLU A C     1 
ATOM   2091 O  O     . GLU A 1 278 ? -31.368 36.406 -31.593 1.00 63.82  ? 308 GLU A O     1 
ATOM   2092 C  CB    . GLU A 1 278 ? -29.471 34.825 -33.582 1.00 63.70  ? 308 GLU A CB    1 
ATOM   2093 C  CG    . GLU A 1 278 ? -28.115 35.179 -34.187 1.00 64.14  ? 308 GLU A CG    1 
ATOM   2094 C  CD    . GLU A 1 278 ? -28.082 35.095 -35.720 1.00 64.67  ? 308 GLU A CD    1 
ATOM   2095 O  OE1   . GLU A 1 278 ? -29.112 34.748 -36.345 1.00 66.29  ? 308 GLU A OE1   1 
ATOM   2096 O  OE2   . GLU A 1 278 ? -27.012 35.380 -36.309 1.00 67.04  ? 308 GLU A OE2   1 
ATOM   2097 N  N     . ASP A 1 279 ? -31.718 34.223 -31.184 1.00 64.35  ? 309 ASP A N     1 
ATOM   2098 C  CA    . ASP A 1 279 ? -33.053 34.439 -30.597 1.00 64.68  ? 309 ASP A CA    1 
ATOM   2099 C  C     . ASP A 1 279 ? -33.010 35.119 -29.224 1.00 64.67  ? 309 ASP A C     1 
ATOM   2100 O  O     . ASP A 1 279 ? -34.014 35.671 -28.773 1.00 64.07  ? 309 ASP A O     1 
ATOM   2101 C  CB    . ASP A 1 279 ? -33.829 33.116 -30.494 1.00 64.94  ? 309 ASP A CB    1 
ATOM   2102 C  CG    . ASP A 1 279 ? -34.498 32.723 -31.802 1.00 65.55  ? 309 ASP A CG    1 
ATOM   2103 O  OD1   . ASP A 1 279 ? -34.733 33.611 -32.649 1.00 66.82  ? 309 ASP A OD1   1 
ATOM   2104 O  OD2   . ASP A 1 279 ? -34.791 31.523 -31.980 1.00 66.39  ? 309 ASP A OD2   1 
ATOM   2105 N  N     . LEU A 1 280 ? -31.847 35.083 -28.573 1.00 65.14  ? 310 LEU A N     1 
ATOM   2106 C  CA    . LEU A 1 280 ? -31.654 35.746 -27.282 1.00 65.44  ? 310 LEU A CA    1 
ATOM   2107 C  C     . LEU A 1 280 ? -31.644 37.278 -27.378 1.00 65.95  ? 310 LEU A C     1 
ATOM   2108 O  O     . LEU A 1 280 ? -31.826 37.963 -26.365 1.00 66.18  ? 310 LEU A O     1 
ATOM   2109 C  CB    . LEU A 1 280 ? -30.371 35.258 -26.608 1.00 65.21  ? 310 LEU A CB    1 
ATOM   2110 C  CG    . LEU A 1 280 ? -30.256 33.739 -26.451 1.00 65.00  ? 310 LEU A CG    1 
ATOM   2111 C  CD1   . LEU A 1 280 ? -28.960 33.362 -25.738 1.00 63.13  ? 310 LEU A CD1   1 
ATOM   2112 C  CD2   . LEU A 1 280 ? -31.484 33.168 -25.730 1.00 63.58  ? 310 LEU A CD2   1 
ATOM   2113 N  N     . ASN A 1 281 ? -31.446 37.812 -28.582 1.00 66.42  ? 311 ASN A N     1 
ATOM   2114 C  CA    . ASN A 1 281 ? -31.532 39.254 -28.809 1.00 66.91  ? 311 ASN A CA    1 
ATOM   2115 C  C     . ASN A 1 281 ? -32.943 39.784 -28.513 1.00 67.51  ? 311 ASN A C     1 
ATOM   2116 O  O     . ASN A 1 281 ? -33.925 39.293 -29.071 1.00 67.45  ? 311 ASN A O     1 
ATOM   2117 C  CB    . ASN A 1 281 ? -31.128 39.581 -30.249 1.00 66.79  ? 311 ASN A CB    1 
ATOM   2118 C  CG    . ASN A 1 281 ? -30.933 41.059 -30.486 1.00 66.66  ? 311 ASN A CG    1 
ATOM   2119 O  OD1   . ASN A 1 281 ? -30.832 41.848 -29.543 1.00 67.02  ? 311 ASN A OD1   1 
ATOM   2120 N  ND2   . ASN A 1 281 ? -30.875 41.447 -31.758 1.00 65.98  ? 311 ASN A ND2   1 
ATOM   2121 N  N     . LYS A 1 282 ? -33.031 40.777 -27.629 1.00 68.29  ? 312 LYS A N     1 
ATOM   2122 C  CA    . LYS A 1 282 ? -34.319 41.330 -27.188 1.00 69.01  ? 312 LYS A CA    1 
ATOM   2123 C  C     . LYS A 1 282 ? -34.711 42.626 -27.931 1.00 69.66  ? 312 LYS A C     1 
ATOM   2124 O  O     . LYS A 1 282 ? -35.867 43.071 -27.840 1.00 69.42  ? 312 LYS A O     1 
ATOM   2125 C  CB    . LYS A 1 282 ? -34.306 41.563 -25.667 1.00 69.10  ? 312 LYS A CB    1 
ATOM   2126 C  CG    . LYS A 1 282 ? -34.147 40.283 -24.836 1.00 69.27  ? 312 LYS A CG    1 
ATOM   2127 C  CD    . LYS A 1 282 ? -33.896 40.574 -23.360 1.00 68.99  ? 312 LYS A CD    1 
ATOM   2128 N  N     . ARG A 1 283 ? -33.755 43.233 -28.643 1.00 70.34  ? 313 ARG A N     1 
ATOM   2129 C  CA    . ARG A 1 283 ? -34.063 44.333 -29.566 1.00 71.00  ? 313 ARG A CA    1 
ATOM   2130 C  C     . ARG A 1 283 ? -33.499 44.026 -30.965 1.00 70.92  ? 313 ARG A C     1 
ATOM   2131 O  O     . ARG A 1 283 ? -32.463 44.555 -31.367 1.00 70.98  ? 313 ARG A O     1 
ATOM   2132 C  CB    . ARG A 1 283 ? -33.573 45.710 -29.055 1.00 71.38  ? 313 ARG A CB    1 
ATOM   2133 C  CG    . ARG A 1 283 ? -33.032 45.803 -27.610 1.00 72.65  ? 313 ARG A CG    1 
ATOM   2134 C  CD    . ARG A 1 283 ? -31.493 45.734 -27.576 1.00 74.95  ? 313 ARG A CD    1 
ATOM   2135 N  NE    . ARG A 1 283 ? -30.903 46.519 -26.488 1.00 75.99  ? 313 ARG A NE    1 
ATOM   2136 C  CZ    . ARG A 1 283 ? -29.600 46.533 -26.183 1.00 77.38  ? 313 ARG A CZ    1 
ATOM   2137 N  NH1   . ARG A 1 283 ? -28.725 45.797 -26.875 1.00 77.57  ? 313 ARG A NH1   1 
ATOM   2138 N  NH2   . ARG A 1 283 ? -29.160 47.285 -25.171 1.00 77.25  ? 313 ARG A NH2   1 
ATOM   2139 N  N     . LYS A 1 284 ? -34.200 43.166 -31.698 1.00 70.92  ? 314 LYS A N     1 
ATOM   2140 C  CA    . LYS A 1 284 ? -33.789 42.772 -33.050 1.00 70.87  ? 314 LYS A CA    1 
ATOM   2141 C  C     . LYS A 1 284 ? -34.051 43.878 -34.094 1.00 70.76  ? 314 LYS A C     1 
ATOM   2142 O  O     . LYS A 1 284 ? -33.383 43.934 -35.121 1.00 70.78  ? 314 LYS A O     1 
ATOM   2143 C  CB    . LYS A 1 284 ? -34.491 41.466 -33.458 1.00 70.91  ? 314 LYS A CB    1 
ATOM   2144 C  CG    . LYS A 1 284 ? -34.265 40.299 -32.489 1.00 70.97  ? 314 LYS A CG    1 
ATOM   2145 C  CD    . LYS A 1 284 ? -34.906 39.006 -32.995 1.00 70.73  ? 314 LYS A CD    1 
ATOM   2146 C  CE    . LYS A 1 284 ? -34.494 37.773 -32.176 1.00 70.05  ? 314 LYS A CE    1 
ATOM   2147 N  NZ    . LYS A 1 284 ? -35.466 37.397 -31.097 1.00 69.01  ? 314 LYS A NZ    1 
ATOM   2148 N  N     . ASP A 1 285 ? -35.022 44.747 -33.835 1.00 70.62  ? 315 ASP A N     1 
ATOM   2149 C  CA    . ASP A 1 285 ? -35.270 45.910 -34.697 1.00 70.62  ? 315 ASP A CA    1 
ATOM   2150 C  C     . ASP A 1 285 ? -34.059 46.853 -34.790 1.00 70.33  ? 315 ASP A C     1 
ATOM   2151 O  O     . ASP A 1 285 ? -33.782 47.433 -35.844 1.00 70.21  ? 315 ASP A O     1 
ATOM   2152 C  CB    . ASP A 1 285 ? -36.457 46.726 -34.166 1.00 70.76  ? 315 ASP A CB    1 
ATOM   2153 C  CG    . ASP A 1 285 ? -37.795 46.017 -34.334 1.00 71.23  ? 315 ASP A CG    1 
ATOM   2154 O  OD1   . ASP A 1 285 ? -37.823 44.842 -34.765 1.00 71.38  ? 315 ASP A OD1   1 
ATOM   2155 O  OD2   . ASP A 1 285 ? -38.827 46.651 -34.023 1.00 71.76  ? 315 ASP A OD2   1 
ATOM   2156 N  N     . THR A 1 286 ? -33.355 47.004 -33.670 1.00 69.96  ? 316 THR A N     1 
ATOM   2157 C  CA    . THR A 1 286 ? -32.325 48.030 -33.527 1.00 69.49  ? 316 THR A CA    1 
ATOM   2158 C  C     . THR A 1 286 ? -30.911 47.472 -33.376 1.00 69.17  ? 316 THR A C     1 
ATOM   2159 O  O     . THR A 1 286 ? -29.945 48.209 -33.547 1.00 69.17  ? 316 THR A O     1 
ATOM   2160 C  CB    . THR A 1 286 ? -32.623 48.930 -32.301 1.00 69.52  ? 316 THR A CB    1 
ATOM   2161 O  OG1   . THR A 1 286 ? -32.304 48.228 -31.093 1.00 69.16  ? 316 THR A OG1   1 
ATOM   2162 C  CG2   . THR A 1 286 ? -34.107 49.352 -32.275 1.00 69.48  ? 316 THR A CG2   1 
ATOM   2163 N  N     . LYS A 1 287 ? -30.785 46.187 -33.050 1.00 68.71  ? 317 LYS A N     1 
ATOM   2164 C  CA    . LYS A 1 287 ? -29.485 45.589 -32.761 1.00 68.46  ? 317 LYS A CA    1 
ATOM   2165 C  C     . LYS A 1 287 ? -29.254 44.415 -33.697 1.00 67.96  ? 317 LYS A C     1 
ATOM   2166 O  O     . LYS A 1 287 ? -30.173 43.654 -33.991 1.00 68.04  ? 317 LYS A O     1 
ATOM   2167 C  CB    . LYS A 1 287 ? -29.426 45.114 -31.302 1.00 68.65  ? 317 LYS A CB    1 
ATOM   2168 C  CG    . LYS A 1 287 ? -28.020 44.809 -30.769 1.00 68.85  ? 317 LYS A CG    1 
ATOM   2169 C  CD    . LYS A 1 287 ? -27.273 46.087 -30.374 1.00 69.13  ? 317 LYS A CD    1 
ATOM   2170 C  CE    . LYS A 1 287 ? -25.842 45.789 -29.945 1.00 68.91  ? 317 LYS A CE    1 
ATOM   2171 N  NZ    . LYS A 1 287 ? -25.007 45.276 -31.089 1.00 69.19  ? 317 LYS A NZ    1 
ATOM   2172 N  N     . GLU A 1 288 ? -28.016 44.268 -34.143 1.00 67.28  ? 318 GLU A N     1 
ATOM   2173 C  CA    . GLU A 1 288 ? -27.648 43.237 -35.091 1.00 66.91  ? 318 GLU A CA    1 
ATOM   2174 C  C     . GLU A 1 288 ? -26.533 42.382 -34.494 1.00 66.35  ? 318 GLU A C     1 
ATOM   2175 O  O     . GLU A 1 288 ? -25.474 42.897 -34.155 1.00 66.35  ? 318 GLU A O     1 
ATOM   2176 C  CB    . GLU A 1 288 ? -27.185 43.912 -36.383 1.00 66.84  ? 318 GLU A CB    1 
ATOM   2177 C  CG    . GLU A 1 288 ? -27.198 43.012 -37.612 1.00 67.66  ? 318 GLU A CG    1 
ATOM   2178 C  CD    . GLU A 1 288 ? -27.198 43.781 -38.946 1.00 67.62  ? 318 GLU A CD    1 
ATOM   2179 O  OE1   . GLU A 1 288 ? -27.461 45.005 -38.975 1.00 68.77  ? 318 GLU A OE1   1 
ATOM   2180 O  OE2   . GLU A 1 288 ? -26.937 43.140 -39.985 1.00 68.80  ? 318 GLU A OE2   1 
ATOM   2181 N  N     . ILE A 1 289 ? -26.780 41.087 -34.331 1.00 65.75  ? 319 ILE A N     1 
ATOM   2182 C  CA    . ILE A 1 289 ? -25.723 40.156 -33.966 1.00 65.32  ? 319 ILE A CA    1 
ATOM   2183 C  C     . ILE A 1 289 ? -25.005 39.775 -35.240 1.00 64.73  ? 319 ILE A C     1 
ATOM   2184 O  O     . ILE A 1 289 ? -25.600 39.177 -36.127 1.00 64.73  ? 319 ILE A O     1 
ATOM   2185 C  CB    . ILE A 1 289 ? -26.256 38.849 -33.351 1.00 65.65  ? 319 ILE A CB    1 
ATOM   2186 C  CG1   . ILE A 1 289 ? -27.129 39.112 -32.116 1.00 66.44  ? 319 ILE A CG1   1 
ATOM   2187 C  CG2   . ILE A 1 289 ? -25.091 37.942 -32.987 1.00 65.58  ? 319 ILE A CG2   1 
ATOM   2188 C  CD1   . ILE A 1 289 ? -26.363 39.678 -30.929 1.00 67.32  ? 319 ILE A CD1   1 
ATOM   2189 N  N     . TYR A 1 290 ? -23.734 40.130 -35.338 1.00 64.34  ? 320 TYR A N     1 
ATOM   2190 C  CA    . TYR A 1 290 ? -22.891 39.696 -36.459 1.00 63.90  ? 320 TYR A CA    1 
ATOM   2191 C  C     . TYR A 1 290 ? -22.277 38.316 -36.135 1.00 63.29  ? 320 TYR A C     1 
ATOM   2192 O  O     . TYR A 1 290 ? -21.435 38.196 -35.247 1.00 63.12  ? 320 TYR A O     1 
ATOM   2193 C  CB    . TYR A 1 290 ? -21.806 40.749 -36.749 1.00 64.02  ? 320 TYR A CB    1 
ATOM   2194 C  CG    . TYR A 1 290 ? -22.381 42.132 -37.030 1.00 64.42  ? 320 TYR A CG    1 
ATOM   2195 C  CD1   . TYR A 1 290 ? -22.797 42.493 -38.313 1.00 64.14  ? 320 TYR A CD1   1 
ATOM   2196 C  CD2   . TYR A 1 290 ? -22.527 43.076 -36.004 1.00 64.87  ? 320 TYR A CD2   1 
ATOM   2197 C  CE1   . TYR A 1 290 ? -23.339 43.761 -38.571 1.00 64.08  ? 320 TYR A CE1   1 
ATOM   2198 C  CE2   . TYR A 1 290 ? -23.067 44.350 -36.252 1.00 63.94  ? 320 TYR A CE2   1 
ATOM   2199 C  CZ    . TYR A 1 290 ? -23.472 44.683 -37.534 1.00 64.16  ? 320 TYR A CZ    1 
ATOM   2200 O  OH    . TYR A 1 290 ? -24.010 45.934 -37.787 1.00 64.48  ? 320 TYR A OH    1 
ATOM   2201 N  N     . THR A 1 291 ? -22.718 37.288 -36.856 1.00 62.58  ? 321 THR A N     1 
ATOM   2202 C  CA    . THR A 1 291 ? -22.346 35.902 -36.580 1.00 62.02  ? 321 THR A CA    1 
ATOM   2203 C  C     . THR A 1 291 ? -21.295 35.371 -37.551 1.00 61.73  ? 321 THR A C     1 
ATOM   2204 O  O     . THR A 1 291 ? -21.349 35.641 -38.744 1.00 61.33  ? 321 THR A O     1 
ATOM   2205 C  CB    . THR A 1 291 ? -23.584 34.984 -36.651 1.00 62.09  ? 321 THR A CB    1 
ATOM   2206 O  OG1   . THR A 1 291 ? -24.459 35.275 -35.554 1.00 61.91  ? 321 THR A OG1   1 
ATOM   2207 C  CG2   . THR A 1 291 ? -23.183 33.528 -36.594 1.00 61.35  ? 321 THR A CG2   1 
ATOM   2208 N  N     . HIS A 1 292 ? -20.348 34.602 -37.021 1.00 61.58  ? 322 HIS A N     1 
ATOM   2209 C  CA    . HIS A 1 292 ? -19.310 33.973 -37.821 1.00 61.58  ? 322 HIS A CA    1 
ATOM   2210 C  C     . HIS A 1 292 ? -18.958 32.596 -37.274 1.00 61.56  ? 322 HIS A C     1 
ATOM   2211 O  O     . HIS A 1 292 ? -18.675 32.444 -36.088 1.00 61.58  ? 322 HIS A O     1 
ATOM   2212 C  CB    . HIS A 1 292 ? -18.043 34.823 -37.822 1.00 61.63  ? 322 HIS A CB    1 
ATOM   2213 C  CG    . HIS A 1 292 ? -18.216 36.167 -38.445 1.00 62.47  ? 322 HIS A CG    1 
ATOM   2214 N  ND1   . HIS A 1 292 ? -18.133 36.373 -39.806 1.00 63.21  ? 322 HIS A ND1   1 
ATOM   2215 C  CD2   . HIS A 1 292 ? -18.463 37.378 -37.894 1.00 63.43  ? 322 HIS A CD2   1 
ATOM   2216 C  CE1   . HIS A 1 292 ? -18.317 37.654 -40.066 1.00 63.39  ? 322 HIS A CE1   1 
ATOM   2217 N  NE2   . HIS A 1 292 ? -18.520 38.287 -38.923 1.00 63.95  ? 322 HIS A NE2   1 
ATOM   2218 N  N     . PHE A 1 293 ? -18.951 31.598 -38.149 1.00 61.54  ? 323 PHE A N     1 
ATOM   2219 C  CA    . PHE A 1 293 ? -18.470 30.277 -37.785 1.00 61.49  ? 323 PHE A CA    1 
ATOM   2220 C  C     . PHE A 1 293 ? -16.966 30.239 -37.946 1.00 61.39  ? 323 PHE A C     1 
ATOM   2221 O  O     . PHE A 1 293 ? -16.458 30.459 -39.040 1.00 61.70  ? 323 PHE A O     1 
ATOM   2222 C  CB    . PHE A 1 293 ? -19.142 29.220 -38.645 1.00 61.46  ? 323 PHE A CB    1 
ATOM   2223 C  CG    . PHE A 1 293 ? -20.608 29.125 -38.402 1.00 61.42  ? 323 PHE A CG    1 
ATOM   2224 C  CD1   . PHE A 1 293 ? -21.491 29.929 -39.100 1.00 61.62  ? 323 PHE A CD1   1 
ATOM   2225 C  CD2   . PHE A 1 293 ? -21.107 28.263 -37.440 1.00 61.47  ? 323 PHE A CD2   1 
ATOM   2226 C  CE1   . PHE A 1 293 ? -22.851 29.863 -38.857 1.00 61.77  ? 323 PHE A CE1   1 
ATOM   2227 C  CE2   . PHE A 1 293 ? -22.469 28.182 -37.196 1.00 61.11  ? 323 PHE A CE2   1 
ATOM   2228 C  CZ    . PHE A 1 293 ? -23.338 28.984 -37.899 1.00 61.58  ? 323 PHE A CZ    1 
ATOM   2229 N  N     . THR A 1 294 ? -16.266 29.949 -36.851 1.00 61.31  ? 324 THR A N     1 
ATOM   2230 C  CA    . THR A 1 294 ? -14.807 30.013 -36.801 1.00 61.08  ? 324 THR A CA    1 
ATOM   2231 C  C     . THR A 1 294 ? -14.132 28.733 -36.310 1.00 61.05  ? 324 THR A C     1 
ATOM   2232 O  O     . THR A 1 294 ? -14.664 27.995 -35.483 1.00 60.78  ? 324 THR A O     1 
ATOM   2233 C  CB    . THR A 1 294 ? -14.352 31.130 -35.835 1.00 61.29  ? 324 THR A CB    1 
ATOM   2234 O  OG1   . THR A 1 294 ? -14.687 30.779 -34.474 1.00 60.50  ? 324 THR A OG1   1 
ATOM   2235 C  CG2   . THR A 1 294 ? -15.004 32.450 -36.214 1.00 61.12  ? 324 THR A CG2   1 
ATOM   2236 N  N     . CYS A 1 295 ? -12.931 28.490 -36.812 1.00 60.97  ? 325 CYS A N     1 
ATOM   2237 C  CA    . CYS A 1 295 ? -12.037 27.542 -36.184 1.00 60.77  ? 325 CYS A CA    1 
ATOM   2238 C  C     . CYS A 1 295 ? -10.879 28.363 -35.677 1.00 60.61  ? 325 CYS A C     1 
ATOM   2239 O  O     . CYS A 1 295 ? -10.039 28.802 -36.453 1.00 60.97  ? 325 CYS A O     1 
ATOM   2240 C  CB    . CYS A 1 295 ? -11.573 26.492 -37.178 1.00 60.82  ? 325 CYS A CB    1 
ATOM   2241 S  SG    . CYS A 1 295 ? -10.128 25.594 -36.613 1.00 60.72  ? 325 CYS A SG    1 
ATOM   2242 N  N     . ALA A 1 296 ? -10.856 28.603 -34.375 1.00 60.70  ? 326 ALA A N     1 
ATOM   2243 C  CA    . ALA A 1 296 ? -9.850  29.478 -33.759 1.00 60.72  ? 326 ALA A CA    1 
ATOM   2244 C  C     . ALA A 1 296 ? -8.395  29.053 -34.065 1.00 60.72  ? 326 ALA A C     1 
ATOM   2245 O  O     . ALA A 1 296 ? -7.515  29.888 -34.240 1.00 60.81  ? 326 ALA A O     1 
ATOM   2246 C  CB    . ALA A 1 296 ? -10.084 29.556 -32.254 1.00 60.26  ? 326 ALA A CB    1 
ATOM   2247 N  N     . THR A 1 297 ? -8.150  27.756 -34.153 1.00 60.78  ? 327 THR A N     1 
ATOM   2248 C  CA    . THR A 1 297 ? -6.796  27.263 -34.379 1.00 60.96  ? 327 THR A CA    1 
ATOM   2249 C  C     . THR A 1 297 ? -6.352  27.332 -35.849 1.00 61.15  ? 327 THR A C     1 
ATOM   2250 O  O     . THR A 1 297 ? -5.195  27.034 -36.148 1.00 61.08  ? 327 THR A O     1 
ATOM   2251 C  CB    . THR A 1 297 ? -6.667  25.818 -33.892 1.00 60.89  ? 327 THR A CB    1 
ATOM   2252 O  OG1   . THR A 1 297 ? -7.741  25.047 -34.432 1.00 60.79  ? 327 THR A OG1   1 
ATOM   2253 C  CG2   . THR A 1 297 ? -6.711  25.750 -32.361 1.00 60.36  ? 327 THR A CG2   1 
ATOM   2254 N  N     . ASP A 1 298 ? -7.257  27.732 -36.747 1.00 61.23  ? 328 ASP A N     1 
ATOM   2255 C  CA    . ASP A 1 298 ? -6.983  27.798 -38.186 1.00 61.37  ? 328 ASP A CA    1 
ATOM   2256 C  C     . ASP A 1 298 ? -6.719  29.236 -38.591 1.00 61.30  ? 328 ASP A C     1 
ATOM   2257 O  O     . ASP A 1 298 ? -7.653  30.000 -38.818 1.00 61.62  ? 328 ASP A O     1 
ATOM   2258 C  CB    . ASP A 1 298 ? -8.184  27.246 -38.962 1.00 61.79  ? 328 ASP A CB    1 
ATOM   2259 C  CG    . ASP A 1 298 ? -8.028  27.347 -40.487 1.00 62.53  ? 328 ASP A CG    1 
ATOM   2260 O  OD1   . ASP A 1 298 ? -7.101  28.024 -40.981 1.00 62.89  ? 328 ASP A OD1   1 
ATOM   2261 O  OD2   . ASP A 1 298 ? -8.867  26.741 -41.197 1.00 63.93  ? 328 ASP A OD2   1 
ATOM   2262 N  N     . THR A 1 299 ? -5.444  29.588 -38.697 1.00 61.16  ? 329 THR A N     1 
ATOM   2263 C  CA    . THR A 1 299 ? -5.032  30.956 -38.946 1.00 61.07  ? 329 THR A CA    1 
ATOM   2264 C  C     . THR A 1 299 ? -5.749  31.559 -40.134 1.00 61.39  ? 329 THR A C     1 
ATOM   2265 O  O     . THR A 1 299 ? -6.441  32.562 -39.985 1.00 61.73  ? 329 THR A O     1 
ATOM   2266 C  CB    . THR A 1 299 ? -3.514  31.046 -39.148 1.00 60.96  ? 329 THR A CB    1 
ATOM   2267 O  OG1   . THR A 1 299 ? -2.872  30.594 -37.956 1.00 60.62  ? 329 THR A OG1   1 
ATOM   2268 C  CG2   . THR A 1 299 ? -3.082  32.473 -39.427 1.00 59.71  ? 329 THR A CG2   1 
ATOM   2269 N  N     . LYS A 1 300 ? -5.600  30.942 -41.299 1.00 61.57  ? 330 LYS A N     1 
ATOM   2270 C  CA    . LYS A 1 300 ? -6.282  31.402 -42.510 1.00 61.89  ? 330 LYS A CA    1 
ATOM   2271 C  C     . LYS A 1 300 ? -7.756  31.796 -42.256 1.00 62.03  ? 330 LYS A C     1 
ATOM   2272 O  O     . LYS A 1 300 ? -8.191  32.868 -42.658 1.00 62.06  ? 330 LYS A O     1 
ATOM   2273 C  CB    . LYS A 1 300 ? -6.189  30.335 -43.609 1.00 61.92  ? 330 LYS A CB    1 
ATOM   2274 C  CG    . LYS A 1 300 ? -6.160  30.901 -45.027 1.00 62.41  ? 330 LYS A CG    1 
ATOM   2275 N  N     . ASN A 1 301 ? -8.509  30.939 -41.574 1.00 62.51  ? 331 ASN A N     1 
ATOM   2276 C  CA    . ASN A 1 301 ? -9.922  31.216 -41.256 1.00 62.94  ? 331 ASN A CA    1 
ATOM   2277 C  C     . ASN A 1 301 ? -10.131 32.415 -40.328 1.00 63.37  ? 331 ASN A C     1 
ATOM   2278 O  O     . ASN A 1 301 ? -11.025 33.249 -40.558 1.00 63.67  ? 331 ASN A O     1 
ATOM   2279 C  CB    . ASN A 1 301 ? -10.589 29.994 -40.622 1.00 62.95  ? 331 ASN A CB    1 
ATOM   2280 C  CG    . ASN A 1 301 ? -11.987 30.289 -40.126 1.00 62.92  ? 331 ASN A CG    1 
ATOM   2281 O  OD1   . ASN A 1 301 ? -12.220 30.392 -38.927 1.00 64.62  ? 331 ASN A OD1   1 
ATOM   2282 N  ND2   . ASN A 1 301 ? -12.920 30.440 -41.043 1.00 63.06  ? 331 ASN A ND2   1 
ATOM   2283 N  N     . VAL A 1 302 ? -9.328  32.492 -39.271 1.00 63.41  ? 332 VAL A N     1 
ATOM   2284 C  CA    . VAL A 1 302 ? -9.409  33.620 -38.350 1.00 63.51  ? 332 VAL A CA    1 
ATOM   2285 C  C     . VAL A 1 302 ? -8.953  34.923 -39.039 1.00 63.75  ? 332 VAL A C     1 
ATOM   2286 O  O     . VAL A 1 302 ? -9.378  36.006 -38.659 1.00 64.14  ? 332 VAL A O     1 
ATOM   2287 C  CB    . VAL A 1 302 ? -8.588  33.357 -37.058 1.00 63.46  ? 332 VAL A CB    1 
ATOM   2288 C  CG1   . VAL A 1 302 ? -8.577  34.585 -36.171 1.00 63.60  ? 332 VAL A CG1   1 
ATOM   2289 C  CG2   . VAL A 1 302 ? -9.145  32.173 -36.299 1.00 63.10  ? 332 VAL A CG2   1 
ATOM   2290 N  N     . GLN A 1 303 ? -8.091  34.821 -40.048 1.00 63.97  ? 333 GLN A N     1 
ATOM   2291 C  CA    . GLN A 1 303 ? -7.668  35.994 -40.823 1.00 64.18  ? 333 GLN A CA    1 
ATOM   2292 C  C     . GLN A 1 303 ? -8.839  36.528 -41.651 1.00 64.36  ? 333 GLN A C     1 
ATOM   2293 O  O     . GLN A 1 303 ? -9.076  37.733 -41.685 1.00 64.19  ? 333 GLN A O     1 
ATOM   2294 C  CB    . GLN A 1 303 ? -6.494  35.630 -41.734 1.00 64.05  ? 333 GLN A CB    1 
ATOM   2295 C  CG    . GLN A 1 303 ? -5.743  36.797 -42.335 1.00 63.97  ? 333 GLN A CG    1 
ATOM   2296 C  CD    . GLN A 1 303 ? -4.668  36.344 -43.331 1.00 64.66  ? 333 GLN A CD    1 
ATOM   2297 O  OE1   . GLN A 1 303 ? -4.396  35.147 -43.475 1.00 66.00  ? 333 GLN A OE1   1 
ATOM   2298 N  NE2   . GLN A 1 303 ? -4.060  37.303 -44.025 1.00 64.53  ? 333 GLN A NE2   1 
ATOM   2299 N  N     . PHE A 1 304 ? -9.575  35.625 -42.301 1.00 64.73  ? 334 PHE A N     1 
ATOM   2300 C  CA    . PHE A 1 304 ? -10.736 36.014 -43.123 1.00 65.15  ? 334 PHE A CA    1 
ATOM   2301 C  C     . PHE A 1 304 ? -11.901 36.558 -42.280 1.00 65.04  ? 334 PHE A C     1 
ATOM   2302 O  O     . PHE A 1 304 ? -12.558 37.520 -42.675 1.00 64.89  ? 334 PHE A O     1 
ATOM   2303 C  CB    . PHE A 1 304 ? -11.207 34.849 -44.015 1.00 65.49  ? 334 PHE A CB    1 
ATOM   2304 C  CG    . PHE A 1 304 ? -12.624 34.997 -44.521 1.00 65.86  ? 334 PHE A CG    1 
ATOM   2305 C  CD1   . PHE A 1 304 ? -12.903 35.785 -45.628 1.00 66.35  ? 334 PHE A CD1   1 
ATOM   2306 C  CD2   . PHE A 1 304 ? -13.687 34.346 -43.873 1.00 67.02  ? 334 PHE A CD2   1 
ATOM   2307 C  CE1   . PHE A 1 304 ? -14.219 35.928 -46.091 1.00 66.85  ? 334 PHE A CE1   1 
ATOM   2308 C  CE2   . PHE A 1 304 ? -15.005 34.473 -44.326 1.00 66.44  ? 334 PHE A CE2   1 
ATOM   2309 C  CZ    . PHE A 1 304 ? -15.273 35.265 -45.434 1.00 66.87  ? 334 PHE A CZ    1 
ATOM   2310 N  N     . VAL A 1 305 ? -12.160 35.943 -41.132 1.00 65.03  ? 335 VAL A N     1 
ATOM   2311 C  CA    . VAL A 1 305 ? -13.206 36.430 -40.241 1.00 65.08  ? 335 VAL A CA    1 
ATOM   2312 C  C     . VAL A 1 305 ? -12.839 37.800 -39.677 1.00 65.29  ? 335 VAL A C     1 
ATOM   2313 O  O     . VAL A 1 305 ? -13.706 38.656 -39.529 1.00 65.34  ? 335 VAL A O     1 
ATOM   2314 C  CB    . VAL A 1 305 ? -13.490 35.442 -39.087 1.00 65.04  ? 335 VAL A CB    1 
ATOM   2315 C  CG1   . VAL A 1 305 ? -14.353 36.084 -38.017 1.00 65.08  ? 335 VAL A CG1   1 
ATOM   2316 C  CG2   . VAL A 1 305 ? -14.169 34.195 -39.622 1.00 64.96  ? 335 VAL A CG2   1 
ATOM   2317 N  N     . PHE A 1 306 ? -11.563 38.032 -39.386 1.00 65.56  ? 336 PHE A N     1 
ATOM   2318 C  CA    . PHE A 1 306 ? -11.187 39.309 -38.768 1.00 66.06  ? 336 PHE A CA    1 
ATOM   2319 C  C     . PHE A 1 306 ? -11.262 40.488 -39.740 1.00 66.13  ? 336 PHE A C     1 
ATOM   2320 O  O     . PHE A 1 306 ? -11.433 41.632 -39.312 1.00 66.26  ? 336 PHE A O     1 
ATOM   2321 C  CB    . PHE A 1 306 ? -9.812  39.249 -38.096 1.00 66.29  ? 336 PHE A CB    1 
ATOM   2322 C  CG    . PHE A 1 306 ? -9.864  39.597 -36.643 1.00 66.63  ? 336 PHE A CG    1 
ATOM   2323 C  CD1   . PHE A 1 306 ? -9.950  38.598 -35.682 1.00 66.96  ? 336 PHE A CD1   1 
ATOM   2324 C  CD2   . PHE A 1 306 ? -9.896  40.921 -36.237 1.00 67.07  ? 336 PHE A CD2   1 
ATOM   2325 C  CE1   . PHE A 1 306 ? -10.031 38.914 -34.335 1.00 67.15  ? 336 PHE A CE1   1 
ATOM   2326 C  CE2   . PHE A 1 306 ? -9.973  41.248 -34.890 1.00 67.03  ? 336 PHE A CE2   1 
ATOM   2327 C  CZ    . PHE A 1 306 ? -10.040 40.242 -33.936 1.00 67.01  ? 336 PHE A CZ    1 
ATOM   2328 N  N     . ASP A 1 307 ? -11.129 40.205 -41.035 1.00 66.13  ? 337 ASP A N     1 
ATOM   2329 C  CA    . ASP A 1 307 ? -11.367 41.201 -42.070 1.00 66.14  ? 337 ASP A CA    1 
ATOM   2330 C  C     . ASP A 1 307 ? -12.833 41.594 -42.098 1.00 65.98  ? 337 ASP A C     1 
ATOM   2331 O  O     . ASP A 1 307 ? -13.156 42.768 -42.228 1.00 66.15  ? 337 ASP A O     1 
ATOM   2332 C  CB    . ASP A 1 307 ? -10.964 40.665 -43.444 1.00 66.38  ? 337 ASP A CB    1 
ATOM   2333 C  CG    . ASP A 1 307 ? -9.502  40.894 -43.754 1.00 67.37  ? 337 ASP A CG    1 
ATOM   2334 O  OD1   . ASP A 1 307 ? -9.123  42.064 -43.963 1.00 69.91  ? 337 ASP A OD1   1 
ATOM   2335 O  OD2   . ASP A 1 307 ? -8.730  39.914 -43.804 1.00 68.94  ? 337 ASP A OD2   1 
ATOM   2336 N  N     . ALA A 1 308 ? -13.720 40.608 -41.995 1.00 65.87  ? 338 ALA A N     1 
ATOM   2337 C  CA    . ALA A 1 308 ? -15.163 40.863 -42.020 1.00 65.79  ? 338 ALA A CA    1 
ATOM   2338 C  C     . ALA A 1 308 ? -15.603 41.633 -40.774 1.00 65.81  ? 338 ALA A C     1 
ATOM   2339 O  O     . ALA A 1 308 ? -16.509 42.466 -40.835 1.00 65.90  ? 338 ALA A O     1 
ATOM   2340 C  CB    . ALA A 1 308 ? -15.933 39.553 -42.139 1.00 65.62  ? 338 ALA A CB    1 
ATOM   2341 N  N     . VAL A 1 309 ? -14.951 41.346 -39.648 1.00 65.79  ? 339 VAL A N     1 
ATOM   2342 C  CA    . VAL A 1 309 ? -15.256 42.008 -38.386 1.00 65.65  ? 339 VAL A CA    1 
ATOM   2343 C  C     . VAL A 1 309 ? -14.826 43.464 -38.471 1.00 65.59  ? 339 VAL A C     1 
ATOM   2344 O  O     . VAL A 1 309 ? -15.648 44.372 -38.315 1.00 65.62  ? 339 VAL A O     1 
ATOM   2345 C  CB    . VAL A 1 309 ? -14.582 41.287 -37.194 1.00 65.50  ? 339 VAL A CB    1 
ATOM   2346 C  CG1   . VAL A 1 309 ? -14.382 42.225 -36.021 1.00 65.93  ? 339 VAL A CG1   1 
ATOM   2347 C  CG2   . VAL A 1 309 ? -15.422 40.103 -36.770 1.00 65.61  ? 339 VAL A CG2   1 
ATOM   2348 N  N     . THR A 1 310 ? -13.544 43.674 -38.747 1.00 65.47  ? 340 THR A N     1 
ATOM   2349 C  CA    . THR A 1 310 ? -12.993 45.013 -38.920 1.00 65.53  ? 340 THR A CA    1 
ATOM   2350 C  C     . THR A 1 310 ? -13.888 45.920 -39.770 1.00 65.75  ? 340 THR A C     1 
ATOM   2351 O  O     . THR A 1 310 ? -14.167 47.048 -39.378 1.00 65.79  ? 340 THR A O     1 
ATOM   2352 C  CB    . THR A 1 310 ? -11.604 44.939 -39.551 1.00 65.51  ? 340 THR A CB    1 
ATOM   2353 O  OG1   . THR A 1 310 ? -10.701 44.335 -38.618 1.00 65.40  ? 340 THR A OG1   1 
ATOM   2354 C  CG2   . THR A 1 310 ? -11.102 46.324 -39.936 1.00 65.37  ? 340 THR A CG2   1 
ATOM   2355 N  N     . ASP A 1 311 ? -14.343 45.428 -40.921 1.00 66.07  ? 341 ASP A N     1 
ATOM   2356 C  CA    . ASP A 1 311 ? -15.256 46.198 -41.779 1.00 66.48  ? 341 ASP A CA    1 
ATOM   2357 C  C     . ASP A 1 311 ? -16.497 46.672 -41.023 1.00 66.20  ? 341 ASP A C     1 
ATOM   2358 O  O     . ASP A 1 311 ? -16.898 47.824 -41.171 1.00 66.44  ? 341 ASP A O     1 
ATOM   2359 C  CB    . ASP A 1 311 ? -15.683 45.395 -43.021 1.00 66.84  ? 341 ASP A CB    1 
ATOM   2360 C  CG    . ASP A 1 311 ? -14.645 45.438 -44.148 1.00 68.27  ? 341 ASP A CG    1 
ATOM   2361 O  OD1   . ASP A 1 311 ? -13.514 45.943 -43.929 1.00 69.73  ? 341 ASP A OD1   1 
ATOM   2362 O  OD2   . ASP A 1 311 ? -14.970 44.964 -45.265 1.00 69.90  ? 341 ASP A OD2   1 
ATOM   2363 N  N     . VAL A 1 312 ? -17.095 45.796 -40.219 1.00 65.80  ? 342 VAL A N     1 
ATOM   2364 C  CA    . VAL A 1 312 ? -18.253 46.169 -39.407 1.00 65.69  ? 342 VAL A CA    1 
ATOM   2365 C  C     . VAL A 1 312 ? -17.880 47.227 -38.366 1.00 65.66  ? 342 VAL A C     1 
ATOM   2366 O  O     . VAL A 1 312 ? -18.661 48.131 -38.090 1.00 65.19  ? 342 VAL A O     1 
ATOM   2367 C  CB    . VAL A 1 312 ? -18.872 44.938 -38.689 1.00 65.91  ? 342 VAL A CB    1 
ATOM   2368 C  CG1   . VAL A 1 312 ? -19.966 45.368 -37.711 1.00 65.79  ? 342 VAL A CG1   1 
ATOM   2369 C  CG2   . VAL A 1 312 ? -19.423 43.941 -39.707 1.00 65.57  ? 342 VAL A CG2   1 
ATOM   2370 N  N     . ILE A 1 313 ? -16.676 47.117 -37.806 1.00 65.90  ? 343 ILE A N     1 
ATOM   2371 C  CA    . ILE A 1 313 ? -16.186 48.081 -36.811 1.00 66.11  ? 343 ILE A CA    1 
ATOM   2372 C  C     . ILE A 1 313 ? -15.789 49.441 -37.427 1.00 66.77  ? 343 ILE A C     1 
ATOM   2373 O  O     . ILE A 1 313 ? -15.543 50.403 -36.697 1.00 67.12  ? 343 ILE A O     1 
ATOM   2374 C  CB    . ILE A 1 313 ? -14.982 47.521 -36.022 1.00 65.96  ? 343 ILE A CB    1 
ATOM   2375 C  CG1   . ILE A 1 313 ? -15.354 46.212 -35.333 1.00 65.26  ? 343 ILE A CG1   1 
ATOM   2376 C  CG2   . ILE A 1 313 ? -14.487 48.536 -34.984 1.00 65.81  ? 343 ILE A CG2   1 
ATOM   2377 C  CD1   . ILE A 1 313 ? -14.262 45.644 -34.483 1.00 64.50  ? 343 ILE A CD1   1 
ATOM   2378 N  N     . ILE A 1 314 ? -15.703 49.523 -38.754 1.00 67.13  ? 344 ILE A N     1 
ATOM   2379 C  CA    . ILE A 1 314 ? -15.588 50.813 -39.425 1.00 67.48  ? 344 ILE A CA    1 
ATOM   2380 C  C     . ILE A 1 314 ? -16.994 51.321 -39.750 1.00 67.74  ? 344 ILE A C     1 
ATOM   2381 O  O     . ILE A 1 314 ? -17.388 52.394 -39.295 1.00 67.81  ? 344 ILE A O     1 
ATOM   2382 C  CB    . ILE A 1 314 ? -14.728 50.724 -40.706 1.00 67.59  ? 344 ILE A CB    1 
ATOM   2383 C  CG1   . ILE A 1 314 ? -13.265 50.457 -40.349 1.00 67.63  ? 344 ILE A CG1   1 
ATOM   2384 C  CG2   . ILE A 1 314 ? -14.820 52.024 -41.516 1.00 67.90  ? 344 ILE A CG2   1 
ATOM   2385 C  CD1   . ILE A 1 314 ? -12.566 51.659 -39.761 1.00 68.54  ? 344 ILE A CD1   1 
ATOM   2386 N  N     . LYS A 1 315 ? -17.747 50.536 -40.521 1.00 68.08  ? 345 LYS A N     1 
ATOM   2387 C  CA    . LYS A 1 315 ? -19.117 50.892 -40.914 1.00 68.37  ? 345 LYS A CA    1 
ATOM   2388 C  C     . LYS A 1 315 ? -19.984 51.368 -39.734 1.00 68.79  ? 345 LYS A C     1 
ATOM   2389 O  O     . LYS A 1 315 ? -20.736 52.337 -39.863 1.00 68.77  ? 345 LYS A O     1 
ATOM   2390 C  CB    . LYS A 1 315 ? -19.795 49.710 -41.616 1.00 68.17  ? 345 LYS A CB    1 
ATOM   2391 N  N     . ASN A 1 316 ? -19.855 50.696 -38.589 1.00 69.38  ? 346 ASN A N     1 
ATOM   2392 C  CA    . ASN A 1 316 ? -20.644 51.016 -37.391 1.00 69.62  ? 346 ASN A CA    1 
ATOM   2393 C  C     . ASN A 1 316 ? -19.971 51.970 -36.409 1.00 69.89  ? 346 ASN A C     1 
ATOM   2394 O  O     . ASN A 1 316 ? -20.448 52.109 -35.287 1.00 69.87  ? 346 ASN A O     1 
ATOM   2395 C  CB    . ASN A 1 316 ? -20.984 49.738 -36.624 1.00 69.65  ? 346 ASN A CB    1 
ATOM   2396 C  CG    . ASN A 1 316 ? -21.708 48.717 -37.470 1.00 69.87  ? 346 ASN A CG    1 
ATOM   2397 O  OD1   . ASN A 1 316 ? -21.592 48.699 -38.699 1.00 70.12  ? 346 ASN A OD1   1 
ATOM   2398 N  ND2   . ASN A 1 316 ? -22.456 47.846 -36.807 1.00 70.28  ? 346 ASN A ND2   1 
ATOM   2399 N  N     . ASN A 1 317 ? -18.871 52.614 -36.805 1.00 70.34  ? 347 ASN A N     1 
ATOM   2400 C  CA    . ASN A 1 317 ? -18.149 53.525 -35.900 1.00 70.74  ? 347 ASN A CA    1 
ATOM   2401 C  C     . ASN A 1 317 ? -17.392 54.655 -36.627 1.00 70.74  ? 347 ASN A C     1 
ATOM   2402 O  O     . ASN A 1 317 ? -16.210 54.881 -36.375 1.00 70.83  ? 347 ASN A O     1 
ATOM   2403 C  CB    . ASN A 1 317 ? -17.186 52.730 -35.007 1.00 70.89  ? 347 ASN A CB    1 
ATOM   2404 C  CG    . ASN A 1 317 ? -17.899 51.654 -34.173 1.00 72.15  ? 347 ASN A CG    1 
ATOM   2405 O  OD1   . ASN A 1 317 ? -18.527 51.956 -33.154 1.00 74.28  ? 347 ASN A OD1   1 
ATOM   2406 N  ND2   . ASN A 1 317 ? -17.799 50.396 -34.605 1.00 73.12  ? 347 ASN A ND2   1 
ATOM   2407 N  N     . LEU A 1 318 ? -18.083 55.361 -37.520 1.00 70.75  ? 348 LEU A N     1 
ATOM   2408 C  CA    . LEU A 1 318 ? -17.501 56.517 -38.213 1.00 70.98  ? 348 LEU A CA    1 
ATOM   2409 C  C     . LEU A 1 318 ? -18.547 57.292 -39.028 1.00 70.95  ? 348 LEU A C     1 
ATOM   2410 O  O     . LEU A 1 318 ? -19.386 56.697 -39.707 1.00 70.79  ? 348 LEU A O     1 
ATOM   2411 C  CB    . LEU A 1 318 ? -16.345 56.080 -39.126 1.00 71.09  ? 348 LEU A CB    1 
ATOM   2412 N  N     . SER B 2 15  ? 13.192  29.972 -11.609 1.00 65.09  ? 65  SER B N     1 
ATOM   2413 C  CA    . SER B 2 15  ? 12.048  29.131 -11.149 1.00 65.26  ? 65  SER B CA    1 
ATOM   2414 C  C     . SER B 2 15  ? 10.929  29.954 -10.495 1.00 65.30  ? 65  SER B C     1 
ATOM   2415 O  O     . SER B 2 15  ? 11.135  31.094 -10.089 1.00 65.38  ? 65  SER B O     1 
ATOM   2416 C  CB    . SER B 2 15  ? 12.546  28.073 -10.168 1.00 65.17  ? 65  SER B CB    1 
ATOM   2417 O  OG    . SER B 2 15  ? 11.511  27.167 -9.840  1.00 65.23  ? 65  SER B OG    1 
ATOM   2418 N  N     . PHE B 2 16  ? 9.745   29.356 -10.399 1.00 65.28  ? 66  PHE B N     1 
ATOM   2419 C  CA    . PHE B 2 16  ? 8.586   29.988 -9.763  1.00 65.32  ? 66  PHE B CA    1 
ATOM   2420 C  C     . PHE B 2 16  ? 8.623   29.781 -8.258  1.00 65.43  ? 66  PHE B C     1 
ATOM   2421 O  O     . PHE B 2 16  ? 8.094   30.594 -7.497  1.00 65.46  ? 66  PHE B O     1 
ATOM   2422 C  CB    . PHE B 2 16  ? 7.294   29.385 -10.330 1.00 65.46  ? 66  PHE B CB    1 
ATOM   2423 C  CG    . PHE B 2 16  ? 6.018   29.999 -9.791  1.00 65.16  ? 66  PHE B CG    1 
ATOM   2424 C  CD1   . PHE B 2 16  ? 5.820   31.366 -9.808  1.00 65.06  ? 66  PHE B CD1   1 
ATOM   2425 C  CD2   . PHE B 2 16  ? 4.994   29.190 -9.316  1.00 65.83  ? 66  PHE B CD2   1 
ATOM   2426 C  CE1   . PHE B 2 16  ? 4.634   31.926 -9.330  1.00 65.40  ? 66  PHE B CE1   1 
ATOM   2427 C  CE2   . PHE B 2 16  ? 3.796   29.739 -8.844  1.00 65.66  ? 66  PHE B CE2   1 
ATOM   2428 C  CZ    . PHE B 2 16  ? 3.621   31.107 -8.850  1.00 65.67  ? 66  PHE B CZ    1 
ATOM   2429 N  N     . ASP B 2 17  ? 9.236   28.679 -7.833  1.00 65.48  ? 67  ASP B N     1 
ATOM   2430 C  CA    . ASP B 2 17  ? 9.311   28.339 -6.417  1.00 65.44  ? 67  ASP B CA    1 
ATOM   2431 C  C     . ASP B 2 17  ? 10.149  29.360 -5.653  1.00 65.46  ? 67  ASP B C     1 
ATOM   2432 O  O     . ASP B 2 17  ? 9.884   29.626 -4.476  1.00 65.42  ? 67  ASP B O     1 
ATOM   2433 C  CB    . ASP B 2 17  ? 9.880   26.929 -6.228  1.00 65.39  ? 67  ASP B CB    1 
ATOM   2434 N  N     . LEU B 2 18  ? 11.156  29.931 -6.318  1.00 65.48  ? 68  LEU B N     1 
ATOM   2435 C  CA    . LEU B 2 18  ? 11.964  30.990 -5.709  1.00 65.48  ? 68  LEU B CA    1 
ATOM   2436 C  C     . LEU B 2 18  ? 11.085  32.220 -5.466  1.00 65.36  ? 68  LEU B C     1 
ATOM   2437 O  O     . LEU B 2 18  ? 11.020  32.733 -4.347  1.00 65.47  ? 68  LEU B O     1 
ATOM   2438 C  CB    . LEU B 2 18  ? 13.177  31.343 -6.581  1.00 65.37  ? 68  LEU B CB    1 
ATOM   2439 N  N     . LEU B 2 19  ? 10.382  32.666 -6.503  1.00 65.23  ? 69  LEU B N     1 
ATOM   2440 C  CA    . LEU B 2 19  ? 9.501   33.834 -6.396  1.00 65.19  ? 69  LEU B CA    1 
ATOM   2441 C  C     . LEU B 2 19  ? 8.592   33.736 -5.166  1.00 65.13  ? 69  LEU B C     1 
ATOM   2442 O  O     . LEU B 2 19  ? 8.532   34.660 -4.359  1.00 65.12  ? 69  LEU B O     1 
ATOM   2443 C  CB    . LEU B 2 19  ? 8.660   33.997 -7.674  1.00 65.17  ? 69  LEU B CB    1 
ATOM   2444 C  CG    . LEU B 2 19  ? 7.677   35.173 -7.756  1.00 65.14  ? 69  LEU B CG    1 
ATOM   2445 C  CD1   . LEU B 2 19  ? 8.382   36.495 -7.501  1.00 64.78  ? 69  LEU B CD1   1 
ATOM   2446 C  CD2   . LEU B 2 19  ? 6.970   35.193 -9.108  1.00 65.05  ? 69  LEU B CD2   1 
ATOM   2447 N  N     . LEU B 2 20  ? 7.917   32.601 -5.015  1.00 65.09  ? 70  LEU B N     1 
ATOM   2448 C  CA    . LEU B 2 20  ? 6.985   32.394 -3.904  1.00 65.10  ? 70  LEU B CA    1 
ATOM   2449 C  C     . LEU B 2 20  ? 7.643   32.261 -2.520  1.00 65.15  ? 70  LEU B C     1 
ATOM   2450 O  O     . LEU B 2 20  ? 6.947   32.303 -1.505  1.00 65.17  ? 70  LEU B O     1 
ATOM   2451 C  CB    . LEU B 2 20  ? 6.107   31.167 -4.180  1.00 65.13  ? 70  LEU B CB    1 
ATOM   2452 C  CG    . LEU B 2 20  ? 5.193   31.267 -5.411  1.00 65.13  ? 70  LEU B CG    1 
ATOM   2453 C  CD1   . LEU B 2 20  ? 4.328   30.029 -5.540  1.00 65.11  ? 70  LEU B CD1   1 
ATOM   2454 C  CD2   . LEU B 2 20  ? 4.318   32.517 -5.355  1.00 64.96  ? 70  LEU B CD2   1 
ATOM   2455 N  N     . SER B 2 21  ? 8.966   32.113 -2.468  1.00 65.17  ? 71  SER B N     1 
ATOM   2456 C  CA    . SER B 2 21  ? 9.670   31.979 -1.187  1.00 65.20  ? 71  SER B CA    1 
ATOM   2457 C  C     . SER B 2 21  ? 10.120  33.295 -0.569  1.00 65.14  ? 71  SER B C     1 
ATOM   2458 O  O     . SER B 2 21  ? 10.269  33.361 0.652   1.00 65.17  ? 71  SER B O     1 
ATOM   2459 C  CB    . SER B 2 21  ? 10.880  31.054 -1.325  1.00 65.19  ? 71  SER B CB    1 
ATOM   2460 O  OG    . SER B 2 21  ? 10.451  29.714 -1.434  1.00 65.41  ? 71  SER B OG    1 
ATOM   2461 N  N     . SER B 2 22  ? 10.341  34.329 -1.389  1.00 65.04  ? 72  SER B N     1 
ATOM   2462 C  CA    . SER B 2 22  ? 10.899  35.609 -0.899  1.00 65.05  ? 72  SER B CA    1 
ATOM   2463 C  C     . SER B 2 22  ? 9.825   36.646 -0.557  1.00 64.93  ? 72  SER B C     1 
ATOM   2464 O  O     . SER B 2 22  ? 8.792   36.735 -1.227  1.00 64.98  ? 72  SER B O     1 
ATOM   2465 C  CB    . SER B 2 22  ? 11.879  36.218 -1.914  1.00 65.06  ? 72  SER B CB    1 
ATOM   2466 O  OG    . SER B 2 22  ? 11.249  37.199 -2.726  1.00 65.04  ? 72  SER B OG    1 
ATOM   2467 N  N     . LYS B 2 23  ? 10.092  37.443 0.477   1.00 64.71  ? 73  LYS B N     1 
ATOM   2468 C  CA    . LYS B 2 23  ? 9.184   38.512 0.880   1.00 64.44  ? 73  LYS B CA    1 
ATOM   2469 C  C     . LYS B 2 23  ? 8.985   39.471 -0.282  1.00 64.17  ? 73  LYS B C     1 
ATOM   2470 O  O     . LYS B 2 23  ? 7.858   39.664 -0.740  1.00 63.97  ? 73  LYS B O     1 
ATOM   2471 C  CB    . LYS B 2 23  ? 9.733   39.265 2.097   1.00 64.39  ? 73  LYS B CB    1 
ATOM   2472 N  N     . ASN B 2 24  ? 10.089  40.042 -0.766  1.00 63.96  ? 74  ASN B N     1 
ATOM   2473 C  CA    . ASN B 2 24  ? 10.054  40.993 -1.881  1.00 63.83  ? 74  ASN B CA    1 
ATOM   2474 C  C     . ASN B 2 24  ? 9.289   40.420 -3.064  1.00 63.62  ? 74  ASN B C     1 
ATOM   2475 O  O     . ASN B 2 24  ? 8.326   41.023 -3.539  1.00 63.54  ? 74  ASN B O     1 
ATOM   2476 C  CB    . ASN B 2 24  ? 11.470  41.371 -2.346  1.00 63.82  ? 74  ASN B CB    1 
ATOM   2477 C  CG    . ASN B 2 24  ? 12.225  42.235 -1.338  1.00 64.02  ? 74  ASN B CG    1 
ATOM   2478 O  OD1   . ASN B 2 24  ? 11.639  42.804 -0.418  1.00 64.51  ? 74  ASN B OD1   1 
ATOM   2479 N  ND2   . ASN B 2 24  ? 13.539  42.340 -1.521  1.00 63.03  ? 74  ASN B ND2   1 
ATOM   2480 N  N     . GLY B 2 25  ? 9.721   39.251 -3.524  1.00 63.36  ? 75  GLY B N     1 
ATOM   2481 C  CA    . GLY B 2 25  ? 9.132   38.614 -4.696  1.00 63.26  ? 75  GLY B CA    1 
ATOM   2482 C  C     . GLY B 2 25  ? 7.619   38.520 -4.632  1.00 63.06  ? 75  GLY B C     1 
ATOM   2483 O  O     . GLY B 2 25  ? 6.926   38.885 -5.582  1.00 63.03  ? 75  GLY B O     1 
ATOM   2484 N  N     . VAL B 2 26  ? 7.111   38.050 -3.497  1.00 62.79  ? 76  VAL B N     1 
ATOM   2485 C  CA    . VAL B 2 26  ? 5.677   37.858 -3.308  1.00 62.54  ? 76  VAL B CA    1 
ATOM   2486 C  C     . VAL B 2 26  ? 4.907   39.175 -3.429  1.00 62.37  ? 76  VAL B C     1 
ATOM   2487 O  O     . VAL B 2 26  ? 3.903   39.244 -4.139  1.00 62.38  ? 76  VAL B O     1 
ATOM   2488 C  CB    . VAL B 2 26  ? 5.368   37.214 -1.938  1.00 62.49  ? 76  VAL B CB    1 
ATOM   2489 C  CG1   . VAL B 2 26  ? 3.864   37.032 -1.755  1.00 62.14  ? 76  VAL B CG1   1 
ATOM   2490 C  CG2   . VAL B 2 26  ? 6.081   35.883 -1.806  1.00 62.32  ? 76  VAL B CG2   1 
ATOM   2491 N  N     . ALA B 2 27  ? 5.381   40.205 -2.735  1.00 62.07  ? 77  ALA B N     1 
ATOM   2492 C  CA    . ALA B 2 27  ? 4.741   41.519 -2.765  1.00 61.98  ? 77  ALA B CA    1 
ATOM   2493 C  C     . ALA B 2 27  ? 4.719   42.088 -4.174  1.00 61.85  ? 77  ALA B C     1 
ATOM   2494 O  O     . ALA B 2 27  ? 3.716   42.658 -4.597  1.00 61.85  ? 77  ALA B O     1 
ATOM   2495 C  CB    . ALA B 2 27  ? 5.457   42.481 -1.835  1.00 61.88  ? 77  ALA B CB    1 
ATOM   2496 N  N     . ALA B 2 28  ? 5.827   41.924 -4.893  1.00 61.76  ? 78  ALA B N     1 
ATOM   2497 C  CA    . ALA B 2 28  ? 5.954   42.425 -6.261  1.00 61.68  ? 78  ALA B CA    1 
ATOM   2498 C  C     . ALA B 2 28  ? 5.005   41.688 -7.180  1.00 61.48  ? 78  ALA B C     1 
ATOM   2499 O  O     . ALA B 2 28  ? 4.331   42.289 -8.009  1.00 61.42  ? 78  ALA B O     1 
ATOM   2500 C  CB    . ALA B 2 28  ? 7.378   42.264 -6.758  1.00 61.81  ? 78  ALA B CB    1 
ATOM   2501 N  N     . PHE B 2 29  ? 4.966   40.374 -7.019  1.00 61.34  ? 79  PHE B N     1 
ATOM   2502 C  CA    . PHE B 2 29  ? 4.063   39.527 -7.776  1.00 61.06  ? 79  PHE B CA    1 
ATOM   2503 C  C     . PHE B 2 29  ? 2.602   39.855 -7.455  1.00 61.07  ? 79  PHE B C     1 
ATOM   2504 O  O     . PHE B 2 29  ? 1.732   39.746 -8.319  1.00 60.95  ? 79  PHE B O     1 
ATOM   2505 C  CB    . PHE B 2 29  ? 4.380   38.055 -7.490  1.00 60.72  ? 79  PHE B CB    1 
ATOM   2506 C  CG    . PHE B 2 29  ? 3.599   37.083 -8.330  1.00 60.44  ? 79  PHE B CG    1 
ATOM   2507 C  CD1   . PHE B 2 29  ? 3.503   37.243 -9.704  1.00 60.39  ? 79  PHE B CD1   1 
ATOM   2508 C  CD2   . PHE B 2 29  ? 2.974   35.992 -7.746  1.00 59.93  ? 79  PHE B CD2   1 
ATOM   2509 C  CE1   . PHE B 2 29  ? 2.785   36.346 -10.474 1.00 60.46  ? 79  PHE B CE1   1 
ATOM   2510 C  CE2   . PHE B 2 29  ? 2.260   35.091 -8.513  1.00 60.18  ? 79  PHE B CE2   1 
ATOM   2511 C  CZ    . PHE B 2 29  ? 2.165   35.267 -9.877  1.00 60.13  ? 79  PHE B CZ    1 
ATOM   2512 N  N     . HIS B 2 30  ? 2.340   40.274 -6.221  1.00 61.09  ? 80  HIS B N     1 
ATOM   2513 C  CA    . HIS B 2 30  ? 0.990   40.638 -5.816  1.00 61.29  ? 80  HIS B CA    1 
ATOM   2514 C  C     . HIS B 2 30  ? 0.525   41.880 -6.581  1.00 61.11  ? 80  HIS B C     1 
ATOM   2515 O  O     . HIS B 2 30  ? -0.555  41.900 -7.190  1.00 60.56  ? 80  HIS B O     1 
ATOM   2516 C  CB    . HIS B 2 30  ? 0.933   40.891 -4.307  1.00 61.53  ? 80  HIS B CB    1 
ATOM   2517 C  CG    . HIS B 2 30  ? -0.455  40.892 -3.760  1.00 62.36  ? 80  HIS B CG    1 
ATOM   2518 N  ND1   . HIS B 2 30  ? -1.158  42.053 -3.512  1.00 62.67  ? 80  HIS B ND1   1 
ATOM   2519 C  CD2   . HIS B 2 30  ? -1.288  39.871 -3.446  1.00 63.10  ? 80  HIS B CD2   1 
ATOM   2520 C  CE1   . HIS B 2 30  ? -2.362  41.746 -3.061  1.00 63.55  ? 80  HIS B CE1   1 
ATOM   2521 N  NE2   . HIS B 2 30  ? -2.466  40.428 -3.010  1.00 63.95  ? 80  HIS B NE2   1 
ATOM   2522 N  N     . ALA B 2 31  ? 1.369   42.909 -6.543  1.00 61.04  ? 81  ALA B N     1 
ATOM   2523 C  CA    . ALA B 2 31  ? 1.126   44.164 -7.249  1.00 60.84  ? 81  ALA B CA    1 
ATOM   2524 C  C     . ALA B 2 31  ? 0.748   43.908 -8.700  1.00 60.74  ? 81  ALA B C     1 
ATOM   2525 O  O     . ALA B 2 31  ? -0.147  44.558 -9.243  1.00 60.97  ? 81  ALA B O     1 
ATOM   2526 C  CB    . ALA B 2 31  ? 2.361   45.053 -7.180  1.00 60.53  ? 81  ALA B CB    1 
ATOM   2527 N  N     . PHE B 2 32  ? 1.435   42.961 -9.325  1.00 60.57  ? 82  PHE B N     1 
ATOM   2528 C  CA    . PHE B 2 32  ? 1.157   42.616 -10.705 1.00 60.48  ? 82  PHE B CA    1 
ATOM   2529 C  C     . PHE B 2 32  ? -0.209  41.944 -10.821 1.00 60.60  ? 82  PHE B C     1 
ATOM   2530 O  O     . PHE B 2 32  ? -1.062  42.384 -11.594 1.00 60.25  ? 82  PHE B O     1 
ATOM   2531 C  CB    . PHE B 2 32  ? 2.242   41.703 -11.253 1.00 60.27  ? 82  PHE B CB    1 
ATOM   2532 C  CG    . PHE B 2 32  ? 2.007   41.278 -12.670 1.00 60.21  ? 82  PHE B CG    1 
ATOM   2533 C  CD1   . PHE B 2 32  ? 2.224   42.162 -13.712 1.00 60.31  ? 82  PHE B CD1   1 
ATOM   2534 C  CD2   . PHE B 2 32  ? 1.569   39.999 -12.964 1.00 59.93  ? 82  PHE B CD2   1 
ATOM   2535 C  CE1   . PHE B 2 32  ? 2.012   41.777 -15.022 1.00 60.18  ? 82  PHE B CE1   1 
ATOM   2536 C  CE2   . PHE B 2 32  ? 1.354   39.613 -14.272 1.00 60.59  ? 82  PHE B CE2   1 
ATOM   2537 C  CZ    . PHE B 2 32  ? 1.576   40.504 -15.301 1.00 60.15  ? 82  PHE B CZ    1 
ATOM   2538 N  N     . LEU B 2 33  ? -0.422  40.893 -10.035 1.00 60.65  ? 83  LEU B N     1 
ATOM   2539 C  CA    . LEU B 2 33  ? -1.701  40.192 -10.056 1.00 60.74  ? 83  LEU B CA    1 
ATOM   2540 C  C     . LEU B 2 33  ? -2.874  41.156 -9.814  1.00 61.18  ? 83  LEU B C     1 
ATOM   2541 O  O     . LEU B 2 33  ? -3.957  40.932 -10.346 1.00 61.41  ? 83  LEU B O     1 
ATOM   2542 C  CB    . LEU B 2 33  ? -1.718  39.033 -9.053  1.00 60.40  ? 83  LEU B CB    1 
ATOM   2543 C  CG    . LEU B 2 33  ? -0.768  37.864 -9.375  1.00 59.91  ? 83  LEU B CG    1 
ATOM   2544 C  CD1   . LEU B 2 33  ? -0.597  36.972 -8.165  1.00 58.84  ? 83  LEU B CD1   1 
ATOM   2545 C  CD2   . LEU B 2 33  ? -1.222  37.037 -10.586 1.00 58.93  ? 83  LEU B CD2   1 
ATOM   2546 N  N     . LYS B 2 34  ? -2.655  42.222 -9.038  1.00 61.40  ? 84  LYS B N     1 
ATOM   2547 C  CA    . LYS B 2 34  ? -3.679  43.256 -8.847  1.00 61.66  ? 84  LYS B CA    1 
ATOM   2548 C  C     . LYS B 2 34  ? -4.011  43.927 -10.171 1.00 61.82  ? 84  LYS B C     1 
ATOM   2549 O  O     . LYS B 2 34  ? -5.172  44.270 -10.430 1.00 62.02  ? 84  LYS B O     1 
ATOM   2550 C  CB    . LYS B 2 34  ? -3.234  44.332 -7.837  1.00 61.83  ? 84  LYS B CB    1 
ATOM   2551 C  CG    . LYS B 2 34  ? -3.627  44.062 -6.390  1.00 61.96  ? 84  LYS B CG    1 
ATOM   2552 N  N     . THR B 2 35  ? -2.987  44.125 -10.999 1.00 61.79  ? 85  THR B N     1 
ATOM   2553 C  CA    . THR B 2 35  ? -3.164  44.769 -12.294 1.00 61.55  ? 85  THR B CA    1 
ATOM   2554 C  C     . THR B 2 35  ? -4.040  43.909 -13.211 1.00 61.78  ? 85  THR B C     1 
ATOM   2555 O  O     . THR B 2 35  ? -4.767  44.434 -14.045 1.00 61.98  ? 85  THR B O     1 
ATOM   2556 C  CB    . THR B 2 35  ? -1.807  45.067 -12.988 1.00 61.48  ? 85  THR B CB    1 
ATOM   2557 O  OG1   . THR B 2 35  ? -1.155  43.841 -13.330 1.00 61.29  ? 85  THR B OG1   1 
ATOM   2558 C  CG2   . THR B 2 35  ? -0.889  45.891 -12.088 1.00 60.81  ? 85  THR B CG2   1 
ATOM   2559 N  N     . GLU B 2 36  ? -3.989  42.592 -13.045 1.00 61.96  ? 86  GLU B N     1 
ATOM   2560 C  CA    . GLU B 2 36  ? -4.773  41.686 -13.885 1.00 62.19  ? 86  GLU B CA    1 
ATOM   2561 C  C     . GLU B 2 36  ? -5.987  41.115 -13.163 1.00 61.87  ? 86  GLU B C     1 
ATOM   2562 O  O     . GLU B 2 36  ? -6.625  40.191 -13.653 1.00 61.74  ? 86  GLU B O     1 
ATOM   2563 C  CB    . GLU B 2 36  ? -3.887  40.556 -14.399 1.00 62.39  ? 86  GLU B CB    1 
ATOM   2564 C  CG    . GLU B 2 36  ? -2.737  41.053 -15.248 1.00 63.32  ? 86  GLU B CG    1 
ATOM   2565 C  CD    . GLU B 2 36  ? -1.984  39.929 -15.914 1.00 64.58  ? 86  GLU B CD    1 
ATOM   2566 O  OE1   . GLU B 2 36  ? -1.922  38.835 -15.308 1.00 64.89  ? 86  GLU B OE1   1 
ATOM   2567 O  OE2   . GLU B 2 36  ? -1.451  40.146 -17.032 1.00 65.11  ? 86  GLU B OE2   1 
ATOM   2568 N  N     . PHE B 2 37  ? -6.308  41.675 -12.005 1.00 61.68  ? 87  PHE B N     1 
ATOM   2569 C  CA    . PHE B 2 37  ? -7.467  41.249 -11.225 1.00 61.61  ? 87  PHE B CA    1 
ATOM   2570 C  C     . PHE B 2 37  ? -7.489  39.750 -10.942 1.00 61.85  ? 87  PHE B C     1 
ATOM   2571 O  O     . PHE B 2 37  ? -8.536  39.127 -10.993 1.00 61.94  ? 87  PHE B O     1 
ATOM   2572 C  CB    . PHE B 2 37  ? -8.752  41.714 -11.919 1.00 61.18  ? 87  PHE B CB    1 
ATOM   2573 C  CG    . PHE B 2 37  ? -8.785  43.188 -12.163 1.00 60.64  ? 87  PHE B CG    1 
ATOM   2574 C  CD1   . PHE B 2 37  ? -9.208  44.057 -11.167 1.00 59.84  ? 87  PHE B CD1   1 
ATOM   2575 C  CD2   . PHE B 2 37  ? -8.347  43.714 -13.365 1.00 60.49  ? 87  PHE B CD2   1 
ATOM   2576 C  CE1   . PHE B 2 37  ? -9.221  45.422 -11.371 1.00 59.54  ? 87  PHE B CE1   1 
ATOM   2577 C  CE2   . PHE B 2 37  ? -8.354  45.091 -13.577 1.00 60.65  ? 87  PHE B CE2   1 
ATOM   2578 C  CZ    . PHE B 2 37  ? -8.795  45.943 -12.573 1.00 60.23  ? 87  PHE B CZ    1 
ATOM   2579 N  N     . SER B 2 38  ? -6.323  39.188 -10.626 1.00 62.37  ? 88  SER B N     1 
ATOM   2580 C  CA    . SER B 2 38  ? -6.196  37.775 -10.256 1.00 62.78  ? 88  SER B CA    1 
ATOM   2581 C  C     . SER B 2 38  ? -5.388  37.593 -8.975  1.00 63.40  ? 88  SER B C     1 
ATOM   2582 O  O     . SER B 2 38  ? -4.740  36.567 -8.784  1.00 63.59  ? 88  SER B O     1 
ATOM   2583 C  CB    . SER B 2 38  ? -5.522  37.007 -11.388 1.00 62.72  ? 88  SER B CB    1 
ATOM   2584 O  OG    . SER B 2 38  ? -4.240  37.535 -11.657 1.00 62.37  ? 88  SER B OG    1 
ATOM   2585 N  N     . GLU B 2 39  ? -5.415  38.592 -8.102  1.00 64.11  ? 89  GLU B N     1 
ATOM   2586 C  CA    . GLU B 2 39  ? -4.656  38.534 -6.859  1.00 64.75  ? 89  GLU B CA    1 
ATOM   2587 C  C     . GLU B 2 39  ? -5.215  37.496 -5.889  1.00 64.89  ? 89  GLU B C     1 
ATOM   2588 O  O     . GLU B 2 39  ? -4.474  37.005 -5.037  1.00 64.98  ? 89  GLU B O     1 
ATOM   2589 C  CB    . GLU B 2 39  ? -4.581  39.913 -6.180  1.00 65.12  ? 89  GLU B CB    1 
ATOM   2590 C  CG    . GLU B 2 39  ? -5.910  40.474 -5.636  1.00 66.18  ? 89  GLU B CG    1 
ATOM   2591 C  CD    . GLU B 2 39  ? -6.732  41.227 -6.686  1.00 68.07  ? 89  GLU B CD    1 
ATOM   2592 O  OE1   . GLU B 2 39  ? -6.750  40.796 -7.864  1.00 68.97  ? 89  GLU B OE1   1 
ATOM   2593 O  OE2   . GLU B 2 39  ? -7.366  42.251 -6.333  1.00 69.16  ? 89  GLU B OE2   1 
ATOM   2594 N  N     . GLU B 2 40  ? -6.500  37.151 -6.024  1.00 64.96  ? 90  GLU B N     1 
ATOM   2595 C  CA    . GLU B 2 40  ? -7.145  36.219 -5.089  1.00 65.13  ? 90  GLU B CA    1 
ATOM   2596 C  C     . GLU B 2 40  ? -6.440  34.878 -5.065  1.00 64.88  ? 90  GLU B C     1 
ATOM   2597 O  O     . GLU B 2 40  ? -6.449  34.191 -4.047  1.00 64.88  ? 90  GLU B O     1 
ATOM   2598 C  CB    . GLU B 2 40  ? -8.644  36.040 -5.392  1.00 65.35  ? 90  GLU B CB    1 
ATOM   2599 C  CG    . GLU B 2 40  ? -9.013  35.066 -6.528  1.00 66.61  ? 90  GLU B CG    1 
ATOM   2600 C  CD    . GLU B 2 40  ? -8.908  35.677 -7.921  1.00 68.17  ? 90  GLU B CD    1 
ATOM   2601 O  OE1   . GLU B 2 40  ? -9.510  36.756 -8.141  1.00 69.59  ? 90  GLU B OE1   1 
ATOM   2602 O  OE2   . GLU B 2 40  ? -8.245  35.065 -8.795  1.00 67.84  ? 90  GLU B OE2   1 
ATOM   2603 N  N     . ASN B 2 41  ? -5.837  34.517 -6.198  1.00 64.89  ? 91  ASN B N     1 
ATOM   2604 C  CA    . ASN B 2 41  ? -5.064  33.283 -6.335  1.00 64.68  ? 91  ASN B CA    1 
ATOM   2605 C  C     . ASN B 2 41  ? -3.914  33.244 -5.366  1.00 64.55  ? 91  ASN B C     1 
ATOM   2606 O  O     . ASN B 2 41  ? -3.827  32.340 -4.553  1.00 64.72  ? 91  ASN B O     1 
ATOM   2607 C  CB    . ASN B 2 41  ? -4.519  33.133 -7.757  1.00 64.52  ? 91  ASN B CB    1 
ATOM   2608 C  CG    . ASN B 2 41  ? -5.612  32.930 -8.779  1.00 64.85  ? 91  ASN B CG    1 
ATOM   2609 O  OD1   . ASN B 2 41  ? -6.662  32.368 -8.478  1.00 66.25  ? 91  ASN B OD1   1 
ATOM   2610 N  ND2   . ASN B 2 41  ? -5.372  33.387 -9.999  1.00 65.29  ? 91  ASN B ND2   1 
ATOM   2611 N  N     . LEU B 2 42  ? -3.034  34.233 -5.452  1.00 64.63  ? 92  LEU B N     1 
ATOM   2612 C  CA    . LEU B 2 42  ? -1.862  34.291 -4.590  1.00 64.45  ? 92  LEU B CA    1 
ATOM   2613 C  C     . LEU B 2 42  ? -2.248  34.367 -3.121  1.00 64.58  ? 92  LEU B C     1 
ATOM   2614 O  O     . LEU B 2 42  ? -1.573  33.782 -2.280  1.00 64.69  ? 92  LEU B O     1 
ATOM   2615 C  CB    . LEU B 2 42  ? -0.992  35.491 -4.955  1.00 64.49  ? 92  LEU B CB    1 
ATOM   2616 C  CG    . LEU B 2 42  ? 0.220   35.755 -4.055  1.00 64.38  ? 92  LEU B CG    1 
ATOM   2617 C  CD1   . LEU B 2 42  ? 1.093   34.509 -3.960  1.00 64.69  ? 92  LEU B CD1   1 
ATOM   2618 C  CD2   . LEU B 2 42  ? 1.007   36.939 -4.580  1.00 64.22  ? 92  LEU B CD2   1 
ATOM   2619 N  N     . GLU B 2 43  ? -3.328  35.084 -2.816  1.00 64.71  ? 93  GLU B N     1 
ATOM   2620 C  CA    . GLU B 2 43  ? -3.768  35.264 -1.430  1.00 65.01  ? 93  GLU B CA    1 
ATOM   2621 C  C     . GLU B 2 43  ? -4.120  33.926 -0.810  1.00 65.05  ? 93  GLU B C     1 
ATOM   2622 O  O     . GLU B 2 43  ? -3.566  33.540 0.221   1.00 65.07  ? 93  GLU B O     1 
ATOM   2623 C  CB    . GLU B 2 43  ? -4.959  36.227 -1.345  1.00 64.86  ? 93  GLU B CB    1 
ATOM   2624 C  CG    . GLU B 2 43  ? -4.549  37.687 -1.524  1.00 65.54  ? 93  GLU B CG    1 
ATOM   2625 C  CD    . GLU B 2 43  ? -5.710  38.674 -1.468  1.00 65.92  ? 93  GLU B CD    1 
ATOM   2626 O  OE1   . GLU B 2 43  ? -6.799  38.303 -0.988  1.00 67.57  ? 93  GLU B OE1   1 
ATOM   2627 O  OE2   . GLU B 2 43  ? -5.521  39.837 -1.897  1.00 67.04  ? 93  GLU B OE2   1 
ATOM   2628 N  N     . PHE B 2 44  ? -5.034  33.215 -1.455  1.00 65.10  ? 94  PHE B N     1 
ATOM   2629 C  CA    . PHE B 2 44  ? -5.393  31.875 -1.035  1.00 65.17  ? 94  PHE B CA    1 
ATOM   2630 C  C     . PHE B 2 44  ? -4.153  31.005 -0.824  1.00 65.17  ? 94  PHE B C     1 
ATOM   2631 O  O     . PHE B 2 44  ? -3.993  30.385 0.225   1.00 65.24  ? 94  PHE B O     1 
ATOM   2632 C  CB    . PHE B 2 44  ? -6.298  31.258 -2.087  1.00 65.42  ? 94  PHE B CB    1 
ATOM   2633 C  CG    . PHE B 2 44  ? -6.646  29.822 -1.834  1.00 65.30  ? 94  PHE B CG    1 
ATOM   2634 C  CD1   . PHE B 2 44  ? -7.314  29.448 -0.679  1.00 64.97  ? 94  PHE B CD1   1 
ATOM   2635 C  CD2   . PHE B 2 44  ? -6.344  28.850 -2.782  1.00 65.51  ? 94  PHE B CD2   1 
ATOM   2636 C  CE1   . PHE B 2 44  ? -7.656  28.124 -0.462  1.00 65.92  ? 94  PHE B CE1   1 
ATOM   2637 C  CE2   . PHE B 2 44  ? -6.682  27.522 -2.572  1.00 65.91  ? 94  PHE B CE2   1 
ATOM   2638 C  CZ    . PHE B 2 44  ? -7.343  27.157 -1.410  1.00 65.59  ? 94  PHE B CZ    1 
ATOM   2639 N  N     . TRP B 2 45  ? -3.269  30.978 -1.814  1.00 65.13  ? 95  TRP B N     1 
ATOM   2640 C  CA    . TRP B 2 45  ? -2.057  30.176 -1.722  1.00 65.24  ? 95  TRP B CA    1 
ATOM   2641 C  C     . TRP B 2 45  ? -1.247  30.521 -0.475  1.00 65.20  ? 95  TRP B C     1 
ATOM   2642 O  O     . TRP B 2 45  ? -0.644  29.635 0.148   1.00 65.35  ? 95  TRP B O     1 
ATOM   2643 C  CB    . TRP B 2 45  ? -1.188  30.356 -2.963  1.00 65.53  ? 95  TRP B CB    1 
ATOM   2644 C  CG    . TRP B 2 45  ? 0.027   29.492 -2.926  1.00 65.97  ? 95  TRP B CG    1 
ATOM   2645 C  CD1   . TRP B 2 45  ? 0.142   28.216 -3.399  1.00 66.13  ? 95  TRP B CD1   1 
ATOM   2646 C  CD2   . TRP B 2 45  ? 1.300   29.829 -2.362  1.00 65.65  ? 95  TRP B CD2   1 
ATOM   2647 N  NE1   . TRP B 2 45  ? 1.412   27.740 -3.166  1.00 66.28  ? 95  TRP B NE1   1 
ATOM   2648 C  CE2   . TRP B 2 45  ? 2.139   28.709 -2.526  1.00 66.05  ? 95  TRP B CE2   1 
ATOM   2649 C  CE3   . TRP B 2 45  ? 1.809   30.966 -1.735  1.00 65.86  ? 95  TRP B CE3   1 
ATOM   2650 C  CZ2   . TRP B 2 45  ? 3.467   28.699 -2.091  1.00 66.24  ? 95  TRP B CZ2   1 
ATOM   2651 C  CZ3   . TRP B 2 45  ? 3.130   30.956 -1.303  1.00 66.02  ? 95  TRP B CZ3   1 
ATOM   2652 C  CH2   . TRP B 2 45  ? 3.942   29.831 -1.484  1.00 66.04  ? 95  TRP B CH2   1 
ATOM   2653 N  N     . LEU B 2 46  ? -1.224  31.804 -0.119  1.00 65.00  ? 96  LEU B N     1 
ATOM   2654 C  CA    . LEU B 2 46  ? -0.576  32.244 1.127   1.00 64.91  ? 96  LEU B CA    1 
ATOM   2655 C  C     . LEU B 2 46  ? -1.412  31.907 2.367   1.00 64.81  ? 96  LEU B C     1 
ATOM   2656 O  O     . LEU B 2 46  ? -0.857  31.660 3.435   1.00 64.59  ? 96  LEU B O     1 
ATOM   2657 C  CB    . LEU B 2 46  ? -0.288  33.743 1.094   1.00 64.78  ? 96  LEU B CB    1 
ATOM   2658 C  CG    . LEU B 2 46  ? 0.732   34.243 0.072   1.00 64.29  ? 96  LEU B CG    1 
ATOM   2659 C  CD1   . LEU B 2 46  ? 0.521   35.731 -0.143  1.00 64.24  ? 96  LEU B CD1   1 
ATOM   2660 C  CD2   . LEU B 2 46  ? 2.165   33.955 0.508   1.00 63.74  ? 96  LEU B CD2   1 
ATOM   2661 N  N     . ALA B 2 47  ? -2.740  31.913 2.217   1.00 64.89  ? 97  ALA B N     1 
ATOM   2662 C  CA    . ALA B 2 47  ? -3.655  31.480 3.278   1.00 64.77  ? 97  ALA B CA    1 
ATOM   2663 C  C     . ALA B 2 47  ? -3.433  30.008 3.595   1.00 65.02  ? 97  ALA B C     1 
ATOM   2664 O  O     . ALA B 2 47  ? -3.500  29.609 4.755   1.00 65.17  ? 97  ALA B O     1 
ATOM   2665 C  CB    . ALA B 2 47  ? -5.107  31.723 2.878   1.00 64.41  ? 97  ALA B CB    1 
ATOM   2666 N  N     . CYS B 2 48  ? -3.159  29.215 2.557   1.00 65.27  ? 98  CYS B N     1 
ATOM   2667 C  CA    . CYS B 2 48  ? -2.878  27.783 2.707   1.00 65.52  ? 98  CYS B CA    1 
ATOM   2668 C  C     . CYS B 2 48  ? -1.528  27.467 3.362   1.00 65.53  ? 98  CYS B C     1 
ATOM   2669 O  O     . CYS B 2 48  ? -1.410  26.463 4.064   1.00 65.48  ? 98  CYS B O     1 
ATOM   2670 C  CB    . CYS B 2 48  ? -2.958  27.077 1.349   1.00 65.60  ? 98  CYS B CB    1 
ATOM   2671 S  SG    . CYS B 2 48  ? -4.645  26.909 0.709   1.00 66.91  ? 98  CYS B SG    1 
ATOM   2672 N  N     . GLU B 2 49  ? -0.514  28.301 3.129   1.00 65.69  ? 99  GLU B N     1 
ATOM   2673 C  CA    . GLU B 2 49  ? 0.810   28.082 3.726   1.00 65.70  ? 99  GLU B CA    1 
ATOM   2674 C  C     . GLU B 2 49  ? 0.861   28.465 5.209   1.00 65.49  ? 99  GLU B C     1 
ATOM   2675 O  O     . GLU B 2 49  ? 1.688   27.937 5.952   1.00 65.63  ? 99  GLU B O     1 
ATOM   2676 C  CB    . GLU B 2 49  ? 1.896   28.814 2.934   1.00 65.95  ? 99  GLU B CB    1 
ATOM   2677 C  CG    . GLU B 2 49  ? 2.173   28.193 1.553   1.00 66.68  ? 99  GLU B CG    1 
ATOM   2678 C  CD    . GLU B 2 49  ? 3.084   26.966 1.617   1.00 67.18  ? 99  GLU B CD    1 
ATOM   2679 O  OE1   . GLU B 2 49  ? 4.192   27.068 2.186   1.00 67.23  ? 99  GLU B OE1   1 
ATOM   2680 O  OE2   . GLU B 2 49  ? 2.698   25.900 1.090   1.00 67.30  ? 99  GLU B OE2   1 
ATOM   2681 N  N     . GLU B 2 50  ? -0.015  29.377 5.635   1.00 65.18  ? 100 GLU B N     1 
ATOM   2682 C  CA    . GLU B 2 50  ? -0.216  29.649 7.064   1.00 64.97  ? 100 GLU B CA    1 
ATOM   2683 C  C     . GLU B 2 50  ? -0.989  28.501 7.712   1.00 64.83  ? 100 GLU B C     1 
ATOM   2684 O  O     . GLU B 2 50  ? -0.545  27.921 8.708   1.00 64.88  ? 100 GLU B O     1 
ATOM   2685 C  CB    . GLU B 2 50  ? -0.982  30.959 7.286   1.00 65.00  ? 100 GLU B CB    1 
ATOM   2686 C  CG    . GLU B 2 50  ? -0.116  32.215 7.244   1.00 65.19  ? 100 GLU B CG    1 
ATOM   2687 N  N     . PHE B 2 51  ? -2.143  28.185 7.123   1.00 64.54  ? 101 PHE B N     1 
ATOM   2688 C  CA    . PHE B 2 51  ? -3.086  27.184 7.638   1.00 64.13  ? 101 PHE B CA    1 
ATOM   2689 C  C     . PHE B 2 51  ? -2.449  25.862 8.042   1.00 63.99  ? 101 PHE B C     1 
ATOM   2690 O  O     . PHE B 2 51  ? -2.816  25.274 9.059   1.00 63.95  ? 101 PHE B O     1 
ATOM   2691 C  CB    . PHE B 2 51  ? -4.154  26.911 6.576   1.00 64.12  ? 101 PHE B CB    1 
ATOM   2692 C  CG    . PHE B 2 51  ? -5.109  25.812 6.937   1.00 63.96  ? 101 PHE B CG    1 
ATOM   2693 C  CD1   . PHE B 2 51  ? -6.252  26.083 7.674   1.00 64.03  ? 101 PHE B CD1   1 
ATOM   2694 C  CD2   . PHE B 2 51  ? -4.868  24.509 6.535   1.00 63.89  ? 101 PHE B CD2   1 
ATOM   2695 C  CE1   . PHE B 2 51  ? -7.134  25.076 8.014   1.00 63.86  ? 101 PHE B CE1   1 
ATOM   2696 C  CE2   . PHE B 2 51  ? -5.742  23.490 6.873   1.00 64.32  ? 101 PHE B CE2   1 
ATOM   2697 C  CZ    . PHE B 2 51  ? -6.882  23.774 7.615   1.00 64.14  ? 101 PHE B CZ    1 
ATOM   2698 N  N     . LYS B 2 52  ? -1.506  25.397 7.233   1.00 63.98  ? 102 LYS B N     1 
ATOM   2699 C  CA    . LYS B 2 52  ? -0.923  24.069 7.404   1.00 64.08  ? 102 LYS B CA    1 
ATOM   2700 C  C     . LYS B 2 52  ? 0.081   24.014 8.541   1.00 63.87  ? 102 LYS B C     1 
ATOM   2701 O  O     . LYS B 2 52  ? 0.437   22.933 8.999   1.00 63.87  ? 102 LYS B O     1 
ATOM   2702 C  CB    . LYS B 2 52  ? -0.261  23.611 6.097   1.00 64.38  ? 102 LYS B CB    1 
ATOM   2703 C  CG    . LYS B 2 52  ? 1.035   24.352 5.740   1.00 64.91  ? 102 LYS B CG    1 
ATOM   2704 C  CD    . LYS B 2 52  ? 1.242   24.466 4.233   1.00 65.69  ? 102 LYS B CD    1 
ATOM   2705 C  CE    . LYS B 2 52  ? 1.428   23.138 3.534   1.00 66.09  ? 102 LYS B CE    1 
ATOM   2706 N  NZ    . LYS B 2 52  ? 1.219   23.325 2.065   1.00 67.08  ? 102 LYS B NZ    1 
ATOM   2707 N  N     . LYS B 2 53  ? 0.542   25.180 8.984   1.00 63.78  ? 103 LYS B N     1 
ATOM   2708 C  CA    . LYS B 2 53  ? 1.442   25.280 10.132  1.00 63.65  ? 103 LYS B CA    1 
ATOM   2709 C  C     . LYS B 2 53  ? 0.706   25.067 11.470  1.00 63.29  ? 103 LYS B C     1 
ATOM   2710 O  O     . LYS B 2 53  ? 1.339   24.826 12.509  1.00 63.21  ? 103 LYS B O     1 
ATOM   2711 C  CB    . LYS B 2 53  ? 2.145   26.646 10.137  1.00 63.73  ? 103 LYS B CB    1 
ATOM   2712 C  CG    . LYS B 2 53  ? 2.957   26.956 8.885   1.00 63.85  ? 103 LYS B CG    1 
ATOM   2713 C  CD    . LYS B 2 53  ? 3.769   28.240 9.051   1.00 64.00  ? 103 LYS B CD    1 
ATOM   2714 C  CE    . LYS B 2 53  ? 4.232   28.780 7.702   1.00 64.92  ? 103 LYS B CE    1 
ATOM   2715 N  N     . ILE B 2 54  ? -0.622  25.155 11.434  1.00 62.85  ? 104 ILE B N     1 
ATOM   2716 C  CA    . ILE B 2 54  ? -1.444  25.042 12.630  1.00 62.58  ? 104 ILE B CA    1 
ATOM   2717 C  C     . ILE B 2 54  ? -1.443  23.589 13.094  1.00 62.43  ? 104 ILE B C     1 
ATOM   2718 O  O     . ILE B 2 54  ? -1.784  22.692 12.323  1.00 62.39  ? 104 ILE B O     1 
ATOM   2719 C  CB    . ILE B 2 54  ? -2.900  25.485 12.360  1.00 62.57  ? 104 ILE B CB    1 
ATOM   2720 C  CG1   . ILE B 2 54  ? -2.955  26.920 11.826  1.00 62.60  ? 104 ILE B CG1   1 
ATOM   2721 C  CG2   . ILE B 2 54  ? -3.735  25.385 13.625  1.00 62.30  ? 104 ILE B CG2   1 
ATOM   2722 C  CD1   . ILE B 2 54  ? -4.254  27.241 11.116  1.00 62.50  ? 104 ILE B CD1   1 
ATOM   2723 N  N     . ARG B 2 55  ? -1.043  23.370 14.347  1.00 62.22  ? 105 ARG B N     1 
ATOM   2724 C  CA    . ARG B 2 55  ? -1.001  22.036 14.945  1.00 62.06  ? 105 ARG B CA    1 
ATOM   2725 C  C     . ARG B 2 55  ? -2.312  21.702 15.660  1.00 62.03  ? 105 ARG B C     1 
ATOM   2726 O  O     . ARG B 2 55  ? -2.767  20.561 15.614  1.00 62.08  ? 105 ARG B O     1 
ATOM   2727 C  CB    . ARG B 2 55  ? 0.175   21.924 15.919  1.00 61.95  ? 105 ARG B CB    1 
ATOM   2728 N  N     . SER B 2 56  ? -2.909  22.693 16.321  1.00 62.02  ? 106 SER B N     1 
ATOM   2729 C  CA    . SER B 2 56  ? -4.196  22.518 17.010  1.00 61.95  ? 106 SER B CA    1 
ATOM   2730 C  C     . SER B 2 56  ? -5.306  22.100 16.046  1.00 61.88  ? 106 SER B C     1 
ATOM   2731 O  O     . SER B 2 56  ? -5.418  22.655 14.952  1.00 61.83  ? 106 SER B O     1 
ATOM   2732 C  CB    . SER B 2 56  ? -4.611  23.819 17.699  1.00 61.91  ? 106 SER B CB    1 
ATOM   2733 O  OG    . SER B 2 56  ? -5.940  23.729 18.175  1.00 61.93  ? 106 SER B OG    1 
ATOM   2734 N  N     . ALA B 2 57  ? -6.134  21.143 16.465  1.00 61.77  ? 107 ALA B N     1 
ATOM   2735 C  CA    . ALA B 2 57  ? -7.223  20.629 15.621  1.00 61.79  ? 107 ALA B CA    1 
ATOM   2736 C  C     . ALA B 2 57  ? -8.493  21.493 15.656  1.00 61.84  ? 107 ALA B C     1 
ATOM   2737 O  O     . ALA B 2 57  ? -9.379  21.314 14.821  1.00 61.82  ? 107 ALA B O     1 
ATOM   2738 C  CB    . ALA B 2 57  ? -7.555  19.191 15.999  1.00 61.62  ? 107 ALA B CB    1 
ATOM   2739 N  N     . THR B 2 58  ? -8.588  22.413 16.618  1.00 61.91  ? 108 THR B N     1 
ATOM   2740 C  CA    . THR B 2 58  ? -9.717  23.347 16.695  1.00 61.88  ? 108 THR B CA    1 
ATOM   2741 C  C     . THR B 2 58  ? -9.512  24.530 15.772  1.00 61.88  ? 108 THR B C     1 
ATOM   2742 O  O     . THR B 2 58  ? -10.429 24.933 15.062  1.00 61.69  ? 108 THR B O     1 
ATOM   2743 C  CB    . THR B 2 58  ? -9.880  23.933 18.099  1.00 61.93  ? 108 THR B CB    1 
ATOM   2744 O  OG1   . THR B 2 58  ? -10.109 22.883 19.047  1.00 61.74  ? 108 THR B OG1   1 
ATOM   2745 C  CG2   . THR B 2 58  ? -11.044 24.928 18.124  1.00 62.18  ? 108 THR B CG2   1 
ATOM   2746 N  N     . LYS B 2 59  ? -8.312  25.106 15.831  1.00 62.06  ? 109 LYS B N     1 
ATOM   2747 C  CA    . LYS B 2 59  ? -7.954  26.266 15.017  1.00 62.27  ? 109 LYS B CA    1 
ATOM   2748 C  C     . LYS B 2 59  ? -7.969  25.890 13.546  1.00 62.45  ? 109 LYS B C     1 
ATOM   2749 O  O     . LYS B 2 59  ? -8.466  26.651 12.706  1.00 62.58  ? 109 LYS B O     1 
ATOM   2750 C  CB    . LYS B 2 59  ? -6.575  26.811 15.406  1.00 62.36  ? 109 LYS B CB    1 
ATOM   2751 N  N     . LEU B 2 60  ? -7.425  24.717 13.232  1.00 62.48  ? 110 LEU B N     1 
ATOM   2752 C  CA    . LEU B 2 60  ? -7.596  24.157 11.904  1.00 62.55  ? 110 LEU B CA    1 
ATOM   2753 C  C     . LEU B 2 60  ? -9.097  24.156 11.607  1.00 62.67  ? 110 LEU B C     1 
ATOM   2754 O  O     . LEU B 2 60  ? -9.538  24.784 10.649  1.00 62.86  ? 110 LEU B O     1 
ATOM   2755 C  CB    . LEU B 2 60  ? -7.013  22.740 11.815  1.00 62.55  ? 110 LEU B CB    1 
ATOM   2756 C  CG    . LEU B 2 60  ? -5.484  22.574 11.852  1.00 62.44  ? 110 LEU B CG    1 
ATOM   2757 C  CD1   . LEU B 2 60  ? -5.104  21.136 12.181  1.00 61.95  ? 110 LEU B CD1   1 
ATOM   2758 C  CD2   . LEU B 2 60  ? -4.825  23.007 10.553  1.00 62.21  ? 110 LEU B CD2   1 
ATOM   2759 N  N     . ALA B 2 61  ? -9.878  23.508 12.470  1.00 62.81  ? 111 ALA B N     1 
ATOM   2760 C  CA    . ALA B 2 61  ? -11.341 23.432 12.318  1.00 62.91  ? 111 ALA B CA    1 
ATOM   2761 C  C     . ALA B 2 61  ? -11.967 24.761 11.888  1.00 62.95  ? 111 ALA B C     1 
ATOM   2762 O  O     . ALA B 2 61  ? -12.665 24.837 10.874  1.00 62.74  ? 111 ALA B O     1 
ATOM   2763 C  CB    . ALA B 2 61  ? -11.985 22.950 13.621  1.00 62.83  ? 111 ALA B CB    1 
ATOM   2764 N  N     . SER B 2 62  ? -11.710 25.803 12.669  1.00 63.12  ? 112 SER B N     1 
ATOM   2765 C  CA    . SER B 2 62  ? -12.247 27.124 12.381  1.00 63.24  ? 112 SER B CA    1 
ATOM   2766 C  C     . SER B 2 62  ? -11.605 27.721 11.135  1.00 63.21  ? 112 SER B C     1 
ATOM   2767 O  O     . SER B 2 62  ? -12.311 28.154 10.228  1.00 63.40  ? 112 SER B O     1 
ATOM   2768 C  CB    . SER B 2 62  ? -12.040 28.055 13.573  1.00 63.26  ? 112 SER B CB    1 
ATOM   2769 O  OG    . SER B 2 62  ? -10.671 28.129 13.920  1.00 63.64  ? 112 SER B OG    1 
ATOM   2770 N  N     . ARG B 2 63  ? -10.275 27.734 11.076  1.00 63.06  ? 113 ARG B N     1 
ATOM   2771 C  CA    . ARG B 2 63  ? -9.578  28.389 9.958   1.00 63.08  ? 113 ARG B CA    1 
ATOM   2772 C  C     . ARG B 2 63  ? -9.971  27.787 8.604   1.00 62.99  ? 113 ARG B C     1 
ATOM   2773 O  O     . ARG B 2 63  ? -10.036 28.489 7.597   1.00 62.77  ? 113 ARG B O     1 
ATOM   2774 C  CB    . ARG B 2 63  ? -8.055  28.337 10.148  1.00 63.10  ? 113 ARG B CB    1 
ATOM   2775 C  CG    . ARG B 2 63  ? -7.256  29.209 9.177   1.00 62.80  ? 113 ARG B CG    1 
ATOM   2776 C  CD    . ARG B 2 63  ? -7.507  30.685 9.407   1.00 62.52  ? 113 ARG B CD    1 
ATOM   2777 N  N     . ALA B 2 64  ? -10.241 26.488 8.590   1.00 63.07  ? 114 ALA B N     1 
ATOM   2778 C  CA    . ALA B 2 64  ? -10.685 25.808 7.377   1.00 63.06  ? 114 ALA B CA    1 
ATOM   2779 C  C     . ALA B 2 64  ? -12.019 26.375 6.890   1.00 63.12  ? 114 ALA B C     1 
ATOM   2780 O  O     . ALA B 2 64  ? -12.209 26.558 5.691   1.00 63.15  ? 114 ALA B O     1 
ATOM   2781 C  CB    . ALA B 2 64  ? -10.795 24.312 7.617   1.00 62.87  ? 114 ALA B CB    1 
ATOM   2782 N  N     . HIS B 2 65  ? -12.934 26.659 7.816   1.00 63.09  ? 115 HIS B N     1 
ATOM   2783 C  CA    . HIS B 2 65  ? -14.205 27.280 7.450   1.00 63.10  ? 115 HIS B CA    1 
ATOM   2784 C  C     . HIS B 2 65  ? -13.990 28.700 6.941   1.00 63.15  ? 115 HIS B C     1 
ATOM   2785 O  O     . HIS B 2 65  ? -14.715 29.146 6.061   1.00 63.34  ? 115 HIS B O     1 
ATOM   2786 C  CB    . HIS B 2 65  ? -15.212 27.269 8.612   1.00 63.12  ? 115 HIS B CB    1 
ATOM   2787 C  CG    . HIS B 2 65  ? -15.993 25.994 8.726   1.00 63.04  ? 115 HIS B CG    1 
ATOM   2788 N  N     . GLN B 2 66  ? -12.996 29.402 7.480   1.00 63.10  ? 116 GLN B N     1 
ATOM   2789 C  CA    . GLN B 2 66  ? -12.671 30.760 7.017   1.00 63.10  ? 116 GLN B CA    1 
ATOM   2790 C  C     . GLN B 2 66  ? -12.080 30.785 5.603   1.00 62.88  ? 116 GLN B C     1 
ATOM   2791 O  O     . GLN B 2 66  ? -12.517 31.563 4.755   1.00 62.77  ? 116 GLN B O     1 
ATOM   2792 C  CB    . GLN B 2 66  ? -11.701 31.451 7.986   1.00 63.00  ? 116 GLN B CB    1 
ATOM   2793 C  CG    . GLN B 2 66  ? -12.326 31.805 9.312   1.00 62.98  ? 116 GLN B CG    1 
ATOM   2794 C  CD    . GLN B 2 66  ? -11.310 32.243 10.352  1.00 63.01  ? 116 GLN B CD    1 
ATOM   2795 O  OE1   . GLN B 2 66  ? -10.168 32.575 10.034  1.00 62.45  ? 116 GLN B OE1   1 
ATOM   2796 N  NE2   . GLN B 2 66  ? -11.727 32.241 11.611  1.00 63.48  ? 116 GLN B NE2   1 
ATOM   2797 N  N     . ILE B 2 67  ? -11.079 29.946 5.364   1.00 62.81  ? 117 ILE B N     1 
ATOM   2798 C  CA    . ILE B 2 67  ? -10.416 29.904 4.068   1.00 62.84  ? 117 ILE B CA    1 
ATOM   2799 C  C     . ILE B 2 67  ? -11.405 29.456 2.995   1.00 63.06  ? 117 ILE B C     1 
ATOM   2800 O  O     . ILE B 2 67  ? -11.468 30.053 1.910   1.00 63.37  ? 117 ILE B O     1 
ATOM   2801 C  CB    . ILE B 2 67  ? -9.185  28.977 4.088   1.00 62.73  ? 117 ILE B CB    1 
ATOM   2802 C  CG1   . ILE B 2 67  ? -8.082  29.588 4.949   1.00 62.73  ? 117 ILE B CG1   1 
ATOM   2803 C  CG2   . ILE B 2 67  ? -8.641  28.753 2.685   1.00 62.47  ? 117 ILE B CG2   1 
ATOM   2804 C  CD1   . ILE B 2 67  ? -6.813  28.748 5.010   1.00 62.55  ? 117 ILE B CD1   1 
ATOM   2805 N  N     . PHE B 2 68  ? -12.185 28.425 3.312   1.00 63.03  ? 118 PHE B N     1 
ATOM   2806 C  CA    . PHE B 2 68  ? -13.223 27.920 2.412   1.00 63.10  ? 118 PHE B CA    1 
ATOM   2807 C  C     . PHE B 2 68  ? -14.303 28.967 2.137   1.00 63.15  ? 118 PHE B C     1 
ATOM   2808 O  O     . PHE B 2 68  ? -14.770 29.097 1.010   1.00 63.09  ? 118 PHE B O     1 
ATOM   2809 C  CB    . PHE B 2 68  ? -13.860 26.653 2.994   1.00 63.01  ? 118 PHE B CB    1 
ATOM   2810 C  CG    . PHE B 2 68  ? -14.878 26.008 2.090   1.00 63.03  ? 118 PHE B CG    1 
ATOM   2811 C  CD1   . PHE B 2 68  ? -14.489 25.050 1.154   1.00 62.78  ? 118 PHE B CD1   1 
ATOM   2812 C  CD2   . PHE B 2 68  ? -16.227 26.352 2.178   1.00 62.79  ? 118 PHE B CD2   1 
ATOM   2813 C  CE1   . PHE B 2 68  ? -15.425 24.448 0.319   1.00 62.58  ? 118 PHE B CE1   1 
ATOM   2814 C  CE2   . PHE B 2 68  ? -17.169 25.758 1.347   1.00 62.82  ? 118 PHE B CE2   1 
ATOM   2815 C  CZ    . PHE B 2 68  ? -16.768 24.803 0.414   1.00 62.81  ? 118 PHE B CZ    1 
ATOM   2816 N  N     . GLU B 2 69  ? -14.697 29.706 3.167   1.00 63.46  ? 119 GLU B N     1 
ATOM   2817 C  CA    . GLU B 2 69  ? -15.723 30.740 3.022   1.00 63.81  ? 119 GLU B CA    1 
ATOM   2818 C  C     . GLU B 2 69  ? -15.280 31.887 2.108   1.00 63.96  ? 119 GLU B C     1 
ATOM   2819 O  O     . GLU B 2 69  ? -16.118 32.519 1.455   1.00 64.21  ? 119 GLU B O     1 
ATOM   2820 C  CB    . GLU B 2 69  ? -16.126 31.313 4.389   1.00 63.85  ? 119 GLU B CB    1 
ATOM   2821 C  CG    . GLU B 2 69  ? -17.003 30.395 5.229   1.00 64.31  ? 119 GLU B CG    1 
ATOM   2822 N  N     . GLU B 2 70  ? -13.978 32.162 2.062   1.00 63.87  ? 120 GLU B N     1 
ATOM   2823 C  CA    . GLU B 2 70  ? -13.485 33.330 1.334   1.00 63.92  ? 120 GLU B CA    1 
ATOM   2824 C  C     . GLU B 2 70  ? -13.103 33.046 -0.114  1.00 63.62  ? 120 GLU B C     1 
ATOM   2825 O  O     . GLU B 2 70  ? -13.402 33.856 -0.997  1.00 63.43  ? 120 GLU B O     1 
ATOM   2826 C  CB    . GLU B 2 70  ? -12.298 33.954 2.064   1.00 63.96  ? 120 GLU B CB    1 
ATOM   2827 C  CG    . GLU B 2 70  ? -11.902 35.313 1.502   1.00 64.75  ? 120 GLU B CG    1 
ATOM   2828 C  CD    . GLU B 2 70  ? -11.190 36.197 2.518   1.00 66.18  ? 120 GLU B CD    1 
ATOM   2829 O  OE1   . GLU B 2 70  ? -10.435 35.647 3.358   1.00 66.86  ? 120 GLU B OE1   1 
ATOM   2830 O  OE2   . GLU B 2 70  ? -11.380 37.440 2.468   1.00 66.14  ? 120 GLU B OE2   1 
ATOM   2831 N  N     . PHE B 2 71  ? -12.459 31.899 -0.343  1.00 63.30  ? 121 PHE B N     1 
ATOM   2832 C  CA    . PHE B 2 71  ? -11.809 31.598 -1.619  1.00 63.11  ? 121 PHE B CA    1 
ATOM   2833 C  C     . PHE B 2 71  ? -12.404 30.437 -2.440  1.00 63.22  ? 121 PHE B C     1 
ATOM   2834 O  O     . PHE B 2 71  ? -12.195 30.368 -3.656  1.00 63.01  ? 121 PHE B O     1 
ATOM   2835 C  CB    . PHE B 2 71  ? -10.348 31.246 -1.362  1.00 62.97  ? 121 PHE B CB    1 
ATOM   2836 C  CG    . PHE B 2 71  ? -9.561  32.323 -0.684  1.00 62.65  ? 121 PHE B CG    1 
ATOM   2837 C  CD1   . PHE B 2 71  ? -9.206  33.467 -1.365  1.00 62.21  ? 121 PHE B CD1   1 
ATOM   2838 C  CD2   . PHE B 2 71  ? -9.127  32.164 0.627   1.00 62.79  ? 121 PHE B CD2   1 
ATOM   2839 C  CE1   . PHE B 2 71  ? -8.456  34.450 -0.746  1.00 62.82  ? 121 PHE B CE1   1 
ATOM   2840 C  CE2   . PHE B 2 71  ? -8.372  33.145 1.253   1.00 62.37  ? 121 PHE B CE2   1 
ATOM   2841 C  CZ    . PHE B 2 71  ? -8.039  34.288 0.568   1.00 62.46  ? 121 PHE B CZ    1 
ATOM   2842 N  N     . ILE B 2 72  ? -13.088 29.501 -1.787  1.00 63.28  ? 122 ILE B N     1 
ATOM   2843 C  CA    . ILE B 2 72  ? -13.490 28.253 -2.444  1.00 63.35  ? 122 ILE B CA    1 
ATOM   2844 C  C     . ILE B 2 72  ? -14.975 28.221 -2.775  1.00 63.78  ? 122 ILE B C     1 
ATOM   2845 O  O     . ILE B 2 72  ? -15.368 27.926 -3.900  1.00 63.89  ? 122 ILE B O     1 
ATOM   2846 C  CB    . ILE B 2 72  ? -13.173 27.022 -1.564  1.00 63.08  ? 122 ILE B CB    1 
ATOM   2847 C  CG1   . ILE B 2 72  ? -11.714 27.037 -1.082  1.00 62.98  ? 122 ILE B CG1   1 
ATOM   2848 C  CG2   . ILE B 2 72  ? -13.478 25.746 -2.320  1.00 62.26  ? 122 ILE B CG2   1 
ATOM   2849 C  CD1   . ILE B 2 72  ? -10.641 27.032 -2.187  1.00 62.06  ? 122 ILE B CD1   1 
ATOM   2850 N  N     . CYS B 2 73  ? -15.781 28.507 -1.764  1.00 64.39  ? 123 CYS B N     1 
ATOM   2851 C  CA    . CYS B 2 73  ? -17.232 28.478 -1.848  1.00 64.62  ? 123 CYS B CA    1 
ATOM   2852 C  C     . CYS B 2 73  ? -17.820 29.168 -3.078  1.00 64.71  ? 123 CYS B C     1 
ATOM   2853 O  O     . CYS B 2 73  ? -17.314 30.191 -3.524  1.00 64.70  ? 123 CYS B O     1 
ATOM   2854 C  CB    . CYS B 2 73  ? -17.793 29.145 -0.601  1.00 64.71  ? 123 CYS B CB    1 
ATOM   2855 S  SG    . CYS B 2 73  ? -19.505 29.523 -0.751  1.00 65.57  ? 123 CYS B SG    1 
ATOM   2856 N  N     . SER B 2 74  ? -18.917 28.618 -3.593  1.00 64.98  ? 124 SER B N     1 
ATOM   2857 C  CA    . SER B 2 74  ? -19.544 29.122 -4.826  1.00 65.18  ? 124 SER B CA    1 
ATOM   2858 C  C     . SER B 2 74  ? -20.105 30.539 -4.719  1.00 65.17  ? 124 SER B C     1 
ATOM   2859 O  O     . SER B 2 74  ? -20.283 31.204 -5.740  1.00 65.35  ? 124 SER B O     1 
ATOM   2860 C  CB    . SER B 2 74  ? -20.655 28.180 -5.304  1.00 65.33  ? 124 SER B CB    1 
ATOM   2861 O  OG    . SER B 2 74  ? -20.118 27.119 -6.074  1.00 65.45  ? 124 SER B OG    1 
ATOM   2862 N  N     . GLU B 2 75  ? -20.403 30.986 -3.501  1.00 64.98  ? 125 GLU B N     1 
ATOM   2863 C  CA    . GLU B 2 75  ? -20.774 32.380 -3.250  1.00 64.77  ? 125 GLU B CA    1 
ATOM   2864 C  C     . GLU B 2 75  ? -19.667 33.111 -2.467  1.00 64.54  ? 125 GLU B C     1 
ATOM   2865 O  O     . GLU B 2 75  ? -19.957 33.908 -1.567  1.00 64.56  ? 125 GLU B O     1 
ATOM   2866 C  CB    . GLU B 2 75  ? -22.105 32.438 -2.489  1.00 64.75  ? 125 GLU B CB    1 
ATOM   2867 N  N     . ALA B 2 76  ? -18.408 32.845 -2.824  1.00 64.22  ? 126 ALA B N     1 
ATOM   2868 C  CA    . ALA B 2 76  ? -17.251 33.389 -2.101  1.00 63.98  ? 126 ALA B CA    1 
ATOM   2869 C  C     . ALA B 2 76  ? -16.817 34.741 -2.646  1.00 63.86  ? 126 ALA B C     1 
ATOM   2870 O  O     . ALA B 2 76  ? -16.812 34.949 -3.863  1.00 63.94  ? 126 ALA B O     1 
ATOM   2871 C  CB    . ALA B 2 76  ? -16.078 32.424 -2.169  1.00 64.02  ? 126 ALA B CB    1 
ATOM   2872 N  N     . PRO B 2 77  ? -16.411 35.654 -1.752  1.00 63.73  ? 127 PRO B N     1 
ATOM   2873 C  CA    . PRO B 2 77  ? -15.974 36.987 -2.154  1.00 63.76  ? 127 PRO B CA    1 
ATOM   2874 C  C     . PRO B 2 77  ? -14.677 36.999 -2.965  1.00 63.71  ? 127 PRO B C     1 
ATOM   2875 O  O     . PRO B 2 77  ? -14.599 37.704 -3.968  1.00 63.90  ? 127 PRO B O     1 
ATOM   2876 C  CB    . PRO B 2 77  ? -15.792 37.721 -0.822  1.00 63.73  ? 127 PRO B CB    1 
ATOM   2877 C  CG    . PRO B 2 77  ? -15.575 36.668 0.175   1.00 63.87  ? 127 PRO B CG    1 
ATOM   2878 C  CD    . PRO B 2 77  ? -16.341 35.472 -0.293  1.00 63.96  ? 127 PRO B CD    1 
ATOM   2879 N  N     . LYS B 2 78  ? -13.675 36.233 -2.547  1.00 63.61  ? 128 LYS B N     1 
ATOM   2880 C  CA    . LYS B 2 78  ? -12.435 36.131 -3.320  1.00 63.56  ? 128 LYS B CA    1 
ATOM   2881 C  C     . LYS B 2 78  ? -12.336 34.762 -3.983  1.00 63.40  ? 128 LYS B C     1 
ATOM   2882 O  O     . LYS B 2 78  ? -11.265 34.161 -4.022  1.00 63.37  ? 128 LYS B O     1 
ATOM   2883 C  CB    . LYS B 2 78  ? -11.225 36.387 -2.423  1.00 63.77  ? 128 LYS B CB    1 
ATOM   2884 C  CG    . LYS B 2 78  ? -11.146 37.800 -1.842  1.00 63.95  ? 128 LYS B CG    1 
ATOM   2885 C  CD    . LYS B 2 78  ? -10.154 37.836 -0.692  1.00 64.15  ? 128 LYS B CD    1 
ATOM   2886 C  CE    . LYS B 2 78  ? -9.956  39.237 -0.108  1.00 64.28  ? 128 LYS B CE    1 
ATOM   2887 N  NZ    . LYS B 2 78  ? -9.071  39.183 1.102   1.00 63.36  ? 128 LYS B NZ    1 
ATOM   2888 N  N     . GLU B 2 79  ? -13.462 34.294 -4.523  1.00 63.37  ? 129 GLU B N     1 
ATOM   2889 C  CA    . GLU B 2 79  ? -13.592 32.957 -5.112  1.00 63.31  ? 129 GLU B CA    1 
ATOM   2890 C  C     . GLU B 2 79  ? -12.538 32.702 -6.179  1.00 63.09  ? 129 GLU B C     1 
ATOM   2891 O  O     . GLU B 2 79  ? -12.400 33.489 -7.113  1.00 63.14  ? 129 GLU B O     1 
ATOM   2892 C  CB    . GLU B 2 79  ? -14.984 32.804 -5.719  1.00 63.26  ? 129 GLU B CB    1 
ATOM   2893 C  CG    . GLU B 2 79  ? -15.260 31.500 -6.452  1.00 63.40  ? 129 GLU B CG    1 
ATOM   2894 C  CD    . GLU B 2 79  ? -16.615 31.516 -7.155  1.00 63.97  ? 129 GLU B CD    1 
ATOM   2895 O  OE1   . GLU B 2 79  ? -17.447 32.410 -6.866  1.00 64.62  ? 129 GLU B OE1   1 
ATOM   2896 O  OE2   . GLU B 2 79  ? -16.855 30.631 -8.002  1.00 65.75  ? 129 GLU B OE2   1 
ATOM   2897 N  N     . VAL B 2 80  ? -11.806 31.598 -6.029  1.00 62.97  ? 130 VAL B N     1 
ATOM   2898 C  CA    . VAL B 2 80  ? -10.719 31.243 -6.945  1.00 62.83  ? 130 VAL B CA    1 
ATOM   2899 C  C     . VAL B 2 80  ? -11.200 30.239 -7.986  1.00 62.63  ? 130 VAL B C     1 
ATOM   2900 O  O     . VAL B 2 80  ? -12.135 29.473 -7.734  1.00 62.43  ? 130 VAL B O     1 
ATOM   2901 C  CB    . VAL B 2 80  ? -9.498  30.667 -6.195  1.00 62.83  ? 130 VAL B CB    1 
ATOM   2902 C  CG1   . VAL B 2 80  ? -9.182  31.525 -4.960  1.00 62.40  ? 130 VAL B CG1   1 
ATOM   2903 C  CG2   . VAL B 2 80  ? -9.731  29.214 -5.808  1.00 62.89  ? 130 VAL B CG2   1 
ATOM   2904 N  N     . ASN B 2 81  ? -10.554 30.259 -9.152  1.00 62.44  ? 131 ASN B N     1 
ATOM   2905 C  CA    . ASN B 2 81  ? -10.963 29.434 -10.286 1.00 62.06  ? 131 ASN B CA    1 
ATOM   2906 C  C     . ASN B 2 81  ? -10.399 28.031 -10.158 1.00 62.07  ? 131 ASN B C     1 
ATOM   2907 O  O     . ASN B 2 81  ? -9.220  27.790 -10.443 1.00 62.26  ? 131 ASN B O     1 
ATOM   2908 C  CB    . ASN B 2 81  ? -10.524 30.069 -11.606 1.00 61.98  ? 131 ASN B CB    1 
ATOM   2909 C  CG    . ASN B 2 81  ? -11.096 29.357 -12.824 1.00 62.30  ? 131 ASN B CG    1 
ATOM   2910 O  OD1   . ASN B 2 81  ? -11.783 28.332 -12.710 1.00 62.39  ? 131 ASN B OD1   1 
ATOM   2911 N  ND2   . ASN B 2 81  ? -10.810 29.900 -14.006 1.00 62.34  ? 131 ASN B ND2   1 
ATOM   2912 N  N     . ILE B 2 82  ? -11.260 27.127 -9.698  1.00 62.08  ? 132 ILE B N     1 
ATOM   2913 C  CA    . ILE B 2 82  ? -10.979 25.703 -9.593  1.00 62.03  ? 132 ILE B CA    1 
ATOM   2914 C  C     . ILE B 2 82  ? -12.226 24.924 -10.046 1.00 62.24  ? 132 ILE B C     1 
ATOM   2915 O  O     . ILE B 2 82  ? -13.344 25.446 -9.996  1.00 62.17  ? 132 ILE B O     1 
ATOM   2916 C  CB    . ILE B 2 82  ? -10.538 25.304 -8.154  1.00 61.99  ? 132 ILE B CB    1 
ATOM   2917 C  CG1   . ILE B 2 82  ? -11.681 25.501 -7.150  1.00 62.10  ? 132 ILE B CG1   1 
ATOM   2918 C  CG2   . ILE B 2 82  ? -9.283  26.088 -7.749  1.00 61.23  ? 132 ILE B CG2   1 
ATOM   2919 C  CD1   . ILE B 2 82  ? -11.233 25.656 -5.705  1.00 61.97  ? 132 ILE B CD1   1 
ATOM   2920 N  N     . ASP B 2 83  ? -12.024 23.691 -10.508 1.00 62.48  ? 133 ASP B N     1 
ATOM   2921 C  CA    . ASP B 2 83  ? -13.109 22.893 -11.077 1.00 62.76  ? 133 ASP B CA    1 
ATOM   2922 C  C     . ASP B 2 83  ? -14.061 22.383 -9.995  1.00 62.74  ? 133 ASP B C     1 
ATOM   2923 O  O     . ASP B 2 83  ? -13.797 22.525 -8.807  1.00 62.70  ? 133 ASP B O     1 
ATOM   2924 C  CB    . ASP B 2 83  ? -12.563 21.738 -11.950 1.00 63.11  ? 133 ASP B CB    1 
ATOM   2925 C  CG    . ASP B 2 83  ? -11.644 20.781 -11.189 1.00 64.17  ? 133 ASP B CG    1 
ATOM   2926 O  OD1   . ASP B 2 83  ? -12.061 20.236 -10.143 1.00 65.47  ? 133 ASP B OD1   1 
ATOM   2927 O  OD2   . ASP B 2 83  ? -10.505 20.555 -11.660 1.00 65.83  ? 133 ASP B OD2   1 
ATOM   2928 N  N     . HIS B 2 84  ? -15.171 21.792 -10.418 1.00 62.82  ? 134 HIS B N     1 
ATOM   2929 C  CA    . HIS B 2 84  ? -16.176 21.305 -9.489  1.00 62.75  ? 134 HIS B CA    1 
ATOM   2930 C  C     . HIS B 2 84  ? -15.643 20.193 -8.586  1.00 62.69  ? 134 HIS B C     1 
ATOM   2931 O  O     . HIS B 2 84  ? -15.932 20.170 -7.392  1.00 62.85  ? 134 HIS B O     1 
ATOM   2932 C  CB    . HIS B 2 84  ? -17.408 20.829 -10.256 1.00 62.75  ? 134 HIS B CB    1 
ATOM   2933 C  CG    . HIS B 2 84  ? -18.512 20.347 -9.372  1.00 62.91  ? 134 HIS B CG    1 
ATOM   2934 N  ND1   . HIS B 2 84  ? -19.477 19.465 -9.801  1.00 63.31  ? 134 HIS B ND1   1 
ATOM   2935 C  CD2   . HIS B 2 84  ? -18.791 20.608 -8.073  1.00 63.14  ? 134 HIS B CD2   1 
ATOM   2936 C  CE1   . HIS B 2 84  ? -20.312 19.212 -8.810  1.00 63.80  ? 134 HIS B CE1   1 
ATOM   2937 N  NE2   . HIS B 2 84  ? -19.914 19.890 -7.748  1.00 64.02  ? 134 HIS B NE2   1 
ATOM   2938 N  N     . GLU B 2 85  ? -14.855 19.287 -9.154  1.00 62.69  ? 135 GLU B N     1 
ATOM   2939 C  CA    . GLU B 2 85  ? -14.311 18.141 -8.408  1.00 62.84  ? 135 GLU B CA    1 
ATOM   2940 C  C     . GLU B 2 85  ? -13.427 18.594 -7.249  1.00 62.44  ? 135 GLU B C     1 
ATOM   2941 O  O     . GLU B 2 85  ? -13.624 18.182 -6.109  1.00 62.48  ? 135 GLU B O     1 
ATOM   2942 C  CB    . GLU B 2 85  ? -13.511 17.237 -9.354  1.00 62.86  ? 135 GLU B CB    1 
ATOM   2943 C  CG    . GLU B 2 85  ? -13.340 15.795 -8.886  1.00 63.47  ? 135 GLU B CG    1 
ATOM   2944 C  CD    . GLU B 2 85  ? -12.902 14.869 -10.021 1.00 63.77  ? 135 GLU B CD    1 
ATOM   2945 O  OE1   . GLU B 2 85  ? -13.404 13.724 -10.104 1.00 64.52  ? 135 GLU B OE1   1 
ATOM   2946 O  OE2   . GLU B 2 85  ? -12.065 15.298 -10.846 1.00 65.14  ? 135 GLU B OE2   1 
ATOM   2947 N  N     . THR B 2 86  ? -12.466 19.462 -7.553  1.00 62.17  ? 136 THR B N     1 
ATOM   2948 C  CA    . THR B 2 86  ? -11.532 19.956 -6.562  1.00 61.86  ? 136 THR B CA    1 
ATOM   2949 C  C     . THR B 2 86  ? -12.242 20.765 -5.491  1.00 61.94  ? 136 THR B C     1 
ATOM   2950 O  O     . THR B 2 86  ? -11.798 20.801 -4.340  1.00 61.96  ? 136 THR B O     1 
ATOM   2951 C  CB    . THR B 2 86  ? -10.442 20.835 -7.200  1.00 61.93  ? 136 THR B CB    1 
ATOM   2952 O  OG1   . THR B 2 86  ? -9.898  20.181 -8.354  1.00 61.16  ? 136 THR B OG1   1 
ATOM   2953 C  CG2   . THR B 2 86  ? -9.323  21.114 -6.186  1.00 61.53  ? 136 THR B CG2   1 
ATOM   2954 N  N     . ARG B 2 87  ? -13.337 21.424 -5.865  1.00 61.95  ? 137 ARG B N     1 
ATOM   2955 C  CA    . ARG B 2 87  ? -14.100 22.225 -4.911  1.00 62.03  ? 137 ARG B CA    1 
ATOM   2956 C  C     . ARG B 2 87  ? -14.801 21.335 -3.900  1.00 62.07  ? 137 ARG B C     1 
ATOM   2957 O  O     . ARG B 2 87  ? -14.625 21.501 -2.687  1.00 61.99  ? 137 ARG B O     1 
ATOM   2958 C  CB    . ARG B 2 87  ? -15.147 23.087 -5.610  1.00 62.03  ? 137 ARG B CB    1 
ATOM   2959 C  CG    . ARG B 2 87  ? -15.841 24.103 -4.666  1.00 62.53  ? 137 ARG B CG    1 
ATOM   2960 C  CD    . ARG B 2 87  ? -17.278 24.373 -5.062  1.00 62.77  ? 137 ARG B CD    1 
ATOM   2961 N  NE    . ARG B 2 87  ? -17.392 24.445 -6.513  1.00 63.51  ? 137 ARG B NE    1 
ATOM   2962 C  CZ    . ARG B 2 87  ? -18.472 24.114 -7.214  1.00 64.33  ? 137 ARG B CZ    1 
ATOM   2963 N  NH1   . ARG B 2 87  ? -19.590 23.700 -6.616  1.00 65.95  ? 137 ARG B NH1   1 
ATOM   2964 N  NH2   . ARG B 2 87  ? -18.435 24.205 -8.531  1.00 63.93  ? 137 ARG B NH2   1 
ATOM   2965 N  N     . GLU B 2 88  ? -15.590 20.392 -4.410  1.00 61.88  ? 138 GLU B N     1 
ATOM   2966 C  CA    . GLU B 2 88  ? -16.428 19.558 -3.562  1.00 61.81  ? 138 GLU B CA    1 
ATOM   2967 C  C     . GLU B 2 88  ? -15.587 18.575 -2.743  1.00 61.51  ? 138 GLU B C     1 
ATOM   2968 O  O     . GLU B 2 88  ? -16.013 18.139 -1.683  1.00 61.23  ? 138 GLU B O     1 
ATOM   2969 C  CB    . GLU B 2 88  ? -17.497 18.833 -4.401  1.00 61.92  ? 138 GLU B CB    1 
ATOM   2970 C  CG    . GLU B 2 88  ? -18.927 18.936 -3.834  1.00 62.89  ? 138 GLU B CG    1 
ATOM   2971 C  CD    . GLU B 2 88  ? -19.434 20.390 -3.685  1.00 63.96  ? 138 GLU B CD    1 
ATOM   2972 O  OE1   . GLU B 2 88  ? -20.155 20.672 -2.699  1.00 63.86  ? 138 GLU B OE1   1 
ATOM   2973 O  OE2   . GLU B 2 88  ? -19.111 21.249 -4.543  1.00 64.30  ? 138 GLU B OE2   1 
ATOM   2974 N  N     . LEU B 2 89  ? -14.396 18.240 -3.231  1.00 61.53  ? 139 LEU B N     1 
ATOM   2975 C  CA    . LEU B 2 89  ? -13.439 17.433 -2.462  1.00 61.97  ? 139 LEU B CA    1 
ATOM   2976 C  C     . LEU B 2 89  ? -12.937 18.212 -1.244  1.00 62.08  ? 139 LEU B C     1 
ATOM   2977 O  O     . LEU B 2 89  ? -12.926 17.705 -0.118  1.00 62.25  ? 139 LEU B O     1 
ATOM   2978 C  CB    . LEU B 2 89  ? -12.265 17.010 -3.353  1.00 62.07  ? 139 LEU B CB    1 
ATOM   2979 C  CG    . LEU B 2 89  ? -10.887 16.727 -2.737  1.00 62.60  ? 139 LEU B CG    1 
ATOM   2980 C  CD1   . LEU B 2 89  ? -10.867 15.444 -1.899  1.00 62.62  ? 139 LEU B CD1   1 
ATOM   2981 C  CD2   . LEU B 2 89  ? -9.859  16.653 -3.866  1.00 62.56  ? 139 LEU B CD2   1 
ATOM   2982 N  N     . THR B 2 90  ? -12.532 19.453 -1.475  1.00 62.20  ? 140 THR B N     1 
ATOM   2983 C  CA    . THR B 2 90  ? -12.129 20.335 -0.394  1.00 62.40  ? 140 THR B CA    1 
ATOM   2984 C  C     . THR B 2 90  ? -13.274 20.562 0.612   1.00 62.66  ? 140 THR B C     1 
ATOM   2985 O  O     . THR B 2 90  ? -13.016 20.801 1.796   1.00 62.86  ? 140 THR B O     1 
ATOM   2986 C  CB    . THR B 2 90  ? -11.597 21.674 -0.959  1.00 62.45  ? 140 THR B CB    1 
ATOM   2987 O  OG1   . THR B 2 90  ? -10.426 21.416 -1.746  1.00 62.68  ? 140 THR B OG1   1 
ATOM   2988 C  CG2   . THR B 2 90  ? -11.250 22.650 0.153   1.00 61.84  ? 140 THR B CG2   1 
ATOM   2989 N  N     . ARG B 2 91  ? -14.524 20.470 0.155   1.00 62.75  ? 141 ARG B N     1 
ATOM   2990 C  CA    . ARG B 2 91  ? -15.675 20.595 1.052   1.00 63.02  ? 141 ARG B CA    1 
ATOM   2991 C  C     . ARG B 2 91  ? -15.854 19.350 1.912   1.00 63.58  ? 141 ARG B C     1 
ATOM   2992 O  O     . ARG B 2 91  ? -16.298 19.442 3.060   1.00 63.65  ? 141 ARG B O     1 
ATOM   2993 C  CB    . ARG B 2 91  ? -16.970 20.878 0.284   1.00 62.96  ? 141 ARG B CB    1 
ATOM   2994 C  CG    . ARG B 2 91  ? -18.117 21.350 1.180   1.00 62.67  ? 141 ARG B CG    1 
ATOM   2995 C  CD    . ARG B 2 91  ? -19.358 21.719 0.388   1.00 62.81  ? 141 ARG B CD    1 
ATOM   2996 N  NE    . ARG B 2 91  ? -20.018 20.541 -0.160  1.00 62.76  ? 141 ARG B NE    1 
ATOM   2997 N  N     . MET B 2 92  ? -15.525 18.186 1.364   1.00 64.14  ? 142 MET B N     1 
ATOM   2998 C  CA    . MET B 2 92  ? -15.578 16.963 2.146   1.00 64.70  ? 142 MET B CA    1 
ATOM   2999 C  C     . MET B 2 92  ? -14.347 16.854 3.040   1.00 64.65  ? 142 MET B C     1 
ATOM   3000 O  O     . MET B 2 92  ? -14.403 16.209 4.083   1.00 64.78  ? 142 MET B O     1 
ATOM   3001 C  CB    . MET B 2 92  ? -15.721 15.737 1.246   1.00 65.30  ? 142 MET B CB    1 
ATOM   3002 C  CG    . MET B 2 92  ? -16.935 15.787 0.292   1.00 66.72  ? 142 MET B CG    1 
ATOM   3003 S  SD    . MET B 2 92  ? -18.505 16.373 1.014   1.00 69.80  ? 142 MET B SD    1 
ATOM   3004 C  CE    . MET B 2 92  ? -19.460 16.742 -0.472  1.00 67.70  ? 142 MET B CE    1 
ATOM   3005 N  N     . ASN B 2 93  ? -13.247 17.499 2.652   1.00 64.59  ? 143 ASN B N     1 
ATOM   3006 C  CA    . ASN B 2 93  ? -12.061 17.571 3.513   1.00 64.57  ? 143 ASN B CA    1 
ATOM   3007 C  C     . ASN B 2 93  ? -12.243 18.447 4.756   1.00 64.80  ? 143 ASN B C     1 
ATOM   3008 O  O     . ASN B 2 93  ? -11.491 18.306 5.725   1.00 64.96  ? 143 ASN B O     1 
ATOM   3009 C  CB    . ASN B 2 93  ? -10.842 18.038 2.718   1.00 64.51  ? 143 ASN B CB    1 
ATOM   3010 C  CG    . ASN B 2 93  ? -10.290 16.956 1.808   1.00 63.78  ? 143 ASN B CG    1 
ATOM   3011 O  OD1   . ASN B 2 93  ? -10.700 15.798 1.879   1.00 62.23  ? 143 ASN B OD1   1 
ATOM   3012 N  ND2   . ASN B 2 93  ? -9.348  17.331 0.951   1.00 62.64  ? 143 ASN B ND2   1 
ATOM   3013 N  N     . LEU B 2 94  ? -13.234 19.342 4.728   1.00 64.92  ? 144 LEU B N     1 
ATOM   3014 C  CA    . LEU B 2 94  ? -13.638 20.107 5.922   1.00 64.89  ? 144 LEU B CA    1 
ATOM   3015 C  C     . LEU B 2 94  ? -14.247 19.240 7.035   1.00 64.89  ? 144 LEU B C     1 
ATOM   3016 O  O     . LEU B 2 94  ? -14.041 19.511 8.222   1.00 64.68  ? 144 LEU B O     1 
ATOM   3017 C  CB    . LEU B 2 94  ? -14.663 21.183 5.557   1.00 64.83  ? 144 LEU B CB    1 
ATOM   3018 C  CG    . LEU B 2 94  ? -14.191 22.433 4.827   1.00 64.96  ? 144 LEU B CG    1 
ATOM   3019 C  CD1   . LEU B 2 94  ? -15.371 23.382 4.656   1.00 65.16  ? 144 LEU B CD1   1 
ATOM   3020 C  CD2   . LEU B 2 94  ? -13.061 23.114 5.577   1.00 64.46  ? 144 LEU B CD2   1 
ATOM   3021 N  N     . GLN B 2 95  ? -15.022 18.227 6.650   1.00 64.92  ? 145 GLN B N     1 
ATOM   3022 C  CA    . GLN B 2 95  ? -15.696 17.352 7.617   1.00 65.03  ? 145 GLN B CA    1 
ATOM   3023 C  C     . GLN B 2 95  ? -14.811 17.112 8.845   1.00 65.00  ? 145 GLN B C     1 
ATOM   3024 O  O     . GLN B 2 95  ? -15.302 17.121 9.974   1.00 65.10  ? 145 GLN B O     1 
ATOM   3025 C  CB    . GLN B 2 95  ? -16.100 16.019 6.969   1.00 64.98  ? 145 GLN B CB    1 
ATOM   3026 N  N     . THR B 2 96  ? -13.514 16.892 8.608   1.00 64.88  ? 146 THR B N     1 
ATOM   3027 C  CA    . THR B 2 96  ? -12.484 16.946 9.657   1.00 64.73  ? 146 THR B CA    1 
ATOM   3028 C  C     . THR B 2 96  ? -11.237 17.638 9.107   1.00 64.52  ? 146 THR B C     1 
ATOM   3029 O  O     . THR B 2 96  ? -10.394 17.008 8.466   1.00 64.66  ? 146 THR B O     1 
ATOM   3030 C  CB    . THR B 2 96  ? -12.073 15.546 10.166  1.00 64.75  ? 146 THR B CB    1 
ATOM   3031 O  OG1   . THR B 2 96  ? -11.600 14.759 9.066   1.00 64.61  ? 146 THR B OG1   1 
ATOM   3032 C  CG2   . THR B 2 96  ? -13.241 14.840 10.857  1.00 64.52  ? 146 THR B CG2   1 
ATOM   3033 N  N     . ALA B 2 97  ? -11.124 18.936 9.355   1.00 64.18  ? 147 ALA B N     1 
ATOM   3034 C  CA    . ALA B 2 97  ? -10.020 19.711 8.817   1.00 63.83  ? 147 ALA B CA    1 
ATOM   3035 C  C     . ALA B 2 97  ? -8.685  19.265 9.415   1.00 63.49  ? 147 ALA B C     1 
ATOM   3036 O  O     . ALA B 2 97  ? -8.408  19.520 10.582  1.00 63.42  ? 147 ALA B O     1 
ATOM   3037 C  CB    . ALA B 2 97  ? -10.248 21.199 9.075   1.00 63.85  ? 147 ALA B CB    1 
ATOM   3038 N  N     . THR B 2 98  ? -7.880  18.578 8.609   1.00 63.15  ? 148 THR B N     1 
ATOM   3039 C  CA    . THR B 2 98  ? -6.466  18.349 8.920   1.00 62.71  ? 148 THR B CA    1 
ATOM   3040 C  C     . THR B 2 98  ? -5.617  19.394 8.171   1.00 62.45  ? 148 THR B C     1 
ATOM   3041 O  O     . THR B 2 98  ? -6.145  20.222 7.417   1.00 62.23  ? 148 THR B O     1 
ATOM   3042 C  CB    . THR B 2 98  ? -5.999  16.916 8.526   1.00 62.61  ? 148 THR B CB    1 
ATOM   3043 O  OG1   . THR B 2 98  ? -5.794  16.838 7.109   1.00 63.03  ? 148 THR B OG1   1 
ATOM   3044 C  CG2   . THR B 2 98  ? -7.016  15.870 8.944   1.00 62.34  ? 148 THR B CG2   1 
ATOM   3045 N  N     . ALA B 2 99  ? -4.304  19.341 8.379   1.00 62.12  ? 149 ALA B N     1 
ATOM   3046 C  CA    . ALA B 2 99  ? -3.365  20.279 7.751   1.00 61.90  ? 149 ALA B CA    1 
ATOM   3047 C  C     . ALA B 2 99  ? -3.367  20.242 6.218   1.00 61.67  ? 149 ALA B C     1 
ATOM   3048 O  O     . ALA B 2 99  ? -3.116  21.262 5.575   1.00 61.62  ? 149 ALA B O     1 
ATOM   3049 C  CB    . ALA B 2 99  ? -1.950  20.028 8.273   1.00 61.83  ? 149 ALA B CB    1 
ATOM   3050 N  N     . THR B 2 100 ? -3.643  19.073 5.641   1.00 61.44  ? 150 THR B N     1 
ATOM   3051 C  CA    . THR B 2 100 ? -3.607  18.889 4.185   1.00 61.34  ? 150 THR B CA    1 
ATOM   3052 C  C     . THR B 2 100 ? -4.924  19.250 3.486   1.00 61.41  ? 150 THR B C     1 
ATOM   3053 O  O     . THR B 2 100 ? -5.006  19.197 2.258   1.00 61.21  ? 150 THR B O     1 
ATOM   3054 C  CB    . THR B 2 100 ? -3.290  17.435 3.836   1.00 61.25  ? 150 THR B CB    1 
ATOM   3055 O  OG1   . THR B 2 100 ? -4.228  16.586 4.501   1.00 61.15  ? 150 THR B OG1   1 
ATOM   3056 C  CG2   . THR B 2 100 ? -1.882  17.071 4.267   1.00 60.84  ? 150 THR B CG2   1 
ATOM   3057 N  N     . CYS B 2 101 ? -5.935  19.623 4.271   1.00 61.40  ? 151 CYS B N     1 
ATOM   3058 C  CA    . CYS B 2 101 ? -7.291  19.919 3.789   1.00 61.46  ? 151 CYS B CA    1 
ATOM   3059 C  C     . CYS B 2 101 ? -7.380  20.612 2.415   1.00 61.70  ? 151 CYS B C     1 
ATOM   3060 O  O     . CYS B 2 101 ? -8.278  20.305 1.619   1.00 61.54  ? 151 CYS B O     1 
ATOM   3061 C  CB    . CYS B 2 101 ? -8.011  20.763 4.845   1.00 61.40  ? 151 CYS B CB    1 
ATOM   3062 S  SG    . CYS B 2 101 ? -9.672  21.297 4.425   1.00 61.02  ? 151 CYS B SG    1 
ATOM   3063 N  N     . PHE B 2 102 ? -6.451  21.534 2.149   1.00 61.95  ? 152 PHE B N     1 
ATOM   3064 C  CA    . PHE B 2 102 ? -6.453  22.343 0.921   1.00 61.98  ? 152 PHE B CA    1 
ATOM   3065 C  C     . PHE B 2 102 ? -5.374  21.982 -0.115  1.00 62.25  ? 152 PHE B C     1 
ATOM   3066 O  O     . PHE B 2 102 ? -5.275  22.652 -1.141  1.00 62.26  ? 152 PHE B O     1 
ATOM   3067 C  CB    . PHE B 2 102 ? -6.310  23.828 1.282   1.00 61.93  ? 152 PHE B CB    1 
ATOM   3068 C  CG    . PHE B 2 102 ? -7.531  24.416 1.923   1.00 61.75  ? 152 PHE B CG    1 
ATOM   3069 C  CD1   . PHE B 2 102 ? -8.627  24.775 1.152   1.00 61.15  ? 152 PHE B CD1   1 
ATOM   3070 C  CD2   . PHE B 2 102 ? -7.589  24.605 3.294   1.00 61.56  ? 152 PHE B CD2   1 
ATOM   3071 C  CE1   . PHE B 2 102 ? -9.754  25.310 1.731   1.00 60.74  ? 152 PHE B CE1   1 
ATOM   3072 C  CE2   . PHE B 2 102 ? -8.719  25.135 3.880   1.00 61.60  ? 152 PHE B CE2   1 
ATOM   3073 C  CZ    . PHE B 2 102 ? -9.805  25.488 3.093   1.00 61.41  ? 152 PHE B CZ    1 
ATOM   3074 N  N     . ASP B 2 103 ? -4.576  20.943 0.124   1.00 62.54  ? 153 ASP B N     1 
ATOM   3075 C  CA    . ASP B 2 103 ? -3.483  20.603 -0.804  1.00 62.84  ? 153 ASP B CA    1 
ATOM   3076 C  C     . ASP B 2 103 ? -3.944  20.509 -2.266  1.00 62.71  ? 153 ASP B C     1 
ATOM   3077 O  O     . ASP B 2 103 ? -3.249  20.979 -3.173  1.00 62.58  ? 153 ASP B O     1 
ATOM   3078 C  CB    . ASP B 2 103 ? -2.782  19.299 -0.394  1.00 63.11  ? 153 ASP B CB    1 
ATOM   3079 C  CG    . ASP B 2 103 ? -1.780  19.488 0.749   1.00 64.14  ? 153 ASP B CG    1 
ATOM   3080 O  OD1   . ASP B 2 103 ? -1.381  20.639 1.033   1.00 66.11  ? 153 ASP B OD1   1 
ATOM   3081 O  OD2   . ASP B 2 103 ? -1.380  18.470 1.362   1.00 65.36  ? 153 ASP B OD2   1 
ATOM   3082 N  N     . ALA B 2 104 ? -5.111  19.915 -2.496  1.00 62.68  ? 154 ALA B N     1 
ATOM   3083 C  CA    . ALA B 2 104 ? -5.629  19.786 -3.859  1.00 62.77  ? 154 ALA B CA    1 
ATOM   3084 C  C     . ALA B 2 104 ? -5.930  21.159 -4.429  1.00 62.77  ? 154 ALA B C     1 
ATOM   3085 O  O     . ALA B 2 104 ? -5.399  21.530 -5.475  1.00 62.65  ? 154 ALA B O     1 
ATOM   3086 C  CB    . ALA B 2 104 ? -6.872  18.917 -3.895  1.00 62.68  ? 154 ALA B CB    1 
ATOM   3087 N  N     . ALA B 2 105 ? -6.765  21.916 -3.726  1.00 62.82  ? 155 ALA B N     1 
ATOM   3088 C  CA    . ALA B 2 105 ? -7.124  23.259 -4.173  1.00 63.12  ? 155 ALA B CA    1 
ATOM   3089 C  C     . ALA B 2 105 ? -5.899  24.169 -4.327  1.00 63.41  ? 155 ALA B C     1 
ATOM   3090 O  O     . ALA B 2 105 ? -5.851  25.017 -5.215  1.00 63.60  ? 155 ALA B O     1 
ATOM   3091 C  CB    . ALA B 2 105 ? -8.129  23.879 -3.216  1.00 62.97  ? 155 ALA B CB    1 
ATOM   3092 N  N     . GLN B 2 106 ? -4.909  23.985 -3.459  1.00 63.84  ? 156 GLN B N     1 
ATOM   3093 C  CA    . GLN B 2 106 ? -3.695  24.808 -3.469  1.00 63.98  ? 156 GLN B CA    1 
ATOM   3094 C  C     . GLN B 2 106 ? -2.805  24.499 -4.673  1.00 64.09  ? 156 GLN B C     1 
ATOM   3095 O  O     . GLN B 2 106 ? -2.113  25.381 -5.180  1.00 64.28  ? 156 GLN B O     1 
ATOM   3096 C  CB    . GLN B 2 106 ? -2.903  24.588 -2.182  1.00 63.93  ? 156 GLN B CB    1 
ATOM   3097 C  CG    . GLN B 2 106 ? -1.888  25.662 -1.893  1.00 63.48  ? 156 GLN B CG    1 
ATOM   3098 C  CD    . GLN B 2 106 ? -0.814  25.198 -0.950  1.00 62.52  ? 156 GLN B CD    1 
ATOM   3099 O  OE1   . GLN B 2 106 ? -1.046  24.358 -0.087  1.00 63.18  ? 156 GLN B OE1   1 
ATOM   3100 N  NE2   . GLN B 2 106 ? 0.375   25.740 -1.112  1.00 63.00  ? 156 GLN B NE2   1 
ATOM   3101 N  N     . GLY B 2 107 ? -2.817  23.246 -5.115  1.00 64.06  ? 157 GLY B N     1 
ATOM   3102 C  CA    . GLY B 2 107 ? -2.055  22.838 -6.296  1.00 64.08  ? 157 GLY B CA    1 
ATOM   3103 C  C     . GLY B 2 107 ? -2.673  23.352 -7.584  1.00 63.94  ? 157 GLY B C     1 
ATOM   3104 O  O     . GLY B 2 107 ? -1.966  23.796 -8.490  1.00 63.97  ? 157 GLY B O     1 
ATOM   3105 N  N     . LYS B 2 108 ? -3.999  23.289 -7.667  1.00 63.80  ? 158 LYS B N     1 
ATOM   3106 C  CA    . LYS B 2 108 ? -4.717  23.798 -8.834  1.00 63.62  ? 158 LYS B CA    1 
ATOM   3107 C  C     . LYS B 2 108 ? -4.391  25.269 -9.012  1.00 63.57  ? 158 LYS B C     1 
ATOM   3108 O  O     . LYS B 2 108 ? -4.014  25.704 -10.096 1.00 63.56  ? 158 LYS B O     1 
ATOM   3109 C  CB    . LYS B 2 108 ? -6.229  23.593 -8.679  1.00 63.46  ? 158 LYS B CB    1 
ATOM   3110 C  CG    . LYS B 2 108 ? -6.680  22.124 -8.768  1.00 63.15  ? 158 LYS B CG    1 
ATOM   3111 C  CD    . LYS B 2 108 ? -6.295  21.494 -10.106 1.00 62.91  ? 158 LYS B CD    1 
ATOM   3112 C  CE    . LYS B 2 108 ? -7.096  20.232 -10.428 1.00 63.14  ? 158 LYS B CE    1 
ATOM   3113 N  N     . THR B 2 109 ? -4.496  26.006 -7.912  1.00 63.73  ? 159 THR B N     1 
ATOM   3114 C  CA    . THR B 2 109 ? -4.211  27.441 -7.870  1.00 63.64  ? 159 THR B CA    1 
ATOM   3115 C  C     . THR B 2 109 ? -2.742  27.801 -8.179  1.00 63.69  ? 159 THR B C     1 
ATOM   3116 O  O     . THR B 2 109 ? -2.479  28.739 -8.926  1.00 63.76  ? 159 THR B O     1 
ATOM   3117 C  CB    . THR B 2 109 ? -4.612  27.999 -6.498  1.00 63.47  ? 159 THR B CB    1 
ATOM   3118 O  OG1   . THR B 2 109 ? -6.027  27.860 -6.333  1.00 62.87  ? 159 THR B OG1   1 
ATOM   3119 C  CG2   . THR B 2 109 ? -4.235  29.445 -6.372  1.00 63.39  ? 159 THR B CG2   1 
ATOM   3120 N  N     . ARG B 2 110 ? -1.796  27.060 -7.616  1.00 63.68  ? 160 ARG B N     1 
ATOM   3121 C  CA    . ARG B 2 110 ? -0.379  27.276 -7.914  1.00 63.93  ? 160 ARG B CA    1 
ATOM   3122 C  C     . ARG B 2 110 ? -0.105  27.171 -9.421  1.00 64.19  ? 160 ARG B C     1 
ATOM   3123 O  O     . ARG B 2 110 ? 0.561   28.028 -9.999  1.00 64.21  ? 160 ARG B O     1 
ATOM   3124 C  CB    . ARG B 2 110 ? 0.476   26.259 -7.159  1.00 63.77  ? 160 ARG B CB    1 
ATOM   3125 C  CG    . ARG B 2 110 ? 1.967   26.451 -7.320  1.00 64.15  ? 160 ARG B CG    1 
ATOM   3126 C  CD    . ARG B 2 110 ? 2.752   25.412 -6.520  1.00 64.44  ? 160 ARG B CD    1 
ATOM   3127 N  NE    . ARG B 2 110 ? 4.181   25.723 -6.444  1.00 64.75  ? 160 ARG B NE    1 
ATOM   3128 C  CZ    . ARG B 2 110 ? 5.058   25.562 -7.439  1.00 65.06  ? 160 ARG B CZ    1 
ATOM   3129 N  NH1   . ARG B 2 110 ? 4.676   25.088 -8.626  1.00 64.71  ? 160 ARG B NH1   1 
ATOM   3130 N  NH2   . ARG B 2 110 ? 6.341   25.878 -7.246  1.00 65.52  ? 160 ARG B NH2   1 
ATOM   3131 N  N     . THR B 2 111 ? -0.629  26.108 -10.037 1.00 64.48  ? 161 THR B N     1 
ATOM   3132 C  CA    . THR B 2 111 ? -0.497  25.848 -11.474 1.00 64.55  ? 161 THR B CA    1 
ATOM   3133 C  C     . THR B 2 111 ? -1.114  26.970 -12.311 1.00 64.39  ? 161 THR B C     1 
ATOM   3134 O  O     . THR B 2 111 ? -0.578  27.364 -13.344 1.00 64.30  ? 161 THR B O     1 
ATOM   3135 C  CB    . THR B 2 111 ? -1.192  24.502 -11.844 1.00 64.80  ? 161 THR B CB    1 
ATOM   3136 O  OG1   . THR B 2 111 ? -0.591  23.431 -11.104 1.00 65.49  ? 161 THR B OG1   1 
ATOM   3137 C  CG2   . THR B 2 111 ? -1.100  24.199 -13.354 1.00 64.85  ? 161 THR B CG2   1 
ATOM   3138 N  N     . LEU B 2 112 ? -2.258  27.467 -11.856 1.00 64.38  ? 162 LEU B N     1 
ATOM   3139 C  CA    . LEU B 2 112 ? -2.940  28.575 -12.506 1.00 64.13  ? 162 LEU B CA    1 
ATOM   3140 C  C     . LEU B 2 112 ? -2.025  29.801 -12.585 1.00 64.06  ? 162 LEU B C     1 
ATOM   3141 O  O     . LEU B 2 112 ? -1.922  30.440 -13.627 1.00 63.84  ? 162 LEU B O     1 
ATOM   3142 C  CB    . LEU B 2 112 ? -4.213  28.897 -11.732 1.00 63.87  ? 162 LEU B CB    1 
ATOM   3143 C  CG    . LEU B 2 112 ? -5.144  29.935 -12.324 1.00 63.78  ? 162 LEU B CG    1 
ATOM   3144 C  CD1   . LEU B 2 112 ? -5.513  29.549 -13.744 1.00 63.57  ? 162 LEU B CD1   1 
ATOM   3145 C  CD2   . LEU B 2 112 ? -6.372  30.051 -11.431 1.00 63.71  ? 162 LEU B CD2   1 
ATOM   3146 N  N     . MET B 2 113 ? -1.346  30.101 -11.486 1.00 64.04  ? 163 MET B N     1 
ATOM   3147 C  CA    . MET B 2 113 ? -0.402  31.215 -11.452 1.00 64.44  ? 163 MET B CA    1 
ATOM   3148 C  C     . MET B 2 113 ? 0.872   30.901 -12.227 1.00 64.31  ? 163 MET B C     1 
ATOM   3149 O  O     . MET B 2 113 ? 1.373   31.756 -12.951 1.00 64.65  ? 163 MET B O     1 
ATOM   3150 C  CB    . MET B 2 113 ? -0.014  31.554 -10.016 1.00 64.51  ? 163 MET B CB    1 
ATOM   3151 C  CG    . MET B 2 113 ? -1.183  31.834 -9.085  1.00 64.88  ? 163 MET B CG    1 
ATOM   3152 S  SD    . MET B 2 113 ? -0.623  32.394 -7.471  1.00 65.41  ? 163 MET B SD    1 
ATOM   3153 C  CE    . MET B 2 113 ? 0.411   31.024 -6.947  1.00 65.65  ? 163 MET B CE    1 
ATOM   3154 N  N     . GLU B 2 114 ? 1.397   29.686 -12.064 1.00 64.06  ? 164 GLU B N     1 
ATOM   3155 C  CA    . GLU B 2 114 ? 2.660   29.295 -12.697 1.00 63.96  ? 164 GLU B CA    1 
ATOM   3156 C  C     . GLU B 2 114 ? 2.540   29.312 -14.214 1.00 63.60  ? 164 GLU B C     1 
ATOM   3157 O  O     . GLU B 2 114 ? 3.395   29.864 -14.902 1.00 63.74  ? 164 GLU B O     1 
ATOM   3158 C  CB    . GLU B 2 114 ? 3.121   27.896 -12.236 1.00 63.95  ? 164 GLU B CB    1 
ATOM   3159 C  CG    . GLU B 2 114 ? 4.608   27.587 -12.560 1.00 64.51  ? 164 GLU B CG    1 
ATOM   3160 C  CD    . GLU B 2 114 ? 4.982   26.097 -12.492 1.00 64.77  ? 164 GLU B CD    1 
ATOM   3161 O  OE1   . GLU B 2 114 ? 4.337   25.323 -11.748 1.00 66.33  ? 164 GLU B OE1   1 
ATOM   3162 O  OE2   . GLU B 2 114 ? 5.944   25.697 -13.184 1.00 65.29  ? 164 GLU B OE2   1 
ATOM   3163 N  N     . LYS B 2 115 ? 1.477   28.701 -14.728 1.00 63.26  ? 165 LYS B N     1 
ATOM   3164 C  CA    . LYS B 2 115 ? 1.302   28.541 -16.170 1.00 62.75  ? 165 LYS B CA    1 
ATOM   3165 C  C     . LYS B 2 115 ? 0.867   29.843 -16.835 1.00 62.45  ? 165 LYS B C     1 
ATOM   3166 O  O     . LYS B 2 115 ? 1.445   30.258 -17.831 1.00 62.27  ? 165 LYS B O     1 
ATOM   3167 C  CB    . LYS B 2 115 ? 0.305   27.410 -16.478 1.00 62.59  ? 165 LYS B CB    1 
ATOM   3168 C  CG    . LYS B 2 115 ? 0.838   26.004 -16.176 1.00 62.30  ? 165 LYS B CG    1 
ATOM   3169 N  N     . ASP B 2 116 ? -0.123  30.505 -16.261 1.00 62.47  ? 166 ASP B N     1 
ATOM   3170 C  CA    . ASP B 2 116 ? -0.768  31.623 -16.937 1.00 62.62  ? 166 ASP B CA    1 
ATOM   3171 C  C     . ASP B 2 116 ? -0.112  32.981 -16.702 1.00 62.39  ? 166 ASP B C     1 
ATOM   3172 O  O     . ASP B 2 116 ? 0.378   33.599 -17.645 1.00 62.39  ? 166 ASP B O     1 
ATOM   3173 C  CB    . ASP B 2 116 ? -2.235  31.697 -16.529 1.00 62.79  ? 166 ASP B CB    1 
ATOM   3174 C  CG    . ASP B 2 116 ? -2.994  32.708 -17.329 1.00 63.72  ? 166 ASP B CG    1 
ATOM   3175 O  OD1   . ASP B 2 116 ? -2.783  32.751 -18.560 1.00 64.33  ? 166 ASP B OD1   1 
ATOM   3176 O  OD2   . ASP B 2 116 ? -3.793  33.469 -16.733 1.00 65.51  ? 166 ASP B OD2   1 
ATOM   3177 N  N     . SER B 2 117 ? -0.108  33.447 -15.455 1.00 62.15  ? 167 SER B N     1 
ATOM   3178 C  CA    . SER B 2 117 ? 0.236   34.843 -15.163 1.00 62.02  ? 167 SER B CA    1 
ATOM   3179 C  C     . SER B 2 117 ? 1.677   35.097 -14.685 1.00 61.80  ? 167 SER B C     1 
ATOM   3180 O  O     . SER B 2 117 ? 2.135   36.234 -14.699 1.00 61.56  ? 167 SER B O     1 
ATOM   3181 C  CB    . SER B 2 117 ? -0.778  35.437 -14.179 1.00 61.97  ? 167 SER B CB    1 
ATOM   3182 O  OG    . SER B 2 117 ? -0.980  34.592 -13.072 1.00 62.08  ? 167 SER B OG    1 
ATOM   3183 N  N     . TYR B 2 118 ? 2.384   34.048 -14.275 1.00 61.76  ? 168 TYR B N     1 
ATOM   3184 C  CA    . TYR B 2 118 ? 3.803   34.157 -13.918 1.00 61.61  ? 168 TYR B CA    1 
ATOM   3185 C  C     . TYR B 2 118 ? 4.682   34.538 -15.113 1.00 61.69  ? 168 TYR B C     1 
ATOM   3186 O  O     . TYR B 2 118 ? 5.595   35.340 -14.965 1.00 61.61  ? 168 TYR B O     1 
ATOM   3187 C  CB    . TYR B 2 118 ? 4.294   32.856 -13.289 1.00 61.44  ? 168 TYR B CB    1 
ATOM   3188 C  CG    . TYR B 2 118 ? 5.792   32.760 -13.062 1.00 61.67  ? 168 TYR B CG    1 
ATOM   3189 C  CD1   . TYR B 2 118 ? 6.482   33.748 -12.364 1.00 61.96  ? 168 TYR B CD1   1 
ATOM   3190 C  CD2   . TYR B 2 118 ? 6.515   31.651 -13.506 1.00 61.63  ? 168 TYR B CD2   1 
ATOM   3191 C  CE1   . TYR B 2 118 ? 7.862   33.648 -12.139 1.00 61.63  ? 168 TYR B CE1   1 
ATOM   3192 C  CE2   . TYR B 2 118 ? 7.885   31.541 -13.282 1.00 61.47  ? 168 TYR B CE2   1 
ATOM   3193 C  CZ    . TYR B 2 118 ? 8.555   32.543 -12.599 1.00 61.79  ? 168 TYR B CZ    1 
ATOM   3194 O  OH    . TYR B 2 118 ? 9.918   32.434 -12.377 1.00 61.90  ? 168 TYR B OH    1 
ATOM   3195 N  N     . PRO B 2 119 ? 4.415   33.970 -16.303 1.00 61.85  ? 169 PRO B N     1 
ATOM   3196 C  CA    . PRO B 2 119 ? 5.222   34.352 -17.473 1.00 61.92  ? 169 PRO B CA    1 
ATOM   3197 C  C     . PRO B 2 119 ? 5.018   35.804 -17.906 1.00 62.02  ? 169 PRO B C     1 
ATOM   3198 O  O     . PRO B 2 119 ? 5.968   36.468 -18.328 1.00 62.22  ? 169 PRO B O     1 
ATOM   3199 C  CB    . PRO B 2 119 ? 4.737   33.399 -18.573 1.00 61.87  ? 169 PRO B CB    1 
ATOM   3200 C  CG    . PRO B 2 119 ? 3.989   32.312 -17.858 1.00 61.93  ? 169 PRO B CG    1 
ATOM   3201 C  CD    . PRO B 2 119 ? 3.405   32.957 -16.650 1.00 61.80  ? 169 PRO B CD    1 
ATOM   3202 N  N     . ARG B 2 120 ? 3.786   36.287 -17.816 1.00 62.09  ? 170 ARG B N     1 
ATOM   3203 C  CA    . ARG B 2 120 ? 3.513   37.693 -18.077 1.00 62.09  ? 170 ARG B CA    1 
ATOM   3204 C  C     . ARG B 2 120 ? 4.227   38.588 -17.072 1.00 61.89  ? 170 ARG B C     1 
ATOM   3205 O  O     . ARG B 2 120 ? 4.692   39.665 -17.427 1.00 61.88  ? 170 ARG B O     1 
ATOM   3206 C  CB    . ARG B 2 120 ? 2.004   37.967 -18.075 1.00 62.10  ? 170 ARG B CB    1 
ATOM   3207 C  CG    . ARG B 2 120 ? 1.349   37.656 -19.410 1.00 62.30  ? 170 ARG B CG    1 
ATOM   3208 C  CD    . ARG B 2 120 ? -0.096  38.132 -19.484 1.00 62.78  ? 170 ARG B CD    1 
ATOM   3209 N  NE    . ARG B 2 120 ? -1.040  37.017 -19.514 1.00 62.76  ? 170 ARG B NE    1 
ATOM   3210 C  CZ    . ARG B 2 120 ? -1.665  36.504 -18.459 1.00 63.07  ? 170 ARG B CZ    1 
ATOM   3211 N  NH1   . ARG B 2 120 ? -2.489  35.486 -18.619 1.00 62.87  ? 170 ARG B NH1   1 
ATOM   3212 N  NH2   . ARG B 2 120 ? -1.483  36.997 -17.246 1.00 63.85  ? 170 ARG B NH2   1 
ATOM   3213 N  N     . PHE B 2 121 ? 4.318   38.132 -15.829 1.00 61.85  ? 171 PHE B N     1 
ATOM   3214 C  CA    . PHE B 2 121 ? 4.989   38.886 -14.769 1.00 62.02  ? 171 PHE B CA    1 
ATOM   3215 C  C     . PHE B 2 121 ? 6.483   39.072 -15.052 1.00 62.10  ? 171 PHE B C     1 
ATOM   3216 O  O     . PHE B 2 121 ? 7.041   40.145 -14.803 1.00 61.73  ? 171 PHE B O     1 
ATOM   3217 C  CB    . PHE B 2 121 ? 4.797   38.194 -13.413 1.00 62.00  ? 171 PHE B CB    1 
ATOM   3218 C  CG    . PHE B 2 121 ? 5.602   38.803 -12.307 1.00 61.78  ? 171 PHE B CG    1 
ATOM   3219 C  CD1   . PHE B 2 121 ? 5.235   40.024 -11.766 1.00 61.51  ? 171 PHE B CD1   1 
ATOM   3220 C  CD2   . PHE B 2 121 ? 6.732   38.164 -11.818 1.00 61.42  ? 171 PHE B CD2   1 
ATOM   3221 C  CE1   . PHE B 2 121 ? 5.970   40.597 -10.750 1.00 61.93  ? 171 PHE B CE1   1 
ATOM   3222 C  CE2   . PHE B 2 121 ? 7.478   38.729 -10.805 1.00 61.59  ? 171 PHE B CE2   1 
ATOM   3223 C  CZ    . PHE B 2 121 ? 7.101   39.950 -10.267 1.00 61.90  ? 171 PHE B CZ    1 
ATOM   3224 N  N     . LEU B 2 122 ? 7.112   38.021 -15.573 1.00 62.27  ? 172 LEU B N     1 
ATOM   3225 C  CA    . LEU B 2 122 ? 8.517   38.059 -15.964 1.00 62.55  ? 172 LEU B CA    1 
ATOM   3226 C  C     . LEU B 2 122 ? 8.772   39.026 -17.131 1.00 62.80  ? 172 LEU B C     1 
ATOM   3227 O  O     . LEU B 2 122 ? 9.872   39.572 -17.268 1.00 62.65  ? 172 LEU B O     1 
ATOM   3228 C  CB    . LEU B 2 122 ? 9.007   36.649 -16.317 1.00 62.52  ? 172 LEU B CB    1 
ATOM   3229 C  CG    . LEU B 2 122 ? 9.147   35.678 -15.137 1.00 62.90  ? 172 LEU B CG    1 
ATOM   3230 C  CD1   . LEU B 2 122 ? 9.293   34.240 -15.619 1.00 62.97  ? 172 LEU B CD1   1 
ATOM   3231 C  CD2   . LEU B 2 122 ? 10.332  36.060 -14.251 1.00 63.33  ? 172 LEU B CD2   1 
ATOM   3232 N  N     . LYS B 2 123 ? 7.752   39.232 -17.963 1.00 63.24  ? 173 LYS B N     1 
ATOM   3233 C  CA    . LYS B 2 123 ? 7.816   40.204 -19.053 1.00 63.64  ? 173 LYS B CA    1 
ATOM   3234 C  C     . LYS B 2 123 ? 7.146   41.531 -18.672 1.00 64.03  ? 173 LYS B C     1 
ATOM   3235 O  O     . LYS B 2 123 ? 6.924   42.373 -19.539 1.00 64.24  ? 173 LYS B O     1 
ATOM   3236 C  CB    . LYS B 2 123 ? 7.156   39.640 -20.320 1.00 63.73  ? 173 LYS B CB    1 
ATOM   3237 C  CG    . LYS B 2 123 ? 7.633   38.247 -20.732 1.00 63.83  ? 173 LYS B CG    1 
ATOM   3238 N  N     . SER B 2 124 ? 6.832   41.724 -17.388 1.00 64.49  ? 174 SER B N     1 
ATOM   3239 C  CA    . SER B 2 124 ? 6.237   42.984 -16.922 1.00 64.84  ? 174 SER B CA    1 
ATOM   3240 C  C     . SER B 2 124 ? 7.324   44.035 -16.656 1.00 65.14  ? 174 SER B C     1 
ATOM   3241 O  O     . SER B 2 124 ? 8.481   43.680 -16.398 1.00 65.06  ? 174 SER B O     1 
ATOM   3242 C  CB    . SER B 2 124 ? 5.371   42.763 -15.666 1.00 64.87  ? 174 SER B CB    1 
ATOM   3243 O  OG    . SER B 2 124 ? 6.125   42.751 -14.466 1.00 64.96  ? 174 SER B OG    1 
ATOM   3244 N  N     . PRO B 2 125 ? 6.957   45.331 -16.737 1.00 65.56  ? 175 PRO B N     1 
ATOM   3245 C  CA    . PRO B 2 125 ? 7.872   46.420 -16.393 1.00 65.69  ? 175 PRO B CA    1 
ATOM   3246 C  C     . PRO B 2 125 ? 8.054   46.551 -14.884 1.00 65.89  ? 175 PRO B C     1 
ATOM   3247 O  O     . PRO B 2 125 ? 9.121   46.968 -14.423 1.00 65.80  ? 175 PRO B O     1 
ATOM   3248 C  CB    . PRO B 2 125 ? 7.172   47.657 -16.954 1.00 65.74  ? 175 PRO B CB    1 
ATOM   3249 C  CG    . PRO B 2 125 ? 5.731   47.325 -16.921 1.00 65.76  ? 175 PRO B CG    1 
ATOM   3250 C  CD    . PRO B 2 125 ? 5.640   45.842 -17.171 1.00 65.71  ? 175 PRO B CD    1 
ATOM   3251 N  N     . ALA B 2 126 ? 7.013   46.204 -14.125 1.00 66.19  ? 176 ALA B N     1 
ATOM   3252 C  CA    . ALA B 2 126 ? 7.118   46.128 -12.671 1.00 66.43  ? 176 ALA B CA    1 
ATOM   3253 C  C     . ALA B 2 126 ? 8.415   45.411 -12.317 1.00 66.59  ? 176 ALA B C     1 
ATOM   3254 O  O     . ALA B 2 126 ? 9.317   46.001 -11.716 1.00 66.60  ? 176 ALA B O     1 
ATOM   3255 C  CB    . ALA B 2 126 ? 5.913   45.383 -12.087 1.00 66.49  ? 176 ALA B CB    1 
ATOM   3256 N  N     . TYR B 2 127 ? 8.506   44.151 -12.746 1.00 66.69  ? 177 TYR B N     1 
ATOM   3257 C  CA    . TYR B 2 127 ? 9.686   43.312 -12.524 1.00 66.82  ? 177 TYR B CA    1 
ATOM   3258 C  C     . TYR B 2 127 ? 10.884  43.709 -13.415 1.00 66.86  ? 177 TYR B C     1 
ATOM   3259 O  O     . TYR B 2 127 ? 12.002  43.872 -12.914 1.00 66.62  ? 177 TYR B O     1 
ATOM   3260 C  CB    . TYR B 2 127 ? 9.312   41.841 -12.733 1.00 66.89  ? 177 TYR B CB    1 
ATOM   3261 C  CG    . TYR B 2 127 ? 10.484  40.894 -12.895 1.00 67.18  ? 177 TYR B CG    1 
ATOM   3262 C  CD1   . TYR B 2 127 ? 11.154  40.385 -11.788 1.00 67.27  ? 177 TYR B CD1   1 
ATOM   3263 C  CD2   . TYR B 2 127 ? 10.908  40.492 -14.162 1.00 67.41  ? 177 TYR B CD2   1 
ATOM   3264 C  CE1   . TYR B 2 127 ? 12.222  39.505 -11.937 1.00 67.59  ? 177 TYR B CE1   1 
ATOM   3265 C  CE2   . TYR B 2 127 ? 11.976  39.619 -14.322 1.00 67.42  ? 177 TYR B CE2   1 
ATOM   3266 C  CZ    . TYR B 2 127 ? 12.628  39.127 -13.208 1.00 67.49  ? 177 TYR B CZ    1 
ATOM   3267 O  OH    . TYR B 2 127 ? 13.685  38.259 -13.365 1.00 67.20  ? 177 TYR B OH    1 
ATOM   3268 N  N     . ARG B 2 128 ? 10.646  43.869 -14.721 1.00 66.94  ? 178 ARG B N     1 
ATOM   3269 C  CA    . ARG B 2 128 ? 11.705  44.243 -15.679 1.00 67.04  ? 178 ARG B CA    1 
ATOM   3270 C  C     . ARG B 2 128 ? 12.618  45.339 -15.129 1.00 67.17  ? 178 ARG B C     1 
ATOM   3271 O  O     . ARG B 2 128 ? 13.840  45.303 -15.322 1.00 67.25  ? 178 ARG B O     1 
ATOM   3272 C  CB    . ARG B 2 128 ? 11.106  44.710 -17.013 1.00 66.99  ? 178 ARG B CB    1 
ATOM   3273 N  N     . ASP B 2 129 ? 12.015  46.310 -14.448 1.00 67.28  ? 179 ASP B N     1 
ATOM   3274 C  CA    . ASP B 2 129 ? 12.763  47.392 -13.812 1.00 67.25  ? 179 ASP B CA    1 
ATOM   3275 C  C     . ASP B 2 129 ? 13.504  46.902 -12.564 1.00 67.27  ? 179 ASP B C     1 
ATOM   3276 O  O     . ASP B 2 129 ? 14.668  47.258 -12.350 1.00 67.44  ? 179 ASP B O     1 
ATOM   3277 C  CB    . ASP B 2 129 ? 11.823  48.548 -13.450 1.00 67.27  ? 179 ASP B CB    1 
ATOM   3278 N  N     . LEU B 2 130 ? 12.838  46.085 -11.749 1.00 67.12  ? 180 LEU B N     1 
ATOM   3279 C  CA    . LEU B 2 130 ? 13.416  45.620 -10.480 1.00 67.15  ? 180 LEU B CA    1 
ATOM   3280 C  C     . LEU B 2 130 ? 14.516  44.559 -10.659 1.00 66.99  ? 180 LEU B C     1 
ATOM   3281 O  O     . LEU B 2 130 ? 15.320  44.331 -9.751  1.00 66.93  ? 180 LEU B O     1 
ATOM   3282 C  CB    . LEU B 2 130 ? 12.308  45.113 -9.551  1.00 67.25  ? 180 LEU B CB    1 
ATOM   3283 C  CG    . LEU B 2 130 ? 11.286  46.195 -9.172  1.00 67.55  ? 180 LEU B CG    1 
ATOM   3284 C  CD1   . LEU B 2 130 ? 9.995   45.575 -8.645  1.00 67.90  ? 180 LEU B CD1   1 
ATOM   3285 C  CD2   . LEU B 2 130 ? 11.877  47.178 -8.162  1.00 67.85  ? 180 LEU B CD2   1 
ATOM   3286 N  N     . ALA B 2 131 ? 14.542  43.916 -11.825 1.00 66.82  ? 181 ALA B N     1 
ATOM   3287 C  CA    . ALA B 2 131 ? 15.658  43.053 -12.215 1.00 66.68  ? 181 ALA B CA    1 
ATOM   3288 C  C     . ALA B 2 131 ? 16.784  43.909 -12.791 1.00 66.62  ? 181 ALA B C     1 
ATOM   3289 O  O     . ALA B 2 131 ? 17.967  43.661 -12.533 1.00 66.58  ? 181 ALA B O     1 
ATOM   3290 C  CB    . ALA B 2 131 ? 15.204  42.024 -13.235 1.00 66.69  ? 181 ALA B CB    1 
ATOM   3291 N  N     . ALA B 2 132 ? 16.405  44.916 -13.578 1.00 66.53  ? 182 ALA B N     1 
ATOM   3292 C  CA    . ALA B 2 132 ? 17.349  45.909 -14.098 1.00 66.42  ? 182 ALA B CA    1 
ATOM   3293 C  C     . ALA B 2 132 ? 18.083  46.616 -12.957 1.00 66.35  ? 182 ALA B C     1 
ATOM   3294 O  O     . ALA B 2 132 ? 19.247  47.002 -13.100 1.00 66.22  ? 182 ALA B O     1 
ATOM   3295 C  CB    . ALA B 2 132 ? 16.619  46.921 -14.974 1.00 66.42  ? 182 ALA B CB    1 
ATOM   3296 N  N     . GLN B 2 133 ? 17.389  46.783 -11.830 1.00 66.35  ? 183 GLN B N     1 
ATOM   3297 C  CA    . GLN B 2 133 ? 18.016  47.215 -10.576 1.00 66.36  ? 183 GLN B CA    1 
ATOM   3298 C  C     . GLN B 2 133 ? 18.943  46.106 -10.064 1.00 66.21  ? 183 GLN B C     1 
ATOM   3299 O  O     . GLN B 2 133 ? 20.102  46.361 -9.709  1.00 65.98  ? 183 GLN B O     1 
ATOM   3300 C  CB    . GLN B 2 133 ? 16.950  47.530 -9.515  1.00 66.46  ? 183 GLN B CB    1 
ATOM   3301 C  CG    . GLN B 2 133 ? 15.943  48.603 -9.921  1.00 66.53  ? 183 GLN B CG    1 
ATOM   3302 N  N     . ALA B 2 134 ? 18.412  44.881 -10.033 1.00 66.02  ? 184 ALA B N     1 
ATOM   3303 C  CA    . ALA B 2 134 ? 19.180  43.689 -9.669  1.00 65.93  ? 184 ALA B CA    1 
ATOM   3304 C  C     . ALA B 2 134 ? 20.339  43.445 -10.639 1.00 65.87  ? 184 ALA B C     1 
ATOM   3305 O  O     . ALA B 2 134 ? 21.491  43.764 -10.343 1.00 65.63  ? 184 ALA B O     1 
ATOM   3306 C  CB    . ALA B 2 134 ? 18.264  42.470 -9.629  1.00 65.84  ? 184 ALA B CB    1 
ATOM   3307 N  N     . GLU C 1 3   ? -8.851  58.262 0.571   1.00 64.40  ? 33  GLU C N     1 
ATOM   3308 C  CA    . GLU C 1 3   ? -9.886  58.593 -0.448  1.00 64.45  ? 33  GLU C CA    1 
ATOM   3309 C  C     . GLU C 1 3   ? -11.093 57.655 -0.368  1.00 64.09  ? 33  GLU C C     1 
ATOM   3310 O  O     . GLU C 1 3   ? -10.948 56.440 -0.406  1.00 64.19  ? 33  GLU C O     1 
ATOM   3311 C  CB    . GLU C 1 3   ? -9.294  58.531 -1.861  1.00 64.56  ? 33  GLU C CB    1 
ATOM   3312 C  CG    . GLU C 1 3   ? -8.528  59.787 -2.289  1.00 65.28  ? 33  GLU C CG    1 
ATOM   3313 C  CD    . GLU C 1 3   ? -8.919  60.288 -3.685  1.00 66.07  ? 33  GLU C CD    1 
ATOM   3314 O  OE1   . GLU C 1 3   ? -10.135 60.344 -3.984  1.00 67.09  ? 33  GLU C OE1   1 
ATOM   3315 O  OE2   . GLU C 1 3   ? -8.013  60.645 -4.473  1.00 65.95  ? 33  GLU C OE2   1 
ATOM   3316 N  N     . VAL C 1 4   ? -12.283 58.236 -0.266  1.00 63.59  ? 34  VAL C N     1 
ATOM   3317 C  CA    . VAL C 1 4   ? -13.526 57.478 -0.247  1.00 63.12  ? 34  VAL C CA    1 
ATOM   3318 C  C     . VAL C 1 4   ? -14.349 57.830 -1.471  1.00 62.62  ? 34  VAL C C     1 
ATOM   3319 O  O     . VAL C 1 4   ? -14.713 58.986 -1.650  1.00 62.50  ? 34  VAL C O     1 
ATOM   3320 C  CB    . VAL C 1 4   ? -14.363 57.804 0.997   1.00 63.16  ? 34  VAL C CB    1 
ATOM   3321 C  CG1   . VAL C 1 4   ? -15.731 57.134 0.900   1.00 62.75  ? 34  VAL C CG1   1 
ATOM   3322 C  CG2   . VAL C 1 4   ? -13.623 57.373 2.266   1.00 62.95  ? 34  VAL C CG2   1 
ATOM   3323 N  N     . LYS C 1 5   ? -14.632 56.836 -2.312  1.00 62.14  ? 35  LYS C N     1 
ATOM   3324 C  CA    . LYS C 1 5   ? -15.431 57.043 -3.514  1.00 61.72  ? 35  LYS C CA    1 
ATOM   3325 C  C     . LYS C 1 5   ? -16.858 56.589 -3.250  1.00 61.49  ? 35  LYS C C     1 
ATOM   3326 O  O     . LYS C 1 5   ? -17.114 55.402 -3.045  1.00 61.57  ? 35  LYS C O     1 
ATOM   3327 C  CB    . LYS C 1 5   ? -14.841 56.298 -4.710  1.00 61.64  ? 35  LYS C CB    1 
ATOM   3328 C  CG    . LYS C 1 5   ? -15.670 56.451 -5.976  1.00 61.55  ? 35  LYS C CG    1 
ATOM   3329 C  CD    . LYS C 1 5   ? -14.861 56.235 -7.247  1.00 61.76  ? 35  LYS C CD    1 
ATOM   3330 C  CE    . LYS C 1 5   ? -15.780 55.974 -8.435  1.00 62.06  ? 35  LYS C CE    1 
ATOM   3331 N  NZ    . LYS C 1 5   ? -15.087 55.991 -9.751  1.00 62.34  ? 35  LYS C NZ    1 
ATOM   3332 N  N     . LEU C 1 6   ? -17.783 57.543 -3.253  1.00 61.12  ? 36  LEU C N     1 
ATOM   3333 C  CA    . LEU C 1 6   ? -19.172 57.268 -2.930  1.00 60.87  ? 36  LEU C CA    1 
ATOM   3334 C  C     . LEU C 1 6   ? -20.090 57.436 -4.152  1.00 60.62  ? 36  LEU C C     1 
ATOM   3335 O  O     . LEU C 1 6   ? -20.032 58.450 -4.859  1.00 60.11  ? 36  LEU C O     1 
ATOM   3336 C  CB    . LEU C 1 6   ? -19.613 58.191 -1.802  1.00 60.99  ? 36  LEU C CB    1 
ATOM   3337 C  CG    . LEU C 1 6   ? -20.956 57.913 -1.140  1.00 60.69  ? 36  LEU C CG    1 
ATOM   3338 C  CD1   . LEU C 1 6   ? -20.969 56.522 -0.556  1.00 60.73  ? 36  LEU C CD1   1 
ATOM   3339 C  CD2   . LEU C 1 6   ? -21.193 58.957 -0.062  1.00 60.89  ? 36  LEU C CD2   1 
ATOM   3340 N  N     . LEU C 1 7   ? -20.927 56.424 -4.380  1.00 60.33  ? 37  LEU C N     1 
ATOM   3341 C  CA    . LEU C 1 7   ? -21.903 56.420 -5.469  1.00 60.34  ? 37  LEU C CA    1 
ATOM   3342 C  C     . LEU C 1 7   ? -23.324 56.575 -4.942  1.00 60.28  ? 37  LEU C C     1 
ATOM   3343 O  O     . LEU C 1 7   ? -23.764 55.792 -4.100  1.00 60.38  ? 37  LEU C O     1 
ATOM   3344 C  CB    . LEU C 1 7   ? -21.824 55.108 -6.254  1.00 60.16  ? 37  LEU C CB    1 
ATOM   3345 C  CG    . LEU C 1 7   ? -21.109 55.127 -7.596  1.00 60.07  ? 37  LEU C CG    1 
ATOM   3346 C  CD1   . LEU C 1 7   ? -19.616 55.384 -7.424  1.00 60.07  ? 37  LEU C CD1   1 
ATOM   3347 C  CD2   . LEU C 1 7   ? -21.365 53.806 -8.300  1.00 59.29  ? 37  LEU C CD2   1 
ATOM   3348 N  N     . LEU C 1 8   ? -24.040 57.572 -5.449  1.00 60.28  ? 38  LEU C N     1 
ATOM   3349 C  CA    . LEU C 1 8   ? -25.463 57.730 -5.160  1.00 60.32  ? 38  LEU C CA    1 
ATOM   3350 C  C     . LEU C 1 8   ? -26.270 57.169 -6.313  1.00 60.19  ? 38  LEU C C     1 
ATOM   3351 O  O     . LEU C 1 8   ? -26.333 57.785 -7.383  1.00 60.28  ? 38  LEU C O     1 
ATOM   3352 C  CB    . LEU C 1 8   ? -25.816 59.199 -4.952  1.00 60.55  ? 38  LEU C CB    1 
ATOM   3353 C  CG    . LEU C 1 8   ? -25.643 59.675 -3.513  1.00 61.30  ? 38  LEU C CG    1 
ATOM   3354 C  CD1   . LEU C 1 8   ? -25.566 61.191 -3.450  1.00 61.70  ? 38  LEU C CD1   1 
ATOM   3355 C  CD2   . LEU C 1 8   ? -26.789 59.135 -2.663  1.00 62.14  ? 38  LEU C CD2   1 
ATOM   3356 N  N     . LEU C 1 9   ? -26.877 56.005 -6.092  1.00 59.91  ? 39  LEU C N     1 
ATOM   3357 C  CA    . LEU C 1 9   ? -27.615 55.309 -7.130  1.00 60.02  ? 39  LEU C CA    1 
ATOM   3358 C  C     . LEU C 1 9   ? -29.062 55.125 -6.715  1.00 60.81  ? 39  LEU C C     1 
ATOM   3359 O  O     . LEU C 1 9   ? -29.404 55.218 -5.533  1.00 61.05  ? 39  LEU C O     1 
ATOM   3360 C  CB    . LEU C 1 9   ? -26.978 53.957 -7.427  1.00 59.67  ? 39  LEU C CB    1 
ATOM   3361 C  CG    . LEU C 1 9   ? -25.480 53.983 -7.711  1.00 58.90  ? 39  LEU C CG    1 
ATOM   3362 C  CD1   . LEU C 1 9   ? -25.046 52.650 -8.240  1.00 58.25  ? 39  LEU C CD1   1 
ATOM   3363 C  CD2   . LEU C 1 9   ? -25.119 55.075 -8.702  1.00 59.03  ? 39  LEU C CD2   1 
ATOM   3364 N  N     . GLY C 1 10  ? -29.910 54.880 -7.710  1.00 61.45  ? 40  GLY C N     1 
ATOM   3365 C  CA    . GLY C 1 10  ? -31.343 54.763 -7.496  1.00 61.82  ? 40  GLY C CA    1 
ATOM   3366 C  C     . GLY C 1 10  ? -32.144 55.142 -8.725  1.00 62.30  ? 40  GLY C C     1 
ATOM   3367 O  O     . GLY C 1 10  ? -31.614 55.713 -9.681  1.00 62.24  ? 40  GLY C O     1 
ATOM   3368 N  N     . ALA C 1 11  ? -33.433 54.813 -8.699  1.00 62.89  ? 41  ALA C N     1 
ATOM   3369 C  CA    . ALA C 1 11  ? -34.350 55.198 -9.768  1.00 63.04  ? 41  ALA C CA    1 
ATOM   3370 C  C     . ALA C 1 11  ? -34.564 56.699 -9.701  1.00 63.24  ? 41  ALA C C     1 
ATOM   3371 O  O     . ALA C 1 11  ? -34.239 57.320 -8.695  1.00 63.02  ? 41  ALA C O     1 
ATOM   3372 C  CB    . ALA C 1 11  ? -35.674 54.470 -9.621  1.00 62.99  ? 41  ALA C CB    1 
ATOM   3373 N  N     . GLY C 1 12  ? -35.109 57.276 -10.770 1.00 63.79  ? 42  GLY C N     1 
ATOM   3374 C  CA    . GLY C 1 12  ? -35.383 58.714 -10.812 1.00 63.96  ? 42  GLY C CA    1 
ATOM   3375 C  C     . GLY C 1 12  ? -36.267 59.177 -9.666  1.00 64.21  ? 42  GLY C C     1 
ATOM   3376 O  O     . GLY C 1 12  ? -37.192 58.473 -9.251  1.00 63.74  ? 42  GLY C O     1 
ATOM   3377 N  N     . GLU C 1 13  ? -35.967 60.360 -9.145  1.00 64.66  ? 43  GLU C N     1 
ATOM   3378 C  CA    . GLU C 1 13  ? -36.793 60.996 -8.110  1.00 65.55  ? 43  GLU C CA    1 
ATOM   3379 C  C     . GLU C 1 13  ? -36.744 60.278 -6.758  1.00 64.65  ? 43  GLU C C     1 
ATOM   3380 O  O     . GLU C 1 13  ? -37.611 60.489 -5.901  1.00 64.54  ? 43  GLU C O     1 
ATOM   3381 C  CB    . GLU C 1 13  ? -38.251 61.171 -8.594  1.00 65.34  ? 43  GLU C CB    1 
ATOM   3382 C  CG    . GLU C 1 13  ? -38.334 61.856 -9.949  1.00 66.84  ? 43  GLU C CG    1 
ATOM   3383 C  CD    . GLU C 1 13  ? -39.752 62.046 -10.469 1.00 68.64  ? 43  GLU C CD    1 
ATOM   3384 O  OE1   . GLU C 1 13  ? -40.720 62.073 -9.657  1.00 72.94  ? 43  GLU C OE1   1 
ATOM   3385 O  OE2   . GLU C 1 13  ? -39.903 62.182 -11.714 1.00 73.12  ? 43  GLU C OE2   1 
ATOM   3386 N  N     . SER C 1 14  ? -35.711 59.466 -6.558  1.00 63.91  ? 44  SER C N     1 
ATOM   3387 C  CA    . SER C 1 14  ? -35.526 58.762 -5.299  1.00 63.70  ? 44  SER C CA    1 
ATOM   3388 C  C     . SER C 1 14  ? -34.903 59.654 -4.225  1.00 63.19  ? 44  SER C C     1 
ATOM   3389 O  O     . SER C 1 14  ? -35.026 59.369 -3.042  1.00 62.97  ? 44  SER C O     1 
ATOM   3390 C  CB    . SER C 1 14  ? -34.670 57.504 -5.507  1.00 64.04  ? 44  SER C CB    1 
ATOM   3391 O  OG    . SER C 1 14  ? -33.361 57.802 -5.988  1.00 64.87  ? 44  SER C OG    1 
ATOM   3392 N  N     . GLY C 1 15  ? -34.223 60.723 -4.637  1.00 62.91  ? 45  GLY C N     1 
ATOM   3393 C  CA    . GLY C 1 15  ? -33.696 61.725 -3.692  1.00 62.51  ? 45  GLY C CA    1 
ATOM   3394 C  C     . GLY C 1 15  ? -32.184 61.858 -3.602  1.00 62.13  ? 45  GLY C C     1 
ATOM   3395 O  O     . GLY C 1 15  ? -31.677 62.401 -2.625  1.00 61.64  ? 45  GLY C O     1 
ATOM   3396 N  N     . LYS C 1 16  ? -31.468 61.384 -4.620  1.00 61.94  ? 46  LYS C N     1 
ATOM   3397 C  CA    . LYS C 1 16  ? -30.000 61.376 -4.612  1.00 61.93  ? 46  LYS C CA    1 
ATOM   3398 C  C     . LYS C 1 16  ? -29.448 62.794 -4.539  1.00 61.69  ? 46  LYS C C     1 
ATOM   3399 O  O     . LYS C 1 16  ? -28.632 63.118 -3.675  1.00 61.21  ? 46  LYS C O     1 
ATOM   3400 C  CB    . LYS C 1 16  ? -29.455 60.692 -5.870  1.00 61.85  ? 46  LYS C CB    1 
ATOM   3401 C  CG    . LYS C 1 16  ? -29.920 59.244 -6.065  1.00 62.24  ? 46  LYS C CG    1 
ATOM   3402 C  CD    . LYS C 1 16  ? -29.569 58.686 -7.456  1.00 62.32  ? 46  LYS C CD    1 
ATOM   3403 C  CE    . LYS C 1 16  ? -30.404 59.303 -8.592  1.00 62.43  ? 46  LYS C CE    1 
ATOM   3404 N  NZ    . LYS C 1 16  ? -31.847 59.008 -8.491  1.00 61.30  ? 46  LYS C NZ    1 
ATOM   3405 N  N     . SER C 1 17  ? -29.923 63.636 -5.452  1.00 61.78  ? 47  SER C N     1 
ATOM   3406 C  CA    . SER C 1 17  ? -29.478 65.019 -5.548  1.00 61.56  ? 47  SER C CA    1 
ATOM   3407 C  C     . SER C 1 17  ? -29.806 65.807 -4.288  1.00 61.57  ? 47  SER C C     1 
ATOM   3408 O  O     . SER C 1 17  ? -29.056 66.712 -3.915  1.00 61.33  ? 47  SER C O     1 
ATOM   3409 C  CB    . SER C 1 17  ? -30.109 65.684 -6.765  1.00 61.59  ? 47  SER C CB    1 
ATOM   3410 O  OG    . SER C 1 17  ? -29.797 64.955 -7.942  1.00 61.26  ? 47  SER C OG    1 
ATOM   3411 N  N     . THR C 1 18  ? -30.908 65.452 -3.627  1.00 61.48  ? 48  THR C N     1 
ATOM   3412 C  CA    . THR C 1 18  ? -31.248 66.048 -2.333  1.00 61.64  ? 48  THR C CA    1 
ATOM   3413 C  C     . THR C 1 18  ? -30.180 65.727 -1.289  1.00 61.69  ? 48  THR C C     1 
ATOM   3414 O  O     . THR C 1 18  ? -29.733 66.612 -0.562  1.00 61.57  ? 48  THR C O     1 
ATOM   3415 C  CB    . THR C 1 18  ? -32.621 65.582 -1.823  1.00 61.56  ? 48  THR C CB    1 
ATOM   3416 O  OG1   . THR C 1 18  ? -33.544 65.553 -2.914  1.00 62.29  ? 48  THR C OG1   1 
ATOM   3417 C  CG2   . THR C 1 18  ? -33.156 66.534 -0.777  1.00 61.33  ? 48  THR C CG2   1 
ATOM   3418 N  N     . ILE C 1 19  ? -29.750 64.471 -1.240  1.00 61.95  ? 49  ILE C N     1 
ATOM   3419 C  CA    . ILE C 1 19  ? -28.678 64.062 -0.326  1.00 62.08  ? 49  ILE C CA    1 
ATOM   3420 C  C     . ILE C 1 19  ? -27.373 64.794 -0.631  1.00 62.28  ? 49  ILE C C     1 
ATOM   3421 O  O     . ILE C 1 19  ? -26.701 65.272 0.285   1.00 62.55  ? 49  ILE C O     1 
ATOM   3422 C  CB    . ILE C 1 19  ? -28.440 62.534 -0.361  1.00 62.17  ? 49  ILE C CB    1 
ATOM   3423 C  CG1   . ILE C 1 19  ? -29.683 61.787 0.131   1.00 62.03  ? 49  ILE C CG1   1 
ATOM   3424 C  CG2   . ILE C 1 19  ? -27.225 62.145 0.477   1.00 62.12  ? 49  ILE C CG2   1 
ATOM   3425 C  CD1   . ILE C 1 19  ? -30.129 62.172 1.503   1.00 62.57  ? 49  ILE C CD1   1 
ATOM   3426 N  N     . VAL C 1 20  ? -27.017 64.899 -1.907  1.00 62.50  ? 50  VAL C N     1 
ATOM   3427 C  CA    . VAL C 1 20  ? -25.811 65.637 -2.294  1.00 62.76  ? 50  VAL C CA    1 
ATOM   3428 C  C     . VAL C 1 20  ? -25.884 67.083 -1.797  1.00 62.96  ? 50  VAL C C     1 
ATOM   3429 O  O     . VAL C 1 20  ? -24.876 67.627 -1.344  1.00 63.09  ? 50  VAL C O     1 
ATOM   3430 C  CB    . VAL C 1 20  ? -25.570 65.590 -3.827  1.00 63.00  ? 50  VAL C CB    1 
ATOM   3431 C  CG1   . VAL C 1 20  ? -24.496 66.607 -4.269  1.00 62.53  ? 50  VAL C CG1   1 
ATOM   3432 C  CG2   . VAL C 1 20  ? -25.169 64.175 -4.245  1.00 62.96  ? 50  VAL C CG2   1 
ATOM   3433 N  N     . LYS C 1 21  ? -27.074 67.690 -1.850  1.00 63.03  ? 51  LYS C N     1 
ATOM   3434 C  CA    . LYS C 1 21  ? -27.276 69.039 -1.290  1.00 63.07  ? 51  LYS C CA    1 
ATOM   3435 C  C     . LYS C 1 21  ? -26.999 69.074 0.218   1.00 63.04  ? 51  LYS C C     1 
ATOM   3436 O  O     . LYS C 1 21  ? -26.413 70.032 0.729   1.00 62.95  ? 51  LYS C O     1 
ATOM   3437 C  CB    . LYS C 1 21  ? -28.698 69.571 -1.558  1.00 63.21  ? 51  LYS C CB    1 
ATOM   3438 C  CG    . LYS C 1 21  ? -29.125 69.577 -3.029  1.00 63.33  ? 51  LYS C CG    1 
ATOM   3439 C  CD    . LYS C 1 21  ? -30.090 70.698 -3.375  1.00 63.31  ? 51  LYS C CD    1 
ATOM   3440 C  CE    . LYS C 1 21  ? -30.687 70.484 -4.774  1.00 63.78  ? 51  LYS C CE    1 
ATOM   3441 N  NZ    . LYS C 1 21  ? -31.730 69.406 -4.797  1.00 64.24  ? 51  LYS C NZ    1 
ATOM   3442 N  N     . GLN C 1 22  ? -27.406 68.020 0.920   1.00 63.05  ? 52  GLN C N     1 
ATOM   3443 C  CA    . GLN C 1 22  ? -27.193 67.933 2.357   1.00 63.00  ? 52  GLN C CA    1 
ATOM   3444 C  C     . GLN C 1 22  ? -25.726 67.770 2.760   1.00 63.45  ? 52  GLN C C     1 
ATOM   3445 O  O     . GLN C 1 22  ? -25.352 68.199 3.848   1.00 63.60  ? 52  GLN C O     1 
ATOM   3446 C  CB    . GLN C 1 22  ? -28.017 66.802 2.951   1.00 62.63  ? 52  GLN C CB    1 
ATOM   3447 C  CG    . GLN C 1 22  ? -29.501 67.021 2.838   1.00 62.01  ? 52  GLN C CG    1 
ATOM   3448 C  CD    . GLN C 1 22  ? -30.031 67.994 3.854   1.00 60.57  ? 52  GLN C CD    1 
ATOM   3449 O  OE1   . GLN C 1 22  ? -29.287 68.816 4.376   1.00 60.14  ? 52  GLN C OE1   1 
ATOM   3450 N  NE2   . GLN C 1 22  ? -31.331 67.912 4.142   1.00 58.71  ? 52  GLN C NE2   1 
ATOM   3451 N  N     . MET C 1 23  ? -24.898 67.164 1.909   1.00 63.84  ? 53  MET C N     1 
ATOM   3452 C  CA    . MET C 1 23  ? -23.449 67.116 2.178   1.00 64.20  ? 53  MET C CA    1 
ATOM   3453 C  C     . MET C 1 23  ? -22.839 68.515 1.997   1.00 64.43  ? 53  MET C C     1 
ATOM   3454 O  O     . MET C 1 23  ? -21.978 68.922 2.766   1.00 64.32  ? 53  MET C O     1 
ATOM   3455 C  CB    . MET C 1 23  ? -22.721 66.120 1.265   1.00 64.31  ? 53  MET C CB    1 
ATOM   3456 C  CG    . MET C 1 23  ? -23.274 64.701 1.240   1.00 64.68  ? 53  MET C CG    1 
ATOM   3457 S  SD    . MET C 1 23  ? -23.041 63.744 2.754   1.00 66.31  ? 53  MET C SD    1 
ATOM   3458 C  CE    . MET C 1 23  ? -24.688 63.846 3.484   1.00 65.16  ? 53  MET C CE    1 
ATOM   3459 N  N     . LYS C 1 24  ? -23.289 69.244 0.974   1.00 64.94  ? 54  LYS C N     1 
ATOM   3460 C  CA    . LYS C 1 24  ? -22.899 70.642 0.788   1.00 65.13  ? 54  LYS C CA    1 
ATOM   3461 C  C     . LYS C 1 24  ? -23.150 71.431 2.065   1.00 65.28  ? 54  LYS C C     1 
ATOM   3462 O  O     . LYS C 1 24  ? -22.223 71.995 2.642   1.00 65.33  ? 54  LYS C O     1 
ATOM   3463 C  CB    . LYS C 1 24  ? -23.684 71.281 -0.362  1.00 65.13  ? 54  LYS C CB    1 
ATOM   3464 N  N     . ILE C 1 25  ? -24.404 71.443 2.510   1.00 65.44  ? 55  ILE C N     1 
ATOM   3465 C  CA    . ILE C 1 25  ? -24.792 72.164 3.726   1.00 65.56  ? 55  ILE C CA    1 
ATOM   3466 C  C     . ILE C 1 25  ? -23.974 71.737 4.940   1.00 65.71  ? 55  ILE C C     1 
ATOM   3467 O  O     . ILE C 1 25  ? -23.306 72.553 5.566   1.00 65.69  ? 55  ILE C O     1 
ATOM   3468 C  CB    . ILE C 1 25  ? -26.277 71.935 4.074   1.00 65.43  ? 55  ILE C CB    1 
ATOM   3469 C  CG1   . ILE C 1 25  ? -27.186 72.648 3.077   1.00 65.65  ? 55  ILE C CG1   1 
ATOM   3470 C  CG2   . ILE C 1 25  ? -26.579 72.430 5.475   1.00 65.18  ? 55  ILE C CG2   1 
ATOM   3471 C  CD1   . ILE C 1 25  ? -28.617 72.132 3.088   1.00 65.60  ? 55  ILE C CD1   1 
ATOM   3472 N  N     . ILE C 1 26  ? -24.031 70.448 5.255   1.00 65.98  ? 56  ILE C N     1 
ATOM   3473 C  CA    . ILE C 1 26  ? -23.529 69.941 6.523   1.00 66.19  ? 56  ILE C CA    1 
ATOM   3474 C  C     . ILE C 1 26  ? -22.012 70.006 6.636   1.00 66.69  ? 56  ILE C C     1 
ATOM   3475 O  O     . ILE C 1 26  ? -21.498 70.419 7.675   1.00 66.90  ? 56  ILE C O     1 
ATOM   3476 C  CB    . ILE C 1 26  ? -24.014 68.504 6.782   1.00 66.05  ? 56  ILE C CB    1 
ATOM   3477 C  CG1   . ILE C 1 26  ? -25.534 68.506 6.989   1.00 65.60  ? 56  ILE C CG1   1 
ATOM   3478 C  CG2   . ILE C 1 26  ? -23.316 67.921 7.999   1.00 65.88  ? 56  ILE C CG2   1 
ATOM   3479 C  CD1   . ILE C 1 26  ? -26.149 67.144 7.132   1.00 64.86  ? 56  ILE C CD1   1 
ATOM   3480 N  N     . HIS C 1 27  ? -21.302 69.634 5.574   1.00 67.15  ? 57  HIS C N     1 
ATOM   3481 C  CA    . HIS C 1 27  ? -19.836 69.582 5.613   1.00 67.64  ? 57  HIS C CA    1 
ATOM   3482 C  C     . HIS C 1 27  ? -19.109 70.666 4.813   1.00 67.83  ? 57  HIS C C     1 
ATOM   3483 O  O     . HIS C 1 27  ? -17.886 70.784 4.909   1.00 67.74  ? 57  HIS C O     1 
ATOM   3484 C  CB    . HIS C 1 27  ? -19.361 68.201 5.164   1.00 67.92  ? 57  HIS C CB    1 
ATOM   3485 C  CG    . HIS C 1 27  ? -19.826 67.094 6.056   1.00 68.40  ? 57  HIS C CG    1 
ATOM   3486 N  ND1   . HIS C 1 27  ? -20.491 65.984 5.583   1.00 68.90  ? 57  HIS C ND1   1 
ATOM   3487 C  CD2   . HIS C 1 27  ? -19.745 66.944 7.401   1.00 68.83  ? 57  HIS C CD2   1 
ATOM   3488 C  CE1   . HIS C 1 27  ? -20.783 65.187 6.598   1.00 69.53  ? 57  HIS C CE1   1 
ATOM   3489 N  NE2   . HIS C 1 27  ? -20.348 65.750 7.712   1.00 68.99  ? 57  HIS C NE2   1 
ATOM   3490 N  N     . GLU C 1 28  ? -19.849 71.453 4.040   1.00 68.16  ? 58  GLU C N     1 
ATOM   3491 C  CA    . GLU C 1 28  ? -19.252 72.502 3.224   1.00 68.49  ? 58  GLU C CA    1 
ATOM   3492 C  C     . GLU C 1 28  ? -20.026 73.815 3.354   1.00 68.86  ? 58  GLU C C     1 
ATOM   3493 O  O     . GLU C 1 28  ? -20.369 74.443 2.355   1.00 69.18  ? 58  GLU C O     1 
ATOM   3494 C  CB    . GLU C 1 28  ? -19.192 72.058 1.760   1.00 68.47  ? 58  GLU C CB    1 
ATOM   3495 N  N     . ALA C 1 29  ? -20.322 74.206 4.589   1.00 69.11  ? 59  ALA C N     1 
ATOM   3496 C  CA    . ALA C 1 29  ? -20.793 75.562 4.897   1.00 69.30  ? 59  ALA C CA    1 
ATOM   3497 C  C     . ALA C 1 29  ? -22.078 76.014 4.191   1.00 69.40  ? 59  ALA C C     1 
ATOM   3498 O  O     . ALA C 1 29  ? -22.046 76.940 3.389   1.00 69.39  ? 59  ALA C O     1 
ATOM   3499 C  CB    . ALA C 1 29  ? -19.669 76.567 4.625   1.00 69.34  ? 59  ALA C CB    1 
ATOM   3500 N  N     . GLY C 1 30  ? -23.195 75.357 4.497   1.00 69.69  ? 60  GLY C N     1 
ATOM   3501 C  CA    . GLY C 1 30  ? -24.537 75.815 4.098   1.00 69.87  ? 60  GLY C CA    1 
ATOM   3502 C  C     . GLY C 1 30  ? -24.791 76.232 2.650   1.00 70.03  ? 60  GLY C C     1 
ATOM   3503 O  O     . GLY C 1 30  ? -24.040 75.881 1.732   1.00 69.86  ? 60  GLY C O     1 
ATOM   3504 N  N     . TYR C 1 31  ? -25.897 76.955 2.467   1.00 70.22  ? 61  TYR C N     1 
ATOM   3505 C  CA    . TYR C 1 31  ? -26.219 77.660 1.228   1.00 70.40  ? 61  TYR C CA    1 
ATOM   3506 C  C     . TYR C 1 31  ? -26.276 79.148 1.551   1.00 70.47  ? 61  TYR C C     1 
ATOM   3507 O  O     . TYR C 1 31  ? -27.142 79.585 2.322   1.00 70.62  ? 61  TYR C O     1 
ATOM   3508 C  CB    . TYR C 1 31  ? -27.575 77.213 0.658   1.00 70.72  ? 61  TYR C CB    1 
ATOM   3509 C  CG    . TYR C 1 31  ? -27.487 76.111 -0.391  1.00 71.15  ? 61  TYR C CG    1 
ATOM   3510 C  CD1   . TYR C 1 31  ? -27.160 76.403 -1.712  1.00 71.52  ? 61  TYR C CD1   1 
ATOM   3511 C  CD2   . TYR C 1 31  ? -27.733 74.782 -0.061  1.00 71.48  ? 61  TYR C CD2   1 
ATOM   3512 C  CE1   . TYR C 1 31  ? -27.072 75.400 -2.673  1.00 71.55  ? 61  TYR C CE1   1 
ATOM   3513 C  CE2   . TYR C 1 31  ? -27.643 73.774 -1.017  1.00 71.55  ? 61  TYR C CE2   1 
ATOM   3514 C  CZ    . TYR C 1 31  ? -27.313 74.090 -2.318  1.00 71.44  ? 61  TYR C CZ    1 
ATOM   3515 O  OH    . TYR C 1 31  ? -27.233 73.095 -3.268  1.00 71.59  ? 61  TYR C OH    1 
ATOM   3516 N  N     . SER C 1 32  ? -25.362 79.922 0.966   1.00 70.23  ? 62  SER C N     1 
ATOM   3517 C  CA    . SER C 1 32  ? -25.329 81.359 1.193   1.00 70.11  ? 62  SER C CA    1 
ATOM   3518 C  C     . SER C 1 32  ? -26.679 81.976 0.850   1.00 70.02  ? 62  SER C C     1 
ATOM   3519 O  O     . SER C 1 32  ? -27.461 81.407 0.091   1.00 69.96  ? 62  SER C O     1 
ATOM   3520 C  CB    . SER C 1 32  ? -24.222 82.035 0.367   1.00 70.22  ? 62  SER C CB    1 
ATOM   3521 O  OG    . SER C 1 32  ? -24.716 82.530 -0.871  1.00 70.36  ? 62  SER C OG    1 
ATOM   3522 N  N     . GLU C 1 33  ? -26.941 83.148 1.413   1.00 70.10  ? 63  GLU C N     1 
ATOM   3523 C  CA    . GLU C 1 33  ? -28.163 83.884 1.130   1.00 70.08  ? 63  GLU C CA    1 
ATOM   3524 C  C     . GLU C 1 33  ? -28.205 84.251 -0.355  1.00 70.13  ? 63  GLU C C     1 
ATOM   3525 O  O     . GLU C 1 33  ? -29.283 84.305 -0.952  1.00 70.07  ? 63  GLU C O     1 
ATOM   3526 C  CB    . GLU C 1 33  ? -28.247 85.140 2.010   1.00 70.07  ? 63  GLU C CB    1 
ATOM   3527 C  CG    . GLU C 1 33  ? -29.630 85.779 2.081   1.00 70.19  ? 63  GLU C CG    1 
ATOM   3528 C  CD    . GLU C 1 33  ? -29.622 87.099 2.832   1.00 70.21  ? 63  GLU C CD    1 
ATOM   3529 N  N     . GLU C 1 34  ? -27.029 84.490 -0.944  1.00 70.16  ? 64  GLU C N     1 
ATOM   3530 C  CA    . GLU C 1 34  ? -26.919 84.807 -2.375  1.00 70.15  ? 64  GLU C CA    1 
ATOM   3531 C  C     . GLU C 1 34  ? -27.207 83.580 -3.251  1.00 70.06  ? 64  GLU C C     1 
ATOM   3532 O  O     . GLU C 1 34  ? -27.807 83.708 -4.321  1.00 70.07  ? 64  GLU C O     1 
ATOM   3533 C  CB    . GLU C 1 34  ? -25.537 85.397 -2.707  1.00 70.06  ? 64  GLU C CB    1 
ATOM   3534 N  N     . GLU C 1 35  ? -26.782 82.400 -2.797  1.00 69.94  ? 65  GLU C N     1 
ATOM   3535 C  CA    . GLU C 1 35  ? -27.065 81.153 -3.519  1.00 69.95  ? 65  GLU C CA    1 
ATOM   3536 C  C     . GLU C 1 35  ? -28.552 80.788 -3.463  1.00 69.81  ? 65  GLU C C     1 
ATOM   3537 O  O     . GLU C 1 35  ? -29.110 80.287 -4.437  1.00 69.61  ? 65  GLU C O     1 
ATOM   3538 C  CB    . GLU C 1 35  ? -26.202 80.003 -2.992  1.00 69.89  ? 65  GLU C CB    1 
ATOM   3539 C  CG    . GLU C 1 35  ? -24.724 80.172 -3.322  1.00 70.22  ? 65  GLU C CG    1 
ATOM   3540 C  CD    . GLU C 1 35  ? -23.880 78.974 -2.925  1.00 70.33  ? 65  GLU C CD    1 
ATOM   3541 O  OE1   . GLU C 1 35  ? -24.171 77.855 -3.400  1.00 70.68  ? 65  GLU C OE1   1 
ATOM   3542 O  OE2   . GLU C 1 35  ? -22.914 79.156 -2.152  1.00 70.78  ? 65  GLU C OE2   1 
ATOM   3543 N  N     . CYS C 1 36  ? -29.192 81.049 -2.329  1.00 69.78  ? 66  CYS C N     1 
ATOM   3544 C  CA    . CYS C 1 36  ? -30.640 80.874 -2.214  1.00 69.77  ? 66  CYS C CA    1 
ATOM   3545 C  C     . CYS C 1 36  ? -31.401 81.723 -3.224  1.00 69.68  ? 66  CYS C C     1 
ATOM   3546 O  O     . CYS C 1 36  ? -32.477 81.326 -3.675  1.00 70.01  ? 66  CYS C O     1 
ATOM   3547 C  CB    . CYS C 1 36  ? -31.121 81.229 -0.809  1.00 69.77  ? 66  CYS C CB    1 
ATOM   3548 S  SG    . CYS C 1 36  ? -30.687 80.000 0.412   1.00 70.12  ? 66  CYS C SG    1 
ATOM   3549 N  N     . LYS C 1 37  ? -30.854 82.889 -3.565  1.00 69.45  ? 67  LYS C N     1 
ATOM   3550 C  CA    . LYS C 1 37  ? -31.464 83.769 -4.564  1.00 69.25  ? 67  LYS C CA    1 
ATOM   3551 C  C     . LYS C 1 37  ? -31.530 83.094 -5.943  1.00 69.07  ? 67  LYS C C     1 
ATOM   3552 O  O     . LYS C 1 37  ? -32.570 83.132 -6.603  1.00 69.25  ? 67  LYS C O     1 
ATOM   3553 C  CB    . LYS C 1 37  ? -30.706 85.100 -4.651  1.00 69.10  ? 67  LYS C CB    1 
ATOM   3554 N  N     . GLN C 1 38  ? -30.437 82.451 -6.355  1.00 68.78  ? 68  GLN C N     1 
ATOM   3555 C  CA    . GLN C 1 38  ? -30.359 81.800 -7.675  1.00 68.58  ? 68  GLN C CA    1 
ATOM   3556 C  C     . GLN C 1 38  ? -31.458 80.754 -7.923  1.00 68.42  ? 68  GLN C C     1 
ATOM   3557 O  O     . GLN C 1 38  ? -31.863 80.544 -9.067  1.00 68.64  ? 68  GLN C O     1 
ATOM   3558 C  CB    . GLN C 1 38  ? -28.975 81.162 -7.886  1.00 68.57  ? 68  GLN C CB    1 
ATOM   3559 C  CG    . GLN C 1 38  ? -27.810 82.153 -7.899  1.00 68.27  ? 68  GLN C CG    1 
ATOM   3560 N  N     . TYR C 1 39  ? -31.928 80.105 -6.858  1.00 68.19  ? 69  TYR C N     1 
ATOM   3561 C  CA    . TYR C 1 39  ? -32.981 79.082 -6.959  1.00 68.09  ? 69  TYR C CA    1 
ATOM   3562 C  C     . TYR C 1 39  ? -34.414 79.638 -7.042  1.00 67.58  ? 69  TYR C C     1 
ATOM   3563 O  O     . TYR C 1 39  ? -35.348 78.875 -7.278  1.00 67.53  ? 69  TYR C O     1 
ATOM   3564 C  CB    . TYR C 1 39  ? -32.904 78.103 -5.776  1.00 68.46  ? 69  TYR C CB    1 
ATOM   3565 C  CG    . TYR C 1 39  ? -31.789 77.078 -5.860  1.00 68.75  ? 69  TYR C CG    1 
ATOM   3566 C  CD1   . TYR C 1 39  ? -30.520 77.371 -5.396  1.00 69.05  ? 69  TYR C CD1   1 
ATOM   3567 C  CD2   . TYR C 1 39  ? -32.014 75.810 -6.384  1.00 68.95  ? 69  TYR C CD2   1 
ATOM   3568 C  CE1   . TYR C 1 39  ? -29.500 76.442 -5.459  1.00 69.20  ? 69  TYR C CE1   1 
ATOM   3569 C  CE2   . TYR C 1 39  ? -30.998 74.874 -6.454  1.00 68.82  ? 69  TYR C CE2   1 
ATOM   3570 C  CZ    . TYR C 1 39  ? -29.743 75.201 -5.989  1.00 69.09  ? 69  TYR C CZ    1 
ATOM   3571 O  OH    . TYR C 1 39  ? -28.719 74.287 -6.044  1.00 69.73  ? 69  TYR C OH    1 
ATOM   3572 N  N     . LYS C 1 40  ? -34.600 80.942 -6.837  1.00 67.00  ? 70  LYS C N     1 
ATOM   3573 C  CA    . LYS C 1 40  ? -35.937 81.542 -6.933  1.00 66.52  ? 70  LYS C CA    1 
ATOM   3574 C  C     . LYS C 1 40  ? -36.628 81.095 -8.223  1.00 66.06  ? 70  LYS C C     1 
ATOM   3575 O  O     . LYS C 1 40  ? -37.785 80.658 -8.200  1.00 65.92  ? 70  LYS C O     1 
ATOM   3576 C  CB    . LYS C 1 40  ? -35.861 83.069 -6.876  1.00 66.38  ? 70  LYS C CB    1 
ATOM   3577 N  N     . ALA C 1 41  ? -35.890 81.185 -9.329  1.00 65.45  ? 71  ALA C N     1 
ATOM   3578 C  CA    . ALA C 1 41  ? -36.340 80.717 -10.639 1.00 65.02  ? 71  ALA C CA    1 
ATOM   3579 C  C     . ALA C 1 41  ? -36.889 79.287 -10.604 1.00 64.74  ? 71  ALA C C     1 
ATOM   3580 O  O     . ALA C 1 41  ? -37.927 78.993 -11.192 1.00 64.69  ? 71  ALA C O     1 
ATOM   3581 C  CB    . ALA C 1 41  ? -35.190 80.799 -11.627 1.00 64.97  ? 71  ALA C CB    1 
ATOM   3582 N  N     . VAL C 1 42  ? -36.183 78.402 -9.909  1.00 64.38  ? 72  VAL C N     1 
ATOM   3583 C  CA    . VAL C 1 42  ? -36.573 77.000 -9.827  1.00 63.84  ? 72  VAL C CA    1 
ATOM   3584 C  C     . VAL C 1 42  ? -37.846 76.833 -9.000  1.00 63.50  ? 72  VAL C C     1 
ATOM   3585 O  O     . VAL C 1 42  ? -38.769 76.135 -9.415  1.00 63.51  ? 72  VAL C O     1 
ATOM   3586 C  CB    . VAL C 1 42  ? -35.437 76.128 -9.242  1.00 63.78  ? 72  VAL C CB    1 
ATOM   3587 C  CG1   . VAL C 1 42  ? -35.821 74.667 -9.276  1.00 63.28  ? 72  VAL C CG1   1 
ATOM   3588 C  CG2   . VAL C 1 42  ? -34.151 76.346 -10.022 1.00 63.48  ? 72  VAL C CG2   1 
ATOM   3589 N  N     . VAL C 1 43  ? -37.895 77.480 -7.842  1.00 63.18  ? 73  VAL C N     1 
ATOM   3590 C  CA    . VAL C 1 43  ? -39.063 77.395 -6.959  1.00 63.13  ? 73  VAL C CA    1 
ATOM   3591 C  C     . VAL C 1 43  ? -40.368 77.768 -7.678  1.00 63.00  ? 73  VAL C C     1 
ATOM   3592 O  O     . VAL C 1 43  ? -41.342 77.010 -7.652  1.00 62.56  ? 73  VAL C O     1 
ATOM   3593 C  CB    . VAL C 1 43  ? -38.892 78.299 -5.719  1.00 63.20  ? 73  VAL C CB    1 
ATOM   3594 C  CG1   . VAL C 1 43  ? -40.226 78.496 -5.003  1.00 62.51  ? 73  VAL C CG1   1 
ATOM   3595 C  CG2   . VAL C 1 43  ? -37.839 77.706 -4.779  1.00 63.24  ? 73  VAL C CG2   1 
ATOM   3596 N  N     . TYR C 1 44  ? -40.371 78.938 -8.311  1.00 62.96  ? 74  TYR C N     1 
ATOM   3597 C  CA    . TYR C 1 44  ? -41.508 79.373 -9.117  1.00 63.03  ? 74  TYR C CA    1 
ATOM   3598 C  C     . TYR C 1 44  ? -41.868 78.278 -10.128 1.00 63.24  ? 74  TYR C C     1 
ATOM   3599 O  O     . TYR C 1 44  ? -43.001 77.773 -10.159 1.00 63.41  ? 74  TYR C O     1 
ATOM   3600 C  CB    . TYR C 1 44  ? -41.177 80.666 -9.875  1.00 63.05  ? 74  TYR C CB    1 
ATOM   3601 C  CG    . TYR C 1 44  ? -40.812 81.882 -9.029  1.00 63.09  ? 74  TYR C CG    1 
ATOM   3602 C  CD1   . TYR C 1 44  ? -41.314 82.053 -7.737  1.00 62.91  ? 74  TYR C CD1   1 
ATOM   3603 C  CD2   . TYR C 1 44  ? -39.995 82.883 -9.548  1.00 63.02  ? 74  TYR C CD2   1 
ATOM   3604 C  CE1   . TYR C 1 44  ? -40.987 83.161 -6.980  1.00 63.07  ? 74  TYR C CE1   1 
ATOM   3605 C  CE2   . TYR C 1 44  ? -39.666 84.007 -8.799  1.00 63.24  ? 74  TYR C CE2   1 
ATOM   3606 C  CZ    . TYR C 1 44  ? -40.162 84.140 -7.512  1.00 63.46  ? 74  TYR C CZ    1 
ATOM   3607 O  OH    . TYR C 1 44  ? -39.846 85.254 -6.756  1.00 63.24  ? 74  TYR C OH    1 
ATOM   3608 N  N     . SER C 1 45  ? -40.873 77.897 -10.923 1.00 62.95  ? 75  SER C N     1 
ATOM   3609 C  CA    . SER C 1 45  ? -41.033 76.902 -11.964 1.00 62.91  ? 75  SER C CA    1 
ATOM   3610 C  C     . SER C 1 45  ? -41.664 75.608 -11.423 1.00 62.77  ? 75  SER C C     1 
ATOM   3611 O  O     . SER C 1 45  ? -42.621 75.080 -12.005 1.00 62.73  ? 75  SER C O     1 
ATOM   3612 C  CB    . SER C 1 45  ? -39.670 76.628 -12.607 1.00 62.87  ? 75  SER C CB    1 
ATOM   3613 O  OG    . SER C 1 45  ? -39.813 76.001 -13.859 1.00 63.48  ? 75  SER C OG    1 
ATOM   3614 N  N     . ASN C 1 46  ? -41.129 75.112 -10.312 1.00 62.68  ? 76  ASN C N     1 
ATOM   3615 C  CA    . ASN C 1 46  ? -41.689 73.945 -9.619  1.00 62.52  ? 76  ASN C CA    1 
ATOM   3616 C  C     . ASN C 1 46  ? -43.158 74.137 -9.281  1.00 62.38  ? 76  ASN C C     1 
ATOM   3617 O  O     . ASN C 1 46  ? -43.987 73.274 -9.547  1.00 62.01  ? 76  ASN C O     1 
ATOM   3618 C  CB    . ASN C 1 46  ? -40.946 73.703 -8.308  1.00 62.59  ? 76  ASN C CB    1 
ATOM   3619 C  CG    . ASN C 1 46  ? -39.689 72.883 -8.475  1.00 62.73  ? 76  ASN C CG    1 
ATOM   3620 O  OD1   . ASN C 1 46  ? -39.205 72.304 -7.510  1.00 63.02  ? 76  ASN C OD1   1 
ATOM   3621 N  ND2   . ASN C 1 46  ? -39.160 72.817 -9.687  1.00 63.37  ? 76  ASN C ND2   1 
ATOM   3622 N  N     . THR C 1 47  ? -43.457 75.283 -8.673  1.00 62.40  ? 77  THR C N     1 
ATOM   3623 C  CA    . THR C 1 47  ? -44.819 75.642 -8.277  1.00 62.04  ? 77  THR C CA    1 
ATOM   3624 C  C     . THR C 1 47  ? -45.752 75.668 -9.472  1.00 61.97  ? 77  THR C C     1 
ATOM   3625 O  O     . THR C 1 47  ? -46.842 75.086 -9.438  1.00 61.94  ? 77  THR C O     1 
ATOM   3626 C  CB    . THR C 1 47  ? -44.840 77.013 -7.619  1.00 61.85  ? 77  THR C CB    1 
ATOM   3627 O  OG1   . THR C 1 47  ? -43.836 77.041 -6.604  1.00 61.18  ? 77  THR C OG1   1 
ATOM   3628 C  CG2   . THR C 1 47  ? -46.205 77.298 -7.007  1.00 61.60  ? 77  THR C CG2   1 
ATOM   3629 N  N     . ILE C 1 48  ? -45.303 76.345 -10.525 1.00 61.78  ? 78  ILE C N     1 
ATOM   3630 C  CA    . ILE C 1 48  ? -46.032 76.415 -11.786 1.00 61.42  ? 78  ILE C CA    1 
ATOM   3631 C  C     . ILE C 1 48  ? -46.266 75.014 -12.330 1.00 61.28  ? 78  ILE C C     1 
ATOM   3632 O  O     . ILE C 1 48  ? -47.403 74.629 -12.584 1.00 61.32  ? 78  ILE C O     1 
ATOM   3633 C  CB    . ILE C 1 48  ? -45.263 77.273 -12.818 1.00 61.23  ? 78  ILE C CB    1 
ATOM   3634 C  CG1   . ILE C 1 48  ? -45.296 78.746 -12.389 1.00 61.24  ? 78  ILE C CG1   1 
ATOM   3635 C  CG2   . ILE C 1 48  ? -45.856 77.114 -14.211 1.00 60.78  ? 78  ILE C CG2   1 
ATOM   3636 C  CD1   . ILE C 1 48  ? -44.559 79.686 -13.322 1.00 61.65  ? 78  ILE C CD1   1 
ATOM   3637 N  N     . GLN C 1 49  ? -45.186 74.249 -12.473 1.00 61.33  ? 79  GLN C N     1 
ATOM   3638 C  CA    . GLN C 1 49  ? -45.249 72.914 -13.071 1.00 61.11  ? 79  GLN C CA    1 
ATOM   3639 C  C     . GLN C 1 49  ? -46.229 72.016 -12.323 1.00 61.01  ? 79  GLN C C     1 
ATOM   3640 O  O     . GLN C 1 49  ? -46.970 71.255 -12.938 1.00 61.08  ? 79  GLN C O     1 
ATOM   3641 C  CB    . GLN C 1 49  ? -43.861 72.271 -13.105 1.00 60.87  ? 79  GLN C CB    1 
ATOM   3642 N  N     . SER C 1 50  ? -46.233 72.121 -10.997 1.00 61.17  ? 80  SER C N     1 
ATOM   3643 C  CA    . SER C 1 50  ? -47.101 71.311 -10.141 1.00 61.06  ? 80  SER C CA    1 
ATOM   3644 C  C     . SER C 1 50  ? -48.563 71.524 -10.489 1.00 61.15  ? 80  SER C C     1 
ATOM   3645 O  O     . SER C 1 50  ? -49.257 70.586 -10.876 1.00 61.40  ? 80  SER C O     1 
ATOM   3646 C  CB    . SER C 1 50  ? -46.892 71.663 -8.666  1.00 60.92  ? 80  SER C CB    1 
ATOM   3647 O  OG    . SER C 1 50  ? -45.617 71.274 -8.209  1.00 60.36  ? 80  SER C OG    1 
ATOM   3648 N  N     . ILE C 1 51  ? -49.017 72.766 -10.360 1.00 61.03  ? 81  ILE C N     1 
ATOM   3649 C  CA    . ILE C 1 51  ? -50.419 73.089 -10.560 1.00 60.88  ? 81  ILE C CA    1 
ATOM   3650 C  C     . ILE C 1 51  ? -50.838 72.776 -11.995 1.00 60.62  ? 81  ILE C C     1 
ATOM   3651 O  O     . ILE C 1 51  ? -51.994 72.367 -12.237 1.00 60.58  ? 81  ILE C O     1 
ATOM   3652 C  CB    . ILE C 1 51  ? -50.733 74.571 -10.181 1.00 61.07  ? 81  ILE C CB    1 
ATOM   3653 C  CG1   . ILE C 1 51  ? -52.235 74.895 -10.347 1.00 61.11  ? 81  ILE C CG1   1 
ATOM   3654 C  CG2   . ILE C 1 51  ? -49.886 75.537 -11.011 1.00 61.46  ? 81  ILE C CG2   1 
ATOM   3655 C  CD1   . ILE C 1 51  ? -53.177 74.054 -9.486  1.00 60.84  ? 81  ILE C CD1   1 
ATOM   3656 N  N     . ILE C 1 52  ? -49.912 72.941 -12.939 1.00 59.99  ? 82  ILE C N     1 
ATOM   3657 C  CA    . ILE C 1 52  ? -50.189 72.562 -14.327 1.00 59.94  ? 82  ILE C CA    1 
ATOM   3658 C  C     . ILE C 1 52  ? -50.549 71.071 -14.440 1.00 59.69  ? 82  ILE C C     1 
ATOM   3659 O  O     . ILE C 1 52  ? -51.535 70.708 -15.094 1.00 59.53  ? 82  ILE C O     1 
ATOM   3660 C  CB    . ILE C 1 52  ? -49.019 72.940 -15.279 1.00 60.07  ? 82  ILE C CB    1 
ATOM   3661 C  CG1   . ILE C 1 52  ? -49.065 74.447 -15.587 1.00 60.20  ? 82  ILE C CG1   1 
ATOM   3662 C  CG2   . ILE C 1 52  ? -49.083 72.143 -16.589 1.00 59.85  ? 82  ILE C CG2   1 
ATOM   3663 C  CD1   . ILE C 1 52  ? -47.911 74.952 -16.445 1.00 59.63  ? 82  ILE C CD1   1 
ATOM   3664 N  N     . ALA C 1 53  ? -49.763 70.218 -13.796 1.00 59.44  ? 83  ALA C N     1 
ATOM   3665 C  CA    . ALA C 1 53  ? -50.052 68.784 -13.766 1.00 59.55  ? 83  ALA C CA    1 
ATOM   3666 C  C     . ALA C 1 53  ? -51.502 68.505 -13.341 1.00 59.68  ? 83  ALA C C     1 
ATOM   3667 O  O     . ALA C 1 53  ? -52.252 67.809 -14.031 1.00 59.42  ? 83  ALA C O     1 
ATOM   3668 C  CB    . ALA C 1 53  ? -49.105 68.086 -12.829 1.00 59.04  ? 83  ALA C CB    1 
ATOM   3669 N  N     . ILE C 1 54  ? -51.889 69.094 -12.217 1.00 59.80  ? 84  ILE C N     1 
ATOM   3670 C  CA    . ILE C 1 54  ? -53.177 68.827 -11.610 1.00 60.05  ? 84  ILE C CA    1 
ATOM   3671 C  C     . ILE C 1 54  ? -54.335 69.276 -12.531 1.00 60.69  ? 84  ILE C C     1 
ATOM   3672 O  O     . ILE C 1 54  ? -55.398 68.635 -12.592 1.00 60.87  ? 84  ILE C O     1 
ATOM   3673 C  CB    . ILE C 1 54  ? -53.281 69.497 -10.220 1.00 59.88  ? 84  ILE C CB    1 
ATOM   3674 C  CG1   . ILE C 1 54  ? -52.102 69.080 -9.330  1.00 59.69  ? 84  ILE C CG1   1 
ATOM   3675 C  CG2   . ILE C 1 54  ? -54.577 69.112 -9.535  1.00 58.99  ? 84  ILE C CG2   1 
ATOM   3676 C  CD1   . ILE C 1 54  ? -51.925 69.961 -8.108  1.00 59.36  ? 84  ILE C CD1   1 
ATOM   3677 N  N     . ILE C 1 55  ? -54.130 70.359 -13.264 1.00 61.02  ? 85  ILE C N     1 
ATOM   3678 C  CA    . ILE C 1 55  ? -55.162 70.835 -14.171 1.00 61.41  ? 85  ILE C CA    1 
ATOM   3679 C  C     . ILE C 1 55  ? -55.274 69.935 -15.391 1.00 61.75  ? 85  ILE C C     1 
ATOM   3680 O  O     . ILE C 1 55  ? -56.380 69.689 -15.894 1.00 62.37  ? 85  ILE C O     1 
ATOM   3681 C  CB    . ILE C 1 55  ? -54.883 72.256 -14.622 1.00 61.55  ? 85  ILE C CB    1 
ATOM   3682 C  CG1   . ILE C 1 55  ? -54.989 73.203 -13.425 1.00 61.62  ? 85  ILE C CG1   1 
ATOM   3683 C  CG2   . ILE C 1 55  ? -55.857 72.661 -15.724 1.00 61.30  ? 85  ILE C CG2   1 
ATOM   3684 C  CD1   . ILE C 1 55  ? -54.369 74.554 -13.705 1.00 62.84  ? 85  ILE C CD1   1 
ATOM   3685 N  N     . ARG C 1 56  ? -54.132 69.453 -15.874 1.00 61.78  ? 86  ARG C N     1 
ATOM   3686 C  CA    . ARG C 1 56  ? -54.131 68.490 -16.965 1.00 61.57  ? 86  ARG C CA    1 
ATOM   3687 C  C     . ARG C 1 56  ? -54.876 67.255 -16.541 1.00 61.66  ? 86  ARG C C     1 
ATOM   3688 O  O     . ARG C 1 56  ? -55.735 66.769 -17.264 1.00 61.76  ? 86  ARG C O     1 
ATOM   3689 C  CB    . ARG C 1 56  ? -52.708 68.124 -17.367 1.00 61.52  ? 86  ARG C CB    1 
ATOM   3690 C  CG    . ARG C 1 56  ? -52.045 69.229 -18.143 1.00 60.68  ? 86  ARG C CG    1 
ATOM   3691 C  CD    . ARG C 1 56  ? -50.575 69.017 -18.290 1.00 59.26  ? 86  ARG C CD    1 
ATOM   3692 N  NE    . ARG C 1 56  ? -50.056 69.905 -19.310 1.00 58.45  ? 86  ARG C NE    1 
ATOM   3693 C  CZ    . ARG C 1 56  ? -48.774 70.021 -19.624 1.00 57.81  ? 86  ARG C CZ    1 
ATOM   3694 N  NH1   . ARG C 1 56  ? -47.850 69.327 -18.973 1.00 56.66  ? 86  ARG C NH1   1 
ATOM   3695 N  NH2   . ARG C 1 56  ? -48.416 70.854 -20.595 1.00 57.65  ? 86  ARG C NH2   1 
ATOM   3696 N  N     . ALA C 1 57  ? -54.560 66.760 -15.351 1.00 61.92  ? 87  ALA C N     1 
ATOM   3697 C  CA    . ALA C 1 57  ? -55.214 65.558 -14.842 1.00 62.14  ? 87  ALA C CA    1 
ATOM   3698 C  C     . ALA C 1 57  ? -56.736 65.725 -14.758 1.00 62.41  ? 87  ALA C C     1 
ATOM   3699 O  O     . ALA C 1 57  ? -57.469 64.809 -15.100 1.00 61.96  ? 87  ALA C O     1 
ATOM   3700 C  CB    . ALA C 1 57  ? -54.645 65.173 -13.496 1.00 61.85  ? 87  ALA C CB    1 
ATOM   3701 N  N     . MET C 1 58  ? -57.199 66.899 -14.325 1.00 63.04  ? 88  MET C N     1 
ATOM   3702 C  CA    . MET C 1 58  ? -58.631 67.137 -14.120 1.00 63.59  ? 88  MET C CA    1 
ATOM   3703 C  C     . MET C 1 58  ? -59.453 66.799 -15.356 1.00 63.89  ? 88  MET C C     1 
ATOM   3704 O  O     . MET C 1 58  ? -60.469 66.121 -15.259 1.00 63.92  ? 88  MET C O     1 
ATOM   3705 C  CB    . MET C 1 58  ? -58.889 68.576 -13.675 1.00 63.42  ? 88  MET C CB    1 
ATOM   3706 C  CG    . MET C 1 58  ? -58.604 68.780 -12.208 1.00 63.79  ? 88  MET C CG    1 
ATOM   3707 S  SD    . MET C 1 58  ? -58.858 70.463 -11.649 1.00 64.47  ? 88  MET C SD    1 
ATOM   3708 C  CE    . MET C 1 58  ? -60.616 70.471 -11.300 1.00 64.58  ? 88  MET C CE    1 
ATOM   3709 N  N     . GLY C 1 59  ? -58.998 67.252 -16.517 1.00 64.37  ? 89  GLY C N     1 
ATOM   3710 C  CA    . GLY C 1 59  ? -59.614 66.861 -17.774 1.00 64.67  ? 89  GLY C CA    1 
ATOM   3711 C  C     . GLY C 1 59  ? -59.444 65.377 -18.058 1.00 65.08  ? 89  GLY C C     1 
ATOM   3712 O  O     . GLY C 1 59  ? -60.408 64.686 -18.392 1.00 65.51  ? 89  GLY C O     1 
ATOM   3713 N  N     . ARG C 1 60  ? -58.227 64.868 -17.918 1.00 65.42  ? 90  ARG C N     1 
ATOM   3714 C  CA    . ARG C 1 60  ? -57.967 63.458 -18.223 1.00 65.76  ? 90  ARG C CA    1 
ATOM   3715 C  C     . ARG C 1 60  ? -58.754 62.507 -17.323 1.00 65.23  ? 90  ARG C C     1 
ATOM   3716 O  O     . ARG C 1 60  ? -59.362 61.555 -17.802 1.00 65.39  ? 90  ARG C O     1 
ATOM   3717 C  CB    . ARG C 1 60  ? -56.466 63.161 -18.178 1.00 66.16  ? 90  ARG C CB    1 
ATOM   3718 C  CG    . ARG C 1 60  ? -55.712 63.837 -19.331 1.00 68.16  ? 90  ARG C CG    1 
ATOM   3719 C  CD    . ARG C 1 60  ? -54.418 63.134 -19.696 1.00 71.10  ? 90  ARG C CD    1 
ATOM   3720 N  NE    . ARG C 1 60  ? -53.265 63.673 -18.966 1.00 73.17  ? 90  ARG C NE    1 
ATOM   3721 C  CZ    . ARG C 1 60  ? -52.307 64.449 -19.481 1.00 73.11  ? 90  ARG C CZ    1 
ATOM   3722 N  NH1   . ARG C 1 60  ? -52.317 64.813 -20.757 1.00 72.58  ? 90  ARG C NH1   1 
ATOM   3723 N  NH2   . ARG C 1 60  ? -51.314 64.859 -18.700 1.00 73.83  ? 90  ARG C NH2   1 
ATOM   3724 N  N     . LEU C 1 61  ? -58.776 62.796 -16.029 1.00 64.98  ? 91  LEU C N     1 
ATOM   3725 C  CA    . LEU C 1 61  ? -59.529 61.994 -15.055 1.00 64.63  ? 91  LEU C CA    1 
ATOM   3726 C  C     . LEU C 1 61  ? -60.975 62.412 -14.997 1.00 64.32  ? 91  LEU C C     1 
ATOM   3727 O  O     . LEU C 1 61  ? -61.744 61.835 -14.238 1.00 64.41  ? 91  LEU C O     1 
ATOM   3728 C  CB    . LEU C 1 61  ? -58.932 62.140 -13.644 1.00 64.66  ? 91  LEU C CB    1 
ATOM   3729 C  CG    . LEU C 1 61  ? -57.436 61.839 -13.502 1.00 64.14  ? 91  LEU C CG    1 
ATOM   3730 C  CD1   . LEU C 1 61  ? -56.998 62.028 -12.056 1.00 63.06  ? 91  LEU C CD1   1 
ATOM   3731 C  CD2   . LEU C 1 61  ? -57.129 60.429 -14.019 1.00 62.96  ? 91  LEU C CD2   1 
ATOM   3732 N  N     . LYS C 1 62  ? -61.337 63.434 -15.771 1.00 64.21  ? 92  LYS C N     1 
ATOM   3733 C  CA    . LYS C 1 62  ? -62.710 63.945 -15.813 1.00 63.88  ? 92  LYS C CA    1 
ATOM   3734 C  C     . LYS C 1 62  ? -63.203 64.367 -14.419 1.00 63.62  ? 92  LYS C C     1 
ATOM   3735 O  O     . LYS C 1 62  ? -64.206 63.855 -13.952 1.00 63.61  ? 92  LYS C O     1 
ATOM   3736 C  CB    . LYS C 1 62  ? -63.645 62.895 -16.431 1.00 63.58  ? 92  LYS C CB    1 
ATOM   3737 N  N     . ILE C 1 63  ? -62.476 65.277 -13.762 1.00 63.64  ? 93  ILE C N     1 
ATOM   3738 C  CA    . ILE C 1 63  ? -62.900 65.881 -12.480 1.00 63.63  ? 93  ILE C CA    1 
ATOM   3739 C  C     . ILE C 1 63  ? -63.264 67.352 -12.664 1.00 63.86  ? 93  ILE C C     1 
ATOM   3740 O  O     . ILE C 1 63  ? -62.414 68.160 -13.060 1.00 63.70  ? 93  ILE C O     1 
ATOM   3741 C  CB    . ILE C 1 63  ? -61.794 65.860 -11.393 1.00 63.57  ? 93  ILE C CB    1 
ATOM   3742 C  CG1   . ILE C 1 63  ? -61.332 64.441 -11.070 1.00 63.62  ? 93  ILE C CG1   1 
ATOM   3743 C  CG2   . ILE C 1 63  ? -62.297 66.507 -10.119 1.00 63.05  ? 93  ILE C CG2   1 
ATOM   3744 C  CD1   . ILE C 1 63  ? -60.035 64.408 -10.297 1.00 63.08  ? 93  ILE C CD1   1 
ATOM   3745 N  N     . ASP C 1 64  ? -64.514 67.696 -12.347 1.00 64.21  ? 94  ASP C N     1 
ATOM   3746 C  CA    . ASP C 1 64  ? -64.982 69.089 -12.396 1.00 64.60  ? 94  ASP C CA    1 
ATOM   3747 C  C     . ASP C 1 64  ? -64.342 69.980 -11.324 1.00 64.73  ? 94  ASP C C     1 
ATOM   3748 O  O     . ASP C 1 64  ? -63.740 69.492 -10.358 1.00 64.85  ? 94  ASP C O     1 
ATOM   3749 C  CB    . ASP C 1 64  ? -66.502 69.151 -12.223 1.00 64.64  ? 94  ASP C CB    1 
ATOM   3750 C  CG    . ASP C 1 64  ? -67.255 68.553 -13.393 1.00 65.45  ? 94  ASP C CG    1 
ATOM   3751 O  OD1   . ASP C 1 64  ? -66.619 68.235 -14.429 1.00 66.26  ? 94  ASP C OD1   1 
ATOM   3752 O  OD2   . ASP C 1 64  ? -68.495 68.410 -13.270 1.00 65.48  ? 94  ASP C OD2   1 
ATOM   3753 N  N     . PHE C 1 65  ? -64.485 71.290 -11.513 1.00 64.81  ? 95  PHE C N     1 
ATOM   3754 C  CA    . PHE C 1 65  ? -64.098 72.273 -10.509 1.00 64.88  ? 95  PHE C CA    1 
ATOM   3755 C  C     . PHE C 1 65  ? -65.208 72.391 -9.479  1.00 65.08  ? 95  PHE C C     1 
ATOM   3756 O  O     . PHE C 1 65  ? -66.343 72.004 -9.744  1.00 65.29  ? 95  PHE C O     1 
ATOM   3757 C  CB    . PHE C 1 65  ? -63.865 73.649 -11.146 1.00 64.79  ? 95  PHE C CB    1 
ATOM   3758 C  CG    . PHE C 1 65  ? -62.655 73.716 -12.024 1.00 64.41  ? 95  PHE C CG    1 
ATOM   3759 C  CD1   . PHE C 1 65  ? -61.392 73.887 -11.473 1.00 64.63  ? 95  PHE C CD1   1 
ATOM   3760 C  CD2   . PHE C 1 65  ? -62.775 73.615 -13.404 1.00 63.95  ? 95  PHE C CD2   1 
ATOM   3761 C  CE1   . PHE C 1 65  ? -60.256 73.951 -12.292 1.00 64.74  ? 95  PHE C CE1   1 
ATOM   3762 C  CE2   . PHE C 1 65  ? -61.651 73.675 -14.225 1.00 64.12  ? 95  PHE C CE2   1 
ATOM   3763 C  CZ    . PHE C 1 65  ? -60.389 73.845 -13.668 1.00 64.32  ? 95  PHE C CZ    1 
ATOM   3764 N  N     . GLY C 1 66  ? -64.872 72.919 -8.307  1.00 65.27  ? 96  GLY C N     1 
ATOM   3765 C  CA    . GLY C 1 66  ? -65.871 73.300 -7.324  1.00 65.39  ? 96  GLY C CA    1 
ATOM   3766 C  C     . GLY C 1 66  ? -66.683 74.450 -7.873  1.00 65.60  ? 96  GLY C C     1 
ATOM   3767 O  O     . GLY C 1 66  ? -67.905 74.366 -7.953  1.00 65.81  ? 96  GLY C O     1 
ATOM   3768 N  N     . ASP C 1 67  ? -65.986 75.515 -8.268  1.00 65.89  ? 97  ASP C N     1 
ATOM   3769 C  CA    . ASP C 1 67  ? -66.603 76.704 -8.868  1.00 66.06  ? 97  ASP C CA    1 
ATOM   3770 C  C     . ASP C 1 67  ? -66.136 76.834 -10.325 1.00 65.81  ? 97  ASP C C     1 
ATOM   3771 O  O     . ASP C 1 67  ? -64.938 76.901 -10.604 1.00 65.49  ? 97  ASP C O     1 
ATOM   3772 C  CB    . ASP C 1 67  ? -66.249 77.965 -8.057  1.00 66.17  ? 97  ASP C CB    1 
ATOM   3773 C  CG    . ASP C 1 67  ? -67.162 79.161 -8.372  1.00 67.51  ? 97  ASP C CG    1 
ATOM   3774 O  OD1   . ASP C 1 67  ? -67.872 79.641 -7.449  1.00 68.93  ? 97  ASP C OD1   1 
ATOM   3775 O  OD2   . ASP C 1 67  ? -67.170 79.632 -9.538  1.00 68.72  ? 97  ASP C OD2   1 
ATOM   3776 N  N     . SER C 1 68  ? -67.102 76.869 -11.241 1.00 65.65  ? 98  SER C N     1 
ATOM   3777 C  CA    . SER C 1 68  ? -66.843 76.976 -12.683 1.00 65.61  ? 98  SER C CA    1 
ATOM   3778 C  C     . SER C 1 68  ? -66.042 78.218 -13.104 1.00 65.35  ? 98  SER C C     1 
ATOM   3779 O  O     . SER C 1 68  ? -65.464 78.251 -14.193 1.00 65.45  ? 98  SER C O     1 
ATOM   3780 C  CB    . SER C 1 68  ? -68.175 76.942 -13.443 1.00 65.70  ? 98  SER C CB    1 
ATOM   3781 O  OG    . SER C 1 68  ? -69.195 77.610 -12.710 1.00 66.14  ? 98  SER C OG    1 
ATOM   3782 N  N     . ALA C 1 69  ? -66.016 79.236 -12.249 1.00 64.94  ? 99  ALA C N     1 
ATOM   3783 C  CA    . ALA C 1 69  ? -65.188 80.419 -12.470 1.00 64.61  ? 99  ALA C CA    1 
ATOM   3784 C  C     . ALA C 1 69  ? -63.694 80.096 -12.566 1.00 64.17  ? 99  ALA C C     1 
ATOM   3785 O  O     . ALA C 1 69  ? -62.922 80.903 -13.079 1.00 64.24  ? 99  ALA C O     1 
ATOM   3786 C  CB    . ALA C 1 69  ? -65.430 81.443 -11.359 1.00 64.60  ? 99  ALA C CB    1 
ATOM   3787 N  N     . ARG C 1 70  ? -63.287 78.931 -12.070 1.00 63.72  ? 100 ARG C N     1 
ATOM   3788 C  CA    . ARG C 1 70  ? -61.886 78.509 -12.155 1.00 63.50  ? 100 ARG C CA    1 
ATOM   3789 C  C     . ARG C 1 70  ? -61.497 78.196 -13.584 1.00 63.28  ? 100 ARG C C     1 
ATOM   3790 O  O     . ARG C 1 70  ? -60.314 78.184 -13.912 1.00 63.04  ? 100 ARG C O     1 
ATOM   3791 C  CB    . ARG C 1 70  ? -61.621 77.276 -11.287 1.00 63.40  ? 100 ARG C CB    1 
ATOM   3792 C  CG    . ARG C 1 70  ? -61.925 77.455 -9.804  1.00 63.56  ? 100 ARG C CG    1 
ATOM   3793 C  CD    . ARG C 1 70  ? -60.903 78.314 -9.071  1.00 63.20  ? 100 ARG C CD    1 
ATOM   3794 N  NE    . ARG C 1 70  ? -61.057 79.740 -9.332  1.00 62.83  ? 100 ARG C NE    1 
ATOM   3795 C  CZ    . ARG C 1 70  ? -62.040 80.505 -8.859  1.00 63.31  ? 100 ARG C CZ    1 
ATOM   3796 N  NH1   . ARG C 1 70  ? -63.012 80.000 -8.103  1.00 63.48  ? 100 ARG C NH1   1 
ATOM   3797 N  NH2   . ARG C 1 70  ? -62.066 81.794 -9.164  1.00 63.50  ? 100 ARG C NH2   1 
ATOM   3798 N  N     . ALA C 1 71  ? -62.496 77.917 -14.423 1.00 63.34  ? 101 ALA C N     1 
ATOM   3799 C  CA    . ALA C 1 71  ? -62.284 77.732 -15.853 1.00 63.37  ? 101 ALA C CA    1 
ATOM   3800 C  C     . ALA C 1 71  ? -61.426 78.866 -16.387 1.00 63.59  ? 101 ALA C C     1 
ATOM   3801 O  O     . ALA C 1 71  ? -60.419 78.624 -17.051 1.00 63.93  ? 101 ALA C O     1 
ATOM   3802 C  CB    . ALA C 1 71  ? -63.612 77.678 -16.587 1.00 63.24  ? 101 ALA C CB    1 
ATOM   3803 N  N     . ASP C 1 72  ? -61.812 80.099 -16.064 1.00 63.71  ? 102 ASP C N     1 
ATOM   3804 C  CA    . ASP C 1 72  ? -61.062 81.278 -16.489 1.00 63.97  ? 102 ASP C CA    1 
ATOM   3805 C  C     . ASP C 1 72  ? -59.619 81.236 -15.992 1.00 63.55  ? 102 ASP C C     1 
ATOM   3806 O  O     . ASP C 1 72  ? -58.691 81.450 -16.768 1.00 63.57  ? 102 ASP C O     1 
ATOM   3807 C  CB    . ASP C 1 72  ? -61.760 82.578 -16.039 1.00 64.22  ? 102 ASP C CB    1 
ATOM   3808 C  CG    . ASP C 1 72  ? -62.714 83.141 -17.101 1.00 66.08  ? 102 ASP C CG    1 
ATOM   3809 O  OD1   . ASP C 1 72  ? -62.260 83.392 -18.246 1.00 68.18  ? 102 ASP C OD1   1 
ATOM   3810 O  OD2   . ASP C 1 72  ? -63.914 83.357 -16.796 1.00 68.16  ? 102 ASP C OD2   1 
ATOM   3811 N  N     . ASP C 1 73  ? -59.428 80.937 -14.714 1.00 63.20  ? 103 ASP C N     1 
ATOM   3812 C  CA    . ASP C 1 73  ? -58.090 80.997 -14.113 1.00 63.14  ? 103 ASP C CA    1 
ATOM   3813 C  C     . ASP C 1 73  ? -57.170 79.880 -14.625 1.00 62.78  ? 103 ASP C C     1 
ATOM   3814 O  O     . ASP C 1 73  ? -55.958 80.065 -14.741 1.00 62.61  ? 103 ASP C O     1 
ATOM   3815 C  CB    . ASP C 1 73  ? -58.181 80.967 -12.582 1.00 63.11  ? 103 ASP C CB    1 
ATOM   3816 C  CG    . ASP C 1 73  ? -58.966 82.154 -12.008 1.00 64.10  ? 103 ASP C CG    1 
ATOM   3817 O  OD1   . ASP C 1 73  ? -59.179 83.165 -12.722 1.00 65.53  ? 103 ASP C OD1   1 
ATOM   3818 O  OD2   . ASP C 1 73  ? -59.379 82.077 -10.832 1.00 64.51  ? 103 ASP C OD2   1 
ATOM   3819 N  N     . ALA C 1 74  ? -57.752 78.729 -14.933 1.00 62.37  ? 104 ALA C N     1 
ATOM   3820 C  CA    . ALA C 1 74  ? -56.996 77.621 -15.475 1.00 62.12  ? 104 ALA C CA    1 
ATOM   3821 C  C     . ALA C 1 74  ? -56.445 77.968 -16.852 1.00 62.01  ? 104 ALA C C     1 
ATOM   3822 O  O     . ALA C 1 74  ? -55.314 77.618 -17.189 1.00 61.48  ? 104 ALA C O     1 
ATOM   3823 C  CB    . ALA C 1 74  ? -57.865 76.393 -15.549 1.00 62.09  ? 104 ALA C CB    1 
ATOM   3824 N  N     . ARG C 1 75  ? -57.245 78.666 -17.649 1.00 61.93  ? 105 ARG C N     1 
ATOM   3825 C  CA    . ARG C 1 75  ? -56.790 79.082 -18.957 1.00 61.91  ? 105 ARG C CA    1 
ATOM   3826 C  C     . ARG C 1 75  ? -55.687 80.103 -18.810 1.00 61.77  ? 105 ARG C C     1 
ATOM   3827 O  O     . ARG C 1 75  ? -54.678 80.034 -19.494 1.00 61.69  ? 105 ARG C O     1 
ATOM   3828 C  CB    . ARG C 1 75  ? -57.931 79.654 -19.774 1.00 62.04  ? 105 ARG C CB    1 
ATOM   3829 C  CG    . ARG C 1 75  ? -58.995 78.648 -20.147 1.00 62.80  ? 105 ARG C CG    1 
ATOM   3830 C  CD    . ARG C 1 75  ? -59.998 79.269 -21.112 1.00 64.22  ? 105 ARG C CD    1 
ATOM   3831 N  NE    . ARG C 1 75  ? -61.370 78.837 -20.844 1.00 64.91  ? 105 ARG C NE    1 
ATOM   3832 C  CZ    . ARG C 1 75  ? -62.287 79.538 -20.175 1.00 65.28  ? 105 ARG C CZ    1 
ATOM   3833 N  NH1   . ARG C 1 75  ? -63.505 79.033 -20.010 1.00 65.55  ? 105 ARG C NH1   1 
ATOM   3834 N  NH2   . ARG C 1 75  ? -62.014 80.738 -19.678 1.00 65.59  ? 105 ARG C NH2   1 
ATOM   3835 N  N     . GLN C 1 76  ? -55.869 81.041 -17.895 1.00 62.05  ? 106 GLN C N     1 
ATOM   3836 C  CA    . GLN C 1 76  ? -54.893 82.106 -17.713 1.00 62.19  ? 106 GLN C CA    1 
ATOM   3837 C  C     . GLN C 1 76  ? -53.585 81.561 -17.192 1.00 62.13  ? 106 GLN C C     1 
ATOM   3838 O  O     . GLN C 1 76  ? -52.536 82.026 -17.595 1.00 62.08  ? 106 GLN C O     1 
ATOM   3839 C  CB    . GLN C 1 76  ? -55.428 83.217 -16.801 1.00 62.23  ? 106 GLN C CB    1 
ATOM   3840 C  CG    . GLN C 1 76  ? -56.391 84.146 -17.496 1.00 62.55  ? 106 GLN C CG    1 
ATOM   3841 C  CD    . GLN C 1 76  ? -55.745 84.907 -18.652 1.00 63.99  ? 106 GLN C CD    1 
ATOM   3842 O  OE1   . GLN C 1 76  ? -54.738 85.602 -18.466 1.00 64.79  ? 106 GLN C OE1   1 
ATOM   3843 N  NE2   . GLN C 1 76  ? -56.325 84.782 -19.852 1.00 63.66  ? 106 GLN C NE2   1 
ATOM   3844 N  N     . LEU C 1 77  ? -53.637 80.561 -16.323 1.00 62.59  ? 107 LEU C N     1 
ATOM   3845 C  CA    . LEU C 1 77  ? -52.411 79.893 -15.885 1.00 63.03  ? 107 LEU C CA    1 
ATOM   3846 C  C     . LEU C 1 77  ? -51.555 79.523 -17.083 1.00 63.37  ? 107 LEU C C     1 
ATOM   3847 O  O     . LEU C 1 77  ? -50.382 79.878 -17.152 1.00 63.49  ? 107 LEU C O     1 
ATOM   3848 C  CB    . LEU C 1 77  ? -52.715 78.622 -15.104 1.00 63.12  ? 107 LEU C CB    1 
ATOM   3849 C  CG    . LEU C 1 77  ? -51.464 77.804 -14.749 1.00 63.27  ? 107 LEU C CG    1 
ATOM   3850 C  CD1   . LEU C 1 77  ? -50.590 78.608 -13.792 1.00 63.68  ? 107 LEU C CD1   1 
ATOM   3851 C  CD2   . LEU C 1 77  ? -51.821 76.437 -14.154 1.00 62.76  ? 107 LEU C CD2   1 
ATOM   3852 N  N     . PHE C 1 78  ? -52.158 78.807 -18.026 1.00 63.75  ? 108 PHE C N     1 
ATOM   3853 C  CA    . PHE C 1 78  ? -51.453 78.375 -19.227 1.00 64.00  ? 108 PHE C CA    1 
ATOM   3854 C  C     . PHE C 1 78  ? -51.034 79.518 -20.133 1.00 64.14  ? 108 PHE C C     1 
ATOM   3855 O  O     . PHE C 1 78  ? -50.069 79.391 -20.870 1.00 64.71  ? 108 PHE C O     1 
ATOM   3856 C  CB    . PHE C 1 78  ? -52.297 77.363 -19.996 1.00 64.18  ? 108 PHE C CB    1 
ATOM   3857 C  CG    . PHE C 1 78  ? -52.316 76.012 -19.354 1.00 64.21  ? 108 PHE C CG    1 
ATOM   3858 C  CD1   . PHE C 1 78  ? -51.265 75.131 -19.545 1.00 64.10  ? 108 PHE C CD1   1 
ATOM   3859 C  CD2   . PHE C 1 78  ? -53.353 75.643 -18.520 1.00 64.61  ? 108 PHE C CD2   1 
ATOM   3860 C  CE1   . PHE C 1 78  ? -51.264 73.898 -18.941 1.00 64.55  ? 108 PHE C CE1   1 
ATOM   3861 C  CE2   . PHE C 1 78  ? -53.365 74.402 -17.907 1.00 64.41  ? 108 PHE C CE2   1 
ATOM   3862 C  CZ    . PHE C 1 78  ? -52.317 73.529 -18.116 1.00 64.69  ? 108 PHE C CZ    1 
ATOM   3863 N  N     . VAL C 1 79  ? -51.747 80.632 -20.074 1.00 64.24  ? 109 VAL C N     1 
ATOM   3864 C  CA    . VAL C 1 79  ? -51.402 81.800 -20.869 1.00 64.32  ? 109 VAL C CA    1 
ATOM   3865 C  C     . VAL C 1 79  ? -50.238 82.576 -20.235 1.00 64.73  ? 109 VAL C C     1 
ATOM   3866 O  O     . VAL C 1 79  ? -49.331 82.999 -20.944 1.00 64.92  ? 109 VAL C O     1 
ATOM   3867 C  CB    . VAL C 1 79  ? -52.633 82.714 -21.068 1.00 64.28  ? 109 VAL C CB    1 
ATOM   3868 C  CG1   . VAL C 1 79  ? -52.255 83.978 -21.807 1.00 64.03  ? 109 VAL C CG1   1 
ATOM   3869 C  CG2   . VAL C 1 79  ? -53.723 81.965 -21.811 1.00 63.54  ? 109 VAL C CG2   1 
ATOM   3870 N  N     . LEU C 1 80  ? -50.259 82.757 -18.912 1.00 65.14  ? 110 LEU C N     1 
ATOM   3871 C  CA    . LEU C 1 80  ? -49.162 83.446 -18.198 1.00 65.26  ? 110 LEU C CA    1 
ATOM   3872 C  C     . LEU C 1 80  ? -47.891 82.607 -18.228 1.00 65.53  ? 110 LEU C C     1 
ATOM   3873 O  O     . LEU C 1 80  ? -46.839 83.079 -18.648 1.00 65.59  ? 110 LEU C O     1 
ATOM   3874 C  CB    . LEU C 1 80  ? -49.527 83.734 -16.738 1.00 65.18  ? 110 LEU C CB    1 
ATOM   3875 C  CG    . LEU C 1 80  ? -50.809 84.522 -16.448 1.00 64.91  ? 110 LEU C CG    1 
ATOM   3876 C  CD1   . LEU C 1 80  ? -50.922 84.787 -14.962 1.00 63.66  ? 110 LEU C CD1   1 
ATOM   3877 C  CD2   . LEU C 1 80  ? -50.856 85.817 -17.227 1.00 64.50  ? 110 LEU C CD2   1 
ATOM   3878 N  N     . ALA C 1 81  ? -48.003 81.361 -17.777 1.00 65.97  ? 111 ALA C N     1 
ATOM   3879 C  CA    . ALA C 1 81  ? -46.919 80.387 -17.890 1.00 66.21  ? 111 ALA C CA    1 
ATOM   3880 C  C     . ALA C 1 81  ? -46.517 80.212 -19.351 1.00 66.52  ? 111 ALA C C     1 
ATOM   3881 O  O     . ALA C 1 81  ? -45.699 79.349 -19.671 1.00 67.10  ? 111 ALA C O     1 
ATOM   3882 C  CB    . ALA C 1 81  ? -47.347 79.055 -17.313 1.00 65.96  ? 111 ALA C CB    1 
ATOM   3883 N  N     . MET C 1 89  ? -42.543 85.080 -11.337 1.00 65.26  ? 119 MET C N     1 
ATOM   3884 C  CA    . MET C 1 89  ? -43.841 85.091 -10.668 1.00 65.34  ? 119 MET C CA    1 
ATOM   3885 C  C     . MET C 1 89  ? -44.416 86.500 -10.644 1.00 65.01  ? 119 MET C C     1 
ATOM   3886 O  O     . MET C 1 89  ? -43.783 87.411 -10.127 1.00 65.00  ? 119 MET C O     1 
ATOM   3887 C  CB    . MET C 1 89  ? -43.701 84.580 -9.228  1.00 65.53  ? 119 MET C CB    1 
ATOM   3888 C  CG    . MET C 1 89  ? -45.000 84.578 -8.386  1.00 65.95  ? 119 MET C CG    1 
ATOM   3889 S  SD    . MET C 1 89  ? -46.165 83.239 -8.762  1.00 67.73  ? 119 MET C SD    1 
ATOM   3890 C  CE    . MET C 1 89  ? -45.158 81.785 -8.507  1.00 65.01  ? 119 MET C CE    1 
ATOM   3891 N  N     . THR C 1 90  ? -45.616 86.664 -11.198 1.00 64.66  ? 120 THR C N     1 
ATOM   3892 C  CA    . THR C 1 90  ? -46.335 87.932 -11.135 1.00 64.39  ? 120 THR C CA    1 
ATOM   3893 C  C     . THR C 1 90  ? -47.478 87.830 -10.127 1.00 64.15  ? 120 THR C C     1 
ATOM   3894 O  O     . THR C 1 90  ? -47.895 86.736 -9.757  1.00 64.20  ? 120 THR C O     1 
ATOM   3895 C  CB    . THR C 1 90  ? -46.893 88.348 -12.525 1.00 64.56  ? 120 THR C CB    1 
ATOM   3896 O  OG1   . THR C 1 90  ? -47.934 87.448 -12.941 1.00 64.81  ? 120 THR C OG1   1 
ATOM   3897 C  CG2   . THR C 1 90  ? -45.781 88.362 -13.576 1.00 64.21  ? 120 THR C CG2   1 
ATOM   3898 N  N     . ALA C 1 91  ? -47.984 88.977 -9.689  1.00 64.04  ? 121 ALA C N     1 
ATOM   3899 C  CA    . ALA C 1 91  ? -49.064 89.019 -8.700  1.00 63.83  ? 121 ALA C CA    1 
ATOM   3900 C  C     . ALA C 1 91  ? -50.341 88.406 -9.242  1.00 63.60  ? 121 ALA C C     1 
ATOM   3901 O  O     . ALA C 1 91  ? -51.116 87.819 -8.486  1.00 63.65  ? 121 ALA C O     1 
ATOM   3902 C  CB    . ALA C 1 91  ? -49.326 90.441 -8.258  1.00 63.85  ? 121 ALA C CB    1 
ATOM   3903 N  N     . GLU C 1 92  ? -50.559 88.557 -10.548 1.00 63.20  ? 122 GLU C N     1 
ATOM   3904 C  CA    . GLU C 1 92  ? -51.707 87.953 -11.217 1.00 62.89  ? 122 GLU C CA    1 
ATOM   3905 C  C     . GLU C 1 92  ? -51.573 86.445 -11.233 1.00 62.26  ? 122 GLU C C     1 
ATOM   3906 O  O     . GLU C 1 92  ? -52.486 85.734 -10.817 1.00 62.26  ? 122 GLU C O     1 
ATOM   3907 C  CB    . GLU C 1 92  ? -51.826 88.458 -12.656 1.00 62.95  ? 122 GLU C CB    1 
ATOM   3908 C  CG    . GLU C 1 92  ? -53.049 87.915 -13.386 1.00 63.30  ? 122 GLU C CG    1 
ATOM   3909 C  CD    . GLU C 1 92  ? -53.195 88.443 -14.799 1.00 63.48  ? 122 GLU C CD    1 
ATOM   3910 O  OE1   . GLU C 1 92  ? -52.275 89.133 -15.298 1.00 64.14  ? 122 GLU C OE1   1 
ATOM   3911 O  OE2   . GLU C 1 92  ? -54.246 88.158 -15.413 1.00 64.69  ? 122 GLU C OE2   1 
ATOM   3912 N  N     . LEU C 1 93  ? -50.437 85.966 -11.733 1.00 61.60  ? 123 LEU C N     1 
ATOM   3913 C  CA    . LEU C 1 93  ? -50.176 84.535 -11.796 1.00 61.23  ? 123 LEU C CA    1 
ATOM   3914 C  C     . LEU C 1 93  ? -50.374 83.943 -10.426 1.00 60.82  ? 123 LEU C C     1 
ATOM   3915 O  O     . LEU C 1 93  ? -51.147 83.002 -10.272 1.00 60.85  ? 123 LEU C O     1 
ATOM   3916 C  CB    . LEU C 1 93  ? -48.756 84.245 -12.302 1.00 61.39  ? 123 LEU C CB    1 
ATOM   3917 C  CG    . LEU C 1 93  ? -48.311 82.780 -12.473 1.00 61.29  ? 123 LEU C CG    1 
ATOM   3918 C  CD1   . LEU C 1 93  ? -49.339 81.957 -13.208 1.00 61.46  ? 123 LEU C CD1   1 
ATOM   3919 C  CD2   . LEU C 1 93  ? -46.976 82.701 -13.200 1.00 61.04  ? 123 LEU C CD2   1 
ATOM   3920 N  N     . ALA C 1 94  ? -49.694 84.517 -9.434  1.00 60.32  ? 124 ALA C N     1 
ATOM   3921 C  CA    . ALA C 1 94  ? -49.843 84.096 -8.044  1.00 59.91  ? 124 ALA C CA    1 
ATOM   3922 C  C     . ALA C 1 94  ? -51.321 83.996 -7.671  1.00 59.60  ? 124 ALA C C     1 
ATOM   3923 O  O     . ALA C 1 94  ? -51.757 82.997 -7.096  1.00 59.41  ? 124 ALA C O     1 
ATOM   3924 C  CB    . ALA C 1 94  ? -49.117 85.060 -7.115  1.00 59.70  ? 124 ALA C CB    1 
ATOM   3925 N  N     . GLY C 1 95  ? -52.086 85.027 -8.029  1.00 59.46  ? 125 GLY C N     1 
ATOM   3926 C  CA    . GLY C 1 95  ? -53.531 85.054 -7.799  1.00 59.32  ? 125 GLY C CA    1 
ATOM   3927 C  C     . GLY C 1 95  ? -54.224 83.846 -8.397  1.00 59.27  ? 125 GLY C C     1 
ATOM   3928 O  O     . GLY C 1 95  ? -54.905 83.098 -7.683  1.00 59.29  ? 125 GLY C O     1 
ATOM   3929 N  N     . VAL C 1 96  ? -54.034 83.659 -9.707  1.00 59.06  ? 126 VAL C N     1 
ATOM   3930 C  CA    . VAL C 1 96  ? -54.517 82.479 -10.428 1.00 58.77  ? 126 VAL C CA    1 
ATOM   3931 C  C     . VAL C 1 96  ? -54.212 81.198 -9.665  1.00 58.70  ? 126 VAL C C     1 
ATOM   3932 O  O     . VAL C 1 96  ? -55.116 80.429 -9.362  1.00 59.01  ? 126 VAL C O     1 
ATOM   3933 C  CB    . VAL C 1 96  ? -53.892 82.382 -11.858 1.00 58.83  ? 126 VAL C CB    1 
ATOM   3934 C  CG1   . VAL C 1 96  ? -53.885 80.939 -12.370 1.00 58.95  ? 126 VAL C CG1   1 
ATOM   3935 C  CG2   . VAL C 1 96  ? -54.623 83.286 -12.837 1.00 58.10  ? 126 VAL C CG2   1 
ATOM   3936 N  N     . ILE C 1 97  ? -52.941 80.976 -9.342  1.00 58.54  ? 127 ILE C N     1 
ATOM   3937 C  CA    . ILE C 1 97  ? -52.515 79.718 -8.710  1.00 58.29  ? 127 ILE C CA    1 
ATOM   3938 C  C     . ILE C 1 97  ? -53.123 79.544 -7.325  1.00 58.45  ? 127 ILE C C     1 
ATOM   3939 O  O     . ILE C 1 97  ? -53.454 78.423 -6.928  1.00 58.52  ? 127 ILE C O     1 
ATOM   3940 C  CB    . ILE C 1 97  ? -50.983 79.630 -8.568  1.00 58.18  ? 127 ILE C CB    1 
ATOM   3941 C  CG1   . ILE C 1 97  ? -50.321 79.602 -9.936  1.00 57.98  ? 127 ILE C CG1   1 
ATOM   3942 C  CG2   . ILE C 1 97  ? -50.579 78.382 -7.798  1.00 57.21  ? 127 ILE C CG2   1 
ATOM   3943 C  CD1   . ILE C 1 97  ? -48.832 79.647 -9.870  1.00 58.63  ? 127 ILE C CD1   1 
ATOM   3944 N  N     . LYS C 1 98  ? -53.257 80.650 -6.592  1.00 58.41  ? 128 LYS C N     1 
ATOM   3945 C  CA    . LYS C 1 98  ? -53.822 80.609 -5.244  1.00 58.33  ? 128 LYS C CA    1 
ATOM   3946 C  C     . LYS C 1 98  ? -55.299 80.225 -5.280  1.00 58.08  ? 128 LYS C C     1 
ATOM   3947 O  O     . LYS C 1 98  ? -55.768 79.503 -4.406  1.00 58.14  ? 128 LYS C O     1 
ATOM   3948 C  CB    . LYS C 1 98  ? -53.639 81.953 -4.527  1.00 58.31  ? 128 LYS C CB    1 
ATOM   3949 N  N     . ARG C 1 99  ? -56.017 80.703 -6.294  1.00 57.87  ? 129 ARG C N     1 
ATOM   3950 C  CA    . ARG C 1 99  ? -57.457 80.445 -6.425  1.00 57.72  ? 129 ARG C CA    1 
ATOM   3951 C  C     . ARG C 1 99  ? -57.752 79.022 -6.882  1.00 57.97  ? 129 ARG C C     1 
ATOM   3952 O  O     . ARG C 1 99  ? -58.683 78.381 -6.394  1.00 57.82  ? 129 ARG C O     1 
ATOM   3953 C  CB    . ARG C 1 99  ? -58.087 81.430 -7.412  1.00 57.85  ? 129 ARG C CB    1 
ATOM   3954 C  CG    . ARG C 1 99  ? -58.253 82.838 -6.869  1.00 57.19  ? 129 ARG C CG    1 
ATOM   3955 C  CD    . ARG C 1 99  ? -59.116 83.700 -7.794  1.00 56.73  ? 129 ARG C CD    1 
ATOM   3956 N  NE    . ARG C 1 99  ? -58.400 84.135 -8.992  1.00 55.72  ? 129 ARG C NE    1 
ATOM   3957 C  CZ    . ARG C 1 99  ? -57.443 85.061 -9.011  1.00 55.18  ? 129 ARG C CZ    1 
ATOM   3958 N  NH1   . ARG C 1 99  ? -56.852 85.375 -10.162 1.00 55.03  ? 129 ARG C NH1   1 
ATOM   3959 N  NH2   . ARG C 1 99  ? -57.069 85.679 -7.896  1.00 55.11  ? 129 ARG C NH2   1 
ATOM   3960 N  N     . LEU C 1 100 ? -56.958 78.551 -7.839  1.00 58.42  ? 130 LEU C N     1 
ATOM   3961 C  CA    . LEU C 1 100 ? -57.026 77.165 -8.313  1.00 58.66  ? 130 LEU C CA    1 
ATOM   3962 C  C     . LEU C 1 100 ? -56.691 76.153 -7.216  1.00 59.11  ? 130 LEU C C     1 
ATOM   3963 O  O     . LEU C 1 100 ? -57.330 75.111 -7.107  1.00 59.51  ? 130 LEU C O     1 
ATOM   3964 C  CB    . LEU C 1 100 ? -56.081 76.952 -9.506  1.00 58.43  ? 130 LEU C CB    1 
ATOM   3965 C  CG    . LEU C 1 100 ? -56.538 77.405 -10.906 1.00 57.54  ? 130 LEU C CG    1 
ATOM   3966 C  CD1   . LEU C 1 100 ? -55.417 77.196 -11.891 1.00 55.95  ? 130 LEU C CD1   1 
ATOM   3967 C  CD2   . LEU C 1 100 ? -57.770 76.667 -11.384 1.00 56.19  ? 130 LEU C CD2   1 
ATOM   3968 N  N     . TRP C 1 101 ? -55.686 76.452 -6.408  1.00 59.51  ? 131 TRP C N     1 
ATOM   3969 C  CA    . TRP C 1 101 ? -55.239 75.516 -5.382  1.00 59.75  ? 131 TRP C CA    1 
ATOM   3970 C  C     . TRP C 1 101 ? -56.273 75.390 -4.257  1.00 60.35  ? 131 TRP C C     1 
ATOM   3971 O  O     . TRP C 1 101 ? -56.390 74.343 -3.625  1.00 60.55  ? 131 TRP C O     1 
ATOM   3972 C  CB    . TRP C 1 101 ? -53.877 75.960 -4.851  1.00 59.56  ? 131 TRP C CB    1 
ATOM   3973 C  CG    . TRP C 1 101 ? -53.394 75.182 -3.698  1.00 58.93  ? 131 TRP C CG    1 
ATOM   3974 C  CD1   . TRP C 1 101 ? -53.191 75.641 -2.446  1.00 58.67  ? 131 TRP C CD1   1 
ATOM   3975 C  CD2   . TRP C 1 101 ? -53.068 73.795 -3.681  1.00 58.92  ? 131 TRP C CD2   1 
ATOM   3976 N  NE1   . TRP C 1 101 ? -52.751 74.632 -1.636  1.00 58.86  ? 131 TRP C NE1   1 
ATOM   3977 C  CE2   . TRP C 1 101 ? -52.664 73.481 -2.371  1.00 59.01  ? 131 TRP C CE2   1 
ATOM   3978 C  CE3   . TRP C 1 101 ? -53.068 72.785 -4.650  1.00 58.77  ? 131 TRP C CE3   1 
ATOM   3979 C  CZ2   . TRP C 1 101 ? -52.262 72.202 -1.999  1.00 58.87  ? 131 TRP C CZ2   1 
ATOM   3980 C  CZ3   . TRP C 1 101 ? -52.667 71.516 -4.285  1.00 59.00  ? 131 TRP C CZ3   1 
ATOM   3981 C  CH2   . TRP C 1 101 ? -52.267 71.234 -2.968  1.00 59.30  ? 131 TRP C CH2   1 
ATOM   3982 N  N     . LYS C 1 102 ? -57.027 76.459 -4.018  1.00 60.96  ? 132 LYS C N     1 
ATOM   3983 C  CA    . LYS C 1 102 ? -58.112 76.433 -3.037  1.00 61.20  ? 132 LYS C CA    1 
ATOM   3984 C  C     . LYS C 1 102 ? -59.334 75.657 -3.532  1.00 61.28  ? 132 LYS C C     1 
ATOM   3985 O  O     . LYS C 1 102 ? -60.130 75.193 -2.723  1.00 61.55  ? 132 LYS C O     1 
ATOM   3986 C  CB    . LYS C 1 102 ? -58.533 77.859 -2.652  1.00 61.10  ? 132 LYS C CB    1 
ATOM   3987 N  N     . ASP C 1 103 ? -59.491 75.514 -4.844  1.00 61.41  ? 133 ASP C N     1 
ATOM   3988 C  CA    . ASP C 1 103 ? -60.698 74.891 -5.383  1.00 61.67  ? 133 ASP C CA    1 
ATOM   3989 C  C     . ASP C 1 103 ? -60.811 73.428 -4.982  1.00 61.80  ? 133 ASP C C     1 
ATOM   3990 O  O     . ASP C 1 103 ? -59.836 72.686 -5.055  1.00 61.74  ? 133 ASP C O     1 
ATOM   3991 C  CB    . ASP C 1 103 ? -60.764 74.993 -6.907  1.00 61.76  ? 133 ASP C CB    1 
ATOM   3992 C  CG    . ASP C 1 103 ? -62.142 74.638 -7.447  1.00 61.88  ? 133 ASP C CG    1 
ATOM   3993 O  OD1   . ASP C 1 103 ? -63.098 75.399 -7.172  1.00 61.88  ? 133 ASP C OD1   1 
ATOM   3994 O  OD2   . ASP C 1 103 ? -62.276 73.599 -8.128  1.00 61.59  ? 133 ASP C OD2   1 
ATOM   3995 N  N     . SER C 1 104 ? -62.020 73.032 -4.583  1.00 61.97  ? 134 SER C N     1 
ATOM   3996 C  CA    . SER C 1 104 ? -62.285 71.699 -4.046  1.00 62.22  ? 134 SER C CA    1 
ATOM   3997 C  C     . SER C 1 104 ? -62.035 70.609 -5.071  1.00 62.34  ? 134 SER C C     1 
ATOM   3998 O  O     . SER C 1 104 ? -61.513 69.551 -4.737  1.00 62.44  ? 134 SER C O     1 
ATOM   3999 C  CB    . SER C 1 104 ? -63.729 71.609 -3.580  1.00 62.26  ? 134 SER C CB    1 
ATOM   4000 O  OG    . SER C 1 104 ? -64.604 71.808 -4.673  1.00 63.17  ? 134 SER C OG    1 
ATOM   4001 N  N     . GLY C 1 105 ? -62.431 70.871 -6.315  1.00 62.57  ? 135 GLY C N     1 
ATOM   4002 C  CA    . GLY C 1 105 ? -62.170 69.957 -7.428  1.00 62.62  ? 135 GLY C CA    1 
ATOM   4003 C  C     . GLY C 1 105 ? -60.696 69.821 -7.780  1.00 62.58  ? 135 GLY C C     1 
ATOM   4004 O  O     . GLY C 1 105 ? -60.269 68.788 -8.283  1.00 62.84  ? 135 GLY C O     1 
ATOM   4005 N  N     . VAL C 1 106 ? -59.913 70.864 -7.537  1.00 62.49  ? 136 VAL C N     1 
ATOM   4006 C  CA    . VAL C 1 106 ? -58.469 70.782 -7.731  1.00 62.39  ? 136 VAL C CA    1 
ATOM   4007 C  C     . VAL C 1 106 ? -57.852 70.033 -6.565  1.00 62.58  ? 136 VAL C C     1 
ATOM   4008 O  O     . VAL C 1 106 ? -56.812 69.389 -6.722  1.00 62.86  ? 136 VAL C O     1 
ATOM   4009 C  CB    . VAL C 1 106 ? -57.835 72.161 -7.855  1.00 62.28  ? 136 VAL C CB    1 
ATOM   4010 C  CG1   . VAL C 1 106 ? -56.336 72.053 -7.911  1.00 61.95  ? 136 VAL C CG1   1 
ATOM   4011 C  CG2   . VAL C 1 106 ? -58.373 72.870 -9.095  1.00 62.49  ? 136 VAL C CG2   1 
ATOM   4012 N  N     . GLN C 1 107 ? -58.501 70.102 -5.401  1.00 62.57  ? 137 GLN C N     1 
ATOM   4013 C  CA    . GLN C 1 107 ? -58.081 69.317 -4.243  1.00 62.48  ? 137 GLN C CA    1 
ATOM   4014 C  C     . GLN C 1 107 ? -58.441 67.848 -4.408  1.00 62.63  ? 137 GLN C C     1 
ATOM   4015 O  O     . GLN C 1 107 ? -57.727 66.979 -3.918  1.00 62.91  ? 137 GLN C O     1 
ATOM   4016 C  CB    . GLN C 1 107 ? -58.686 69.874 -2.947  1.00 62.48  ? 137 GLN C CB    1 
ATOM   4017 C  CG    . GLN C 1 107 ? -58.014 71.164 -2.454  1.00 62.03  ? 137 GLN C CG    1 
ATOM   4018 C  CD    . GLN C 1 107 ? -56.538 70.968 -2.148  1.00 60.81  ? 137 GLN C CD    1 
ATOM   4019 O  OE1   . GLN C 1 107 ? -56.166 70.071 -1.399  1.00 60.19  ? 137 GLN C OE1   1 
ATOM   4020 N  NE2   . GLN C 1 107 ? -55.694 71.794 -2.742  1.00 59.60  ? 137 GLN C NE2   1 
ATOM   4021 N  N     . ALA C 1 108 ? -59.543 67.569 -5.098  1.00 62.87  ? 138 ALA C N     1 
ATOM   4022 C  CA    . ALA C 1 108 ? -59.921 66.191 -5.396  1.00 63.12  ? 138 ALA C CA    1 
ATOM   4023 C  C     . ALA C 1 108 ? -58.843 65.554 -6.268  1.00 63.51  ? 138 ALA C C     1 
ATOM   4024 O  O     . ALA C 1 108 ? -58.305 64.490 -5.947  1.00 63.56  ? 138 ALA C O     1 
ATOM   4025 C  CB    . ALA C 1 108 ? -61.260 66.146 -6.093  1.00 62.98  ? 138 ALA C CB    1 
ATOM   4026 N  N     . CYS C 1 109 ? -58.510 66.237 -7.355  1.00 63.88  ? 139 CYS C N     1 
ATOM   4027 C  CA    . CYS C 1 109 ? -57.474 65.774 -8.263  1.00 64.19  ? 139 CYS C CA    1 
ATOM   4028 C  C     . CYS C 1 109 ? -56.127 65.649 -7.565  1.00 64.57  ? 139 CYS C C     1 
ATOM   4029 O  O     . CYS C 1 109 ? -55.387 64.704 -7.818  1.00 65.02  ? 139 CYS C O     1 
ATOM   4030 C  CB    . CYS C 1 109 ? -57.357 66.709 -9.462  1.00 64.25  ? 139 CYS C CB    1 
ATOM   4031 S  SG    . CYS C 1 109 ? -56.438 66.013 -10.835 1.00 63.74  ? 139 CYS C SG    1 
ATOM   4032 N  N     . PHE C 1 110 ? -55.797 66.588 -6.688  1.00 64.98  ? 140 PHE C N     1 
ATOM   4033 C  CA    . PHE C 1 110 ? -54.537 66.487 -5.944  1.00 65.39  ? 140 PHE C CA    1 
ATOM   4034 C  C     . PHE C 1 110 ? -54.498 65.164 -5.179  1.00 65.28  ? 140 PHE C C     1 
ATOM   4035 O  O     . PHE C 1 110 ? -53.517 64.427 -5.238  1.00 65.09  ? 140 PHE C O     1 
ATOM   4036 C  CB    . PHE C 1 110 ? -54.373 67.668 -4.983  1.00 65.78  ? 140 PHE C CB    1 
ATOM   4037 C  CG    . PHE C 1 110 ? -53.113 67.611 -4.156  1.00 66.68  ? 140 PHE C CG    1 
ATOM   4038 C  CD1   . PHE C 1 110 ? -51.873 67.872 -4.732  1.00 67.28  ? 140 PHE C CD1   1 
ATOM   4039 C  CD2   . PHE C 1 110 ? -53.166 67.299 -2.793  1.00 67.17  ? 140 PHE C CD2   1 
ATOM   4040 C  CE1   . PHE C 1 110 ? -50.698 67.822 -3.962  1.00 67.39  ? 140 PHE C CE1   1 
ATOM   4041 C  CE2   . PHE C 1 110 ? -52.004 67.254 -2.022  1.00 66.76  ? 140 PHE C CE2   1 
ATOM   4042 C  CZ    . PHE C 1 110 ? -50.769 67.514 -2.607  1.00 66.73  ? 140 PHE C CZ    1 
ATOM   4043 N  N     . ASN C 1 111 ? -55.592 64.860 -4.485  1.00 65.22  ? 141 ASN C N     1 
ATOM   4044 C  CA    . ASN C 1 111 ? -55.701 63.625 -3.727  1.00 65.10  ? 141 ASN C CA    1 
ATOM   4045 C  C     . ASN C 1 111 ? -55.511 62.380 -4.577  1.00 65.05  ? 141 ASN C C     1 
ATOM   4046 O  O     . ASN C 1 111 ? -55.150 61.338 -4.046  1.00 65.49  ? 141 ASN C O     1 
ATOM   4047 C  CB    . ASN C 1 111 ? -57.061 63.536 -3.027  1.00 65.18  ? 141 ASN C CB    1 
ATOM   4048 C  CG    . ASN C 1 111 ? -57.186 64.477 -1.843  1.00 65.05  ? 141 ASN C CG    1 
ATOM   4049 O  OD1   . ASN C 1 111 ? -56.249 65.193 -1.487  1.00 65.43  ? 141 ASN C OD1   1 
ATOM   4050 N  ND2   . ASN C 1 111 ? -58.358 64.475 -1.223  1.00 65.07  ? 141 ASN C ND2   1 
ATOM   4051 N  N     . ARG C 1 112 ? -55.761 62.474 -5.882  1.00 64.79  ? 142 ARG C N     1 
ATOM   4052 C  CA    . ARG C 1 112 ? -55.647 61.318 -6.770  1.00 64.56  ? 142 ARG C CA    1 
ATOM   4053 C  C     . ARG C 1 112 ? -54.353 61.296 -7.584  1.00 64.74  ? 142 ARG C C     1 
ATOM   4054 O  O     . ARG C 1 112 ? -54.250 60.567 -8.575  1.00 64.65  ? 142 ARG C O     1 
ATOM   4055 C  CB    . ARG C 1 112 ? -56.865 61.245 -7.691  1.00 64.50  ? 142 ARG C CB    1 
ATOM   4056 C  CG    . ARG C 1 112 ? -58.136 60.833 -6.967  1.00 63.82  ? 142 ARG C CG    1 
ATOM   4057 C  CD    . ARG C 1 112 ? -59.321 60.865 -7.875  1.00 63.12  ? 142 ARG C CD    1 
ATOM   4058 N  NE    . ARG C 1 112 ? -59.172 59.938 -8.990  1.00 63.03  ? 142 ARG C NE    1 
ATOM   4059 C  CZ    . ARG C 1 112 ? -60.001 59.883 -10.032 1.00 62.74  ? 142 ARG C CZ    1 
ATOM   4060 N  NH1   . ARG C 1 112 ? -61.066 60.681 -10.112 1.00 61.87  ? 142 ARG C NH1   1 
ATOM   4061 N  NH2   . ARG C 1 112 ? -59.765 59.015 -11.004 1.00 62.84  ? 142 ARG C NH2   1 
ATOM   4062 N  N     . SER C 1 113 ? -53.345 62.033 -7.115  1.00 65.03  ? 143 SER C N     1 
ATOM   4063 C  CA    . SER C 1 113 ? -52.117 62.272 -7.880  1.00 65.13  ? 143 SER C CA    1 
ATOM   4064 C  C     . SER C 1 113 ? -51.341 61.034 -8.257  1.00 65.51  ? 143 SER C C     1 
ATOM   4065 O  O     . SER C 1 113 ? -50.524 61.089 -9.176  1.00 65.96  ? 143 SER C O     1 
ATOM   4066 C  CB    . SER C 1 113 ? -51.176 63.228 -7.146  1.00 65.01  ? 143 SER C CB    1 
ATOM   4067 O  OG    . SER C 1 113 ? -50.718 62.658 -5.947  1.00 64.30  ? 143 SER C OG    1 
ATOM   4068 N  N     . ARG C 1 114 ? -51.578 59.922 -7.575  1.00 65.75  ? 144 ARG C N     1 
ATOM   4069 C  CA    . ARG C 1 114 ? -50.886 58.687 -7.930  1.00 66.22  ? 144 ARG C CA    1 
ATOM   4070 C  C     . ARG C 1 114 ? -51.174 58.266 -9.372  1.00 66.05  ? 144 ARG C C     1 
ATOM   4071 O  O     . ARG C 1 114 ? -50.395 57.511 -9.964  1.00 66.29  ? 144 ARG C O     1 
ATOM   4072 C  CB    . ARG C 1 114 ? -51.246 57.548 -6.968  1.00 66.62  ? 144 ARG C CB    1 
ATOM   4073 C  CG    . ARG C 1 114 ? -52.615 56.928 -7.210  1.00 67.64  ? 144 ARG C CG    1 
ATOM   4074 C  CD    . ARG C 1 114 ? -52.758 55.609 -6.517  1.00 68.75  ? 144 ARG C CD    1 
ATOM   4075 N  NE    . ARG C 1 114 ? -53.937 54.902 -7.006  1.00 70.07  ? 144 ARG C NE    1 
ATOM   4076 C  CZ    . ARG C 1 114 ? -53.969 54.071 -8.050  1.00 70.10  ? 144 ARG C CZ    1 
ATOM   4077 N  NH1   . ARG C 1 114 ? -55.120 53.499 -8.379  1.00 71.06  ? 144 ARG C NH1   1 
ATOM   4078 N  NH2   . ARG C 1 114 ? -52.881 53.800 -8.766  1.00 69.57  ? 144 ARG C NH2   1 
ATOM   4079 N  N     . GLU C 1 115 ? -52.280 58.766 -9.925  1.00 65.74  ? 145 GLU C N     1 
ATOM   4080 C  CA    . GLU C 1 115 ? -52.713 58.427 -11.277 1.00 65.67  ? 145 GLU C CA    1 
ATOM   4081 C  C     . GLU C 1 115 ? -52.038 59.245 -12.380 1.00 65.36  ? 145 GLU C C     1 
ATOM   4082 O  O     . GLU C 1 115 ? -52.294 59.017 -13.561 1.00 65.35  ? 145 GLU C O     1 
ATOM   4083 C  CB    . GLU C 1 115 ? -54.226 58.598 -11.381 1.00 65.75  ? 145 GLU C CB    1 
ATOM   4084 C  CG    . GLU C 1 115 ? -54.992 57.725 -10.411 1.00 66.82  ? 145 GLU C CG    1 
ATOM   4085 C  CD    . GLU C 1 115 ? -56.485 57.955 -10.475 1.00 68.59  ? 145 GLU C CD    1 
ATOM   4086 O  OE1   . GLU C 1 115 ? -57.016 58.095 -11.597 1.00 69.23  ? 145 GLU C OE1   1 
ATOM   4087 O  OE2   . GLU C 1 115 ? -57.131 57.991 -9.402  1.00 69.91  ? 145 GLU C OE2   1 
ATOM   4088 N  N     . TYR C 1 116 ? -51.203 60.208 -11.999 1.00 65.12  ? 146 TYR C N     1 
ATOM   4089 C  CA    . TYR C 1 116 ? -50.482 61.054 -12.963 1.00 65.09  ? 146 TYR C CA    1 
ATOM   4090 C  C     . TYR C 1 116 ? -49.141 61.419 -12.340 1.00 64.85  ? 146 TYR C C     1 
ATOM   4091 O  O     . TYR C 1 116 ? -48.770 60.814 -11.354 1.00 65.40  ? 146 TYR C O     1 
ATOM   4092 C  CB    . TYR C 1 116 ? -51.320 62.290 -13.386 1.00 64.91  ? 146 TYR C CB    1 
ATOM   4093 C  CG    . TYR C 1 116 ? -51.830 63.173 -12.265 1.00 64.59  ? 146 TYR C CG    1 
ATOM   4094 C  CD1   . TYR C 1 116 ? -53.080 62.954 -11.688 1.00 64.85  ? 146 TYR C CD1   1 
ATOM   4095 C  CD2   . TYR C 1 116 ? -51.077 64.249 -11.799 1.00 65.22  ? 146 TYR C CD2   1 
ATOM   4096 C  CE1   . TYR C 1 116 ? -53.565 63.774 -10.661 1.00 64.42  ? 146 TYR C CE1   1 
ATOM   4097 C  CE2   . TYR C 1 116 ? -51.547 65.074 -10.768 1.00 64.77  ? 146 TYR C CE2   1 
ATOM   4098 C  CZ    . TYR C 1 116 ? -52.793 64.831 -10.206 1.00 64.87  ? 146 TYR C CZ    1 
ATOM   4099 O  OH    . TYR C 1 116 ? -53.258 65.641 -9.187  1.00 64.82  ? 146 TYR C OH    1 
ATOM   4100 N  N     . GLN C 1 117 ? -48.391 62.358 -12.902 1.00 64.76  ? 147 GLN C N     1 
ATOM   4101 C  CA    . GLN C 1 117 ? -47.069 62.661 -12.349 1.00 65.02  ? 147 GLN C CA    1 
ATOM   4102 C  C     . GLN C 1 117 ? -47.065 64.065 -11.770 1.00 65.26  ? 147 GLN C C     1 
ATOM   4103 O  O     . GLN C 1 117 ? -47.121 65.038 -12.518 1.00 65.73  ? 147 GLN C O     1 
ATOM   4104 C  CB    . GLN C 1 117 ? -45.955 62.501 -13.400 1.00 64.82  ? 147 GLN C CB    1 
ATOM   4105 C  CG    . GLN C 1 117 ? -45.908 61.114 -14.105 1.00 64.93  ? 147 GLN C CG    1 
ATOM   4106 C  CD    . GLN C 1 117 ? -45.404 59.971 -13.216 1.00 64.82  ? 147 GLN C CD    1 
ATOM   4107 O  OE1   . GLN C 1 117 ? -44.741 60.186 -12.200 1.00 66.57  ? 147 GLN C OE1   1 
ATOM   4108 N  NE2   . GLN C 1 117 ? -45.709 58.750 -13.614 1.00 63.62  ? 147 GLN C NE2   1 
ATOM   4109 N  N     . LEU C 1 118 ? -46.997 64.157 -10.439 1.00 65.38  ? 148 LEU C N     1 
ATOM   4110 C  CA    . LEU C 1 118 ? -46.978 65.433 -9.732  1.00 65.43  ? 148 LEU C CA    1 
ATOM   4111 C  C     . LEU C 1 118 ? -45.768 65.503 -8.831  1.00 65.72  ? 148 LEU C C     1 
ATOM   4112 O  O     . LEU C 1 118 ? -45.525 64.575 -8.074  1.00 65.55  ? 148 LEU C O     1 
ATOM   4113 C  CB    . LEU C 1 118 ? -48.227 65.559 -8.873  1.00 65.64  ? 148 LEU C CB    1 
ATOM   4114 C  CG    . LEU C 1 118 ? -48.451 66.855 -8.107  1.00 65.41  ? 148 LEU C CG    1 
ATOM   4115 C  CD1   . LEU C 1 118 ? -48.623 68.013 -9.082  1.00 64.58  ? 148 LEU C CD1   1 
ATOM   4116 C  CD2   . LEU C 1 118 ? -49.671 66.694 -7.208  1.00 65.05  ? 148 LEU C CD2   1 
ATOM   4117 N  N     . ASN C 1 119 ? -45.039 66.621 -8.893  1.00 66.26  ? 149 ASN C N     1 
ATOM   4118 C  CA    . ASN C 1 119 ? -43.842 66.845 -8.067  1.00 66.63  ? 149 ASN C CA    1 
ATOM   4119 C  C     . ASN C 1 119 ? -44.074 66.571 -6.596  1.00 66.82  ? 149 ASN C C     1 
ATOM   4120 O  O     . ASN C 1 119 ? -45.111 66.942 -6.044  1.00 66.73  ? 149 ASN C O     1 
ATOM   4121 C  CB    . ASN C 1 119 ? -43.354 68.292 -8.183  1.00 66.78  ? 149 ASN C CB    1 
ATOM   4122 C  CG    . ASN C 1 119 ? -42.722 68.583 -9.506  1.00 67.89  ? 149 ASN C CG    1 
ATOM   4123 O  OD1   . ASN C 1 119 ? -41.980 67.761 -10.050 1.00 70.26  ? 149 ASN C OD1   1 
ATOM   4124 N  ND2   . ASN C 1 119 ? -43.016 69.754 -10.050 1.00 69.26  ? 149 ASN C ND2   1 
ATOM   4125 N  N     . ASP C 1 120 ? -43.078 65.962 -5.960  1.00 66.93  ? 150 ASP C N     1 
ATOM   4126 C  CA    . ASP C 1 120 ? -43.139 65.664 -4.536  1.00 67.24  ? 150 ASP C CA    1 
ATOM   4127 C  C     . ASP C 1 120 ? -43.413 66.913 -3.687  1.00 66.39  ? 150 ASP C C     1 
ATOM   4128 O  O     . ASP C 1 120 ? -44.077 66.833 -2.663  1.00 66.03  ? 150 ASP C O     1 
ATOM   4129 C  CB    . ASP C 1 120 ? -41.823 65.032 -4.102  1.00 67.84  ? 150 ASP C CB    1 
ATOM   4130 C  CG    . ASP C 1 120 ? -41.516 63.750 -4.862  1.00 71.21  ? 150 ASP C CG    1 
ATOM   4131 O  OD1   . ASP C 1 120 ? -41.983 62.689 -4.358  1.00 73.69  ? 150 ASP C OD1   1 
ATOM   4132 O  OD2   . ASP C 1 120 ? -40.824 63.809 -5.947  1.00 73.49  ? 150 ASP C OD2   1 
ATOM   4133 N  N     . SER C 1 121 ? -42.905 68.061 -4.128  1.00 65.80  ? 151 SER C N     1 
ATOM   4134 C  CA    . SER C 1 121 ? -42.964 69.294 -3.341  1.00 65.35  ? 151 SER C CA    1 
ATOM   4135 C  C     . SER C 1 121 ? -44.150 70.205 -3.689  1.00 64.76  ? 151 SER C C     1 
ATOM   4136 O  O     . SER C 1 121 ? -44.170 71.365 -3.280  1.00 64.76  ? 151 SER C O     1 
ATOM   4137 C  CB    . SER C 1 121 ? -41.649 70.071 -3.501  1.00 65.21  ? 151 SER C CB    1 
ATOM   4138 O  OG    . SER C 1 121 ? -40.539 69.273 -3.128  1.00 65.61  ? 151 SER C OG    1 
ATOM   4139 N  N     . ALA C 1 122 ? -45.134 69.680 -4.418  1.00 64.16  ? 152 ALA C N     1 
ATOM   4140 C  CA    . ALA C 1 122 ? -46.310 70.454 -4.827  1.00 63.69  ? 152 ALA C CA    1 
ATOM   4141 C  C     . ALA C 1 122 ? -47.012 71.117 -3.641  1.00 63.37  ? 152 ALA C C     1 
ATOM   4142 O  O     . ALA C 1 122 ? -47.113 72.333 -3.575  1.00 62.98  ? 152 ALA C O     1 
ATOM   4143 C  CB    . ALA C 1 122 ? -47.278 69.572 -5.567  1.00 63.47  ? 152 ALA C CB    1 
ATOM   4144 N  N     . ALA C 1 123 ? -47.486 70.314 -2.698  1.00 63.30  ? 153 ALA C N     1 
ATOM   4145 C  CA    . ALA C 1 123 ? -48.189 70.850 -1.524  1.00 63.27  ? 153 ALA C CA    1 
ATOM   4146 C  C     . ALA C 1 123 ? -47.316 71.816 -0.712  1.00 62.97  ? 153 ALA C C     1 
ATOM   4147 O  O     . ALA C 1 123 ? -47.785 72.853 -0.252  1.00 63.16  ? 153 ALA C O     1 
ATOM   4148 C  CB    . ALA C 1 123 ? -48.704 69.712 -0.636  1.00 63.13  ? 153 ALA C CB    1 
ATOM   4149 N  N     . TYR C 1 124 ? -46.045 71.481 -0.553  1.00 62.86  ? 154 TYR C N     1 
ATOM   4150 C  CA    . TYR C 1 124 ? -45.118 72.336 0.170   1.00 62.56  ? 154 TYR C CA    1 
ATOM   4151 C  C     . TYR C 1 124 ? -45.091 73.762 -0.384  1.00 62.60  ? 154 TYR C C     1 
ATOM   4152 O  O     . TYR C 1 124 ? -45.242 74.716 0.372   1.00 62.93  ? 154 TYR C O     1 
ATOM   4153 C  CB    . TYR C 1 124 ? -43.716 71.746 0.136   1.00 62.46  ? 154 TYR C CB    1 
ATOM   4154 C  CG    . TYR C 1 124 ? -42.691 72.645 0.766   1.00 62.29  ? 154 TYR C CG    1 
ATOM   4155 C  CD1   . TYR C 1 124 ? -42.554 72.704 2.141   1.00 61.38  ? 154 TYR C CD1   1 
ATOM   4156 C  CD2   . TYR C 1 124 ? -41.871 73.448 -0.013  1.00 62.08  ? 154 TYR C CD2   1 
ATOM   4157 C  CE1   . TYR C 1 124 ? -41.638 73.530 2.726   1.00 61.42  ? 154 TYR C CE1   1 
ATOM   4158 C  CE2   . TYR C 1 124 ? -40.940 74.275 0.567   1.00 62.01  ? 154 TYR C CE2   1 
ATOM   4159 C  CZ    . TYR C 1 124 ? -40.827 74.310 1.941   1.00 61.92  ? 154 TYR C CZ    1 
ATOM   4160 O  OH    . TYR C 1 124 ? -39.903 75.135 2.543   1.00 62.52  ? 154 TYR C OH    1 
ATOM   4161 N  N     . TYR C 1 125 ? -44.896 73.913 -1.691  1.00 62.41  ? 155 TYR C N     1 
ATOM   4162 C  CA    . TYR C 1 125 ? -44.876 75.251 -2.300  1.00 62.11  ? 155 TYR C CA    1 
ATOM   4163 C  C     . TYR C 1 125 ? -46.263 75.892 -2.402  1.00 62.16  ? 155 TYR C C     1 
ATOM   4164 O  O     . TYR C 1 125 ? -46.424 77.065 -2.049  1.00 62.54  ? 155 TYR C O     1 
ATOM   4165 C  CB    . TYR C 1 125 ? -44.229 75.223 -3.686  1.00 61.88  ? 155 TYR C CB    1 
ATOM   4166 C  CG    . TYR C 1 125 ? -42.773 74.822 -3.683  1.00 61.26  ? 155 TYR C CG    1 
ATOM   4167 C  CD1   . TYR C 1 125 ? -41.865 75.434 -2.832  1.00 60.60  ? 155 TYR C CD1   1 
ATOM   4168 C  CD2   . TYR C 1 125 ? -42.304 73.844 -4.548  1.00 60.42  ? 155 TYR C CD2   1 
ATOM   4169 C  CE1   . TYR C 1 125 ? -40.540 75.069 -2.829  1.00 61.08  ? 155 TYR C CE1   1 
ATOM   4170 C  CE2   . TYR C 1 125 ? -40.982 73.475 -4.559  1.00 60.49  ? 155 TYR C CE2   1 
ATOM   4171 C  CZ    . TYR C 1 125 ? -40.104 74.089 -3.697  1.00 61.34  ? 155 TYR C CZ    1 
ATOM   4172 O  OH    . TYR C 1 125 ? -38.785 73.724 -3.707  1.00 61.39  ? 155 TYR C OH    1 
ATOM   4173 N  N     . LEU C 1 126 ? -47.252 75.141 -2.883  1.00 61.94  ? 156 LEU C N     1 
ATOM   4174 C  CA    . LEU C 1 126 ? -48.600 75.676 -3.052  1.00 61.89  ? 156 LEU C CA    1 
ATOM   4175 C  C     . LEU C 1 126 ? -49.216 76.098 -1.731  1.00 62.34  ? 156 LEU C C     1 
ATOM   4176 O  O     . LEU C 1 126 ? -49.888 77.134 -1.662  1.00 62.36  ? 156 LEU C O     1 
ATOM   4177 C  CB    . LEU C 1 126 ? -49.512 74.683 -3.766  1.00 61.80  ? 156 LEU C CB    1 
ATOM   4178 C  CG    . LEU C 1 126 ? -49.269 74.635 -5.279  1.00 61.65  ? 156 LEU C CG    1 
ATOM   4179 C  CD1   . LEU C 1 126 ? -49.918 73.422 -5.899  1.00 60.83  ? 156 LEU C CD1   1 
ATOM   4180 C  CD2   . LEU C 1 126 ? -49.757 75.910 -5.950  1.00 60.46  ? 156 LEU C CD2   1 
ATOM   4181 N  N     . ASN C 1 127 ? -48.970 75.325 -0.678  1.00 62.77  ? 157 ASN C N     1 
ATOM   4182 C  CA    . ASN C 1 127 ? -49.430 75.718 0.664   1.00 63.24  ? 157 ASN C CA    1 
ATOM   4183 C  C     . ASN C 1 127 ? -48.667 76.916 1.259   1.00 63.56  ? 157 ASN C C     1 
ATOM   4184 O  O     . ASN C 1 127 ? -48.991 77.353 2.358   1.00 63.58  ? 157 ASN C O     1 
ATOM   4185 C  CB    . ASN C 1 127 ? -49.374 74.524 1.646   1.00 63.31  ? 157 ASN C CB    1 
ATOM   4186 C  CG    . ASN C 1 127 ? -50.449 73.471 1.367   1.00 62.69  ? 157 ASN C CG    1 
ATOM   4187 O  OD1   . ASN C 1 127 ? -51.535 73.781 0.861   1.00 61.78  ? 157 ASN C OD1   1 
ATOM   4188 N  ND2   . ASN C 1 127 ? -50.153 72.227 1.715   1.00 60.33  ? 157 ASN C ND2   1 
ATOM   4189 N  N     . ASP C 1 128 ? -47.655 77.422 0.548   1.00 64.02  ? 158 ASP C N     1 
ATOM   4190 C  CA    . ASP C 1 128 ? -46.862 78.578 1.000   1.00 64.53  ? 158 ASP C CA    1 
ATOM   4191 C  C     . ASP C 1 128 ? -46.710 79.637 -0.084  1.00 64.76  ? 158 ASP C C     1 
ATOM   4192 O  O     . ASP C 1 128 ? -45.788 80.467 -0.034  1.00 64.74  ? 158 ASP C O     1 
ATOM   4193 C  CB    . ASP C 1 128 ? -45.472 78.131 1.476   1.00 64.53  ? 158 ASP C CB    1 
ATOM   4194 C  CG    . ASP C 1 128 ? -45.335 78.155 2.984   1.00 65.58  ? 158 ASP C CG    1 
ATOM   4195 O  OD1   . ASP C 1 128 ? -45.772 79.153 3.615   1.00 66.34  ? 158 ASP C OD1   1 
ATOM   4196 O  OD2   . ASP C 1 128 ? -44.771 77.180 3.534   1.00 67.16  ? 158 ASP C OD2   1 
ATOM   4197 N  N     . LEU C 1 129 ? -47.635 79.630 -1.042  1.00 64.97  ? 159 LEU C N     1 
ATOM   4198 C  CA    . LEU C 1 129 ? -47.564 80.539 -2.180  1.00 65.09  ? 159 LEU C CA    1 
ATOM   4199 C  C     . LEU C 1 129 ? -47.550 82.004 -1.763  1.00 65.02  ? 159 LEU C C     1 
ATOM   4200 O  O     . LEU C 1 129 ? -46.919 82.819 -2.431  1.00 65.23  ? 159 LEU C O     1 
ATOM   4201 C  CB    . LEU C 1 129 ? -48.716 80.282 -3.161  1.00 65.20  ? 159 LEU C CB    1 
ATOM   4202 C  CG    . LEU C 1 129 ? -48.635 81.021 -4.506  1.00 65.45  ? 159 LEU C CG    1 
ATOM   4203 C  CD1   . LEU C 1 129 ? -47.246 80.911 -5.120  1.00 65.04  ? 159 LEU C CD1   1 
ATOM   4204 C  CD2   . LEU C 1 129 ? -49.690 80.499 -5.475  1.00 65.16  ? 159 LEU C CD2   1 
ATOM   4205 N  N     . ASP C 1 130 ? -48.233 82.341 -0.671  1.00 64.94  ? 160 ASP C N     1 
ATOM   4206 C  CA    . ASP C 1 130 ? -48.228 83.724 -0.175  1.00 64.95  ? 160 ASP C CA    1 
ATOM   4207 C  C     . ASP C 1 130 ? -46.828 84.204 0.212   1.00 64.83  ? 160 ASP C C     1 
ATOM   4208 O  O     . ASP C 1 130 ? -46.455 85.335 -0.068  1.00 64.61  ? 160 ASP C O     1 
ATOM   4209 C  CB    . ASP C 1 130 ? -49.190 83.888 1.004   1.00 65.08  ? 160 ASP C CB    1 
ATOM   4210 C  CG    . ASP C 1 130 ? -50.582 84.289 0.560   1.00 65.29  ? 160 ASP C CG    1 
ATOM   4211 O  OD1   . ASP C 1 130 ? -51.132 85.250 1.134   1.00 65.36  ? 160 ASP C OD1   1 
ATOM   4212 O  OD2   . ASP C 1 130 ? -51.114 83.664 -0.382  1.00 65.63  ? 160 ASP C OD2   1 
ATOM   4213 N  N     . ARG C 1 131 ? -46.059 83.329 0.845   1.00 64.99  ? 161 ARG C N     1 
ATOM   4214 C  CA    . ARG C 1 131 ? -44.669 83.620 1.185   1.00 65.01  ? 161 ARG C CA    1 
ATOM   4215 C  C     . ARG C 1 131 ? -43.782 83.738 -0.064  1.00 65.07  ? 161 ARG C C     1 
ATOM   4216 O  O     . ARG C 1 131 ? -42.935 84.632 -0.147  1.00 64.94  ? 161 ARG C O     1 
ATOM   4217 C  CB    . ARG C 1 131 ? -44.131 82.529 2.113   1.00 65.07  ? 161 ARG C CB    1 
ATOM   4218 C  CG    . ARG C 1 131 ? -42.757 82.828 2.704   1.00 65.20  ? 161 ARG C CG    1 
ATOM   4219 C  CD    . ARG C 1 131 ? -42.409 81.853 3.817   1.00 64.67  ? 161 ARG C CD    1 
ATOM   4220 N  NE    . ARG C 1 131 ? -42.509 80.473 3.359   1.00 64.72  ? 161 ARG C NE    1 
ATOM   4221 C  CZ    . ARG C 1 131 ? -41.593 79.850 2.617   1.00 64.66  ? 161 ARG C CZ    1 
ATOM   4222 N  NH1   . ARG C 1 131 ? -40.479 80.469 2.237   1.00 64.46  ? 161 ARG C NH1   1 
ATOM   4223 N  NH2   . ARG C 1 131 ? -41.796 78.589 2.252   1.00 64.54  ? 161 ARG C NH2   1 
ATOM   4224 N  N     . ILE C 1 132 ? -43.988 82.841 -1.031  1.00 65.06  ? 162 ILE C N     1 
ATOM   4225 C  CA    . ILE C 1 132 ? -43.176 82.821 -2.248  1.00 65.12  ? 162 ILE C CA    1 
ATOM   4226 C  C     . ILE C 1 132 ? -43.587 83.915 -3.252  1.00 65.06  ? 162 ILE C C     1 
ATOM   4227 O  O     . ILE C 1 132 ? -42.782 84.332 -4.091  1.00 65.00  ? 162 ILE C O     1 
ATOM   4228 C  CB    . ILE C 1 132 ? -43.258 81.451 -2.976  1.00 65.41  ? 162 ILE C CB    1 
ATOM   4229 C  CG1   . ILE C 1 132 ? -43.103 80.253 -2.021  1.00 65.47  ? 162 ILE C CG1   1 
ATOM   4230 C  CG2   . ILE C 1 132 ? -42.194 81.369 -4.062  1.00 66.18  ? 162 ILE C CG2   1 
ATOM   4231 C  CD1   . ILE C 1 132 ? -41.927 80.335 -1.096  1.00 65.95  ? 162 ILE C CD1   1 
ATOM   4232 N  N     . ALA C 1 133 ? -44.839 84.371 -3.169  1.00 65.07  ? 163 ALA C N     1 
ATOM   4233 C  CA    . ALA C 1 133 ? -45.390 85.374 -4.106  1.00 64.97  ? 163 ALA C CA    1 
ATOM   4234 C  C     . ALA C 1 133 ? -44.903 86.804 -3.867  1.00 64.84  ? 163 ALA C C     1 
ATOM   4235 O  O     . ALA C 1 133 ? -45.017 87.649 -4.752  1.00 64.48  ? 163 ALA C O     1 
ATOM   4236 C  CB    . ALA C 1 133 ? -46.912 85.352 -4.058  1.00 64.99  ? 163 ALA C CB    1 
ATOM   4237 N  N     . GLN C 1 134 ? -44.382 87.070 -2.670  1.00 65.05  ? 164 GLN C N     1 
ATOM   4238 C  CA    . GLN C 1 134 ? -43.934 88.409 -2.292  1.00 65.08  ? 164 GLN C CA    1 
ATOM   4239 C  C     . GLN C 1 134 ? -42.769 88.864 -3.164  1.00 64.97  ? 164 GLN C C     1 
ATOM   4240 O  O     . GLN C 1 134 ? -41.875 88.084 -3.455  1.00 64.86  ? 164 GLN C O     1 
ATOM   4241 C  CB    . GLN C 1 134 ? -43.509 88.442 -0.815  1.00 65.31  ? 164 GLN C CB    1 
ATOM   4242 C  CG    . GLN C 1 134 ? -44.633 88.202 0.205   1.00 65.89  ? 164 GLN C CG    1 
ATOM   4243 C  CD    . GLN C 1 134 ? -45.662 89.326 0.234   1.00 67.31  ? 164 GLN C CD    1 
ATOM   4244 O  OE1   . GLN C 1 134 ? -46.305 89.626 -0.778  1.00 68.77  ? 164 GLN C OE1   1 
ATOM   4245 N  NE2   . GLN C 1 134 ? -45.827 89.951 1.397   1.00 67.29  ? 164 GLN C NE2   1 
ATOM   4246 N  N     . PRO C 1 135 ? -42.765 90.143 -3.570  1.00 65.15  ? 165 PRO C N     1 
ATOM   4247 C  CA    . PRO C 1 135 ? -41.744 90.622 -4.509  1.00 65.12  ? 165 PRO C CA    1 
ATOM   4248 C  C     . PRO C 1 135 ? -40.300 90.397 -4.041  1.00 64.91  ? 165 PRO C C     1 
ATOM   4249 O  O     . PRO C 1 135 ? -39.499 89.840 -4.791  1.00 65.08  ? 165 PRO C O     1 
ATOM   4250 C  CB    . PRO C 1 135 ? -42.050 92.122 -4.634  1.00 65.09  ? 165 PRO C CB    1 
ATOM   4251 C  CG    . PRO C 1 135 ? -42.930 92.451 -3.482  1.00 65.01  ? 165 PRO C CG    1 
ATOM   4252 C  CD    . PRO C 1 135 ? -43.695 91.217 -3.177  1.00 65.15  ? 165 PRO C CD    1 
ATOM   4253 N  N     . ASN C 1 136 ? -39.983 90.820 -2.821  1.00 64.47  ? 166 ASN C N     1 
ATOM   4254 C  CA    . ASN C 1 136 ? -38.630 90.693 -2.293  1.00 64.34  ? 166 ASN C CA    1 
ATOM   4255 C  C     . ASN C 1 136 ? -38.503 89.436 -1.437  1.00 64.20  ? 166 ASN C C     1 
ATOM   4256 O  O     . ASN C 1 136 ? -38.379 89.516 -0.218  1.00 64.40  ? 166 ASN C O     1 
ATOM   4257 C  CB    . ASN C 1 136 ? -38.260 91.942 -1.481  1.00 64.52  ? 166 ASN C CB    1 
ATOM   4258 N  N     . TYR C 1 137 ? -38.522 88.274 -2.085  1.00 63.92  ? 167 TYR C N     1 
ATOM   4259 C  CA    . TYR C 1 137 ? -38.616 86.994 -1.386  1.00 63.57  ? 167 TYR C CA    1 
ATOM   4260 C  C     . TYR C 1 137 ? -37.348 86.159 -1.542  1.00 63.23  ? 167 TYR C C     1 
ATOM   4261 O  O     . TYR C 1 137 ? -36.926 85.851 -2.659  1.00 63.16  ? 167 TYR C O     1 
ATOM   4262 C  CB    . TYR C 1 137 ? -39.828 86.202 -1.892  1.00 63.72  ? 167 TYR C CB    1 
ATOM   4263 C  CG    . TYR C 1 137 ? -39.589 84.714 -1.940  1.00 63.92  ? 167 TYR C CG    1 
ATOM   4264 C  CD1   . TYR C 1 137 ? -39.481 83.969 -0.774  1.00 64.04  ? 167 TYR C CD1   1 
ATOM   4265 C  CD2   . TYR C 1 137 ? -39.442 84.057 -3.156  1.00 64.44  ? 167 TYR C CD2   1 
ATOM   4266 C  CE1   . TYR C 1 137 ? -39.244 82.611 -0.818  1.00 64.14  ? 167 TYR C CE1   1 
ATOM   4267 C  CE2   . TYR C 1 137 ? -39.208 82.697 -3.211  1.00 63.97  ? 167 TYR C CE2   1 
ATOM   4268 C  CZ    . TYR C 1 137 ? -39.109 81.981 -2.041  1.00 64.15  ? 167 TYR C CZ    1 
ATOM   4269 O  OH    . TYR C 1 137 ? -38.872 80.630 -2.096  1.00 64.54  ? 167 TYR C OH    1 
ATOM   4270 N  N     . ILE C 1 138 ? -36.770 85.758 -0.414  1.00 62.80  ? 168 ILE C N     1 
ATOM   4271 C  CA    . ILE C 1 138 ? -35.531 84.994 -0.420  1.00 62.45  ? 168 ILE C CA    1 
ATOM   4272 C  C     . ILE C 1 138 ? -35.779 83.548 0.027   1.00 62.34  ? 168 ILE C C     1 
ATOM   4273 O  O     . ILE C 1 138 ? -36.119 83.305 1.187   1.00 62.39  ? 168 ILE C O     1 
ATOM   4274 C  CB    . ILE C 1 138 ? -34.460 85.643 0.468   1.00 62.31  ? 168 ILE C CB    1 
ATOM   4275 C  CG1   . ILE C 1 138 ? -34.307 87.130 0.105   1.00 62.46  ? 168 ILE C CG1   1 
ATOM   4276 C  CG2   . ILE C 1 138 ? -33.143 84.914 0.299   1.00 61.92  ? 168 ILE C CG2   1 
ATOM   4277 C  CD1   . ILE C 1 138 ? -33.173 87.848 0.824   1.00 62.27  ? 168 ILE C CD1   1 
ATOM   4278 N  N     . PRO C 1 139 ? -35.619 82.585 -0.903  1.00 61.97  ? 169 PRO C N     1 
ATOM   4279 C  CA    . PRO C 1 139 ? -35.733 81.162 -0.611  1.00 61.80  ? 169 PRO C CA    1 
ATOM   4280 C  C     . PRO C 1 139 ? -34.962 80.728 0.629   1.00 61.51  ? 169 PRO C C     1 
ATOM   4281 O  O     . PRO C 1 139 ? -33.866 81.229 0.868   1.00 61.63  ? 169 PRO C O     1 
ATOM   4282 C  CB    . PRO C 1 139 ? -35.119 80.521 -1.856  1.00 61.90  ? 169 PRO C CB    1 
ATOM   4283 C  CG    . PRO C 1 139 ? -35.486 81.449 -2.940  1.00 61.76  ? 169 PRO C CG    1 
ATOM   4284 C  CD    . PRO C 1 139 ? -35.331 82.810 -2.333  1.00 61.93  ? 169 PRO C CD    1 
ATOM   4285 N  N     . THR C 1 140 ? -35.553 79.819 1.406   1.00 61.16  ? 170 THR C N     1 
ATOM   4286 C  CA    . THR C 1 140 ? -34.928 79.269 2.609   1.00 60.88  ? 170 THR C CA    1 
ATOM   4287 C  C     . THR C 1 140 ? -34.207 77.974 2.294   1.00 60.96  ? 170 THR C C     1 
ATOM   4288 O  O     . THR C 1 140 ? -34.556 77.274 1.355   1.00 61.20  ? 170 THR C O     1 
ATOM   4289 C  CB    . THR C 1 140 ? -35.963 78.952 3.713   1.00 60.71  ? 170 THR C CB    1 
ATOM   4290 O  OG1   . THR C 1 140 ? -36.851 77.919 3.269   1.00 60.14  ? 170 THR C OG1   1 
ATOM   4291 C  CG2   . THR C 1 140 ? -36.758 80.176 4.070   1.00 60.19  ? 170 THR C CG2   1 
ATOM   4292 N  N     . GLN C 1 141 ? -33.225 77.631 3.118   1.00 61.11  ? 171 GLN C N     1 
ATOM   4293 C  CA    . GLN C 1 141 ? -32.487 76.379 2.947   1.00 61.03  ? 171 GLN C CA    1 
ATOM   4294 C  C     . GLN C 1 141 ? -33.430 75.200 2.676   1.00 60.99  ? 171 GLN C C     1 
ATOM   4295 O  O     . GLN C 1 141 ? -33.122 74.329 1.867   1.00 61.32  ? 171 GLN C O     1 
ATOM   4296 C  CB    . GLN C 1 141 ? -31.622 76.102 4.177   1.00 61.06  ? 171 GLN C CB    1 
ATOM   4297 C  CG    . GLN C 1 141 ? -30.455 75.151 3.920   1.00 61.04  ? 171 GLN C CG    1 
ATOM   4298 C  CD    . GLN C 1 141 ? -29.229 75.499 4.753   1.00 60.06  ? 171 GLN C CD    1 
ATOM   4299 O  OE1   . GLN C 1 141 ? -28.583 76.525 4.532   1.00 59.47  ? 171 GLN C OE1   1 
ATOM   4300 N  NE2   . GLN C 1 141 ? -28.906 74.644 5.712   1.00 59.69  ? 171 GLN C NE2   1 
ATOM   4301 N  N     . GLN C 1 142 ? -34.585 75.184 3.335   1.00 60.80  ? 172 GLN C N     1 
ATOM   4302 C  CA    . GLN C 1 142 ? -35.572 74.129 3.128   1.00 60.54  ? 172 GLN C CA    1 
ATOM   4303 C  C     . GLN C 1 142 ? -36.197 74.237 1.736   1.00 60.55  ? 172 GLN C C     1 
ATOM   4304 O  O     . GLN C 1 142 ? -36.365 73.229 1.051   1.00 60.80  ? 172 GLN C O     1 
ATOM   4305 C  CB    . GLN C 1 142 ? -36.637 74.175 4.235   1.00 60.48  ? 172 GLN C CB    1 
ATOM   4306 C  CG    . GLN C 1 142 ? -37.724 73.083 4.190   1.00 60.37  ? 172 GLN C CG    1 
ATOM   4307 C  CD    . GLN C 1 142 ? -37.185 71.655 4.284   1.00 60.48  ? 172 GLN C CD    1 
ATOM   4308 O  OE1   . GLN C 1 142 ? -37.827 70.720 3.820   1.00 59.55  ? 172 GLN C OE1   1 
ATOM   4309 N  NE2   . GLN C 1 142 ? -36.006 71.488 4.882   1.00 61.02  ? 172 GLN C NE2   1 
ATOM   4310 N  N     . ASP C 1 143 ? -36.518 75.455 1.309   1.00 60.53  ? 173 ASP C N     1 
ATOM   4311 C  CA    . ASP C 1 143 ? -37.083 75.676 -0.020  1.00 60.55  ? 173 ASP C CA    1 
ATOM   4312 C  C     . ASP C 1 143 ? -36.152 75.189 -1.107  1.00 60.50  ? 173 ASP C C     1 
ATOM   4313 O  O     . ASP C 1 143 ? -36.599 74.685 -2.132  1.00 60.56  ? 173 ASP C O     1 
ATOM   4314 C  CB    . ASP C 1 143 ? -37.347 77.157 -0.265  1.00 60.66  ? 173 ASP C CB    1 
ATOM   4315 C  CG    . ASP C 1 143 ? -38.411 77.714 0.637   1.00 61.90  ? 173 ASP C CG    1 
ATOM   4316 O  OD1   . ASP C 1 143 ? -39.263 76.919 1.082   1.00 62.69  ? 173 ASP C OD1   1 
ATOM   4317 O  OD2   . ASP C 1 143 ? -38.390 78.945 0.898   1.00 63.02  ? 173 ASP C OD2   1 
ATOM   4318 N  N     . VAL C 1 144 ? -34.855 75.365 -0.889  1.00 60.60  ? 174 VAL C N     1 
ATOM   4319 C  CA    . VAL C 1 144 ? -33.849 74.911 -1.845  1.00 60.62  ? 174 VAL C CA    1 
ATOM   4320 C  C     . VAL C 1 144 ? -33.832 73.384 -1.940  1.00 60.53  ? 174 VAL C C     1 
ATOM   4321 O  O     . VAL C 1 144 ? -33.786 72.835 -3.041  1.00 60.47  ? 174 VAL C O     1 
ATOM   4322 C  CB    . VAL C 1 144 ? -32.446 75.435 -1.471  1.00 60.59  ? 174 VAL C CB    1 
ATOM   4323 C  CG1   . VAL C 1 144 ? -31.365 74.799 -2.360  1.00 60.69  ? 174 VAL C CG1   1 
ATOM   4324 C  CG2   . VAL C 1 144 ? -32.421 76.946 -1.578  1.00 60.50  ? 174 VAL C CG2   1 
ATOM   4325 N  N     . LEU C 1 145 ? -33.872 72.716 -0.785  1.00 60.46  ? 175 LEU C N     1 
ATOM   4326 C  CA    . LEU C 1 145 ? -33.903 71.252 -0.725  1.00 60.37  ? 175 LEU C CA    1 
ATOM   4327 C  C     . LEU C 1 145 ? -35.198 70.662 -1.293  1.00 60.39  ? 175 LEU C C     1 
ATOM   4328 O  O     . LEU C 1 145 ? -35.214 69.525 -1.736  1.00 60.59  ? 175 LEU C O     1 
ATOM   4329 C  CB    . LEU C 1 145 ? -33.723 70.763 0.716   1.00 60.53  ? 175 LEU C CB    1 
ATOM   4330 C  CG    . LEU C 1 145 ? -32.392 71.031 1.426   1.00 59.74  ? 175 LEU C CG    1 
ATOM   4331 C  CD1   . LEU C 1 145 ? -32.597 70.926 2.925   1.00 59.03  ? 175 LEU C CD1   1 
ATOM   4332 C  CD2   . LEU C 1 145 ? -31.302 70.079 0.954   1.00 58.53  ? 175 LEU C CD2   1 
ATOM   4333 N  N     . ARG C 1 146 ? -36.284 71.421 -1.290  1.00 60.38  ? 176 ARG C N     1 
ATOM   4334 C  CA    . ARG C 1 146 ? -37.513 70.938 -1.911  1.00 60.39  ? 176 ARG C CA    1 
ATOM   4335 C  C     . ARG C 1 146 ? -37.485 71.061 -3.441  1.00 60.48  ? 176 ARG C C     1 
ATOM   4336 O  O     . ARG C 1 146 ? -38.391 70.545 -4.119  1.00 60.60  ? 176 ARG C O     1 
ATOM   4337 C  CB    . ARG C 1 146 ? -38.735 71.665 -1.342  1.00 60.32  ? 176 ARG C CB    1 
ATOM   4338 C  CG    . ARG C 1 146 ? -38.993 71.371 0.120   1.00 59.98  ? 176 ARG C CG    1 
ATOM   4339 C  CD    . ARG C 1 146 ? -39.375 69.935 0.362   1.00 59.74  ? 176 ARG C CD    1 
ATOM   4340 N  NE    . ARG C 1 146 ? -39.823 69.747 1.745   1.00 60.24  ? 176 ARG C NE    1 
ATOM   4341 C  CZ    . ARG C 1 146 ? -40.947 69.134 2.122   1.00 60.08  ? 176 ARG C CZ    1 
ATOM   4342 N  NH1   . ARG C 1 146 ? -41.794 68.607 1.236   1.00 60.38  ? 176 ARG C NH1   1 
ATOM   4343 N  NH2   . ARG C 1 146 ? -41.223 69.039 3.412   1.00 59.34  ? 176 ARG C NH2   1 
ATOM   4344 N  N     . THR C 1 147 ? -36.463 71.722 -3.993  1.00 60.15  ? 177 THR C N     1 
ATOM   4345 C  CA    . THR C 1 147 ? -36.455 72.000 -5.434  1.00 60.21  ? 177 THR C CA    1 
ATOM   4346 C  C     . THR C 1 147 ? -36.341 70.739 -6.280  1.00 59.97  ? 177 THR C C     1 
ATOM   4347 O  O     . THR C 1 147 ? -35.642 69.801 -5.923  1.00 60.10  ? 177 THR C O     1 
ATOM   4348 C  CB    . THR C 1 147 ? -35.326 72.980 -5.871  1.00 60.19  ? 177 THR C CB    1 
ATOM   4349 O  OG1   . THR C 1 147 ? -34.034 72.432 -5.555  1.00 60.34  ? 177 THR C OG1   1 
ATOM   4350 C  CG2   . THR C 1 147 ? -35.508 74.322 -5.215  1.00 60.08  ? 177 THR C CG2   1 
ATOM   4351 N  N     . ARG C 1 148 ? -37.012 70.746 -7.422  1.00 60.00  ? 178 ARG C N     1 
ATOM   4352 C  CA    . ARG C 1 148 ? -36.954 69.629 -8.351  1.00 60.35  ? 178 ARG C CA    1 
ATOM   4353 C  C     . ARG C 1 148 ? -36.228 70.056 -9.620  1.00 59.86  ? 178 ARG C C     1 
ATOM   4354 O  O     . ARG C 1 148 ? -36.665 70.967 -10.308 1.00 59.78  ? 178 ARG C O     1 
ATOM   4355 C  CB    . ARG C 1 148 ? -38.368 69.106 -8.665  1.00 60.71  ? 178 ARG C CB    1 
ATOM   4356 C  CG    . ARG C 1 148 ? -38.443 68.005 -9.717  1.00 61.74  ? 178 ARG C CG    1 
ATOM   4357 C  CD    . ARG C 1 148 ? -37.453 66.886 -9.453  1.00 62.92  ? 178 ARG C CD    1 
ATOM   4358 N  NE    . ARG C 1 148 ? -37.363 65.943 -10.558 1.00 62.93  ? 178 ARG C NE    1 
ATOM   4359 C  CZ    . ARG C 1 148 ? -36.566 64.883 -10.559 1.00 63.81  ? 178 ARG C CZ    1 
ATOM   4360 N  NH1   . ARG C 1 148 ? -35.793 64.640 -9.507  1.00 63.66  ? 178 ARG C NH1   1 
ATOM   4361 N  NH2   . ARG C 1 148 ? -36.548 64.060 -11.610 1.00 64.28  ? 178 ARG C NH2   1 
ATOM   4362 N  N     . VAL C 1 149 ? -35.104 69.395 -9.890  1.00 59.74  ? 179 VAL C N     1 
ATOM   4363 C  CA    . VAL C 1 149 ? -34.296 69.612 -11.087 1.00 59.64  ? 179 VAL C CA    1 
ATOM   4364 C  C     . VAL C 1 149 ? -33.790 68.255 -11.548 1.00 59.78  ? 179 VAL C C     1 
ATOM   4365 O  O     . VAL C 1 149 ? -32.963 67.619 -10.875 1.00 59.42  ? 179 VAL C O     1 
ATOM   4366 C  CB    . VAL C 1 149 ? -33.084 70.549 -10.822 1.00 59.72  ? 179 VAL C CB    1 
ATOM   4367 C  CG1   . VAL C 1 149 ? -32.172 70.628 -12.055 1.00 58.94  ? 179 VAL C CG1   1 
ATOM   4368 C  CG2   . VAL C 1 149 ? -33.567 71.942 -10.415 1.00 59.22  ? 179 VAL C CG2   1 
ATOM   4369 N  N     . LYS C 1 150 ? -34.300 67.797 -12.686 1.00 59.80  ? 180 LYS C N     1 
ATOM   4370 C  CA    . LYS C 1 150 ? -33.945 66.480 -13.154 1.00 59.86  ? 180 LYS C CA    1 
ATOM   4371 C  C     . LYS C 1 150 ? -32.446 66.450 -13.438 1.00 59.66  ? 180 LYS C C     1 
ATOM   4372 O  O     . LYS C 1 150 ? -31.954 67.219 -14.258 1.00 59.36  ? 180 LYS C O     1 
ATOM   4373 C  CB    . LYS C 1 150 ? -34.758 66.105 -14.389 1.00 60.06  ? 180 LYS C CB    1 
ATOM   4374 C  CG    . LYS C 1 150 ? -34.704 64.625 -14.720 1.00 61.12  ? 180 LYS C CG    1 
ATOM   4375 C  CD    . LYS C 1 150 ? -35.188 64.320 -16.130 1.00 62.67  ? 180 LYS C CD    1 
ATOM   4376 C  CE    . LYS C 1 150 ? -36.712 64.283 -16.237 1.00 63.90  ? 180 LYS C CE    1 
ATOM   4377 N  NZ    . LYS C 1 150 ? -37.111 63.667 -17.539 1.00 64.38  ? 180 LYS C NZ    1 
ATOM   4378 N  N     . THR C 1 151 ? -31.725 65.586 -12.726 1.00 59.90  ? 181 THR C N     1 
ATOM   4379 C  CA    . THR C 1 151 ? -30.309 65.365 -13.007 1.00 60.05  ? 181 THR C CA    1 
ATOM   4380 C  C     . THR C 1 151 ? -30.144 64.539 -14.265 1.00 60.60  ? 181 THR C C     1 
ATOM   4381 O  O     . THR C 1 151 ? -30.861 63.545 -14.469 1.00 60.58  ? 181 THR C O     1 
ATOM   4382 C  CB    . THR C 1 151 ? -29.568 64.616 -11.896 1.00 59.69  ? 181 THR C CB    1 
ATOM   4383 O  OG1   . THR C 1 151 ? -29.928 65.151 -10.619 1.00 59.46  ? 181 THR C OG1   1 
ATOM   4384 C  CG2   . THR C 1 151 ? -28.071 64.748 -12.099 1.00 58.82  ? 181 THR C CG2   1 
ATOM   4385 N  N     . THR C 1 152 ? -29.191 64.950 -15.099 1.00 61.02  ? 182 THR C N     1 
ATOM   4386 C  CA    . THR C 1 152 ? -28.795 64.163 -16.255 1.00 61.35  ? 182 THR C CA    1 
ATOM   4387 C  C     . THR C 1 152 ? -27.269 64.059 -16.324 1.00 61.56  ? 182 THR C C     1 
ATOM   4388 O  O     . THR C 1 152 ? -26.570 65.062 -16.433 1.00 61.47  ? 182 THR C O     1 
ATOM   4389 C  CB    . THR C 1 152 ? -29.401 64.723 -17.571 1.00 61.41  ? 182 THR C CB    1 
ATOM   4390 O  OG1   . THR C 1 152 ? -28.847 64.031 -18.698 1.00 61.82  ? 182 THR C OG1   1 
ATOM   4391 C  CG2   . THR C 1 152 ? -29.154 66.215 -17.718 1.00 61.43  ? 182 THR C CG2   1 
ATOM   4392 N  N     . GLY C 1 153 ? -26.768 62.829 -16.232 1.00 61.95  ? 183 GLY C N     1 
ATOM   4393 C  CA    . GLY C 1 153 ? -25.342 62.552 -16.339 1.00 62.04  ? 183 GLY C CA    1 
ATOM   4394 C  C     . GLY C 1 153 ? -24.732 62.137 -15.017 1.00 62.18  ? 183 GLY C C     1 
ATOM   4395 O  O     . GLY C 1 153 ? -25.379 61.467 -14.211 1.00 62.10  ? 183 GLY C O     1 
ATOM   4396 N  N     . ILE C 1 154 ? -23.474 62.529 -14.813 1.00 62.43  ? 184 ILE C N     1 
ATOM   4397 C  CA    . ILE C 1 154 ? -22.713 62.182 -13.613 1.00 62.70  ? 184 ILE C CA    1 
ATOM   4398 C  C     . ILE C 1 154 ? -21.979 63.416 -13.056 1.00 62.97  ? 184 ILE C C     1 
ATOM   4399 O  O     . ILE C 1 154 ? -20.976 63.875 -13.620 1.00 62.59  ? 184 ILE C O     1 
ATOM   4400 C  CB    . ILE C 1 154 ? -21.674 61.072 -13.898 1.00 62.77  ? 184 ILE C CB    1 
ATOM   4401 C  CG1   . ILE C 1 154 ? -22.359 59.800 -14.412 1.00 62.66  ? 184 ILE C CG1   1 
ATOM   4402 C  CG2   . ILE C 1 154 ? -20.872 60.764 -12.641 1.00 62.66  ? 184 ILE C CG2   1 
ATOM   4403 C  CD1   . ILE C 1 154 ? -21.394 58.750 -14.923 1.00 62.47  ? 184 ILE C CD1   1 
ATOM   4404 N  N     . VAL C 1 155 ? -22.488 63.930 -11.938 1.00 63.34  ? 185 VAL C N     1 
ATOM   4405 C  CA    . VAL C 1 155 ? -21.911 65.095 -11.277 1.00 63.55  ? 185 VAL C CA    1 
ATOM   4406 C  C     . VAL C 1 155 ? -21.072 64.621 -10.101 1.00 63.78  ? 185 VAL C C     1 
ATOM   4407 O  O     . VAL C 1 155 ? -21.548 63.864 -9.251  1.00 63.50  ? 185 VAL C O     1 
ATOM   4408 C  CB    . VAL C 1 155 ? -22.998 66.055 -10.738 1.00 63.84  ? 185 VAL C CB    1 
ATOM   4409 C  CG1   . VAL C 1 155 ? -22.429 67.465 -10.599 1.00 63.84  ? 185 VAL C CG1   1 
ATOM   4410 C  CG2   . VAL C 1 155 ? -24.252 66.055 -11.638 1.00 63.35  ? 185 VAL C CG2   1 
ATOM   4411 N  N     . GLU C 1 156 ? -19.820 65.066 -10.068 1.00 64.25  ? 186 GLU C N     1 
ATOM   4412 C  CA    . GLU C 1 156 ? -18.896 64.716 -9.001  1.00 64.49  ? 186 GLU C CA    1 
ATOM   4413 C  C     . GLU C 1 156 ? -18.699 65.910 -8.077  1.00 64.72  ? 186 GLU C C     1 
ATOM   4414 O  O     . GLU C 1 156 ? -18.243 66.963 -8.517  1.00 64.64  ? 186 GLU C O     1 
ATOM   4415 C  CB    . GLU C 1 156 ? -17.549 64.292 -9.586  1.00 64.69  ? 186 GLU C CB    1 
ATOM   4416 N  N     . THR C 1 157 ? -19.071 65.739 -6.809  1.00 65.00  ? 187 THR C N     1 
ATOM   4417 C  CA    . THR C 1 157 ? -18.747 66.688 -5.744  1.00 65.25  ? 187 THR C CA    1 
ATOM   4418 C  C     . THR C 1 157 ? -17.498 66.195 -5.012  1.00 65.34  ? 187 THR C C     1 
ATOM   4419 O  O     . THR C 1 157 ? -17.187 65.008 -5.038  1.00 65.42  ? 187 THR C O     1 
ATOM   4420 C  CB    . THR C 1 157 ? -19.882 66.786 -4.697  1.00 65.10  ? 187 THR C CB    1 
ATOM   4421 O  OG1   . THR C 1 157 ? -21.142 66.891 -5.354  1.00 65.80  ? 187 THR C OG1   1 
ATOM   4422 C  CG2   . THR C 1 157 ? -19.699 68.002 -3.804  1.00 65.65  ? 187 THR C CG2   1 
ATOM   4423 N  N     . HIS C 1 158 ? -16.788 67.112 -4.366  1.00 65.47  ? 188 HIS C N     1 
ATOM   4424 C  CA    . HIS C 1 158 ? -15.804 66.752 -3.344  1.00 65.67  ? 188 HIS C CA    1 
ATOM   4425 C  C     . HIS C 1 158 ? -16.307 67.229 -1.980  1.00 65.48  ? 188 HIS C C     1 
ATOM   4426 O  O     . HIS C 1 158 ? -17.157 68.123 -1.910  1.00 65.58  ? 188 HIS C O     1 
ATOM   4427 C  CB    . HIS C 1 158 ? -14.449 67.396 -3.636  1.00 65.80  ? 188 HIS C CB    1 
ATOM   4428 C  CG    . HIS C 1 158 ? -13.762 66.848 -4.848  1.00 66.86  ? 188 HIS C CG    1 
ATOM   4429 N  ND1   . HIS C 1 158 ? -14.176 65.695 -5.484  1.00 67.61  ? 188 HIS C ND1   1 
ATOM   4430 C  CD2   . HIS C 1 158 ? -12.665 67.279 -5.520  1.00 67.86  ? 188 HIS C CD2   1 
ATOM   4431 C  CE1   . HIS C 1 158 ? -13.373 65.449 -6.506  1.00 68.27  ? 188 HIS C CE1   1 
ATOM   4432 N  NE2   . HIS C 1 158 ? -12.446 66.394 -6.549  1.00 68.35  ? 188 HIS C NE2   1 
ATOM   4433 N  N     . PHE C 1 159 ? -15.810 66.603 -0.913  1.00 65.06  ? 189 PHE C N     1 
ATOM   4434 C  CA    . PHE C 1 159 ? -15.913 67.146 0.449   1.00 64.79  ? 189 PHE C CA    1 
ATOM   4435 C  C     . PHE C 1 159 ? -15.109 66.291 1.425   1.00 64.66  ? 189 PHE C C     1 
ATOM   4436 O  O     . PHE C 1 159 ? -14.612 65.224 1.060   1.00 64.65  ? 189 PHE C O     1 
ATOM   4437 C  CB    . PHE C 1 159 ? -17.368 67.307 0.926   1.00 64.97  ? 189 PHE C CB    1 
ATOM   4438 C  CG    . PHE C 1 159 ? -18.079 66.015 1.198   1.00 64.97  ? 189 PHE C CG    1 
ATOM   4439 C  CD1   . PHE C 1 159 ? -17.984 65.404 2.445   1.00 65.16  ? 189 PHE C CD1   1 
ATOM   4440 C  CD2   . PHE C 1 159 ? -18.864 65.426 0.225   1.00 65.30  ? 189 PHE C CD2   1 
ATOM   4441 C  CE1   . PHE C 1 159 ? -18.643 64.217 2.712   1.00 65.29  ? 189 PHE C CE1   1 
ATOM   4442 C  CE2   . PHE C 1 159 ? -19.530 64.233 0.482   1.00 66.03  ? 189 PHE C CE2   1 
ATOM   4443 C  CZ    . PHE C 1 159 ? -19.414 63.624 1.734   1.00 65.42  ? 189 PHE C CZ    1 
ATOM   4444 N  N     . THR C 1 160 ? -14.966 66.777 2.656   1.00 64.44  ? 190 THR C N     1 
ATOM   4445 C  CA    . THR C 1 160 ? -14.158 66.100 3.673   1.00 64.34  ? 190 THR C CA    1 
ATOM   4446 C  C     . THR C 1 160 ? -14.932 65.982 4.987   1.00 64.38  ? 190 THR C C     1 
ATOM   4447 O  O     . THR C 1 160 ? -15.633 66.915 5.384   1.00 64.62  ? 190 THR C O     1 
ATOM   4448 C  CB    . THR C 1 160 ? -12.812 66.837 3.928   1.00 64.27  ? 190 THR C CB    1 
ATOM   4449 O  OG1   . THR C 1 160 ? -11.982 66.754 2.762   1.00 63.65  ? 190 THR C OG1   1 
ATOM   4450 C  CG2   . THR C 1 160 ? -12.070 66.226 5.111   1.00 63.87  ? 190 THR C CG2   1 
ATOM   4451 N  N     . PHE C 1 161 ? -14.801 64.834 5.650   1.00 64.13  ? 191 PHE C N     1 
ATOM   4452 C  CA    . PHE C 1 161 ? -15.499 64.589 6.907   1.00 63.89  ? 191 PHE C CA    1 
ATOM   4453 C  C     . PHE C 1 161 ? -14.880 63.425 7.670   1.00 63.81  ? 191 PHE C C     1 
ATOM   4454 O  O     . PHE C 1 161 ? -14.456 62.443 7.067   1.00 63.73  ? 191 PHE C O     1 
ATOM   4455 C  CB    . PHE C 1 161 ? -16.980 64.306 6.645   1.00 63.90  ? 191 PHE C CB    1 
ATOM   4456 C  CG    . PHE C 1 161 ? -17.732 63.859 7.863   1.00 63.70  ? 191 PHE C CG    1 
ATOM   4457 C  CD1   . PHE C 1 161 ? -17.810 64.676 8.984   1.00 63.76  ? 191 PHE C CD1   1 
ATOM   4458 C  CD2   . PHE C 1 161 ? -18.359 62.624 7.898   1.00 64.09  ? 191 PHE C CD2   1 
ATOM   4459 C  CE1   . PHE C 1 161 ? -18.500 64.269 10.126  1.00 63.88  ? 191 PHE C CE1   1 
ATOM   4460 C  CE2   . PHE C 1 161 ? -19.056 62.207 9.038   1.00 64.50  ? 191 PHE C CE2   1 
ATOM   4461 C  CZ    . PHE C 1 161 ? -19.125 63.032 10.153  1.00 63.99  ? 191 PHE C CZ    1 
ATOM   4462 N  N     . LYS C 1 162 ? -14.826 63.559 8.997   1.00 63.73  ? 192 LYS C N     1 
ATOM   4463 C  CA    . LYS C 1 162 ? -14.362 62.502 9.903   1.00 63.67  ? 192 LYS C CA    1 
ATOM   4464 C  C     . LYS C 1 162 ? -12.926 62.063 9.587   1.00 63.73  ? 192 LYS C C     1 
ATOM   4465 O  O     . LYS C 1 162 ? -12.530 60.932 9.868   1.00 63.53  ? 192 LYS C O     1 
ATOM   4466 C  CB    . LYS C 1 162 ? -15.328 61.308 9.864   1.00 63.63  ? 192 LYS C CB    1 
ATOM   4467 C  CG    . LYS C 1 162 ? -15.493 60.585 11.194  1.00 63.43  ? 192 LYS C CG    1 
ATOM   4468 N  N     . ASP C 1 163 ? -12.151 62.994 9.035   1.00 63.85  ? 193 ASP C N     1 
ATOM   4469 C  CA    . ASP C 1 163 ? -10.810 62.733 8.517   1.00 64.00  ? 193 ASP C CA    1 
ATOM   4470 C  C     . ASP C 1 163 ? -10.864 61.812 7.301   1.00 64.04  ? 193 ASP C C     1 
ATOM   4471 O  O     . ASP C 1 163 ? -10.105 60.852 7.206   1.00 64.12  ? 193 ASP C O     1 
ATOM   4472 C  CB    . ASP C 1 163 ? -9.877  62.165 9.601   1.00 64.05  ? 193 ASP C CB    1 
ATOM   4473 C  CG    . ASP C 1 163 ? -9.820  63.036 10.852  1.00 64.10  ? 193 ASP C CG    1 
ATOM   4474 O  OD1   . ASP C 1 163 ? -10.310 64.184 10.818  1.00 64.29  ? 193 ASP C OD1   1 
ATOM   4475 O  OD2   . ASP C 1 163 ? -9.278  62.566 11.874  1.00 64.08  ? 193 ASP C OD2   1 
ATOM   4476 N  N     . LEU C 1 164 ? -11.768 62.117 6.373   1.00 64.16  ? 194 LEU C N     1 
ATOM   4477 C  CA    . LEU C 1 164 ? -11.895 61.366 5.123   1.00 64.33  ? 194 LEU C CA    1 
ATOM   4478 C  C     . LEU C 1 164 ? -12.214 62.312 3.971   1.00 64.47  ? 194 LEU C C     1 
ATOM   4479 O  O     . LEU C 1 164 ? -13.055 63.201 4.117   1.00 64.37  ? 194 LEU C O     1 
ATOM   4480 C  CB    . LEU C 1 164 ? -13.005 60.319 5.224   1.00 64.33  ? 194 LEU C CB    1 
ATOM   4481 C  CG    . LEU C 1 164 ? -12.984 59.379 6.427   1.00 64.33  ? 194 LEU C CG    1 
ATOM   4482 C  CD1   . LEU C 1 164 ? -14.231 58.519 6.410   1.00 64.35  ? 194 LEU C CD1   1 
ATOM   4483 C  CD2   . LEU C 1 164 ? -11.718 58.522 6.432   1.00 64.17  ? 194 LEU C CD2   1 
ATOM   4484 N  N     . HIS C 1 165 ? -11.549 62.105 2.834   1.00 64.58  ? 195 HIS C N     1 
ATOM   4485 C  CA    . HIS C 1 165 ? -11.747 62.933 1.645   1.00 64.65  ? 195 HIS C CA    1 
ATOM   4486 C  C     . HIS C 1 165 ? -12.728 62.261 0.688   1.00 64.58  ? 195 HIS C C     1 
ATOM   4487 O  O     . HIS C 1 165 ? -12.365 61.339 -0.039  1.00 64.46  ? 195 HIS C O     1 
ATOM   4488 C  CB    . HIS C 1 165 ? -10.412 63.187 0.933   1.00 64.65  ? 195 HIS C CB    1 
ATOM   4489 C  CG    . HIS C 1 165 ? -9.435  63.983 1.743   1.00 65.10  ? 195 HIS C CG    1 
ATOM   4490 N  ND1   . HIS C 1 165 ? -9.716  65.246 2.220   1.00 65.60  ? 195 HIS C ND1   1 
ATOM   4491 C  CD2   . HIS C 1 165 ? -8.171  63.701 2.145   1.00 65.29  ? 195 HIS C CD2   1 
ATOM   4492 C  CE1   . HIS C 1 165 ? -8.672  65.703 2.890   1.00 65.45  ? 195 HIS C CE1   1 
ATOM   4493 N  NE2   . HIS C 1 165 ? -7.721  64.786 2.857   1.00 65.23  ? 195 HIS C NE2   1 
ATOM   4494 N  N     . PHE C 1 166 ? -13.967 62.740 0.686   1.00 64.58  ? 196 PHE C N     1 
ATOM   4495 C  CA    . PHE C 1 166 ? -15.031 62.139 -0.121  1.00 64.62  ? 196 PHE C CA    1 
ATOM   4496 C  C     . PHE C 1 166 ? -15.069 62.624 -1.566  1.00 64.70  ? 196 PHE C C     1 
ATOM   4497 O  O     . PHE C 1 166 ? -15.195 63.826 -1.828  1.00 64.73  ? 196 PHE C O     1 
ATOM   4498 C  CB    . PHE C 1 166 ? -16.395 62.404 0.510   1.00 64.51  ? 196 PHE C CB    1 
ATOM   4499 C  CG    . PHE C 1 166 ? -16.653 61.584 1.723   1.00 64.53  ? 196 PHE C CG    1 
ATOM   4500 C  CD1   . PHE C 1 166 ? -16.152 61.975 2.956   1.00 64.40  ? 196 PHE C CD1   1 
ATOM   4501 C  CD2   . PHE C 1 166 ? -17.386 60.414 1.637   1.00 64.19  ? 196 PHE C CD2   1 
ATOM   4502 C  CE1   . PHE C 1 166 ? -16.390 61.218 4.084   1.00 64.37  ? 196 PHE C CE1   1 
ATOM   4503 C  CE2   . PHE C 1 166 ? -17.624 59.651 2.761   1.00 64.31  ? 196 PHE C CE2   1 
ATOM   4504 C  CZ    . PHE C 1 166 ? -17.127 60.052 3.986   1.00 64.51  ? 196 PHE C CZ    1 
ATOM   4505 N  N     . LYS C 1 167 ? -14.966 61.672 -2.492  1.00 64.74  ? 197 LYS C N     1 
ATOM   4506 C  CA    . LYS C 1 167 ? -15.288 61.898 -3.893  1.00 64.66  ? 197 LYS C CA    1 
ATOM   4507 C  C     . LYS C 1 167 ? -16.660 61.276 -4.124  1.00 64.72  ? 197 LYS C C     1 
ATOM   4508 O  O     . LYS C 1 167 ? -16.775 60.077 -4.380  1.00 64.58  ? 197 LYS C O     1 
ATOM   4509 C  CB    . LYS C 1 167 ? -14.224 61.278 -4.808  1.00 64.69  ? 197 LYS C CB    1 
ATOM   4510 C  CG    . LYS C 1 167 ? -12.838 61.914 -4.677  1.00 64.23  ? 197 LYS C CG    1 
ATOM   4511 N  N     . MET C 1 168 ? -17.697 62.105 -3.996  1.00 64.89  ? 198 MET C N     1 
ATOM   4512 C  CA    . MET C 1 168 ? -19.099 61.666 -4.093  1.00 65.12  ? 198 MET C CA    1 
ATOM   4513 C  C     . MET C 1 168 ? -19.637 61.839 -5.510  1.00 64.57  ? 198 MET C C     1 
ATOM   4514 O  O     . MET C 1 168 ? -19.573 62.932 -6.068  1.00 64.70  ? 198 MET C O     1 
ATOM   4515 C  CB    . MET C 1 168 ? -19.964 62.469 -3.117  1.00 65.05  ? 198 MET C CB    1 
ATOM   4516 C  CG    . MET C 1 168 ? -21.449 62.509 -3.478  1.00 66.01  ? 198 MET C CG    1 
ATOM   4517 S  SD    . MET C 1 168 ? -22.482 63.261 -2.201  1.00 66.77  ? 198 MET C SD    1 
ATOM   4518 C  CE    . MET C 1 168 ? -22.334 62.019 -0.903  1.00 67.77  ? 198 MET C CE    1 
ATOM   4519 N  N     . PHE C 1 169 ? -20.194 60.774 -6.079  1.00 64.22  ? 199 PHE C N     1 
ATOM   4520 C  CA    . PHE C 1 169 ? -20.740 60.825 -7.439  1.00 63.74  ? 199 PHE C CA    1 
ATOM   4521 C  C     . PHE C 1 169 ? -22.256 60.735 -7.447  1.00 63.42  ? 199 PHE C C     1 
ATOM   4522 O  O     . PHE C 1 169 ? -22.818 59.779 -6.929  1.00 63.43  ? 199 PHE C O     1 
ATOM   4523 C  CB    . PHE C 1 169 ? -20.143 59.699 -8.275  1.00 63.68  ? 199 PHE C CB    1 
ATOM   4524 C  CG    . PHE C 1 169 ? -18.694 59.899 -8.591  1.00 63.26  ? 199 PHE C CG    1 
ATOM   4525 C  CD1   . PHE C 1 169 ? -18.299 60.343 -9.841  1.00 63.58  ? 199 PHE C CD1   1 
ATOM   4526 C  CD2   . PHE C 1 169 ? -17.726 59.661 -7.634  1.00 63.71  ? 199 PHE C CD2   1 
ATOM   4527 C  CE1   . PHE C 1 169 ? -16.952 60.537 -10.143 1.00 64.28  ? 199 PHE C CE1   1 
ATOM   4528 C  CE2   . PHE C 1 169 ? -16.373 59.852 -7.923  1.00 64.43  ? 199 PHE C CE2   1 
ATOM   4529 C  CZ    . PHE C 1 169 ? -15.986 60.293 -9.182  1.00 63.96  ? 199 PHE C CZ    1 
ATOM   4530 N  N     . ASP C 1 170 ? -22.911 61.735 -8.032  1.00 63.26  ? 200 ASP C N     1 
ATOM   4531 C  CA    . ASP C 1 170 ? -24.370 61.723 -8.201  1.00 63.20  ? 200 ASP C CA    1 
ATOM   4532 C  C     . ASP C 1 170 ? -24.762 61.452 -9.650  1.00 62.88  ? 200 ASP C C     1 
ATOM   4533 O  O     . ASP C 1 170 ? -24.127 61.961 -10.572 1.00 62.93  ? 200 ASP C O     1 
ATOM   4534 C  CB    . ASP C 1 170 ? -24.976 63.058 -7.782  1.00 63.40  ? 200 ASP C CB    1 
ATOM   4535 C  CG    . ASP C 1 170 ? -26.496 63.035 -7.806  1.00 64.41  ? 200 ASP C CG    1 
ATOM   4536 O  OD1   . ASP C 1 170 ? -27.071 61.934 -7.665  1.00 65.95  ? 200 ASP C OD1   1 
ATOM   4537 O  OD2   . ASP C 1 170 ? -27.126 64.103 -7.972  1.00 65.34  ? 200 ASP C OD2   1 
ATOM   4538 N  N     . VAL C 1 171 ? -25.835 60.688 -9.844  1.00 62.66  ? 201 VAL C N     1 
ATOM   4539 C  CA    . VAL C 1 171 ? -26.247 60.245 -11.182 1.00 62.43  ? 201 VAL C CA    1 
ATOM   4540 C  C     . VAL C 1 171 ? -27.745 60.422 -11.484 1.00 62.10  ? 201 VAL C C     1 
ATOM   4541 O  O     . VAL C 1 171 ? -28.559 60.660 -10.597 1.00 61.73  ? 201 VAL C O     1 
ATOM   4542 C  CB    . VAL C 1 171 ? -25.876 58.767 -11.394 1.00 62.40  ? 201 VAL C CB    1 
ATOM   4543 C  CG1   . VAL C 1 171 ? -24.401 58.538 -11.079 1.00 62.50  ? 201 VAL C CG1   1 
ATOM   4544 C  CG2   . VAL C 1 171 ? -26.745 57.880 -10.528 1.00 62.87  ? 201 VAL C CG2   1 
ATOM   4545 N  N     . GLY C 1 172 ? -28.091 60.306 -12.760 1.00 62.03  ? 202 GLY C N     1 
ATOM   4546 C  CA    . GLY C 1 172 ? -29.483 60.341 -13.186 1.00 61.99  ? 202 GLY C CA    1 
ATOM   4547 C  C     . GLY C 1 172 ? -30.094 58.967 -13.026 1.00 61.99  ? 202 GLY C C     1 
ATOM   4548 O  O     . GLY C 1 172 ? -29.472 57.970 -13.370 1.00 62.11  ? 202 GLY C O     1 
ATOM   4549 N  N     . GLY C 1 173 ? -31.314 58.906 -12.502 1.00 61.96  ? 203 GLY C N     1 
ATOM   4550 C  CA    . GLY C 1 173 ? -31.945 57.631 -12.177 1.00 61.69  ? 203 GLY C CA    1 
ATOM   4551 C  C     . GLY C 1 173 ? -32.855 57.072 -13.251 1.00 61.57  ? 203 GLY C C     1 
ATOM   4552 O  O     . GLY C 1 173 ? -33.263 55.912 -13.176 1.00 61.55  ? 203 GLY C O     1 
ATOM   4553 N  N     . GLN C 1 174 ? -33.196 57.882 -14.245 1.00 61.53  ? 204 GLN C N     1 
ATOM   4554 C  CA    . GLN C 1 174 ? -34.159 57.447 -15.257 1.00 61.65  ? 204 GLN C CA    1 
ATOM   4555 C  C     . GLN C 1 174 ? -33.544 56.378 -16.149 1.00 61.76  ? 204 GLN C C     1 
ATOM   4556 O  O     . GLN C 1 174 ? -32.334 56.356 -16.355 1.00 61.80  ? 204 GLN C O     1 
ATOM   4557 C  CB    . GLN C 1 174 ? -34.670 58.623 -16.094 1.00 61.61  ? 204 GLN C CB    1 
ATOM   4558 C  CG    . GLN C 1 174 ? -35.747 59.472 -15.406 1.00 61.73  ? 204 GLN C CG    1 
ATOM   4559 C  CD    . GLN C 1 174 ? -35.185 60.492 -14.420 1.00 61.56  ? 204 GLN C CD    1 
ATOM   4560 O  OE1   . GLN C 1 174 ? -33.991 60.817 -14.443 1.00 61.68  ? 204 GLN C OE1   1 
ATOM   4561 N  NE2   . GLN C 1 174 ? -36.049 61.001 -13.551 1.00 59.69  ? 204 GLN C NE2   1 
ATOM   4562 N  N     . ARG C 1 175 ? -34.388 55.490 -16.668 1.00 61.96  ? 205 ARG C N     1 
ATOM   4563 C  CA    . ARG C 1 175 ? -33.936 54.410 -17.537 1.00 61.89  ? 205 ARG C CA    1 
ATOM   4564 C  C     . ARG C 1 175 ? -32.835 54.879 -18.456 1.00 61.73  ? 205 ARG C C     1 
ATOM   4565 O  O     . ARG C 1 175 ? -31.732 54.340 -18.420 1.00 61.92  ? 205 ARG C O     1 
ATOM   4566 C  CB    . ARG C 1 175 ? -35.096 53.869 -18.362 1.00 62.07  ? 205 ARG C CB    1 
ATOM   4567 C  CG    . ARG C 1 175 ? -36.120 53.130 -17.529 1.00 63.17  ? 205 ARG C CG    1 
ATOM   4568 C  CD    . ARG C 1 175 ? -36.999 52.199 -18.351 1.00 64.23  ? 205 ARG C CD    1 
ATOM   4569 N  NE    . ARG C 1 175 ? -37.831 51.384 -17.462 1.00 64.72  ? 205 ARG C NE    1 
ATOM   4570 C  CZ    . ARG C 1 175 ? -38.801 50.567 -17.868 1.00 65.02  ? 205 ARG C CZ    1 
ATOM   4571 N  NH1   . ARG C 1 175 ? -39.109 50.450 -19.156 1.00 65.03  ? 205 ARG C NH1   1 
ATOM   4572 N  NH2   . ARG C 1 175 ? -39.488 49.876 -16.967 1.00 65.55  ? 205 ARG C NH2   1 
ATOM   4573 N  N     . SER C 1 176 ? -33.132 55.921 -19.234 1.00 61.59  ? 206 SER C N     1 
ATOM   4574 C  CA    . SER C 1 176 ? -32.208 56.475 -20.227 1.00 61.35  ? 206 SER C CA    1 
ATOM   4575 C  C     . SER C 1 176 ? -30.805 56.801 -19.699 1.00 61.29  ? 206 SER C C     1 
ATOM   4576 O  O     . SER C 1 176 ? -29.833 56.784 -20.459 1.00 61.10  ? 206 SER C O     1 
ATOM   4577 C  CB    . SER C 1 176 ? -32.806 57.748 -20.831 1.00 61.45  ? 206 SER C CB    1 
ATOM   4578 O  OG    . SER C 1 176 ? -32.699 58.844 -19.936 1.00 61.03  ? 206 SER C OG    1 
ATOM   4579 N  N     . GLU C 1 177 ? -30.714 57.107 -18.407 1.00 61.16  ? 207 GLU C N     1 
ATOM   4580 C  CA    . GLU C 1 177 ? -29.473 57.558 -17.788 1.00 61.24  ? 207 GLU C CA    1 
ATOM   4581 C  C     . GLU C 1 177 ? -28.551 56.421 -17.355 1.00 61.24  ? 207 GLU C C     1 
ATOM   4582 O  O     . GLU C 1 177 ? -27.338 56.617 -17.202 1.00 61.04  ? 207 GLU C O     1 
ATOM   4583 C  CB    . GLU C 1 177 ? -29.790 58.428 -16.563 1.00 61.20  ? 207 GLU C CB    1 
ATOM   4584 C  CG    . GLU C 1 177 ? -30.639 59.656 -16.853 1.00 61.00  ? 207 GLU C CG    1 
ATOM   4585 C  CD    . GLU C 1 177 ? -29.918 60.707 -17.685 1.00 61.73  ? 207 GLU C CD    1 
ATOM   4586 O  OE1   . GLU C 1 177 ? -30.603 61.623 -18.204 1.00 62.69  ? 207 GLU C OE1   1 
ATOM   4587 O  OE2   . GLU C 1 177 ? -28.672 60.634 -17.809 1.00 61.37  ? 207 GLU C OE2   1 
ATOM   4588 N  N     . ARG C 1 178 ? -29.123 55.237 -17.167 1.00 61.25  ? 208 ARG C N     1 
ATOM   4589 C  CA    . ARG C 1 178 ? -28.420 54.155 -16.481 1.00 61.38  ? 208 ARG C CA    1 
ATOM   4590 C  C     . ARG C 1 178 ? -27.310 53.509 -17.314 1.00 61.51  ? 208 ARG C C     1 
ATOM   4591 O  O     . ARG C 1 178 ? -26.404 52.886 -16.768 1.00 61.30  ? 208 ARG C O     1 
ATOM   4592 C  CB    . ARG C 1 178 ? -29.415 53.108 -15.996 1.00 61.23  ? 208 ARG C CB    1 
ATOM   4593 C  CG    . ARG C 1 178 ? -30.455 53.667 -15.054 1.00 60.93  ? 208 ARG C CG    1 
ATOM   4594 C  CD    . ARG C 1 178 ? -31.421 52.588 -14.629 1.00 61.08  ? 208 ARG C CD    1 
ATOM   4595 N  NE    . ARG C 1 178 ? -32.682 53.148 -14.165 1.00 60.34  ? 208 ARG C NE    1 
ATOM   4596 C  CZ    . ARG C 1 178 ? -33.821 52.466 -14.102 1.00 61.09  ? 208 ARG C CZ    1 
ATOM   4597 N  NH1   . ARG C 1 178 ? -33.866 51.194 -14.448 1.00 61.62  ? 208 ARG C NH1   1 
ATOM   4598 N  NH2   . ARG C 1 178 ? -34.928 53.059 -13.679 1.00 62.35  ? 208 ARG C NH2   1 
ATOM   4599 N  N     . LYS C 1 179 ? -27.377 53.676 -18.630 1.00 61.86  ? 209 LYS C N     1 
ATOM   4600 C  CA    . LYS C 1 179 ? -26.268 53.299 -19.510 1.00 62.25  ? 209 LYS C CA    1 
ATOM   4601 C  C     . LYS C 1 179 ? -24.942 53.894 -19.013 1.00 62.17  ? 209 LYS C C     1 
ATOM   4602 O  O     . LYS C 1 179 ? -23.880 53.305 -19.206 1.00 62.23  ? 209 LYS C O     1 
ATOM   4603 C  CB    . LYS C 1 179 ? -26.488 53.809 -20.945 1.00 62.43  ? 209 LYS C CB    1 
ATOM   4604 C  CG    . LYS C 1 179 ? -27.908 53.728 -21.508 1.00 62.93  ? 209 LYS C CG    1 
ATOM   4605 C  CD    . LYS C 1 179 ? -27.925 54.093 -23.003 1.00 62.71  ? 209 LYS C CD    1 
ATOM   4606 C  CE    . LYS C 1 179 ? -29.067 55.053 -23.325 1.00 63.92  ? 209 LYS C CE    1 
ATOM   4607 N  NZ    . LYS C 1 179 ? -30.416 54.521 -22.955 1.00 63.61  ? 209 LYS C NZ    1 
ATOM   4608 N  N     . LYS C 1 180 ? -25.014 55.073 -18.398 1.00 62.05  ? 210 LYS C N     1 
ATOM   4609 C  CA    . LYS C 1 180 ? -23.830 55.852 -18.090 1.00 61.95  ? 210 LYS C CA    1 
ATOM   4610 C  C     . LYS C 1 180 ? -23.233 55.544 -16.718 1.00 61.68  ? 210 LYS C C     1 
ATOM   4611 O  O     . LYS C 1 180 ? -22.176 56.067 -16.391 1.00 61.74  ? 210 LYS C O     1 
ATOM   4612 C  CB    . LYS C 1 180 ? -24.147 57.351 -18.158 1.00 62.14  ? 210 LYS C CB    1 
ATOM   4613 C  CG    . LYS C 1 180 ? -24.896 57.843 -19.406 1.00 62.51  ? 210 LYS C CG    1 
ATOM   4614 C  CD    . LYS C 1 180 ? -25.774 59.069 -19.047 1.00 63.05  ? 210 LYS C CD    1 
ATOM   4615 C  CE    . LYS C 1 180 ? -26.570 59.620 -20.235 1.00 62.96  ? 210 LYS C CE    1 
ATOM   4616 N  NZ    . LYS C 1 180 ? -27.106 61.008 -19.992 1.00 62.79  ? 210 LYS C NZ    1 
ATOM   4617 N  N     . TRP C 1 181 ? -23.892 54.721 -15.908 1.00 61.47  ? 211 TRP C N     1 
ATOM   4618 C  CA    . TRP C 1 181 ? -23.404 54.449 -14.543 1.00 61.32  ? 211 TRP C CA    1 
ATOM   4619 C  C     . TRP C 1 181 ? -22.040 53.769 -14.558 1.00 61.60  ? 211 TRP C C     1 
ATOM   4620 O  O     . TRP C 1 181 ? -21.205 53.983 -13.676 1.00 61.43  ? 211 TRP C O     1 
ATOM   4621 C  CB    . TRP C 1 181 ? -24.395 53.573 -13.784 1.00 60.87  ? 211 TRP C CB    1 
ATOM   4622 C  CG    . TRP C 1 181 ? -25.662 54.267 -13.458 1.00 60.24  ? 211 TRP C CG    1 
ATOM   4623 C  CD1   . TRP C 1 181 ? -26.091 55.453 -13.957 1.00 59.80  ? 211 TRP C CD1   1 
ATOM   4624 C  CD2   . TRP C 1 181 ? -26.688 53.805 -12.575 1.00 59.62  ? 211 TRP C CD2   1 
ATOM   4625 N  NE1   . TRP C 1 181 ? -27.310 55.773 -13.430 1.00 60.15  ? 211 TRP C NE1   1 
ATOM   4626 C  CE2   . TRP C 1 181 ? -27.707 54.775 -12.582 1.00 60.64  ? 211 TRP C CE2   1 
ATOM   4627 C  CE3   . TRP C 1 181 ? -26.842 52.671 -11.773 1.00 59.56  ? 211 TRP C CE3   1 
ATOM   4628 C  CZ2   . TRP C 1 181 ? -28.878 54.646 -11.812 1.00 60.67  ? 211 TRP C CZ2   1 
ATOM   4629 C  CZ3   . TRP C 1 181 ? -28.007 52.540 -11.010 1.00 59.91  ? 211 TRP C CZ3   1 
ATOM   4630 C  CH2   . TRP C 1 181 ? -29.006 53.520 -11.037 1.00 60.04  ? 211 TRP C CH2   1 
ATOM   4631 N  N     . ILE C 1 182 ? -21.819 52.964 -15.588 1.00 61.89  ? 212 ILE C N     1 
ATOM   4632 C  CA    . ILE C 1 182 ? -20.585 52.219 -15.742 1.00 62.08  ? 212 ILE C CA    1 
ATOM   4633 C  C     . ILE C 1 182 ? -19.334 53.104 -15.885 1.00 62.23  ? 212 ILE C C     1 
ATOM   4634 O  O     . ILE C 1 182 ? -18.207 52.605 -15.838 1.00 62.36  ? 212 ILE C O     1 
ATOM   4635 C  CB    . ILE C 1 182 ? -20.701 51.257 -16.940 1.00 62.09  ? 212 ILE C CB    1 
ATOM   4636 C  CG1   . ILE C 1 182 ? -19.576 50.212 -16.914 1.00 61.85  ? 212 ILE C CG1   1 
ATOM   4637 C  CG2   . ILE C 1 182 ? -20.774 52.035 -18.265 1.00 62.03  ? 212 ILE C CG2   1 
ATOM   4638 C  CD1   . ILE C 1 182 ? -18.817 50.161 -18.180 1.00 61.82  ? 212 ILE C CD1   1 
ATOM   4639 N  N     . HIS C 1 183 ? -19.522 54.409 -16.040 1.00 62.42  ? 213 HIS C N     1 
ATOM   4640 C  CA    . HIS C 1 183 ? -18.394 55.344 -16.068 1.00 62.68  ? 213 HIS C CA    1 
ATOM   4641 C  C     . HIS C 1 183 ? -17.787 55.667 -14.690 1.00 62.61  ? 213 HIS C C     1 
ATOM   4642 O  O     . HIS C 1 183 ? -16.722 56.278 -14.614 1.00 62.61  ? 213 HIS C O     1 
ATOM   4643 C  CB    . HIS C 1 183 ? -18.796 56.631 -16.786 1.00 62.63  ? 213 HIS C CB    1 
ATOM   4644 C  CG    . HIS C 1 183 ? -19.035 56.440 -18.250 1.00 63.08  ? 213 HIS C CG    1 
ATOM   4645 N  ND1   . HIS C 1 183 ? -18.027 56.100 -19.129 1.00 63.37  ? 213 HIS C ND1   1 
ATOM   4646 C  CD2   . HIS C 1 183 ? -20.167 56.533 -18.989 1.00 63.19  ? 213 HIS C CD2   1 
ATOM   4647 C  CE1   . HIS C 1 183 ? -18.528 55.992 -20.347 1.00 63.95  ? 213 HIS C CE1   1 
ATOM   4648 N  NE2   . HIS C 1 183 ? -19.825 56.252 -20.290 1.00 64.03  ? 213 HIS C NE2   1 
ATOM   4649 N  N     . CYS C 1 184 ? -18.445 55.248 -13.612 1.00 62.54  ? 214 CYS C N     1 
ATOM   4650 C  CA    . CYS C 1 184 ? -17.960 55.532 -12.261 1.00 62.46  ? 214 CYS C CA    1 
ATOM   4651 C  C     . CYS C 1 184 ? -17.937 54.282 -11.380 1.00 62.10  ? 214 CYS C C     1 
ATOM   4652 O  O     . CYS C 1 184 ? -18.214 54.350 -10.185 1.00 62.18  ? 214 CYS C O     1 
ATOM   4653 C  CB    . CYS C 1 184 ? -18.838 56.615 -11.629 1.00 62.52  ? 214 CYS C CB    1 
ATOM   4654 S  SG    . CYS C 1 184 ? -20.588 56.164 -11.458 1.00 63.05  ? 214 CYS C SG    1 
ATOM   4655 N  N     . PHE C 1 185 ? -17.579 53.145 -11.968 1.00 61.66  ? 215 PHE C N     1 
ATOM   4656 C  CA    . PHE C 1 185 ? -17.703 51.856 -11.283 1.00 61.23  ? 215 PHE C CA    1 
ATOM   4657 C  C     . PHE C 1 185 ? -16.382 51.270 -10.801 1.00 61.18  ? 215 PHE C C     1 
ATOM   4658 O  O     . PHE C 1 185 ? -16.396 50.326 -10.016 1.00 61.19  ? 215 PHE C O     1 
ATOM   4659 C  CB    . PHE C 1 185 ? -18.422 50.844 -12.189 1.00 60.71  ? 215 PHE C CB    1 
ATOM   4660 C  CG    . PHE C 1 185 ? -19.920 50.793 -12.003 1.00 60.08  ? 215 PHE C CG    1 
ATOM   4661 C  CD1   . PHE C 1 185 ? -20.622 49.651 -12.356 1.00 59.39  ? 215 PHE C CD1   1 
ATOM   4662 C  CD2   . PHE C 1 185 ? -20.630 51.864 -11.480 1.00 59.49  ? 215 PHE C CD2   1 
ATOM   4663 C  CE1   . PHE C 1 185 ? -22.000 49.582 -12.203 1.00 59.17  ? 215 PHE C CE1   1 
ATOM   4664 C  CE2   . PHE C 1 185 ? -22.014 51.788 -11.320 1.00 59.36  ? 215 PHE C CE2   1 
ATOM   4665 C  CZ    . PHE C 1 185 ? -22.692 50.647 -11.680 1.00 58.87  ? 215 PHE C CZ    1 
ATOM   4666 N  N     . GLU C 1 186 ? -15.252 51.815 -11.249 1.00 61.36  ? 216 GLU C N     1 
ATOM   4667 C  CA    . GLU C 1 186 ? -13.938 51.300 -10.821 1.00 61.46  ? 216 GLU C CA    1 
ATOM   4668 C  C     . GLU C 1 186 ? -13.541 51.906 -9.470  1.00 61.34  ? 216 GLU C C     1 
ATOM   4669 O  O     . GLU C 1 186 ? -13.648 53.118 -9.276  1.00 61.45  ? 216 GLU C O     1 
ATOM   4670 C  CB    . GLU C 1 186 ? -12.844 51.577 -11.864 1.00 61.32  ? 216 GLU C CB    1 
ATOM   4671 C  CG    . GLU C 1 186 ? -11.865 50.408 -12.014 1.00 62.02  ? 216 GLU C CG    1 
ATOM   4672 C  CD    . GLU C 1 186 ? -10.416 50.827 -12.243 1.00 63.48  ? 216 GLU C CD    1 
ATOM   4673 O  OE1   . GLU C 1 186 ? -10.159 51.993 -12.627 1.00 64.04  ? 216 GLU C OE1   1 
ATOM   4674 O  OE2   . GLU C 1 186 ? -9.523  49.971 -12.040 1.00 63.92  ? 216 GLU C OE2   1 
ATOM   4675 N  N     . GLY C 1 187 ? -13.110 51.058 -8.538  1.00 61.13  ? 217 GLY C N     1 
ATOM   4676 C  CA    . GLY C 1 187 ? -12.670 51.506 -7.214  1.00 61.08  ? 217 GLY C CA    1 
ATOM   4677 C  C     . GLY C 1 187 ? -13.724 52.218 -6.374  1.00 61.11  ? 217 GLY C C     1 
ATOM   4678 O  O     . GLY C 1 187 ? -13.421 53.213 -5.699  1.00 61.07  ? 217 GLY C O     1 
ATOM   4679 N  N     . VAL C 1 188 ? -14.963 51.724 -6.415  1.00 60.92  ? 218 VAL C N     1 
ATOM   4680 C  CA    . VAL C 1 188 ? -16.020 52.240 -5.548  1.00 60.73  ? 218 VAL C CA    1 
ATOM   4681 C  C     . VAL C 1 188 ? -15.769 51.724 -4.128  1.00 60.58  ? 218 VAL C C     1 
ATOM   4682 O  O     . VAL C 1 188 ? -15.275 50.617 -3.958  1.00 60.76  ? 218 VAL C O     1 
ATOM   4683 C  CB    . VAL C 1 188 ? -17.436 51.828 -6.041  1.00 60.65  ? 218 VAL C CB    1 
ATOM   4684 C  CG1   . VAL C 1 188 ? -18.508 52.288 -5.065  1.00 60.29  ? 218 VAL C CG1   1 
ATOM   4685 C  CG2   . VAL C 1 188 ? -17.709 52.406 -7.412  1.00 60.65  ? 218 VAL C CG2   1 
ATOM   4686 N  N     . THR C 1 189 ? -16.079 52.548 -3.127  1.00 60.35  ? 219 THR C N     1 
ATOM   4687 C  CA    . THR C 1 189 ? -15.921 52.187 -1.714  1.00 60.12  ? 219 THR C CA    1 
ATOM   4688 C  C     . THR C 1 189 ? -17.270 52.027 -1.020  1.00 59.89  ? 219 THR C C     1 
ATOM   4689 O  O     . THR C 1 189 ? -17.425 51.190 -0.131  1.00 59.36  ? 219 THR C O     1 
ATOM   4690 C  CB    . THR C 1 189 ? -15.116 53.259 -0.953  1.00 60.13  ? 219 THR C CB    1 
ATOM   4691 O  OG1   . THR C 1 189 ? -14.250 53.941 -1.865  1.00 60.23  ? 219 THR C OG1   1 
ATOM   4692 C  CG2   . THR C 1 189 ? -14.296 52.628 0.173   1.00 59.49  ? 219 THR C CG2   1 
ATOM   4693 N  N     . ALA C 1 190 ? -18.231 52.858 -1.410  1.00 59.85  ? 220 ALA C N     1 
ATOM   4694 C  CA    . ALA C 1 190 ? -19.580 52.761 -0.872  1.00 59.90  ? 220 ALA C CA    1 
ATOM   4695 C  C     . ALA C 1 190 ? -20.624 53.211 -1.882  1.00 59.82  ? 220 ALA C C     1 
ATOM   4696 O  O     . ALA C 1 190 ? -20.436 54.191 -2.596  1.00 59.76  ? 220 ALA C O     1 
ATOM   4697 C  CB    . ALA C 1 190 ? -19.701 53.574 0.397   1.00 59.83  ? 220 ALA C CB    1 
ATOM   4698 N  N     . ILE C 1 191 ? -21.714 52.458 -1.934  1.00 59.81  ? 221 ILE C N     1 
ATOM   4699 C  CA    . ILE C 1 191 ? -22.903 52.838 -2.667  1.00 59.94  ? 221 ILE C CA    1 
ATOM   4700 C  C     . ILE C 1 191 ? -23.966 53.254 -1.666  1.00 60.28  ? 221 ILE C C     1 
ATOM   4701 O  O     . ILE C 1 191 ? -24.164 52.588 -0.644  1.00 60.31  ? 221 ILE C O     1 
ATOM   4702 C  CB    . ILE C 1 191 ? -23.451 51.648 -3.496  1.00 59.90  ? 221 ILE C CB    1 
ATOM   4703 C  CG1   . ILE C 1 191 ? -22.491 51.331 -4.651  1.00 59.25  ? 221 ILE C CG1   1 
ATOM   4704 C  CG2   . ILE C 1 191 ? -24.870 51.942 -4.016  1.00 59.65  ? 221 ILE C CG2   1 
ATOM   4705 C  CD1   . ILE C 1 191 ? -22.859 50.111 -5.430  1.00 58.19  ? 221 ILE C CD1   1 
ATOM   4706 N  N     . ILE C 1 192 ? -24.641 54.361 -1.941  1.00 60.46  ? 222 ILE C N     1 
ATOM   4707 C  CA    . ILE C 1 192 ? -25.897 54.647 -1.253  1.00 60.57  ? 222 ILE C CA    1 
ATOM   4708 C  C     . ILE C 1 192 ? -27.005 54.523 -2.266  1.00 60.66  ? 222 ILE C C     1 
ATOM   4709 O  O     . ILE C 1 192 ? -27.159 55.373 -3.133  1.00 60.29  ? 222 ILE C O     1 
ATOM   4710 C  CB    . ILE C 1 192 ? -25.929 56.027 -0.600  1.00 60.49  ? 222 ILE C CB    1 
ATOM   4711 C  CG1   . ILE C 1 192 ? -24.750 56.154 0.370   1.00 60.81  ? 222 ILE C CG1   1 
ATOM   4712 C  CG2   . ILE C 1 192 ? -27.257 56.230 0.113   1.00 59.07  ? 222 ILE C CG2   1 
ATOM   4713 C  CD1   . ILE C 1 192 ? -24.704 57.461 1.135   1.00 61.28  ? 222 ILE C CD1   1 
ATOM   4714 N  N     . PHE C 1 193 ? -27.753 53.435 -2.164  1.00 61.10  ? 223 PHE C N     1 
ATOM   4715 C  CA    . PHE C 1 193 ? -28.904 53.236 -3.014  1.00 61.57  ? 223 PHE C CA    1 
ATOM   4716 C  C     . PHE C 1 193 ? -30.124 53.856 -2.355  1.00 61.79  ? 223 PHE C C     1 
ATOM   4717 O  O     . PHE C 1 193 ? -30.550 53.407 -1.303  1.00 61.24  ? 223 PHE C O     1 
ATOM   4718 C  CB    . PHE C 1 193 ? -29.141 51.753 -3.249  1.00 61.93  ? 223 PHE C CB    1 
ATOM   4719 C  CG    . PHE C 1 193 ? -30.107 51.470 -4.354  1.00 62.20  ? 223 PHE C CG    1 
ATOM   4720 C  CD1   . PHE C 1 193 ? -29.653 51.065 -5.597  1.00 62.56  ? 223 PHE C CD1   1 
ATOM   4721 C  CD2   . PHE C 1 193 ? -31.469 51.624 -4.156  1.00 62.45  ? 223 PHE C CD2   1 
ATOM   4722 C  CE1   . PHE C 1 193 ? -30.533 50.816 -6.616  1.00 62.92  ? 223 PHE C CE1   1 
ATOM   4723 C  CE2   . PHE C 1 193 ? -32.360 51.371 -5.171  1.00 62.77  ? 223 PHE C CE2   1 
ATOM   4724 C  CZ    . PHE C 1 193 ? -31.898 50.966 -6.401  1.00 63.04  ? 223 PHE C CZ    1 
ATOM   4725 N  N     . CYS C 1 194 ? -30.685 54.883 -2.988  1.00 62.50  ? 224 CYS C N     1 
ATOM   4726 C  CA    . CYS C 1 194 ? -31.906 55.535 -2.492  1.00 63.14  ? 224 CYS C CA    1 
ATOM   4727 C  C     . CYS C 1 194 ? -33.186 54.865 -2.974  1.00 63.00  ? 224 CYS C C     1 
ATOM   4728 O  O     . CYS C 1 194 ? -33.258 54.374 -4.096  1.00 63.01  ? 224 CYS C O     1 
ATOM   4729 C  CB    . CYS C 1 194 ? -31.921 56.994 -2.923  1.00 63.22  ? 224 CYS C CB    1 
ATOM   4730 S  SG    . CYS C 1 194 ? -30.438 57.856 -2.397  1.00 64.72  ? 224 CYS C SG    1 
ATOM   4731 N  N     . VAL C 1 195 ? -34.198 54.841 -2.119  1.00 63.18  ? 225 VAL C N     1 
ATOM   4732 C  CA    . VAL C 1 195 ? -35.509 54.366 -2.536  1.00 63.53  ? 225 VAL C CA    1 
ATOM   4733 C  C     . VAL C 1 195 ? -36.591 55.287 -2.018  1.00 63.79  ? 225 VAL C C     1 
ATOM   4734 O  O     . VAL C 1 195 ? -36.482 55.819 -0.933  1.00 63.95  ? 225 VAL C O     1 
ATOM   4735 C  CB    . VAL C 1 195 ? -35.767 52.941 -2.062  1.00 63.57  ? 225 VAL C CB    1 
ATOM   4736 C  CG1   . VAL C 1 195 ? -37.239 52.577 -2.246  1.00 64.29  ? 225 VAL C CG1   1 
ATOM   4737 C  CG2   . VAL C 1 195 ? -34.894 51.984 -2.828  1.00 63.03  ? 225 VAL C CG2   1 
ATOM   4738 N  N     . ALA C 1 196 ? -37.633 55.482 -2.813  1.00 64.37  ? 226 ALA C N     1 
ATOM   4739 C  CA    . ALA C 1 196 ? -38.733 56.348 -2.429  1.00 64.64  ? 226 ALA C CA    1 
ATOM   4740 C  C     . ALA C 1 196 ? -39.847 55.499 -1.862  1.00 64.94  ? 226 ALA C C     1 
ATOM   4741 O  O     . ALA C 1 196 ? -40.663 54.987 -2.615  1.00 65.16  ? 226 ALA C O     1 
ATOM   4742 C  CB    . ALA C 1 196 ? -39.232 57.135 -3.629  1.00 64.40  ? 226 ALA C CB    1 
ATOM   4743 N  N     . LEU C 1 197 ? -39.893 55.359 -0.537  1.00 65.12  ? 227 LEU C N     1 
ATOM   4744 C  CA    . LEU C 1 197 ? -40.975 54.608 0.117   1.00 65.26  ? 227 LEU C CA    1 
ATOM   4745 C  C     . LEU C 1 197 ? -42.355 54.991 -0.436  1.00 65.29  ? 227 LEU C C     1 
ATOM   4746 O  O     . LEU C 1 197 ? -43.231 54.152 -0.570  1.00 65.07  ? 227 LEU C O     1 
ATOM   4747 C  CB    . LEU C 1 197 ? -40.954 54.814 1.638   1.00 65.23  ? 227 LEU C CB    1 
ATOM   4748 C  CG    . LEU C 1 197 ? -39.736 54.288 2.417   1.00 66.02  ? 227 LEU C CG    1 
ATOM   4749 C  CD1   . LEU C 1 197 ? -39.833 54.632 3.891   1.00 65.47  ? 227 LEU C CD1   1 
ATOM   4750 C  CD2   . LEU C 1 197 ? -39.548 52.784 2.251   1.00 66.30  ? 227 LEU C CD2   1 
ATOM   4751 N  N     . SER C 1 198 ? -42.528 56.261 -0.773  1.00 65.68  ? 228 SER C N     1 
ATOM   4752 C  CA    . SER C 1 198 ? -43.810 56.781 -1.227  1.00 65.98  ? 228 SER C CA    1 
ATOM   4753 C  C     . SER C 1 198 ? -44.086 56.474 -2.687  1.00 66.19  ? 228 SER C C     1 
ATOM   4754 O  O     . SER C 1 198 ? -45.137 56.851 -3.196  1.00 66.50  ? 228 SER C O     1 
ATOM   4755 C  CB    . SER C 1 198 ? -43.827 58.294 -1.045  1.00 66.17  ? 228 SER C CB    1 
ATOM   4756 O  OG    . SER C 1 198 ? -42.693 58.877 -1.675  1.00 66.66  ? 228 SER C OG    1 
ATOM   4757 N  N     . ASP C 1 199 ? -43.145 55.813 -3.366  1.00 66.17  ? 229 ASP C N     1 
ATOM   4758 C  CA    . ASP C 1 199 ? -43.318 55.444 -4.774  1.00 66.11  ? 229 ASP C CA    1 
ATOM   4759 C  C     . ASP C 1 199 ? -44.150 54.179 -4.971  1.00 65.61  ? 229 ASP C C     1 
ATOM   4760 O  O     . ASP C 1 199 ? -44.327 53.735 -6.107  1.00 66.05  ? 229 ASP C O     1 
ATOM   4761 C  CB    . ASP C 1 199 ? -41.951 55.233 -5.446  1.00 66.26  ? 229 ASP C CB    1 
ATOM   4762 C  CG    . ASP C 1 199 ? -41.324 56.528 -5.928  1.00 68.34  ? 229 ASP C CG    1 
ATOM   4763 O  OD1   . ASP C 1 199 ? -41.837 57.620 -5.558  1.00 71.57  ? 229 ASP C OD1   1 
ATOM   4764 O  OD2   . ASP C 1 199 ? -40.314 56.454 -6.681  1.00 69.30  ? 229 ASP C OD2   1 
ATOM   4765 N  N     . TYR C 1 200 ? -44.652 53.588 -3.891  1.00 64.79  ? 230 TYR C N     1 
ATOM   4766 C  CA    . TYR C 1 200 ? -45.303 52.290 -3.986  1.00 64.28  ? 230 TYR C CA    1 
ATOM   4767 C  C     . TYR C 1 200 ? -46.536 52.275 -4.906  1.00 64.40  ? 230 TYR C C     1 
ATOM   4768 O  O     . TYR C 1 200 ? -46.777 51.276 -5.573  1.00 64.93  ? 230 TYR C O     1 
ATOM   4769 C  CB    . TYR C 1 200 ? -45.628 51.722 -2.592  1.00 63.75  ? 230 TYR C CB    1 
ATOM   4770 C  CG    . TYR C 1 200 ? -46.734 52.416 -1.840  1.00 62.84  ? 230 TYR C CG    1 
ATOM   4771 C  CD1   . TYR C 1 200 ? -46.451 53.394 -0.891  1.00 62.08  ? 230 TYR C CD1   1 
ATOM   4772 C  CD2   . TYR C 1 200 ? -48.059 52.081 -2.062  1.00 62.19  ? 230 TYR C CD2   1 
ATOM   4773 C  CE1   . TYR C 1 200 ? -47.463 54.027 -0.190  1.00 62.14  ? 230 TYR C CE1   1 
ATOM   4774 C  CE2   . TYR C 1 200 ? -49.085 52.709 -1.367  1.00 62.65  ? 230 TYR C CE2   1 
ATOM   4775 C  CZ    . TYR C 1 200 ? -48.779 53.679 -0.433  1.00 62.65  ? 230 TYR C CZ    1 
ATOM   4776 O  OH    . TYR C 1 200 ? -49.794 54.300 0.242   1.00 62.20  ? 230 TYR C OH    1 
ATOM   4777 N  N     . ASP C 1 201 ? -47.294 53.366 -4.974  1.00 64.21  ? 231 ASP C N     1 
ATOM   4778 C  CA    . ASP C 1 201 ? -48.523 53.385 -5.783  1.00 64.26  ? 231 ASP C CA    1 
ATOM   4779 C  C     . ASP C 1 201 ? -48.428 54.287 -7.012  1.00 63.76  ? 231 ASP C C     1 
ATOM   4780 O  O     . ASP C 1 201 ? -49.445 54.614 -7.626  1.00 63.95  ? 231 ASP C O     1 
ATOM   4781 C  CB    . ASP C 1 201 ? -49.712 53.832 -4.923  1.00 64.40  ? 231 ASP C CB    1 
ATOM   4782 C  CG    . ASP C 1 201 ? -49.610 55.283 -4.506  1.00 65.24  ? 231 ASP C CG    1 
ATOM   4783 O  OD1   . ASP C 1 201 ? -48.498 55.849 -4.604  1.00 66.74  ? 231 ASP C OD1   1 
ATOM   4784 O  OD2   . ASP C 1 201 ? -50.628 55.863 -4.077  1.00 66.94  ? 231 ASP C OD2   1 
ATOM   4785 N  N     . LEU C 1 202 ? -47.214 54.703 -7.352  1.00 63.11  ? 232 LEU C N     1 
ATOM   4786 C  CA    . LEU C 1 202 ? -46.973 55.537 -8.524  1.00 62.52  ? 232 LEU C CA    1 
ATOM   4787 C  C     . LEU C 1 202 ? -46.462 54.663 -9.654  1.00 62.30  ? 232 LEU C C     1 
ATOM   4788 O  O     . LEU C 1 202 ? -46.068 53.524 -9.421  1.00 62.52  ? 232 LEU C O     1 
ATOM   4789 C  CB    . LEU C 1 202 ? -45.926 56.598 -8.208  1.00 62.29  ? 232 LEU C CB    1 
ATOM   4790 C  CG    . LEU C 1 202 ? -46.180 57.476 -6.993  1.00 61.77  ? 232 LEU C CG    1 
ATOM   4791 C  CD1   . LEU C 1 202 ? -45.078 58.516 -6.823  1.00 60.40  ? 232 LEU C CD1   1 
ATOM   4792 C  CD2   . LEU C 1 202 ? -47.525 58.132 -7.129  1.00 61.79  ? 232 LEU C CD2   1 
ATOM   4793 N  N     . VAL C 1 203 ? -46.477 55.197 -10.871 1.00 62.12  ? 233 VAL C N     1 
ATOM   4794 C  CA    . VAL C 1 203 ? -45.893 54.525 -12.030 1.00 62.22  ? 233 VAL C CA    1 
ATOM   4795 C  C     . VAL C 1 203 ? -44.756 55.375 -12.597 1.00 62.61  ? 233 VAL C C     1 
ATOM   4796 O  O     . VAL C 1 203 ? -44.702 56.578 -12.349 1.00 62.64  ? 233 VAL C O     1 
ATOM   4797 C  CB    . VAL C 1 203 ? -46.933 54.236 -13.141 1.00 62.15  ? 233 VAL C CB    1 
ATOM   4798 C  CG1   . VAL C 1 203 ? -47.950 53.225 -12.663 1.00 61.22  ? 233 VAL C CG1   1 
ATOM   4799 C  CG2   . VAL C 1 203 ? -47.603 55.516 -13.615 1.00 61.43  ? 233 VAL C CG2   1 
ATOM   4800 N  N     . LEU C 1 204 ? -43.852 54.742 -13.351 1.00 62.96  ? 234 LEU C N     1 
ATOM   4801 C  CA    . LEU C 1 204 ? -42.680 55.434 -13.905 1.00 62.92  ? 234 LEU C CA    1 
ATOM   4802 C  C     . LEU C 1 204 ? -43.093 56.549 -14.854 1.00 63.32  ? 234 LEU C C     1 
ATOM   4803 O  O     . LEU C 1 204 ? -44.022 56.401 -15.665 1.00 63.14  ? 234 LEU C O     1 
ATOM   4804 C  CB    . LEU C 1 204 ? -41.739 54.466 -14.641 1.00 62.83  ? 234 LEU C CB    1 
ATOM   4805 C  CG    . LEU C 1 204 ? -40.904 53.479 -13.814 1.00 62.10  ? 234 LEU C CG    1 
ATOM   4806 C  CD1   . LEU C 1 204 ? -40.095 52.586 -14.744 1.00 61.18  ? 234 LEU C CD1   1 
ATOM   4807 C  CD2   . LEU C 1 204 ? -39.998 54.203 -12.849 1.00 61.02  ? 234 LEU C CD2   1 
ATOM   4808 N  N     . ALA C 1 205 ? -42.397 57.673 -14.740 1.00 63.93  ? 235 ALA C N     1 
ATOM   4809 C  CA    . ALA C 1 205 ? -42.639 58.793 -15.634 1.00 64.42  ? 235 ALA C CA    1 
ATOM   4810 C  C     . ALA C 1 205 ? -42.279 58.390 -17.058 1.00 64.90  ? 235 ALA C C     1 
ATOM   4811 O  O     . ALA C 1 205 ? -42.934 58.818 -18.006 1.00 65.34  ? 235 ALA C O     1 
ATOM   4812 C  CB    . ALA C 1 205 ? -41.846 60.011 -15.196 1.00 64.29  ? 235 ALA C CB    1 
ATOM   4813 N  N     . GLU C 1 206 ? -41.252 57.551 -17.200 1.00 65.39  ? 236 GLU C N     1 
ATOM   4814 C  CA    . GLU C 1 206 ? -40.790 57.107 -18.515 1.00 65.65  ? 236 GLU C CA    1 
ATOM   4815 C  C     . GLU C 1 206 ? -41.493 55.847 -19.019 1.00 66.01  ? 236 GLU C C     1 
ATOM   4816 O  O     . GLU C 1 206 ? -41.288 55.452 -20.160 1.00 65.94  ? 236 GLU C O     1 
ATOM   4817 C  CB    . GLU C 1 206 ? -39.264 56.903 -18.527 1.00 65.80  ? 236 GLU C CB    1 
ATOM   4818 C  CG    . GLU C 1 206 ? -38.711 55.780 -17.649 1.00 64.80  ? 236 GLU C CG    1 
ATOM   4819 C  CD    . GLU C 1 206 ? -38.285 56.269 -16.290 1.00 65.24  ? 236 GLU C CD    1 
ATOM   4820 O  OE1   . GLU C 1 206 ? -37.185 55.883 -15.823 1.00 66.68  ? 236 GLU C OE1   1 
ATOM   4821 O  OE2   . GLU C 1 206 ? -39.047 57.052 -15.690 1.00 64.81  ? 236 GLU C OE2   1 
ATOM   4822 N  N     . ASP C 1 207 ? -42.304 55.218 -18.173 1.00 66.53  ? 237 ASP C N     1 
ATOM   4823 C  CA    . ASP C 1 207 ? -43.071 54.021 -18.557 1.00 67.09  ? 237 ASP C CA    1 
ATOM   4824 C  C     . ASP C 1 207 ? -44.338 53.923 -17.712 1.00 67.23  ? 237 ASP C C     1 
ATOM   4825 O  O     . ASP C 1 207 ? -44.348 53.258 -16.683 1.00 67.02  ? 237 ASP C O     1 
ATOM   4826 C  CB    . ASP C 1 207 ? -42.221 52.753 -18.371 1.00 67.23  ? 237 ASP C CB    1 
ATOM   4827 C  CG    . ASP C 1 207 ? -42.876 51.501 -18.971 1.00 68.17  ? 237 ASP C CG    1 
ATOM   4828 O  OD1   . ASP C 1 207 ? -44.118 51.468 -19.139 1.00 68.71  ? 237 ASP C OD1   1 
ATOM   4829 O  OD2   . ASP C 1 207 ? -42.137 50.539 -19.277 1.00 68.42  ? 237 ASP C OD2   1 
ATOM   4830 N  N     . GLU C 1 208 ? -45.404 54.587 -18.152 1.00 67.69  ? 238 GLU C N     1 
ATOM   4831 C  CA    . GLU C 1 208 ? -46.669 54.630 -17.399 1.00 67.86  ? 238 GLU C CA    1 
ATOM   4832 C  C     . GLU C 1 208 ? -47.225 53.243 -17.018 1.00 68.09  ? 238 GLU C C     1 
ATOM   4833 O  O     . GLU C 1 208 ? -48.117 53.154 -16.174 1.00 68.08  ? 238 GLU C O     1 
ATOM   4834 C  CB    . GLU C 1 208 ? -47.728 55.414 -18.187 1.00 67.74  ? 238 GLU C CB    1 
ATOM   4835 N  N     . GLU C 1 209 ? -46.694 52.181 -17.634 1.00 68.39  ? 239 GLU C N     1 
ATOM   4836 C  CA    . GLU C 1 209 ? -47.137 50.798 -17.399 1.00 68.88  ? 239 GLU C CA    1 
ATOM   4837 C  C     . GLU C 1 209 ? -46.293 50.009 -16.364 1.00 68.96  ? 239 GLU C C     1 
ATOM   4838 O  O     . GLU C 1 209 ? -46.487 48.796 -16.198 1.00 68.93  ? 239 GLU C O     1 
ATOM   4839 C  CB    . GLU C 1 209 ? -47.157 50.021 -18.730 1.00 68.94  ? 239 GLU C CB    1 
ATOM   4840 C  CG    . GLU C 1 209 ? -48.014 50.647 -19.830 1.00 69.85  ? 239 GLU C CG    1 
ATOM   4841 C  CD    . GLU C 1 209 ? -49.522 50.546 -19.563 1.00 71.84  ? 239 GLU C CD    1 
ATOM   4842 O  OE1   . GLU C 1 209 ? -50.046 49.416 -19.413 1.00 72.68  ? 239 GLU C OE1   1 
ATOM   4843 O  OE2   . GLU C 1 209 ? -50.193 51.601 -19.528 1.00 72.96  ? 239 GLU C OE2   1 
ATOM   4844 N  N     . MET C 1 210 ? -45.356 50.672 -15.684 1.00 68.84  ? 240 MET C N     1 
ATOM   4845 C  CA    . MET C 1 210 ? -44.619 50.014 -14.610 1.00 68.72  ? 240 MET C CA    1 
ATOM   4846 C  C     . MET C 1 210 ? -44.584 50.788 -13.312 1.00 68.18  ? 240 MET C C     1 
ATOM   4847 O  O     . MET C 1 210 ? -44.281 51.976 -13.300 1.00 68.04  ? 240 MET C O     1 
ATOM   4848 C  CB    . MET C 1 210 ? -43.180 49.689 -14.985 1.00 68.93  ? 240 MET C CB    1 
ATOM   4849 C  CG    . MET C 1 210 ? -42.476 49.017 -13.786 1.00 69.23  ? 240 MET C CG    1 
ATOM   4850 S  SD    . MET C 1 210 ? -41.334 47.737 -14.203 1.00 69.28  ? 240 MET C SD    1 
ATOM   4851 C  CE    . MET C 1 210 ? -41.605 46.582 -12.870 1.00 70.24  ? 240 MET C CE    1 
ATOM   4852 N  N     . ASN C 1 211 ? -44.862 50.064 -12.229 1.00 67.69  ? 241 ASN C N     1 
ATOM   4853 C  CA    . ASN C 1 211 ? -44.806 50.571 -10.875 1.00 67.59  ? 241 ASN C CA    1 
ATOM   4854 C  C     . ASN C 1 211 ? -43.385 50.919 -10.450 1.00 67.55  ? 241 ASN C C     1 
ATOM   4855 O  O     . ASN C 1 211 ? -42.460 50.127 -10.634 1.00 67.45  ? 241 ASN C O     1 
ATOM   4856 C  CB    . ASN C 1 211 ? -45.371 49.516 -9.925  1.00 67.67  ? 241 ASN C CB    1 
ATOM   4857 C  CG    . ASN C 1 211 ? -45.487 50.018 -8.512  1.00 67.78  ? 241 ASN C CG    1 
ATOM   4858 O  OD1   . ASN C 1 211 ? -44.494 50.121 -7.781  1.00 66.51  ? 241 ASN C OD1   1 
ATOM   4859 N  ND2   . ASN C 1 211 ? -46.708 50.339 -8.115  1.00 68.02  ? 241 ASN C ND2   1 
ATOM   4860 N  N     . ARG C 1 212 ? -43.229 52.093 -9.848  1.00 67.63  ? 242 ARG C N     1 
ATOM   4861 C  CA    . ARG C 1 212 ? -41.909 52.609 -9.476  1.00 67.89  ? 242 ARG C CA    1 
ATOM   4862 C  C     . ARG C 1 212 ? -41.168 51.776 -8.436  1.00 67.51  ? 242 ARG C C     1 
ATOM   4863 O  O     . ARG C 1 212 ? -39.947 51.709 -8.469  1.00 67.47  ? 242 ARG C O     1 
ATOM   4864 C  CB    . ARG C 1 212 ? -42.031 54.045 -8.986  1.00 68.23  ? 242 ARG C CB    1 
ATOM   4865 C  CG    . ARG C 1 212 ? -42.092 55.054 -10.123 1.00 70.07  ? 242 ARG C CG    1 
ATOM   4866 C  CD    . ARG C 1 212 ? -42.959 56.239 -9.777  1.00 72.45  ? 242 ARG C CD    1 
ATOM   4867 N  NE    . ARG C 1 212 ? -42.539 57.441 -10.496 1.00 73.70  ? 242 ARG C NE    1 
ATOM   4868 C  CZ    . ARG C 1 212 ? -41.903 58.474 -9.946  1.00 74.44  ? 242 ARG C CZ    1 
ATOM   4869 N  NH1   . ARG C 1 212 ? -41.599 58.493 -8.650  1.00 74.98  ? 242 ARG C NH1   1 
ATOM   4870 N  NH2   . ARG C 1 212 ? -41.576 59.508 -10.702 1.00 73.86  ? 242 ARG C NH2   1 
ATOM   4871 N  N     . MET C 1 213 ? -41.905 51.145 -7.526  1.00 67.27  ? 243 MET C N     1 
ATOM   4872 C  CA    . MET C 1 213 ? -41.303 50.305 -6.497  1.00 67.15  ? 243 MET C CA    1 
ATOM   4873 C  C     . MET C 1 213 ? -40.672 49.061 -7.118  1.00 66.82  ? 243 MET C C     1 
ATOM   4874 O  O     . MET C 1 213 ? -39.547 48.689 -6.782  1.00 66.59  ? 243 MET C O     1 
ATOM   4875 C  CB    . MET C 1 213 ? -42.363 49.888 -5.482  1.00 67.42  ? 243 MET C CB    1 
ATOM   4876 C  CG    . MET C 1 213 ? -41.812 49.263 -4.222  1.00 68.04  ? 243 MET C CG    1 
ATOM   4877 S  SD    . MET C 1 213 ? -41.021 50.492 -3.198  1.00 70.25  ? 243 MET C SD    1 
ATOM   4878 C  CE    . MET C 1 213 ? -42.348 50.929 -2.088  1.00 69.55  ? 243 MET C CE    1 
ATOM   4879 N  N     . HIS C 1 214 ? -41.414 48.422 -8.021  1.00 66.45  ? 244 HIS C N     1 
ATOM   4880 C  CA    . HIS C 1 214 ? -40.922 47.257 -8.737  1.00 66.10  ? 244 HIS C CA    1 
ATOM   4881 C  C     . HIS C 1 214 ? -39.633 47.582 -9.497  1.00 65.90  ? 244 HIS C C     1 
ATOM   4882 O  O     . HIS C 1 214 ? -38.621 46.889 -9.344  1.00 65.44  ? 244 HIS C O     1 
ATOM   4883 C  CB    . HIS C 1 214 ? -41.981 46.739 -9.698  1.00 66.07  ? 244 HIS C CB    1 
ATOM   4884 C  CG    . HIS C 1 214 ? -43.185 46.161 -9.020  1.00 66.83  ? 244 HIS C CG    1 
ATOM   4885 N  ND1   . HIS C 1 214 ? -44.278 45.692 -9.717  1.00 66.99  ? 244 HIS C ND1   1 
ATOM   4886 C  CD2   . HIS C 1 214 ? -43.473 45.982 -7.708  1.00 67.66  ? 244 HIS C CD2   1 
ATOM   4887 C  CE1   . HIS C 1 214 ? -45.180 45.238 -8.865  1.00 66.97  ? 244 HIS C CE1   1 
ATOM   4888 N  NE2   . HIS C 1 214 ? -44.718 45.406 -7.639  1.00 66.98  ? 244 HIS C NE2   1 
ATOM   4889 N  N     . GLU C 1 215 ? -39.671 48.646 -10.300 1.00 65.79  ? 245 GLU C N     1 
ATOM   4890 C  CA    . GLU C 1 215 ? -38.482 49.117 -11.028 1.00 65.75  ? 245 GLU C CA    1 
ATOM   4891 C  C     . GLU C 1 215 ? -37.285 49.248 -10.099 1.00 65.52  ? 245 GLU C C     1 
ATOM   4892 O  O     . GLU C 1 215 ? -36.174 48.835 -10.435 1.00 65.35  ? 245 GLU C O     1 
ATOM   4893 C  CB    . GLU C 1 215 ? -38.737 50.481 -11.666 1.00 65.80  ? 245 GLU C CB    1 
ATOM   4894 C  CG    . GLU C 1 215 ? -37.612 50.975 -12.579 1.00 66.43  ? 245 GLU C CG    1 
ATOM   4895 C  CD    . GLU C 1 215 ? -37.618 50.307 -13.944 1.00 68.10  ? 245 GLU C CD    1 
ATOM   4896 O  OE1   . GLU C 1 215 ? -38.328 49.290 -14.123 1.00 69.44  ? 245 GLU C OE1   1 
ATOM   4897 O  OE2   . GLU C 1 215 ? -36.916 50.805 -14.848 1.00 68.49  ? 245 GLU C OE2   1 
ATOM   4898 N  N     . SER C 1 216 ? -37.539 49.834 -8.934  1.00 65.31  ? 246 SER C N     1 
ATOM   4899 C  CA    . SER C 1 216 ? -36.509 50.093 -7.942  1.00 65.22  ? 246 SER C CA    1 
ATOM   4900 C  C     . SER C 1 216 ? -36.021 48.807 -7.269  1.00 64.89  ? 246 SER C C     1 
ATOM   4901 O  O     . SER C 1 216 ? -34.840 48.676 -6.973  1.00 64.79  ? 246 SER C O     1 
ATOM   4902 C  CB    . SER C 1 216 ? -37.040 51.074 -6.903  1.00 65.07  ? 246 SER C CB    1 
ATOM   4903 O  OG    . SER C 1 216 ? -36.055 51.306 -5.918  1.00 66.86  ? 246 SER C OG    1 
ATOM   4904 N  N     . MET C 1 217 ? -36.936 47.868 -7.033  1.00 64.63  ? 247 MET C N     1 
ATOM   4905 C  CA    . MET C 1 217 ? -36.568 46.530 -6.581  1.00 64.43  ? 247 MET C CA    1 
ATOM   4906 C  C     . MET C 1 217 ? -35.681 45.834 -7.610  1.00 64.07  ? 247 MET C C     1 
ATOM   4907 O  O     . MET C 1 217 ? -34.683 45.214 -7.246  1.00 63.96  ? 247 MET C O     1 
ATOM   4908 C  CB    . MET C 1 217 ? -37.809 45.664 -6.328  1.00 64.28  ? 247 MET C CB    1 
ATOM   4909 C  CG    . MET C 1 217 ? -38.598 46.031 -5.075  1.00 64.88  ? 247 MET C CG    1 
ATOM   4910 S  SD    . MET C 1 217 ? -39.991 44.916 -4.731  1.00 65.26  ? 247 MET C SD    1 
ATOM   4911 C  CE    . MET C 1 217 ? -39.094 43.374 -4.547  1.00 65.20  ? 247 MET C CE    1 
ATOM   4912 N  N     . LYS C 1 218 ? -36.049 45.932 -8.889  1.00 63.67  ? 248 LYS C N     1 
ATOM   4913 C  CA    . LYS C 1 218 ? -35.305 45.250 -9.951  1.00 63.30  ? 248 LYS C CA    1 
ATOM   4914 C  C     . LYS C 1 218 ? -33.938 45.883 -10.108 1.00 63.05  ? 248 LYS C C     1 
ATOM   4915 O  O     . LYS C 1 218 ? -32.983 45.218 -10.496 1.00 63.09  ? 248 LYS C O     1 
ATOM   4916 C  CB    . LYS C 1 218 ? -36.060 45.277 -11.283 1.00 62.97  ? 248 LYS C CB    1 
ATOM   4917 N  N     . LEU C 1 219 ? -33.844 47.166 -9.782  1.00 62.80  ? 249 LEU C N     1 
ATOM   4918 C  CA    . LEU C 1 219 ? -32.584 47.901 -9.905  1.00 62.71  ? 249 LEU C CA    1 
ATOM   4919 C  C     . LEU C 1 219 ? -31.662 47.614 -8.727  1.00 62.62  ? 249 LEU C C     1 
ATOM   4920 O  O     . LEU C 1 219 ? -30.461 47.434 -8.916  1.00 62.64  ? 249 LEU C O     1 
ATOM   4921 C  CB    . LEU C 1 219 ? -32.858 49.402 -10.007 1.00 62.74  ? 249 LEU C CB    1 
ATOM   4922 C  CG    . LEU C 1 219 ? -31.892 50.274 -10.794 1.00 62.73  ? 249 LEU C CG    1 
ATOM   4923 C  CD1   . LEU C 1 219 ? -31.773 49.807 -12.220 1.00 63.27  ? 249 LEU C CD1   1 
ATOM   4924 C  CD2   . LEU C 1 219 ? -32.410 51.688 -10.761 1.00 63.50  ? 249 LEU C CD2   1 
ATOM   4925 N  N     . PHE C 1 220 ? -32.226 47.572 -7.517  1.00 62.45  ? 250 PHE C N     1 
ATOM   4926 C  CA    . PHE C 1 220 ? -31.460 47.230 -6.322  1.00 62.48  ? 250 PHE C CA    1 
ATOM   4927 C  C     . PHE C 1 220 ? -30.888 45.824 -6.472  1.00 62.73  ? 250 PHE C C     1 
ATOM   4928 O  O     . PHE C 1 220 ? -29.693 45.604 -6.295  1.00 62.69  ? 250 PHE C O     1 
ATOM   4929 C  CB    . PHE C 1 220 ? -32.328 47.333 -5.062  1.00 62.20  ? 250 PHE C CB    1 
ATOM   4930 C  CG    . PHE C 1 220 ? -31.590 47.007 -3.774  1.00 62.22  ? 250 PHE C CG    1 
ATOM   4931 C  CD1   . PHE C 1 220 ? -30.590 47.838 -3.297  1.00 62.10  ? 250 PHE C CD1   1 
ATOM   4932 C  CD2   . PHE C 1 220 ? -31.902 45.865 -3.038  1.00 62.20  ? 250 PHE C CD2   1 
ATOM   4933 C  CE1   . PHE C 1 220 ? -29.917 47.543 -2.104  1.00 61.61  ? 250 PHE C CE1   1 
ATOM   4934 C  CE2   . PHE C 1 220 ? -31.230 45.567 -1.856  1.00 61.61  ? 250 PHE C CE2   1 
ATOM   4935 C  CZ    . PHE C 1 220 ? -30.240 46.410 -1.391  1.00 61.46  ? 250 PHE C CZ    1 
ATOM   4936 N  N     . ASP C 1 221 ? -31.765 44.890 -6.816  1.00 63.13  ? 251 ASP C N     1 
ATOM   4937 C  CA    . ASP C 1 221 ? -31.401 43.512 -7.128  1.00 63.54  ? 251 ASP C CA    1 
ATOM   4938 C  C     . ASP C 1 221 ? -30.108 43.435 -7.936  1.00 63.90  ? 251 ASP C C     1 
ATOM   4939 O  O     . ASP C 1 221 ? -29.165 42.743 -7.553  1.00 63.85  ? 251 ASP C O     1 
ATOM   4940 C  CB    . ASP C 1 221 ? -32.543 42.871 -7.926  1.00 63.60  ? 251 ASP C CB    1 
ATOM   4941 C  CG    . ASP C 1 221 ? -32.422 41.375 -8.039  1.00 64.03  ? 251 ASP C CG    1 
ATOM   4942 O  OD1   . ASP C 1 221 ? -31.588 40.760 -7.335  1.00 64.52  ? 251 ASP C OD1   1 
ATOM   4943 O  OD2   . ASP C 1 221 ? -33.194 40.809 -8.840  1.00 65.13  ? 251 ASP C OD2   1 
ATOM   4944 N  N     . SER C 1 222 ? -30.065 44.164 -9.046  1.00 64.25  ? 252 SER C N     1 
ATOM   4945 C  CA    . SER C 1 222 ? -28.887 44.170 -9.902  1.00 64.44  ? 252 SER C CA    1 
ATOM   4946 C  C     . SER C 1 222 ? -27.629 44.727 -9.231  1.00 64.50  ? 252 SER C C     1 
ATOM   4947 O  O     . SER C 1 222 ? -26.556 44.168 -9.402  1.00 64.44  ? 252 SER C O     1 
ATOM   4948 C  CB    . SER C 1 222 ? -29.145 44.954 -11.175 1.00 64.45  ? 252 SER C CB    1 
ATOM   4949 O  OG    . SER C 1 222 ? -27.933 45.076 -11.897 1.00 65.12  ? 252 SER C OG    1 
ATOM   4950 N  N     . ILE C 1 223 ? -27.752 45.824 -8.487  1.00 64.68  ? 253 ILE C N     1 
ATOM   4951 C  CA    . ILE C 1 223 ? -26.582 46.413 -7.821  1.00 65.04  ? 253 ILE C CA    1 
ATOM   4952 C  C     . ILE C 1 223 ? -26.124 45.518 -6.670  1.00 65.23  ? 253 ILE C C     1 
ATOM   4953 O  O     . ILE C 1 223 ? -24.967 45.091 -6.591  1.00 65.15  ? 253 ILE C O     1 
ATOM   4954 C  CB    . ILE C 1 223 ? -26.876 47.819 -7.251  1.00 65.21  ? 253 ILE C CB    1 
ATOM   4955 C  CG1   . ILE C 1 223 ? -27.335 48.786 -8.359  1.00 65.38  ? 253 ILE C CG1   1 
ATOM   4956 C  CG2   . ILE C 1 223 ? -25.635 48.363 -6.536  1.00 64.71  ? 253 ILE C CG2   1 
ATOM   4957 C  CD1   . ILE C 1 223 ? -26.330 48.952 -9.504  1.00 65.35  ? 253 ILE C CD1   1 
ATOM   4958 N  N     . CYS C 1 224 ? -27.074 45.243 -5.792  1.00 65.72  ? 254 CYS C N     1 
ATOM   4959 C  CA    . CYS C 1 224 ? -26.880 44.426 -4.616  1.00 65.64  ? 254 CYS C CA    1 
ATOM   4960 C  C     . CYS C 1 224 ? -26.172 43.102 -4.933  1.00 65.51  ? 254 CYS C C     1 
ATOM   4961 O  O     . CYS C 1 224 ? -25.172 42.749 -4.299  1.00 65.36  ? 254 CYS C O     1 
ATOM   4962 C  CB    . CYS C 1 224 ? -28.255 44.159 -4.002  1.00 65.57  ? 254 CYS C CB    1 
ATOM   4963 S  SG    . CYS C 1 224 ? -28.225 43.454 -2.370  1.00 67.41  ? 254 CYS C SG    1 
ATOM   4964 N  N     . ASN C 1 225 ? -26.696 42.390 -5.929  1.00 65.39  ? 255 ASN C N     1 
ATOM   4965 C  CA    . ASN C 1 225 ? -26.234 41.042 -6.267  1.00 65.12  ? 255 ASN C CA    1 
ATOM   4966 C  C     . ASN C 1 225 ? -25.135 41.017 -7.309  1.00 65.00  ? 255 ASN C C     1 
ATOM   4967 O  O     . ASN C 1 225 ? -24.519 39.987 -7.517  1.00 65.05  ? 255 ASN C O     1 
ATOM   4968 C  CB    . ASN C 1 225 ? -27.401 40.180 -6.763  1.00 65.20  ? 255 ASN C CB    1 
ATOM   4969 C  CG    . ASN C 1 225 ? -28.368 39.823 -5.658  1.00 65.12  ? 255 ASN C CG    1 
ATOM   4970 O  OD1   . ASN C 1 225 ? -28.085 38.954 -4.834  1.00 66.92  ? 255 ASN C OD1   1 
ATOM   4971 N  ND2   . ASN C 1 225 ? -29.519 40.480 -5.638  1.00 64.42  ? 255 ASN C ND2   1 
ATOM   4972 N  N     . ASN C 1 226 ? -24.908 42.128 -7.995  1.00 65.10  ? 256 ASN C N     1 
ATOM   4973 C  CA    . ASN C 1 226 ? -23.761 42.222 -8.885  1.00 64.89  ? 256 ASN C CA    1 
ATOM   4974 C  C     . ASN C 1 226 ? -22.513 42.182 -8.022  1.00 64.61  ? 256 ASN C C     1 
ATOM   4975 O  O     . ASN C 1 226 ? -22.365 42.980 -7.094  1.00 64.34  ? 256 ASN C O     1 
ATOM   4976 C  CB    . ASN C 1 226 ? -23.819 43.509 -9.710  1.00 64.97  ? 256 ASN C CB    1 
ATOM   4977 C  CG    . ASN C 1 226 ? -22.525 43.812 -10.430 1.00 65.50  ? 256 ASN C CG    1 
ATOM   4978 O  OD1   . ASN C 1 226 ? -21.719 42.920 -10.718 1.00 66.36  ? 256 ASN C OD1   1 
ATOM   4979 N  ND2   . ASN C 1 226 ? -22.320 45.087 -10.737 1.00 65.81  ? 256 ASN C ND2   1 
ATOM   4980 N  N     . LYS C 1 227 ? -21.633 41.226 -8.307  1.00 64.69  ? 257 LYS C N     1 
ATOM   4981 C  CA    . LYS C 1 227 ? -20.332 41.180 -7.648  1.00 64.63  ? 257 LYS C CA    1 
ATOM   4982 C  C     . LYS C 1 227 ? -19.544 42.396 -8.136  1.00 64.67  ? 257 LYS C C     1 
ATOM   4983 O  O     . LYS C 1 227 ? -20.135 43.357 -8.651  1.00 64.80  ? 257 LYS C O     1 
ATOM   4984 C  CB    . LYS C 1 227 ? -19.610 39.870 -7.939  1.00 64.73  ? 257 LYS C CB    1 
ATOM   4985 N  N     . TRP C 1 228 ? -18.228 42.400 -7.960  1.00 64.47  ? 258 TRP C N     1 
ATOM   4986 C  CA    . TRP C 1 228 ? -17.472 43.644 -8.111  1.00 64.26  ? 258 TRP C CA    1 
ATOM   4987 C  C     . TRP C 1 228 ? -17.808 44.534 -6.916  1.00 64.01  ? 258 TRP C C     1 
ATOM   4988 O  O     . TRP C 1 228 ? -16.910 45.110 -6.303  1.00 63.91  ? 258 TRP C O     1 
ATOM   4989 C  CB    . TRP C 1 228 ? -17.815 44.361 -9.431  1.00 64.32  ? 258 TRP C CB    1 
ATOM   4990 N  N     . PHE C 1 229 ? -19.102 44.631 -6.591  1.00 63.81  ? 259 PHE C N     1 
ATOM   4991 C  CA    . PHE C 1 229 ? -19.567 45.340 -5.396  1.00 63.94  ? 259 PHE C CA    1 
ATOM   4992 C  C     . PHE C 1 229 ? -19.690 44.478 -4.145  1.00 63.88  ? 259 PHE C C     1 
ATOM   4993 O  O     . PHE C 1 229 ? -20.334 44.893 -3.179  1.00 63.92  ? 259 PHE C O     1 
ATOM   4994 C  CB    . PHE C 1 229 ? -20.914 46.029 -5.657  1.00 64.01  ? 259 PHE C CB    1 
ATOM   4995 C  CG    . PHE C 1 229 ? -20.854 47.071 -6.718  1.00 64.04  ? 259 PHE C CG    1 
ATOM   4996 C  CD1   . PHE C 1 229 ? -19.919 48.095 -6.645  1.00 63.86  ? 259 PHE C CD1   1 
ATOM   4997 C  CD2   . PHE C 1 229 ? -21.726 47.036 -7.791  1.00 63.89  ? 259 PHE C CD2   1 
ATOM   4998 C  CE1   . PHE C 1 229 ? -19.850 49.059 -7.622  1.00 63.75  ? 259 PHE C CE1   1 
ATOM   4999 C  CE2   . PHE C 1 229 ? -21.660 48.000 -8.774  1.00 64.07  ? 259 PHE C CE2   1 
ATOM   5000 C  CZ    . PHE C 1 229 ? -20.722 49.015 -8.689  1.00 63.82  ? 259 PHE C CZ    1 
ATOM   5001 N  N     . THR C 1 230 ? -19.083 43.294 -4.142  1.00 63.83  ? 260 THR C N     1 
ATOM   5002 C  CA    . THR C 1 230 ? -18.893 42.577 -2.883  1.00 63.89  ? 260 THR C CA    1 
ATOM   5003 C  C     . THR C 1 230 ? -17.875 43.356 -2.048  1.00 63.77  ? 260 THR C C     1 
ATOM   5004 O  O     . THR C 1 230 ? -18.027 43.471 -0.834  1.00 63.77  ? 260 THR C O     1 
ATOM   5005 C  CB    . THR C 1 230 ? -18.448 41.100 -3.077  1.00 64.07  ? 260 THR C CB    1 
ATOM   5006 O  OG1   . THR C 1 230 ? -17.628 40.983 -4.248  1.00 64.27  ? 260 THR C OG1   1 
ATOM   5007 C  CG2   . THR C 1 230 ? -19.678 40.175 -3.203  1.00 63.85  ? 260 THR C CG2   1 
ATOM   5008 N  N     . ASP C 1 231 ? -16.870 43.921 -2.714  1.00 63.59  ? 261 ASP C N     1 
ATOM   5009 C  CA    . ASP C 1 231 ? -15.856 44.750 -2.050  1.00 63.53  ? 261 ASP C CA    1 
ATOM   5010 C  C     . ASP C 1 231 ? -16.394 46.056 -1.444  1.00 63.20  ? 261 ASP C C     1 
ATOM   5011 O  O     . ASP C 1 231 ? -15.808 46.579 -0.493  1.00 62.96  ? 261 ASP C O     1 
ATOM   5012 C  CB    . ASP C 1 231 ? -14.730 45.092 -3.038  1.00 63.75  ? 261 ASP C CB    1 
ATOM   5013 N  N     . THR C 1 232 ? -17.493 46.584 -1.991  1.00 62.86  ? 262 THR C N     1 
ATOM   5014 C  CA    . THR C 1 232 ? -17.997 47.901 -1.579  1.00 62.67  ? 262 THR C CA    1 
ATOM   5015 C  C     . THR C 1 232 ? -19.147 47.791 -0.574  1.00 62.24  ? 262 THR C C     1 
ATOM   5016 O  O     . THR C 1 232 ? -19.927 46.845 -0.610  1.00 62.38  ? 262 THR C O     1 
ATOM   5017 C  CB    . THR C 1 232 ? -18.431 48.786 -2.797  1.00 62.72  ? 262 THR C CB    1 
ATOM   5018 O  OG1   . THR C 1 232 ? -19.809 48.556 -3.126  1.00 63.36  ? 262 THR C OG1   1 
ATOM   5019 C  CG2   . THR C 1 232 ? -17.551 48.520 -4.017  1.00 62.70  ? 262 THR C CG2   1 
ATOM   5020 N  N     . SER C 1 233 ? -19.237 48.772 0.319   1.00 61.79  ? 263 SER C N     1 
ATOM   5021 C  CA    . SER C 1 233 ? -20.278 48.800 1.337   1.00 61.66  ? 263 SER C CA    1 
ATOM   5022 C  C     . SER C 1 233 ? -21.582 49.304 0.743   1.00 61.44  ? 263 SER C C     1 
ATOM   5023 O  O     . SER C 1 233 ? -21.690 50.471 0.374   1.00 61.68  ? 263 SER C O     1 
ATOM   5024 C  CB    . SER C 1 233 ? -19.862 49.702 2.499   1.00 61.63  ? 263 SER C CB    1 
ATOM   5025 O  OG    . SER C 1 233 ? -18.716 49.184 3.153   1.00 61.87  ? 263 SER C OG    1 
ATOM   5026 N  N     . ILE C 1 234 ? -22.573 48.429 0.647   1.00 60.98  ? 264 ILE C N     1 
ATOM   5027 C  CA    . ILE C 1 234 ? -23.863 48.818 0.096   1.00 60.60  ? 264 ILE C CA    1 
ATOM   5028 C  C     . ILE C 1 234 ? -24.751 49.315 1.212   1.00 60.19  ? 264 ILE C C     1 
ATOM   5029 O  O     . ILE C 1 234 ? -25.015 48.581 2.166   1.00 60.41  ? 264 ILE C O     1 
ATOM   5030 C  CB    . ILE C 1 234 ? -24.547 47.645 -0.613  1.00 60.78  ? 264 ILE C CB    1 
ATOM   5031 C  CG1   . ILE C 1 234 ? -23.714 47.213 -1.826  1.00 61.20  ? 264 ILE C CG1   1 
ATOM   5032 C  CG2   . ILE C 1 234 ? -25.951 48.028 -1.047  1.00 60.53  ? 264 ILE C CG2   1 
ATOM   5033 C  CD1   . ILE C 1 234 ? -23.998 45.803 -2.288  1.00 62.22  ? 264 ILE C CD1   1 
ATOM   5034 N  N     . ILE C 1 235 ? -25.194 50.563 1.084   1.00 59.72  ? 265 ILE C N     1 
ATOM   5035 C  CA    . ILE C 1 235 ? -26.146 51.188 2.000   1.00 59.22  ? 265 ILE C CA    1 
ATOM   5036 C  C     . ILE C 1 235 ? -27.476 51.451 1.295   1.00 58.84  ? 265 ILE C C     1 
ATOM   5037 O  O     . ILE C 1 235 ? -27.509 51.932 0.160   1.00 58.58  ? 265 ILE C O     1 
ATOM   5038 C  CB    . ILE C 1 235 ? -25.610 52.537 2.524   1.00 59.26  ? 265 ILE C CB    1 
ATOM   5039 C  CG1   . ILE C 1 235 ? -24.275 52.344 3.241   1.00 59.27  ? 265 ILE C CG1   1 
ATOM   5040 C  CG2   . ILE C 1 235 ? -26.612 53.192 3.460   1.00 59.04  ? 265 ILE C CG2   1 
ATOM   5041 C  CD1   . ILE C 1 235 ? -23.082 52.550 2.350   1.00 60.02  ? 265 ILE C CD1   1 
ATOM   5042 N  N     . LEU C 1 236 ? -28.565 51.159 1.990   1.00 58.69  ? 266 LEU C N     1 
ATOM   5043 C  CA    . LEU C 1 236 ? -29.912 51.355 1.466   1.00 58.73  ? 266 LEU C CA    1 
ATOM   5044 C  C     . LEU C 1 236 ? -30.617 52.491 2.221   1.00 58.97  ? 266 LEU C C     1 
ATOM   5045 O  O     . LEU C 1 236 ? -30.884 52.366 3.416   1.00 59.05  ? 266 LEU C O     1 
ATOM   5046 C  CB    . LEU C 1 236 ? -30.707 50.057 1.606   1.00 58.56  ? 266 LEU C CB    1 
ATOM   5047 C  CG    . LEU C 1 236 ? -32.176 50.076 1.188   1.00 58.59  ? 266 LEU C CG    1 
ATOM   5048 C  CD1   . LEU C 1 236 ? -32.312 50.328 -0.312  1.00 58.84  ? 266 LEU C CD1   1 
ATOM   5049 C  CD2   . LEU C 1 236 ? -32.842 48.769 1.583   1.00 58.24  ? 266 LEU C CD2   1 
ATOM   5050 N  N     . PHE C 1 237 ? -30.899 53.589 1.518   1.00 59.07  ? 267 PHE C N     1 
ATOM   5051 C  CA    . PHE C 1 237 ? -31.635 54.731 2.068   1.00 59.37  ? 267 PHE C CA    1 
ATOM   5052 C  C     . PHE C 1 237 ? -33.103 54.640 1.697   1.00 59.48  ? 267 PHE C C     1 
ATOM   5053 O  O     . PHE C 1 237 ? -33.487 54.980 0.579   1.00 59.36  ? 267 PHE C O     1 
ATOM   5054 C  CB    . PHE C 1 237 ? -31.082 56.052 1.512   1.00 59.55  ? 267 PHE C CB    1 
ATOM   5055 C  CG    . PHE C 1 237 ? -29.948 56.635 2.297   1.00 59.49  ? 267 PHE C CG    1 
ATOM   5056 C  CD1   . PHE C 1 237 ? -29.122 55.841 3.094   1.00 60.30  ? 267 PHE C CD1   1 
ATOM   5057 C  CD2   . PHE C 1 237 ? -29.673 57.982 2.200   1.00 59.10  ? 267 PHE C CD2   1 
ATOM   5058 C  CE1   . PHE C 1 237 ? -28.056 56.406 3.808   1.00 60.01  ? 267 PHE C CE1   1 
ATOM   5059 C  CE2   . PHE C 1 237 ? -28.599 58.553 2.905   1.00 59.44  ? 267 PHE C CE2   1 
ATOM   5060 C  CZ    . PHE C 1 237 ? -27.798 57.765 3.708   1.00 59.32  ? 267 PHE C CZ    1 
ATOM   5061 N  N     . LEU C 1 238 ? -33.923 54.190 2.635   1.00 60.05  ? 268 LEU C N     1 
ATOM   5062 C  CA    . LEU C 1 238 ? -35.369 54.097 2.403   1.00 60.68  ? 268 LEU C CA    1 
ATOM   5063 C  C     . LEU C 1 238 ? -35.999 55.468 2.646   1.00 60.85  ? 268 LEU C C     1 
ATOM   5064 O  O     . LEU C 1 238 ? -36.348 55.808 3.769   1.00 61.37  ? 268 LEU C O     1 
ATOM   5065 C  CB    . LEU C 1 238 ? -35.988 53.031 3.313   1.00 60.81  ? 268 LEU C CB    1 
ATOM   5066 C  CG    . LEU C 1 238 ? -35.696 51.597 2.885   1.00 60.88  ? 268 LEU C CG    1 
ATOM   5067 C  CD1   . LEU C 1 238 ? -35.939 50.606 4.006   1.00 60.80  ? 268 LEU C CD1   1 
ATOM   5068 C  CD2   . LEU C 1 238 ? -36.551 51.265 1.664   1.00 62.32  ? 268 LEU C CD2   1 
ATOM   5069 N  N     . ASN C 1 239 ? -36.139 56.244 1.583   1.00 61.07  ? 269 ASN C N     1 
ATOM   5070 C  CA    . ASN C 1 239 ? -36.322 57.687 1.681   1.00 61.71  ? 269 ASN C CA    1 
ATOM   5071 C  C     . ASN C 1 239 ? -37.794 58.132 1.593   1.00 61.94  ? 269 ASN C C     1 
ATOM   5072 O  O     . ASN C 1 239 ? -38.701 57.299 1.515   1.00 62.13  ? 269 ASN C O     1 
ATOM   5073 C  CB    . ASN C 1 239 ? -35.489 58.348 0.572   1.00 61.94  ? 269 ASN C CB    1 
ATOM   5074 C  CG    . ASN C 1 239 ? -35.069 59.771 0.906   1.00 62.99  ? 269 ASN C CG    1 
ATOM   5075 O  OD1   . ASN C 1 239 ? -34.822 60.109 2.076   1.00 63.83  ? 269 ASN C OD1   1 
ATOM   5076 N  ND2   . ASN C 1 239 ? -34.982 60.619 -0.128  1.00 62.57  ? 269 ASN C ND2   1 
ATOM   5077 N  N     . LYS C 1 240 ? -38.021 59.445 1.617   1.00 61.98  ? 270 LYS C N     1 
ATOM   5078 C  CA    . LYS C 1 240 ? -39.365 60.020 1.580   1.00 62.26  ? 270 LYS C CA    1 
ATOM   5079 C  C     . LYS C 1 240 ? -40.283 59.376 2.617   1.00 62.58  ? 270 LYS C C     1 
ATOM   5080 O  O     . LYS C 1 240 ? -41.459 59.148 2.346   1.00 62.49  ? 270 LYS C O     1 
ATOM   5081 C  CB    . LYS C 1 240 ? -39.966 59.940 0.160   1.00 62.11  ? 270 LYS C CB    1 
ATOM   5082 C  CG    . LYS C 1 240 ? -39.511 61.075 -0.770  1.00 62.00  ? 270 LYS C CG    1 
ATOM   5083 C  CD    . LYS C 1 240 ? -39.718 60.742 -2.233  1.00 61.35  ? 270 LYS C CD    1 
ATOM   5084 C  CE    . LYS C 1 240 ? -39.285 61.883 -3.154  1.00 61.40  ? 270 LYS C CE    1 
ATOM   5085 N  NZ    . LYS C 1 240 ? -39.640 61.627 -4.594  1.00 59.53  ? 270 LYS C NZ    1 
ATOM   5086 N  N     . LYS C 1 241 ? -39.746 59.112 3.810   1.00 63.14  ? 271 LYS C N     1 
ATOM   5087 C  CA    . LYS C 1 241 ? -40.516 58.431 4.858   1.00 63.70  ? 271 LYS C CA    1 
ATOM   5088 C  C     . LYS C 1 241 ? -41.665 59.305 5.363   1.00 63.99  ? 271 LYS C C     1 
ATOM   5089 O  O     . LYS C 1 241 ? -42.762 58.808 5.651   1.00 64.28  ? 271 LYS C O     1 
ATOM   5090 C  CB    . LYS C 1 241 ? -39.616 57.950 6.007   1.00 63.62  ? 271 LYS C CB    1 
ATOM   5091 C  CG    . LYS C 1 241 ? -39.147 59.005 6.984   1.00 63.78  ? 271 LYS C CG    1 
ATOM   5092 C  CD    . LYS C 1 241 ? -38.048 58.445 7.907   1.00 63.93  ? 271 LYS C CD    1 
ATOM   5093 C  CE    . LYS C 1 241 ? -37.865 59.299 9.171   1.00 64.57  ? 271 LYS C CE    1 
ATOM   5094 N  NZ    . LYS C 1 241 ? -36.471 59.258 9.706   1.00 64.55  ? 271 LYS C NZ    1 
ATOM   5095 N  N     . ASP C 1 242 ? -41.413 60.607 5.437   1.00 64.14  ? 272 ASP C N     1 
ATOM   5096 C  CA    . ASP C 1 242 ? -42.467 61.588 5.725   1.00 64.17  ? 272 ASP C CA    1 
ATOM   5097 C  C     . ASP C 1 242 ? -43.635 61.510 4.726   1.00 64.11  ? 272 ASP C C     1 
ATOM   5098 O  O     . ASP C 1 242 ? -44.785 61.389 5.143   1.00 64.27  ? 272 ASP C O     1 
ATOM   5099 C  CB    . ASP C 1 242 ? -41.897 63.027 5.818   1.00 64.12  ? 272 ASP C CB    1 
ATOM   5100 C  CG    . ASP C 1 242 ? -40.987 63.395 4.645   1.00 63.96  ? 272 ASP C CG    1 
ATOM   5101 O  OD1   . ASP C 1 242 ? -40.542 62.492 3.907   1.00 65.09  ? 272 ASP C OD1   1 
ATOM   5102 O  OD2   . ASP C 1 242 ? -40.703 64.589 4.462   1.00 62.70  ? 272 ASP C OD2   1 
ATOM   5103 N  N     . LEU C 1 243 ? -43.346 61.559 3.425   1.00 64.20  ? 273 LEU C N     1 
ATOM   5104 C  CA    . LEU C 1 243 ? -44.395 61.434 2.398   1.00 64.61  ? 273 LEU C CA    1 
ATOM   5105 C  C     . LEU C 1 243 ? -45.162 60.103 2.531   1.00 64.77  ? 273 LEU C C     1 
ATOM   5106 O  O     . LEU C 1 243 ? -46.391 60.046 2.430   1.00 64.37  ? 273 LEU C O     1 
ATOM   5107 C  CB    . LEU C 1 243 ? -43.798 61.550 0.990   1.00 64.49  ? 273 LEU C CB    1 
ATOM   5108 C  CG    . LEU C 1 243 ? -43.158 62.899 0.611   1.00 65.24  ? 273 LEU C CG    1 
ATOM   5109 C  CD1   . LEU C 1 243 ? -42.627 62.861 -0.827  1.00 63.37  ? 273 LEU C CD1   1 
ATOM   5110 C  CD2   . LEU C 1 243 ? -44.136 64.093 0.817   1.00 64.52  ? 273 LEU C CD2   1 
ATOM   5111 N  N     . PHE C 1 244 ? -44.414 59.040 2.783   1.00 65.02  ? 274 PHE C N     1 
ATOM   5112 C  CA    . PHE C 1 244 ? -44.982 57.716 2.941   1.00 65.31  ? 274 PHE C CA    1 
ATOM   5113 C  C     . PHE C 1 244 ? -45.928 57.645 4.141   1.00 65.71  ? 274 PHE C C     1 
ATOM   5114 O  O     . PHE C 1 244 ? -46.998 57.043 4.063   1.00 65.56  ? 274 PHE C O     1 
ATOM   5115 C  CB    . PHE C 1 244 ? -43.847 56.696 3.087   1.00 65.08  ? 274 PHE C CB    1 
ATOM   5116 C  CG    . PHE C 1 244 ? -44.316 55.296 3.236   1.00 63.98  ? 274 PHE C CG    1 
ATOM   5117 C  CD1   . PHE C 1 244 ? -44.803 54.605 2.155   1.00 64.02  ? 274 PHE C CD1   1 
ATOM   5118 C  CD2   . PHE C 1 244 ? -44.261 54.666 4.458   1.00 63.53  ? 274 PHE C CD2   1 
ATOM   5119 C  CE1   . PHE C 1 244 ? -45.240 53.299 2.295   1.00 64.79  ? 274 PHE C CE1   1 
ATOM   5120 C  CE2   . PHE C 1 244 ? -44.697 53.370 4.607   1.00 63.90  ? 274 PHE C CE2   1 
ATOM   5121 C  CZ    . PHE C 1 244 ? -45.187 52.683 3.527   1.00 64.31  ? 274 PHE C CZ    1 
ATOM   5122 N  N     . GLU C 1 245 ? -45.528 58.275 5.235   1.00 66.25  ? 275 GLU C N     1 
ATOM   5123 C  CA    . GLU C 1 245 ? -46.270 58.210 6.491   1.00 67.20  ? 275 GLU C CA    1 
ATOM   5124 C  C     . GLU C 1 245 ? -47.671 58.817 6.395   1.00 66.87  ? 275 GLU C C     1 
ATOM   5125 O  O     . GLU C 1 245 ? -48.585 58.372 7.075   1.00 66.57  ? 275 GLU C O     1 
ATOM   5126 C  CB    . GLU C 1 245 ? -45.471 58.929 7.576   1.00 67.29  ? 275 GLU C CB    1 
ATOM   5127 C  CG    . GLU C 1 245 ? -46.036 58.829 8.988   1.00 68.49  ? 275 GLU C CG    1 
ATOM   5128 C  CD    . GLU C 1 245 ? -45.303 59.755 9.951   1.00 69.31  ? 275 GLU C CD    1 
ATOM   5129 O  OE1   . GLU C 1 245 ? -44.768 60.786 9.480   1.00 73.42  ? 275 GLU C OE1   1 
ATOM   5130 O  OE2   . GLU C 1 245 ? -45.258 59.465 11.171  1.00 71.80  ? 275 GLU C OE2   1 
ATOM   5131 N  N     . GLU C 1 246 ? -47.822 59.834 5.553   1.00 67.14  ? 276 GLU C N     1 
ATOM   5132 C  CA    . GLU C 1 246 ? -49.104 60.511 5.350   1.00 67.35  ? 276 GLU C CA    1 
ATOM   5133 C  C     . GLU C 1 246 ? -49.908 59.911 4.202   1.00 67.28  ? 276 GLU C C     1 
ATOM   5134 O  O     . GLU C 1 246 ? -51.091 60.204 4.044   1.00 67.69  ? 276 GLU C O     1 
ATOM   5135 C  CB    . GLU C 1 246 ? -48.871 62.002 5.088   1.00 67.39  ? 276 GLU C CB    1 
ATOM   5136 C  CG    . GLU C 1 246 ? -48.614 62.814 6.364   1.00 68.33  ? 276 GLU C CG    1 
ATOM   5137 N  N     . LYS C 1 247 ? -49.253 59.074 3.411   1.00 67.03  ? 277 LYS C N     1 
ATOM   5138 C  CA    . LYS C 1 247 ? -49.823 58.487 2.211   1.00 67.00  ? 277 LYS C CA    1 
ATOM   5139 C  C     . LYS C 1 247 ? -50.414 57.094 2.481   1.00 66.71  ? 277 LYS C C     1 
ATOM   5140 O  O     . LYS C 1 247 ? -51.375 56.679 1.824   1.00 66.37  ? 277 LYS C O     1 
ATOM   5141 C  CB    . LYS C 1 247 ? -48.686 58.369 1.193   1.00 67.22  ? 277 LYS C CB    1 
ATOM   5142 C  CG    . LYS C 1 247 ? -49.054 58.064 -0.245  1.00 67.37  ? 277 LYS C CG    1 
ATOM   5143 C  CD    . LYS C 1 247 ? -47.766 57.851 -1.045  1.00 67.49  ? 277 LYS C CD    1 
ATOM   5144 C  CE    . LYS C 1 247 ? -47.792 58.543 -2.387  1.00 68.16  ? 277 LYS C CE    1 
ATOM   5145 N  NZ    . LYS C 1 247 ? -48.691 57.845 -3.318  1.00 68.53  ? 277 LYS C NZ    1 
ATOM   5146 N  N     . ILE C 1 248 ? -49.833 56.386 3.452   1.00 66.38  ? 278 ILE C N     1 
ATOM   5147 C  CA    . ILE C 1 248 ? -50.049 54.950 3.619   1.00 66.12  ? 278 ILE C CA    1 
ATOM   5148 C  C     . ILE C 1 248 ? -51.449 54.596 4.105   1.00 66.19  ? 278 ILE C C     1 
ATOM   5149 O  O     . ILE C 1 248 ? -52.021 53.619 3.647   1.00 66.31  ? 278 ILE C O     1 
ATOM   5150 C  CB    . ILE C 1 248 ? -48.976 54.327 4.554   1.00 66.11  ? 278 ILE C CB    1 
ATOM   5151 C  CG1   . ILE C 1 248 ? -49.048 52.794 4.536   1.00 66.04  ? 278 ILE C CG1   1 
ATOM   5152 C  CG2   . ILE C 1 248 ? -49.124 54.846 5.987   1.00 65.69  ? 278 ILE C CG2   1 
ATOM   5153 C  CD1   . ILE C 1 248 ? -48.800 52.180 3.197   1.00 65.77  ? 278 ILE C CD1   1 
ATOM   5154 N  N     . LYS C 1 249 ? -52.002 55.390 5.018   1.00 66.38  ? 279 LYS C N     1 
ATOM   5155 C  CA    . LYS C 1 249 ? -53.371 55.171 5.502   1.00 66.57  ? 279 LYS C CA    1 
ATOM   5156 C  C     . LYS C 1 249 ? -54.431 55.671 4.510   1.00 66.54  ? 279 LYS C C     1 
ATOM   5157 O  O     . LYS C 1 249 ? -55.631 55.520 4.750   1.00 66.68  ? 279 LYS C O     1 
ATOM   5158 C  CB    . LYS C 1 249 ? -53.580 55.823 6.880   1.00 66.70  ? 279 LYS C CB    1 
ATOM   5159 C  CG    . LYS C 1 249 ? -53.181 57.304 6.954   1.00 67.37  ? 279 LYS C CG    1 
ATOM   5160 N  N     . LYS C 1 250 ? -53.982 56.254 3.401   1.00 66.38  ? 280 LYS C N     1 
ATOM   5161 C  CA    . LYS C 1 250 ? -54.869 56.779 2.370   1.00 66.45  ? 280 LYS C CA    1 
ATOM   5162 C  C     . LYS C 1 250 ? -54.831 55.943 1.080   1.00 66.05  ? 280 LYS C C     1 
ATOM   5163 O  O     . LYS C 1 250 ? -55.849 55.817 0.401   1.00 66.04  ? 280 LYS C O     1 
ATOM   5164 C  CB    . LYS C 1 250 ? -54.509 58.246 2.092   1.00 66.58  ? 280 LYS C CB    1 
ATOM   5165 C  CG    . LYS C 1 250 ? -54.443 59.110 3.391   1.00 67.25  ? 280 LYS C CG    1 
ATOM   5166 C  CD    . LYS C 1 250 ? -54.277 60.613 3.121   1.00 66.77  ? 280 LYS C CD    1 
ATOM   5167 N  N     . SER C 1 251 ? -53.676 55.358 0.756   1.00 65.50  ? 281 SER C N     1 
ATOM   5168 C  CA    . SER C 1 251 ? -53.519 54.545 -0.461  1.00 65.03  ? 281 SER C CA    1 
ATOM   5169 C  C     . SER C 1 251 ? -52.903 53.195 -0.113  1.00 64.44  ? 281 SER C C     1 
ATOM   5170 O  O     . SER C 1 251 ? -51.769 53.154 0.346   1.00 64.79  ? 281 SER C O     1 
ATOM   5171 C  CB    . SER C 1 251 ? -52.621 55.279 -1.471  1.00 65.19  ? 281 SER C CB    1 
ATOM   5172 O  OG    . SER C 1 251 ? -52.597 54.619 -2.728  1.00 65.51  ? 281 SER C OG    1 
ATOM   5173 N  N     . PRO C 1 252 ? -53.625 52.084 -0.355  1.00 63.64  ? 282 PRO C N     1 
ATOM   5174 C  CA    . PRO C 1 252 ? -53.192 50.780 0.181   1.00 63.18  ? 282 PRO C CA    1 
ATOM   5175 C  C     . PRO C 1 252 ? -51.950 50.175 -0.495  1.00 62.55  ? 282 PRO C C     1 
ATOM   5176 O  O     . PRO C 1 252 ? -51.774 50.321 -1.699  1.00 62.38  ? 282 PRO C O     1 
ATOM   5177 C  CB    . PRO C 1 252 ? -54.419 49.888 -0.036  1.00 63.13  ? 282 PRO C CB    1 
ATOM   5178 C  CG    . PRO C 1 252 ? -55.126 50.486 -1.194  1.00 63.31  ? 282 PRO C CG    1 
ATOM   5179 C  CD    . PRO C 1 252 ? -54.860 51.968 -1.152  1.00 63.66  ? 282 PRO C CD    1 
ATOM   5180 N  N     . LEU C 1 253 ? -51.105 49.502 0.293   1.00 62.00  ? 283 LEU C N     1 
ATOM   5181 C  CA    . LEU C 1 253 ? -49.839 48.914 -0.198  1.00 61.55  ? 283 LEU C CA    1 
ATOM   5182 C  C     . LEU C 1 253 ? -50.062 47.791 -1.195  1.00 61.47  ? 283 LEU C C     1 
ATOM   5183 O  O     . LEU C 1 253 ? -49.211 47.547 -2.045  1.00 61.03  ? 283 LEU C O     1 
ATOM   5184 C  CB    . LEU C 1 253 ? -48.994 48.394 0.969   1.00 61.45  ? 283 LEU C CB    1 
ATOM   5185 C  CG    . LEU C 1 253 ? -47.597 47.831 0.688   1.00 61.25  ? 283 LEU C CG    1 
ATOM   5186 C  CD1   . LEU C 1 253 ? -46.681 48.886 0.092   1.00 59.89  ? 283 LEU C CD1   1 
ATOM   5187 C  CD2   . LEU C 1 253 ? -46.994 47.249 1.963   1.00 61.04  ? 283 LEU C CD2   1 
ATOM   5188 N  N     . THR C 1 254 ? -51.217 47.129 -1.092  1.00 61.68  ? 284 THR C N     1 
ATOM   5189 C  CA    . THR C 1 254 ? -51.626 46.090 -2.041  1.00 61.86  ? 284 THR C CA    1 
ATOM   5190 C  C     . THR C 1 254 ? -51.642 46.530 -3.520  1.00 61.84  ? 284 THR C C     1 
ATOM   5191 O  O     . THR C 1 254 ? -51.720 45.691 -4.406  1.00 61.65  ? 284 THR C O     1 
ATOM   5192 C  CB    . THR C 1 254 ? -53.017 45.498 -1.670  1.00 62.10  ? 284 THR C CB    1 
ATOM   5193 O  OG1   . THR C 1 254 ? -53.990 46.547 -1.559  1.00 62.89  ? 284 THR C OG1   1 
ATOM   5194 C  CG2   . THR C 1 254 ? -52.951 44.747 -0.357  1.00 61.75  ? 284 THR C CG2   1 
ATOM   5195 N  N     . ILE C 1 255 ? -51.572 47.834 -3.790  1.00 62.27  ? 285 ILE C N     1 
ATOM   5196 C  CA    . ILE C 1 255 ? -51.393 48.321 -5.167  1.00 62.41  ? 285 ILE C CA    1 
ATOM   5197 C  C     . ILE C 1 255 ? -50.014 47.926 -5.674  1.00 62.85  ? 285 ILE C C     1 
ATOM   5198 O  O     . ILE C 1 255 ? -49.824 47.647 -6.862  1.00 63.29  ? 285 ILE C O     1 
ATOM   5199 C  CB    . ILE C 1 255 ? -51.519 49.857 -5.291  1.00 62.10  ? 285 ILE C CB    1 
ATOM   5200 C  CG1   . ILE C 1 255 ? -52.931 50.316 -4.957  1.00 61.25  ? 285 ILE C CG1   1 
ATOM   5201 C  CG2   . ILE C 1 255 ? -51.171 50.302 -6.709  1.00 61.51  ? 285 ILE C CG2   1 
ATOM   5202 C  CD1   . ILE C 1 255 ? -53.038 51.798 -4.703  1.00 60.90  ? 285 ILE C CD1   1 
ATOM   5203 N  N     . CYS C 1 256 ? -49.052 47.919 -4.766  1.00 63.09  ? 286 CYS C N     1 
ATOM   5204 C  CA    . CYS C 1 256 ? -47.712 47.496 -5.098  1.00 63.14  ? 286 CYS C CA    1 
ATOM   5205 C  C     . CYS C 1 256 ? -47.550 45.991 -4.900  1.00 62.82  ? 286 CYS C C     1 
ATOM   5206 O  O     . CYS C 1 256 ? -46.957 45.318 -5.727  1.00 62.95  ? 286 CYS C O     1 
ATOM   5207 C  CB    . CYS C 1 256 ? -46.711 48.239 -4.225  1.00 63.24  ? 286 CYS C CB    1 
ATOM   5208 S  SG    . CYS C 1 256 ? -45.036 47.978 -4.745  1.00 64.15  ? 286 CYS C SG    1 
ATOM   5209 N  N     . TYR C 1 257 ? -48.075 45.479 -3.792  1.00 62.57  ? 287 TYR C N     1 
ATOM   5210 C  CA    . TYR C 1 257 ? -47.891 44.091 -3.395  1.00 62.12  ? 287 TYR C CA    1 
ATOM   5211 C  C     . TYR C 1 257 ? -49.239 43.434 -3.120  1.00 61.94  ? 287 TYR C C     1 
ATOM   5212 O  O     . TYR C 1 257 ? -49.662 43.336 -1.963  1.00 61.65  ? 287 TYR C O     1 
ATOM   5213 C  CB    . TYR C 1 257 ? -47.044 44.032 -2.135  1.00 61.97  ? 287 TYR C CB    1 
ATOM   5214 C  CG    . TYR C 1 257 ? -45.667 44.596 -2.294  1.00 61.77  ? 287 TYR C CG    1 
ATOM   5215 C  CD1   . TYR C 1 257 ? -44.698 43.916 -3.020  1.00 61.79  ? 287 TYR C CD1   1 
ATOM   5216 C  CD2   . TYR C 1 257 ? -45.319 45.799 -1.699  1.00 61.06  ? 287 TYR C CD2   1 
ATOM   5217 C  CE1   . TYR C 1 257 ? -43.416 44.435 -3.156  1.00 61.99  ? 287 TYR C CE1   1 
ATOM   5218 C  CE2   . TYR C 1 257 ? -44.048 46.315 -1.825  1.00 60.97  ? 287 TYR C CE2   1 
ATOM   5219 C  CZ    . TYR C 1 257 ? -43.104 45.639 -2.553  1.00 61.12  ? 287 TYR C CZ    1 
ATOM   5220 O  OH    . TYR C 1 257 ? -41.844 46.169 -2.681  1.00 61.59  ? 287 TYR C OH    1 
ATOM   5221 N  N     . PRO C 1 258 ? -49.927 42.980 -4.182  1.00 61.80  ? 288 PRO C N     1 
ATOM   5222 C  CA    . PRO C 1 258 ? -51.259 42.376 -4.027  1.00 61.61  ? 288 PRO C CA    1 
ATOM   5223 C  C     . PRO C 1 258 ? -51.345 41.276 -2.967  1.00 61.35  ? 288 PRO C C     1 
ATOM   5224 O  O     . PRO C 1 258 ? -52.383 41.127 -2.336  1.00 61.19  ? 288 PRO C O     1 
ATOM   5225 C  CB    . PRO C 1 258 ? -51.541 41.812 -5.419  1.00 61.54  ? 288 PRO C CB    1 
ATOM   5226 C  CG    . PRO C 1 258 ? -50.789 42.713 -6.323  1.00 61.55  ? 288 PRO C CG    1 
ATOM   5227 C  CD    . PRO C 1 258 ? -49.518 43.027 -5.597  1.00 61.58  ? 288 PRO C CD    1 
ATOM   5228 N  N     . GLU C 1 259 ? -50.249 40.548 -2.760  1.00 61.33  ? 289 GLU C N     1 
ATOM   5229 C  CA    . GLU C 1 259 ? -50.185 39.467 -1.769  1.00 61.56  ? 289 GLU C CA    1 
ATOM   5230 C  C     . GLU C 1 259 ? -49.824 39.936 -0.343  1.00 61.09  ? 289 GLU C C     1 
ATOM   5231 O  O     . GLU C 1 259 ? -49.478 39.117 0.511   1.00 61.21  ? 289 GLU C O     1 
ATOM   5232 C  CB    . GLU C 1 259 ? -49.172 38.405 -2.228  1.00 61.59  ? 289 GLU C CB    1 
ATOM   5233 C  CG    . GLU C 1 259 ? -49.404 37.891 -3.656  1.00 62.39  ? 289 GLU C CG    1 
ATOM   5234 C  CD    . GLU C 1 259 ? -48.456 36.773 -4.040  1.00 62.85  ? 289 GLU C CD    1 
ATOM   5235 O  OE1   . GLU C 1 259 ? -47.435 36.589 -3.336  1.00 64.61  ? 289 GLU C OE1   1 
ATOM   5236 O  OE2   . GLU C 1 259 ? -48.735 36.078 -5.045  1.00 64.91  ? 289 GLU C OE2   1 
ATOM   5237 N  N     . TYR C 1 260 ? -49.907 41.239 -0.086  1.00 60.58  ? 290 TYR C N     1 
ATOM   5238 C  CA    . TYR C 1 260 ? -49.593 41.780 1.229   1.00 60.26  ? 290 TYR C CA    1 
ATOM   5239 C  C     . TYR C 1 260 ? -50.780 41.606 2.179   1.00 60.07  ? 290 TYR C C     1 
ATOM   5240 O  O     . TYR C 1 260 ? -51.884 42.072 1.892   1.00 59.84  ? 290 TYR C O     1 
ATOM   5241 C  CB    . TYR C 1 260 ? -49.191 43.255 1.116   1.00 59.83  ? 290 TYR C CB    1 
ATOM   5242 C  CG    . TYR C 1 260 ? -49.010 43.961 2.443   1.00 59.34  ? 290 TYR C CG    1 
ATOM   5243 C  CD1   . TYR C 1 260 ? -47.947 43.648 3.287   1.00 58.91  ? 290 TYR C CD1   1 
ATOM   5244 C  CD2   . TYR C 1 260 ? -49.907 44.951 2.851   1.00 58.77  ? 290 TYR C CD2   1 
ATOM   5245 C  CE1   . TYR C 1 260 ? -47.784 44.312 4.510   1.00 59.69  ? 290 TYR C CE1   1 
ATOM   5246 C  CE2   . TYR C 1 260 ? -49.760 45.612 4.060   1.00 58.41  ? 290 TYR C CE2   1 
ATOM   5247 C  CZ    . TYR C 1 260 ? -48.701 45.298 4.886   1.00 59.35  ? 290 TYR C CZ    1 
ATOM   5248 O  OH    . TYR C 1 260 ? -48.569 45.968 6.081   1.00 59.08  ? 290 TYR C OH    1 
ATOM   5249 N  N     . ALA C 1 261 ? -50.532 40.952 3.313   1.00 59.96  ? 291 ALA C N     1 
ATOM   5250 C  CA    . ALA C 1 261 ? -51.586 40.614 4.283   1.00 60.10  ? 291 ALA C CA    1 
ATOM   5251 C  C     . ALA C 1 261 ? -51.710 41.590 5.464   1.00 59.99  ? 291 ALA C C     1 
ATOM   5252 O  O     . ALA C 1 261 ? -52.717 41.579 6.173   1.00 59.88  ? 291 ALA C O     1 
ATOM   5253 C  CB    . ALA C 1 261 ? -51.367 39.188 4.812   1.00 60.18  ? 291 ALA C CB    1 
ATOM   5254 N  N     . GLY C 1 262 ? -50.696 42.425 5.679   1.00 59.91  ? 292 GLY C N     1 
ATOM   5255 C  CA    . GLY C 1 262 ? -50.698 43.367 6.803   1.00 59.95  ? 292 GLY C CA    1 
ATOM   5256 C  C     . GLY C 1 262 ? -51.659 44.535 6.642   1.00 59.74  ? 292 GLY C C     1 
ATOM   5257 O  O     . GLY C 1 262 ? -52.294 44.694 5.600   1.00 59.85  ? 292 GLY C O     1 
ATOM   5258 N  N     . SER C 1 263 ? -51.772 45.353 7.681   1.00 59.38  ? 293 SER C N     1 
ATOM   5259 C  CA    . SER C 1 263 ? -52.616 46.534 7.614   1.00 59.36  ? 293 SER C CA    1 
ATOM   5260 C  C     . SER C 1 263 ? -51.868 47.670 6.931   1.00 59.38  ? 293 SER C C     1 
ATOM   5261 O  O     . SER C 1 263 ? -50.640 47.646 6.822   1.00 59.25  ? 293 SER C O     1 
ATOM   5262 C  CB    . SER C 1 263 ? -53.075 46.951 9.009   1.00 59.29  ? 293 SER C CB    1 
ATOM   5263 O  OG    . SER C 1 263 ? -53.780 45.895 9.641   1.00 58.99  ? 293 SER C OG    1 
ATOM   5264 N  N     . ASN C 1 264 ? -52.618 48.659 6.462   1.00 59.54  ? 294 ASN C N     1 
ATOM   5265 C  CA    . ASN C 1 264 ? -52.028 49.837 5.841   1.00 59.83  ? 294 ASN C CA    1 
ATOM   5266 C  C     . ASN C 1 264 ? -51.622 50.885 6.885   1.00 59.90  ? 294 ASN C C     1 
ATOM   5267 O  O     . ASN C 1 264 ? -52.263 51.928 7.022   1.00 59.91  ? 294 ASN C O     1 
ATOM   5268 C  CB    . ASN C 1 264 ? -52.987 50.421 4.811   1.00 59.75  ? 294 ASN C CB    1 
ATOM   5269 C  CG    . ASN C 1 264 ? -53.173 49.506 3.624   1.00 60.16  ? 294 ASN C CG    1 
ATOM   5270 O  OD1   . ASN C 1 264 ? -52.213 49.160 2.927   1.00 59.63  ? 294 ASN C OD1   1 
ATOM   5271 N  ND2   . ASN C 1 264 ? -54.414 49.104 3.384   1.00 61.01  ? 294 ASN C ND2   1 
ATOM   5272 N  N     . THR C 1 265 ? -50.547 50.577 7.612   1.00 59.84  ? 295 THR C N     1 
ATOM   5273 C  CA    . THR C 1 265 ? -50.011 51.434 8.662   1.00 59.68  ? 295 THR C CA    1 
ATOM   5274 C  C     . THR C 1 265 ? -48.541 51.703 8.379   1.00 59.87  ? 295 THR C C     1 
ATOM   5275 O  O     . THR C 1 265 ? -47.898 50.934 7.676   1.00 60.13  ? 295 THR C O     1 
ATOM   5276 C  CB    . THR C 1 265 ? -50.132 50.754 10.038  1.00 59.44  ? 295 THR C CB    1 
ATOM   5277 O  OG1   . THR C 1 265 ? -49.170 49.704 10.134  1.00 58.57  ? 295 THR C OG1   1 
ATOM   5278 C  CG2   . THR C 1 265 ? -51.523 50.176 10.228  1.00 58.82  ? 295 THR C CG2   1 
ATOM   5279 N  N     . TYR C 1 266 ? -47.998 52.774 8.940   1.00 60.07  ? 296 TYR C N     1 
ATOM   5280 C  CA    . TYR C 1 266 ? -46.586 53.088 8.734   1.00 60.37  ? 296 TYR C CA    1 
ATOM   5281 C  C     . TYR C 1 266 ? -45.659 51.937 9.125   1.00 60.08  ? 296 TYR C C     1 
ATOM   5282 O  O     . TYR C 1 266 ? -44.869 51.474 8.301   1.00 60.23  ? 296 TYR C O     1 
ATOM   5283 C  CB    . TYR C 1 266 ? -46.190 54.336 9.523   1.00 61.04  ? 296 TYR C CB    1 
ATOM   5284 C  CG    . TYR C 1 266 ? -44.726 54.724 9.391   1.00 61.71  ? 296 TYR C CG    1 
ATOM   5285 C  CD1   . TYR C 1 266 ? -44.254 55.326 8.231   1.00 62.53  ? 296 TYR C CD1   1 
ATOM   5286 C  CD2   . TYR C 1 266 ? -43.819 54.496 10.428  1.00 62.03  ? 296 TYR C CD2   1 
ATOM   5287 C  CE1   . TYR C 1 266 ? -42.920 55.693 8.097   1.00 62.70  ? 296 TYR C CE1   1 
ATOM   5288 C  CE2   . TYR C 1 266 ? -42.480 54.862 10.307  1.00 62.54  ? 296 TYR C CE2   1 
ATOM   5289 C  CZ    . TYR C 1 266 ? -42.038 55.466 9.134   1.00 62.87  ? 296 TYR C CZ    1 
ATOM   5290 O  OH    . TYR C 1 266 ? -40.717 55.847 8.984   1.00 63.07  ? 296 TYR C OH    1 
ATOM   5291 N  N     . GLU C 1 267 ? -45.754 51.482 10.373  1.00 59.57  ? 297 GLU C N     1 
ATOM   5292 C  CA    . GLU C 1 267 ? -44.786 50.521 10.913  1.00 59.25  ? 297 GLU C CA    1 
ATOM   5293 C  C     . GLU C 1 267 ? -44.743 49.199 10.140  1.00 59.07  ? 297 GLU C C     1 
ATOM   5294 O  O     . GLU C 1 267 ? -43.663 48.673 9.862   1.00 58.96  ? 297 GLU C O     1 
ATOM   5295 C  CB    . GLU C 1 267 ? -45.008 50.274 12.421  1.00 59.23  ? 297 GLU C CB    1 
ATOM   5296 C  CG    . GLU C 1 267 ? -46.338 49.636 12.831  1.00 58.73  ? 297 GLU C CG    1 
ATOM   5297 C  CD    . GLU C 1 267 ? -47.470 50.627 13.016  1.00 58.06  ? 297 GLU C CD    1 
ATOM   5298 O  OE1   . GLU C 1 267 ? -48.483 50.248 13.634  1.00 58.34  ? 297 GLU C OE1   1 
ATOM   5299 O  OE2   . GLU C 1 267 ? -47.361 51.774 12.543  1.00 57.33  ? 297 GLU C OE2   1 
ATOM   5300 N  N     . GLU C 1 268 ? -45.915 48.687 9.777   1.00 58.72  ? 298 GLU C N     1 
ATOM   5301 C  CA    . GLU C 1 268 ? -46.029 47.366 9.164   1.00 58.51  ? 298 GLU C CA    1 
ATOM   5302 C  C     . GLU C 1 268 ? -45.768 47.428 7.668   1.00 58.18  ? 298 GLU C C     1 
ATOM   5303 O  O     . GLU C 1 268 ? -45.062 46.588 7.126   1.00 58.15  ? 298 GLU C O     1 
ATOM   5304 C  CB    . GLU C 1 268 ? -47.414 46.774 9.435   1.00 58.39  ? 298 GLU C CB    1 
ATOM   5305 C  CG    . GLU C 1 268 ? -47.562 45.319 9.042   1.00 58.61  ? 298 GLU C CG    1 
ATOM   5306 C  CD    . GLU C 1 268 ? -48.884 44.709 9.486   1.00 58.87  ? 298 GLU C CD    1 
ATOM   5307 O  OE1   . GLU C 1 268 ? -49.000 43.464 9.457   1.00 59.22  ? 298 GLU C OE1   1 
ATOM   5308 O  OE2   . GLU C 1 268 ? -49.802 45.465 9.870   1.00 59.62  ? 298 GLU C OE2   1 
ATOM   5309 N  N     . ALA C 1 269 ? -46.349 48.416 7.004   1.00 58.03  ? 299 ALA C N     1 
ATOM   5310 C  CA    . ALA C 1 269 ? -46.116 48.610 5.585   1.00 58.18  ? 299 ALA C CA    1 
ATOM   5311 C  C     . ALA C 1 269 ? -44.632 48.865 5.311   1.00 58.29  ? 299 ALA C C     1 
ATOM   5312 O  O     . ALA C 1 269 ? -44.045 48.235 4.440   1.00 58.43  ? 299 ALA C O     1 
ATOM   5313 C  CB    . ALA C 1 269 ? -46.954 49.757 5.069   1.00 58.05  ? 299 ALA C CB    1 
ATOM   5314 N  N     . ALA C 1 270 ? -44.040 49.782 6.073   1.00 58.34  ? 300 ALA C N     1 
ATOM   5315 C  CA    . ALA C 1 270 ? -42.633 50.144 5.931   1.00 58.30  ? 300 ALA C CA    1 
ATOM   5316 C  C     . ALA C 1 270 ? -41.707 48.970 6.210   1.00 58.42  ? 300 ALA C C     1 
ATOM   5317 O  O     . ALA C 1 270 ? -40.697 48.781 5.514   1.00 58.63  ? 300 ALA C O     1 
ATOM   5318 C  CB    . ALA C 1 270 ? -42.298 51.269 6.874   1.00 58.47  ? 300 ALA C CB    1 
ATOM   5319 N  N     . ALA C 1 271 ? -42.021 48.200 7.246   1.00 57.84  ? 301 ALA C N     1 
ATOM   5320 C  CA    . ALA C 1 271 ? -41.231 47.023 7.530   1.00 57.81  ? 301 ALA C CA    1 
ATOM   5321 C  C     . ALA C 1 271 ? -41.281 46.104 6.307   1.00 57.67  ? 301 ALA C C     1 
ATOM   5322 O  O     . ALA C 1 271 ? -40.259 45.589 5.860   1.00 57.47  ? 301 ALA C O     1 
ATOM   5323 C  CB    . ALA C 1 271 ? -41.746 46.307 8.774   1.00 57.68  ? 301 ALA C CB    1 
ATOM   5324 N  N     . TYR C 1 272 ? -42.479 45.941 5.753   1.00 57.59  ? 302 TYR C N     1 
ATOM   5325 C  CA    . TYR C 1 272 ? -42.705 45.005 4.665   1.00 57.51  ? 302 TYR C CA    1 
ATOM   5326 C  C     . TYR C 1 272 ? -41.861 45.380 3.473   1.00 57.46  ? 302 TYR C C     1 
ATOM   5327 O  O     . TYR C 1 272 ? -41.247 44.523 2.859   1.00 57.58  ? 302 TYR C O     1 
ATOM   5328 C  CB    . TYR C 1 272 ? -44.179 44.986 4.264   1.00 57.71  ? 302 TYR C CB    1 
ATOM   5329 C  CG    . TYR C 1 272 ? -44.546 43.839 3.360   1.00 57.33  ? 302 TYR C CG    1 
ATOM   5330 C  CD1   . TYR C 1 272 ? -44.662 42.559 3.863   1.00 56.58  ? 302 TYR C CD1   1 
ATOM   5331 C  CD2   . TYR C 1 272 ? -44.774 44.040 2.005   1.00 57.29  ? 302 TYR C CD2   1 
ATOM   5332 C  CE1   . TYR C 1 272 ? -44.996 41.500 3.048   1.00 57.72  ? 302 TYR C CE1   1 
ATOM   5333 C  CE2   . TYR C 1 272 ? -45.118 42.991 1.172   1.00 57.46  ? 302 TYR C CE2   1 
ATOM   5334 C  CZ    . TYR C 1 272 ? -45.228 41.716 1.697   1.00 58.42  ? 302 TYR C CZ    1 
ATOM   5335 O  OH    . TYR C 1 272 ? -45.579 40.649 0.886   1.00 58.27  ? 302 TYR C OH    1 
ATOM   5336 N  N     . ILE C 1 273 ? -41.823 46.667 3.159   1.00 57.46  ? 303 ILE C N     1 
ATOM   5337 C  CA    . ILE C 1 273 ? -40.993 47.153 2.068   1.00 57.51  ? 303 ILE C CA    1 
ATOM   5338 C  C     . ILE C 1 273 ? -39.506 46.920 2.386   1.00 58.18  ? 303 ILE C C     1 
ATOM   5339 O  O     . ILE C 1 273 ? -38.753 46.493 1.515   1.00 58.25  ? 303 ILE C O     1 
ATOM   5340 C  CB    . ILE C 1 273 ? -41.271 48.638 1.749   1.00 57.02  ? 303 ILE C CB    1 
ATOM   5341 C  CG1   . ILE C 1 273 ? -42.698 48.800 1.232   1.00 56.73  ? 303 ILE C CG1   1 
ATOM   5342 C  CG2   . ILE C 1 273 ? -40.291 49.159 0.719   1.00 55.59  ? 303 ILE C CG2   1 
ATOM   5343 C  CD1   . ILE C 1 273 ? -43.229 50.218 1.334   1.00 56.19  ? 303 ILE C CD1   1 
ATOM   5344 N  N     . GLN C 1 274 ? -39.079 47.174 3.620   1.00 58.72  ? 304 GLN C N     1 
ATOM   5345 C  CA    . GLN C 1 274 ? -37.671 46.958 3.945   1.00 59.50  ? 304 GLN C CA    1 
ATOM   5346 C  C     . GLN C 1 274 ? -37.253 45.505 3.690   1.00 59.66  ? 304 GLN C C     1 
ATOM   5347 O  O     . GLN C 1 274 ? -36.140 45.235 3.262   1.00 59.48  ? 304 GLN C O     1 
ATOM   5348 C  CB    . GLN C 1 274 ? -37.337 47.350 5.391   1.00 59.74  ? 304 GLN C CB    1 
ATOM   5349 C  CG    . GLN C 1 274 ? -35.952 46.824 5.828   1.00 60.51  ? 304 GLN C CG    1 
ATOM   5350 C  CD    . GLN C 1 274 ? -35.389 47.515 7.046   1.00 61.49  ? 304 GLN C CD    1 
ATOM   5351 O  OE1   . GLN C 1 274 ? -36.117 48.119 7.821   1.00 62.93  ? 304 GLN C OE1   1 
ATOM   5352 N  NE2   . GLN C 1 274 ? -34.078 47.413 7.228   1.00 61.78  ? 304 GLN C NE2   1 
ATOM   5353 N  N     . CYS C 1 275 ? -38.155 44.576 3.957   1.00 60.12  ? 305 CYS C N     1 
ATOM   5354 C  CA    . CYS C 1 275 ? -37.852 43.167 3.787   1.00 60.62  ? 305 CYS C CA    1 
ATOM   5355 C  C     . CYS C 1 275 ? -37.869 42.731 2.332   1.00 60.78  ? 305 CYS C C     1 
ATOM   5356 O  O     . CYS C 1 275 ? -37.013 41.950 1.914   1.00 60.88  ? 305 CYS C O     1 
ATOM   5357 C  CB    . CYS C 1 275 ? -38.817 42.337 4.614   1.00 60.58  ? 305 CYS C CB    1 
ATOM   5358 S  SG    . CYS C 1 275 ? -38.505 42.606 6.358   1.00 61.91  ? 305 CYS C SG    1 
ATOM   5359 N  N     . GLN C 1 276 ? -38.825 43.246 1.561   1.00 60.92  ? 306 GLN C N     1 
ATOM   5360 C  CA    . GLN C 1 276 ? -38.880 42.949 0.139   1.00 61.13  ? 306 GLN C CA    1 
ATOM   5361 C  C     . GLN C 1 276 ? -37.536 43.236 -0.497  1.00 61.28  ? 306 GLN C C     1 
ATOM   5362 O  O     . GLN C 1 276 ? -37.025 42.421 -1.243  1.00 61.20  ? 306 GLN C O     1 
ATOM   5363 C  CB    . GLN C 1 276 ? -39.977 43.754 -0.557  1.00 61.16  ? 306 GLN C CB    1 
ATOM   5364 C  CG    . GLN C 1 276 ? -41.389 43.326 -0.179  1.00 61.61  ? 306 GLN C CG    1 
ATOM   5365 C  CD    . GLN C 1 276 ? -41.660 41.858 -0.466  1.00 62.01  ? 306 GLN C CD    1 
ATOM   5366 O  OE1   . GLN C 1 276 ? -41.469 41.390 -1.592  1.00 62.07  ? 306 GLN C OE1   1 
ATOM   5367 N  NE2   . GLN C 1 276 ? -42.109 41.123 0.554   1.00 61.92  ? 306 GLN C NE2   1 
ATOM   5368 N  N     . PHE C 1 277 ? -36.961 44.387 -0.176  1.00 61.81  ? 307 PHE C N     1 
ATOM   5369 C  CA    . PHE C 1 277 ? -35.663 44.769 -0.715  1.00 62.38  ? 307 PHE C CA    1 
ATOM   5370 C  C     . PHE C 1 277 ? -34.553 43.930 -0.105  1.00 63.03  ? 307 PHE C C     1 
ATOM   5371 O  O     . PHE C 1 277 ? -33.771 43.316 -0.822  1.00 63.16  ? 307 PHE C O     1 
ATOM   5372 C  CB    . PHE C 1 277 ? -35.384 46.258 -0.483  1.00 62.37  ? 307 PHE C CB    1 
ATOM   5373 C  CG    . PHE C 1 277 ? -36.005 47.162 -1.521  1.00 62.23  ? 307 PHE C CG    1 
ATOM   5374 C  CD1   . PHE C 1 277 ? -37.307 47.624 -1.373  1.00 61.97  ? 307 PHE C CD1   1 
ATOM   5375 C  CD2   . PHE C 1 277 ? -35.289 47.542 -2.646  1.00 62.01  ? 307 PHE C CD2   1 
ATOM   5376 C  CE1   . PHE C 1 277 ? -37.889 48.449 -2.326  1.00 61.72  ? 307 PHE C CE1   1 
ATOM   5377 C  CE2   . PHE C 1 277 ? -35.864 48.364 -3.607  1.00 62.29  ? 307 PHE C CE2   1 
ATOM   5378 C  CZ    . PHE C 1 277 ? -37.172 48.821 -3.439  1.00 62.35  ? 307 PHE C CZ    1 
ATOM   5379 N  N     . GLU C 1 278 ? -34.490 43.885 1.218   1.00 63.76  ? 308 GLU C N     1 
ATOM   5380 C  CA    . GLU C 1 278 ? -33.406 43.177 1.879   1.00 64.30  ? 308 GLU C CA    1 
ATOM   5381 C  C     . GLU C 1 278 ? -33.352 41.729 1.431   1.00 64.66  ? 308 GLU C C     1 
ATOM   5382 O  O     . GLU C 1 278 ? -32.269 41.195 1.236   1.00 64.87  ? 308 GLU C O     1 
ATOM   5383 C  CB    . GLU C 1 278 ? -33.498 43.299 3.401   1.00 64.21  ? 308 GLU C CB    1 
ATOM   5384 C  CG    . GLU C 1 278 ? -32.941 44.628 3.910   1.00 64.39  ? 308 GLU C CG    1 
ATOM   5385 C  CD    . GLU C 1 278 ? -32.928 44.751 5.428   1.00 65.22  ? 308 GLU C CD    1 
ATOM   5386 O  OE1   . GLU C 1 278 ? -33.443 43.834 6.124   1.00 66.55  ? 308 GLU C OE1   1 
ATOM   5387 O  OE2   . GLU C 1 278 ? -32.393 45.776 5.925   1.00 65.99  ? 308 GLU C OE2   1 
ATOM   5388 N  N     . ASP C 1 279 ? -34.515 41.117 1.209   1.00 65.27  ? 309 ASP C N     1 
ATOM   5389 C  CA    . ASP C 1 279 ? -34.576 39.722 0.741   1.00 65.81  ? 309 ASP C CA    1 
ATOM   5390 C  C     . ASP C 1 279 ? -34.144 39.513 -0.723  1.00 65.79  ? 309 ASP C C     1 
ATOM   5391 O  O     . ASP C 1 279 ? -34.134 38.393 -1.192  1.00 65.95  ? 309 ASP C O     1 
ATOM   5392 C  CB    . ASP C 1 279 ? -35.985 39.140 0.925   1.00 66.10  ? 309 ASP C CB    1 
ATOM   5393 C  CG    . ASP C 1 279 ? -36.465 39.186 2.372   1.00 67.53  ? 309 ASP C CG    1 
ATOM   5394 O  OD1   . ASP C 1 279 ? -35.630 39.286 3.301   1.00 68.68  ? 309 ASP C OD1   1 
ATOM   5395 O  OD2   . ASP C 1 279 ? -37.700 39.128 2.577   1.00 70.23  ? 309 ASP C OD2   1 
ATOM   5396 N  N     . LEU C 1 280 ? -33.802 40.570 -1.453  1.00 65.96  ? 310 LEU C N     1 
ATOM   5397 C  CA    . LEU C 1 280 ? -33.219 40.397 -2.788  1.00 65.99  ? 310 LEU C CA    1 
ATOM   5398 C  C     . LEU C 1 280 ? -31.747 39.992 -2.719  1.00 66.41  ? 310 LEU C C     1 
ATOM   5399 O  O     . LEU C 1 280 ? -31.194 39.519 -3.709  1.00 66.38  ? 310 LEU C O     1 
ATOM   5400 C  CB    . LEU C 1 280 ? -33.361 41.669 -3.621  1.00 65.73  ? 310 LEU C CB    1 
ATOM   5401 C  CG    . LEU C 1 280 ? -34.797 42.093 -3.935  1.00 65.05  ? 310 LEU C CG    1 
ATOM   5402 C  CD1   . LEU C 1 280 ? -34.815 43.493 -4.532  1.00 64.08  ? 310 LEU C CD1   1 
ATOM   5403 C  CD2   . LEU C 1 280 ? -35.470 41.092 -4.862  1.00 63.47  ? 310 LEU C CD2   1 
ATOM   5404 N  N     . ASN C 1 281 ? -31.119 40.180 -1.557  1.00 67.03  ? 311 ASN C N     1 
ATOM   5405 C  CA    . ASN C 1 281 ? -29.712 39.818 -1.365  1.00 67.54  ? 311 ASN C CA    1 
ATOM   5406 C  C     . ASN C 1 281 ? -29.546 38.312 -1.306  1.00 68.00  ? 311 ASN C C     1 
ATOM   5407 O  O     . ASN C 1 281 ? -30.040 37.671 -0.379  1.00 68.34  ? 311 ASN C O     1 
ATOM   5408 C  CB    . ASN C 1 281 ? -29.166 40.443 -0.077  1.00 67.62  ? 311 ASN C CB    1 
ATOM   5409 C  CG    . ASN C 1 281 ? -27.724 40.043 0.214   1.00 67.77  ? 311 ASN C CG    1 
ATOM   5410 O  OD1   . ASN C 1 281 ? -27.005 39.554 -0.664  1.00 68.17  ? 311 ASN C OD1   1 
ATOM   5411 N  ND2   . ASN C 1 281 ? -27.295 40.252 1.457   1.00 66.98  ? 311 ASN C ND2   1 
ATOM   5412 N  N     . LYS C 1 282 ? -28.839 37.754 -2.283  1.00 68.53  ? 312 LYS C N     1 
ATOM   5413 C  CA    . LYS C 1 282 ? -28.638 36.307 -2.353  1.00 69.14  ? 312 LYS C CA    1 
ATOM   5414 C  C     . LYS C 1 282 ? -27.517 35.819 -1.442  1.00 69.70  ? 312 LYS C C     1 
ATOM   5415 O  O     . LYS C 1 282 ? -27.492 34.650 -1.078  1.00 69.71  ? 312 LYS C O     1 
ATOM   5416 C  CB    . LYS C 1 282 ? -28.383 35.877 -3.795  1.00 69.19  ? 312 LYS C CB    1 
ATOM   5417 C  CG    . LYS C 1 282 ? -29.627 36.002 -4.657  1.00 69.54  ? 312 LYS C CG    1 
ATOM   5418 C  CD    . LYS C 1 282 ? -29.343 35.859 -6.141  1.00 69.64  ? 312 LYS C CD    1 
ATOM   5419 C  CE    . LYS C 1 282 ? -30.560 36.278 -6.954  1.00 69.59  ? 312 LYS C CE    1 
ATOM   5420 N  NZ    . LYS C 1 282 ? -30.401 35.985 -8.396  1.00 69.78  ? 312 LYS C NZ    1 
ATOM   5421 N  N     . ARG C 1 283 ? -26.604 36.715 -1.068  1.00 70.47  ? 313 ARG C N     1 
ATOM   5422 C  CA    . ARG C 1 283 ? -25.506 36.379 -0.163  1.00 71.09  ? 313 ARG C CA    1 
ATOM   5423 C  C     . ARG C 1 283 ? -25.750 36.943 1.240   1.00 71.18  ? 313 ARG C C     1 
ATOM   5424 O  O     . ARG C 1 283 ? -24.880 37.607 1.811   1.00 71.18  ? 313 ARG C O     1 
ATOM   5425 C  CB    . ARG C 1 283 ? -24.167 36.883 -0.731  1.00 71.34  ? 313 ARG C CB    1 
ATOM   5426 C  CG    . ARG C 1 283 ? -23.534 35.945 -1.743  1.00 73.14  ? 313 ARG C CG    1 
ATOM   5427 C  CD    . ARG C 1 283 ? -24.117 36.112 -3.136  1.00 75.96  ? 313 ARG C CD    1 
ATOM   5428 N  NE    . ARG C 1 283 ? -23.423 37.155 -3.897  1.00 77.69  ? 313 ARG C NE    1 
ATOM   5429 C  CZ    . ARG C 1 283 ? -23.658 37.456 -5.179  1.00 78.20  ? 313 ARG C CZ    1 
ATOM   5430 N  NH1   . ARG C 1 283 ? -24.590 36.809 -5.877  1.00 78.69  ? 313 ARG C NH1   1 
ATOM   5431 N  NH2   . ARG C 1 283 ? -22.951 38.418 -5.769  1.00 77.94  ? 313 ARG C NH2   1 
ATOM   5432 N  N     . LYS C 1 284 ? -26.928 36.664 1.802   1.00 71.42  ? 314 LYS C N     1 
ATOM   5433 C  CA    . LYS C 1 284 ? -27.257 37.110 3.169   1.00 71.66  ? 314 LYS C CA    1 
ATOM   5434 C  C     . LYS C 1 284 ? -26.172 36.655 4.140   1.00 71.53  ? 314 LYS C C     1 
ATOM   5435 O  O     . LYS C 1 284 ? -25.747 37.413 5.012   1.00 71.88  ? 314 LYS C O     1 
ATOM   5436 C  CB    . LYS C 1 284 ? -28.605 36.543 3.644   1.00 71.76  ? 314 LYS C CB    1 
ATOM   5437 C  CG    . LYS C 1 284 ? -29.858 37.092 2.951   1.00 72.00  ? 314 LYS C CG    1 
ATOM   5438 C  CD    . LYS C 1 284 ? -31.124 36.478 3.586   1.00 72.02  ? 314 LYS C CD    1 
ATOM   5439 C  CE    . LYS C 1 284 ? -32.426 36.971 2.947   1.00 71.90  ? 314 LYS C CE    1 
ATOM   5440 N  NZ    . LYS C 1 284 ? -32.693 36.354 1.604   1.00 71.42  ? 314 LYS C NZ    1 
ATOM   5441 N  N     . ASP C 1 285 ? -25.726 35.414 3.973   1.00 71.27  ? 315 ASP C N     1 
ATOM   5442 C  CA    . ASP C 1 285 ? -24.696 34.831 4.831   1.00 71.13  ? 315 ASP C CA    1 
ATOM   5443 C  C     . ASP C 1 285 ? -23.386 35.619 4.863   1.00 70.79  ? 315 ASP C C     1 
ATOM   5444 O  O     . ASP C 1 285 ? -22.648 35.532 5.851   1.00 70.90  ? 315 ASP C O     1 
ATOM   5445 C  CB    . ASP C 1 285 ? -24.384 33.390 4.391   1.00 71.29  ? 315 ASP C CB    1 
ATOM   5446 C  CG    . ASP C 1 285 ? -25.461 32.387 4.806   1.00 71.64  ? 315 ASP C CG    1 
ATOM   5447 O  OD1   . ASP C 1 285 ? -26.471 32.797 5.428   1.00 71.89  ? 315 ASP C OD1   1 
ATOM   5448 O  OD2   . ASP C 1 285 ? -25.284 31.179 4.504   1.00 71.36  ? 315 ASP C OD2   1 
ATOM   5449 N  N     . THR C 1 286 ? -23.079 36.353 3.791   1.00 70.25  ? 316 THR C N     1 
ATOM   5450 C  CA    . THR C 1 286 ? -21.781 37.037 3.679   1.00 69.91  ? 316 THR C CA    1 
ATOM   5451 C  C     . THR C 1 286 ? -21.838 38.508 3.282   1.00 69.46  ? 316 THR C C     1 
ATOM   5452 O  O     . THR C 1 286 ? -20.846 39.213 3.447   1.00 69.57  ? 316 THR C O     1 
ATOM   5453 C  CB    . THR C 1 286 ? -20.850 36.315 2.674   1.00 70.01  ? 316 THR C CB    1 
ATOM   5454 O  OG1   . THR C 1 286 ? -21.303 36.541 1.332   1.00 70.12  ? 316 THR C OG1   1 
ATOM   5455 C  CG2   . THR C 1 286 ? -20.805 34.815 2.958   1.00 70.05  ? 316 THR C CG2   1 
ATOM   5456 N  N     . LYS C 1 287 ? -22.970 38.962 2.749   1.00 68.92  ? 317 LYS C N     1 
ATOM   5457 C  CA    . LYS C 1 287 ? -23.144 40.360 2.342   1.00 68.58  ? 317 LYS C CA    1 
ATOM   5458 C  C     . LYS C 1 287 ? -24.158 41.052 3.258   1.00 68.12  ? 317 LYS C C     1 
ATOM   5459 O  O     . LYS C 1 287 ? -25.269 40.544 3.459   1.00 68.11  ? 317 LYS C O     1 
ATOM   5460 C  CB    . LYS C 1 287 ? -23.624 40.425 0.881   1.00 68.69  ? 317 LYS C CB    1 
ATOM   5461 C  CG    . LYS C 1 287 ? -23.609 41.815 0.238   1.00 68.37  ? 317 LYS C CG    1 
ATOM   5462 C  CD    . LYS C 1 287 ? -22.193 42.270 -0.076  1.00 68.62  ? 317 LYS C CD    1 
ATOM   5463 C  CE    . LYS C 1 287 ? -22.172 43.654 -0.700  1.00 68.68  ? 317 LYS C CE    1 
ATOM   5464 N  NZ    . LYS C 1 287 ? -20.823 44.276 -0.613  1.00 68.79  ? 317 LYS C NZ    1 
ATOM   5465 N  N     . GLU C 1 288 ? -23.778 42.202 3.813   1.00 67.52  ? 318 GLU C N     1 
ATOM   5466 C  CA    . GLU C 1 288 ? -24.680 42.958 4.678   1.00 67.14  ? 318 GLU C CA    1 
ATOM   5467 C  C     . GLU C 1 288 ? -25.212 44.199 3.970   1.00 66.55  ? 318 GLU C C     1 
ATOM   5468 O  O     . GLU C 1 288 ? -24.458 44.897 3.298   1.00 66.74  ? 318 GLU C O     1 
ATOM   5469 C  CB    . GLU C 1 288 ? -23.989 43.358 5.977   1.00 67.21  ? 318 GLU C CB    1 
ATOM   5470 C  CG    . GLU C 1 288 ? -24.893 44.193 6.905   1.00 67.83  ? 318 GLU C CG    1 
ATOM   5471 C  CD    . GLU C 1 288 ? -24.707 43.899 8.395   1.00 68.73  ? 318 GLU C CD    1 
ATOM   5472 O  OE1   . GLU C 1 288 ? -23.899 43.009 8.760   1.00 69.41  ? 318 GLU C OE1   1 
ATOM   5473 O  OE2   . GLU C 1 288 ? -25.390 44.565 9.204   1.00 68.75  ? 318 GLU C OE2   1 
ATOM   5474 N  N     . ILE C 1 289 ? -26.515 44.446 4.114   1.00 65.61  ? 319 ILE C N     1 
ATOM   5475 C  CA    . ILE C 1 289 ? -27.133 45.683 3.646   1.00 65.09  ? 319 ILE C CA    1 
ATOM   5476 C  C     . ILE C 1 289 ? -27.354 46.577 4.860   1.00 64.46  ? 319 ILE C C     1 
ATOM   5477 O  O     . ILE C 1 289 ? -28.029 46.178 5.796   1.00 64.51  ? 319 ILE C O     1 
ATOM   5478 C  CB    . ILE C 1 289 ? -28.491 45.436 2.932   1.00 64.99  ? 319 ILE C CB    1 
ATOM   5479 C  CG1   . ILE C 1 289 ? -28.314 44.526 1.715   1.00 65.02  ? 319 ILE C CG1   1 
ATOM   5480 C  CG2   . ILE C 1 289 ? -29.090 46.737 2.486   1.00 64.17  ? 319 ILE C CG2   1 
ATOM   5481 C  CD1   . ILE C 1 289 ? -27.361 45.083 0.659   1.00 65.06  ? 319 ILE C CD1   1 
ATOM   5482 N  N     . TYR C 1 290 ? -26.771 47.773 4.839   1.00 63.73  ? 320 TYR C N     1 
ATOM   5483 C  CA    . TYR C 1 290 ? -26.872 48.709 5.950   1.00 63.21  ? 320 TYR C CA    1 
ATOM   5484 C  C     . TYR C 1 290 ? -28.008 49.689 5.660   1.00 62.96  ? 320 TYR C C     1 
ATOM   5485 O  O     . TYR C 1 290 ? -27.844 50.628 4.878   1.00 62.98  ? 320 TYR C O     1 
ATOM   5486 C  CB    . TYR C 1 290 ? -25.548 49.449 6.139   1.00 63.18  ? 320 TYR C CB    1 
ATOM   5487 C  CG    . TYR C 1 290 ? -24.337 48.540 6.270   1.00 62.94  ? 320 TYR C CG    1 
ATOM   5488 C  CD1   . TYR C 1 290 ? -23.997 47.982 7.494   1.00 62.80  ? 320 TYR C CD1   1 
ATOM   5489 C  CD2   . TYR C 1 290 ? -23.524 48.255 5.170   1.00 62.99  ? 320 TYR C CD2   1 
ATOM   5490 C  CE1   . TYR C 1 290 ? -22.885 47.151 7.626   1.00 63.67  ? 320 TYR C CE1   1 
ATOM   5491 C  CE2   . TYR C 1 290 ? -22.402 47.424 5.288   1.00 63.34  ? 320 TYR C CE2   1 
ATOM   5492 C  CZ    . TYR C 1 290 ? -22.090 46.873 6.521   1.00 63.62  ? 320 TYR C CZ    1 
ATOM   5493 O  OH    . TYR C 1 290 ? -20.994 46.050 6.668   1.00 62.91  ? 320 TYR C OH    1 
ATOM   5494 N  N     . THR C 1 291 ? -29.159 49.465 6.294   1.00 62.38  ? 321 THR C N     1 
ATOM   5495 C  CA    . THR C 1 291 ? -30.393 50.138 5.909   1.00 61.85  ? 321 THR C CA    1 
ATOM   5496 C  C     . THR C 1 291 ? -30.776 51.231 6.887   1.00 61.63  ? 321 THR C C     1 
ATOM   5497 O  O     . THR C 1 291 ? -30.636 51.074 8.096   1.00 61.03  ? 321 THR C O     1 
ATOM   5498 C  CB    . THR C 1 291 ? -31.549 49.127 5.798   1.00 61.93  ? 321 THR C CB    1 
ATOM   5499 O  OG1   . THR C 1 291 ? -31.138 48.048 4.950   1.00 62.66  ? 321 THR C OG1   1 
ATOM   5500 C  CG2   . THR C 1 291 ? -32.809 49.766 5.229   1.00 60.19  ? 321 THR C CG2   1 
ATOM   5501 N  N     . HIS C 1 292 ? -31.260 52.342 6.336   1.00 61.49  ? 322 HIS C N     1 
ATOM   5502 C  CA    . HIS C 1 292 ? -31.732 53.462 7.129   1.00 61.50  ? 322 HIS C CA    1 
ATOM   5503 C  C     . HIS C 1 292 ? -32.968 54.097 6.502   1.00 61.31  ? 322 HIS C C     1 
ATOM   5504 O  O     . HIS C 1 292 ? -33.068 54.254 5.286   1.00 61.27  ? 322 HIS C O     1 
ATOM   5505 C  CB    . HIS C 1 292 ? -30.634 54.526 7.278   1.00 61.77  ? 322 HIS C CB    1 
ATOM   5506 C  CG    . HIS C 1 292 ? -29.413 54.049 8.005   1.00 62.10  ? 322 HIS C CG    1 
ATOM   5507 N  ND1   . HIS C 1 292 ? -29.474 53.378 9.206   1.00 63.22  ? 322 HIS C ND1   1 
ATOM   5508 C  CD2   . HIS C 1 292 ? -28.098 54.163 7.706   1.00 62.78  ? 322 HIS C CD2   1 
ATOM   5509 C  CE1   . HIS C 1 292 ? -28.250 53.085 9.608   1.00 63.74  ? 322 HIS C CE1   1 
ATOM   5510 N  NE2   . HIS C 1 292 ? -27.396 53.554 8.717   1.00 63.29  ? 322 HIS C NE2   1 
ATOM   5511 N  N     . PHE C 1 293 ? -33.906 54.474 7.356   1.00 61.32  ? 323 PHE C N     1 
ATOM   5512 C  CA    . PHE C 1 293 ? -35.091 55.194 6.934   1.00 61.36  ? 323 PHE C CA    1 
ATOM   5513 C  C     . PHE C 1 293 ? -34.797 56.666 7.045   1.00 61.36  ? 323 PHE C C     1 
ATOM   5514 O  O     . PHE C 1 293 ? -34.530 57.157 8.141   1.00 61.13  ? 323 PHE C O     1 
ATOM   5515 C  CB    . PHE C 1 293 ? -36.285 54.825 7.809   1.00 61.37  ? 323 PHE C CB    1 
ATOM   5516 C  CG    . PHE C 1 293 ? -36.795 53.448 7.552   1.00 61.45  ? 323 PHE C CG    1 
ATOM   5517 C  CD1   . PHE C 1 293 ? -36.121 52.352 8.058   1.00 60.99  ? 323 PHE C CD1   1 
ATOM   5518 C  CD2   . PHE C 1 293 ? -37.925 53.242 6.774   1.00 61.67  ? 323 PHE C CD2   1 
ATOM   5519 C  CE1   . PHE C 1 293 ? -36.567 51.084 7.819   1.00 61.31  ? 323 PHE C CE1   1 
ATOM   5520 C  CE2   . PHE C 1 293 ? -38.384 51.961 6.529   1.00 61.61  ? 323 PHE C CE2   1 
ATOM   5521 C  CZ    . PHE C 1 293 ? -37.702 50.879 7.052   1.00 61.53  ? 323 PHE C CZ    1 
ATOM   5522 N  N     . THR C 1 294 ? -34.853 57.370 5.912   1.00 61.37  ? 324 THR C N     1 
ATOM   5523 C  CA    . THR C 1 294 ? -34.450 58.775 5.869   1.00 61.20  ? 324 THR C CA    1 
ATOM   5524 C  C     . THR C 1 294 ? -35.554 59.731 5.397   1.00 61.23  ? 324 THR C C     1 
ATOM   5525 O  O     . THR C 1 294 ? -36.648 59.324 4.960   1.00 61.15  ? 324 THR C O     1 
ATOM   5526 C  CB    . THR C 1 294 ? -33.189 58.981 4.984   1.00 60.97  ? 324 THR C CB    1 
ATOM   5527 O  OG1   . THR C 1 294 ? -33.455 58.550 3.645   1.00 60.35  ? 324 THR C OG1   1 
ATOM   5528 C  CG2   . THR C 1 294 ? -32.010 58.201 5.539   1.00 61.26  ? 324 THR C CG2   1 
ATOM   5529 N  N     . CYS C 1 295 ? -35.233 61.012 5.543   1.00 60.91  ? 325 CYS C N     1 
ATOM   5530 C  CA    . CYS C 1 295 ? -35.961 62.106 4.938   1.00 60.69  ? 325 CYS C CA    1 
ATOM   5531 C  C     . CYS C 1 295 ? -34.917 63.090 4.366   1.00 60.18  ? 325 CYS C C     1 
ATOM   5532 O  O     . CYS C 1 295 ? -34.476 64.011 5.043   1.00 59.58  ? 325 CYS C O     1 
ATOM   5533 C  CB    . CYS C 1 295 ? -36.858 62.767 5.984   1.00 60.77  ? 325 CYS C CB    1 
ATOM   5534 S  SG    . CYS C 1 295 ? -37.817 64.128 5.369   1.00 61.22  ? 325 CYS C SG    1 
ATOM   5535 N  N     . ALA C 1 296 ? -34.516 62.850 3.119   1.00 60.00  ? 326 ALA C N     1 
ATOM   5536 C  CA    . ALA C 1 296 ? -33.401 63.553 2.477   1.00 60.13  ? 326 ALA C CA    1 
ATOM   5537 C  C     . ALA C 1 296 ? -33.443 65.068 2.645   1.00 60.33  ? 326 ALA C C     1 
ATOM   5538 O  O     . ALA C 1 296 ? -32.399 65.708 2.795   1.00 60.17  ? 326 ALA C O     1 
ATOM   5539 C  CB    . ALA C 1 296 ? -33.338 63.194 0.995   1.00 59.96  ? 326 ALA C CB    1 
ATOM   5540 N  N     . THR C 1 297 ? -34.647 65.637 2.624   1.00 60.59  ? 327 THR C N     1 
ATOM   5541 C  CA    . THR C 1 297 ? -34.828 67.076 2.861   1.00 61.03  ? 327 THR C CA    1 
ATOM   5542 C  C     . THR C 1 297 ? -34.686 67.529 4.332   1.00 60.98  ? 327 THR C C     1 
ATOM   5543 O  O     . THR C 1 297 ? -34.823 68.709 4.613   1.00 61.14  ? 327 THR C O     1 
ATOM   5544 C  CB    . THR C 1 297 ? -36.202 67.542 2.350   1.00 60.98  ? 327 THR C CB    1 
ATOM   5545 O  OG1   . THR C 1 297 ? -37.222 66.711 2.912   1.00 61.82  ? 327 THR C OG1   1 
ATOM   5546 C  CG2   . THR C 1 297 ? -36.262 67.463 0.834   1.00 61.06  ? 327 THR C CG2   1 
ATOM   5547 N  N     . ASP C 1 298 ? -34.392 66.605 5.246   1.00 61.29  ? 328 ASP C N     1 
ATOM   5548 C  CA    . ASP C 1 298 ? -34.325 66.875 6.692   1.00 61.56  ? 328 ASP C CA    1 
ATOM   5549 C  C     . ASP C 1 298 ? -32.876 66.792 7.198   1.00 61.46  ? 328 ASP C C     1 
ATOM   5550 O  O     . ASP C 1 298 ? -32.387 65.711 7.513   1.00 61.23  ? 328 ASP C O     1 
ATOM   5551 C  CB    . ASP C 1 298 ? -35.205 65.847 7.407   1.00 61.75  ? 328 ASP C CB    1 
ATOM   5552 C  CG    . ASP C 1 298 ? -35.506 66.212 8.836   1.00 62.21  ? 328 ASP C CG    1 
ATOM   5553 O  OD1   . ASP C 1 298 ? -34.559 66.497 9.602   1.00 63.31  ? 328 ASP C OD1   1 
ATOM   5554 O  OD2   . ASP C 1 298 ? -36.702 66.172 9.198   1.00 62.04  ? 328 ASP C OD2   1 
ATOM   5555 N  N     . THR C 1 299 ? -32.203 67.939 7.284   1.00 61.56  ? 329 THR C N     1 
ATOM   5556 C  CA    . THR C 1 299 ? -30.752 67.995 7.549   1.00 61.65  ? 329 THR C CA    1 
ATOM   5557 C  C     . THR C 1 299 ? -30.303 67.252 8.816   1.00 61.87  ? 329 THR C C     1 
ATOM   5558 O  O     . THR C 1 299 ? -29.393 66.407 8.749   1.00 61.79  ? 329 THR C O     1 
ATOM   5559 C  CB    . THR C 1 299 ? -30.248 69.465 7.588   1.00 61.65  ? 329 THR C CB    1 
ATOM   5560 O  OG1   . THR C 1 299 ? -30.411 70.055 6.292   1.00 62.07  ? 329 THR C OG1   1 
ATOM   5561 C  CG2   . THR C 1 299 ? -28.789 69.548 7.969   1.00 61.49  ? 329 THR C CG2   1 
ATOM   5562 N  N     . LYS C 1 300 ? -30.924 67.549 9.960   1.00 62.10  ? 330 LYS C N     1 
ATOM   5563 C  CA    . LYS C 1 300 ? -30.558 66.865 11.220  1.00 62.36  ? 330 LYS C CA    1 
ATOM   5564 C  C     . LYS C 1 300 ? -30.528 65.352 11.025  1.00 62.48  ? 330 LYS C C     1 
ATOM   5565 O  O     . LYS C 1 300 ? -29.555 64.698 11.383  1.00 62.75  ? 330 LYS C O     1 
ATOM   5566 C  CB    . LYS C 1 300 ? -31.516 67.216 12.365  1.00 62.37  ? 330 LYS C CB    1 
ATOM   5567 N  N     . ASN C 1 301 ? -31.594 64.810 10.445  1.00 62.58  ? 331 ASN C N     1 
ATOM   5568 C  CA    . ASN C 1 301 ? -31.679 63.383 10.162  1.00 62.63  ? 331 ASN C CA    1 
ATOM   5569 C  C     . ASN C 1 301 ? -30.578 62.886 9.226   1.00 62.47  ? 331 ASN C C     1 
ATOM   5570 O  O     . ASN C 1 301 ? -30.022 61.812 9.435   1.00 62.38  ? 331 ASN C O     1 
ATOM   5571 C  CB    . ASN C 1 301 ? -33.048 63.044 9.566   1.00 62.72  ? 331 ASN C CB    1 
ATOM   5572 C  CG    . ASN C 1 301 ? -33.119 61.626 9.054   1.00 62.47  ? 331 ASN C CG    1 
ATOM   5573 O  OD1   . ASN C 1 301 ? -33.378 61.397 7.881   1.00 63.46  ? 331 ASN C OD1   1 
ATOM   5574 N  ND2   . ASN C 1 301 ? -32.867 60.669 9.927   1.00 62.36  ? 331 ASN C ND2   1 
ATOM   5575 N  N     . VAL C 1 302 ? -30.271 63.664 8.196   1.00 62.42  ? 332 VAL C N     1 
ATOM   5576 C  CA    . VAL C 1 302 ? -29.297 63.240 7.188   1.00 62.50  ? 332 VAL C CA    1 
ATOM   5577 C  C     . VAL C 1 302 ? -27.876 63.336 7.758   1.00 62.88  ? 332 VAL C C     1 
ATOM   5578 O  O     . VAL C 1 302 ? -27.027 62.481 7.491   1.00 62.78  ? 332 VAL C O     1 
ATOM   5579 C  CB    . VAL C 1 302 ? -29.454 64.044 5.874   1.00 62.27  ? 332 VAL C CB    1 
ATOM   5580 C  CG1   . VAL C 1 302 ? -28.384 63.663 4.881   1.00 62.03  ? 332 VAL C CG1   1 
ATOM   5581 C  CG2   . VAL C 1 302 ? -30.844 63.807 5.270   1.00 61.82  ? 332 VAL C CG2   1 
ATOM   5582 N  N     . GLN C 1 303 ? -27.636 64.363 8.566   1.00 63.27  ? 333 GLN C N     1 
ATOM   5583 C  CA    . GLN C 1 303 ? -26.398 64.465 9.343   1.00 63.60  ? 333 GLN C CA    1 
ATOM   5584 C  C     . GLN C 1 303 ? -26.144 63.203 10.178  1.00 63.83  ? 333 GLN C C     1 
ATOM   5585 O  O     . GLN C 1 303 ? -25.032 62.665 10.174  1.00 63.67  ? 333 GLN C O     1 
ATOM   5586 C  CB    . GLN C 1 303 ? -26.455 65.681 10.275  1.00 63.61  ? 333 GLN C CB    1 
ATOM   5587 C  CG    . GLN C 1 303 ? -25.143 66.017 10.966  1.00 63.38  ? 333 GLN C CG    1 
ATOM   5588 C  CD    . GLN C 1 303 ? -25.306 67.104 12.006  1.00 63.29  ? 333 GLN C CD    1 
ATOM   5589 O  OE1   . GLN C 1 303 ? -26.165 67.971 11.875  1.00 62.65  ? 333 GLN C OE1   1 
ATOM   5590 N  NE2   . GLN C 1 303 ? -24.484 67.060 13.052  1.00 62.97  ? 333 GLN C NE2   1 
ATOM   5591 N  N     . PHE C 1 304 ? -27.183 62.749 10.880  1.00 64.13  ? 334 PHE C N     1 
ATOM   5592 C  CA    . PHE C 1 304 ? -27.073 61.642 11.836  1.00 64.47  ? 334 PHE C CA    1 
ATOM   5593 C  C     . PHE C 1 304 ? -26.970 60.294 11.144  1.00 64.51  ? 334 PHE C C     1 
ATOM   5594 O  O     . PHE C 1 304 ? -26.308 59.392 11.642  1.00 64.67  ? 334 PHE C O     1 
ATOM   5595 C  CB    . PHE C 1 304 ? -28.269 61.631 12.798  1.00 64.52  ? 334 PHE C CB    1 
ATOM   5596 C  CG    . PHE C 1 304 ? -28.212 60.535 13.830  1.00 64.71  ? 334 PHE C CG    1 
ATOM   5597 N  N     . VAL C 1 305 ? -27.645 60.154 10.012  1.00 64.67  ? 335 VAL C N     1 
ATOM   5598 C  CA    . VAL C 1 305 ? -27.588 58.921 9.242   1.00 64.66  ? 335 VAL C CA    1 
ATOM   5599 C  C     . VAL C 1 305 ? -26.230 58.792 8.566   1.00 64.96  ? 335 VAL C C     1 
ATOM   5600 O  O     . VAL C 1 305 ? -25.577 57.750 8.654   1.00 64.61  ? 335 VAL C O     1 
ATOM   5601 C  CB    . VAL C 1 305 ? -28.701 58.873 8.191   1.00 64.61  ? 335 VAL C CB    1 
ATOM   5602 C  CG1   . VAL C 1 305 ? -28.385 57.829 7.126   1.00 64.27  ? 335 VAL C CG1   1 
ATOM   5603 C  CG2   . VAL C 1 305 ? -30.043 58.605 8.867   1.00 64.09  ? 335 VAL C CG2   1 
ATOM   5604 N  N     . PHE C 1 306 ? -25.802 59.862 7.899   1.00 65.42  ? 336 PHE C N     1 
ATOM   5605 C  CA    . PHE C 1 306 ? -24.504 59.861 7.232   1.00 65.60  ? 336 PHE C CA    1 
ATOM   5606 C  C     . PHE C 1 306 ? -23.366 59.758 8.240   1.00 65.61  ? 336 PHE C C     1 
ATOM   5607 O  O     . PHE C 1 306 ? -22.267 59.330 7.901   1.00 65.54  ? 336 PHE C O     1 
ATOM   5608 C  CB    . PHE C 1 306 ? -24.321 61.094 6.364   1.00 65.75  ? 336 PHE C CB    1 
ATOM   5609 C  CG    . PHE C 1 306 ? -23.176 60.978 5.413   1.00 65.84  ? 336 PHE C CG    1 
ATOM   5610 C  CD1   . PHE C 1 306 ? -23.349 60.369 4.180   1.00 66.43  ? 336 PHE C CD1   1 
ATOM   5611 C  CD2   . PHE C 1 306 ? -21.920 61.446 5.758   1.00 66.34  ? 336 PHE C CD2   1 
ATOM   5612 C  CE1   . PHE C 1 306 ? -22.290 60.244 3.296   1.00 66.63  ? 336 PHE C CE1   1 
ATOM   5613 C  CE2   . PHE C 1 306 ? -20.851 61.327 4.882   1.00 66.85  ? 336 PHE C CE2   1 
ATOM   5614 C  CZ    . PHE C 1 306 ? -21.035 60.727 3.647   1.00 66.72  ? 336 PHE C CZ    1 
ATOM   5615 N  N     . ASP C 1 307 ? -23.636 60.165 9.474   1.00 65.76  ? 337 ASP C N     1 
ATOM   5616 C  CA    . ASP C 1 307 ? -22.743 59.875 10.590  1.00 66.09  ? 337 ASP C CA    1 
ATOM   5617 C  C     . ASP C 1 307 ? -22.634 58.347 10.761  1.00 65.89  ? 337 ASP C C     1 
ATOM   5618 O  O     . ASP C 1 307 ? -21.533 57.779 10.725  1.00 65.67  ? 337 ASP C O     1 
ATOM   5619 C  CB    . ASP C 1 307 ? -23.268 60.567 11.854  1.00 66.25  ? 337 ASP C CB    1 
ATOM   5620 C  CG    . ASP C 1 307 ? -22.556 60.132 13.102  1.00 67.80  ? 337 ASP C CG    1 
ATOM   5621 O  OD1   . ASP C 1 307 ? -21.786 60.945 13.665  1.00 69.87  ? 337 ASP C OD1   1 
ATOM   5622 O  OD2   . ASP C 1 307 ? -22.771 58.975 13.533  1.00 70.35  ? 337 ASP C OD2   1 
ATOM   5623 N  N     . ALA C 1 308 ? -23.789 57.697 10.910  1.00 65.76  ? 338 ALA C N     1 
ATOM   5624 C  CA    . ALA C 1 308 ? -23.879 56.239 11.034  1.00 65.51  ? 338 ALA C CA    1 
ATOM   5625 C  C     . ALA C 1 308 ? -23.198 55.524 9.870   1.00 65.44  ? 338 ALA C C     1 
ATOM   5626 O  O     . ALA C 1 308 ? -22.379 54.621 10.075  1.00 65.69  ? 338 ALA C O     1 
ATOM   5627 C  CB    . ALA C 1 308 ? -25.340 55.808 11.133  1.00 65.19  ? 338 ALA C CB    1 
ATOM   5628 N  N     . VAL C 1 309 ? -23.541 55.937 8.655   1.00 65.28  ? 339 VAL C N     1 
ATOM   5629 C  CA    . VAL C 1 309 ? -22.954 55.372 7.448   1.00 65.19  ? 339 VAL C CA    1 
ATOM   5630 C  C     . VAL C 1 309 ? -21.439 55.484 7.482   1.00 65.34  ? 339 VAL C C     1 
ATOM   5631 O  O     . VAL C 1 309 ? -20.722 54.526 7.192   1.00 65.29  ? 339 VAL C O     1 
ATOM   5632 C  CB    . VAL C 1 309 ? -23.443 56.112 6.199   1.00 65.15  ? 339 VAL C CB    1 
ATOM   5633 C  CG1   . VAL C 1 309 ? -22.668 55.649 4.965   1.00 65.07  ? 339 VAL C CG1   1 
ATOM   5634 C  CG2   . VAL C 1 309 ? -24.940 55.912 6.017   1.00 64.83  ? 339 VAL C CG2   1 
ATOM   5635 N  N     . THR C 1 310 ? -20.959 56.665 7.843   1.00 65.42  ? 340 THR C N     1 
ATOM   5636 C  CA    . THR C 1 310 ? -19.539 56.960 7.790   1.00 65.45  ? 340 THR C CA    1 
ATOM   5637 C  C     . THR C 1 310 ? -18.734 56.143 8.796   1.00 65.70  ? 340 THR C C     1 
ATOM   5638 O  O     . THR C 1 310 ? -17.625 55.697 8.489   1.00 65.66  ? 340 THR C O     1 
ATOM   5639 C  CB    . THR C 1 310 ? -19.312 58.446 7.985   1.00 65.57  ? 340 THR C CB    1 
ATOM   5640 O  OG1   . THR C 1 310 ? -19.824 59.139 6.830   1.00 65.14  ? 340 THR C OG1   1 
ATOM   5641 C  CG2   . THR C 1 310 ? -17.829 58.748 8.173   1.00 65.23  ? 340 THR C CG2   1 
ATOM   5642 N  N     . ASP C 1 311 ? -19.293 55.929 9.983   1.00 65.93  ? 341 ASP C N     1 
ATOM   5643 C  CA    . ASP C 1 311 ? -18.700 54.983 10.930  1.00 66.08  ? 341 ASP C CA    1 
ATOM   5644 C  C     . ASP C 1 311 ? -18.547 53.616 10.255  1.00 66.01  ? 341 ASP C C     1 
ATOM   5645 O  O     . ASP C 1 311 ? -17.472 53.022 10.283  1.00 66.07  ? 341 ASP C O     1 
ATOM   5646 C  CB    . ASP C 1 311 ? -19.559 54.847 12.201  1.00 66.25  ? 341 ASP C CB    1 
ATOM   5647 C  CG    . ASP C 1 311 ? -19.510 56.087 13.101  1.00 66.69  ? 341 ASP C CG    1 
ATOM   5648 O  OD1   . ASP C 1 311 ? -18.577 56.909 12.967  1.00 67.28  ? 341 ASP C OD1   1 
ATOM   5649 O  OD2   . ASP C 1 311 ? -20.414 56.232 13.956  1.00 66.97  ? 341 ASP C OD2   1 
ATOM   5650 N  N     . VAL C 1 312 ? -19.622 53.143 9.626   1.00 65.93  ? 342 VAL C N     1 
ATOM   5651 C  CA    . VAL C 1 312 ? -19.634 51.828 8.976   1.00 65.91  ? 342 VAL C CA    1 
ATOM   5652 C  C     . VAL C 1 312 ? -18.537 51.699 7.916   1.00 65.95  ? 342 VAL C C     1 
ATOM   5653 O  O     . VAL C 1 312 ? -17.883 50.661 7.822   1.00 65.97  ? 342 VAL C O     1 
ATOM   5654 C  CB    . VAL C 1 312 ? -21.018 51.524 8.350   1.00 65.86  ? 342 VAL C CB    1 
ATOM   5655 C  CG1   . VAL C 1 312 ? -20.993 50.220 7.574   1.00 65.81  ? 342 VAL C CG1   1 
ATOM   5656 C  CG2   . VAL C 1 312 ? -22.088 51.474 9.438   1.00 66.21  ? 342 VAL C CG2   1 
ATOM   5657 N  N     . ILE C 1 313 ? -18.334 52.761 7.138   1.00 66.07  ? 343 ILE C N     1 
ATOM   5658 C  CA    . ILE C 1 313 ? -17.259 52.817 6.141   1.00 66.06  ? 343 ILE C CA    1 
ATOM   5659 C  C     . ILE C 1 313 ? -15.857 52.775 6.780   1.00 66.41  ? 343 ILE C C     1 
ATOM   5660 O  O     . ILE C 1 313 ? -14.911 52.274 6.170   1.00 66.19  ? 343 ILE C O     1 
ATOM   5661 C  CB    . ILE C 1 313 ? -17.401 54.075 5.249   1.00 66.08  ? 343 ILE C CB    1 
ATOM   5662 C  CG1   . ILE C 1 313 ? -18.655 53.959 4.374   1.00 66.03  ? 343 ILE C CG1   1 
ATOM   5663 C  CG2   . ILE C 1 313 ? -16.177 54.268 4.364   1.00 65.63  ? 343 ILE C CG2   1 
ATOM   5664 C  CD1   . ILE C 1 313 ? -18.961 55.203 3.557   1.00 65.89  ? 343 ILE C CD1   1 
ATOM   5665 N  N     . ILE C 1 314 ? -15.730 53.287 8.004   1.00 66.82  ? 344 ILE C N     1 
ATOM   5666 C  CA    . ILE C 1 314 ? -14.449 53.281 8.717   1.00 67.15  ? 344 ILE C CA    1 
ATOM   5667 C  C     . ILE C 1 314 ? -14.128 51.896 9.284   1.00 67.51  ? 344 ILE C C     1 
ATOM   5668 O  O     . ILE C 1 314 ? -12.949 51.503 9.356   1.00 67.68  ? 344 ILE C O     1 
ATOM   5669 C  CB    . ILE C 1 314 ? -14.418 54.330 9.859   1.00 67.15  ? 344 ILE C CB    1 
ATOM   5670 C  CG1   . ILE C 1 314 ? -14.585 55.750 9.304   1.00 67.19  ? 344 ILE C CG1   1 
ATOM   5671 C  CG2   . ILE C 1 314 ? -13.103 54.255 10.626  1.00 67.25  ? 344 ILE C CG2   1 
ATOM   5672 C  CD1   . ILE C 1 314 ? -13.302 56.354 8.767   1.00 67.35  ? 344 ILE C CD1   1 
ATOM   5673 N  N     . LYS C 1 315 ? -15.163 51.165 9.699   1.00 67.80  ? 345 LYS C N     1 
ATOM   5674 C  CA    . LYS C 1 315 ? -14.989 49.787 10.172  1.00 68.13  ? 345 LYS C CA    1 
ATOM   5675 C  C     . LYS C 1 315 ? -14.673 48.846 8.995   1.00 68.44  ? 345 LYS C C     1 
ATOM   5676 O  O     . LYS C 1 315 ? -13.774 48.009 9.095   1.00 68.45  ? 345 LYS C O     1 
ATOM   5677 C  CB    . LYS C 1 315 ? -16.229 49.307 10.941  1.00 67.96  ? 345 LYS C CB    1 
ATOM   5678 N  N     . ASN C 1 316 ? -15.387 49.022 7.877   1.00 68.76  ? 346 ASN C N     1 
ATOM   5679 C  CA    . ASN C 1 316 ? -15.237 48.172 6.678   1.00 68.98  ? 346 ASN C CA    1 
ATOM   5680 C  C     . ASN C 1 316 ? -13.956 48.360 5.852   1.00 69.25  ? 346 ASN C C     1 
ATOM   5681 O  O     . ASN C 1 316 ? -13.728 47.608 4.896   1.00 69.19  ? 346 ASN C O     1 
ATOM   5682 C  CB    . ASN C 1 316 ? -16.438 48.364 5.737   1.00 68.95  ? 346 ASN C CB    1 
ATOM   5683 C  CG    . ASN C 1 316 ? -17.602 47.459 6.077   1.00 69.11  ? 346 ASN C CG    1 
ATOM   5684 O  OD1   . ASN C 1 316 ? -17.790 47.069 7.232   1.00 69.06  ? 346 ASN C OD1   1 
ATOM   5685 N  ND2   . ASN C 1 316 ? -18.398 47.119 5.064   1.00 69.24  ? 346 ASN C ND2   1 
ATOM   5686 N  N     . ASN C 1 317 ? -13.138 49.356 6.198   1.00 69.56  ? 347 ASN C N     1 
ATOM   5687 C  CA    . ASN C 1 317 ? -11.936 49.688 5.428   1.00 69.71  ? 347 ASN C CA    1 
ATOM   5688 C  C     . ASN C 1 317 ? -10.650 49.513 6.236   1.00 69.93  ? 347 ASN C C     1 
ATOM   5689 O  O     . ASN C 1 317 ? -9.594  50.010 5.840   1.00 70.12  ? 347 ASN C O     1 
ATOM   5690 C  CB    . ASN C 1 317 ? -12.030 51.130 4.908   1.00 69.72  ? 347 ASN C CB    1 
ATOM   5691 C  CG    . ASN C 1 317 ? -13.097 51.307 3.815   1.00 70.04  ? 347 ASN C CG    1 
ATOM   5692 O  OD1   . ASN C 1 317 ? -12.857 51.992 2.822   1.00 70.35  ? 347 ASN C OD1   1 
ATOM   5693 N  ND2   . ASN C 1 317 ? -14.271 50.699 3.998   1.00 69.41  ? 347 ASN C ND2   1 
ATOM   5694 N  N     . LEU C 1 318 ? -10.730 48.797 7.358   1.00 69.99  ? 348 LEU C N     1 
ATOM   5695 C  CA    . LEU C 1 318 ? -9.575  48.633 8.243   1.00 70.07  ? 348 LEU C CA    1 
ATOM   5696 C  C     . LEU C 1 318 ? -9.778  47.498 9.246   1.00 70.15  ? 348 LEU C C     1 
ATOM   5697 O  O     . LEU C 1 318 ? -10.904 47.203 9.646   1.00 70.24  ? 348 LEU C O     1 
ATOM   5698 C  CB    . LEU C 1 318 ? -9.285  49.939 8.992   1.00 69.99  ? 348 LEU C CB    1 
ATOM   5699 N  N     . PHE D 2 5   ? -16.313 88.557 -30.343 1.00 67.02  ? 55  PHE D N     1 
ATOM   5700 C  CA    . PHE D 2 5   ? -16.342 87.314 -29.517 1.00 67.10  ? 55  PHE D CA    1 
ATOM   5701 C  C     . PHE D 2 5   ? -16.451 87.597 -28.012 1.00 67.09  ? 55  PHE D C     1 
ATOM   5702 O  O     . PHE D 2 5   ? -16.858 86.719 -27.246 1.00 67.02  ? 55  PHE D O     1 
ATOM   5703 C  CB    . PHE D 2 5   ? -15.103 86.461 -29.798 1.00 67.12  ? 55  PHE D CB    1 
ATOM   5704 N  N     . SER D 2 6   ? -16.084 88.811 -27.594 1.00 67.04  ? 56  SER D N     1 
ATOM   5705 C  CA    . SER D 2 6   ? -16.199 89.223 -26.190 1.00 66.99  ? 56  SER D CA    1 
ATOM   5706 C  C     . SER D 2 6   ? -17.661 89.280 -25.735 1.00 67.05  ? 56  SER D C     1 
ATOM   5707 O  O     . SER D 2 6   ? -18.000 88.813 -24.644 1.00 66.91  ? 56  SER D O     1 
ATOM   5708 C  CB    . SER D 2 6   ? -15.540 90.587 -25.981 1.00 66.94  ? 56  SER D CB    1 
ATOM   5709 O  OG    . SER D 2 6   ? -15.589 90.974 -24.620 1.00 66.80  ? 56  SER D OG    1 
ATOM   5710 N  N     . GLU D 2 7   ? -18.513 89.861 -26.579 1.00 67.15  ? 57  GLU D N     1 
ATOM   5711 C  CA    . GLU D 2 7   ? -19.952 89.942 -26.319 1.00 67.14  ? 57  GLU D CA    1 
ATOM   5712 C  C     . GLU D 2 7   ? -20.601 88.561 -26.332 1.00 67.21  ? 57  GLU D C     1 
ATOM   5713 O  O     . GLU D 2 7   ? -21.616 88.341 -25.666 1.00 67.27  ? 57  GLU D O     1 
ATOM   5714 C  CB    . GLU D 2 7   ? -20.634 90.839 -27.358 1.00 67.09  ? 57  GLU D CB    1 
ATOM   5715 N  N     . ASP D 2 8   ? -20.020 87.639 -27.099 1.00 67.20  ? 58  ASP D N     1 
ATOM   5716 C  CA    . ASP D 2 8   ? -20.501 86.262 -27.155 1.00 67.13  ? 58  ASP D CA    1 
ATOM   5717 C  C     . ASP D 2 8   ? -20.283 85.560 -25.817 1.00 67.08  ? 58  ASP D C     1 
ATOM   5718 O  O     . ASP D 2 8   ? -21.247 85.131 -25.186 1.00 67.25  ? 58  ASP D O     1 
ATOM   5719 C  CB    . ASP D 2 8   ? -19.803 85.487 -28.277 1.00 67.13  ? 58  ASP D CB    1 
ATOM   5720 N  N     . VAL D 2 9   ? -19.024 85.469 -25.381 1.00 66.95  ? 59  VAL D N     1 
ATOM   5721 C  CA    . VAL D 2 9   ? -18.668 84.741 -24.150 1.00 66.86  ? 59  VAL D CA    1 
ATOM   5722 C  C     . VAL D 2 9   ? -19.335 85.325 -22.902 1.00 66.87  ? 59  VAL D C     1 
ATOM   5723 O  O     . VAL D 2 9   ? -19.804 84.581 -22.033 1.00 66.94  ? 59  VAL D O     1 
ATOM   5724 C  CB    . VAL D 2 9   ? -17.136 84.686 -23.931 1.00 66.81  ? 59  VAL D CB    1 
ATOM   5725 C  CG1   . VAL D 2 9   ? -16.802 84.058 -22.576 1.00 66.60  ? 59  VAL D CG1   1 
ATOM   5726 C  CG2   . VAL D 2 9   ? -16.471 83.907 -25.055 1.00 66.68  ? 59  VAL D CG2   1 
ATOM   5727 N  N     . LEU D 2 10  ? -19.374 86.651 -22.821 1.00 66.82  ? 60  LEU D N     1 
ATOM   5728 C  CA    . LEU D 2 10  ? -20.074 87.341 -21.739 1.00 66.79  ? 60  LEU D CA    1 
ATOM   5729 C  C     . LEU D 2 10  ? -21.587 87.086 -21.794 1.00 66.75  ? 60  LEU D C     1 
ATOM   5730 O  O     . LEU D 2 10  ? -22.235 86.956 -20.757 1.00 66.74  ? 60  LEU D O     1 
ATOM   5731 C  CB    . LEU D 2 10  ? -19.786 88.846 -21.789 1.00 66.71  ? 60  LEU D CB    1 
ATOM   5732 N  N     . GLY D 2 11  ? -22.139 87.001 -23.003 1.00 66.77  ? 61  GLY D N     1 
ATOM   5733 C  CA    . GLY D 2 11  ? -23.580 86.818 -23.194 1.00 66.82  ? 61  GLY D CA    1 
ATOM   5734 C  C     . GLY D 2 11  ? -24.129 85.455 -22.806 1.00 66.91  ? 61  GLY D C     1 
ATOM   5735 O  O     . GLY D 2 11  ? -25.329 85.313 -22.561 1.00 66.98  ? 61  GLY D O     1 
ATOM   5736 N  N     . TRP D 2 12  ? -23.260 84.449 -22.745 1.00 66.94  ? 62  TRP D N     1 
ATOM   5737 C  CA    . TRP D 2 12  ? -23.691 83.092 -22.413 1.00 67.03  ? 62  TRP D CA    1 
ATOM   5738 C  C     . TRP D 2 12  ? -24.118 82.940 -20.950 1.00 66.96  ? 62  TRP D C     1 
ATOM   5739 O  O     . TRP D 2 12  ? -24.841 81.998 -20.616 1.00 66.89  ? 62  TRP D O     1 
ATOM   5740 C  CB    . TRP D 2 12  ? -22.588 82.069 -22.702 1.00 67.23  ? 62  TRP D CB    1 
ATOM   5741 C  CG    . TRP D 2 12  ? -22.046 82.093 -24.094 1.00 67.28  ? 62  TRP D CG    1 
ATOM   5742 C  CD1   . TRP D 2 12  ? -22.653 82.597 -25.208 1.00 67.40  ? 62  TRP D CD1   1 
ATOM   5743 C  CD2   . TRP D 2 12  ? -20.790 81.556 -24.525 1.00 67.48  ? 62  TRP D CD2   1 
ATOM   5744 N  NE1   . TRP D 2 12  ? -21.841 82.426 -26.305 1.00 67.59  ? 62  TRP D NE1   1 
ATOM   5745 C  CE2   . TRP D 2 12  ? -20.693 81.786 -25.913 1.00 67.54  ? 62  TRP D CE2   1 
ATOM   5746 C  CE3   . TRP D 2 12  ? -19.731 80.912 -23.869 1.00 67.61  ? 62  TRP D CE3   1 
ATOM   5747 C  CZ2   . TRP D 2 12  ? -19.574 81.394 -26.661 1.00 67.37  ? 62  TRP D CZ2   1 
ATOM   5748 C  CZ3   . TRP D 2 12  ? -18.619 80.519 -24.615 1.00 67.43  ? 62  TRP D CZ3   1 
ATOM   5749 C  CH2   . TRP D 2 12  ? -18.554 80.760 -25.996 1.00 67.34  ? 62  TRP D CH2   1 
ATOM   5750 N  N     . ARG D 2 13  ? -23.646 83.839 -20.085 1.00 66.73  ? 63  ARG D N     1 
ATOM   5751 C  CA    . ARG D 2 13  ? -24.027 83.833 -18.673 1.00 66.62  ? 63  ARG D CA    1 
ATOM   5752 C  C     . ARG D 2 13  ? -25.380 84.506 -18.480 1.00 66.52  ? 63  ARG D C     1 
ATOM   5753 O  O     . ARG D 2 13  ? -26.184 84.059 -17.665 1.00 66.84  ? 63  ARG D O     1 
ATOM   5754 C  CB    . ARG D 2 13  ? -22.974 84.538 -17.815 1.00 66.63  ? 63  ARG D CB    1 
ATOM   5755 N  N     . GLU D 2 14  ? -25.629 85.576 -19.231 1.00 66.30  ? 64  GLU D N     1 
ATOM   5756 C  CA    . GLU D 2 14  ? -26.883 86.322 -19.128 1.00 66.13  ? 64  GLU D CA    1 
ATOM   5757 C  C     . GLU D 2 14  ? -28.086 85.517 -19.633 1.00 66.03  ? 64  GLU D C     1 
ATOM   5758 O  O     . GLU D 2 14  ? -29.170 85.608 -19.058 1.00 66.03  ? 64  GLU D O     1 
ATOM   5759 C  CB    . GLU D 2 14  ? -26.784 87.648 -19.894 1.00 66.00  ? 64  GLU D CB    1 
ATOM   5760 N  N     . SER D 2 15  ? -27.899 84.730 -20.693 1.00 65.89  ? 65  SER D N     1 
ATOM   5761 C  CA    . SER D 2 15  ? -29.017 84.014 -21.312 1.00 65.83  ? 65  SER D CA    1 
ATOM   5762 C  C     . SER D 2 15  ? -28.586 82.740 -22.033 1.00 65.67  ? 65  SER D C     1 
ATOM   5763 O  O     . SER D 2 15  ? -27.594 82.729 -22.754 1.00 65.76  ? 65  SER D O     1 
ATOM   5764 C  CB    . SER D 2 15  ? -29.749 84.937 -22.292 1.00 65.94  ? 65  SER D CB    1 
ATOM   5765 O  OG    . SER D 2 15  ? -30.874 84.294 -22.872 1.00 66.09  ? 65  SER D OG    1 
ATOM   5766 N  N     . PHE D 2 16  ? -29.371 81.682 -21.847 1.00 65.57  ? 66  PHE D N     1 
ATOM   5767 C  CA    . PHE D 2 16  ? -29.103 80.373 -22.440 1.00 65.56  ? 66  PHE D CA    1 
ATOM   5768 C  C     . PHE D 2 16  ? -29.354 80.338 -23.966 1.00 65.54  ? 66  PHE D C     1 
ATOM   5769 O  O     . PHE D 2 16  ? -28.865 79.443 -24.660 1.00 65.51  ? 66  PHE D O     1 
ATOM   5770 C  CB    . PHE D 2 16  ? -29.944 79.311 -21.700 1.00 65.53  ? 66  PHE D CB    1 
ATOM   5771 C  CG    . PHE D 2 16  ? -29.646 77.878 -22.101 1.00 65.61  ? 66  PHE D CG    1 
ATOM   5772 C  CD1   . PHE D 2 16  ? -28.341 77.430 -22.271 1.00 65.51  ? 66  PHE D CD1   1 
ATOM   5773 C  CD2   . PHE D 2 16  ? -30.682 76.968 -22.281 1.00 65.77  ? 66  PHE D CD2   1 
ATOM   5774 C  CE1   . PHE D 2 16  ? -28.079 76.108 -22.637 1.00 65.52  ? 66  PHE D CE1   1 
ATOM   5775 C  CE2   . PHE D 2 16  ? -30.422 75.648 -22.647 1.00 65.78  ? 66  PHE D CE2   1 
ATOM   5776 C  CZ    . PHE D 2 16  ? -29.116 75.223 -22.825 1.00 65.35  ? 66  PHE D CZ    1 
ATOM   5777 N  N     . ASP D 2 17  ? -30.106 81.310 -24.482 1.00 65.50  ? 67  ASP D N     1 
ATOM   5778 C  CA    . ASP D 2 17  ? -30.323 81.440 -25.925 1.00 65.50  ? 67  ASP D CA    1 
ATOM   5779 C  C     . ASP D 2 17  ? -29.076 81.926 -26.659 1.00 65.46  ? 67  ASP D C     1 
ATOM   5780 O  O     . ASP D 2 17  ? -28.793 81.470 -27.766 1.00 65.35  ? 67  ASP D O     1 
ATOM   5781 C  CB    . ASP D 2 17  ? -31.472 82.405 -26.216 1.00 65.60  ? 67  ASP D CB    1 
ATOM   5782 C  CG    . ASP D 2 17  ? -32.835 81.789 -25.968 1.00 65.89  ? 67  ASP D CG    1 
ATOM   5783 O  OD1   . ASP D 2 17  ? -32.913 80.661 -25.427 1.00 65.68  ? 67  ASP D OD1   1 
ATOM   5784 O  OD2   . ASP D 2 17  ? -33.833 82.451 -26.321 1.00 66.34  ? 67  ASP D OD2   1 
ATOM   5785 N  N     . LEU D 2 18  ? -28.351 82.865 -26.054 1.00 65.39  ? 68  LEU D N     1 
ATOM   5786 C  CA    . LEU D 2 18  ? -27.117 83.386 -26.651 1.00 65.34  ? 68  LEU D CA    1 
ATOM   5787 C  C     . LEU D 2 18  ? -26.065 82.284 -26.733 1.00 65.20  ? 68  LEU D C     1 
ATOM   5788 O  O     . LEU D 2 18  ? -25.331 82.185 -27.719 1.00 65.23  ? 68  LEU D O     1 
ATOM   5789 C  CB    . LEU D 2 18  ? -26.578 84.579 -25.850 1.00 65.42  ? 68  LEU D CB    1 
ATOM   5790 N  N     . LEU D 2 19  ? -26.008 81.461 -25.688 1.00 64.94  ? 69  LEU D N     1 
ATOM   5791 C  CA    . LEU D 2 19  ? -25.170 80.269 -25.669 1.00 64.78  ? 69  LEU D CA    1 
ATOM   5792 C  C     . LEU D 2 19  ? -25.511 79.363 -26.842 1.00 64.77  ? 69  LEU D C     1 
ATOM   5793 O  O     . LEU D 2 19  ? -24.620 78.897 -27.562 1.00 64.52  ? 69  LEU D O     1 
ATOM   5794 C  CB    . LEU D 2 19  ? -25.377 79.515 -24.350 1.00 64.82  ? 69  LEU D CB    1 
ATOM   5795 C  CG    . LEU D 2 19  ? -24.657 78.179 -24.144 1.00 64.70  ? 69  LEU D CG    1 
ATOM   5796 C  CD1   . LEU D 2 19  ? -23.159 78.337 -24.307 1.00 64.68  ? 69  LEU D CD1   1 
ATOM   5797 C  CD2   . LEU D 2 19  ? -24.978 77.622 -22.772 1.00 64.77  ? 69  LEU D CD2   1 
ATOM   5798 N  N     . LEU D 2 20  ? -26.811 79.131 -27.029 1.00 64.78  ? 70  LEU D N     1 
ATOM   5799 C  CA    . LEU D 2 20  ? -27.313 78.263 -28.097 1.00 64.85  ? 70  LEU D CA    1 
ATOM   5800 C  C     . LEU D 2 20  ? -27.447 78.984 -29.452 1.00 64.98  ? 70  LEU D C     1 
ATOM   5801 O  O     . LEU D 2 20  ? -28.070 78.458 -30.376 1.00 65.20  ? 70  LEU D O     1 
ATOM   5802 C  CB    . LEU D 2 20  ? -28.671 77.668 -27.695 1.00 64.73  ? 70  LEU D CB    1 
ATOM   5803 C  CG    . LEU D 2 20  ? -28.713 76.689 -26.521 1.00 64.81  ? 70  LEU D CG    1 
ATOM   5804 C  CD1   . LEU D 2 20  ? -30.152 76.415 -26.102 1.00 64.84  ? 70  LEU D CD1   1 
ATOM   5805 C  CD2   . LEU D 2 20  ? -28.026 75.392 -26.890 1.00 64.52  ? 70  LEU D CD2   1 
ATOM   5806 N  N     . SER D 2 21  ? -26.871 80.178 -29.575 1.00 64.94  ? 71  SER D N     1 
ATOM   5807 C  CA    . SER D 2 21  ? -26.935 80.939 -30.816 1.00 64.95  ? 71  SER D CA    1 
ATOM   5808 C  C     . SER D 2 21  ? -25.540 81.223 -31.370 1.00 64.93  ? 71  SER D C     1 
ATOM   5809 O  O     . SER D 2 21  ? -25.375 82.104 -32.220 1.00 64.89  ? 71  SER D O     1 
ATOM   5810 C  CB    . SER D 2 21  ? -27.691 82.252 -30.588 1.00 64.94  ? 71  SER D CB    1 
ATOM   5811 O  OG    . SER D 2 21  ? -29.052 82.005 -30.287 1.00 65.04  ? 71  SER D OG    1 
ATOM   5812 N  N     . SER D 2 22  ? -24.544 80.471 -30.901 1.00 64.81  ? 72  SER D N     1 
ATOM   5813 C  CA    . SER D 2 22  ? -23.159 80.668 -31.336 1.00 64.65  ? 72  SER D CA    1 
ATOM   5814 C  C     . SER D 2 22  ? -22.420 79.344 -31.441 1.00 64.63  ? 72  SER D C     1 
ATOM   5815 O  O     . SER D 2 22  ? -22.531 78.489 -30.565 1.00 64.87  ? 72  SER D O     1 
ATOM   5816 C  CB    . SER D 2 22  ? -22.417 81.587 -30.367 1.00 64.62  ? 72  SER D CB    1 
ATOM   5817 O  OG    . SER D 2 22  ? -22.078 80.898 -29.184 1.00 63.77  ? 72  SER D OG    1 
ATOM   5818 N  N     . LYS D 2 23  ? -21.657 79.182 -32.514 1.00 64.59  ? 73  LYS D N     1 
ATOM   5819 C  CA    . LYS D 2 23  ? -20.928 77.942 -32.740 1.00 64.51  ? 73  LYS D CA    1 
ATOM   5820 C  C     . LYS D 2 23  ? -19.910 77.687 -31.621 1.00 64.42  ? 73  LYS D C     1 
ATOM   5821 O  O     . LYS D 2 23  ? -19.779 76.555 -31.155 1.00 64.40  ? 73  LYS D O     1 
ATOM   5822 C  CB    . LYS D 2 23  ? -20.259 77.955 -34.120 1.00 64.58  ? 73  LYS D CB    1 
ATOM   5823 C  CG    . LYS D 2 23  ? -21.251 77.955 -35.282 1.00 64.17  ? 73  LYS D CG    1 
ATOM   5824 N  N     . ASN D 2 24  ? -19.215 78.738 -31.178 1.00 64.28  ? 74  ASN D N     1 
ATOM   5825 C  CA    . ASN D 2 24  ? -18.259 78.629 -30.064 1.00 64.17  ? 74  ASN D CA    1 
ATOM   5826 C  C     . ASN D 2 24  ? -18.942 78.377 -28.712 1.00 63.97  ? 74  ASN D C     1 
ATOM   5827 O  O     . ASN D 2 24  ? -18.362 77.738 -27.834 1.00 63.94  ? 74  ASN D O     1 
ATOM   5828 C  CB    . ASN D 2 24  ? -17.371 79.877 -29.974 1.00 64.11  ? 74  ASN D CB    1 
ATOM   5829 C  CG    . ASN D 2 24  ? -16.464 80.038 -31.177 1.00 64.40  ? 74  ASN D CG    1 
ATOM   5830 O  OD1   . ASN D 2 24  ? -16.680 79.420 -32.218 1.00 65.07  ? 74  ASN D OD1   1 
ATOM   5831 N  ND2   . ASN D 2 24  ? -15.444 80.877 -31.043 1.00 64.42  ? 74  ASN D ND2   1 
ATOM   5832 N  N     . GLY D 2 25  ? -20.161 78.888 -28.549 1.00 63.79  ? 75  GLY D N     1 
ATOM   5833 C  CA    . GLY D 2 25  ? -20.948 78.657 -27.333 1.00 63.69  ? 75  GLY D CA    1 
ATOM   5834 C  C     . GLY D 2 25  ? -21.469 77.240 -27.238 1.00 63.61  ? 75  GLY D C     1 
ATOM   5835 O  O     . GLY D 2 25  ? -21.426 76.624 -26.165 1.00 63.68  ? 75  GLY D O     1 
ATOM   5836 N  N     . VAL D 2 26  ? -21.954 76.720 -28.363 1.00 63.37  ? 76  VAL D N     1 
ATOM   5837 C  CA    . VAL D 2 26  ? -22.387 75.326 -28.448 1.00 63.23  ? 76  VAL D CA    1 
ATOM   5838 C  C     . VAL D 2 26  ? -21.203 74.328 -28.370 1.00 63.03  ? 76  VAL D C     1 
ATOM   5839 O  O     . VAL D 2 26  ? -21.294 73.319 -27.674 1.00 62.95  ? 76  VAL D O     1 
ATOM   5840 C  CB    . VAL D 2 26  ? -23.248 75.109 -29.712 1.00 63.29  ? 76  VAL D CB    1 
ATOM   5841 C  CG1   . VAL D 2 26  ? -23.557 73.633 -29.928 1.00 63.67  ? 76  VAL D CG1   1 
ATOM   5842 C  CG2   . VAL D 2 26  ? -24.542 75.905 -29.592 1.00 63.47  ? 76  VAL D CG2   1 
ATOM   5843 N  N     . ALA D 2 27  ? -20.094 74.623 -29.053 1.00 62.96  ? 77  ALA D N     1 
ATOM   5844 C  CA    . ALA D 2 27  ? -18.889 73.769 -29.014 1.00 62.79  ? 77  ALA D CA    1 
ATOM   5845 C  C     . ALA D 2 27  ? -18.236 73.671 -27.623 1.00 62.67  ? 77  ALA D C     1 
ATOM   5846 O  O     . ALA D 2 27  ? -17.797 72.590 -27.215 1.00 62.58  ? 77  ALA D O     1 
ATOM   5847 C  CB    . ALA D 2 27  ? -17.859 74.249 -30.039 1.00 62.65  ? 77  ALA D CB    1 
ATOM   5848 N  N     . ALA D 2 28  ? -18.157 74.798 -26.913 1.00 62.44  ? 78  ALA D N     1 
ATOM   5849 C  CA    . ALA D 2 28  ? -17.582 74.828 -25.566 1.00 62.24  ? 78  ALA D CA    1 
ATOM   5850 C  C     . ALA D 2 28  ? -18.532 74.187 -24.566 1.00 62.17  ? 78  ALA D C     1 
ATOM   5851 O  O     . ALA D 2 28  ? -18.088 73.537 -23.622 1.00 62.16  ? 78  ALA D O     1 
ATOM   5852 C  CB    . ALA D 2 28  ? -17.255 76.252 -25.144 1.00 62.26  ? 78  ALA D CB    1 
ATOM   5853 N  N     . PHE D 2 29  ? -19.836 74.364 -24.778 1.00 62.12  ? 79  PHE D N     1 
ATOM   5854 C  CA    . PHE D 2 29  ? -20.855 73.728 -23.925 1.00 62.08  ? 79  PHE D CA    1 
ATOM   5855 C  C     . PHE D 2 29  ? -20.925 72.217 -24.150 1.00 61.89  ? 79  PHE D C     1 
ATOM   5856 O  O     . PHE D 2 29  ? -21.281 71.475 -23.244 1.00 62.00  ? 79  PHE D O     1 
ATOM   5857 C  CB    . PHE D 2 29  ? -22.233 74.370 -24.154 1.00 62.31  ? 79  PHE D CB    1 
ATOM   5858 C  CG    . PHE D 2 29  ? -23.315 73.874 -23.222 1.00 61.84  ? 79  PHE D CG    1 
ATOM   5859 C  CD1   . PHE D 2 29  ? -23.135 73.889 -21.851 1.00 62.18  ? 79  PHE D CD1   1 
ATOM   5860 C  CD2   . PHE D 2 29  ? -24.525 73.434 -23.723 1.00 61.86  ? 79  PHE D CD2   1 
ATOM   5861 C  CE1   . PHE D 2 29  ? -24.131 73.442 -20.988 1.00 62.61  ? 79  PHE D CE1   1 
ATOM   5862 C  CE2   . PHE D 2 29  ? -25.533 72.996 -22.873 1.00 62.84  ? 79  PHE D CE2   1 
ATOM   5863 C  CZ    . PHE D 2 29  ? -25.334 72.995 -21.501 1.00 62.92  ? 79  PHE D CZ    1 
ATOM   5864 N  N     . HIS D 2 30  ? -20.580 71.771 -25.354 1.00 61.81  ? 80  HIS D N     1 
ATOM   5865 C  CA    . HIS D 2 30  ? -20.520 70.343 -25.671 1.00 61.85  ? 80  HIS D CA    1 
ATOM   5866 C  C     . HIS D 2 30  ? -19.366 69.667 -24.930 1.00 61.76  ? 80  HIS D C     1 
ATOM   5867 O  O     . HIS D 2 30  ? -19.561 68.631 -24.293 1.00 61.92  ? 80  HIS D O     1 
ATOM   5868 C  CB    . HIS D 2 30  ? -20.372 70.147 -27.184 1.00 62.01  ? 80  HIS D CB    1 
ATOM   5869 C  CG    . HIS D 2 30  ? -20.394 68.714 -27.624 1.00 62.44  ? 80  HIS D CG    1 
ATOM   5870 N  ND1   . HIS D 2 30  ? -19.281 68.076 -28.134 1.00 62.63  ? 80  HIS D ND1   1 
ATOM   5871 C  CD2   . HIS D 2 30  ? -21.397 67.803 -27.648 1.00 62.14  ? 80  HIS D CD2   1 
ATOM   5872 C  CE1   . HIS D 2 30  ? -19.598 66.832 -28.447 1.00 62.78  ? 80  HIS D CE1   1 
ATOM   5873 N  NE2   . HIS D 2 30  ? -20.875 66.639 -28.160 1.00 61.83  ? 80  HIS D NE2   1 
ATOM   5874 N  N     . ALA D 2 31  ? -18.172 70.260 -25.001 1.00 61.58  ? 81  ALA D N     1 
ATOM   5875 C  CA    . ALA D 2 31  ? -16.997 69.726 -24.297 1.00 61.37  ? 81  ALA D CA    1 
ATOM   5876 C  C     . ALA D 2 31  ? -17.291 69.507 -22.809 1.00 61.20  ? 81  ALA D C     1 
ATOM   5877 O  O     . ALA D 2 31  ? -16.830 68.533 -22.218 1.00 61.04  ? 81  ALA D O     1 
ATOM   5878 C  CB    . ALA D 2 31  ? -15.792 70.655 -24.474 1.00 61.19  ? 81  ALA D CB    1 
ATOM   5879 N  N     . PHE D 2 32  ? -18.064 70.416 -22.219 1.00 61.19  ? 82  PHE D N     1 
ATOM   5880 C  CA    . PHE D 2 32  ? -18.484 70.305 -20.819 1.00 61.21  ? 82  PHE D CA    1 
ATOM   5881 C  C     . PHE D 2 32  ? -19.401 69.106 -20.593 1.00 61.11  ? 82  PHE D C     1 
ATOM   5882 O  O     . PHE D 2 32  ? -19.188 68.319 -19.674 1.00 61.19  ? 82  PHE D O     1 
ATOM   5883 C  CB    . PHE D 2 32  ? -19.199 71.586 -20.376 1.00 61.21  ? 82  PHE D CB    1 
ATOM   5884 C  CG    . PHE D 2 32  ? -19.707 71.544 -18.958 1.00 61.29  ? 82  PHE D CG    1 
ATOM   5885 C  CD1   . PHE D 2 32  ? -18.887 71.913 -17.901 1.00 61.41  ? 82  PHE D CD1   1 
ATOM   5886 C  CD2   . PHE D 2 32  ? -21.013 71.149 -18.682 1.00 61.11  ? 82  PHE D CD2   1 
ATOM   5887 C  CE1   . PHE D 2 32  ? -19.358 71.884 -16.597 1.00 61.48  ? 82  PHE D CE1   1 
ATOM   5888 C  CE2   . PHE D 2 32  ? -21.487 71.121 -17.382 1.00 60.79  ? 82  PHE D CE2   1 
ATOM   5889 C  CZ    . PHE D 2 32  ? -20.665 71.486 -16.340 1.00 61.08  ? 82  PHE D CZ    1 
ATOM   5890 N  N     . LEU D 2 33  ? -20.421 68.968 -21.429 1.00 61.00  ? 83  LEU D N     1 
ATOM   5891 C  CA    . LEU D 2 33  ? -21.354 67.854 -21.285 1.00 61.16  ? 83  LEU D CA    1 
ATOM   5892 C  C     . LEU D 2 33  ? -20.668 66.483 -21.402 1.00 61.19  ? 83  LEU D C     1 
ATOM   5893 O  O     . LEU D 2 33  ? -21.077 65.528 -20.739 1.00 61.14  ? 83  LEU D O     1 
ATOM   5894 C  CB    . LEU D 2 33  ? -22.485 67.968 -22.305 1.00 61.16  ? 83  LEU D CB    1 
ATOM   5895 C  CG    . LEU D 2 33  ? -23.410 69.168 -22.116 1.00 60.79  ? 83  LEU D CG    1 
ATOM   5896 C  CD1   . LEU D 2 33  ? -24.308 69.347 -23.331 1.00 59.82  ? 83  LEU D CD1   1 
ATOM   5897 C  CD2   . LEU D 2 33  ? -24.214 68.996 -20.844 1.00 60.93  ? 83  LEU D CD2   1 
ATOM   5898 N  N     . LYS D 2 34  ? -19.633 66.388 -22.236 1.00 61.15  ? 84  LYS D N     1 
ATOM   5899 C  CA    . LYS D 2 34  ? -18.824 65.177 -22.291 1.00 61.21  ? 84  LYS D CA    1 
ATOM   5900 C  C     . LYS D 2 34  ? -18.301 64.824 -20.905 1.00 61.21  ? 84  LYS D C     1 
ATOM   5901 O  O     . LYS D 2 34  ? -18.386 63.671 -20.489 1.00 61.00  ? 84  LYS D O     1 
ATOM   5902 C  CB    . LYS D 2 34  ? -17.645 65.321 -23.255 1.00 61.28  ? 84  LYS D CB    1 
ATOM   5903 C  CG    . LYS D 2 34  ? -17.980 65.080 -24.723 1.00 61.41  ? 84  LYS D CG    1 
ATOM   5904 C  CD    . LYS D 2 34  ? -16.693 64.962 -25.563 1.00 61.33  ? 84  LYS D CD    1 
ATOM   5905 N  N     . THR D 2 35  ? -17.789 65.818 -20.181 1.00 61.37  ? 85  THR D N     1 
ATOM   5906 C  CA    . THR D 2 35  ? -17.179 65.564 -18.871 1.00 61.60  ? 85  THR D CA    1 
ATOM   5907 C  C     . THR D 2 35  ? -18.181 65.074 -17.836 1.00 61.65  ? 85  THR D C     1 
ATOM   5908 O  O     . THR D 2 35  ? -17.780 64.459 -16.850 1.00 61.73  ? 85  THR D O     1 
ATOM   5909 C  CB    . THR D 2 35  ? -16.463 66.801 -18.282 1.00 61.70  ? 85  THR D CB    1 
ATOM   5910 O  OG1   . THR D 2 35  ? -17.435 67.744 -17.813 1.00 61.79  ? 85  THR D OG1   1 
ATOM   5911 C  CG2   . THR D 2 35  ? -15.519 67.449 -19.311 1.00 61.44  ? 85  THR D CG2   1 
ATOM   5912 N  N     . GLU D 2 36  ? -19.463 65.369 -18.060 1.00 61.86  ? 86  GLU D N     1 
ATOM   5913 C  CA    . GLU D 2 36  ? -20.570 64.893 -17.227 1.00 61.98  ? 86  GLU D CA    1 
ATOM   5914 C  C     . GLU D 2 36  ? -21.473 63.887 -17.968 1.00 61.92  ? 86  GLU D C     1 
ATOM   5915 O  O     . GLU D 2 36  ? -22.632 63.688 -17.590 1.00 61.69  ? 86  GLU D O     1 
ATOM   5916 C  CB    . GLU D 2 36  ? -21.444 66.077 -16.802 1.00 62.26  ? 86  GLU D CB    1 
ATOM   5917 C  CG    . GLU D 2 36  ? -20.833 67.052 -15.805 1.00 62.39  ? 86  GLU D CG    1 
ATOM   5918 C  CD    . GLU D 2 36  ? -21.858 68.076 -15.279 1.00 62.45  ? 86  GLU D CD    1 
ATOM   5919 O  OE1   . GLU D 2 36  ? -23.046 68.043 -15.704 1.00 62.26  ? 86  GLU D OE1   1 
ATOM   5920 O  OE2   . GLU D 2 36  ? -21.466 68.918 -14.437 1.00 62.72  ? 86  GLU D OE2   1 
ATOM   5921 N  N     . PHE D 2 37  ? -20.967 63.294 -19.047 1.00 61.88  ? 87  PHE D N     1 
ATOM   5922 C  CA    . PHE D 2 37  ? -21.693 62.254 -19.796 1.00 61.85  ? 87  PHE D CA    1 
ATOM   5923 C  C     . PHE D 2 37  ? -23.202 62.536 -20.056 1.00 62.10  ? 87  PHE D C     1 
ATOM   5924 O  O     . PHE D 2 37  ? -24.035 61.653 -19.922 1.00 61.68  ? 87  PHE D O     1 
ATOM   5925 C  CB    . PHE D 2 37  ? -21.515 60.905 -19.088 1.00 61.43  ? 87  PHE D CB    1 
ATOM   5926 C  CG    . PHE D 2 37  ? -20.095 60.611 -18.698 1.00 61.08  ? 87  PHE D CG    1 
ATOM   5927 C  CD1   . PHE D 2 37  ? -19.214 60.032 -19.606 1.00 60.84  ? 87  PHE D CD1   1 
ATOM   5928 C  CD2   . PHE D 2 37  ? -19.633 60.914 -17.425 1.00 60.85  ? 87  PHE D CD2   1 
ATOM   5929 C  CE1   . PHE D 2 37  ? -17.906 59.764 -19.257 1.00 59.93  ? 87  PHE D CE1   1 
ATOM   5930 C  CE2   . PHE D 2 37  ? -18.319 60.645 -17.067 1.00 60.64  ? 87  PHE D CE2   1 
ATOM   5931 C  CZ    . PHE D 2 37  ? -17.456 60.071 -17.987 1.00 60.59  ? 87  PHE D CZ    1 
ATOM   5932 N  N     . SER D 2 38  ? -23.535 63.764 -20.438 1.00 62.85  ? 88  SER D N     1 
ATOM   5933 C  CA    . SER D 2 38  ? -24.899 64.107 -20.849 1.00 63.63  ? 88  SER D CA    1 
ATOM   5934 C  C     . SER D 2 38  ? -24.921 64.927 -22.144 1.00 63.90  ? 88  SER D C     1 
ATOM   5935 O  O     . SER D 2 38  ? -25.825 65.742 -22.350 1.00 64.09  ? 88  SER D O     1 
ATOM   5936 C  CB    . SER D 2 38  ? -25.617 64.883 -19.739 1.00 63.75  ? 88  SER D CB    1 
ATOM   5937 O  OG    . SER D 2 38  ? -25.086 66.194 -19.621 1.00 64.49  ? 88  SER D OG    1 
ATOM   5938 N  N     . GLU D 2 39  ? -23.948 64.693 -23.020 1.00 64.26  ? 89  GLU D N     1 
ATOM   5939 C  CA    . GLU D 2 39  ? -23.824 65.475 -24.260 1.00 64.75  ? 89  GLU D CA    1 
ATOM   5940 C  C     . GLU D 2 39  ? -24.883 65.116 -25.290 1.00 64.94  ? 89  GLU D C     1 
ATOM   5941 O  O     . GLU D 2 39  ? -25.102 65.863 -26.244 1.00 64.26  ? 89  GLU D O     1 
ATOM   5942 C  CB    . GLU D 2 39  ? -22.418 65.333 -24.879 1.00 64.83  ? 89  GLU D CB    1 
ATOM   5943 C  CG    . GLU D 2 39  ? -22.053 63.939 -25.398 1.00 65.00  ? 89  GLU D CG    1 
ATOM   5944 C  CD    . GLU D 2 39  ? -21.342 63.092 -24.355 1.00 66.18  ? 89  GLU D CD    1 
ATOM   5945 O  OE1   . GLU D 2 39  ? -21.740 63.131 -23.169 1.00 65.80  ? 89  GLU D OE1   1 
ATOM   5946 O  OE2   . GLU D 2 39  ? -20.378 62.387 -24.725 1.00 67.33  ? 89  GLU D OE2   1 
ATOM   5947 N  N     . GLU D 2 40  ? -25.523 63.963 -25.086 1.00 65.57  ? 90  GLU D N     1 
ATOM   5948 C  CA    . GLU D 2 40  ? -26.573 63.480 -25.977 1.00 66.07  ? 90  GLU D CA    1 
ATOM   5949 C  C     . GLU D 2 40  ? -27.683 64.511 -26.073 1.00 66.01  ? 90  GLU D C     1 
ATOM   5950 O  O     . GLU D 2 40  ? -28.220 64.767 -27.158 1.00 66.17  ? 90  GLU D O     1 
ATOM   5951 C  CB    . GLU D 2 40  ? -27.114 62.110 -25.518 1.00 66.62  ? 90  GLU D CB    1 
ATOM   5952 C  CG    . GLU D 2 40  ? -28.380 62.079 -24.607 1.00 68.48  ? 90  GLU D CG    1 
ATOM   5953 C  CD    . GLU D 2 40  ? -28.094 62.075 -23.107 1.00 71.13  ? 90  GLU D CD    1 
ATOM   5954 O  OE1   . GLU D 2 40  ? -26.900 62.110 -22.706 1.00 71.14  ? 90  GLU D OE1   1 
ATOM   5955 O  OE2   . GLU D 2 40  ? -29.089 62.025 -22.329 1.00 72.99  ? 90  GLU D OE2   1 
ATOM   5956 N  N     . ASN D 2 41  ? -28.004 65.123 -24.937 1.00 65.78  ? 91  ASN D N     1 
ATOM   5957 C  CA    . ASN D 2 41  ? -29.004 66.171 -24.901 1.00 65.54  ? 91  ASN D CA    1 
ATOM   5958 C  C     . ASN D 2 41  ? -28.720 67.243 -25.955 1.00 65.36  ? 91  ASN D C     1 
ATOM   5959 O  O     . ASN D 2 41  ? -29.600 67.604 -26.747 1.00 65.38  ? 91  ASN D O     1 
ATOM   5960 C  CB    . ASN D 2 41  ? -29.060 66.784 -23.504 1.00 65.61  ? 91  ASN D CB    1 
ATOM   5961 C  CG    . ASN D 2 41  ? -29.682 65.847 -22.476 1.00 65.87  ? 91  ASN D CG    1 
ATOM   5962 O  OD1   . ASN D 2 41  ? -30.650 65.136 -22.764 1.00 66.14  ? 91  ASN D OD1   1 
ATOM   5963 N  ND2   . ASN D 2 41  ? -29.129 65.849 -21.267 1.00 66.29  ? 91  ASN D ND2   1 
ATOM   5964 N  N     . LEU D 2 42  ? -27.484 67.730 -25.974 1.00 64.99  ? 92  LEU D N     1 
ATOM   5965 C  CA    . LEU D 2 42  ? -27.093 68.784 -26.902 1.00 64.89  ? 92  LEU D CA    1 
ATOM   5966 C  C     . LEU D 2 42  ? -27.054 68.272 -28.345 1.00 64.84  ? 92  LEU D C     1 
ATOM   5967 O  O     . LEU D 2 42  ? -27.481 68.964 -29.272 1.00 64.97  ? 92  LEU D O     1 
ATOM   5968 C  CB    . LEU D 2 42  ? -25.738 69.373 -26.499 1.00 64.76  ? 92  LEU D CB    1 
ATOM   5969 C  CG    . LEU D 2 42  ? -25.181 70.498 -27.370 1.00 65.05  ? 92  LEU D CG    1 
ATOM   5970 C  CD1   . LEU D 2 42  ? -26.226 71.590 -27.589 1.00 64.90  ? 92  LEU D CD1   1 
ATOM   5971 C  CD2   . LEU D 2 42  ? -23.911 71.073 -26.752 1.00 65.07  ? 92  LEU D CD2   1 
ATOM   5972 N  N     . GLU D 2 43  ? -26.554 67.055 -28.533 1.00 64.80  ? 93  GLU D N     1 
ATOM   5973 C  CA    . GLU D 2 43  ? -26.478 66.463 -29.869 1.00 64.82  ? 93  GLU D CA    1 
ATOM   5974 C  C     . GLU D 2 43  ? -27.883 66.273 -30.465 1.00 64.89  ? 93  GLU D C     1 
ATOM   5975 O  O     . GLU D 2 43  ? -28.104 66.560 -31.642 1.00 64.66  ? 93  GLU D O     1 
ATOM   5976 C  CB    . GLU D 2 43  ? -25.670 65.158 -29.837 1.00 64.55  ? 93  GLU D CB    1 
ATOM   5977 C  CG    . GLU D 2 43  ? -24.202 65.413 -29.510 1.00 64.75  ? 93  GLU D CG    1 
ATOM   5978 C  CD    . GLU D 2 43  ? -23.343 64.159 -29.411 1.00 65.23  ? 93  GLU D CD    1 
ATOM   5979 O  OE1   . GLU D 2 43  ? -23.880 63.056 -29.181 1.00 67.48  ? 93  GLU D OE1   1 
ATOM   5980 O  OE2   . GLU D 2 43  ? -22.108 64.282 -29.547 1.00 64.72  ? 93  GLU D OE2   1 
ATOM   5981 N  N     . PHE D 2 44  ? -28.832 65.824 -29.643 1.00 64.97  ? 94  PHE D N     1 
ATOM   5982 C  CA    . PHE D 2 44  ? -30.228 65.734 -30.066 1.00 64.99  ? 94  PHE D CA    1 
ATOM   5983 C  C     . PHE D 2 44  ? -30.746 67.092 -30.514 1.00 64.99  ? 94  PHE D C     1 
ATOM   5984 O  O     . PHE D 2 44  ? -31.381 67.202 -31.562 1.00 65.13  ? 94  PHE D O     1 
ATOM   5985 C  CB    . PHE D 2 44  ? -31.111 65.191 -28.933 1.00 65.15  ? 94  PHE D CB    1 
ATOM   5986 C  CG    . PHE D 2 44  ? -32.592 65.212 -29.244 1.00 65.28  ? 94  PHE D CG    1 
ATOM   5987 C  CD1   . PHE D 2 44  ? -33.102 64.492 -30.316 1.00 65.53  ? 94  PHE D CD1   1 
ATOM   5988 C  CD2   . PHE D 2 44  ? -33.471 65.945 -28.463 1.00 65.40  ? 94  PHE D CD2   1 
ATOM   5989 C  CE1   . PHE D 2 44  ? -34.463 64.505 -30.608 1.00 65.18  ? 94  PHE D CE1   1 
ATOM   5990 C  CE2   . PHE D 2 44  ? -34.836 65.959 -28.748 1.00 65.73  ? 94  PHE D CE2   1 
ATOM   5991 C  CZ    . PHE D 2 44  ? -35.332 65.242 -29.821 1.00 65.15  ? 94  PHE D CZ    1 
ATOM   5992 N  N     . TRP D 2 45  ? -30.466 68.122 -29.720 1.00 64.93  ? 95  TRP D N     1 
ATOM   5993 C  CA    . TRP D 2 45  ? -30.987 69.467 -29.976 1.00 64.90  ? 95  TRP D CA    1 
ATOM   5994 C  C     . TRP D 2 45  ? -30.508 69.995 -31.331 1.00 64.93  ? 95  TRP D C     1 
ATOM   5995 O  O     . TRP D 2 45  ? -31.311 70.450 -32.146 1.00 65.17  ? 95  TRP D O     1 
ATOM   5996 C  CB    . TRP D 2 45  ? -30.571 70.410 -28.845 1.00 64.80  ? 95  TRP D CB    1 
ATOM   5997 C  CG    . TRP D 2 45  ? -31.202 71.756 -28.913 1.00 64.70  ? 95  TRP D CG    1 
ATOM   5998 C  CD1   . TRP D 2 45  ? -32.423 72.115 -28.423 1.00 65.12  ? 95  TRP D CD1   1 
ATOM   5999 C  CD2   . TRP D 2 45  ? -30.635 72.939 -29.487 1.00 64.69  ? 95  TRP D CD2   1 
ATOM   6000 N  NE1   . TRP D 2 45  ? -32.663 73.453 -28.671 1.00 65.15  ? 95  TRP D NE1   1 
ATOM   6001 C  CE2   . TRP D 2 45  ? -31.579 73.978 -29.323 1.00 64.89  ? 95  TRP D CE2   1 
ATOM   6002 C  CE3   . TRP D 2 45  ? -29.426 73.218 -30.133 1.00 64.65  ? 95  TRP D CE3   1 
ATOM   6003 C  CZ2   . TRP D 2 45  ? -31.347 75.271 -29.773 1.00 64.97  ? 95  TRP D CZ2   1 
ATOM   6004 C  CZ3   . TRP D 2 45  ? -29.196 74.496 -30.582 1.00 64.79  ? 95  TRP D CZ3   1 
ATOM   6005 C  CH2   . TRP D 2 45  ? -30.153 75.513 -30.402 1.00 65.13  ? 95  TRP D CH2   1 
ATOM   6006 N  N     . LEU D 2 46  ? -29.195 69.922 -31.550 1.00 64.78  ? 96  LEU D N     1 
ATOM   6007 C  CA    . LEU D 2 46  ? -28.566 70.253 -32.824 1.00 64.51  ? 96  LEU D CA    1 
ATOM   6008 C  C     . LEU D 2 46  ? -29.087 69.403 -33.987 1.00 64.46  ? 96  LEU D C     1 
ATOM   6009 O  O     . LEU D 2 46  ? -29.157 69.874 -35.127 1.00 64.57  ? 96  LEU D O     1 
ATOM   6010 C  CB    . LEU D 2 46  ? -27.055 70.042 -32.714 1.00 64.56  ? 96  LEU D CB    1 
ATOM   6011 C  CG    . LEU D 2 46  ? -26.292 70.976 -31.773 1.00 64.59  ? 96  LEU D CG    1 
ATOM   6012 C  CD1   . LEU D 2 46  ? -24.897 70.423 -31.503 1.00 64.23  ? 96  LEU D CD1   1 
ATOM   6013 C  CD2   . LEU D 2 46  ? -26.217 72.380 -32.352 1.00 63.58  ? 96  LEU D CD2   1 
ATOM   6014 N  N     . ALA D 2 47  ? -29.421 68.146 -33.703 1.00 64.42  ? 97  ALA D N     1 
ATOM   6015 C  CA    . ALA D 2 47  ? -29.968 67.236 -34.709 1.00 64.33  ? 97  ALA D CA    1 
ATOM   6016 C  C     . ALA D 2 47  ? -31.348 67.688 -35.170 1.00 64.31  ? 97  ALA D C     1 
ATOM   6017 O  O     . ALA D 2 47  ? -31.667 67.591 -36.360 1.00 64.31  ? 97  ALA D O     1 
ATOM   6018 C  CB    . ALA D 2 47  ? -30.031 65.825 -34.174 1.00 64.08  ? 97  ALA D CB    1 
ATOM   6019 N  N     . CYS D 2 48  ? -32.147 68.181 -34.223 1.00 64.34  ? 98  CYS D N     1 
ATOM   6020 C  CA    . CYS D 2 48  ? -33.480 68.730 -34.507 1.00 64.40  ? 98  CYS D CA    1 
ATOM   6021 C  C     . CYS D 2 48  ? -33.442 70.014 -35.339 1.00 64.77  ? 98  CYS D C     1 
ATOM   6022 O  O     . CYS D 2 48  ? -34.344 70.271 -36.146 1.00 64.57  ? 98  CYS D O     1 
ATOM   6023 C  CB    . CYS D 2 48  ? -34.221 69.017 -33.203 1.00 64.30  ? 98  CYS D CB    1 
ATOM   6024 S  SG    . CYS D 2 48  ? -34.630 67.551 -32.268 1.00 63.43  ? 98  CYS D SG    1 
ATOM   6025 N  N     . GLU D 2 49  ? -32.411 70.826 -35.127 1.00 64.99  ? 99  GLU D N     1 
ATOM   6026 C  CA    . GLU D 2 49  ? -32.275 72.064 -35.879 1.00 65.32  ? 99  GLU D CA    1 
ATOM   6027 C  C     . GLU D 2 49  ? -32.002 71.763 -37.356 1.00 65.26  ? 99  GLU D C     1 
ATOM   6028 O  O     . GLU D 2 49  ? -32.738 72.238 -38.219 1.00 65.63  ? 99  GLU D O     1 
ATOM   6029 C  CB    . GLU D 2 49  ? -31.208 72.982 -35.260 1.00 65.44  ? 99  GLU D CB    1 
ATOM   6030 C  CG    . GLU D 2 49  ? -31.655 73.634 -33.938 1.00 66.01  ? 99  GLU D CG    1 
ATOM   6031 C  CD    . GLU D 2 49  ? -32.726 74.721 -34.126 1.00 67.04  ? 99  GLU D CD    1 
ATOM   6032 O  OE1   . GLU D 2 49  ? -32.377 75.822 -34.617 1.00 66.86  ? 99  GLU D OE1   1 
ATOM   6033 O  OE2   . GLU D 2 49  ? -33.910 74.479 -33.776 1.00 66.93  ? 99  GLU D OE2   1 
ATOM   6034 N  N     . GLU D 2 50  ? -30.983 70.953 -37.647 1.00 65.03  ? 100 GLU D N     1 
ATOM   6035 C  CA    . GLU D 2 50  ? -30.701 70.554 -39.033 1.00 64.87  ? 100 GLU D CA    1 
ATOM   6036 C  C     . GLU D 2 50  ? -31.896 69.841 -39.672 1.00 64.61  ? 100 GLU D C     1 
ATOM   6037 O  O     . GLU D 2 50  ? -32.134 69.980 -40.875 1.00 64.70  ? 100 GLU D O     1 
ATOM   6038 C  CB    . GLU D 2 50  ? -29.463 69.645 -39.123 1.00 64.99  ? 100 GLU D CB    1 
ATOM   6039 C  CG    . GLU D 2 50  ? -28.122 70.314 -38.808 1.00 65.46  ? 100 GLU D CG    1 
ATOM   6040 C  CD    . GLU D 2 50  ? -27.817 71.529 -39.687 1.00 66.31  ? 100 GLU D CD    1 
ATOM   6041 O  OE1   . GLU D 2 50  ? -28.065 71.486 -40.919 1.00 66.45  ? 100 GLU D OE1   1 
ATOM   6042 O  OE2   . GLU D 2 50  ? -27.316 72.532 -39.133 1.00 66.59  ? 100 GLU D OE2   1 
ATOM   6043 N  N     . PHE D 2 51  ? -32.636 69.081 -38.864 1.00 64.18  ? 101 PHE D N     1 
ATOM   6044 C  CA    . PHE D 2 51  ? -33.812 68.353 -39.333 1.00 63.87  ? 101 PHE D CA    1 
ATOM   6045 C  C     . PHE D 2 51  ? -34.917 69.301 -39.815 1.00 64.02  ? 101 PHE D C     1 
ATOM   6046 O  O     . PHE D 2 51  ? -35.520 69.066 -40.861 1.00 64.12  ? 101 PHE D O     1 
ATOM   6047 C  CB    . PHE D 2 51  ? -34.346 67.430 -38.225 1.00 63.64  ? 101 PHE D CB    1 
ATOM   6048 C  CG    . PHE D 2 51  ? -35.671 66.785 -38.546 1.00 63.18  ? 101 PHE D CG    1 
ATOM   6049 C  CD1   . PHE D 2 51  ? -35.731 65.647 -39.330 1.00 62.47  ? 101 PHE D CD1   1 
ATOM   6050 C  CD2   . PHE D 2 51  ? -36.858 67.322 -38.062 1.00 63.16  ? 101 PHE D CD2   1 
ATOM   6051 C  CE1   . PHE D 2 51  ? -36.949 65.055 -39.633 1.00 62.69  ? 101 PHE D CE1   1 
ATOM   6052 C  CE2   . PHE D 2 51  ? -38.084 66.733 -38.360 1.00 63.27  ? 101 PHE D CE2   1 
ATOM   6053 C  CZ    . PHE D 2 51  ? -38.130 65.599 -39.145 1.00 63.04  ? 101 PHE D CZ    1 
ATOM   6054 N  N     . LYS D 2 52  ? -35.185 70.366 -39.066 1.00 63.98  ? 102 LYS D N     1 
ATOM   6055 C  CA    . LYS D 2 52  ? -36.292 71.261 -39.421 1.00 64.05  ? 102 LYS D CA    1 
ATOM   6056 C  C     . LYS D 2 52  ? -35.995 72.168 -40.625 1.00 63.94  ? 102 LYS D C     1 
ATOM   6057 O  O     . LYS D 2 52  ? -36.903 72.828 -41.140 1.00 63.90  ? 102 LYS D O     1 
ATOM   6058 C  CB    . LYS D 2 52  ? -36.784 72.070 -38.207 1.00 64.15  ? 102 LYS D CB    1 
ATOM   6059 C  CG    . LYS D 2 52  ? -35.756 72.982 -37.529 1.00 64.21  ? 102 LYS D CG    1 
ATOM   6060 C  CD    . LYS D 2 52  ? -36.367 73.689 -36.313 1.00 64.07  ? 102 LYS D CD    1 
ATOM   6061 C  CE    . LYS D 2 52  ? -36.631 72.728 -35.159 1.00 63.61  ? 102 LYS D CE    1 
ATOM   6062 N  NZ    . LYS D 2 52  ? -37.538 73.324 -34.157 1.00 63.53  ? 102 LYS D NZ    1 
ATOM   6063 N  N     . LYS D 2 53  ? -34.738 72.187 -41.078 1.00 63.80  ? 103 LYS D N     1 
ATOM   6064 C  CA    . LYS D 2 53  ? -34.371 72.843 -42.344 1.00 63.60  ? 103 LYS D CA    1 
ATOM   6065 C  C     . LYS D 2 53  ? -34.739 72.000 -43.574 1.00 63.34  ? 103 LYS D C     1 
ATOM   6066 O  O     . LYS D 2 53  ? -34.641 72.486 -44.703 1.00 63.49  ? 103 LYS D O     1 
ATOM   6067 C  CB    . LYS D 2 53  ? -32.865 73.118 -42.410 1.00 63.63  ? 103 LYS D CB    1 
ATOM   6068 C  CG    . LYS D 2 53  ? -32.294 74.087 -41.388 1.00 63.77  ? 103 LYS D CG    1 
ATOM   6069 C  CD    . LYS D 2 53  ? -30.782 74.176 -41.604 1.00 64.16  ? 103 LYS D CD    1 
ATOM   6070 C  CE    . LYS D 2 53  ? -30.082 75.124 -40.650 1.00 64.12  ? 103 LYS D CE    1 
ATOM   6071 N  NZ    . LYS D 2 53  ? -28.616 75.136 -40.933 1.00 63.84  ? 103 LYS D NZ    1 
ATOM   6072 N  N     . ILE D 2 54  ? -35.127 70.740 -43.369 1.00 62.94  ? 104 ILE D N     1 
ATOM   6073 C  CA    . ILE D 2 54  ? -35.430 69.844 -44.485 1.00 62.50  ? 104 ILE D CA    1 
ATOM   6074 C  C     . ILE D 2 54  ? -36.815 70.145 -45.045 1.00 62.38  ? 104 ILE D C     1 
ATOM   6075 O  O     . ILE D 2 54  ? -37.801 70.147 -44.303 1.00 62.18  ? 104 ILE D O     1 
ATOM   6076 C  CB    . ILE D 2 54  ? -35.376 68.359 -44.079 1.00 62.42  ? 104 ILE D CB    1 
ATOM   6077 C  CG1   . ILE D 2 54  ? -34.002 67.991 -43.515 1.00 61.95  ? 104 ILE D CG1   1 
ATOM   6078 C  CG2   . ILE D 2 54  ? -35.689 67.472 -45.279 1.00 62.05  ? 104 ILE D CG2   1 
ATOM   6079 C  CD1   . ILE D 2 54  ? -33.969 66.614 -42.888 1.00 61.03  ? 104 ILE D CD1   1 
ATOM   6080 N  N     . ARG D 2 55  ? -36.870 70.407 -46.353 1.00 62.26  ? 105 ARG D N     1 
ATOM   6081 C  CA    . ARG D 2 55  ? -38.124 70.679 -47.052 1.00 62.13  ? 105 ARG D CA    1 
ATOM   6082 C  C     . ARG D 2 55  ? -38.695 69.407 -47.680 1.00 62.08  ? 105 ARG D C     1 
ATOM   6083 O  O     . ARG D 2 55  ? -39.905 69.200 -47.664 1.00 62.13  ? 105 ARG D O     1 
ATOM   6084 C  CB    . ARG D 2 55  ? -37.919 71.754 -48.120 1.00 62.05  ? 105 ARG D CB    1 
ATOM   6085 N  N     . SER D 2 56  ? -37.826 68.558 -48.225 1.00 62.04  ? 106 SER D N     1 
ATOM   6086 C  CA    . SER D 2 56  ? -38.241 67.288 -48.834 1.00 62.10  ? 106 SER D CA    1 
ATOM   6087 C  C     . SER D 2 56  ? -38.958 66.351 -47.843 1.00 62.17  ? 106 SER D C     1 
ATOM   6088 O  O     . SER D 2 56  ? -38.524 66.200 -46.701 1.00 62.25  ? 106 SER D O     1 
ATOM   6089 C  CB    . SER D 2 56  ? -37.019 66.577 -49.424 1.00 62.08  ? 106 SER D CB    1 
ATOM   6090 O  OG    . SER D 2 56  ? -37.356 65.291 -49.909 1.00 62.29  ? 106 SER D OG    1 
ATOM   6091 N  N     . ALA D 2 57  ? -40.046 65.719 -48.292 1.00 62.14  ? 107 ALA D N     1 
ATOM   6092 C  CA    . ALA D 2 57  ? -40.867 64.840 -47.436 1.00 61.98  ? 107 ALA D CA    1 
ATOM   6093 C  C     . ALA D 2 57  ? -40.244 63.453 -47.225 1.00 61.94  ? 107 ALA D C     1 
ATOM   6094 O  O     . ALA D 2 57  ? -40.378 62.863 -46.149 1.00 62.05  ? 107 ALA D O     1 
ATOM   6095 C  CB    . ALA D 2 57  ? -42.270 64.697 -48.022 1.00 61.82  ? 107 ALA D CB    1 
ATOM   6096 N  N     . THR D 2 58  ? -39.579 62.936 -48.258 1.00 61.82  ? 108 THR D N     1 
ATOM   6097 C  CA    . THR D 2 58  ? -38.916 61.631 -48.200 1.00 61.70  ? 108 THR D CA    1 
ATOM   6098 C  C     . THR D 2 58  ? -37.663 61.694 -47.343 1.00 61.66  ? 108 THR D C     1 
ATOM   6099 O  O     . THR D 2 58  ? -37.408 60.786 -46.560 1.00 61.56  ? 108 THR D O     1 
ATOM   6100 C  CB    . THR D 2 58  ? -38.522 61.126 -49.611 1.00 61.72  ? 108 THR D CB    1 
ATOM   6101 O  OG1   . THR D 2 58  ? -39.703 60.826 -50.368 1.00 61.76  ? 108 THR D OG1   1 
ATOM   6102 C  CG2   . THR D 2 58  ? -37.653 59.877 -49.525 1.00 61.66  ? 108 THR D CG2   1 
ATOM   6103 N  N     . LYS D 2 59  ? -36.879 62.757 -47.508 1.00 61.79  ? 109 LYS D N     1 
ATOM   6104 C  CA    . LYS D 2 59  ? -35.667 62.957 -46.711 1.00 61.94  ? 109 LYS D CA    1 
ATOM   6105 C  C     . LYS D 2 59  ? -36.004 63.375 -45.271 1.00 62.20  ? 109 LYS D C     1 
ATOM   6106 O  O     . LYS D 2 59  ? -35.174 63.218 -44.372 1.00 62.23  ? 109 LYS D O     1 
ATOM   6107 C  CB    . LYS D 2 59  ? -34.743 63.986 -47.374 1.00 61.94  ? 109 LYS D CB    1 
ATOM   6108 C  CG    . LYS D 2 59  ? -33.381 64.142 -46.701 1.00 61.46  ? 109 LYS D CG    1 
ATOM   6109 N  N     . LEU D 2 60  ? -37.210 63.906 -45.051 1.00 62.31  ? 110 LEU D N     1 
ATOM   6110 C  CA    . LEU D 2 60  ? -37.717 64.115 -43.690 1.00 62.45  ? 110 LEU D CA    1 
ATOM   6111 C  C     . LEU D 2 60  ? -37.926 62.765 -43.001 1.00 62.61  ? 110 LEU D C     1 
ATOM   6112 O  O     . LEU D 2 60  ? -37.432 62.539 -41.902 1.00 62.58  ? 110 LEU D O     1 
ATOM   6113 C  CB    . LEU D 2 60  ? -39.033 64.904 -43.686 1.00 62.48  ? 110 LEU D CB    1 
ATOM   6114 C  CG    . LEU D 2 60  ? -38.948 66.433 -43.703 1.00 62.35  ? 110 LEU D CG    1 
ATOM   6115 C  CD1   . LEU D 2 60  ? -40.294 67.031 -44.085 1.00 62.17  ? 110 LEU D CD1   1 
ATOM   6116 C  CD2   . LEU D 2 60  ? -38.474 66.979 -42.367 1.00 62.05  ? 110 LEU D CD2   1 
ATOM   6117 N  N     . ALA D 2 61  ? -38.653 61.870 -43.661 1.00 62.86  ? 111 ALA D N     1 
ATOM   6118 C  CA    . ALA D 2 61  ? -38.917 60.536 -43.116 1.00 63.06  ? 111 ALA D CA    1 
ATOM   6119 C  C     . ALA D 2 61  ? -37.626 59.779 -42.752 1.00 63.14  ? 111 ALA D C     1 
ATOM   6120 O  O     . ALA D 2 61  ? -37.494 59.267 -41.640 1.00 63.12  ? 111 ALA D O     1 
ATOM   6121 C  CB    . ALA D 2 61  ? -39.762 59.720 -44.102 1.00 63.01  ? 111 ALA D CB    1 
ATOM   6122 N  N     . SER D 2 62  ? -36.674 59.724 -43.677 1.00 63.21  ? 112 SER D N     1 
ATOM   6123 C  CA    . SER D 2 62  ? -35.439 58.984 -43.436 1.00 63.40  ? 112 SER D CA    1 
ATOM   6124 C  C     . SER D 2 62  ? -34.691 59.553 -42.236 1.00 63.21  ? 112 SER D C     1 
ATOM   6125 O  O     . SER D 2 62  ? -34.301 58.808 -41.344 1.00 63.25  ? 112 SER D O     1 
ATOM   6126 C  CB    . SER D 2 62  ? -34.534 58.962 -44.680 1.00 63.55  ? 112 SER D CB    1 
ATOM   6127 O  OG    . SER D 2 62  ? -33.770 60.154 -44.802 1.00 64.56  ? 112 SER D OG    1 
ATOM   6128 N  N     . ARG D 2 63  ? -34.511 60.870 -42.202 1.00 63.18  ? 113 ARG D N     1 
ATOM   6129 C  CA    . ARG D 2 63  ? -33.803 61.508 -41.085 1.00 63.23  ? 113 ARG D CA    1 
ATOM   6130 C  C     . ARG D 2 63  ? -34.628 61.436 -39.799 1.00 63.27  ? 113 ARG D C     1 
ATOM   6131 O  O     . ARG D 2 63  ? -34.068 61.352 -38.708 1.00 63.39  ? 113 ARG D O     1 
ATOM   6132 C  CB    . ARG D 2 63  ? -33.440 62.964 -41.405 1.00 63.18  ? 113 ARG D CB    1 
ATOM   6133 C  CG    . ARG D 2 63  ? -32.136 63.444 -40.760 1.00 63.32  ? 113 ARG D CG    1 
ATOM   6134 C  CD    . ARG D 2 63  ? -30.898 62.964 -41.535 1.00 63.53  ? 113 ARG D CD    1 
ATOM   6135 N  N     . ALA D 2 64  ? -35.954 61.460 -39.927 1.00 63.25  ? 114 ALA D N     1 
ATOM   6136 C  CA    . ALA D 2 64  ? -36.838 61.309 -38.773 1.00 63.31  ? 114 ALA D CA    1 
ATOM   6137 C  C     . ALA D 2 64  ? -36.601 59.974 -38.081 1.00 63.49  ? 114 ALA D C     1 
ATOM   6138 O  O     . ALA D 2 64  ? -36.376 59.922 -36.879 1.00 63.75  ? 114 ALA D O     1 
ATOM   6139 C  CB    . ALA D 2 64  ? -38.294 61.432 -39.190 1.00 63.22  ? 114 ALA D CB    1 
ATOM   6140 N  N     . HIS D 2 65  ? -36.638 58.890 -38.844 1.00 63.79  ? 115 HIS D N     1 
ATOM   6141 C  CA    . HIS D 2 65  ? -36.429 57.562 -38.270 1.00 64.00  ? 115 HIS D CA    1 
ATOM   6142 C  C     . HIS D 2 65  ? -35.013 57.401 -37.704 1.00 63.64  ? 115 HIS D C     1 
ATOM   6143 O  O     . HIS D 2 65  ? -34.865 56.871 -36.610 1.00 63.42  ? 115 HIS D O     1 
ATOM   6144 C  CB    . HIS D 2 65  ? -36.794 56.457 -39.280 1.00 64.28  ? 115 HIS D CB    1 
ATOM   6145 C  CG    . HIS D 2 65  ? -38.272 56.340 -39.524 1.00 65.58  ? 115 HIS D CG    1 
ATOM   6146 N  ND1   . HIS D 2 65  ? -38.942 57.125 -40.440 1.00 67.21  ? 115 HIS D ND1   1 
ATOM   6147 C  CD2   . HIS D 2 65  ? -39.214 55.555 -38.945 1.00 66.83  ? 115 HIS D CD2   1 
ATOM   6148 C  CE1   . HIS D 2 65  ? -40.229 56.819 -40.426 1.00 67.18  ? 115 HIS D CE1   1 
ATOM   6149 N  NE2   . HIS D 2 65  ? -40.420 55.870 -39.526 1.00 67.24  ? 115 HIS D NE2   1 
ATOM   6150 N  N     . GLN D 2 66  ? -33.996 57.885 -38.426 1.00 63.53  ? 116 GLN D N     1 
ATOM   6151 C  CA    . GLN D 2 66  ? -32.597 57.861 -37.946 1.00 63.56  ? 116 GLN D CA    1 
ATOM   6152 C  C     . GLN D 2 66  ? -32.453 58.510 -36.569 1.00 63.52  ? 116 GLN D C     1 
ATOM   6153 O  O     . GLN D 2 66  ? -31.771 57.974 -35.696 1.00 63.39  ? 116 GLN D O     1 
ATOM   6154 C  CB    . GLN D 2 66  ? -31.661 58.597 -38.907 1.00 63.47  ? 116 GLN D CB    1 
ATOM   6155 C  CG    . GLN D 2 66  ? -31.320 57.861 -40.187 1.00 63.70  ? 116 GLN D CG    1 
ATOM   6156 C  CD    . GLN D 2 66  ? -30.495 58.726 -41.148 1.00 63.72  ? 116 GLN D CD    1 
ATOM   6157 O  OE1   . GLN D 2 66  ? -29.331 59.038 -40.875 1.00 63.10  ? 116 GLN D OE1   1 
ATOM   6158 N  NE2   . GLN D 2 66  ? -31.102 59.120 -42.272 1.00 62.82  ? 116 GLN D NE2   1 
ATOM   6159 N  N     . ILE D 2 67  ? -33.086 59.672 -36.400 1.00 63.49  ? 117 ILE D N     1 
ATOM   6160 C  CA    . ILE D 2 67  ? -33.060 60.418 -35.135 1.00 63.46  ? 117 ILE D CA    1 
ATOM   6161 C  C     . ILE D 2 67  ? -33.860 59.701 -34.039 1.00 63.53  ? 117 ILE D C     1 
ATOM   6162 O  O     . ILE D 2 67  ? -33.411 59.596 -32.890 1.00 63.32  ? 117 ILE D O     1 
ATOM   6163 C  CB    . ILE D 2 67  ? -33.618 61.847 -35.320 1.00 63.50  ? 117 ILE D CB    1 
ATOM   6164 C  CG1   . ILE D 2 67  ? -32.609 62.719 -36.083 1.00 63.79  ? 117 ILE D CG1   1 
ATOM   6165 C  CG2   . ILE D 2 67  ? -33.954 62.482 -33.973 1.00 63.37  ? 117 ILE D CG2   1 
ATOM   6166 C  CD1   . ILE D 2 67  ? -33.145 64.103 -36.484 1.00 63.28  ? 117 ILE D CD1   1 
ATOM   6167 N  N     . PHE D 2 68  ? -35.048 59.215 -34.390 1.00 63.43  ? 118 PHE D N     1 
ATOM   6168 C  CA    . PHE D 2 68  ? -35.834 58.452 -33.440 1.00 63.38  ? 118 PHE D CA    1 
ATOM   6169 C  C     . PHE D 2 68  ? -35.034 57.253 -32.965 1.00 63.54  ? 118 PHE D C     1 
ATOM   6170 O  O     . PHE D 2 68  ? -34.960 56.993 -31.768 1.00 63.80  ? 118 PHE D O     1 
ATOM   6171 C  CB    . PHE D 2 68  ? -37.156 57.982 -34.036 1.00 63.23  ? 118 PHE D CB    1 
ATOM   6172 C  CG    . PHE D 2 68  ? -38.117 57.471 -33.006 1.00 63.08  ? 118 PHE D CG    1 
ATOM   6173 C  CD1   . PHE D 2 68  ? -39.029 58.333 -32.408 1.00 63.19  ? 118 PHE D CD1   1 
ATOM   6174 C  CD2   . PHE D 2 68  ? -38.091 56.146 -32.608 1.00 62.52  ? 118 PHE D CD2   1 
ATOM   6175 C  CE1   . PHE D 2 68  ? -39.906 57.876 -31.447 1.00 63.04  ? 118 PHE D CE1   1 
ATOM   6176 C  CE2   . PHE D 2 68  ? -38.961 55.680 -31.642 1.00 62.91  ? 118 PHE D CE2   1 
ATOM   6177 C  CZ    . PHE D 2 68  ? -39.871 56.545 -31.060 1.00 63.24  ? 118 PHE D CZ    1 
ATOM   6178 N  N     . GLU D 2 69  ? -34.424 56.540 -33.907 1.00 63.76  ? 119 GLU D N     1 
ATOM   6179 C  CA    . GLU D 2 69  ? -33.680 55.314 -33.599 1.00 64.03  ? 119 GLU D CA    1 
ATOM   6180 C  C     . GLU D 2 69  ? -32.384 55.586 -32.808 1.00 63.80  ? 119 GLU D C     1 
ATOM   6181 O  O     . GLU D 2 69  ? -31.850 54.690 -32.175 1.00 63.73  ? 119 GLU D O     1 
ATOM   6182 C  CB    . GLU D 2 69  ? -33.370 54.526 -34.891 1.00 64.20  ? 119 GLU D CB    1 
ATOM   6183 C  CG    . GLU D 2 69  ? -34.362 53.387 -35.256 1.00 65.75  ? 119 GLU D CG    1 
ATOM   6184 C  CD    . GLU D 2 69  ? -35.810 53.851 -35.545 1.00 67.95  ? 119 GLU D CD    1 
ATOM   6185 O  OE1   . GLU D 2 69  ? -36.297 53.703 -36.698 1.00 68.38  ? 119 GLU D OE1   1 
ATOM   6186 O  OE2   . GLU D 2 69  ? -36.475 54.338 -34.606 1.00 69.55  ? 119 GLU D OE2   1 
ATOM   6187 N  N     . GLU D 2 70  ? -31.899 56.822 -32.836 1.00 63.76  ? 120 GLU D N     1 
ATOM   6188 C  CA    . GLU D 2 70  ? -30.620 57.187 -32.217 1.00 63.84  ? 120 GLU D CA    1 
ATOM   6189 C  C     . GLU D 2 70  ? -30.775 57.791 -30.816 1.00 63.50  ? 120 GLU D C     1 
ATOM   6190 O  O     . GLU D 2 70  ? -29.936 57.552 -29.940 1.00 63.37  ? 120 GLU D O     1 
ATOM   6191 C  CB    . GLU D 2 70  ? -29.890 58.183 -33.134 1.00 63.95  ? 120 GLU D CB    1 
ATOM   6192 C  CG    . GLU D 2 70  ? -28.596 58.775 -32.594 1.00 65.05  ? 120 GLU D CG    1 
ATOM   6193 C  CD    . GLU D 2 70  ? -27.397 57.866 -32.749 1.00 67.22  ? 120 GLU D CD    1 
ATOM   6194 O  OE1   . GLU D 2 70  ? -27.572 56.644 -32.951 1.00 68.50  ? 120 GLU D OE1   1 
ATOM   6195 O  OE2   . GLU D 2 70  ? -26.262 58.388 -32.672 1.00 68.66  ? 120 GLU D OE2   1 
ATOM   6196 N  N     . PHE D 2 71  ? -31.840 58.569 -30.626 1.00 63.15  ? 121 PHE D N     1 
ATOM   6197 C  CA    . PHE D 2 71  ? -31.975 59.480 -29.496 1.00 63.08  ? 121 PHE D CA    1 
ATOM   6198 C  C     . PHE D 2 71  ? -33.217 59.246 -28.634 1.00 63.32  ? 121 PHE D C     1 
ATOM   6199 O  O     . PHE D 2 71  ? -33.157 59.394 -27.418 1.00 63.48  ? 121 PHE D O     1 
ATOM   6200 C  CB    . PHE D 2 71  ? -32.029 60.921 -30.005 1.00 62.88  ? 121 PHE D CB    1 
ATOM   6201 C  CG    . PHE D 2 71  ? -30.748 61.406 -30.631 1.00 62.77  ? 121 PHE D CG    1 
ATOM   6202 C  CD1   . PHE D 2 71  ? -29.659 61.760 -29.841 1.00 62.60  ? 121 PHE D CD1   1 
ATOM   6203 C  CD2   . PHE D 2 71  ? -30.637 61.546 -32.012 1.00 62.73  ? 121 PHE D CD2   1 
ATOM   6204 C  CE1   . PHE D 2 71  ? -28.473 62.226 -30.419 1.00 62.57  ? 121 PHE D CE1   1 
ATOM   6205 C  CE2   . PHE D 2 71  ? -29.447 62.012 -32.594 1.00 62.34  ? 121 PHE D CE2   1 
ATOM   6206 C  CZ    . PHE D 2 71  ? -28.372 62.351 -31.796 1.00 62.12  ? 121 PHE D CZ    1 
ATOM   6207 N  N     . ILE D 2 72  ? -34.348 58.922 -29.253 1.00 63.47  ? 122 ILE D N     1 
ATOM   6208 C  CA    . ILE D 2 72  ? -35.595 58.772 -28.507 1.00 63.70  ? 122 ILE D CA    1 
ATOM   6209 C  C     . ILE D 2 72  ? -35.786 57.379 -27.937 1.00 63.97  ? 122 ILE D C     1 
ATOM   6210 O  O     . ILE D 2 72  ? -35.989 57.212 -26.729 1.00 63.97  ? 122 ILE D O     1 
ATOM   6211 C  CB    . ILE D 2 72  ? -36.835 59.077 -29.380 1.00 63.68  ? 122 ILE D CB    1 
ATOM   6212 C  CG1   . ILE D 2 72  ? -36.755 60.493 -29.958 1.00 63.08  ? 122 ILE D CG1   1 
ATOM   6213 C  CG2   . ILE D 2 72  ? -38.111 58.886 -28.564 1.00 63.46  ? 122 ILE D CG2   1 
ATOM   6214 C  CD1   . ILE D 2 72  ? -36.474 61.553 -28.937 1.00 62.30  ? 122 ILE D CD1   1 
ATOM   6215 N  N     . CYS D 2 73  ? -35.713 56.386 -28.816 1.00 64.31  ? 123 CYS D N     1 
ATOM   6216 C  CA    . CYS D 2 73  ? -36.307 55.080 -28.546 1.00 64.82  ? 123 CYS D CA    1 
ATOM   6217 C  C     . CYS D 2 73  ? -35.636 54.310 -27.430 1.00 64.82  ? 123 CYS D C     1 
ATOM   6218 O  O     . CYS D 2 73  ? -34.457 54.511 -27.140 1.00 65.04  ? 123 CYS D O     1 
ATOM   6219 C  CB    . CYS D 2 73  ? -36.314 54.213 -29.804 1.00 64.89  ? 123 CYS D CB    1 
ATOM   6220 S  SG    . CYS D 2 73  ? -34.758 53.409 -30.112 1.00 66.01  ? 123 CYS D SG    1 
ATOM   6221 N  N     . SER D 2 74  ? -36.408 53.400 -26.839 1.00 64.95  ? 124 SER D N     1 
ATOM   6222 C  CA    . SER D 2 74  ? -35.958 52.563 -25.738 1.00 64.84  ? 124 SER D CA    1 
ATOM   6223 C  C     . SER D 2 74  ? -34.558 52.012 -26.022 1.00 64.75  ? 124 SER D C     1 
ATOM   6224 O  O     . SER D 2 74  ? -34.286 51.485 -27.099 1.00 64.50  ? 124 SER D O     1 
ATOM   6225 C  CB    . SER D 2 74  ? -36.962 51.433 -25.494 1.00 64.73  ? 124 SER D CB    1 
ATOM   6226 O  OG    . SER D 2 74  ? -36.626 50.695 -24.330 1.00 64.99  ? 124 SER D OG    1 
ATOM   6227 N  N     . GLU D 2 75  ? -33.673 52.160 -25.044 1.00 64.98  ? 125 GLU D N     1 
ATOM   6228 C  CA    . GLU D 2 75  ? -32.228 51.925 -25.226 1.00 65.25  ? 125 GLU D CA    1 
ATOM   6229 C  C     . GLU D 2 75  ? -31.758 52.298 -26.648 1.00 64.85  ? 125 GLU D C     1 
ATOM   6230 O  O     . GLU D 2 75  ? -31.194 51.487 -27.377 1.00 64.96  ? 125 GLU D O     1 
ATOM   6231 C  CB    . GLU D 2 75  ? -31.826 50.477 -24.848 1.00 65.45  ? 125 GLU D CB    1 
ATOM   6232 C  CG    . GLU D 2 75  ? -32.280 49.988 -23.441 1.00 66.33  ? 125 GLU D CG    1 
ATOM   6233 C  CD    . GLU D 2 75  ? -31.592 50.696 -22.256 1.00 67.69  ? 125 GLU D CD    1 
ATOM   6234 O  OE1   . GLU D 2 75  ? -30.761 51.609 -22.463 1.00 69.20  ? 125 GLU D OE1   1 
ATOM   6235 O  OE2   . GLU D 2 75  ? -31.889 50.329 -21.098 1.00 68.06  ? 125 GLU D OE2   1 
ATOM   6236 N  N     . ALA D 2 76  ? -32.046 53.531 -27.042 1.00 64.45  ? 126 ALA D N     1 
ATOM   6237 C  CA    . ALA D 2 76  ? -31.370 54.150 -28.157 1.00 64.09  ? 126 ALA D CA    1 
ATOM   6238 C  C     . ALA D 2 76  ? -29.918 54.374 -27.699 1.00 63.86  ? 126 ALA D C     1 
ATOM   6239 O  O     . ALA D 2 76  ? -29.665 54.547 -26.509 1.00 63.78  ? 126 ALA D O     1 
ATOM   6240 C  CB    . ALA D 2 76  ? -32.043 55.468 -28.502 1.00 63.91  ? 126 ALA D CB    1 
ATOM   6241 N  N     . PRO D 2 77  ? -28.951 54.338 -28.627 1.00 63.59  ? 127 PRO D N     1 
ATOM   6242 C  CA    . PRO D 2 77  ? -27.547 54.477 -28.202 1.00 63.53  ? 127 PRO D CA    1 
ATOM   6243 C  C     . PRO D 2 77  ? -27.228 55.808 -27.518 1.00 63.57  ? 127 PRO D C     1 
ATOM   6244 O  O     . PRO D 2 77  ? -26.285 55.887 -26.730 1.00 63.62  ? 127 PRO D O     1 
ATOM   6245 C  CB    . PRO D 2 77  ? -26.760 54.332 -29.506 1.00 63.41  ? 127 PRO D CB    1 
ATOM   6246 C  CG    . PRO D 2 77  ? -27.749 54.592 -30.583 1.00 63.73  ? 127 PRO D CG    1 
ATOM   6247 C  CD    . PRO D 2 77  ? -29.077 54.151 -30.078 1.00 63.38  ? 127 PRO D CD    1 
ATOM   6248 N  N     . LYS D 2 78  ? -28.008 56.840 -27.822 1.00 63.64  ? 128 LYS D N     1 
ATOM   6249 C  CA    . LYS D 2 78  ? -27.875 58.133 -27.160 1.00 63.67  ? 128 LYS D CA    1 
ATOM   6250 C  C     . LYS D 2 78  ? -29.255 58.575 -26.666 1.00 63.53  ? 128 LYS D C     1 
ATOM   6251 O  O     . LYS D 2 78  ? -29.713 59.673 -26.956 1.00 63.11  ? 128 LYS D O     1 
ATOM   6252 C  CB    . LYS D 2 78  ? -27.253 59.152 -28.121 1.00 63.67  ? 128 LYS D CB    1 
ATOM   6253 C  CG    . LYS D 2 78  ? -25.790 58.858 -28.474 1.00 64.09  ? 128 LYS D CG    1 
ATOM   6254 C  CD    . LYS D 2 78  ? -25.283 59.727 -29.635 1.00 64.05  ? 128 LYS D CD    1 
ATOM   6255 N  N     . GLU D 2 79  ? -29.910 57.697 -25.907 1.00 63.73  ? 129 GLU D N     1 
ATOM   6256 C  CA    . GLU D 2 79  ? -31.282 57.942 -25.449 1.00 63.89  ? 129 GLU D CA    1 
ATOM   6257 C  C     . GLU D 2 79  ? -31.358 59.217 -24.615 1.00 63.69  ? 129 GLU D C     1 
ATOM   6258 O  O     . GLU D 2 79  ? -30.514 59.448 -23.745 1.00 64.07  ? 129 GLU D O     1 
ATOM   6259 C  CB    . GLU D 2 79  ? -31.827 56.760 -24.638 1.00 63.95  ? 129 GLU D CB    1 
ATOM   6260 C  CG    . GLU D 2 79  ? -33.347 56.674 -24.654 1.00 64.22  ? 129 GLU D CG    1 
ATOM   6261 C  CD    . GLU D 2 79  ? -33.916 55.688 -23.659 1.00 64.19  ? 129 GLU D CD    1 
ATOM   6262 O  OE1   . GLU D 2 79  ? -33.160 54.876 -23.097 1.00 66.79  ? 129 GLU D OE1   1 
ATOM   6263 O  OE2   . GLU D 2 79  ? -35.136 55.719 -23.435 1.00 65.31  ? 129 GLU D OE2   1 
ATOM   6264 N  N     . VAL D 2 80  ? -32.359 60.047 -24.898 1.00 63.29  ? 130 VAL D N     1 
ATOM   6265 C  CA    . VAL D 2 80  ? -32.541 61.303 -24.180 1.00 62.82  ? 130 VAL D CA    1 
ATOM   6266 C  C     . VAL D 2 80  ? -33.577 61.142 -23.089 1.00 62.84  ? 130 VAL D C     1 
ATOM   6267 O  O     . VAL D 2 80  ? -34.559 60.396 -23.231 1.00 62.84  ? 130 VAL D O     1 
ATOM   6268 C  CB    . VAL D 2 80  ? -32.962 62.448 -25.101 1.00 62.66  ? 130 VAL D CB    1 
ATOM   6269 C  CG1   . VAL D 2 80  ? -31.810 62.811 -26.039 1.00 62.75  ? 130 VAL D CG1   1 
ATOM   6270 C  CG2   . VAL D 2 80  ? -34.229 62.090 -25.877 1.00 61.96  ? 130 VAL D CG2   1 
ATOM   6271 N  N     . ASN D 2 81  ? -33.360 61.866 -22.000 1.00 62.72  ? 131 ASN D N     1 
ATOM   6272 C  CA    . ASN D 2 81  ? -34.201 61.735 -20.822 1.00 62.62  ? 131 ASN D CA    1 
ATOM   6273 C  C     . ASN D 2 81  ? -35.548 62.445 -21.028 1.00 62.50  ? 131 ASN D C     1 
ATOM   6274 O  O     . ASN D 2 81  ? -35.724 63.608 -20.651 1.00 62.88  ? 131 ASN D O     1 
ATOM   6275 C  CB    . ASN D 2 81  ? -33.446 62.279 -19.603 1.00 62.51  ? 131 ASN D CB    1 
ATOM   6276 C  CG    . ASN D 2 81  ? -33.964 61.727 -18.306 1.00 62.08  ? 131 ASN D CG    1 
ATOM   6277 O  OD1   . ASN D 2 81  ? -35.111 61.302 -18.217 1.00 61.97  ? 131 ASN D OD1   1 
ATOM   6278 N  ND2   . ASN D 2 81  ? -33.120 61.735 -17.281 1.00 61.93  ? 131 ASN D ND2   1 
ATOM   6279 N  N     . ILE D 2 82  ? -36.494 61.753 -21.652 1.00 62.05  ? 132 ILE D N     1 
ATOM   6280 C  CA    . ILE D 2 82  ? -37.827 62.318 -21.858 1.00 61.76  ? 132 ILE D CA    1 
ATOM   6281 C  C     . ILE D 2 82  ? -38.880 61.371 -21.311 1.00 61.63  ? 132 ILE D C     1 
ATOM   6282 O  O     . ILE D 2 82  ? -38.737 60.159 -21.381 1.00 61.51  ? 132 ILE D O     1 
ATOM   6283 C  CB    . ILE D 2 82  ? -38.101 62.665 -23.361 1.00 61.87  ? 132 ILE D CB    1 
ATOM   6284 C  CG1   . ILE D 2 82  ? -38.197 61.412 -24.231 1.00 61.83  ? 132 ILE D CG1   1 
ATOM   6285 C  CG2   . ILE D 2 82  ? -37.012 63.569 -23.914 1.00 61.11  ? 132 ILE D CG2   1 
ATOM   6286 C  CD1   . ILE D 2 82  ? -38.563 61.708 -25.649 1.00 61.58  ? 132 ILE D CD1   1 
ATOM   6287 N  N     . ASP D 2 83  ? -39.940 61.932 -20.758 1.00 61.86  ? 133 ASP D N     1 
ATOM   6288 C  CA    . ASP D 2 83  ? -40.994 61.128 -20.177 1.00 61.89  ? 133 ASP D CA    1 
ATOM   6289 C  C     . ASP D 2 83  ? -41.726 60.323 -21.243 1.00 61.87  ? 133 ASP D C     1 
ATOM   6290 O  O     . ASP D 2 83  ? -41.471 60.473 -22.434 1.00 61.56  ? 133 ASP D O     1 
ATOM   6291 C  CB    . ASP D 2 83  ? -41.966 62.003 -19.382 1.00 61.97  ? 133 ASP D CB    1 
ATOM   6292 C  CG    . ASP D 2 83  ? -42.884 62.836 -20.262 1.00 62.41  ? 133 ASP D CG    1 
ATOM   6293 O  OD1   . ASP D 2 83  ? -42.984 62.588 -21.478 1.00 62.96  ? 133 ASP D OD1   1 
ATOM   6294 O  OD2   . ASP D 2 83  ? -43.541 63.744 -19.716 1.00 64.74  ? 133 ASP D OD2   1 
ATOM   6295 N  N     . HIS D 2 84  ? -42.633 59.469 -20.790 1.00 62.23  ? 134 HIS D N     1 
ATOM   6296 C  CA    . HIS D 2 84  ? -43.381 58.583 -21.661 1.00 62.65  ? 134 HIS D CA    1 
ATOM   6297 C  C     . HIS D 2 84  ? -44.225 59.372 -22.666 1.00 62.73  ? 134 HIS D C     1 
ATOM   6298 O  O     . HIS D 2 84  ? -44.248 59.033 -23.850 1.00 62.78  ? 134 HIS D O     1 
ATOM   6299 C  CB    . HIS D 2 84  ? -44.251 57.649 -20.807 1.00 62.91  ? 134 HIS D CB    1 
ATOM   6300 C  CG    . HIS D 2 84  ? -44.973 56.595 -21.590 1.00 64.13  ? 134 HIS D CG    1 
ATOM   6301 N  ND1   . HIS D 2 84  ? -46.317 56.328 -21.416 1.00 65.24  ? 134 HIS D ND1   1 
ATOM   6302 C  CD2   . HIS D 2 84  ? -44.544 55.748 -22.557 1.00 64.82  ? 134 HIS D CD2   1 
ATOM   6303 C  CE1   . HIS D 2 84  ? -46.682 55.359 -22.238 1.00 65.36  ? 134 HIS D CE1   1 
ATOM   6304 N  NE2   . HIS D 2 84  ? -45.625 54.990 -22.941 1.00 65.64  ? 134 HIS D NE2   1 
ATOM   6305 N  N     . GLU D 2 85  ? -44.889 60.429 -22.195 1.00 62.82  ? 135 GLU D N     1 
ATOM   6306 C  CA    . GLU D 2 85  ? -45.759 61.253 -23.044 1.00 63.25  ? 135 GLU D CA    1 
ATOM   6307 C  C     . GLU D 2 85  ? -45.021 61.836 -24.243 1.00 62.88  ? 135 GLU D C     1 
ATOM   6308 O  O     . GLU D 2 85  ? -45.418 61.633 -25.386 1.00 63.01  ? 135 GLU D O     1 
ATOM   6309 C  CB    . GLU D 2 85  ? -46.388 62.400 -22.249 1.00 63.22  ? 135 GLU D CB    1 
ATOM   6310 C  CG    . GLU D 2 85  ? -47.798 62.132 -21.752 1.00 64.11  ? 135 GLU D CG    1 
ATOM   6311 C  CD    . GLU D 2 85  ? -48.330 63.260 -20.871 1.00 64.80  ? 135 GLU D CD    1 
ATOM   6312 O  OE1   . GLU D 2 85  ? -49.365 63.053 -20.191 1.00 66.70  ? 135 GLU D OE1   1 
ATOM   6313 O  OE2   . GLU D 2 85  ? -47.708 64.351 -20.852 1.00 66.69  ? 135 GLU D OE2   1 
ATOM   6314 N  N     . THR D 2 86  ? -43.953 62.571 -23.971 1.00 62.55  ? 136 THR D N     1 
ATOM   6315 C  CA    . THR D 2 86  ? -43.136 63.156 -25.025 1.00 62.45  ? 136 THR D CA    1 
ATOM   6316 C  C     . THR D 2 86  ? -42.633 62.104 -26.027 1.00 62.43  ? 136 THR D C     1 
ATOM   6317 O  O     . THR D 2 86  ? -42.645 62.343 -27.244 1.00 62.17  ? 136 THR D O     1 
ATOM   6318 C  CB    . THR D 2 86  ? -41.929 63.896 -24.422 1.00 62.52  ? 136 THR D CB    1 
ATOM   6319 O  OG1   . THR D 2 86  ? -42.400 64.942 -23.561 1.00 62.67  ? 136 THR D OG1   1 
ATOM   6320 C  CG2   . THR D 2 86  ? -41.038 64.481 -25.517 1.00 61.97  ? 136 THR D CG2   1 
ATOM   6321 N  N     . ARG D 2 87  ? -42.188 60.952 -25.515 1.00 62.25  ? 137 ARG D N     1 
ATOM   6322 C  CA    . ARG D 2 87  ? -41.735 59.859 -26.374 1.00 62.12  ? 137 ARG D CA    1 
ATOM   6323 C  C     . ARG D 2 87  ? -42.894 59.338 -27.225 1.00 61.84  ? 137 ARG D C     1 
ATOM   6324 O  O     . ARG D 2 87  ? -42.781 59.235 -28.441 1.00 61.47  ? 137 ARG D O     1 
ATOM   6325 C  CB    . ARG D 2 87  ? -41.127 58.712 -25.555 1.00 62.18  ? 137 ARG D CB    1 
ATOM   6326 C  CG    . ARG D 2 87  ? -40.705 57.513 -26.419 1.00 62.68  ? 137 ARG D CG    1 
ATOM   6327 C  CD    . ARG D 2 87  ? -39.624 56.636 -25.775 1.00 63.52  ? 137 ARG D CD    1 
ATOM   6328 N  NE    . ARG D 2 87  ? -39.967 56.245 -24.410 1.00 63.91  ? 137 ARG D NE    1 
ATOM   6329 C  CZ    . ARG D 2 87  ? -40.943 55.398 -24.072 1.00 64.25  ? 137 ARG D CZ    1 
ATOM   6330 N  NH1   . ARG D 2 87  ? -41.710 54.814 -24.991 1.00 64.13  ? 137 ARG D NH1   1 
ATOM   6331 N  NH2   . ARG D 2 87  ? -41.162 55.136 -22.790 1.00 64.21  ? 137 ARG D NH2   1 
ATOM   6332 N  N     . GLU D 2 88  ? -44.005 59.017 -26.570 1.00 61.60  ? 138 GLU D N     1 
ATOM   6333 C  CA    . GLU D 2 88  ? -45.189 58.531 -27.252 1.00 61.52  ? 138 GLU D CA    1 
ATOM   6334 C  C     . GLU D 2 88  ? -45.624 59.501 -28.344 1.00 61.16  ? 138 GLU D C     1 
ATOM   6335 O  O     . GLU D 2 88  ? -46.065 59.080 -29.413 1.00 60.99  ? 138 GLU D O     1 
ATOM   6336 C  CB    . GLU D 2 88  ? -46.322 58.311 -26.236 1.00 61.85  ? 138 GLU D CB    1 
ATOM   6337 C  CG    . GLU D 2 88  ? -47.705 57.972 -26.815 1.00 62.77  ? 138 GLU D CG    1 
ATOM   6338 C  CD    . GLU D 2 88  ? -47.685 56.795 -27.779 1.00 64.68  ? 138 GLU D CD    1 
ATOM   6339 O  OE1   . GLU D 2 88  ? -46.696 56.030 -27.774 1.00 66.41  ? 138 GLU D OE1   1 
ATOM   6340 O  OE2   . GLU D 2 88  ? -48.663 56.632 -28.547 1.00 66.35  ? 138 GLU D OE2   1 
ATOM   6341 N  N     . LEU D 2 89  ? -45.485 60.796 -28.069 1.00 60.78  ? 139 LEU D N     1 
ATOM   6342 C  CA    . LEU D 2 89  ? -45.894 61.844 -29.001 1.00 60.51  ? 139 LEU D CA    1 
ATOM   6343 C  C     . LEU D 2 89  ? -44.988 61.894 -30.226 1.00 60.63  ? 139 LEU D C     1 
ATOM   6344 O  O     . LEU D 2 89  ? -45.482 61.926 -31.347 1.00 60.42  ? 139 LEU D O     1 
ATOM   6345 C  CB    . LEU D 2 89  ? -45.929 63.206 -28.296 1.00 60.14  ? 139 LEU D CB    1 
ATOM   6346 C  CG    . LEU D 2 89  ? -46.247 64.438 -29.148 1.00 59.51  ? 139 LEU D CG    1 
ATOM   6347 C  CD1   . LEU D 2 89  ? -47.579 64.319 -29.910 1.00 57.93  ? 139 LEU D CD1   1 
ATOM   6348 C  CD2   . LEU D 2 89  ? -46.234 65.651 -28.254 1.00 58.64  ? 139 LEU D CD2   1 
ATOM   6349 N  N     . THR D 2 90  ? -43.673 61.901 -30.004 1.00 60.96  ? 140 THR D N     1 
ATOM   6350 C  CA    . THR D 2 90  ? -42.684 61.801 -31.084 1.00 61.30  ? 140 THR D CA    1 
ATOM   6351 C  C     . THR D 2 90  ? -42.957 60.614 -32.008 1.00 61.62  ? 140 THR D C     1 
ATOM   6352 O  O     . THR D 2 90  ? -42.853 60.726 -33.229 1.00 61.49  ? 140 THR D O     1 
ATOM   6353 C  CB    . THR D 2 90  ? -41.256 61.649 -30.515 1.00 61.26  ? 140 THR D CB    1 
ATOM   6354 O  OG1   . THR D 2 90  ? -40.975 62.747 -29.646 1.00 61.99  ? 140 THR D OG1   1 
ATOM   6355 C  CG2   . THR D 2 90  ? -40.229 61.633 -31.619 1.00 60.82  ? 140 THR D CG2   1 
ATOM   6356 N  N     . ARG D 2 91  ? -43.308 59.486 -31.402 1.00 62.17  ? 141 ARG D N     1 
ATOM   6357 C  CA    . ARG D 2 91  ? -43.651 58.264 -32.122 1.00 62.99  ? 141 ARG D CA    1 
ATOM   6358 C  C     . ARG D 2 91  ? -44.928 58.431 -32.973 1.00 63.34  ? 141 ARG D C     1 
ATOM   6359 O  O     . ARG D 2 91  ? -45.039 57.857 -34.055 1.00 63.29  ? 141 ARG D O     1 
ATOM   6360 C  CB    . ARG D 2 91  ? -43.822 57.114 -31.117 1.00 63.03  ? 141 ARG D CB    1 
ATOM   6361 C  CG    . ARG D 2 91  ? -43.409 55.728 -31.613 1.00 63.62  ? 141 ARG D CG    1 
ATOM   6362 C  CD    . ARG D 2 91  ? -43.756 54.642 -30.574 1.00 64.04  ? 141 ARG D CD    1 
ATOM   6363 N  NE    . ARG D 2 91  ? -42.809 54.579 -29.451 1.00 64.55  ? 141 ARG D NE    1 
ATOM   6364 C  CZ    . ARG D 2 91  ? -41.688 53.852 -29.430 1.00 65.05  ? 141 ARG D CZ    1 
ATOM   6365 N  NH1   . ARG D 2 91  ? -41.325 53.113 -30.479 1.00 64.92  ? 141 ARG D NH1   1 
ATOM   6366 N  NH2   . ARG D 2 91  ? -40.912 53.870 -28.346 1.00 65.26  ? 141 ARG D NH2   1 
ATOM   6367 N  N     . MET D 2 92  ? -45.890 59.210 -32.482 1.00 63.87  ? 142 MET D N     1 
ATOM   6368 C  CA    . MET D 2 92  ? -47.083 59.523 -33.267 1.00 64.40  ? 142 MET D CA    1 
ATOM   6369 C  C     . MET D 2 92  ? -46.727 60.485 -34.400 1.00 64.56  ? 142 MET D C     1 
ATOM   6370 O  O     . MET D 2 92  ? -47.296 60.402 -35.491 1.00 64.72  ? 142 MET D O     1 
ATOM   6371 C  CB    . MET D 2 92  ? -48.187 60.133 -32.394 1.00 64.65  ? 142 MET D CB    1 
ATOM   6372 C  CG    . MET D 2 92  ? -48.660 59.264 -31.228 1.00 65.27  ? 142 MET D CG    1 
ATOM   6373 S  SD    . MET D 2 92  ? -49.795 57.949 -31.689 1.00 66.67  ? 142 MET D SD    1 
ATOM   6374 C  CE    . MET D 2 92  ? -48.723 56.749 -32.487 1.00 66.36  ? 142 MET D CE    1 
ATOM   6375 N  N     . ASN D 2 93  ? -45.793 61.397 -34.135 1.00 64.64  ? 143 ASN D N     1 
ATOM   6376 C  CA    . ASN D 2 93  ? -45.305 62.330 -35.150 1.00 64.71  ? 143 ASN D CA    1 
ATOM   6377 C  C     . ASN D 2 93  ? -44.472 61.644 -36.231 1.00 64.90  ? 143 ASN D C     1 
ATOM   6378 O  O     . ASN D 2 93  ? -44.590 61.983 -37.409 1.00 65.06  ? 143 ASN D O     1 
ATOM   6379 C  CB    . ASN D 2 93  ? -44.484 63.453 -34.508 1.00 64.63  ? 143 ASN D CB    1 
ATOM   6380 C  CG    . ASN D 2 93  ? -45.345 64.458 -33.755 1.00 64.45  ? 143 ASN D CG    1 
ATOM   6381 O  OD1   . ASN D 2 93  ? -46.577 64.347 -33.713 1.00 62.72  ? 143 ASN D OD1   1 
ATOM   6382 N  ND2   . ASN D 2 93  ? -44.692 65.453 -33.156 1.00 64.03  ? 143 ASN D ND2   1 
ATOM   6383 N  N     . LEU D 2 94  ? -43.650 60.676 -35.830 1.00 65.13  ? 144 LEU D N     1 
ATOM   6384 C  CA    . LEU D 2 94  ? -42.770 59.959 -36.763 1.00 65.34  ? 144 LEU D CA    1 
ATOM   6385 C  C     . LEU D 2 94  ? -43.546 59.185 -37.844 1.00 65.43  ? 144 LEU D C     1 
ATOM   6386 O  O     . LEU D 2 94  ? -42.965 58.801 -38.870 1.00 65.63  ? 144 LEU D O     1 
ATOM   6387 C  CB    . LEU D 2 94  ? -41.830 59.011 -35.995 1.00 65.42  ? 144 LEU D CB    1 
ATOM   6388 C  CG    . LEU D 2 94  ? -40.762 58.227 -36.779 1.00 65.55  ? 144 LEU D CG    1 
ATOM   6389 C  CD1   . LEU D 2 94  ? -39.874 59.154 -37.576 1.00 66.25  ? 144 LEU D CD1   1 
ATOM   6390 C  CD2   . LEU D 2 94  ? -39.908 57.376 -35.855 1.00 65.52  ? 144 LEU D CD2   1 
ATOM   6391 N  N     . GLN D 2 95  ? -44.843 58.954 -37.616 1.00 65.34  ? 145 GLN D N     1 
ATOM   6392 C  CA    . GLN D 2 95  ? -45.712 58.333 -38.624 1.00 65.40  ? 145 GLN D CA    1 
ATOM   6393 C  C     . GLN D 2 95  ? -45.655 59.096 -39.937 1.00 65.20  ? 145 GLN D C     1 
ATOM   6394 O  O     . GLN D 2 95  ? -45.460 58.504 -41.000 1.00 65.34  ? 145 GLN D O     1 
ATOM   6395 C  CB    . GLN D 2 95  ? -47.170 58.289 -38.159 1.00 65.46  ? 145 GLN D CB    1 
ATOM   6396 C  CG    . GLN D 2 95  ? -47.490 57.235 -37.107 1.00 65.65  ? 145 GLN D CG    1 
ATOM   6397 C  CD    . GLN D 2 95  ? -48.985 57.157 -36.808 1.00 65.84  ? 145 GLN D CD    1 
ATOM   6398 O  OE1   . GLN D 2 95  ? -49.400 57.000 -35.651 1.00 66.86  ? 145 GLN D OE1   1 
ATOM   6399 N  NE2   . GLN D 2 95  ? -49.800 57.276 -37.852 1.00 65.25  ? 145 GLN D NE2   1 
ATOM   6400 N  N     . THR D 2 96  ? -45.846 60.409 -39.849 1.00 64.96  ? 146 THR D N     1 
ATOM   6401 C  CA    . THR D 2 96  ? -45.812 61.283 -41.014 1.00 64.66  ? 146 THR D CA    1 
ATOM   6402 C  C     . THR D 2 96  ? -44.823 62.414 -40.744 1.00 64.32  ? 146 THR D C     1 
ATOM   6403 O  O     . THR D 2 96  ? -45.208 63.526 -40.388 1.00 64.26  ? 146 THR D O     1 
ATOM   6404 C  CB    . THR D 2 96  ? -47.214 61.826 -41.330 1.00 64.70  ? 146 THR D CB    1 
ATOM   6405 O  OG1   . THR D 2 96  ? -47.687 62.621 -40.234 1.00 64.87  ? 146 THR D OG1   1 
ATOM   6406 C  CG2   . THR D 2 96  ? -48.185 60.668 -41.578 1.00 64.61  ? 146 THR D CG2   1 
ATOM   6407 N  N     . ALA D 2 97  ? -43.541 62.095 -40.908 1.00 64.01  ? 147 ALA D N     1 
ATOM   6408 C  CA    . ALA D 2 97  ? -42.435 62.997 -40.573 1.00 63.64  ? 147 ALA D CA    1 
ATOM   6409 C  C     . ALA D 2 97  ? -42.498 64.352 -41.294 1.00 63.38  ? 147 ALA D C     1 
ATOM   6410 O  O     . ALA D 2 97  ? -42.129 64.460 -42.474 1.00 63.55  ? 147 ALA D O     1 
ATOM   6411 C  CB    . ALA D 2 97  ? -41.111 62.319 -40.874 1.00 63.53  ? 147 ALA D CB    1 
ATOM   6412 N  N     . THR D 2 98  ? -42.972 65.369 -40.570 1.00 62.75  ? 148 THR D N     1 
ATOM   6413 C  CA    . THR D 2 98  ? -42.907 66.767 -41.002 1.00 62.22  ? 148 THR D CA    1 
ATOM   6414 C  C     . THR D 2 98  ? -41.851 67.481 -40.155 1.00 61.87  ? 148 THR D C     1 
ATOM   6415 O  O     . THR D 2 98  ? -41.429 66.957 -39.128 1.00 61.64  ? 148 THR D O     1 
ATOM   6416 C  CB    . THR D 2 98  ? -44.284 67.480 -40.857 1.00 62.31  ? 148 THR D CB    1 
ATOM   6417 O  OG1   . THR D 2 98  ? -44.575 67.731 -39.474 1.00 61.70  ? 148 THR D OG1   1 
ATOM   6418 C  CG2   . THR D 2 98  ? -45.406 66.639 -41.481 1.00 61.69  ? 148 THR D CG2   1 
ATOM   6419 N  N     . ALA D 2 99  ? -41.435 68.675 -40.569 1.00 61.53  ? 149 ALA D N     1 
ATOM   6420 C  CA    . ALA D 2 99  ? -40.352 69.395 -39.877 1.00 61.34  ? 149 ALA D CA    1 
ATOM   6421 C  C     . ALA D 2 99  ? -40.606 69.608 -38.376 1.00 61.25  ? 149 ALA D C     1 
ATOM   6422 O  O     . ALA D 2 99  ? -39.665 69.783 -37.603 1.00 61.13  ? 149 ALA D O     1 
ATOM   6423 C  CB    . ALA D 2 99  ? -40.076 70.731 -40.560 1.00 61.06  ? 149 ALA D CB    1 
ATOM   6424 N  N     . THR D 2 100 ? -41.874 69.578 -37.974 1.00 61.39  ? 150 THR D N     1 
ATOM   6425 C  CA    . THR D 2 100 ? -42.284 69.790 -36.579 1.00 61.48  ? 150 THR D CA    1 
ATOM   6426 C  C     . THR D 2 100 ? -42.165 68.536 -35.701 1.00 61.80  ? 150 THR D C     1 
ATOM   6427 O  O     . THR D 2 100 ? -42.531 68.565 -34.526 1.00 61.97  ? 150 THR D O     1 
ATOM   6428 C  CB    . THR D 2 100 ? -43.770 70.234 -36.519 1.00 61.37  ? 150 THR D CB    1 
ATOM   6429 O  OG1   . THR D 2 100 ? -44.586 69.252 -37.170 1.00 60.20  ? 150 THR D OG1   1 
ATOM   6430 C  CG2   . THR D 2 100 ? -43.962 71.575 -37.203 1.00 61.23  ? 150 THR D CG2   1 
ATOM   6431 N  N     . CYS D 2 101 ? -41.659 67.446 -36.268 1.00 62.00  ? 151 CYS D N     1 
ATOM   6432 C  CA    . CYS D 2 101 ? -41.749 66.131 -35.640 1.00 62.10  ? 151 CYS D CA    1 
ATOM   6433 C  C     . CYS D 2 101 ? -41.161 66.050 -34.224 1.00 62.05  ? 151 CYS D C     1 
ATOM   6434 O  O     . CYS D 2 101 ? -41.732 65.396 -33.348 1.00 62.26  ? 151 CYS D O     1 
ATOM   6435 C  CB    . CYS D 2 101 ? -41.065 65.101 -36.536 1.00 62.13  ? 151 CYS D CB    1 
ATOM   6436 S  SG    . CYS D 2 101 ? -41.150 63.436 -35.919 1.00 62.65  ? 151 CYS D SG    1 
ATOM   6437 N  N     . PHE D 2 102 ? -40.034 66.720 -34.005 1.00 61.90  ? 152 PHE D N     1 
ATOM   6438 C  CA    . PHE D 2 102 ? -39.308 66.630 -32.739 1.00 61.73  ? 152 PHE D CA    1 
ATOM   6439 C  C     . PHE D 2 102 ? -39.437 67.861 -31.851 1.00 61.76  ? 152 PHE D C     1 
ATOM   6440 O  O     . PHE D 2 102 ? -38.669 68.014 -30.910 1.00 61.50  ? 152 PHE D O     1 
ATOM   6441 C  CB    . PHE D 2 102 ? -37.831 66.368 -33.022 1.00 61.66  ? 152 PHE D CB    1 
ATOM   6442 C  CG    . PHE D 2 102 ? -37.588 65.089 -33.726 1.00 61.23  ? 152 PHE D CG    1 
ATOM   6443 C  CD1   . PHE D 2 102 ? -37.408 63.921 -33.012 1.00 61.64  ? 152 PHE D CD1   1 
ATOM   6444 C  CD2   . PHE D 2 102 ? -37.562 65.039 -35.103 1.00 61.74  ? 152 PHE D CD2   1 
ATOM   6445 C  CE1   . PHE D 2 102 ? -37.195 62.718 -33.663 1.00 61.75  ? 152 PHE D CE1   1 
ATOM   6446 C  CE2   . PHE D 2 102 ? -37.348 63.837 -35.765 1.00 61.75  ? 152 PHE D CE2   1 
ATOM   6447 C  CZ    . PHE D 2 102 ? -37.170 62.678 -35.044 1.00 61.58  ? 152 PHE D CZ    1 
ATOM   6448 N  N     . ASP D 2 103 ? -40.421 68.719 -32.118 1.00 62.05  ? 153 ASP D N     1 
ATOM   6449 C  CA    . ASP D 2 103 ? -40.532 69.993 -31.391 1.00 62.29  ? 153 ASP D CA    1 
ATOM   6450 C  C     . ASP D 2 103 ? -40.945 69.843 -29.914 1.00 62.25  ? 153 ASP D C     1 
ATOM   6451 O  O     . ASP D 2 103 ? -40.441 70.566 -29.049 1.00 61.98  ? 153 ASP D O     1 
ATOM   6452 C  CB    . ASP D 2 103 ? -41.462 70.959 -32.128 1.00 62.40  ? 153 ASP D CB    1 
ATOM   6453 C  CG    . ASP D 2 103 ? -40.857 71.472 -33.436 1.00 62.68  ? 153 ASP D CG    1 
ATOM   6454 O  OD1   . ASP D 2 103 ? -40.074 70.739 -34.067 1.00 62.67  ? 153 ASP D OD1   1 
ATOM   6455 O  OD2   . ASP D 2 103 ? -41.174 72.608 -33.843 1.00 64.23  ? 153 ASP D OD2   1 
ATOM   6456 N  N     . ALA D 2 104 ? -41.829 68.893 -29.628 1.00 62.25  ? 154 ALA D N     1 
ATOM   6457 C  CA    . ALA D 2 104 ? -42.164 68.565 -28.241 1.00 62.42  ? 154 ALA D CA    1 
ATOM   6458 C  C     . ALA D 2 104 ? -40.967 67.961 -27.476 1.00 62.67  ? 154 ALA D C     1 
ATOM   6459 O  O     . ALA D 2 104 ? -40.746 68.281 -26.305 1.00 62.48  ? 154 ALA D O     1 
ATOM   6460 C  CB    . ALA D 2 104 ? -43.363 67.621 -28.192 1.00 62.34  ? 154 ALA D CB    1 
ATOM   6461 N  N     . ALA D 2 105 ? -40.194 67.100 -28.134 1.00 62.87  ? 155 ALA D N     1 
ATOM   6462 C  CA    . ALA D 2 105 ? -39.055 66.461 -27.470 1.00 63.09  ? 155 ALA D CA    1 
ATOM   6463 C  C     . ALA D 2 105 ? -37.842 67.393 -27.358 1.00 63.29  ? 155 ALA D C     1 
ATOM   6464 O  O     . ALA D 2 105 ? -37.091 67.316 -26.386 1.00 63.53  ? 155 ALA D O     1 
ATOM   6465 C  CB    . ALA D 2 105 ? -38.678 65.152 -28.173 1.00 62.96  ? 155 ALA D CB    1 
ATOM   6466 N  N     . GLN D 2 106 ? -37.648 68.271 -28.338 1.00 63.39  ? 156 GLN D N     1 
ATOM   6467 C  CA    . GLN D 2 106 ? -36.526 69.212 -28.303 1.00 63.39  ? 156 GLN D CA    1 
ATOM   6468 C  C     . GLN D 2 106 ? -36.720 70.216 -27.174 1.00 63.66  ? 156 GLN D C     1 
ATOM   6469 O  O     . GLN D 2 106 ? -35.759 70.558 -26.472 1.00 63.73  ? 156 GLN D O     1 
ATOM   6470 C  CB    . GLN D 2 106 ? -36.393 69.940 -29.638 1.00 63.41  ? 156 GLN D CB    1 
ATOM   6471 C  CG    . GLN D 2 106 ? -35.267 70.960 -29.700 1.00 63.14  ? 156 GLN D CG    1 
ATOM   6472 C  CD    . GLN D 2 106 ? -35.296 71.795 -30.973 1.00 63.26  ? 156 GLN D CD    1 
ATOM   6473 O  OE1   . GLN D 2 106 ? -36.360 72.041 -31.553 1.00 62.54  ? 156 GLN D OE1   1 
ATOM   6474 N  NE2   . GLN D 2 106 ? -34.121 72.237 -31.412 1.00 63.18  ? 156 GLN D NE2   1 
ATOM   6475 N  N     . GLY D 2 107 ? -37.963 70.686 -27.014 1.00 63.74  ? 157 GLY D N     1 
ATOM   6476 C  CA    . GLY D 2 107 ? -38.341 71.574 -25.905 1.00 63.54  ? 157 GLY D CA    1 
ATOM   6477 C  C     . GLY D 2 107 ? -38.014 70.988 -24.540 1.00 63.48  ? 157 GLY D C     1 
ATOM   6478 O  O     . GLY D 2 107 ? -37.479 71.681 -23.676 1.00 63.66  ? 157 GLY D O     1 
ATOM   6479 N  N     . LYS D 2 108 ? -38.317 69.707 -24.347 1.00 63.19  ? 158 LYS D N     1 
ATOM   6480 C  CA    . LYS D 2 108 ? -38.017 69.043 -23.083 1.00 63.21  ? 158 LYS D CA    1 
ATOM   6481 C  C     . LYS D 2 108 ? -36.502 68.849 -22.901 1.00 63.20  ? 158 LYS D C     1 
ATOM   6482 O  O     . LYS D 2 108 ? -35.974 69.059 -21.809 1.00 63.08  ? 158 LYS D O     1 
ATOM   6483 C  CB    . LYS D 2 108 ? -38.750 67.698 -22.976 1.00 62.97  ? 158 LYS D CB    1 
ATOM   6484 C  CG    . LYS D 2 108 ? -40.267 67.809 -22.885 1.00 62.55  ? 158 LYS D CG    1 
ATOM   6485 C  CD    . LYS D 2 108 ? -40.739 68.227 -21.501 1.00 62.65  ? 158 LYS D CD    1 
ATOM   6486 C  CE    . LYS D 2 108 ? -42.211 67.859 -21.248 1.00 62.33  ? 158 LYS D CE    1 
ATOM   6487 N  N     . THR D 2 109 ? -35.807 68.454 -23.963 1.00 63.23  ? 159 THR D N     1 
ATOM   6488 C  CA    . THR D 2 109 ? -34.350 68.313 -23.904 1.00 63.34  ? 159 THR D CA    1 
ATOM   6489 C  C     . THR D 2 109 ? -33.688 69.678 -23.661 1.00 63.72  ? 159 THR D C     1 
ATOM   6490 O  O     . THR D 2 109 ? -32.622 69.749 -23.051 1.00 63.93  ? 159 THR D O     1 
ATOM   6491 C  CB    . THR D 2 109 ? -33.772 67.660 -25.188 1.00 63.32  ? 159 THR D CB    1 
ATOM   6492 O  OG1   . THR D 2 109 ? -34.295 66.332 -25.331 1.00 62.58  ? 159 THR D OG1   1 
ATOM   6493 C  CG2   . THR D 2 109 ? -32.251 67.592 -25.136 1.00 62.54  ? 159 THR D CG2   1 
ATOM   6494 N  N     . ARG D 2 110 ? -34.326 70.751 -24.129 1.00 63.86  ? 160 ARG D N     1 
ATOM   6495 C  CA    . ARG D 2 110 ? -33.879 72.118 -23.829 1.00 64.01  ? 160 ARG D CA    1 
ATOM   6496 C  C     . ARG D 2 110 ? -34.003 72.410 -22.340 1.00 63.96  ? 160 ARG D C     1 
ATOM   6497 O  O     . ARG D 2 110 ? -33.004 72.601 -21.659 1.00 64.16  ? 160 ARG D O     1 
ATOM   6498 C  CB    . ARG D 2 110 ? -34.690 73.156 -24.624 1.00 64.07  ? 160 ARG D CB    1 
ATOM   6499 N  N     . THR D 2 111 ? -35.236 72.431 -21.841 1.00 63.90  ? 161 THR D N     1 
ATOM   6500 C  CA    . THR D 2 111 ? -35.497 72.681 -20.424 1.00 63.90  ? 161 THR D CA    1 
ATOM   6501 C  C     . THR D 2 111 ? -34.570 71.874 -19.516 1.00 63.95  ? 161 THR D C     1 
ATOM   6502 O  O     . THR D 2 111 ? -34.108 72.372 -18.488 1.00 63.78  ? 161 THR D O     1 
ATOM   6503 C  CB    . THR D 2 111 ? -36.970 72.363 -20.068 1.00 63.89  ? 161 THR D CB    1 
ATOM   6504 O  OG1   . THR D 2 111 ? -37.818 73.376 -20.621 1.00 64.09  ? 161 THR D OG1   1 
ATOM   6505 C  CG2   . THR D 2 111 ? -37.182 72.303 -18.559 1.00 63.07  ? 161 THR D CG2   1 
ATOM   6506 N  N     . LEU D 2 112 ? -34.300 70.633 -19.911 1.00 64.10  ? 162 LEU D N     1 
ATOM   6507 C  CA    . LEU D 2 112 ? -33.442 69.738 -19.137 1.00 64.19  ? 162 LEU D CA    1 
ATOM   6508 C  C     . LEU D 2 112 ? -32.020 70.285 -19.004 1.00 63.97  ? 162 LEU D C     1 
ATOM   6509 O  O     . LEU D 2 112 ? -31.460 70.299 -17.909 1.00 64.05  ? 162 LEU D O     1 
ATOM   6510 C  CB    . LEU D 2 112 ? -33.404 68.352 -19.781 1.00 64.21  ? 162 LEU D CB    1 
ATOM   6511 C  CG    . LEU D 2 112 ? -32.678 67.266 -18.987 1.00 64.77  ? 162 LEU D CG    1 
ATOM   6512 C  CD1   . LEU D 2 112 ? -33.395 67.061 -17.661 1.00 66.17  ? 162 LEU D CD1   1 
ATOM   6513 C  CD2   . LEU D 2 112 ? -32.592 65.956 -19.764 1.00 64.13  ? 162 LEU D CD2   1 
ATOM   6514 N  N     . MET D 2 113 ? -31.447 70.718 -20.123 1.00 63.70  ? 163 MET D N     1 
ATOM   6515 C  CA    . MET D 2 113 ? -30.114 71.320 -20.138 1.00 63.61  ? 163 MET D CA    1 
ATOM   6516 C  C     . MET D 2 113 ? -30.098 72.646 -19.379 1.00 63.44  ? 163 MET D C     1 
ATOM   6517 O  O     . MET D 2 113 ? -29.264 72.869 -18.495 1.00 63.18  ? 163 MET D O     1 
ATOM   6518 C  CB    . MET D 2 113 ? -29.665 71.575 -21.583 1.00 63.64  ? 163 MET D CB    1 
ATOM   6519 C  CG    . MET D 2 113 ? -29.310 70.322 -22.367 1.00 63.39  ? 163 MET D CG    1 
ATOM   6520 S  SD    . MET D 2 113 ? -28.698 70.710 -24.021 1.00 63.81  ? 163 MET D SD    1 
ATOM   6521 C  CE    . MET D 2 113 ? -30.234 71.119 -24.868 1.00 61.18  ? 163 MET D CE    1 
ATOM   6522 N  N     . GLU D 2 114 ? -31.037 73.514 -19.738 1.00 63.25  ? 164 GLU D N     1 
ATOM   6523 C  CA    . GLU D 2 114 ? -31.136 74.849 -19.167 1.00 63.20  ? 164 GLU D CA    1 
ATOM   6524 C  C     . GLU D 2 114 ? -31.254 74.851 -17.649 1.00 63.08  ? 164 GLU D C     1 
ATOM   6525 O  O     . GLU D 2 114 ? -30.780 75.783 -17.007 1.00 63.56  ? 164 GLU D O     1 
ATOM   6526 C  CB    . GLU D 2 114 ? -32.336 75.600 -19.763 1.00 63.25  ? 164 GLU D CB    1 
ATOM   6527 N  N     . LYS D 2 115 ? -31.886 73.824 -17.081 1.00 62.88  ? 165 LYS D N     1 
ATOM   6528 C  CA    . LYS D 2 115 ? -32.182 73.796 -15.647 1.00 62.58  ? 165 LYS D CA    1 
ATOM   6529 C  C     . LYS D 2 115 ? -31.138 73.049 -14.813 1.00 62.46  ? 165 LYS D C     1 
ATOM   6530 O  O     . LYS D 2 115 ? -30.920 73.386 -13.655 1.00 62.19  ? 165 LYS D O     1 
ATOM   6531 C  CB    . LYS D 2 115 ? -33.589 73.226 -15.394 1.00 62.65  ? 165 LYS D CB    1 
ATOM   6532 C  CG    . LYS D 2 115 ? -34.737 74.167 -15.775 1.00 61.72  ? 165 LYS D CG    1 
ATOM   6533 N  N     . ASP D 2 116 ? -30.487 72.052 -15.398 1.00 62.67  ? 166 ASP D N     1 
ATOM   6534 C  CA    . ASP D 2 116 ? -29.569 71.194 -14.649 1.00 62.87  ? 166 ASP D CA    1 
ATOM   6535 C  C     . ASP D 2 116 ? -28.119 71.534 -14.974 1.00 62.83  ? 166 ASP D C     1 
ATOM   6536 O  O     . ASP D 2 116 ? -27.389 72.071 -14.131 1.00 62.91  ? 166 ASP D O     1 
ATOM   6537 C  CB    . ASP D 2 116 ? -29.861 69.712 -14.955 1.00 63.14  ? 166 ASP D CB    1 
ATOM   6538 C  CG    . ASP D 2 116 ? -29.137 68.739 -13.999 1.00 63.89  ? 166 ASP D CG    1 
ATOM   6539 O  OD1   . ASP D 2 116 ? -28.541 67.738 -14.477 1.00 63.73  ? 166 ASP D OD1   1 
ATOM   6540 O  OD2   . ASP D 2 116 ? -29.176 68.959 -12.770 1.00 64.69  ? 166 ASP D OD2   1 
ATOM   6541 N  N     . SER D 2 117 ? -27.714 71.241 -16.205 1.00 62.63  ? 167 SER D N     1 
ATOM   6542 C  CA    . SER D 2 117 ? -26.306 71.289 -16.592 1.00 62.49  ? 167 SER D CA    1 
ATOM   6543 C  C     . SER D 2 117 ? -25.808 72.705 -16.855 1.00 62.25  ? 167 SER D C     1 
ATOM   6544 O  O     . SER D 2 117 ? -24.700 73.062 -16.454 1.00 62.21  ? 167 SER D O     1 
ATOM   6545 C  CB    . SER D 2 117 ? -26.066 70.394 -17.816 1.00 62.58  ? 167 SER D CB    1 
ATOM   6546 O  OG    . SER D 2 117 ? -27.289 70.007 -18.434 1.00 63.01  ? 167 SER D OG    1 
ATOM   6547 N  N     . TYR D 2 118 ? -26.627 73.505 -17.528 1.00 62.15  ? 168 TYR D N     1 
ATOM   6548 C  CA    . TYR D 2 118 ? -26.248 74.871 -17.905 1.00 61.98  ? 168 TYR D CA    1 
ATOM   6549 C  C     . TYR D 2 118 ? -25.720 75.717 -16.721 1.00 61.82  ? 168 TYR D C     1 
ATOM   6550 O  O     . TYR D 2 118 ? -24.659 76.314 -16.835 1.00 61.40  ? 168 TYR D O     1 
ATOM   6551 C  CB    . TYR D 2 118 ? -27.413 75.563 -18.641 1.00 61.87  ? 168 TYR D CB    1 
ATOM   6552 C  CG    . TYR D 2 118 ? -27.266 77.067 -18.794 1.00 62.06  ? 168 TYR D CG    1 
ATOM   6553 C  CD1   . TYR D 2 118 ? -26.115 77.622 -19.364 1.00 61.23  ? 168 TYR D CD1   1 
ATOM   6554 C  CD2   . TYR D 2 118 ? -28.280 77.932 -18.387 1.00 61.39  ? 168 TYR D CD2   1 
ATOM   6555 C  CE1   . TYR D 2 118 ? -25.975 78.981 -19.507 1.00 60.81  ? 168 TYR D CE1   1 
ATOM   6556 C  CE2   . TYR D 2 118 ? -28.144 79.301 -18.532 1.00 61.24  ? 168 TYR D CE2   1 
ATOM   6557 C  CZ    . TYR D 2 118 ? -26.986 79.820 -19.092 1.00 61.34  ? 168 TYR D CZ    1 
ATOM   6558 O  OH    . TYR D 2 118 ? -26.837 81.184 -19.235 1.00 61.74  ? 168 TYR D OH    1 
ATOM   6559 N  N     . PRO D 2 119 ? -26.454 75.771 -15.590 1.00 61.89  ? 169 PRO D N     1 
ATOM   6560 C  CA    . PRO D 2 119 ? -25.948 76.482 -14.408 1.00 61.92  ? 169 PRO D CA    1 
ATOM   6561 C  C     . PRO D 2 119 ? -24.569 76.030 -13.938 1.00 62.05  ? 169 PRO D C     1 
ATOM   6562 O  O     . PRO D 2 119 ? -23.773 76.856 -13.492 1.00 62.22  ? 169 PRO D O     1 
ATOM   6563 C  CB    . PRO D 2 119 ? -26.999 76.170 -13.339 1.00 61.74  ? 169 PRO D CB    1 
ATOM   6564 C  CG    . PRO D 2 119 ? -28.228 75.955 -14.095 1.00 61.91  ? 169 PRO D CG    1 
ATOM   6565 C  CD    . PRO D 2 119 ? -27.803 75.237 -15.343 1.00 61.91  ? 169 PRO D CD    1 
ATOM   6566 N  N     . ARG D 2 120 ? -24.300 74.732 -14.032 1.00 62.28  ? 170 ARG D N     1 
ATOM   6567 C  CA    . ARG D 2 120 ? -22.996 74.178 -13.666 1.00 62.44  ? 170 ARG D CA    1 
ATOM   6568 C  C     . ARG D 2 120 ? -21.939 74.414 -14.746 1.00 62.47  ? 170 ARG D C     1 
ATOM   6569 O  O     . ARG D 2 120 ? -20.743 74.315 -14.476 1.00 62.60  ? 170 ARG D O     1 
ATOM   6570 C  CB    . ARG D 2 120 ? -23.109 72.682 -13.376 1.00 62.50  ? 170 ARG D CB    1 
ATOM   6571 C  CG    . ARG D 2 120 ? -23.846 72.353 -12.087 1.00 63.02  ? 170 ARG D CG    1 
ATOM   6572 C  CD    . ARG D 2 120 ? -23.665 70.888 -11.720 1.00 63.75  ? 170 ARG D CD    1 
ATOM   6573 N  NE    . ARG D 2 120 ? -24.164 70.028 -12.792 1.00 64.45  ? 170 ARG D NE    1 
ATOM   6574 C  CZ    . ARG D 2 120 ? -25.363 69.442 -12.827 1.00 64.36  ? 170 ARG D CZ    1 
ATOM   6575 N  NH1   . ARG D 2 120 ? -26.245 69.573 -11.831 1.00 63.48  ? 170 ARG D NH1   1 
ATOM   6576 N  NH2   . ARG D 2 120 ? -25.674 68.702 -13.880 1.00 64.15  ? 170 ARG D NH2   1 
ATOM   6577 N  N     . PHE D 2 121 ? -22.376 74.702 -15.969 1.00 62.53  ? 171 PHE D N     1 
ATOM   6578 C  CA    . PHE D 2 121 ? -21.458 75.147 -17.016 1.00 62.65  ? 171 PHE D CA    1 
ATOM   6579 C  C     . PHE D 2 121 ? -20.876 76.511 -16.679 1.00 62.47  ? 171 PHE D C     1 
ATOM   6580 O  O     . PHE D 2 121 ? -19.683 76.739 -16.835 1.00 62.35  ? 171 PHE D O     1 
ATOM   6581 C  CB    . PHE D 2 121 ? -22.167 75.221 -18.369 1.00 62.84  ? 171 PHE D CB    1 
ATOM   6582 C  CG    . PHE D 2 121 ? -21.298 75.746 -19.479 1.00 63.22  ? 171 PHE D CG    1 
ATOM   6583 C  CD1   . PHE D 2 121 ? -20.110 75.102 -19.814 1.00 63.78  ? 171 PHE D CD1   1 
ATOM   6584 C  CD2   . PHE D 2 121 ? -21.671 76.869 -20.202 1.00 63.55  ? 171 PHE D CD2   1 
ATOM   6585 C  CE1   . PHE D 2 121 ? -19.301 75.576 -20.847 1.00 63.81  ? 171 PHE D CE1   1 
ATOM   6586 C  CE2   . PHE D 2 121 ? -20.868 77.348 -21.233 1.00 63.77  ? 171 PHE D CE2   1 
ATOM   6587 C  CZ    . PHE D 2 121 ? -19.682 76.697 -21.557 1.00 63.49  ? 171 PHE D CZ    1 
ATOM   6588 N  N     . LEU D 2 122 ? -21.736 77.405 -16.207 1.00 62.54  ? 172 LEU D N     1 
ATOM   6589 C  CA    . LEU D 2 122 ? -21.354 78.776 -15.907 1.00 62.72  ? 172 LEU D CA    1 
ATOM   6590 C  C     . LEU D 2 122 ? -20.466 78.868 -14.663 1.00 63.08  ? 172 LEU D C     1 
ATOM   6591 O  O     . LEU D 2 122 ? -19.720 79.841 -14.498 1.00 63.06  ? 172 LEU D O     1 
ATOM   6592 C  CB    . LEU D 2 122 ? -22.605 79.646 -15.740 1.00 62.67  ? 172 LEU D CB    1 
ATOM   6593 C  CG    . LEU D 2 122 ? -23.573 79.694 -16.934 1.00 62.48  ? 172 LEU D CG    1 
ATOM   6594 C  CD1   . LEU D 2 122 ? -24.709 80.688 -16.689 1.00 62.13  ? 172 LEU D CD1   1 
ATOM   6595 C  CD2   . LEU D 2 122 ? -22.840 80.034 -18.225 1.00 62.47  ? 172 LEU D CD2   1 
ATOM   6596 N  N     . LYS D 2 123 ? -20.543 77.857 -13.796 1.00 63.43  ? 173 LYS D N     1 
ATOM   6597 C  CA    . LYS D 2 123 ? -19.647 77.750 -12.638 1.00 63.58  ? 173 LYS D CA    1 
ATOM   6598 C  C     . LYS D 2 123 ? -18.426 76.857 -12.921 1.00 63.77  ? 173 LYS D C     1 
ATOM   6599 O  O     . LYS D 2 123 ? -17.623 76.624 -12.028 1.00 63.96  ? 173 LYS D O     1 
ATOM   6600 C  CB    . LYS D 2 123 ? -20.414 77.218 -11.419 1.00 63.55  ? 173 LYS D CB    1 
ATOM   6601 C  CG    . LYS D 2 123 ? -21.599 78.075 -10.999 1.00 63.25  ? 173 LYS D CG    1 
ATOM   6602 N  N     . SER D 2 124 ? -18.275 76.380 -14.157 1.00 64.03  ? 174 SER D N     1 
ATOM   6603 C  CA    . SER D 2 124 ? -17.190 75.455 -14.511 1.00 64.32  ? 174 SER D CA    1 
ATOM   6604 C  C     . SER D 2 124 ? -15.833 76.154 -14.668 1.00 64.42  ? 174 SER D C     1 
ATOM   6605 O  O     . SER D 2 124 ? -15.780 77.364 -14.874 1.00 64.37  ? 174 SER D O     1 
ATOM   6606 C  CB    . SER D 2 124 ? -17.532 74.718 -15.808 1.00 64.40  ? 174 SER D CB    1 
ATOM   6607 O  OG    . SER D 2 124 ? -17.423 75.576 -16.933 1.00 64.57  ? 174 SER D OG    1 
ATOM   6608 N  N     . PRO D 2 125 ? -14.728 75.391 -14.576 1.00 64.72  ? 175 PRO D N     1 
ATOM   6609 C  CA    . PRO D 2 125 ? -13.396 75.980 -14.765 1.00 65.00  ? 175 PRO D CA    1 
ATOM   6610 C  C     . PRO D 2 125 ? -13.095 76.390 -16.207 1.00 65.23  ? 175 PRO D C     1 
ATOM   6611 O  O     . PRO D 2 125 ? -12.314 77.314 -16.429 1.00 65.21  ? 175 PRO D O     1 
ATOM   6612 C  CB    . PRO D 2 125 ? -12.436 74.857 -14.331 1.00 64.97  ? 175 PRO D CB    1 
ATOM   6613 C  CG    . PRO D 2 125 ? -13.282 73.832 -13.666 1.00 64.89  ? 175 PRO D CG    1 
ATOM   6614 C  CD    . PRO D 2 125 ? -14.638 73.954 -14.274 1.00 64.68  ? 175 PRO D CD    1 
ATOM   6615 N  N     . ALA D 2 126 ? -13.703 75.698 -17.171 1.00 65.57  ? 176 ALA D N     1 
ATOM   6616 C  CA    . ALA D 2 126 ? -13.493 75.991 -18.593 1.00 65.67  ? 176 ALA D CA    1 
ATOM   6617 C  C     . ALA D 2 126 ? -14.147 77.304 -18.985 1.00 65.78  ? 176 ALA D C     1 
ATOM   6618 O  O     . ALA D 2 126 ? -13.559 78.097 -19.725 1.00 65.95  ? 176 ALA D O     1 
ATOM   6619 C  CB    . ALA D 2 126 ? -14.029 74.870 -19.453 1.00 65.66  ? 176 ALA D CB    1 
ATOM   6620 N  N     . TYR D 2 127 ? -15.365 77.524 -18.496 1.00 65.89  ? 177 TYR D N     1 
ATOM   6621 C  CA    . TYR D 2 127 ? -16.044 78.798 -18.690 1.00 66.00  ? 177 TYR D CA    1 
ATOM   6622 C  C     . TYR D 2 127 ? -15.317 79.891 -17.920 1.00 66.23  ? 177 TYR D C     1 
ATOM   6623 O  O     . TYR D 2 127 ? -14.978 80.934 -18.488 1.00 66.35  ? 177 TYR D O     1 
ATOM   6624 C  CB    . TYR D 2 127 ? -17.499 78.733 -18.232 1.00 65.93  ? 177 TYR D CB    1 
ATOM   6625 C  CG    . TYR D 2 127 ? -18.224 80.049 -18.396 1.00 65.69  ? 177 TYR D CG    1 
ATOM   6626 C  CD1   . TYR D 2 127 ? -18.621 80.489 -19.653 1.00 65.70  ? 177 TYR D CD1   1 
ATOM   6627 C  CD2   . TYR D 2 127 ? -18.496 80.859 -17.300 1.00 65.67  ? 177 TYR D CD2   1 
ATOM   6628 C  CE1   . TYR D 2 127 ? -19.281 81.698 -19.818 1.00 65.78  ? 177 TYR D CE1   1 
ATOM   6629 C  CE2   . TYR D 2 127 ? -19.156 82.072 -17.452 1.00 65.76  ? 177 TYR D CE2   1 
ATOM   6630 C  CZ    . TYR D 2 127 ? -19.547 82.485 -18.714 1.00 65.88  ? 177 TYR D CZ    1 
ATOM   6631 O  OH    . TYR D 2 127 ? -20.200 83.688 -18.878 1.00 66.00  ? 177 TYR D OH    1 
ATOM   6632 N  N     . ARG D 2 128 ? -15.070 79.640 -16.634 1.00 66.34  ? 178 ARG D N     1 
ATOM   6633 C  CA    . ARG D 2 128 ? -14.342 80.581 -15.768 1.00 66.44  ? 178 ARG D CA    1 
ATOM   6634 C  C     . ARG D 2 128 ? -13.002 81.069 -16.355 1.00 66.45  ? 178 ARG D C     1 
ATOM   6635 O  O     . ARG D 2 128 ? -12.624 82.223 -16.147 1.00 66.43  ? 178 ARG D O     1 
ATOM   6636 C  CB    . ARG D 2 128 ? -14.109 79.961 -14.383 1.00 66.44  ? 178 ARG D CB    1 
ATOM   6637 N  N     . ASP D 2 129 ? -12.297 80.196 -17.080 1.00 66.48  ? 179 ASP D N     1 
ATOM   6638 C  CA    . ASP D 2 129 ? -11.031 80.566 -17.742 1.00 66.58  ? 179 ASP D CA    1 
ATOM   6639 C  C     . ASP D 2 129 ? -11.235 81.292 -19.082 1.00 66.59  ? 179 ASP D C     1 
ATOM   6640 O  O     . ASP D 2 129 ? -10.324 81.972 -19.560 1.00 66.51  ? 179 ASP D O     1 
ATOM   6641 C  CB    . ASP D 2 129 ? -10.139 79.329 -17.964 1.00 66.57  ? 179 ASP D CB    1 
ATOM   6642 C  CG    . ASP D 2 129 ? -9.224  79.036 -16.782 1.00 66.31  ? 179 ASP D CG    1 
ATOM   6643 O  OD1   . ASP D 2 129 ? -8.458  79.938 -16.380 1.00 66.34  ? 179 ASP D OD1   1 
ATOM   6644 O  OD2   . ASP D 2 129 ? -9.252  77.897 -16.271 1.00 65.47  ? 179 ASP D OD2   1 
ATOM   6645 N  N     . LEU D 2 130 ? -12.412 81.130 -19.687 1.00 66.61  ? 180 LEU D N     1 
ATOM   6646 C  CA    . LEU D 2 130 ? -12.745 81.786 -20.960 1.00 66.61  ? 180 LEU D CA    1 
ATOM   6647 C  C     . LEU D 2 130 ? -13.466 83.122 -20.755 1.00 66.55  ? 180 LEU D C     1 
ATOM   6648 O  O     . LEU D 2 130 ? -13.456 83.980 -21.643 1.00 66.50  ? 180 LEU D O     1 
ATOM   6649 C  CB    . LEU D 2 130 ? -13.609 80.861 -21.827 1.00 66.66  ? 180 LEU D CB    1 
ATOM   6650 N  N     . ALA D 2 131 ? -14.101 83.285 -19.594 1.00 66.48  ? 181 ALA D N     1 
ATOM   6651 C  CA    . ALA D 2 131 ? -14.772 84.537 -19.242 1.00 66.45  ? 181 ALA D CA    1 
ATOM   6652 C  C     . ALA D 2 131 ? -13.752 85.629 -18.930 1.00 66.39  ? 181 ALA D C     1 
ATOM   6653 O  O     . ALA D 2 131 ? -13.942 86.786 -19.305 1.00 66.50  ? 181 ALA D O     1 
ATOM   6654 C  CB    . ALA D 2 131 ? -15.706 84.327 -18.056 1.00 66.40  ? 181 ALA D CB    1 
ATOM   6655 N  N     . ALA D 2 132 ? -12.670 85.251 -18.248 1.00 66.31  ? 182 ALA D N     1 
ATOM   6656 C  CA    . ALA D 2 132 ? -11.587 86.179 -17.899 1.00 66.13  ? 182 ALA D CA    1 
ATOM   6657 C  C     . ALA D 2 132 ? -10.767 86.619 -19.113 1.00 66.01  ? 182 ALA D C     1 
ATOM   6658 O  O     . ALA D 2 132 ? -10.285 87.752 -19.155 1.00 66.00  ? 182 ALA D O     1 
ATOM   6659 C  CB    . ALA D 2 132 ? -10.672 85.552 -16.854 1.00 66.11  ? 182 ALA D CB    1 
ATOM   6660 N  N     . GLN D 2 133 ? -10.599 85.723 -20.086 1.00 65.90  ? 183 GLN D N     1 
ATOM   6661 C  CA    . GLN D 2 133 ? -9.884  86.052 -21.326 1.00 65.83  ? 183 GLN D CA    1 
ATOM   6662 C  C     . GLN D 2 133 ? -10.669 87.062 -22.164 1.00 65.72  ? 183 GLN D C     1 
ATOM   6663 O  O     . GLN D 2 133 ? -10.080 87.847 -22.908 1.00 65.66  ? 183 GLN D O     1 
ATOM   6664 C  CB    . GLN D 2 133 ? -9.609  84.792 -22.154 1.00 65.79  ? 183 GLN D CB    1 
ATOM   6665 C  CG    . GLN D 2 133 ? -8.616  85.011 -23.288 1.00 65.80  ? 183 GLN D CG    1 
ATOM   6666 N  N     . ALA D 2 134 ? -11.995 87.030 -22.034 1.00 65.60  ? 184 ALA D N     1 
ATOM   6667 C  CA    . ALA D 2 134 ? -12.878 87.970 -22.720 1.00 65.51  ? 184 ALA D CA    1 
ATOM   6668 C  C     . ALA D 2 134 ? -12.895 89.317 -22.002 1.00 65.41  ? 184 ALA D C     1 
ATOM   6669 O  O     . ALA D 2 134 ? -13.127 89.380 -20.778 1.00 65.22  ? 184 ALA D O     1 
ATOM   6670 C  CB    . ALA D 2 134 ? -14.295 87.396 -22.810 1.00 65.55  ? 184 ALA D CB    1 
HETATM 6671 AL AL    . ALF E 3 .   ? -10.532 30.590 -20.264 1.00 47.65  ? 355 ALF A AL    1 
HETATM 6672 F  F1    . ALF E 3 .   ? -9.792  32.073 -20.913 1.00 48.48  ? 355 ALF A F1    1 
HETATM 6673 F  F2    . ALF E 3 .   ? -11.248 29.048 -19.763 1.00 47.75  ? 355 ALF A F2    1 
HETATM 6674 F  F3    . ALF E 3 .   ? -8.883  30.002 -19.897 1.00 48.10  ? 355 ALF A F3    1 
HETATM 6675 F  F4    . ALF E 3 .   ? -12.172 31.234 -20.497 1.00 46.91  ? 355 ALF A F4    1 
HETATM 6676 MG MG    . MG  F 4 .   ? -8.106  32.053 -22.028 1.00 52.33  ? 356 MG  A MG    1 
HETATM 6677 S  S     . SO4 G 5 .   ? 8.370   -1.947 -10.993 1.00 108.46 ? 357 SO4 A S     1 
HETATM 6678 O  O1    . SO4 G 5 .   ? 9.337   -1.876 -12.088 1.00 108.76 ? 357 SO4 A O1    1 
HETATM 6679 O  O2    . SO4 G 5 .   ? 7.136   -2.604 -11.432 1.00 108.50 ? 357 SO4 A O2    1 
HETATM 6680 O  O3    . SO4 G 5 .   ? 8.973   -2.730 -9.922  1.00 108.32 ? 357 SO4 A O3    1 
HETATM 6681 O  O4    . SO4 G 5 .   ? 8.063   -0.597 -10.522 1.00 108.01 ? 357 SO4 A O4    1 
HETATM 6682 S  S     . SO4 H 5 .   ? -29.476 11.500 -38.068 1.00 84.56  ? 358 SO4 A S     1 
HETATM 6683 O  O1    . SO4 H 5 .   ? -29.309 10.498 -39.117 1.00 84.84  ? 358 SO4 A O1    1 
HETATM 6684 O  O2    . SO4 H 5 .   ? -30.681 12.292 -38.309 1.00 85.31  ? 358 SO4 A O2    1 
HETATM 6685 O  O3    . SO4 H 5 .   ? -29.584 10.828 -36.771 1.00 84.41  ? 358 SO4 A O3    1 
HETATM 6686 O  O4    . SO4 H 5 .   ? -28.328 12.401 -38.101 1.00 86.02  ? 358 SO4 A O4    1 
HETATM 6687 S  S     . SO4 I 5 .   ? -9.200  51.599 -20.532 1.00 109.89 ? 359 SO4 A S     1 
HETATM 6688 O  O1    . SO4 I 5 .   ? -8.441  51.528 -21.781 1.00 109.47 ? 359 SO4 A O1    1 
HETATM 6689 O  O2    . SO4 I 5 .   ? -10.554 52.086 -20.798 1.00 109.75 ? 359 SO4 A O2    1 
HETATM 6690 O  O3    . SO4 I 5 .   ? -9.290  50.265 -19.942 1.00 110.04 ? 359 SO4 A O3    1 
HETATM 6691 O  O4    . SO4 I 5 .   ? -8.531  52.498 -19.592 1.00 109.59 ? 359 SO4 A O4    1 
HETATM 6692 S  S     . SO4 J 5 .   ? -12.488 47.443 -7.508  1.00 123.89 ? 360 SO4 A S     1 
HETATM 6693 O  O1    . SO4 J 5 .   ? -11.176 48.067 -7.683  1.00 123.43 ? 360 SO4 A O1    1 
HETATM 6694 O  O2    . SO4 J 5 .   ? -13.394 47.930 -8.550  1.00 123.41 ? 360 SO4 A O2    1 
HETATM 6695 O  O3    . SO4 J 5 .   ? -12.350 45.992 -7.618  1.00 123.58 ? 360 SO4 A O3    1 
HETATM 6696 O  O4    . SO4 J 5 .   ? -13.032 47.772 -6.189  1.00 123.48 ? 360 SO4 A O4    1 
HETATM 6697 P  PB    . GDP K 6 .   ? -10.444 30.314 -23.434 1.00 40.18  ? 401 GDP A PB    1 
HETATM 6698 O  O1B   . GDP K 6 .   ? -9.464  31.429 -23.594 1.00 37.11  ? 401 GDP A O1B   1 
HETATM 6699 O  O2B   . GDP K 6 .   ? -10.635 30.000 -21.972 1.00 40.04  ? 401 GDP A O2B   1 
HETATM 6700 O  O3B   . GDP K 6 .   ? -11.801 30.674 -23.991 1.00 41.18  ? 401 GDP A O3B   1 
HETATM 6701 O  O3A   . GDP K 6 .   ? -10.040 28.990 -24.244 1.00 40.84  ? 401 GDP A O3A   1 
HETATM 6702 P  PA    . GDP K 6 .   ? -8.690  28.790 -25.078 1.00 41.60  ? 401 GDP A PA    1 
HETATM 6703 O  O1A   . GDP K 6 .   ? -7.540  28.456 -24.144 1.00 41.50  ? 401 GDP A O1A   1 
HETATM 6704 O  O2A   . GDP K 6 .   ? -8.439  29.977 -25.964 1.00 41.16  ? 401 GDP A O2A   1 
HETATM 6705 O  "O5'" . GDP K 6 .   ? -9.042  27.517 -25.983 1.00 42.13  ? 401 GDP A "O5'" 1 
HETATM 6706 C  "C5'" . GDP K 6 .   ? -9.418  26.288 -25.363 1.00 43.19  ? 401 GDP A "C5'" 1 
HETATM 6707 C  "C4'" . GDP K 6 .   ? -8.631  25.121 -25.954 1.00 44.13  ? 401 GDP A "C4'" 1 
HETATM 6708 O  "O4'" . GDP K 6 .   ? -9.318  24.679 -27.129 1.00 44.36  ? 401 GDP A "O4'" 1 
HETATM 6709 C  "C3'" . GDP K 6 .   ? -7.186  25.452 -26.363 1.00 43.97  ? 401 GDP A "C3'" 1 
HETATM 6710 O  "O3'" . GDP K 6 .   ? -6.317  24.339 -26.099 1.00 42.09  ? 401 GDP A "O3'" 1 
HETATM 6711 C  "C2'" . GDP K 6 .   ? -7.284  25.715 -27.850 1.00 44.65  ? 401 GDP A "C2'" 1 
HETATM 6712 O  "O2'" . GDP K 6 .   ? -6.135  25.301 -28.580 1.00 45.64  ? 401 GDP A "O2'" 1 
HETATM 6713 C  "C1'" . GDP K 6 .   ? -8.490  24.897 -28.282 1.00 45.82  ? 401 GDP A "C1'" 1 
HETATM 6714 N  N9    . GDP K 6 .   ? -9.317  25.594 -29.280 1.00 46.21  ? 401 GDP A N9    1 
HETATM 6715 C  C8    . GDP K 6 .   ? -9.878  26.806 -29.151 1.00 46.28  ? 401 GDP A C8    1 
HETATM 6716 N  N7    . GDP K 6 .   ? -10.588 27.111 -30.258 1.00 46.37  ? 401 GDP A N7    1 
HETATM 6717 C  C5    . GDP K 6 .   ? -10.506 26.078 -31.099 1.00 45.97  ? 401 GDP A C5    1 
HETATM 6718 C  C6    . GDP K 6 .   ? -11.036 25.752 -32.430 1.00 46.26  ? 401 GDP A C6    1 
HETATM 6719 O  O6    . GDP K 6 .   ? -11.761 26.546 -33.066 1.00 46.20  ? 401 GDP A O6    1 
HETATM 6720 N  N1    . GDP K 6 .   ? -10.705 24.566 -32.940 1.00 47.06  ? 401 GDP A N1    1 
HETATM 6721 C  C2    . GDP K 6 .   ? -9.925  23.677 -32.285 1.00 46.72  ? 401 GDP A C2    1 
HETATM 6722 N  N2    . GDP K 6 .   ? -9.628  22.491 -32.867 1.00 46.56  ? 401 GDP A N2    1 
HETATM 6723 N  N3    . GDP K 6 .   ? -9.419  23.912 -31.057 1.00 46.40  ? 401 GDP A N3    1 
HETATM 6724 C  C4    . GDP K 6 .   ? -9.673  25.076 -30.441 1.00 46.23  ? 401 GDP A C4    1 
HETATM 6725 S  S     . SO4 L 5 .   ? -0.694  25.481 17.220  1.00 102.59 ? 302 SO4 B S     1 
HETATM 6726 O  O1    . SO4 L 5 .   ? 0.204   25.000 16.172  1.00 102.65 ? 302 SO4 B O1    1 
HETATM 6727 O  O2    . SO4 L 5 .   ? -2.093  25.292 16.834  1.00 101.99 ? 302 SO4 B O2    1 
HETATM 6728 O  O3    . SO4 L 5 .   ? -0.411  24.737 18.448  1.00 102.45 ? 302 SO4 B O3    1 
HETATM 6729 O  O4    . SO4 L 5 .   ? -0.464  26.909 17.426  1.00 102.14 ? 302 SO4 B O4    1 
HETATM 6730 AL AL    . ALF M 3 .   ? -33.113 62.313 -10.843 1.00 58.09  ? 355 ALF C AL    1 
HETATM 6731 F  F1    . ALF M 3 .   ? -32.537 60.623 -10.737 1.00 59.14  ? 355 ALF C F1    1 
HETATM 6732 F  F2    . ALF M 3 .   ? -33.637 63.989 -11.034 1.00 59.29  ? 355 ALF C F2    1 
HETATM 6733 F  F3    . ALF M 3 .   ? -31.533 62.942 -10.337 1.00 58.96  ? 355 ALF C F3    1 
HETATM 6734 F  F4    . ALF M 3 .   ? -34.731 61.744 -11.341 1.00 59.13  ? 355 ALF C F4    1 
HETATM 6735 MG MG    . MG  N 4 .   ? -30.961 63.976 -9.092  1.00 59.58  ? 356 MG  C MG    1 
HETATM 6736 S  S     . SO4 O 5 .   ? -52.096 53.471 14.078  1.00 92.50  ? 357 SO4 C S     1 
HETATM 6737 O  O1    . SO4 O 5 .   ? -51.155 54.268 13.283  1.00 91.29  ? 357 SO4 C O1    1 
HETATM 6738 O  O2    . SO4 O 5 .   ? -53.331 53.173 13.345  1.00 90.43  ? 357 SO4 C O2    1 
HETATM 6739 O  O3    . SO4 O 5 .   ? -51.433 52.223 14.480  1.00 91.29  ? 357 SO4 C O3    1 
HETATM 6740 O  O4    . SO4 O 5 .   ? -52.458 54.260 15.250  1.00 92.43  ? 357 SO4 C O4    1 
HETATM 6741 S  S     . SO4 P 5 .   ? -59.507 87.421 -19.118 1.00 113.14 ? 358 SO4 C S     1 
HETATM 6742 O  O1    . SO4 P 5 .   ? -59.429 86.561 -20.301 1.00 112.72 ? 358 SO4 C O1    1 
HETATM 6743 O  O2    . SO4 P 5 .   ? -60.889 87.872 -18.936 1.00 112.56 ? 358 SO4 C O2    1 
HETATM 6744 O  O3    . SO4 P 5 .   ? -59.075 86.682 -17.929 1.00 112.18 ? 358 SO4 C O3    1 
HETATM 6745 O  O4    . SO4 P 5 .   ? -58.643 88.580 -19.332 1.00 112.54 ? 358 SO4 C O4    1 
HETATM 6746 P  PB    . GDP Q 6 .   ? -33.147 62.347 -7.737  1.00 46.01  ? 402 GDP C PB    1 
HETATM 6747 O  O1B   . GDP Q 6 .   ? -31.886 63.163 -7.601  1.00 45.97  ? 402 GDP C O1B   1 
HETATM 6748 O  O2B   . GDP Q 6 .   ? -33.575 62.360 -9.180  1.00 44.80  ? 402 GDP C O2B   1 
HETATM 6749 O  O3B   . GDP Q 6 .   ? -32.881 60.938 -7.286  1.00 45.85  ? 402 GDP C O3B   1 
HETATM 6750 O  O3A   . GDP Q 6 .   ? -34.300 62.942 -6.789  1.00 46.05  ? 402 GDP C O3A   1 
HETATM 6751 P  PA    . GDP Q 6 .   ? -34.158 64.418 -6.161  1.00 45.98  ? 402 GDP C PA    1 
HETATM 6752 O  O1A   . GDP Q 6 .   ? -34.022 65.427 -7.271  1.00 46.48  ? 402 GDP C O1A   1 
HETATM 6753 O  O2A   . GDP Q 6 .   ? -32.965 64.542 -5.249  1.00 46.59  ? 402 GDP C O2A   1 
HETATM 6754 O  "O5'" . GDP Q 6 .   ? -35.524 64.588 -5.350  1.00 45.46  ? 402 GDP C "O5'" 1 
HETATM 6755 C  "C5'" . GDP Q 6 .   ? -36.759 64.608 -6.053  1.00 45.39  ? 402 GDP C "C5'" 1 
HETATM 6756 C  "C4'" . GDP Q 6 .   ? -37.740 65.517 -5.340  1.00 45.50  ? 402 GDP C "C4'" 1 
HETATM 6757 O  "O4'" . GDP Q 6 .   ? -38.163 64.917 -4.113  1.00 45.12  ? 402 GDP C "O4'" 1 
HETATM 6758 C  "C3'" . GDP Q 6 .   ? -37.119 66.852 -4.977  1.00 45.88  ? 402 GDP C "C3'" 1 
HETATM 6759 O  "O3'" . GDP Q 6 .   ? -38.089 67.896 -5.152  1.00 48.05  ? 402 GDP C "O3'" 1 
HETATM 6760 C  "C2'" . GDP Q 6 .   ? -36.755 66.719 -3.513  1.00 45.85  ? 402 GDP C "C2'" 1 
HETATM 6761 O  "O2'" . GDP Q 6 .   ? -36.897 67.958 -2.831  1.00 46.77  ? 402 GDP C "O2'" 1 
HETATM 6762 C  "C1'" . GDP Q 6 .   ? -37.758 65.719 -2.982  1.00 45.98  ? 402 GDP C "C1'" 1 
HETATM 6763 N  N9    . GDP Q 6 .   ? -37.278 64.834 -1.879  1.00 45.99  ? 402 GDP C N9    1 
HETATM 6764 C  C8    . GDP Q 6 .   ? -36.176 64.049 -1.830  1.00 46.07  ? 402 GDP C C8    1 
HETATM 6765 N  N7    . GDP Q 6 .   ? -36.124 63.347 -0.664  1.00 45.76  ? 402 GDP C N7    1 
HETATM 6766 C  C5    . GDP Q 6 .   ? -37.224 63.665 0.037   1.00 45.73  ? 402 GDP C C5    1 
HETATM 6767 C  C6    . GDP Q 6 .   ? -37.815 63.307 1.344   1.00 45.99  ? 402 GDP C C6    1 
HETATM 6768 O  O6    . GDP Q 6 .   ? -37.285 62.498 2.126   1.00 45.66  ? 402 GDP C O6    1 
HETATM 6769 N  N1    . GDP Q 6 .   ? -38.972 63.878 1.686   1.00 46.84  ? 402 GDP C N1    1 
HETATM 6770 C  C2    . GDP Q 6 .   ? -39.623 64.756 0.901   1.00 46.32  ? 402 GDP C C2    1 
HETATM 6771 N  N2    . GDP Q 6 .   ? -40.793 65.272 1.340   1.00 46.00  ? 402 GDP C N2    1 
HETATM 6772 N  N3    . GDP Q 6 .   ? -39.147 65.135 -0.311  1.00 45.79  ? 402 GDP C N3    1 
HETATM 6773 C  C4    . GDP Q 6 .   ? -37.978 64.633 -0.773  1.00 45.72  ? 402 GDP C C4    1 
HETATM 6774 S  S     . SO4 R 5 .   ? -33.905 69.224 -48.450 1.00 102.50 ? 303 SO4 D S     1 
HETATM 6775 O  O1    . SO4 R 5 .   ? -33.166 69.729 -49.603 1.00 102.75 ? 303 SO4 D O1    1 
HETATM 6776 O  O2    . SO4 R 5 .   ? -35.294 68.966 -48.823 1.00 101.44 ? 303 SO4 D O2    1 
HETATM 6777 O  O3    . SO4 R 5 .   ? -33.277 67.981 -48.002 1.00 102.45 ? 303 SO4 D O3    1 
HETATM 6778 O  O4    . SO4 R 5 .   ? -33.851 70.239 -47.397 1.00 102.16 ? 303 SO4 D O4    1 
HETATM 6779 O  O     . HOH S 7 .   ? -0.537  50.701 -27.717 1.00 47.37  ? 402 HOH A O     1 
HETATM 6780 O  O     . HOH S 7 .   ? -28.249 22.458 -17.803 1.00 40.44  ? 403 HOH A O     1 
HETATM 6781 O  O     . HOH S 7 .   ? -10.160 22.397 -24.153 1.00 40.24  ? 404 HOH A O     1 
HETATM 6782 O  O     . HOH S 7 .   ? -7.082  21.533 -25.291 1.00 36.11  ? 405 HOH A O     1 
HETATM 6783 O  O     . HOH S 7 .   ? -28.447 39.691 -35.855 1.00 42.90  ? 406 HOH A O     1 
HETATM 6784 O  O     . HOH S 7 .   ? -16.180 24.936 -18.046 1.00 45.64  ? 407 HOH A O     1 
HETATM 6785 O  O     . HOH S 7 .   ? -7.372  30.578 -22.221 1.00 46.79  ? 408 HOH A O     1 
HETATM 6786 O  O     . HOH S 7 .   ? -32.945 22.823 -38.533 1.00 48.35  ? 409 HOH A O     1 
HETATM 6787 O  O     . HOH S 7 .   ? -14.892 3.020  -28.912 1.00 58.10  ? 410 HOH A O     1 
HETATM 6788 O  O     . HOH S 7 .   ? -37.120 15.472 -30.697 1.00 44.18  ? 411 HOH A O     1 
HETATM 6789 O  O     . HOH S 7 .   ? -37.798 38.192 -29.171 1.00 48.84  ? 412 HOH A O     1 
HETATM 6790 O  O     . HOH S 7 .   ? -38.503 39.299 -31.542 1.00 51.64  ? 413 HOH A O     1 
HETATM 6791 O  O     . HOH S 7 .   ? -16.781 25.577 -42.978 1.00 42.84  ? 414 HOH A O     1 
HETATM 6792 O  O     . HOH S 7 .   ? -17.402 29.139 -43.207 1.00 54.51  ? 415 HOH A O     1 
HETATM 6793 O  O     . HOH S 7 .   ? -10.286 31.194 -18.446 1.00 50.22  ? 416 HOH A O     1 
HETATM 6794 O  O     . HOH S 7 .   ? -8.990  33.785 -22.236 1.00 43.52  ? 417 HOH A O     1 
HETATM 6795 O  O     . HOH T 7 .   ? 13.930  38.673 -2.598  1.00 53.05  ? 13  HOH B O     1 
HETATM 6796 O  O     . HOH T 7 .   ? 12.263  26.790 -14.679 1.00 67.77  ? 20  HOH B O     1 
HETATM 6797 O  O     . HOH U 7 .   ? -38.524 56.671 -10.933 1.00 48.22  ? 403 HOH C O     1 
HETATM 6798 O  O     . HOH U 7 .   ? -70.892 76.003 -10.746 1.00 55.86  ? 404 HOH C O     1 
HETATM 6799 O  O     . HOH U 7 .   ? -29.208 62.779 -9.100  1.00 40.94  ? 405 HOH C O     1 
HETATM 6800 O  O     . HOH U 7 .   ? -19.340 44.900 3.829   1.00 41.77  ? 406 HOH C O     1 
HETATM 6801 O  O     . HOH U 7 .   ? -32.633 62.378 -12.719 1.00 35.11  ? 407 HOH C O     1 
HETATM 6802 O  O     . HOH U 7 .   ? -38.346 40.736 -2.487  1.00 41.52  ? 408 HOH C O     1 
HETATM 6803 O  O     . HOH U 7 .   ? -17.854 37.911 4.077   1.00 63.67  ? 409 HOH C O     1 
HETATM 6804 O  O     . HOH U 7 .   ? -26.052 73.101 -5.250  1.00 50.29  ? 410 HOH C O     1 
HETATM 6805 O  O     . HOH U 7 .   ? -12.590 67.898 0.589   1.00 42.55  ? 411 HOH C O     1 
HETATM 6806 O  O     . HOH U 7 .   ? -14.383 66.159 10.266  1.00 40.16  ? 412 HOH C O     1 
HETATM 6807 O  O     . HOH U 7 .   ? -32.224 65.277 -9.162  1.00 41.94  ? 413 HOH C O     1 
HETATM 6808 O  O     . HOH U 7 .   ? -16.415 67.190 11.209  1.00 44.30  ? 414 HOH C O     1 
HETATM 6809 O  O     . HOH U 7 .   ? -55.766 48.620 6.404   1.00 47.00  ? 415 HOH C O     1 
HETATM 6810 O  O     . HOH U 7 .   ? -38.458 66.965 -14.152 1.00 57.29  ? 416 HOH C O     1 
HETATM 6811 O  O     . HOH V 7 .   ? -38.896 51.497 -28.690 1.00 50.97  ? 6   HOH D O     1 
HETATM 6812 O  O     . HOH V 7 .   ? -43.779 52.489 -25.458 1.00 45.45  ? 9   HOH D O     1 
HETATM 6813 O  O     . HOH V 7 .   ? -48.313 61.375 -25.162 1.00 44.71  ? 24  HOH D O     1 
HETATM 6814 O  O     . HOH V 7 .   ? -8.654  82.077 -14.827 1.00 66.76  ? 38  HOH D O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ALA 1   31  ?   ?   ?   A . n 
A 1 2   ARG 2   32  32  ARG ARG A . n 
A 1 3   GLU 3   33  33  GLU GLU A . n 
A 1 4   VAL 4   34  34  VAL VAL A . n 
A 1 5   LYS 5   35  35  LYS LYS A . n 
A 1 6   LEU 6   36  36  LEU LEU A . n 
A 1 7   LEU 7   37  37  LEU LEU A . n 
A 1 8   LEU 8   38  38  LEU LEU A . n 
A 1 9   LEU 9   39  39  LEU LEU A . n 
A 1 10  GLY 10  40  40  GLY GLY A . n 
A 1 11  ALA 11  41  41  ALA ALA A . n 
A 1 12  GLY 12  42  42  GLY GLY A . n 
A 1 13  GLU 13  43  43  GLU GLU A . n 
A 1 14  SER 14  44  44  SER SER A . n 
A 1 15  GLY 15  45  45  GLY GLY A . n 
A 1 16  LYS 16  46  46  LYS LYS A . n 
A 1 17  SER 17  47  47  SER SER A . n 
A 1 18  THR 18  48  48  THR THR A . n 
A 1 19  ILE 19  49  49  ILE ILE A . n 
A 1 20  VAL 20  50  50  VAL VAL A . n 
A 1 21  LYS 21  51  51  LYS LYS A . n 
A 1 22  GLN 22  52  52  GLN GLN A . n 
A 1 23  MET 23  53  53  MET MET A . n 
A 1 24  LYS 24  54  54  LYS LYS A . n 
A 1 25  ILE 25  55  55  ILE ILE A . n 
A 1 26  ILE 26  56  56  ILE ILE A . n 
A 1 27  HIS 27  57  57  HIS HIS A . n 
A 1 28  GLU 28  58  58  GLU GLU A . n 
A 1 29  ALA 29  59  59  ALA ALA A . n 
A 1 30  GLY 30  60  60  GLY GLY A . n 
A 1 31  TYR 31  61  61  TYR TYR A . n 
A 1 32  SER 32  62  62  SER SER A . n 
A 1 33  GLU 33  63  63  GLU GLU A . n 
A 1 34  GLU 34  64  64  GLU GLU A . n 
A 1 35  GLU 35  65  65  GLU GLU A . n 
A 1 36  CYS 36  66  66  CYS CYS A . n 
A 1 37  LYS 37  67  67  LYS LYS A . n 
A 1 38  GLN 38  68  68  GLN GLN A . n 
A 1 39  TYR 39  69  69  TYR TYR A . n 
A 1 40  LYS 40  70  70  LYS LYS A . n 
A 1 41  ALA 41  71  71  ALA ALA A . n 
A 1 42  VAL 42  72  72  VAL VAL A . n 
A 1 43  VAL 43  73  73  VAL VAL A . n 
A 1 44  TYR 44  74  74  TYR TYR A . n 
A 1 45  SER 45  75  75  SER SER A . n 
A 1 46  ASN 46  76  76  ASN ASN A . n 
A 1 47  THR 47  77  77  THR THR A . n 
A 1 48  ILE 48  78  78  ILE ILE A . n 
A 1 49  GLN 49  79  79  GLN GLN A . n 
A 1 50  SER 50  80  80  SER SER A . n 
A 1 51  ILE 51  81  81  ILE ILE A . n 
A 1 52  ILE 52  82  82  ILE ILE A . n 
A 1 53  ALA 53  83  83  ALA ALA A . n 
A 1 54  ILE 54  84  84  ILE ILE A . n 
A 1 55  ILE 55  85  85  ILE ILE A . n 
A 1 56  ARG 56  86  86  ARG ARG A . n 
A 1 57  ALA 57  87  87  ALA ALA A . n 
A 1 58  MET 58  88  88  MET MET A . n 
A 1 59  GLY 59  89  89  GLY GLY A . n 
A 1 60  ARG 60  90  90  ARG ARG A . n 
A 1 61  LEU 61  91  91  LEU LEU A . n 
A 1 62  LYS 62  92  92  LYS LYS A . n 
A 1 63  ILE 63  93  93  ILE ILE A . n 
A 1 64  ASP 64  94  94  ASP ASP A . n 
A 1 65  PHE 65  95  95  PHE PHE A . n 
A 1 66  GLY 66  96  96  GLY GLY A . n 
A 1 67  ASP 67  97  97  ASP ASP A . n 
A 1 68  SER 68  98  98  SER SER A . n 
A 1 69  ALA 69  99  99  ALA ALA A . n 
A 1 70  ARG 70  100 100 ARG ARG A . n 
A 1 71  ALA 71  101 101 ALA ALA A . n 
A 1 72  ASP 72  102 102 ASP ASP A . n 
A 1 73  ASP 73  103 103 ASP ASP A . n 
A 1 74  ALA 74  104 104 ALA ALA A . n 
A 1 75  ARG 75  105 105 ARG ARG A . n 
A 1 76  GLN 76  106 106 GLN GLN A . n 
A 1 77  LEU 77  107 107 LEU LEU A . n 
A 1 78  PHE 78  108 108 PHE PHE A . n 
A 1 79  VAL 79  109 109 VAL VAL A . n 
A 1 80  LEU 80  110 110 LEU LEU A . n 
A 1 81  ALA 81  111 111 ALA ALA A . n 
A 1 82  GLY 82  112 ?   ?   ?   A . n 
A 1 83  ALA 83  113 ?   ?   ?   A . n 
A 1 84  ALA 84  114 ?   ?   ?   A . n 
A 1 85  GLU 85  115 ?   ?   ?   A . n 
A 1 86  GLU 86  116 ?   ?   ?   A . n 
A 1 87  GLY 87  117 ?   ?   ?   A . n 
A 1 88  PHE 88  118 ?   ?   ?   A . n 
A 1 89  MET 89  119 119 MET MET A . n 
A 1 90  THR 90  120 120 THR THR A . n 
A 1 91  ALA 91  121 121 ALA ALA A . n 
A 1 92  GLU 92  122 122 GLU GLU A . n 
A 1 93  LEU 93  123 123 LEU LEU A . n 
A 1 94  ALA 94  124 124 ALA ALA A . n 
A 1 95  GLY 95  125 125 GLY GLY A . n 
A 1 96  VAL 96  126 126 VAL VAL A . n 
A 1 97  ILE 97  127 127 ILE ILE A . n 
A 1 98  LYS 98  128 128 LYS LYS A . n 
A 1 99  ARG 99  129 129 ARG ARG A . n 
A 1 100 LEU 100 130 130 LEU LEU A . n 
A 1 101 TRP 101 131 131 TRP TRP A . n 
A 1 102 LYS 102 132 132 LYS LYS A . n 
A 1 103 ASP 103 133 133 ASP ASP A . n 
A 1 104 SER 104 134 134 SER SER A . n 
A 1 105 GLY 105 135 135 GLY GLY A . n 
A 1 106 VAL 106 136 136 VAL VAL A . n 
A 1 107 GLN 107 137 137 GLN GLN A . n 
A 1 108 ALA 108 138 138 ALA ALA A . n 
A 1 109 CYS 109 139 139 CYS CYS A . n 
A 1 110 PHE 110 140 140 PHE PHE A . n 
A 1 111 ASN 111 141 141 ASN ASN A . n 
A 1 112 ARG 112 142 142 ARG ARG A . n 
A 1 113 SER 113 143 143 SER SER A . n 
A 1 114 ARG 114 144 144 ARG ARG A . n 
A 1 115 GLU 115 145 145 GLU GLU A . n 
A 1 116 TYR 116 146 146 TYR TYR A . n 
A 1 117 GLN 117 147 147 GLN GLN A . n 
A 1 118 LEU 118 148 148 LEU LEU A . n 
A 1 119 ASN 119 149 149 ASN ASN A . n 
A 1 120 ASP 120 150 150 ASP ASP A . n 
A 1 121 SER 121 151 151 SER SER A . n 
A 1 122 ALA 122 152 152 ALA ALA A . n 
A 1 123 ALA 123 153 153 ALA ALA A . n 
A 1 124 TYR 124 154 154 TYR TYR A . n 
A 1 125 TYR 125 155 155 TYR TYR A . n 
A 1 126 LEU 126 156 156 LEU LEU A . n 
A 1 127 ASN 127 157 157 ASN ASN A . n 
A 1 128 ASP 128 158 158 ASP ASP A . n 
A 1 129 LEU 129 159 159 LEU LEU A . n 
A 1 130 ASP 130 160 160 ASP ASP A . n 
A 1 131 ARG 131 161 161 ARG ARG A . n 
A 1 132 ILE 132 162 162 ILE ILE A . n 
A 1 133 ALA 133 163 163 ALA ALA A . n 
A 1 134 GLN 134 164 164 GLN GLN A . n 
A 1 135 PRO 135 165 165 PRO PRO A . n 
A 1 136 ASN 136 166 166 ASN ASN A . n 
A 1 137 TYR 137 167 167 TYR TYR A . n 
A 1 138 ILE 138 168 168 ILE ILE A . n 
A 1 139 PRO 139 169 169 PRO PRO A . n 
A 1 140 THR 140 170 170 THR THR A . n 
A 1 141 GLN 141 171 171 GLN GLN A . n 
A 1 142 GLN 142 172 172 GLN GLN A . n 
A 1 143 ASP 143 173 173 ASP ASP A . n 
A 1 144 VAL 144 174 174 VAL VAL A . n 
A 1 145 LEU 145 175 175 LEU LEU A . n 
A 1 146 ARG 146 176 176 ARG ARG A . n 
A 1 147 THR 147 177 177 THR THR A . n 
A 1 148 ARG 148 178 178 ARG ARG A . n 
A 1 149 VAL 149 179 179 VAL VAL A . n 
A 1 150 LYS 150 180 180 LYS LYS A . n 
A 1 151 THR 151 181 181 THR THR A . n 
A 1 152 THR 152 182 182 THR THR A . n 
A 1 153 GLY 153 183 183 GLY GLY A . n 
A 1 154 ILE 154 184 184 ILE ILE A . n 
A 1 155 VAL 155 185 185 VAL VAL A . n 
A 1 156 GLU 156 186 186 GLU GLU A . n 
A 1 157 THR 157 187 187 THR THR A . n 
A 1 158 HIS 158 188 188 HIS HIS A . n 
A 1 159 PHE 159 189 189 PHE PHE A . n 
A 1 160 THR 160 190 190 THR THR A . n 
A 1 161 PHE 161 191 191 PHE PHE A . n 
A 1 162 LYS 162 192 192 LYS LYS A . n 
A 1 163 ASP 163 193 193 ASP ASP A . n 
A 1 164 LEU 164 194 194 LEU LEU A . n 
A 1 165 HIS 165 195 195 HIS HIS A . n 
A 1 166 PHE 166 196 196 PHE PHE A . n 
A 1 167 LYS 167 197 197 LYS LYS A . n 
A 1 168 MET 168 198 198 MET MET A . n 
A 1 169 PHE 169 199 199 PHE PHE A . n 
A 1 170 ASP 170 200 200 ASP ASP A . n 
A 1 171 VAL 171 201 201 VAL VAL A . n 
A 1 172 GLY 172 202 202 GLY GLY A . n 
A 1 173 GLY 173 203 203 GLY GLY A . n 
A 1 174 GLN 174 204 204 GLN GLN A . n 
A 1 175 ARG 175 205 205 ARG ARG A . n 
A 1 176 SER 176 206 206 SER SER A . n 
A 1 177 GLU 177 207 207 GLU GLU A . n 
A 1 178 ARG 178 208 208 ARG ARG A . n 
A 1 179 LYS 179 209 209 LYS LYS A . n 
A 1 180 LYS 180 210 210 LYS LYS A . n 
A 1 181 TRP 181 211 211 TRP TRP A . n 
A 1 182 ILE 182 212 212 ILE ILE A . n 
A 1 183 HIS 183 213 213 HIS HIS A . n 
A 1 184 CYS 184 214 214 CYS CYS A . n 
A 1 185 PHE 185 215 215 PHE PHE A . n 
A 1 186 GLU 186 216 216 GLU GLU A . n 
A 1 187 GLY 187 217 217 GLY GLY A . n 
A 1 188 VAL 188 218 218 VAL VAL A . n 
A 1 189 THR 189 219 219 THR THR A . n 
A 1 190 ALA 190 220 220 ALA ALA A . n 
A 1 191 ILE 191 221 221 ILE ILE A . n 
A 1 192 ILE 192 222 222 ILE ILE A . n 
A 1 193 PHE 193 223 223 PHE PHE A . n 
A 1 194 CYS 194 224 224 CYS CYS A . n 
A 1 195 VAL 195 225 225 VAL VAL A . n 
A 1 196 ALA 196 226 226 ALA ALA A . n 
A 1 197 LEU 197 227 227 LEU LEU A . n 
A 1 198 SER 198 228 228 SER SER A . n 
A 1 199 ASP 199 229 229 ASP ASP A . n 
A 1 200 TYR 200 230 230 TYR TYR A . n 
A 1 201 ASP 201 231 231 ASP ASP A . n 
A 1 202 LEU 202 232 232 LEU LEU A . n 
A 1 203 VAL 203 233 233 VAL VAL A . n 
A 1 204 LEU 204 234 234 LEU LEU A . n 
A 1 205 ALA 205 235 235 ALA ALA A . n 
A 1 206 GLU 206 236 236 GLU GLU A . n 
A 1 207 ASP 207 237 237 ASP ASP A . n 
A 1 208 GLU 208 238 238 GLU GLU A . n 
A 1 209 GLU 209 239 239 GLU GLU A . n 
A 1 210 MET 210 240 240 MET MET A . n 
A 1 211 ASN 211 241 241 ASN ASN A . n 
A 1 212 ARG 212 242 242 ARG ARG A . n 
A 1 213 MET 213 243 243 MET MET A . n 
A 1 214 HIS 214 244 244 HIS HIS A . n 
A 1 215 GLU 215 245 245 GLU GLU A . n 
A 1 216 SER 216 246 246 SER SER A . n 
A 1 217 MET 217 247 247 MET MET A . n 
A 1 218 LYS 218 248 248 LYS LYS A . n 
A 1 219 LEU 219 249 249 LEU LEU A . n 
A 1 220 PHE 220 250 250 PHE PHE A . n 
A 1 221 ASP 221 251 251 ASP ASP A . n 
A 1 222 SER 222 252 252 SER SER A . n 
A 1 223 ILE 223 253 253 ILE ILE A . n 
A 1 224 CYS 224 254 254 CYS CYS A . n 
A 1 225 ASN 225 255 255 ASN ASN A . n 
A 1 226 ASN 226 256 256 ASN ASN A . n 
A 1 227 LYS 227 257 257 LYS LYS A . n 
A 1 228 TRP 228 258 258 TRP TRP A . n 
A 1 229 PHE 229 259 259 PHE PHE A . n 
A 1 230 THR 230 260 260 THR THR A . n 
A 1 231 ASP 231 261 261 ASP ASP A . n 
A 1 232 THR 232 262 262 THR THR A . n 
A 1 233 SER 233 263 263 SER SER A . n 
A 1 234 ILE 234 264 264 ILE ILE A . n 
A 1 235 ILE 235 265 265 ILE ILE A . n 
A 1 236 LEU 236 266 266 LEU LEU A . n 
A 1 237 PHE 237 267 267 PHE PHE A . n 
A 1 238 LEU 238 268 268 LEU LEU A . n 
A 1 239 ASN 239 269 269 ASN ASN A . n 
A 1 240 LYS 240 270 270 LYS LYS A . n 
A 1 241 LYS 241 271 271 LYS LYS A . n 
A 1 242 ASP 242 272 272 ASP ASP A . n 
A 1 243 LEU 243 273 273 LEU LEU A . n 
A 1 244 PHE 244 274 274 PHE PHE A . n 
A 1 245 GLU 245 275 275 GLU GLU A . n 
A 1 246 GLU 246 276 276 GLU GLU A . n 
A 1 247 LYS 247 277 277 LYS LYS A . n 
A 1 248 ILE 248 278 278 ILE ILE A . n 
A 1 249 LYS 249 279 279 LYS LYS A . n 
A 1 250 LYS 250 280 280 LYS LYS A . n 
A 1 251 SER 251 281 281 SER SER A . n 
A 1 252 PRO 252 282 282 PRO PRO A . n 
A 1 253 LEU 253 283 283 LEU LEU A . n 
A 1 254 THR 254 284 284 THR THR A . n 
A 1 255 ILE 255 285 285 ILE ILE A . n 
A 1 256 CYS 256 286 286 CYS CYS A . n 
A 1 257 TYR 257 287 287 TYR TYR A . n 
A 1 258 PRO 258 288 288 PRO PRO A . n 
A 1 259 GLU 259 289 289 GLU GLU A . n 
A 1 260 TYR 260 290 290 TYR TYR A . n 
A 1 261 ALA 261 291 291 ALA ALA A . n 
A 1 262 GLY 262 292 292 GLY GLY A . n 
A 1 263 SER 263 293 293 SER SER A . n 
A 1 264 ASN 264 294 294 ASN ASN A . n 
A 1 265 THR 265 295 295 THR THR A . n 
A 1 266 TYR 266 296 296 TYR TYR A . n 
A 1 267 GLU 267 297 297 GLU GLU A . n 
A 1 268 GLU 268 298 298 GLU GLU A . n 
A 1 269 ALA 269 299 299 ALA ALA A . n 
A 1 270 ALA 270 300 300 ALA ALA A . n 
A 1 271 ALA 271 301 301 ALA ALA A . n 
A 1 272 TYR 272 302 302 TYR TYR A . n 
A 1 273 ILE 273 303 303 ILE ILE A . n 
A 1 274 GLN 274 304 304 GLN GLN A . n 
A 1 275 CYS 275 305 305 CYS CYS A . n 
A 1 276 GLN 276 306 306 GLN GLN A . n 
A 1 277 PHE 277 307 307 PHE PHE A . n 
A 1 278 GLU 278 308 308 GLU GLU A . n 
A 1 279 ASP 279 309 309 ASP ASP A . n 
A 1 280 LEU 280 310 310 LEU LEU A . n 
A 1 281 ASN 281 311 311 ASN ASN A . n 
A 1 282 LYS 282 312 312 LYS LYS A . n 
A 1 283 ARG 283 313 313 ARG ARG A . n 
A 1 284 LYS 284 314 314 LYS LYS A . n 
A 1 285 ASP 285 315 315 ASP ASP A . n 
A 1 286 THR 286 316 316 THR THR A . n 
A 1 287 LYS 287 317 317 LYS LYS A . n 
A 1 288 GLU 288 318 318 GLU GLU A . n 
A 1 289 ILE 289 319 319 ILE ILE A . n 
A 1 290 TYR 290 320 320 TYR TYR A . n 
A 1 291 THR 291 321 321 THR THR A . n 
A 1 292 HIS 292 322 322 HIS HIS A . n 
A 1 293 PHE 293 323 323 PHE PHE A . n 
A 1 294 THR 294 324 324 THR THR A . n 
A 1 295 CYS 295 325 325 CYS CYS A . n 
A 1 296 ALA 296 326 326 ALA ALA A . n 
A 1 297 THR 297 327 327 THR THR A . n 
A 1 298 ASP 298 328 328 ASP ASP A . n 
A 1 299 THR 299 329 329 THR THR A . n 
A 1 300 LYS 300 330 330 LYS LYS A . n 
A 1 301 ASN 301 331 331 ASN ASN A . n 
A 1 302 VAL 302 332 332 VAL VAL A . n 
A 1 303 GLN 303 333 333 GLN GLN A . n 
A 1 304 PHE 304 334 334 PHE PHE A . n 
A 1 305 VAL 305 335 335 VAL VAL A . n 
A 1 306 PHE 306 336 336 PHE PHE A . n 
A 1 307 ASP 307 337 337 ASP ASP A . n 
A 1 308 ALA 308 338 338 ALA ALA A . n 
A 1 309 VAL 309 339 339 VAL VAL A . n 
A 1 310 THR 310 340 340 THR THR A . n 
A 1 311 ASP 311 341 341 ASP ASP A . n 
A 1 312 VAL 312 342 342 VAL VAL A . n 
A 1 313 ILE 313 343 343 ILE ILE A . n 
A 1 314 ILE 314 344 344 ILE ILE A . n 
A 1 315 LYS 315 345 345 LYS LYS A . n 
A 1 316 ASN 316 346 346 ASN ASN A . n 
A 1 317 ASN 317 347 347 ASN ASN A . n 
A 1 318 LEU 318 348 348 LEU LEU A . n 
A 1 319 LYS 319 349 ?   ?   ?   A . n 
A 1 320 ASP 320 350 ?   ?   ?   A . n 
A 1 321 CYS 321 351 ?   ?   ?   A . n 
A 1 322 GLY 322 352 ?   ?   ?   A . n 
A 1 323 LEU 323 353 ?   ?   ?   A . n 
A 1 324 PHE 324 354 ?   ?   ?   A . n 
B 2 1   SER 1   51  ?   ?   ?   B . n 
B 2 2   MET 2   52  ?   ?   ?   B . n 
B 2 3   ARG 3   53  ?   ?   ?   B . n 
B 2 4   ASN 4   54  ?   ?   ?   B . n 
B 2 5   PHE 5   55  ?   ?   ?   B . n 
B 2 6   SER 6   56  ?   ?   ?   B . n 
B 2 7   GLU 7   57  ?   ?   ?   B . n 
B 2 8   ASP 8   58  ?   ?   ?   B . n 
B 2 9   VAL 9   59  ?   ?   ?   B . n 
B 2 10  LEU 10  60  ?   ?   ?   B . n 
B 2 11  GLY 11  61  ?   ?   ?   B . n 
B 2 12  TRP 12  62  ?   ?   ?   B . n 
B 2 13  ARG 13  63  ?   ?   ?   B . n 
B 2 14  GLU 14  64  ?   ?   ?   B . n 
B 2 15  SER 15  65  65  SER SER B . n 
B 2 16  PHE 16  66  66  PHE PHE B . n 
B 2 17  ASP 17  67  67  ASP ASP B . n 
B 2 18  LEU 18  68  68  LEU LEU B . n 
B 2 19  LEU 19  69  69  LEU LEU B . n 
B 2 20  LEU 20  70  70  LEU LEU B . n 
B 2 21  SER 21  71  71  SER SER B . n 
B 2 22  SER 22  72  72  SER SER B . n 
B 2 23  LYS 23  73  73  LYS LYS B . n 
B 2 24  ASN 24  74  74  ASN ASN B . n 
B 2 25  GLY 25  75  75  GLY GLY B . n 
B 2 26  VAL 26  76  76  VAL VAL B . n 
B 2 27  ALA 27  77  77  ALA ALA B . n 
B 2 28  ALA 28  78  78  ALA ALA B . n 
B 2 29  PHE 29  79  79  PHE PHE B . n 
B 2 30  HIS 30  80  80  HIS HIS B . n 
B 2 31  ALA 31  81  81  ALA ALA B . n 
B 2 32  PHE 32  82  82  PHE PHE B . n 
B 2 33  LEU 33  83  83  LEU LEU B . n 
B 2 34  LYS 34  84  84  LYS LYS B . n 
B 2 35  THR 35  85  85  THR THR B . n 
B 2 36  GLU 36  86  86  GLU GLU B . n 
B 2 37  PHE 37  87  87  PHE PHE B . n 
B 2 38  SER 38  88  88  SER SER B . n 
B 2 39  GLU 39  89  89  GLU GLU B . n 
B 2 40  GLU 40  90  90  GLU GLU B . n 
B 2 41  ASN 41  91  91  ASN ASN B . n 
B 2 42  LEU 42  92  92  LEU LEU B . n 
B 2 43  GLU 43  93  93  GLU GLU B . n 
B 2 44  PHE 44  94  94  PHE PHE B . n 
B 2 45  TRP 45  95  95  TRP TRP B . n 
B 2 46  LEU 46  96  96  LEU LEU B . n 
B 2 47  ALA 47  97  97  ALA ALA B . n 
B 2 48  CYS 48  98  98  CYS CYS B . n 
B 2 49  GLU 49  99  99  GLU GLU B . n 
B 2 50  GLU 50  100 100 GLU GLU B . n 
B 2 51  PHE 51  101 101 PHE PHE B . n 
B 2 52  LYS 52  102 102 LYS LYS B . n 
B 2 53  LYS 53  103 103 LYS LYS B . n 
B 2 54  ILE 54  104 104 ILE ILE B . n 
B 2 55  ARG 55  105 105 ARG ARG B . n 
B 2 56  SER 56  106 106 SER SER B . n 
B 2 57  ALA 57  107 107 ALA ALA B . n 
B 2 58  THR 58  108 108 THR THR B . n 
B 2 59  LYS 59  109 109 LYS LYS B . n 
B 2 60  LEU 60  110 110 LEU LEU B . n 
B 2 61  ALA 61  111 111 ALA ALA B . n 
B 2 62  SER 62  112 112 SER SER B . n 
B 2 63  ARG 63  113 113 ARG ARG B . n 
B 2 64  ALA 64  114 114 ALA ALA B . n 
B 2 65  HIS 65  115 115 HIS HIS B . n 
B 2 66  GLN 66  116 116 GLN GLN B . n 
B 2 67  ILE 67  117 117 ILE ILE B . n 
B 2 68  PHE 68  118 118 PHE PHE B . n 
B 2 69  GLU 69  119 119 GLU GLU B . n 
B 2 70  GLU 70  120 120 GLU GLU B . n 
B 2 71  PHE 71  121 121 PHE PHE B . n 
B 2 72  ILE 72  122 122 ILE ILE B . n 
B 2 73  CYS 73  123 123 CYS CYS B . n 
B 2 74  SER 74  124 124 SER SER B . n 
B 2 75  GLU 75  125 125 GLU GLU B . n 
B 2 76  ALA 76  126 126 ALA ALA B . n 
B 2 77  PRO 77  127 127 PRO PRO B . n 
B 2 78  LYS 78  128 128 LYS LYS B . n 
B 2 79  GLU 79  129 129 GLU GLU B . n 
B 2 80  VAL 80  130 130 VAL VAL B . n 
B 2 81  ASN 81  131 131 ASN ASN B . n 
B 2 82  ILE 82  132 132 ILE ILE B . n 
B 2 83  ASP 83  133 133 ASP ASP B . n 
B 2 84  HIS 84  134 134 HIS HIS B . n 
B 2 85  GLU 85  135 135 GLU GLU B . n 
B 2 86  THR 86  136 136 THR THR B . n 
B 2 87  ARG 87  137 137 ARG ARG B . n 
B 2 88  GLU 88  138 138 GLU GLU B . n 
B 2 89  LEU 89  139 139 LEU LEU B . n 
B 2 90  THR 90  140 140 THR THR B . n 
B 2 91  ARG 91  141 141 ARG ARG B . n 
B 2 92  MET 92  142 142 MET MET B . n 
B 2 93  ASN 93  143 143 ASN ASN B . n 
B 2 94  LEU 94  144 144 LEU LEU B . n 
B 2 95  GLN 95  145 145 GLN GLN B . n 
B 2 96  THR 96  146 146 THR THR B . n 
B 2 97  ALA 97  147 147 ALA ALA B . n 
B 2 98  THR 98  148 148 THR THR B . n 
B 2 99  ALA 99  149 149 ALA ALA B . n 
B 2 100 THR 100 150 150 THR THR B . n 
B 2 101 CYS 101 151 151 CYS CYS B . n 
B 2 102 PHE 102 152 152 PHE PHE B . n 
B 2 103 ASP 103 153 153 ASP ASP B . n 
B 2 104 ALA 104 154 154 ALA ALA B . n 
B 2 105 ALA 105 155 155 ALA ALA B . n 
B 2 106 GLN 106 156 156 GLN GLN B . n 
B 2 107 GLY 107 157 157 GLY GLY B . n 
B 2 108 LYS 108 158 158 LYS LYS B . n 
B 2 109 THR 109 159 159 THR THR B . n 
B 2 110 ARG 110 160 160 ARG ARG B . n 
B 2 111 THR 111 161 161 THR THR B . n 
B 2 112 LEU 112 162 162 LEU LEU B . n 
B 2 113 MET 113 163 163 MET MET B . n 
B 2 114 GLU 114 164 164 GLU GLU B . n 
B 2 115 LYS 115 165 165 LYS LYS B . n 
B 2 116 ASP 116 166 166 ASP ASP B . n 
B 2 117 SER 117 167 167 SER SER B . n 
B 2 118 TYR 118 168 168 TYR TYR B . n 
B 2 119 PRO 119 169 169 PRO PRO B . n 
B 2 120 ARG 120 170 170 ARG ARG B . n 
B 2 121 PHE 121 171 171 PHE PHE B . n 
B 2 122 LEU 122 172 172 LEU LEU B . n 
B 2 123 LYS 123 173 173 LYS LYS B . n 
B 2 124 SER 124 174 174 SER SER B . n 
B 2 125 PRO 125 175 175 PRO PRO B . n 
B 2 126 ALA 126 176 176 ALA ALA B . n 
B 2 127 TYR 127 177 177 TYR TYR B . n 
B 2 128 ARG 128 178 178 ARG ARG B . n 
B 2 129 ASP 129 179 179 ASP ASP B . n 
B 2 130 LEU 130 180 180 LEU LEU B . n 
B 2 131 ALA 131 181 181 ALA ALA B . n 
B 2 132 ALA 132 182 182 ALA ALA B . n 
B 2 133 GLN 133 183 183 GLN GLN B . n 
B 2 134 ALA 134 184 184 ALA ALA B . n 
B 2 135 SER 135 185 ?   ?   ?   B . n 
B 2 136 ALA 136 186 ?   ?   ?   B . n 
B 2 137 ALA 137 187 ?   ?   ?   B . n 
B 2 138 SER 138 188 ?   ?   ?   B . n 
B 2 139 ALA 139 189 ?   ?   ?   B . n 
B 2 140 THR 140 190 ?   ?   ?   B . n 
C 1 1   ALA 1   31  ?   ?   ?   C . n 
C 1 2   ARG 2   32  ?   ?   ?   C . n 
C 1 3   GLU 3   33  33  GLU GLU C . n 
C 1 4   VAL 4   34  34  VAL VAL C . n 
C 1 5   LYS 5   35  35  LYS LYS C . n 
C 1 6   LEU 6   36  36  LEU LEU C . n 
C 1 7   LEU 7   37  37  LEU LEU C . n 
C 1 8   LEU 8   38  38  LEU LEU C . n 
C 1 9   LEU 9   39  39  LEU LEU C . n 
C 1 10  GLY 10  40  40  GLY GLY C . n 
C 1 11  ALA 11  41  41  ALA ALA C . n 
C 1 12  GLY 12  42  42  GLY GLY C . n 
C 1 13  GLU 13  43  43  GLU GLU C . n 
C 1 14  SER 14  44  44  SER SER C . n 
C 1 15  GLY 15  45  45  GLY GLY C . n 
C 1 16  LYS 16  46  46  LYS LYS C . n 
C 1 17  SER 17  47  47  SER SER C . n 
C 1 18  THR 18  48  48  THR THR C . n 
C 1 19  ILE 19  49  49  ILE ILE C . n 
C 1 20  VAL 20  50  50  VAL VAL C . n 
C 1 21  LYS 21  51  51  LYS LYS C . n 
C 1 22  GLN 22  52  52  GLN GLN C . n 
C 1 23  MET 23  53  53  MET MET C . n 
C 1 24  LYS 24  54  54  LYS LYS C . n 
C 1 25  ILE 25  55  55  ILE ILE C . n 
C 1 26  ILE 26  56  56  ILE ILE C . n 
C 1 27  HIS 27  57  57  HIS HIS C . n 
C 1 28  GLU 28  58  58  GLU GLU C . n 
C 1 29  ALA 29  59  59  ALA ALA C . n 
C 1 30  GLY 30  60  60  GLY GLY C . n 
C 1 31  TYR 31  61  61  TYR TYR C . n 
C 1 32  SER 32  62  62  SER SER C . n 
C 1 33  GLU 33  63  63  GLU GLU C . n 
C 1 34  GLU 34  64  64  GLU GLU C . n 
C 1 35  GLU 35  65  65  GLU GLU C . n 
C 1 36  CYS 36  66  66  CYS CYS C . n 
C 1 37  LYS 37  67  67  LYS LYS C . n 
C 1 38  GLN 38  68  68  GLN GLN C . n 
C 1 39  TYR 39  69  69  TYR TYR C . n 
C 1 40  LYS 40  70  70  LYS LYS C . n 
C 1 41  ALA 41  71  71  ALA ALA C . n 
C 1 42  VAL 42  72  72  VAL VAL C . n 
C 1 43  VAL 43  73  73  VAL VAL C . n 
C 1 44  TYR 44  74  74  TYR TYR C . n 
C 1 45  SER 45  75  75  SER SER C . n 
C 1 46  ASN 46  76  76  ASN ASN C . n 
C 1 47  THR 47  77  77  THR THR C . n 
C 1 48  ILE 48  78  78  ILE ILE C . n 
C 1 49  GLN 49  79  79  GLN GLN C . n 
C 1 50  SER 50  80  80  SER SER C . n 
C 1 51  ILE 51  81  81  ILE ILE C . n 
C 1 52  ILE 52  82  82  ILE ILE C . n 
C 1 53  ALA 53  83  83  ALA ALA C . n 
C 1 54  ILE 54  84  84  ILE ILE C . n 
C 1 55  ILE 55  85  85  ILE ILE C . n 
C 1 56  ARG 56  86  86  ARG ARG C . n 
C 1 57  ALA 57  87  87  ALA ALA C . n 
C 1 58  MET 58  88  88  MET MET C . n 
C 1 59  GLY 59  89  89  GLY GLY C . n 
C 1 60  ARG 60  90  90  ARG ARG C . n 
C 1 61  LEU 61  91  91  LEU LEU C . n 
C 1 62  LYS 62  92  92  LYS LYS C . n 
C 1 63  ILE 63  93  93  ILE ILE C . n 
C 1 64  ASP 64  94  94  ASP ASP C . n 
C 1 65  PHE 65  95  95  PHE PHE C . n 
C 1 66  GLY 66  96  96  GLY GLY C . n 
C 1 67  ASP 67  97  97  ASP ASP C . n 
C 1 68  SER 68  98  98  SER SER C . n 
C 1 69  ALA 69  99  99  ALA ALA C . n 
C 1 70  ARG 70  100 100 ARG ARG C . n 
C 1 71  ALA 71  101 101 ALA ALA C . n 
C 1 72  ASP 72  102 102 ASP ASP C . n 
C 1 73  ASP 73  103 103 ASP ASP C . n 
C 1 74  ALA 74  104 104 ALA ALA C . n 
C 1 75  ARG 75  105 105 ARG ARG C . n 
C 1 76  GLN 76  106 106 GLN GLN C . n 
C 1 77  LEU 77  107 107 LEU LEU C . n 
C 1 78  PHE 78  108 108 PHE PHE C . n 
C 1 79  VAL 79  109 109 VAL VAL C . n 
C 1 80  LEU 80  110 110 LEU LEU C . n 
C 1 81  ALA 81  111 111 ALA ALA C . n 
C 1 82  GLY 82  112 ?   ?   ?   C . n 
C 1 83  ALA 83  113 ?   ?   ?   C . n 
C 1 84  ALA 84  114 ?   ?   ?   C . n 
C 1 85  GLU 85  115 ?   ?   ?   C . n 
C 1 86  GLU 86  116 ?   ?   ?   C . n 
C 1 87  GLY 87  117 ?   ?   ?   C . n 
C 1 88  PHE 88  118 ?   ?   ?   C . n 
C 1 89  MET 89  119 119 MET MET C . n 
C 1 90  THR 90  120 120 THR THR C . n 
C 1 91  ALA 91  121 121 ALA ALA C . n 
C 1 92  GLU 92  122 122 GLU GLU C . n 
C 1 93  LEU 93  123 123 LEU LEU C . n 
C 1 94  ALA 94  124 124 ALA ALA C . n 
C 1 95  GLY 95  125 125 GLY GLY C . n 
C 1 96  VAL 96  126 126 VAL VAL C . n 
C 1 97  ILE 97  127 127 ILE ILE C . n 
C 1 98  LYS 98  128 128 LYS LYS C . n 
C 1 99  ARG 99  129 129 ARG ARG C . n 
C 1 100 LEU 100 130 130 LEU LEU C . n 
C 1 101 TRP 101 131 131 TRP TRP C . n 
C 1 102 LYS 102 132 132 LYS LYS C . n 
C 1 103 ASP 103 133 133 ASP ASP C . n 
C 1 104 SER 104 134 134 SER SER C . n 
C 1 105 GLY 105 135 135 GLY GLY C . n 
C 1 106 VAL 106 136 136 VAL VAL C . n 
C 1 107 GLN 107 137 137 GLN GLN C . n 
C 1 108 ALA 108 138 138 ALA ALA C . n 
C 1 109 CYS 109 139 139 CYS CYS C . n 
C 1 110 PHE 110 140 140 PHE PHE C . n 
C 1 111 ASN 111 141 141 ASN ASN C . n 
C 1 112 ARG 112 142 142 ARG ARG C . n 
C 1 113 SER 113 143 143 SER SER C . n 
C 1 114 ARG 114 144 144 ARG ARG C . n 
C 1 115 GLU 115 145 145 GLU GLU C . n 
C 1 116 TYR 116 146 146 TYR TYR C . n 
C 1 117 GLN 117 147 147 GLN GLN C . n 
C 1 118 LEU 118 148 148 LEU LEU C . n 
C 1 119 ASN 119 149 149 ASN ASN C . n 
C 1 120 ASP 120 150 150 ASP ASP C . n 
C 1 121 SER 121 151 151 SER SER C . n 
C 1 122 ALA 122 152 152 ALA ALA C . n 
C 1 123 ALA 123 153 153 ALA ALA C . n 
C 1 124 TYR 124 154 154 TYR TYR C . n 
C 1 125 TYR 125 155 155 TYR TYR C . n 
C 1 126 LEU 126 156 156 LEU LEU C . n 
C 1 127 ASN 127 157 157 ASN ASN C . n 
C 1 128 ASP 128 158 158 ASP ASP C . n 
C 1 129 LEU 129 159 159 LEU LEU C . n 
C 1 130 ASP 130 160 160 ASP ASP C . n 
C 1 131 ARG 131 161 161 ARG ARG C . n 
C 1 132 ILE 132 162 162 ILE ILE C . n 
C 1 133 ALA 133 163 163 ALA ALA C . n 
C 1 134 GLN 134 164 164 GLN GLN C . n 
C 1 135 PRO 135 165 165 PRO PRO C . n 
C 1 136 ASN 136 166 166 ASN ASN C . n 
C 1 137 TYR 137 167 167 TYR TYR C . n 
C 1 138 ILE 138 168 168 ILE ILE C . n 
C 1 139 PRO 139 169 169 PRO PRO C . n 
C 1 140 THR 140 170 170 THR THR C . n 
C 1 141 GLN 141 171 171 GLN GLN C . n 
C 1 142 GLN 142 172 172 GLN GLN C . n 
C 1 143 ASP 143 173 173 ASP ASP C . n 
C 1 144 VAL 144 174 174 VAL VAL C . n 
C 1 145 LEU 145 175 175 LEU LEU C . n 
C 1 146 ARG 146 176 176 ARG ARG C . n 
C 1 147 THR 147 177 177 THR THR C . n 
C 1 148 ARG 148 178 178 ARG ARG C . n 
C 1 149 VAL 149 179 179 VAL VAL C . n 
C 1 150 LYS 150 180 180 LYS LYS C . n 
C 1 151 THR 151 181 181 THR THR C . n 
C 1 152 THR 152 182 182 THR THR C . n 
C 1 153 GLY 153 183 183 GLY GLY C . n 
C 1 154 ILE 154 184 184 ILE ILE C . n 
C 1 155 VAL 155 185 185 VAL VAL C . n 
C 1 156 GLU 156 186 186 GLU GLU C . n 
C 1 157 THR 157 187 187 THR THR C . n 
C 1 158 HIS 158 188 188 HIS HIS C . n 
C 1 159 PHE 159 189 189 PHE PHE C . n 
C 1 160 THR 160 190 190 THR THR C . n 
C 1 161 PHE 161 191 191 PHE PHE C . n 
C 1 162 LYS 162 192 192 LYS LYS C . n 
C 1 163 ASP 163 193 193 ASP ASP C . n 
C 1 164 LEU 164 194 194 LEU LEU C . n 
C 1 165 HIS 165 195 195 HIS HIS C . n 
C 1 166 PHE 166 196 196 PHE PHE C . n 
C 1 167 LYS 167 197 197 LYS LYS C . n 
C 1 168 MET 168 198 198 MET MET C . n 
C 1 169 PHE 169 199 199 PHE PHE C . n 
C 1 170 ASP 170 200 200 ASP ASP C . n 
C 1 171 VAL 171 201 201 VAL VAL C . n 
C 1 172 GLY 172 202 202 GLY GLY C . n 
C 1 173 GLY 173 203 203 GLY GLY C . n 
C 1 174 GLN 174 204 204 GLN GLN C . n 
C 1 175 ARG 175 205 205 ARG ARG C . n 
C 1 176 SER 176 206 206 SER SER C . n 
C 1 177 GLU 177 207 207 GLU GLU C . n 
C 1 178 ARG 178 208 208 ARG ARG C . n 
C 1 179 LYS 179 209 209 LYS LYS C . n 
C 1 180 LYS 180 210 210 LYS LYS C . n 
C 1 181 TRP 181 211 211 TRP TRP C . n 
C 1 182 ILE 182 212 212 ILE ILE C . n 
C 1 183 HIS 183 213 213 HIS HIS C . n 
C 1 184 CYS 184 214 214 CYS CYS C . n 
C 1 185 PHE 185 215 215 PHE PHE C . n 
C 1 186 GLU 186 216 216 GLU GLU C . n 
C 1 187 GLY 187 217 217 GLY GLY C . n 
C 1 188 VAL 188 218 218 VAL VAL C . n 
C 1 189 THR 189 219 219 THR THR C . n 
C 1 190 ALA 190 220 220 ALA ALA C . n 
C 1 191 ILE 191 221 221 ILE ILE C . n 
C 1 192 ILE 192 222 222 ILE ILE C . n 
C 1 193 PHE 193 223 223 PHE PHE C . n 
C 1 194 CYS 194 224 224 CYS CYS C . n 
C 1 195 VAL 195 225 225 VAL VAL C . n 
C 1 196 ALA 196 226 226 ALA ALA C . n 
C 1 197 LEU 197 227 227 LEU LEU C . n 
C 1 198 SER 198 228 228 SER SER C . n 
C 1 199 ASP 199 229 229 ASP ASP C . n 
C 1 200 TYR 200 230 230 TYR TYR C . n 
C 1 201 ASP 201 231 231 ASP ASP C . n 
C 1 202 LEU 202 232 232 LEU LEU C . n 
C 1 203 VAL 203 233 233 VAL VAL C . n 
C 1 204 LEU 204 234 234 LEU LEU C . n 
C 1 205 ALA 205 235 235 ALA ALA C . n 
C 1 206 GLU 206 236 236 GLU GLU C . n 
C 1 207 ASP 207 237 237 ASP ASP C . n 
C 1 208 GLU 208 238 238 GLU GLU C . n 
C 1 209 GLU 209 239 239 GLU GLU C . n 
C 1 210 MET 210 240 240 MET MET C . n 
C 1 211 ASN 211 241 241 ASN ASN C . n 
C 1 212 ARG 212 242 242 ARG ARG C . n 
C 1 213 MET 213 243 243 MET MET C . n 
C 1 214 HIS 214 244 244 HIS HIS C . n 
C 1 215 GLU 215 245 245 GLU GLU C . n 
C 1 216 SER 216 246 246 SER SER C . n 
C 1 217 MET 217 247 247 MET MET C . n 
C 1 218 LYS 218 248 248 LYS LYS C . n 
C 1 219 LEU 219 249 249 LEU LEU C . n 
C 1 220 PHE 220 250 250 PHE PHE C . n 
C 1 221 ASP 221 251 251 ASP ASP C . n 
C 1 222 SER 222 252 252 SER SER C . n 
C 1 223 ILE 223 253 253 ILE ILE C . n 
C 1 224 CYS 224 254 254 CYS CYS C . n 
C 1 225 ASN 225 255 255 ASN ASN C . n 
C 1 226 ASN 226 256 256 ASN ASN C . n 
C 1 227 LYS 227 257 257 LYS LYS C . n 
C 1 228 TRP 228 258 258 TRP TRP C . n 
C 1 229 PHE 229 259 259 PHE PHE C . n 
C 1 230 THR 230 260 260 THR THR C . n 
C 1 231 ASP 231 261 261 ASP ASP C . n 
C 1 232 THR 232 262 262 THR THR C . n 
C 1 233 SER 233 263 263 SER SER C . n 
C 1 234 ILE 234 264 264 ILE ILE C . n 
C 1 235 ILE 235 265 265 ILE ILE C . n 
C 1 236 LEU 236 266 266 LEU LEU C . n 
C 1 237 PHE 237 267 267 PHE PHE C . n 
C 1 238 LEU 238 268 268 LEU LEU C . n 
C 1 239 ASN 239 269 269 ASN ASN C . n 
C 1 240 LYS 240 270 270 LYS LYS C . n 
C 1 241 LYS 241 271 271 LYS LYS C . n 
C 1 242 ASP 242 272 272 ASP ASP C . n 
C 1 243 LEU 243 273 273 LEU LEU C . n 
C 1 244 PHE 244 274 274 PHE PHE C . n 
C 1 245 GLU 245 275 275 GLU GLU C . n 
C 1 246 GLU 246 276 276 GLU GLU C . n 
C 1 247 LYS 247 277 277 LYS LYS C . n 
C 1 248 ILE 248 278 278 ILE ILE C . n 
C 1 249 LYS 249 279 279 LYS LYS C . n 
C 1 250 LYS 250 280 280 LYS LYS C . n 
C 1 251 SER 251 281 281 SER SER C . n 
C 1 252 PRO 252 282 282 PRO PRO C . n 
C 1 253 LEU 253 283 283 LEU LEU C . n 
C 1 254 THR 254 284 284 THR THR C . n 
C 1 255 ILE 255 285 285 ILE ILE C . n 
C 1 256 CYS 256 286 286 CYS CYS C . n 
C 1 257 TYR 257 287 287 TYR TYR C . n 
C 1 258 PRO 258 288 288 PRO PRO C . n 
C 1 259 GLU 259 289 289 GLU GLU C . n 
C 1 260 TYR 260 290 290 TYR TYR C . n 
C 1 261 ALA 261 291 291 ALA ALA C . n 
C 1 262 GLY 262 292 292 GLY GLY C . n 
C 1 263 SER 263 293 293 SER SER C . n 
C 1 264 ASN 264 294 294 ASN ASN C . n 
C 1 265 THR 265 295 295 THR THR C . n 
C 1 266 TYR 266 296 296 TYR TYR C . n 
C 1 267 GLU 267 297 297 GLU GLU C . n 
C 1 268 GLU 268 298 298 GLU GLU C . n 
C 1 269 ALA 269 299 299 ALA ALA C . n 
C 1 270 ALA 270 300 300 ALA ALA C . n 
C 1 271 ALA 271 301 301 ALA ALA C . n 
C 1 272 TYR 272 302 302 TYR TYR C . n 
C 1 273 ILE 273 303 303 ILE ILE C . n 
C 1 274 GLN 274 304 304 GLN GLN C . n 
C 1 275 CYS 275 305 305 CYS CYS C . n 
C 1 276 GLN 276 306 306 GLN GLN C . n 
C 1 277 PHE 277 307 307 PHE PHE C . n 
C 1 278 GLU 278 308 308 GLU GLU C . n 
C 1 279 ASP 279 309 309 ASP ASP C . n 
C 1 280 LEU 280 310 310 LEU LEU C . n 
C 1 281 ASN 281 311 311 ASN ASN C . n 
C 1 282 LYS 282 312 312 LYS LYS C . n 
C 1 283 ARG 283 313 313 ARG ARG C . n 
C 1 284 LYS 284 314 314 LYS LYS C . n 
C 1 285 ASP 285 315 315 ASP ASP C . n 
C 1 286 THR 286 316 316 THR THR C . n 
C 1 287 LYS 287 317 317 LYS LYS C . n 
C 1 288 GLU 288 318 318 GLU GLU C . n 
C 1 289 ILE 289 319 319 ILE ILE C . n 
C 1 290 TYR 290 320 320 TYR TYR C . n 
C 1 291 THR 291 321 321 THR THR C . n 
C 1 292 HIS 292 322 322 HIS HIS C . n 
C 1 293 PHE 293 323 323 PHE PHE C . n 
C 1 294 THR 294 324 324 THR THR C . n 
C 1 295 CYS 295 325 325 CYS CYS C . n 
C 1 296 ALA 296 326 326 ALA ALA C . n 
C 1 297 THR 297 327 327 THR THR C . n 
C 1 298 ASP 298 328 328 ASP ASP C . n 
C 1 299 THR 299 329 329 THR THR C . n 
C 1 300 LYS 300 330 330 LYS LYS C . n 
C 1 301 ASN 301 331 331 ASN ASN C . n 
C 1 302 VAL 302 332 332 VAL VAL C . n 
C 1 303 GLN 303 333 333 GLN GLN C . n 
C 1 304 PHE 304 334 334 PHE PHE C . n 
C 1 305 VAL 305 335 335 VAL VAL C . n 
C 1 306 PHE 306 336 336 PHE PHE C . n 
C 1 307 ASP 307 337 337 ASP ASP C . n 
C 1 308 ALA 308 338 338 ALA ALA C . n 
C 1 309 VAL 309 339 339 VAL VAL C . n 
C 1 310 THR 310 340 340 THR THR C . n 
C 1 311 ASP 311 341 341 ASP ASP C . n 
C 1 312 VAL 312 342 342 VAL VAL C . n 
C 1 313 ILE 313 343 343 ILE ILE C . n 
C 1 314 ILE 314 344 344 ILE ILE C . n 
C 1 315 LYS 315 345 345 LYS LYS C . n 
C 1 316 ASN 316 346 346 ASN ASN C . n 
C 1 317 ASN 317 347 347 ASN ASN C . n 
C 1 318 LEU 318 348 348 LEU LEU C . n 
C 1 319 LYS 319 349 ?   ?   ?   C . n 
C 1 320 ASP 320 350 ?   ?   ?   C . n 
C 1 321 CYS 321 351 ?   ?   ?   C . n 
C 1 322 GLY 322 352 ?   ?   ?   C . n 
C 1 323 LEU 323 353 ?   ?   ?   C . n 
C 1 324 PHE 324 354 ?   ?   ?   C . n 
D 2 1   SER 1   51  ?   ?   ?   D . n 
D 2 2   MET 2   52  ?   ?   ?   D . n 
D 2 3   ARG 3   53  ?   ?   ?   D . n 
D 2 4   ASN 4   54  ?   ?   ?   D . n 
D 2 5   PHE 5   55  55  PHE PHE D . n 
D 2 6   SER 6   56  56  SER SER D . n 
D 2 7   GLU 7   57  57  GLU GLU D . n 
D 2 8   ASP 8   58  58  ASP ASP D . n 
D 2 9   VAL 9   59  59  VAL VAL D . n 
D 2 10  LEU 10  60  60  LEU LEU D . n 
D 2 11  GLY 11  61  61  GLY GLY D . n 
D 2 12  TRP 12  62  62  TRP TRP D . n 
D 2 13  ARG 13  63  63  ARG ARG D . n 
D 2 14  GLU 14  64  64  GLU GLU D . n 
D 2 15  SER 15  65  65  SER SER D . n 
D 2 16  PHE 16  66  66  PHE PHE D . n 
D 2 17  ASP 17  67  67  ASP ASP D . n 
D 2 18  LEU 18  68  68  LEU LEU D . n 
D 2 19  LEU 19  69  69  LEU LEU D . n 
D 2 20  LEU 20  70  70  LEU LEU D . n 
D 2 21  SER 21  71  71  SER SER D . n 
D 2 22  SER 22  72  72  SER SER D . n 
D 2 23  LYS 23  73  73  LYS LYS D . n 
D 2 24  ASN 24  74  74  ASN ASN D . n 
D 2 25  GLY 25  75  75  GLY GLY D . n 
D 2 26  VAL 26  76  76  VAL VAL D . n 
D 2 27  ALA 27  77  77  ALA ALA D . n 
D 2 28  ALA 28  78  78  ALA ALA D . n 
D 2 29  PHE 29  79  79  PHE PHE D . n 
D 2 30  HIS 30  80  80  HIS HIS D . n 
D 2 31  ALA 31  81  81  ALA ALA D . n 
D 2 32  PHE 32  82  82  PHE PHE D . n 
D 2 33  LEU 33  83  83  LEU LEU D . n 
D 2 34  LYS 34  84  84  LYS LYS D . n 
D 2 35  THR 35  85  85  THR THR D . n 
D 2 36  GLU 36  86  86  GLU GLU D . n 
D 2 37  PHE 37  87  87  PHE PHE D . n 
D 2 38  SER 38  88  88  SER SER D . n 
D 2 39  GLU 39  89  89  GLU GLU D . n 
D 2 40  GLU 40  90  90  GLU GLU D . n 
D 2 41  ASN 41  91  91  ASN ASN D . n 
D 2 42  LEU 42  92  92  LEU LEU D . n 
D 2 43  GLU 43  93  93  GLU GLU D . n 
D 2 44  PHE 44  94  94  PHE PHE D . n 
D 2 45  TRP 45  95  95  TRP TRP D . n 
D 2 46  LEU 46  96  96  LEU LEU D . n 
D 2 47  ALA 47  97  97  ALA ALA D . n 
D 2 48  CYS 48  98  98  CYS CYS D . n 
D 2 49  GLU 49  99  99  GLU GLU D . n 
D 2 50  GLU 50  100 100 GLU GLU D . n 
D 2 51  PHE 51  101 101 PHE PHE D . n 
D 2 52  LYS 52  102 102 LYS LYS D . n 
D 2 53  LYS 53  103 103 LYS LYS D . n 
D 2 54  ILE 54  104 104 ILE ILE D . n 
D 2 55  ARG 55  105 105 ARG ARG D . n 
D 2 56  SER 56  106 106 SER SER D . n 
D 2 57  ALA 57  107 107 ALA ALA D . n 
D 2 58  THR 58  108 108 THR THR D . n 
D 2 59  LYS 59  109 109 LYS LYS D . n 
D 2 60  LEU 60  110 110 LEU LEU D . n 
D 2 61  ALA 61  111 111 ALA ALA D . n 
D 2 62  SER 62  112 112 SER SER D . n 
D 2 63  ARG 63  113 113 ARG ARG D . n 
D 2 64  ALA 64  114 114 ALA ALA D . n 
D 2 65  HIS 65  115 115 HIS HIS D . n 
D 2 66  GLN 66  116 116 GLN GLN D . n 
D 2 67  ILE 67  117 117 ILE ILE D . n 
D 2 68  PHE 68  118 118 PHE PHE D . n 
D 2 69  GLU 69  119 119 GLU GLU D . n 
D 2 70  GLU 70  120 120 GLU GLU D . n 
D 2 71  PHE 71  121 121 PHE PHE D . n 
D 2 72  ILE 72  122 122 ILE ILE D . n 
D 2 73  CYS 73  123 123 CYS CYS D . n 
D 2 74  SER 74  124 124 SER SER D . n 
D 2 75  GLU 75  125 125 GLU GLU D . n 
D 2 76  ALA 76  126 126 ALA ALA D . n 
D 2 77  PRO 77  127 127 PRO PRO D . n 
D 2 78  LYS 78  128 128 LYS LYS D . n 
D 2 79  GLU 79  129 129 GLU GLU D . n 
D 2 80  VAL 80  130 130 VAL VAL D . n 
D 2 81  ASN 81  131 131 ASN ASN D . n 
D 2 82  ILE 82  132 132 ILE ILE D . n 
D 2 83  ASP 83  133 133 ASP ASP D . n 
D 2 84  HIS 84  134 134 HIS HIS D . n 
D 2 85  GLU 85  135 135 GLU GLU D . n 
D 2 86  THR 86  136 136 THR THR D . n 
D 2 87  ARG 87  137 137 ARG ARG D . n 
D 2 88  GLU 88  138 138 GLU GLU D . n 
D 2 89  LEU 89  139 139 LEU LEU D . n 
D 2 90  THR 90  140 140 THR THR D . n 
D 2 91  ARG 91  141 141 ARG ARG D . n 
D 2 92  MET 92  142 142 MET MET D . n 
D 2 93  ASN 93  143 143 ASN ASN D . n 
D 2 94  LEU 94  144 144 LEU LEU D . n 
D 2 95  GLN 95  145 145 GLN GLN D . n 
D 2 96  THR 96  146 146 THR THR D . n 
D 2 97  ALA 97  147 147 ALA ALA D . n 
D 2 98  THR 98  148 148 THR THR D . n 
D 2 99  ALA 99  149 149 ALA ALA D . n 
D 2 100 THR 100 150 150 THR THR D . n 
D 2 101 CYS 101 151 151 CYS CYS D . n 
D 2 102 PHE 102 152 152 PHE PHE D . n 
D 2 103 ASP 103 153 153 ASP ASP D . n 
D 2 104 ALA 104 154 154 ALA ALA D . n 
D 2 105 ALA 105 155 155 ALA ALA D . n 
D 2 106 GLN 106 156 156 GLN GLN D . n 
D 2 107 GLY 107 157 157 GLY GLY D . n 
D 2 108 LYS 108 158 158 LYS LYS D . n 
D 2 109 THR 109 159 159 THR THR D . n 
D 2 110 ARG 110 160 160 ARG ARG D . n 
D 2 111 THR 111 161 161 THR THR D . n 
D 2 112 LEU 112 162 162 LEU LEU D . n 
D 2 113 MET 113 163 163 MET MET D . n 
D 2 114 GLU 114 164 164 GLU GLU D . n 
D 2 115 LYS 115 165 165 LYS LYS D . n 
D 2 116 ASP 116 166 166 ASP ASP D . n 
D 2 117 SER 117 167 167 SER SER D . n 
D 2 118 TYR 118 168 168 TYR TYR D . n 
D 2 119 PRO 119 169 169 PRO PRO D . n 
D 2 120 ARG 120 170 170 ARG ARG D . n 
D 2 121 PHE 121 171 171 PHE PHE D . n 
D 2 122 LEU 122 172 172 LEU LEU D . n 
D 2 123 LYS 123 173 173 LYS LYS D . n 
D 2 124 SER 124 174 174 SER SER D . n 
D 2 125 PRO 125 175 175 PRO PRO D . n 
D 2 126 ALA 126 176 176 ALA ALA D . n 
D 2 127 TYR 127 177 177 TYR TYR D . n 
D 2 128 ARG 128 178 178 ARG ARG D . n 
D 2 129 ASP 129 179 179 ASP ASP D . n 
D 2 130 LEU 130 180 180 LEU LEU D . n 
D 2 131 ALA 131 181 181 ALA ALA D . n 
D 2 132 ALA 132 182 182 ALA ALA D . n 
D 2 133 GLN 133 183 183 GLN GLN D . n 
D 2 134 ALA 134 184 184 ALA ALA D . n 
D 2 135 SER 135 185 ?   ?   ?   D . n 
D 2 136 ALA 136 186 ?   ?   ?   D . n 
D 2 137 ALA 137 187 ?   ?   ?   D . n 
D 2 138 SER 138 188 ?   ?   ?   D . n 
D 2 139 ALA 139 189 ?   ?   ?   D . n 
D 2 140 THR 140 190 ?   ?   ?   D . n 
# 
_pdbx_SG_project.id                    1 
_pdbx_SG_project.project_name          ? 
_pdbx_SG_project.full_name_of_center   'Structural Genomics Consortium' 
_pdbx_SG_project.initial_of_center     SGC 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 3 ALF 1  355 101 ALF ALF A . 
F 4 MG  1  356 201 MG  MG  A . 
G 5 SO4 1  357 304 SO4 SO4 A . 
H 5 SO4 1  358 305 SO4 SO4 A . 
I 5 SO4 1  359 306 SO4 SO4 A . 
J 5 SO4 1  360 308 SO4 SO4 A . 
K 6 GDP 1  401 401 GDP GDP A . 
L 5 SO4 1  302 302 SO4 SO4 B . 
M 3 ALF 1  355 102 ALF ALF C . 
N 4 MG  1  356 202 MG  MG  C . 
O 5 SO4 1  357 301 SO4 SO4 C . 
P 5 SO4 1  358 307 SO4 SO4 C . 
Q 6 GDP 1  402 402 GDP GDP C . 
R 5 SO4 1  303 303 SO4 SO4 D . 
S 7 HOH 1  402 3   HOH HOH A . 
S 7 HOH 2  403 5   HOH HOH A . 
S 7 HOH 3  404 7   HOH HOH A . 
S 7 HOH 4  405 16  HOH HOH A . 
S 7 HOH 5  406 18  HOH HOH A . 
S 7 HOH 6  407 21  HOH HOH A . 
S 7 HOH 7  408 27  HOH HOH A . 
S 7 HOH 8  409 30  HOH HOH A . 
S 7 HOH 9  410 32  HOH HOH A . 
S 7 HOH 10 411 34  HOH HOH A . 
S 7 HOH 11 412 39  HOH HOH A . 
S 7 HOH 12 413 41  HOH HOH A . 
S 7 HOH 13 414 42  HOH HOH A . 
S 7 HOH 14 415 43  HOH HOH A . 
S 7 HOH 15 416 45  HOH HOH A . 
S 7 HOH 16 417 46  HOH HOH A . 
T 7 HOH 1  13  13  HOH HOH B . 
T 7 HOH 2  20  20  HOH HOH B . 
U 7 HOH 1  403 4   HOH HOH C . 
U 7 HOH 2  404 8   HOH HOH C . 
U 7 HOH 3  405 15  HOH HOH C . 
U 7 HOH 4  406 17  HOH HOH C . 
U 7 HOH 5  407 25  HOH HOH C . 
U 7 HOH 6  408 26  HOH HOH C . 
U 7 HOH 7  409 33  HOH HOH C . 
U 7 HOH 8  410 36  HOH HOH C . 
U 7 HOH 9  411 37  HOH HOH C . 
U 7 HOH 10 412 44  HOH HOH C . 
U 7 HOH 11 413 47  HOH HOH C . 
U 7 HOH 12 414 48  HOH HOH C . 
U 7 HOH 13 415 49  HOH HOH C . 
U 7 HOH 14 416 50  HOH HOH C . 
V 7 HOH 1  6   6   HOH HOH D . 
V 7 HOH 2  9   9   HOH HOH D . 
V 7 HOH 3  24  24  HOH HOH D . 
V 7 HOH 4  38  38  HOH HOH D . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_defined_assembly ? dimeric 2 
2 author_defined_assembly ? dimeric 2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,B,E,F,G,H,I,J,K,L,S,T 
2 1 C,D,M,N,O,P,Q,R,U,V     
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1   O2B ? K GDP .   ? A GDP 401 ? 1_555 AL ? E ALF . ? A ALF 355 ? 1_555 F1  ? E ALF .   ? A ALF 355 ? 1_555 87.2  ? 
2   O2B ? K GDP .   ? A GDP 401 ? 1_555 AL ? E ALF . ? A ALF 355 ? 1_555 F2  ? E ALF .   ? A ALF 355 ? 1_555 87.7  ? 
3   F1  ? E ALF .   ? A ALF 355 ? 1_555 AL ? E ALF . ? A ALF 355 ? 1_555 F2  ? E ALF .   ? A ALF 355 ? 1_555 174.8 ? 
4   O2B ? K GDP .   ? A GDP 401 ? 1_555 AL ? E ALF . ? A ALF 355 ? 1_555 F3  ? E ALF .   ? A ALF 355 ? 1_555 98.0  ? 
5   F1  ? E ALF .   ? A ALF 355 ? 1_555 AL ? E ALF . ? A ALF 355 ? 1_555 F3  ? E ALF .   ? A ALF 355 ? 1_555 88.0  ? 
6   F2  ? E ALF .   ? A ALF 355 ? 1_555 AL ? E ALF . ? A ALF 355 ? 1_555 F3  ? E ALF .   ? A ALF 355 ? 1_555 91.6  ? 
7   O2B ? K GDP .   ? A GDP 401 ? 1_555 AL ? E ALF . ? A ALF 355 ? 1_555 F4  ? E ALF .   ? A ALF 355 ? 1_555 86.7  ? 
8   F1  ? E ALF .   ? A ALF 355 ? 1_555 AL ? E ALF . ? A ALF 355 ? 1_555 F4  ? E ALF .   ? A ALF 355 ? 1_555 91.9  ? 
9   F2  ? E ALF .   ? A ALF 355 ? 1_555 AL ? E ALF . ? A ALF 355 ? 1_555 F4  ? E ALF .   ? A ALF 355 ? 1_555 88.8  ? 
10  F3  ? E ALF .   ? A ALF 355 ? 1_555 AL ? E ALF . ? A ALF 355 ? 1_555 F4  ? E ALF .   ? A ALF 355 ? 1_555 175.3 ? 
11  O2B ? K GDP .   ? A GDP 401 ? 1_555 AL ? E ALF . ? A ALF 355 ? 1_555 O1B ? K GDP .   ? A GDP 401 ? 1_555 38.7  ? 
12  F1  ? E ALF .   ? A ALF 355 ? 1_555 AL ? E ALF . ? A ALF 355 ? 1_555 O1B ? K GDP .   ? A GDP 401 ? 1_555 49.0  ? 
13  F2  ? E ALF .   ? A ALF 355 ? 1_555 AL ? E ALF . ? A ALF 355 ? 1_555 O1B ? K GDP .   ? A GDP 401 ? 1_555 125.8 ? 
14  F3  ? E ALF .   ? A ALF 355 ? 1_555 AL ? E ALF . ? A ALF 355 ? 1_555 O1B ? K GDP .   ? A GDP 401 ? 1_555 89.6  ? 
15  F4  ? E ALF .   ? A ALF 355 ? 1_555 AL ? E ALF . ? A ALF 355 ? 1_555 O1B ? K GDP .   ? A GDP 401 ? 1_555 93.9  ? 
16  O2B ? K GDP .   ? A GDP 401 ? 1_555 AL ? E ALF . ? A ALF 355 ? 1_555 MG  ? F MG  .   ? A MG  356 ? 1_555 71.7  ? 
17  F1  ? E ALF .   ? A ALF 355 ? 1_555 AL ? E ALF . ? A ALF 355 ? 1_555 MG  ? F MG  .   ? A MG  356 ? 1_555 30.7  ? 
18  F2  ? E ALF .   ? A ALF 355 ? 1_555 AL ? E ALF . ? A ALF 355 ? 1_555 MG  ? F MG  .   ? A MG  356 ? 1_555 145.5 ? 
19  F3  ? E ALF .   ? A ALF 355 ? 1_555 AL ? E ALF . ? A ALF 355 ? 1_555 MG  ? F MG  .   ? A MG  356 ? 1_555 65.3  ? 
20  F4  ? E ALF .   ? A ALF 355 ? 1_555 AL ? E ALF . ? A ALF 355 ? 1_555 MG  ? F MG  .   ? A MG  356 ? 1_555 116.3 ? 
21  O1B ? K GDP .   ? A GDP 401 ? 1_555 AL ? E ALF . ? A ALF 355 ? 1_555 MG  ? F MG  .   ? A MG  356 ? 1_555 36.1  ? 
22  O2B ? K GDP .   ? A GDP 401 ? 1_555 AL ? E ALF . ? A ALF 355 ? 1_555 O   ? S HOH .   ? A HOH 416 ? 1_555 175.9 ? 
23  F1  ? E ALF .   ? A ALF 355 ? 1_555 AL ? E ALF . ? A ALF 355 ? 1_555 O   ? S HOH .   ? A HOH 416 ? 1_555 91.7  ? 
24  F2  ? E ALF .   ? A ALF 355 ? 1_555 AL ? E ALF . ? A ALF 355 ? 1_555 O   ? S HOH .   ? A HOH 416 ? 1_555 93.3  ? 
25  F3  ? E ALF .   ? A ALF 355 ? 1_555 AL ? E ALF . ? A ALF 355 ? 1_555 O   ? S HOH .   ? A HOH 416 ? 1_555 78.0  ? 
26  F4  ? E ALF .   ? A ALF 355 ? 1_555 AL ? E ALF . ? A ALF 355 ? 1_555 O   ? S HOH .   ? A HOH 416 ? 1_555 97.3  ? 
27  O1B ? K GDP .   ? A GDP 401 ? 1_555 AL ? E ALF . ? A ALF 355 ? 1_555 O   ? S HOH .   ? A HOH 416 ? 1_555 139.5 ? 
28  MG  ? F MG  .   ? A MG  356 ? 1_555 AL ? E ALF . ? A ALF 355 ? 1_555 O   ? S HOH .   ? A HOH 416 ? 1_555 105.5 ? 
29  O2B ? K GDP .   ? A GDP 401 ? 1_555 AL ? E ALF . ? A ALF 355 ? 1_555 O   ? S HOH .   ? A HOH 408 ? 1_555 63.3  ? 
30  F1  ? E ALF .   ? A ALF 355 ? 1_555 AL ? E ALF . ? A ALF 355 ? 1_555 O   ? S HOH .   ? A HOH 408 ? 1_555 57.1  ? 
31  F2  ? E ALF .   ? A ALF 355 ? 1_555 AL ? E ALF . ? A ALF 355 ? 1_555 O   ? S HOH .   ? A HOH 408 ? 1_555 119.3 ? 
32  F3  ? E ALF .   ? A ALF 355 ? 1_555 AL ? E ALF . ? A ALF 355 ? 1_555 O   ? S HOH .   ? A HOH 408 ? 1_555 47.4  ? 
33  F4  ? E ALF .   ? A ALF 355 ? 1_555 AL ? E ALF . ? A ALF 355 ? 1_555 O   ? S HOH .   ? A HOH 408 ? 1_555 135.8 ? 
34  O1B ? K GDP .   ? A GDP 401 ? 1_555 AL ? E ALF . ? A ALF 355 ? 1_555 O   ? S HOH .   ? A HOH 408 ? 1_555 42.3  ? 
35  MG  ? F MG  .   ? A MG  356 ? 1_555 AL ? E ALF . ? A ALF 355 ? 1_555 O   ? S HOH .   ? A HOH 408 ? 1_555 26.5  ? 
36  O   ? S HOH .   ? A HOH 416 ? 1_555 AL ? E ALF . ? A ALF 355 ? 1_555 O   ? S HOH .   ? A HOH 408 ? 1_555 112.8 ? 
37  F1  ? E ALF .   ? A ALF 355 ? 1_555 MG ? F MG  . ? A MG  356 ? 1_555 F3  ? E ALF .   ? A ALF 355 ? 1_555 53.9  ? 
38  F1  ? E ALF .   ? A ALF 355 ? 1_555 MG ? F MG  . ? A MG  356 ? 1_555 O1B ? K GDP .   ? A GDP 401 ? 1_555 83.0  ? 
39  F3  ? E ALF .   ? A ALF 355 ? 1_555 MG ? F MG  . ? A MG  356 ? 1_555 O1B ? K GDP .   ? A GDP 401 ? 1_555 98.7  ? 
40  F1  ? E ALF .   ? A ALF 355 ? 1_555 MG ? F MG  . ? A MG  356 ? 1_555 OG1 ? A THR 151 ? A THR 181 ? 1_555 87.9  ? 
41  F3  ? E ALF .   ? A ALF 355 ? 1_555 MG ? F MG  . ? A MG  356 ? 1_555 OG1 ? A THR 151 ? A THR 181 ? 1_555 74.3  ? 
42  O1B ? K GDP .   ? A GDP 401 ? 1_555 MG ? F MG  . ? A MG  356 ? 1_555 OG1 ? A THR 151 ? A THR 181 ? 1_555 170.8 ? 
43  F1  ? E ALF .   ? A ALF 355 ? 1_555 MG ? F MG  . ? A MG  356 ? 1_555 OG  ? A SER 17  ? A SER 47  ? 1_555 149.2 ? 
44  F3  ? E ALF .   ? A ALF 355 ? 1_555 MG ? F MG  . ? A MG  356 ? 1_555 OG  ? A SER 17  ? A SER 47  ? 1_555 156.4 ? 
45  O1B ? K GDP .   ? A GDP 401 ? 1_555 MG ? F MG  . ? A MG  356 ? 1_555 OG  ? A SER 17  ? A SER 47  ? 1_555 91.7  ? 
46  OG1 ? A THR 151 ? A THR 181 ? 1_555 MG ? F MG  . ? A MG  356 ? 1_555 OG  ? A SER 17  ? A SER 47  ? 1_555 97.1  ? 
47  F1  ? E ALF .   ? A ALF 355 ? 1_555 MG ? F MG  . ? A MG  356 ? 1_555 O   ? S HOH .   ? A HOH 408 ? 1_555 116.2 ? 
48  F3  ? E ALF .   ? A ALF 355 ? 1_555 MG ? F MG  . ? A MG  356 ? 1_555 O   ? S HOH .   ? A HOH 408 ? 1_555 66.2  ? 
49  O1B ? K GDP .   ? A GDP 401 ? 1_555 MG ? F MG  . ? A MG  356 ? 1_555 O   ? S HOH .   ? A HOH 408 ? 1_555 86.4  ? 
50  OG1 ? A THR 151 ? A THR 181 ? 1_555 MG ? F MG  . ? A MG  356 ? 1_555 O   ? S HOH .   ? A HOH 408 ? 1_555 96.0  ? 
51  OG  ? A SER 17  ? A SER 47  ? 1_555 MG ? F MG  . ? A MG  356 ? 1_555 O   ? S HOH .   ? A HOH 408 ? 1_555 93.5  ? 
52  F1  ? E ALF .   ? A ALF 355 ? 1_555 MG ? F MG  . ? A MG  356 ? 1_555 O   ? S HOH .   ? A HOH 417 ? 1_555 70.9  ? 
53  F3  ? E ALF .   ? A ALF 355 ? 1_555 MG ? F MG  . ? A MG  356 ? 1_555 O   ? S HOH .   ? A HOH 417 ? 1_555 123.6 ? 
54  O1B ? K GDP .   ? A GDP 401 ? 1_555 MG ? F MG  . ? A MG  356 ? 1_555 O   ? S HOH .   ? A HOH 417 ? 1_555 84.0  ? 
55  OG1 ? A THR 151 ? A THR 181 ? 1_555 MG ? F MG  . ? A MG  356 ? 1_555 O   ? S HOH .   ? A HOH 417 ? 1_555 94.9  ? 
56  OG  ? A SER 17  ? A SER 47  ? 1_555 MG ? F MG  . ? A MG  356 ? 1_555 O   ? S HOH .   ? A HOH 417 ? 1_555 78.4  ? 
57  O   ? S HOH .   ? A HOH 408 ? 1_555 MG ? F MG  . ? A MG  356 ? 1_555 O   ? S HOH .   ? A HOH 417 ? 1_555 167.2 ? 
58  O2B ? Q GDP .   ? C GDP 402 ? 1_555 AL ? M ALF . ? C ALF 355 ? 1_555 F1  ? M ALF .   ? C ALF 355 ? 1_555 93.1  ? 
59  O2B ? Q GDP .   ? C GDP 402 ? 1_555 AL ? M ALF . ? C ALF 355 ? 1_555 F2  ? M ALF .   ? C ALF 355 ? 1_555 89.9  ? 
60  F1  ? M ALF .   ? C ALF 355 ? 1_555 AL ? M ALF . ? C ALF 355 ? 1_555 F2  ? M ALF .   ? C ALF 355 ? 1_555 176.8 ? 
61  O2B ? Q GDP .   ? C GDP 402 ? 1_555 AL ? M ALF . ? C ALF 355 ? 1_555 F3  ? M ALF .   ? C ALF 355 ? 1_555 87.4  ? 
62  F1  ? M ALF .   ? C ALF 355 ? 1_555 AL ? M ALF . ? C ALF 355 ? 1_555 F3  ? M ALF .   ? C ALF 355 ? 1_555 91.8  ? 
63  F2  ? M ALF .   ? C ALF 355 ? 1_555 AL ? M ALF . ? C ALF 355 ? 1_555 F3  ? M ALF .   ? C ALF 355 ? 1_555 87.6  ? 
64  O2B ? Q GDP .   ? C GDP 402 ? 1_555 AL ? M ALF . ? C ALF 355 ? 1_555 F4  ? M ALF .   ? C ALF 355 ? 1_555 92.0  ? 
65  F1  ? M ALF .   ? C ALF 355 ? 1_555 AL ? M ALF . ? C ALF 355 ? 1_555 F4  ? M ALF .   ? C ALF 355 ? 1_555 90.4  ? 
66  F2  ? M ALF .   ? C ALF 355 ? 1_555 AL ? M ALF . ? C ALF 355 ? 1_555 F4  ? M ALF .   ? C ALF 355 ? 1_555 90.2  ? 
67  F3  ? M ALF .   ? C ALF 355 ? 1_555 AL ? M ALF . ? C ALF 355 ? 1_555 F4  ? M ALF .   ? C ALF 355 ? 1_555 177.7 ? 
68  O2B ? Q GDP .   ? C GDP 402 ? 1_555 AL ? M ALF . ? C ALF 355 ? 1_555 O1B ? Q GDP .   ? C GDP 402 ? 1_555 37.9  ? 
69  F1  ? M ALF .   ? C ALF 355 ? 1_555 AL ? M ALF . ? C ALF 355 ? 1_555 O1B ? Q GDP .   ? C GDP 402 ? 1_555 93.5  ? 
70  F2  ? M ALF .   ? C ALF 355 ? 1_555 AL ? M ALF . ? C ALF 355 ? 1_555 O1B ? Q GDP .   ? C GDP 402 ? 1_555 88.5  ? 
71  F3  ? M ALF .   ? C ALF 355 ? 1_555 AL ? M ALF . ? C ALF 355 ? 1_555 O1B ? Q GDP .   ? C GDP 402 ? 1_555 49.5  ? 
72  F4  ? M ALF .   ? C ALF 355 ? 1_555 AL ? M ALF . ? C ALF 355 ? 1_555 O1B ? Q GDP .   ? C GDP 402 ? 1_555 129.8 ? 
73  O2B ? Q GDP .   ? C GDP 402 ? 1_555 AL ? M ALF . ? C ALF 355 ? 1_555 MG  ? N MG  .   ? C MG  356 ? 1_555 69.1  ? 
74  F1  ? M ALF .   ? C ALF 355 ? 1_555 AL ? M ALF . ? C ALF 355 ? 1_555 MG  ? N MG  .   ? C MG  356 ? 1_555 103.9 ? 
75  F2  ? M ALF .   ? C ALF 355 ? 1_555 AL ? M ALF . ? C ALF 355 ? 1_555 MG  ? N MG  .   ? C MG  356 ? 1_555 76.6  ? 
76  F3  ? M ALF .   ? C ALF 355 ? 1_555 AL ? M ALF . ? C ALF 355 ? 1_555 MG  ? N MG  .   ? C MG  356 ? 1_555 21.7  ? 
77  F4  ? M ALF .   ? C ALF 355 ? 1_555 AL ? M ALF . ? C ALF 355 ? 1_555 MG  ? N MG  .   ? C MG  356 ? 1_555 156.6 ? 
78  O1B ? Q GDP .   ? C GDP 402 ? 1_555 AL ? M ALF . ? C ALF 355 ? 1_555 MG  ? N MG  .   ? C MG  356 ? 1_555 32.6  ? 
79  O2B ? Q GDP .   ? C GDP 402 ? 1_555 AL ? M ALF . ? C ALF 355 ? 1_555 O   ? U HOH .   ? C HOH 413 ? 1_555 65.5  ? 
80  F1  ? M ALF .   ? C ALF 355 ? 1_555 AL ? M ALF . ? C ALF 355 ? 1_555 O   ? U HOH .   ? C HOH 413 ? 1_555 133.3 ? 
81  F2  ? M ALF .   ? C ALF 355 ? 1_555 AL ? M ALF . ? C ALF 355 ? 1_555 O   ? U HOH .   ? C HOH 413 ? 1_555 47.8  ? 
82  F3  ? M ALF .   ? C ALF 355 ? 1_555 AL ? M ALF . ? C ALF 355 ? 1_555 O   ? U HOH .   ? C HOH 413 ? 1_555 48.8  ? 
83  F4  ? M ALF .   ? C ALF 355 ? 1_555 AL ? M ALF . ? C ALF 355 ? 1_555 O   ? U HOH .   ? C HOH 413 ? 1_555 129.0 ? 
84  O1B ? Q GDP .   ? C GDP 402 ? 1_555 AL ? M ALF . ? C ALF 355 ? 1_555 O   ? U HOH .   ? C HOH 413 ? 1_555 43.9  ? 
85  MG  ? N MG  .   ? C MG  356 ? 1_555 AL ? M ALF . ? C ALF 355 ? 1_555 O   ? U HOH .   ? C HOH 413 ? 1_555 30.8  ? 
86  O2B ? Q GDP .   ? C GDP 402 ? 1_555 AL ? M ALF . ? C ALF 355 ? 1_555 O   ? U HOH .   ? C HOH 407 ? 1_555 176.3 ? 
87  F1  ? M ALF .   ? C ALF 355 ? 1_555 AL ? M ALF . ? C ALF 355 ? 1_555 O   ? U HOH .   ? C HOH 407 ? 1_555 90.5  ? 
88  F2  ? M ALF .   ? C ALF 355 ? 1_555 AL ? M ALF . ? C ALF 355 ? 1_555 O   ? U HOH .   ? C HOH 407 ? 1_555 86.4  ? 
89  F3  ? M ALF .   ? C ALF 355 ? 1_555 AL ? M ALF . ? C ALF 355 ? 1_555 O   ? U HOH .   ? C HOH 407 ? 1_555 92.5  ? 
90  F4  ? M ALF .   ? C ALF 355 ? 1_555 AL ? M ALF . ? C ALF 355 ? 1_555 O   ? U HOH .   ? C HOH 407 ? 1_555 88.0  ? 
91  O1B ? Q GDP .   ? C GDP 402 ? 1_555 AL ? M ALF . ? C ALF 355 ? 1_555 O   ? U HOH .   ? C HOH 407 ? 1_555 141.8 ? 
92  MG  ? N MG  .   ? C MG  356 ? 1_555 AL ? M ALF . ? C ALF 355 ? 1_555 O   ? U HOH .   ? C HOH 407 ? 1_555 110.0 ? 
93  O   ? U HOH .   ? C HOH 413 ? 1_555 AL ? M ALF . ? C ALF 355 ? 1_555 O   ? U HOH .   ? C HOH 407 ? 1_555 111.8 ? 
94  F3  ? M ALF .   ? C ALF 355 ? 1_555 MG ? N MG  . ? C MG  356 ? 1_555 OG1 ? C THR 151 ? C THR 181 ? 1_555 88.5  ? 
95  F3  ? M ALF .   ? C ALF 355 ? 1_555 MG ? N MG  . ? C MG  356 ? 1_555 O1B ? Q GDP .   ? C GDP 402 ? 1_555 98.4  ? 
96  OG1 ? C THR 151 ? C THR 181 ? 1_555 MG ? N MG  . ? C MG  356 ? 1_555 O1B ? Q GDP .   ? C GDP 402 ? 1_555 172.1 ? 
97  F3  ? M ALF .   ? C ALF 355 ? 1_555 MG ? N MG  . ? C MG  356 ? 1_555 O   ? U HOH .   ? C HOH 405 ? 1_555 86.1  ? 
98  OG1 ? C THR 151 ? C THR 181 ? 1_555 MG ? N MG  . ? C MG  356 ? 1_555 O   ? U HOH .   ? C HOH 405 ? 1_555 84.8  ? 
99  O1B ? Q GDP .   ? C GDP 402 ? 1_555 MG ? N MG  . ? C MG  356 ? 1_555 O   ? U HOH .   ? C HOH 405 ? 1_555 99.3  ? 
100 F3  ? M ALF .   ? C ALF 355 ? 1_555 MG ? N MG  . ? C MG  356 ? 1_555 OG  ? C SER 17  ? C SER 47  ? 1_555 161.8 ? 
101 OG1 ? C THR 151 ? C THR 181 ? 1_555 MG ? N MG  . ? C MG  356 ? 1_555 OG  ? C SER 17  ? C SER 47  ? 1_555 81.8  ? 
102 O1B ? Q GDP .   ? C GDP 402 ? 1_555 MG ? N MG  . ? C MG  356 ? 1_555 OG  ? C SER 17  ? C SER 47  ? 1_555 92.5  ? 
103 O   ? U HOH .   ? C HOH 405 ? 1_555 MG ? N MG  . ? C MG  356 ? 1_555 OG  ? C SER 17  ? C SER 47  ? 1_555 77.7  ? 
104 F3  ? M ALF .   ? C ALF 355 ? 1_555 MG ? N MG  . ? C MG  356 ? 1_555 O   ? U HOH .   ? C HOH 413 ? 1_555 99.9  ? 
105 OG1 ? C THR 151 ? C THR 181 ? 1_555 MG ? N MG  . ? C MG  356 ? 1_555 O   ? U HOH .   ? C HOH 413 ? 1_555 85.2  ? 
106 O1B ? Q GDP .   ? C GDP 402 ? 1_555 MG ? N MG  . ? C MG  356 ? 1_555 O   ? U HOH .   ? C HOH 413 ? 1_555 89.9  ? 
107 O   ? U HOH .   ? C HOH 405 ? 1_555 MG ? N MG  . ? C MG  356 ? 1_555 O   ? U HOH .   ? C HOH 413 ? 1_555 168.2 ? 
108 OG  ? C SER 17  ? C SER 47  ? 1_555 MG ? N MG  . ? C MG  356 ? 1_555 O   ? U HOH .   ? C HOH 413 ? 1_555 94.6  ? 
109 F3  ? M ALF .   ? C ALF 355 ? 1_555 MG ? N MG  . ? C MG  356 ? 1_555 O2B ? Q GDP .   ? C GDP 402 ? 1_555 51.6  ? 
110 OG1 ? C THR 151 ? C THR 181 ? 1_555 MG ? N MG  . ? C MG  356 ? 1_555 O2B ? Q GDP .   ? C GDP 402 ? 1_555 131.6 ? 
111 O1B ? Q GDP .   ? C GDP 402 ? 1_555 MG ? N MG  . ? C MG  356 ? 1_555 O2B ? Q GDP .   ? C GDP 402 ? 1_555 52.7  ? 
112 O   ? U HOH .   ? C HOH 405 ? 1_555 MG ? N MG  . ? C MG  356 ? 1_555 O2B ? Q GDP .   ? C GDP 402 ? 1_555 113.9 ? 
113 OG  ? C SER 17  ? C SER 47  ? 1_555 MG ? N MG  . ? C MG  356 ? 1_555 O2B ? Q GDP .   ? C GDP 402 ? 1_555 143.7 ? 
114 O   ? U HOH .   ? C HOH 413 ? 1_555 MG ? N MG  . ? C MG  356 ? 1_555 O2B ? Q GDP .   ? C GDP 402 ? 1_555 77.5  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2006-11-21 
2 'Structure model' 1 1 2008-05-01 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' Advisory                    
3 3 'Structure model' 'Version format compliance' 
# 
loop_
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.pdbx_refine_id 
1 ? refined -12.1406 26.3156 -26.8262 -0.2517 -0.2011 -0.2627 -0.0417 -0.0313 -0.0203 1.7866 3.2676 1.1721 -0.7743 0.1890 -0.2264 
-0.0429 -0.0036 0.2462 -0.1339 0.0572  -0.1065 -0.0359 0.0165 -0.0143 'X-RAY DIFFRACTION' 
2 ? refined -3.4884  30.8065 -3.8230  0.0448  -0.1846 -0.1360 0.0375  -0.1299 -0.0462 2.5729 5.4555 6.7555 1.3901  0.2114 -1.4946 
0.0152  -0.0825 0.0408 0.8051  -0.0738 -0.4560 -0.1464 0.0791 0.0586  'X-RAY DIFFRACTION' 
3 ? refined -37.3910 61.7632 -4.1897  -0.1407 -0.2631 -0.2364 0.0248  -0.0609 -0.0114 2.1505 2.6445 2.7201 -0.9297 0.4517 -0.8157 
-0.2153 -0.0848 0.1420 0.2634  0.0133  -0.3869 -0.0993 0.1263 0.2020  'X-RAY DIFFRACTION' 
4 ? refined -30.3892 68.7111 -27.6885 -0.1463 -0.0705 0.0029  0.0338  0.0891  0.2108  5.2911 3.0500 6.4304 0.1141  2.0131 0.3896  
0.0292  0.5636  0.4446 -0.1940 -0.2228 -0.2599 -0.6270 0.4225 0.1936  'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.selection_details 
1 1 A 32  A 2  A 111 A 81  ? 'X-RAY DIFFRACTION' ? 
2 1 A 119 A 89 A 348 A 318 ? 'X-RAY DIFFRACTION' ? 
3 2 B 65  B 15 B 184 B 134 ? 'X-RAY DIFFRACTION' ? 
4 3 C 33  C 3  C 111 C 81  ? 'X-RAY DIFFRACTION' ? 
5 3 C 119 C 89 C 348 C 318 ? 'X-RAY DIFFRACTION' ? 
6 4 D 55  D 5  D 184 D 134 ? 'X-RAY DIFFRACTION' ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC   refinement       5.2.0019 ? 1 
HKL-2000 'data reduction' .        ? 2 
HKL-2000 'data scaling'   .        ? 3 
PHASER   phasing          .        ? 4 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 GLU A 58  ? ? -106.74 -143.37 
2  1 ASN A 166 ? ? -86.37  43.99   
3  1 ASP A 237 ? ? -160.92 115.11  
4  1 ASN A 347 ? ? -151.67 50.45   
5  1 LYS B 128 ? ? -108.24 41.89   
6  1 CYS B 151 ? ? -36.09  -38.13  
7  1 ASP C 237 ? ? -152.86 86.23   
8  1 LYS C 257 ? ? -67.63  -162.89 
9  1 TRP C 258 ? ? 71.40   -45.64  
10 1 ARG C 313 ? ? -104.84 51.60   
11 1 GLU D 125 ? ? 33.05   54.51   
12 1 ALA D 147 ? ? -56.98  100.48  
13 1 ASP D 166 ? ? -105.03 -68.32  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1   1 Y 1 A GLU 33  ? CG  ? A GLU 3   CG  
2   1 Y 1 A GLU 33  ? CD  ? A GLU 3   CD  
3   1 Y 1 A GLU 33  ? OE1 ? A GLU 3   OE1 
4   1 Y 1 A GLU 33  ? OE2 ? A GLU 3   OE2 
5   1 Y 1 A LYS 54  ? CE  ? A LYS 24  CE  
6   1 Y 1 A LYS 54  ? NZ  ? A LYS 24  NZ  
7   1 Y 1 A HIS 57  ? CG  ? A HIS 27  CG  
8   1 Y 1 A HIS 57  ? ND1 ? A HIS 27  ND1 
9   1 Y 1 A HIS 57  ? CD2 ? A HIS 27  CD2 
10  1 Y 1 A HIS 57  ? CE1 ? A HIS 27  CE1 
11  1 Y 1 A HIS 57  ? NE2 ? A HIS 27  NE2 
12  1 Y 1 A GLU 58  ? CG  ? A GLU 28  CG  
13  1 Y 1 A GLU 58  ? CD  ? A GLU 28  CD  
14  1 Y 1 A GLU 58  ? OE1 ? A GLU 28  OE1 
15  1 Y 1 A GLU 58  ? OE2 ? A GLU 28  OE2 
16  1 Y 1 A SER 62  ? OG  ? A SER 32  OG  
17  1 Y 1 A GLU 65  ? CG  ? A GLU 35  CG  
18  1 Y 1 A GLU 65  ? CD  ? A GLU 35  CD  
19  1 Y 1 A GLU 65  ? OE1 ? A GLU 35  OE1 
20  1 Y 1 A GLU 65  ? OE2 ? A GLU 35  OE2 
21  1 Y 1 A LYS 67  ? CG  ? A LYS 37  CG  
22  1 Y 1 A LYS 67  ? CD  ? A LYS 37  CD  
23  1 Y 1 A LYS 67  ? CE  ? A LYS 37  CE  
24  1 Y 1 A LYS 67  ? NZ  ? A LYS 37  NZ  
25  1 Y 1 A GLN 79  ? CG  ? A GLN 49  CG  
26  1 Y 1 A GLN 79  ? CD  ? A GLN 49  CD  
27  1 Y 1 A GLN 79  ? OE1 ? A GLN 49  OE1 
28  1 Y 1 A GLN 79  ? NE2 ? A GLN 49  NE2 
29  1 Y 1 A ARG 90  ? NE  ? A ARG 60  NE  
30  1 Y 1 A ARG 90  ? CZ  ? A ARG 60  CZ  
31  1 Y 1 A ARG 90  ? NH1 ? A ARG 60  NH1 
32  1 Y 1 A ARG 90  ? NH2 ? A ARG 60  NH2 
33  1 Y 1 A LYS 132 ? CD  ? A LYS 102 CD  
34  1 Y 1 A LYS 132 ? CE  ? A LYS 102 CE  
35  1 Y 1 A LYS 132 ? NZ  ? A LYS 102 NZ  
36  1 Y 1 A GLN 171 ? CG  ? A GLN 141 CG  
37  1 Y 1 A GLN 171 ? CD  ? A GLN 141 CD  
38  1 Y 1 A GLN 171 ? OE1 ? A GLN 141 OE1 
39  1 Y 1 A GLN 171 ? NE2 ? A GLN 141 NE2 
40  1 Y 1 A LYS 180 ? CE  ? A LYS 150 CE  
41  1 Y 1 A LYS 180 ? NZ  ? A LYS 150 NZ  
42  1 Y 1 A PHE 191 ? CD1 ? A PHE 161 CD1 
43  1 Y 1 A PHE 191 ? CD2 ? A PHE 161 CD2 
44  1 Y 1 A PHE 191 ? CE1 ? A PHE 161 CE1 
45  1 Y 1 A PHE 191 ? CE2 ? A PHE 161 CE2 
46  1 Y 1 A PHE 191 ? CZ  ? A PHE 161 CZ  
47  1 Y 1 A LYS 192 ? CB  ? A LYS 162 CB  
48  1 Y 1 A LYS 192 ? CG  ? A LYS 162 CG  
49  1 Y 1 A LYS 192 ? CD  ? A LYS 162 CD  
50  1 Y 1 A LYS 192 ? CE  ? A LYS 162 CE  
51  1 Y 1 A LYS 192 ? NZ  ? A LYS 162 NZ  
52  1 Y 1 A ASP 193 ? CG  ? A ASP 163 CG  
53  1 Y 1 A ASP 193 ? OD1 ? A ASP 163 OD1 
54  1 Y 1 A ASP 193 ? OD2 ? A ASP 163 OD2 
55  1 Y 1 A PHE 196 ? CD1 ? A PHE 166 CD1 
56  1 Y 1 A PHE 196 ? CD2 ? A PHE 166 CD2 
57  1 Y 1 A PHE 196 ? CE1 ? A PHE 166 CE1 
58  1 Y 1 A PHE 196 ? CE2 ? A PHE 166 CE2 
59  1 Y 1 A PHE 196 ? CZ  ? A PHE 166 CZ  
60  1 Y 1 A LYS 197 ? CG  ? A LYS 167 CG  
61  1 Y 1 A LYS 197 ? CD  ? A LYS 167 CD  
62  1 Y 1 A LYS 197 ? CE  ? A LYS 167 CE  
63  1 Y 1 A LYS 197 ? NZ  ? A LYS 167 NZ  
64  1 Y 1 A GLU 238 ? CG  ? A GLU 208 CG  
65  1 Y 1 A GLU 238 ? CD  ? A GLU 208 CD  
66  1 Y 1 A GLU 238 ? OE1 ? A GLU 208 OE1 
67  1 Y 1 A GLU 238 ? OE2 ? A GLU 208 OE2 
68  1 Y 1 A LYS 248 ? CE  ? A LYS 218 CE  
69  1 Y 1 A LYS 248 ? NZ  ? A LYS 218 NZ  
70  1 Y 1 A LYS 257 ? CE  ? A LYS 227 CE  
71  1 Y 1 A LYS 257 ? NZ  ? A LYS 227 NZ  
72  1 Y 1 A GLU 276 ? CD  ? A GLU 246 CD  
73  1 Y 1 A GLU 276 ? OE1 ? A GLU 246 OE1 
74  1 Y 1 A GLU 276 ? OE2 ? A GLU 246 OE2 
75  1 Y 1 A LYS 279 ? CE  ? A LYS 249 CE  
76  1 Y 1 A LYS 279 ? NZ  ? A LYS 249 NZ  
77  1 Y 1 A LYS 280 ? CE  ? A LYS 250 CE  
78  1 Y 1 A LYS 280 ? NZ  ? A LYS 250 NZ  
79  1 Y 1 A GLU 289 ? CG  ? A GLU 259 CG  
80  1 Y 1 A GLU 289 ? CD  ? A GLU 259 CD  
81  1 Y 1 A GLU 289 ? OE1 ? A GLU 259 OE1 
82  1 Y 1 A GLU 289 ? OE2 ? A GLU 259 OE2 
83  1 Y 1 A LYS 312 ? CE  ? A LYS 282 CE  
84  1 Y 1 A LYS 312 ? NZ  ? A LYS 282 NZ  
85  1 Y 1 A LYS 330 ? CD  ? A LYS 300 CD  
86  1 Y 1 A LYS 330 ? CE  ? A LYS 300 CE  
87  1 Y 1 A LYS 330 ? NZ  ? A LYS 300 NZ  
88  1 Y 1 A LYS 345 ? CG  ? A LYS 315 CG  
89  1 Y 1 A LYS 345 ? CD  ? A LYS 315 CD  
90  1 Y 1 A LYS 345 ? CE  ? A LYS 315 CE  
91  1 Y 1 A LYS 345 ? NZ  ? A LYS 315 NZ  
92  1 Y 1 A LEU 348 ? CG  ? A LEU 318 CG  
93  1 Y 1 A LEU 348 ? CD1 ? A LEU 318 CD1 
94  1 Y 1 A LEU 348 ? CD2 ? A LEU 318 CD2 
95  1 Y 1 B ASP 67  ? CG  ? B ASP 17  CG  
96  1 Y 1 B ASP 67  ? OD1 ? B ASP 17  OD1 
97  1 Y 1 B ASP 67  ? OD2 ? B ASP 17  OD2 
98  1 Y 1 B LEU 68  ? CG  ? B LEU 18  CG  
99  1 Y 1 B LEU 68  ? CD1 ? B LEU 18  CD1 
100 1 Y 1 B LEU 68  ? CD2 ? B LEU 18  CD2 
101 1 Y 1 B LYS 73  ? CG  ? B LYS 23  CG  
102 1 Y 1 B LYS 73  ? CD  ? B LYS 23  CD  
103 1 Y 1 B LYS 73  ? CE  ? B LYS 23  CE  
104 1 Y 1 B LYS 73  ? NZ  ? B LYS 23  NZ  
105 1 Y 1 B LYS 84  ? CD  ? B LYS 34  CD  
106 1 Y 1 B LYS 84  ? CE  ? B LYS 34  CE  
107 1 Y 1 B LYS 84  ? NZ  ? B LYS 34  NZ  
108 1 Y 1 B GLU 100 ? CD  ? B GLU 50  CD  
109 1 Y 1 B GLU 100 ? OE1 ? B GLU 50  OE1 
110 1 Y 1 B GLU 100 ? OE2 ? B GLU 50  OE2 
111 1 Y 1 B LYS 103 ? NZ  ? B LYS 53  NZ  
112 1 Y 1 B ARG 105 ? CG  ? B ARG 55  CG  
113 1 Y 1 B ARG 105 ? CD  ? B ARG 55  CD  
114 1 Y 1 B ARG 105 ? NE  ? B ARG 55  NE  
115 1 Y 1 B ARG 105 ? CZ  ? B ARG 55  CZ  
116 1 Y 1 B ARG 105 ? NH1 ? B ARG 55  NH1 
117 1 Y 1 B ARG 105 ? NH2 ? B ARG 55  NH2 
118 1 Y 1 B LYS 109 ? CG  ? B LYS 59  CG  
119 1 Y 1 B LYS 109 ? CD  ? B LYS 59  CD  
120 1 Y 1 B LYS 109 ? CE  ? B LYS 59  CE  
121 1 Y 1 B LYS 109 ? NZ  ? B LYS 59  NZ  
122 1 Y 1 B ARG 113 ? NE  ? B ARG 63  NE  
123 1 Y 1 B ARG 113 ? CZ  ? B ARG 63  CZ  
124 1 Y 1 B ARG 113 ? NH1 ? B ARG 63  NH1 
125 1 Y 1 B ARG 113 ? NH2 ? B ARG 63  NH2 
126 1 Y 1 B HIS 115 ? ND1 ? B HIS 65  ND1 
127 1 Y 1 B HIS 115 ? CD2 ? B HIS 65  CD2 
128 1 Y 1 B HIS 115 ? CE1 ? B HIS 65  CE1 
129 1 Y 1 B HIS 115 ? NE2 ? B HIS 65  NE2 
130 1 Y 1 B GLU 119 ? CD  ? B GLU 69  CD  
131 1 Y 1 B GLU 119 ? OE1 ? B GLU 69  OE1 
132 1 Y 1 B GLU 119 ? OE2 ? B GLU 69  OE2 
133 1 Y 1 B GLU 125 ? CG  ? B GLU 75  CG  
134 1 Y 1 B GLU 125 ? CD  ? B GLU 75  CD  
135 1 Y 1 B GLU 125 ? OE1 ? B GLU 75  OE1 
136 1 Y 1 B GLU 125 ? OE2 ? B GLU 75  OE2 
137 1 Y 1 B ARG 141 ? CZ  ? B ARG 91  CZ  
138 1 Y 1 B ARG 141 ? NH1 ? B ARG 91  NH1 
139 1 Y 1 B ARG 141 ? NH2 ? B ARG 91  NH2 
140 1 Y 1 B GLN 145 ? CG  ? B GLN 95  CG  
141 1 Y 1 B GLN 145 ? CD  ? B GLN 95  CD  
142 1 Y 1 B GLN 145 ? OE1 ? B GLN 95  OE1 
143 1 Y 1 B GLN 145 ? NE2 ? B GLN 95  NE2 
144 1 Y 1 B LYS 158 ? NZ  ? B LYS 108 NZ  
145 1 Y 1 B LYS 165 ? CD  ? B LYS 115 CD  
146 1 Y 1 B LYS 165 ? CE  ? B LYS 115 CE  
147 1 Y 1 B LYS 165 ? NZ  ? B LYS 115 NZ  
148 1 Y 1 B LYS 173 ? CD  ? B LYS 123 CD  
149 1 Y 1 B LYS 173 ? CE  ? B LYS 123 CE  
150 1 Y 1 B LYS 173 ? NZ  ? B LYS 123 NZ  
151 1 Y 1 B ARG 178 ? CG  ? B ARG 128 CG  
152 1 Y 1 B ARG 178 ? CD  ? B ARG 128 CD  
153 1 Y 1 B ARG 178 ? NE  ? B ARG 128 NE  
154 1 Y 1 B ARG 178 ? CZ  ? B ARG 128 CZ  
155 1 Y 1 B ARG 178 ? NH1 ? B ARG 128 NH1 
156 1 Y 1 B ARG 178 ? NH2 ? B ARG 128 NH2 
157 1 Y 1 B ASP 179 ? CG  ? B ASP 129 CG  
158 1 Y 1 B ASP 179 ? OD1 ? B ASP 129 OD1 
159 1 Y 1 B ASP 179 ? OD2 ? B ASP 129 OD2 
160 1 Y 1 B GLN 183 ? CD  ? B GLN 133 CD  
161 1 Y 1 B GLN 183 ? OE1 ? B GLN 133 OE1 
162 1 Y 1 B GLN 183 ? NE2 ? B GLN 133 NE2 
163 1 Y 1 C LYS 54  ? CG  ? C LYS 24  CG  
164 1 Y 1 C LYS 54  ? CD  ? C LYS 24  CD  
165 1 Y 1 C LYS 54  ? CE  ? C LYS 24  CE  
166 1 Y 1 C LYS 54  ? NZ  ? C LYS 24  NZ  
167 1 Y 1 C GLU 58  ? CG  ? C GLU 28  CG  
168 1 Y 1 C GLU 58  ? CD  ? C GLU 28  CD  
169 1 Y 1 C GLU 58  ? OE1 ? C GLU 28  OE1 
170 1 Y 1 C GLU 58  ? OE2 ? C GLU 28  OE2 
171 1 Y 1 C GLU 63  ? OE1 ? C GLU 33  OE1 
172 1 Y 1 C GLU 63  ? OE2 ? C GLU 33  OE2 
173 1 Y 1 C GLU 64  ? CG  ? C GLU 34  CG  
174 1 Y 1 C GLU 64  ? CD  ? C GLU 34  CD  
175 1 Y 1 C GLU 64  ? OE1 ? C GLU 34  OE1 
176 1 Y 1 C GLU 64  ? OE2 ? C GLU 34  OE2 
177 1 Y 1 C LYS 67  ? CG  ? C LYS 37  CG  
178 1 Y 1 C LYS 67  ? CD  ? C LYS 37  CD  
179 1 Y 1 C LYS 67  ? CE  ? C LYS 37  CE  
180 1 Y 1 C LYS 67  ? NZ  ? C LYS 37  NZ  
181 1 Y 1 C GLN 68  ? CD  ? C GLN 38  CD  
182 1 Y 1 C GLN 68  ? OE1 ? C GLN 38  OE1 
183 1 Y 1 C GLN 68  ? NE2 ? C GLN 38  NE2 
184 1 Y 1 C LYS 70  ? CG  ? C LYS 40  CG  
185 1 Y 1 C LYS 70  ? CD  ? C LYS 40  CD  
186 1 Y 1 C LYS 70  ? CE  ? C LYS 40  CE  
187 1 Y 1 C LYS 70  ? NZ  ? C LYS 40  NZ  
188 1 Y 1 C GLN 79  ? CG  ? C GLN 49  CG  
189 1 Y 1 C GLN 79  ? CD  ? C GLN 49  CD  
190 1 Y 1 C GLN 79  ? OE1 ? C GLN 49  OE1 
191 1 Y 1 C GLN 79  ? NE2 ? C GLN 49  NE2 
192 1 Y 1 C LYS 92  ? CG  ? C LYS 62  CG  
193 1 Y 1 C LYS 92  ? CD  ? C LYS 62  CD  
194 1 Y 1 C LYS 92  ? CE  ? C LYS 62  CE  
195 1 Y 1 C LYS 92  ? NZ  ? C LYS 62  NZ  
196 1 Y 1 C LYS 128 ? CG  ? C LYS 98  CG  
197 1 Y 1 C LYS 128 ? CD  ? C LYS 98  CD  
198 1 Y 1 C LYS 128 ? CE  ? C LYS 98  CE  
199 1 Y 1 C LYS 128 ? NZ  ? C LYS 98  NZ  
200 1 Y 1 C LYS 132 ? CG  ? C LYS 102 CG  
201 1 Y 1 C LYS 132 ? CD  ? C LYS 102 CD  
202 1 Y 1 C LYS 132 ? CE  ? C LYS 102 CE  
203 1 Y 1 C LYS 132 ? NZ  ? C LYS 102 NZ  
204 1 Y 1 C ASN 166 ? CG  ? C ASN 136 CG  
205 1 Y 1 C ASN 166 ? OD1 ? C ASN 136 OD1 
206 1 Y 1 C ASN 166 ? ND2 ? C ASN 136 ND2 
207 1 Y 1 C GLU 186 ? CG  ? C GLU 156 CG  
208 1 Y 1 C GLU 186 ? CD  ? C GLU 156 CD  
209 1 Y 1 C GLU 186 ? OE1 ? C GLU 156 OE1 
210 1 Y 1 C GLU 186 ? OE2 ? C GLU 156 OE2 
211 1 Y 1 C LYS 192 ? CD  ? C LYS 162 CD  
212 1 Y 1 C LYS 192 ? CE  ? C LYS 162 CE  
213 1 Y 1 C LYS 192 ? NZ  ? C LYS 162 NZ  
214 1 Y 1 C LYS 197 ? CD  ? C LYS 167 CD  
215 1 Y 1 C LYS 197 ? CE  ? C LYS 167 CE  
216 1 Y 1 C LYS 197 ? NZ  ? C LYS 167 NZ  
217 1 Y 1 C GLU 238 ? CG  ? C GLU 208 CG  
218 1 Y 1 C GLU 238 ? CD  ? C GLU 208 CD  
219 1 Y 1 C GLU 238 ? OE1 ? C GLU 208 OE1 
220 1 Y 1 C GLU 238 ? OE2 ? C GLU 208 OE2 
221 1 Y 1 C LYS 248 ? CG  ? C LYS 218 CG  
222 1 Y 1 C LYS 248 ? CD  ? C LYS 218 CD  
223 1 Y 1 C LYS 248 ? CE  ? C LYS 218 CE  
224 1 Y 1 C LYS 248 ? NZ  ? C LYS 218 NZ  
225 1 Y 1 C LYS 257 ? CG  ? C LYS 227 CG  
226 1 Y 1 C LYS 257 ? CD  ? C LYS 227 CD  
227 1 Y 1 C LYS 257 ? CE  ? C LYS 227 CE  
228 1 Y 1 C LYS 257 ? NZ  ? C LYS 227 NZ  
229 1 Y 1 C TRP 258 ? CG  ? C TRP 228 CG  
230 1 Y 1 C TRP 258 ? CD1 ? C TRP 228 CD1 
231 1 Y 1 C TRP 258 ? CD2 ? C TRP 228 CD2 
232 1 Y 1 C TRP 258 ? NE1 ? C TRP 228 NE1 
233 1 Y 1 C TRP 258 ? CE2 ? C TRP 228 CE2 
234 1 Y 1 C TRP 258 ? CE3 ? C TRP 228 CE3 
235 1 Y 1 C TRP 258 ? CZ2 ? C TRP 228 CZ2 
236 1 Y 1 C TRP 258 ? CZ3 ? C TRP 228 CZ3 
237 1 Y 1 C TRP 258 ? CH2 ? C TRP 228 CH2 
238 1 Y 1 C ASP 261 ? CG  ? C ASP 231 CG  
239 1 Y 1 C ASP 261 ? OD1 ? C ASP 231 OD1 
240 1 Y 1 C ASP 261 ? OD2 ? C ASP 231 OD2 
241 1 Y 1 C GLU 276 ? CD  ? C GLU 246 CD  
242 1 Y 1 C GLU 276 ? OE1 ? C GLU 246 OE1 
243 1 Y 1 C GLU 276 ? OE2 ? C GLU 246 OE2 
244 1 Y 1 C LYS 279 ? CD  ? C LYS 249 CD  
245 1 Y 1 C LYS 279 ? CE  ? C LYS 249 CE  
246 1 Y 1 C LYS 279 ? NZ  ? C LYS 249 NZ  
247 1 Y 1 C LYS 280 ? CE  ? C LYS 250 CE  
248 1 Y 1 C LYS 280 ? NZ  ? C LYS 250 NZ  
249 1 Y 1 C LYS 330 ? CG  ? C LYS 300 CG  
250 1 Y 1 C LYS 330 ? CD  ? C LYS 300 CD  
251 1 Y 1 C LYS 330 ? CE  ? C LYS 300 CE  
252 1 Y 1 C LYS 330 ? NZ  ? C LYS 300 NZ  
253 1 Y 1 C PHE 334 ? CD1 ? C PHE 304 CD1 
254 1 Y 1 C PHE 334 ? CD2 ? C PHE 304 CD2 
255 1 Y 1 C PHE 334 ? CE1 ? C PHE 304 CE1 
256 1 Y 1 C PHE 334 ? CE2 ? C PHE 304 CE2 
257 1 Y 1 C PHE 334 ? CZ  ? C PHE 304 CZ  
258 1 Y 1 C LYS 345 ? CG  ? C LYS 315 CG  
259 1 Y 1 C LYS 345 ? CD  ? C LYS 315 CD  
260 1 Y 1 C LYS 345 ? CE  ? C LYS 315 CE  
261 1 Y 1 C LYS 345 ? NZ  ? C LYS 315 NZ  
262 1 Y 1 C LEU 348 ? CG  ? C LEU 318 CG  
263 1 Y 1 C LEU 348 ? CD1 ? C LEU 318 CD1 
264 1 Y 1 C LEU 348 ? CD2 ? C LEU 318 CD2 
265 1 Y 1 D PHE 55  ? CG  ? D PHE 5   CG  
266 1 Y 1 D PHE 55  ? CD1 ? D PHE 5   CD1 
267 1 Y 1 D PHE 55  ? CD2 ? D PHE 5   CD2 
268 1 Y 1 D PHE 55  ? CE1 ? D PHE 5   CE1 
269 1 Y 1 D PHE 55  ? CE2 ? D PHE 5   CE2 
270 1 Y 1 D PHE 55  ? CZ  ? D PHE 5   CZ  
271 1 Y 1 D GLU 57  ? CG  ? D GLU 7   CG  
272 1 Y 1 D GLU 57  ? CD  ? D GLU 7   CD  
273 1 Y 1 D GLU 57  ? OE1 ? D GLU 7   OE1 
274 1 Y 1 D GLU 57  ? OE2 ? D GLU 7   OE2 
275 1 Y 1 D ASP 58  ? CG  ? D ASP 8   CG  
276 1 Y 1 D ASP 58  ? OD1 ? D ASP 8   OD1 
277 1 Y 1 D ASP 58  ? OD2 ? D ASP 8   OD2 
278 1 Y 1 D LEU 60  ? CG  ? D LEU 10  CG  
279 1 Y 1 D LEU 60  ? CD1 ? D LEU 10  CD1 
280 1 Y 1 D LEU 60  ? CD2 ? D LEU 10  CD2 
281 1 Y 1 D ARG 63  ? CG  ? D ARG 13  CG  
282 1 Y 1 D ARG 63  ? CD  ? D ARG 13  CD  
283 1 Y 1 D ARG 63  ? NE  ? D ARG 13  NE  
284 1 Y 1 D ARG 63  ? CZ  ? D ARG 13  CZ  
285 1 Y 1 D ARG 63  ? NH1 ? D ARG 13  NH1 
286 1 Y 1 D ARG 63  ? NH2 ? D ARG 13  NH2 
287 1 Y 1 D GLU 64  ? CG  ? D GLU 14  CG  
288 1 Y 1 D GLU 64  ? CD  ? D GLU 14  CD  
289 1 Y 1 D GLU 64  ? OE1 ? D GLU 14  OE1 
290 1 Y 1 D GLU 64  ? OE2 ? D GLU 14  OE2 
291 1 Y 1 D LEU 68  ? CG  ? D LEU 18  CG  
292 1 Y 1 D LEU 68  ? CD1 ? D LEU 18  CD1 
293 1 Y 1 D LEU 68  ? CD2 ? D LEU 18  CD2 
294 1 Y 1 D LYS 73  ? CD  ? D LYS 23  CD  
295 1 Y 1 D LYS 73  ? CE  ? D LYS 23  CE  
296 1 Y 1 D LYS 73  ? NZ  ? D LYS 23  NZ  
297 1 Y 1 D LYS 84  ? CE  ? D LYS 34  CE  
298 1 Y 1 D LYS 84  ? NZ  ? D LYS 34  NZ  
299 1 Y 1 D ARG 105 ? CG  ? D ARG 55  CG  
300 1 Y 1 D ARG 105 ? CD  ? D ARG 55  CD  
301 1 Y 1 D ARG 105 ? NE  ? D ARG 55  NE  
302 1 Y 1 D ARG 105 ? CZ  ? D ARG 55  CZ  
303 1 Y 1 D ARG 105 ? NH1 ? D ARG 55  NH1 
304 1 Y 1 D ARG 105 ? NH2 ? D ARG 55  NH2 
305 1 Y 1 D LYS 109 ? CD  ? D LYS 59  CD  
306 1 Y 1 D LYS 109 ? CE  ? D LYS 59  CE  
307 1 Y 1 D LYS 109 ? NZ  ? D LYS 59  NZ  
308 1 Y 1 D ARG 113 ? NE  ? D ARG 63  NE  
309 1 Y 1 D ARG 113 ? CZ  ? D ARG 63  CZ  
310 1 Y 1 D ARG 113 ? NH1 ? D ARG 63  NH1 
311 1 Y 1 D ARG 113 ? NH2 ? D ARG 63  NH2 
312 1 Y 1 D LYS 128 ? CE  ? D LYS 78  CE  
313 1 Y 1 D LYS 128 ? NZ  ? D LYS 78  NZ  
314 1 Y 1 D LYS 158 ? NZ  ? D LYS 108 NZ  
315 1 Y 1 D ARG 160 ? CG  ? D ARG 110 CG  
316 1 Y 1 D ARG 160 ? CD  ? D ARG 110 CD  
317 1 Y 1 D ARG 160 ? NE  ? D ARG 110 NE  
318 1 Y 1 D ARG 160 ? CZ  ? D ARG 110 CZ  
319 1 Y 1 D ARG 160 ? NH1 ? D ARG 110 NH1 
320 1 Y 1 D ARG 160 ? NH2 ? D ARG 110 NH2 
321 1 Y 1 D GLU 164 ? CG  ? D GLU 114 CG  
322 1 Y 1 D GLU 164 ? CD  ? D GLU 114 CD  
323 1 Y 1 D GLU 164 ? OE1 ? D GLU 114 OE1 
324 1 Y 1 D GLU 164 ? OE2 ? D GLU 114 OE2 
325 1 Y 1 D LYS 165 ? CD  ? D LYS 115 CD  
326 1 Y 1 D LYS 165 ? CE  ? D LYS 115 CE  
327 1 Y 1 D LYS 165 ? NZ  ? D LYS 115 NZ  
328 1 Y 1 D LYS 173 ? CD  ? D LYS 123 CD  
329 1 Y 1 D LYS 173 ? CE  ? D LYS 123 CE  
330 1 Y 1 D LYS 173 ? NZ  ? D LYS 123 NZ  
331 1 Y 1 D ARG 178 ? CG  ? D ARG 128 CG  
332 1 Y 1 D ARG 178 ? CD  ? D ARG 128 CD  
333 1 Y 1 D ARG 178 ? NE  ? D ARG 128 NE  
334 1 Y 1 D ARG 178 ? CZ  ? D ARG 128 CZ  
335 1 Y 1 D ARG 178 ? NH1 ? D ARG 128 NH1 
336 1 Y 1 D ARG 178 ? NH2 ? D ARG 128 NH2 
337 1 Y 1 D LEU 180 ? CG  ? D LEU 130 CG  
338 1 Y 1 D LEU 180 ? CD1 ? D LEU 130 CD1 
339 1 Y 1 D LEU 180 ? CD2 ? D LEU 130 CD2 
340 1 Y 1 D GLN 183 ? CD  ? D GLN 133 CD  
341 1 Y 1 D GLN 183 ? OE1 ? D GLN 133 OE1 
342 1 Y 1 D GLN 183 ? NE2 ? D GLN 133 NE2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A ALA 31  ? A ALA 1   
2  1 Y 1 A GLY 112 ? A GLY 82  
3  1 Y 1 A ALA 113 ? A ALA 83  
4  1 Y 1 A ALA 114 ? A ALA 84  
5  1 Y 1 A GLU 115 ? A GLU 85  
6  1 Y 1 A GLU 116 ? A GLU 86  
7  1 Y 1 A GLY 117 ? A GLY 87  
8  1 Y 1 A PHE 118 ? A PHE 88  
9  1 Y 1 A LYS 349 ? A LYS 319 
10 1 Y 1 A ASP 350 ? A ASP 320 
11 1 Y 1 A CYS 351 ? A CYS 321 
12 1 Y 1 A GLY 352 ? A GLY 322 
13 1 Y 1 A LEU 353 ? A LEU 323 
14 1 Y 1 A PHE 354 ? A PHE 324 
15 1 Y 1 B SER 51  ? B SER 1   
16 1 Y 1 B MET 52  ? B MET 2   
17 1 Y 1 B ARG 53  ? B ARG 3   
18 1 Y 1 B ASN 54  ? B ASN 4   
19 1 Y 1 B PHE 55  ? B PHE 5   
20 1 Y 1 B SER 56  ? B SER 6   
21 1 Y 1 B GLU 57  ? B GLU 7   
22 1 Y 1 B ASP 58  ? B ASP 8   
23 1 Y 1 B VAL 59  ? B VAL 9   
24 1 Y 1 B LEU 60  ? B LEU 10  
25 1 Y 1 B GLY 61  ? B GLY 11  
26 1 Y 1 B TRP 62  ? B TRP 12  
27 1 Y 1 B ARG 63  ? B ARG 13  
28 1 Y 1 B GLU 64  ? B GLU 14  
29 1 Y 1 B SER 185 ? B SER 135 
30 1 Y 1 B ALA 186 ? B ALA 136 
31 1 Y 1 B ALA 187 ? B ALA 137 
32 1 Y 1 B SER 188 ? B SER 138 
33 1 Y 1 B ALA 189 ? B ALA 139 
34 1 Y 1 B THR 190 ? B THR 140 
35 1 Y 1 C ALA 31  ? C ALA 1   
36 1 Y 1 C ARG 32  ? C ARG 2   
37 1 Y 1 C GLY 112 ? C GLY 82  
38 1 Y 1 C ALA 113 ? C ALA 83  
39 1 Y 1 C ALA 114 ? C ALA 84  
40 1 Y 1 C GLU 115 ? C GLU 85  
41 1 Y 1 C GLU 116 ? C GLU 86  
42 1 Y 1 C GLY 117 ? C GLY 87  
43 1 Y 1 C PHE 118 ? C PHE 88  
44 1 Y 1 C LYS 349 ? C LYS 319 
45 1 Y 1 C ASP 350 ? C ASP 320 
46 1 Y 1 C CYS 351 ? C CYS 321 
47 1 Y 1 C GLY 352 ? C GLY 322 
48 1 Y 1 C LEU 353 ? C LEU 323 
49 1 Y 1 C PHE 354 ? C PHE 324 
50 1 Y 1 D SER 51  ? D SER 1   
51 1 Y 1 D MET 52  ? D MET 2   
52 1 Y 1 D ARG 53  ? D ARG 3   
53 1 Y 1 D ASN 54  ? D ASN 4   
54 1 Y 1 D SER 185 ? D SER 135 
55 1 Y 1 D ALA 186 ? D ALA 136 
56 1 Y 1 D ALA 187 ? D ALA 137 
57 1 Y 1 D SER 188 ? D SER 138 
58 1 Y 1 D ALA 189 ? D ALA 139 
59 1 Y 1 D THR 190 ? D THR 140 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 'TETRAFLUOROALUMINATE ION' ALF 
4 'MAGNESIUM ION'            MG  
5 'SULFATE ION'              SO4 
6 "GUANOSINE-5'-DIPHOSPHATE" GDP 
7 water                      HOH 
#