data_2IMT
# 
_entry.id   2IMT 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.286 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2IMT         
RCSB  RCSB039761   
WWPDB D_1000039761 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1MAZ 'Bcl-xL crystal structure'                      unspecified 
PDB 1F16 'Bax NMR structure'                             unspecified 
PDB 1LXL 'Bcl-xL NMR structure'                          unspecified 
PDB 1BXL 'Bcl-xL Bak BH3 NMR structure'                  unspecified 
PDB 1MK3 'Bcl-w NMR structure'                           unspecified 
PDB 1WSX 'Mcl-1 NMR structure'                           unspecified 
PDB 2IMS 'Bak (Bcl antagonist killer) crystal structure' unspecified 
# 
_pdbx_database_status.entry_id                        2IMT 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2006-10-04 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Moldoveanu, T.' 1 
'Liu, Q.'        2 
'Tocilj, A.'     3 
'Watson, M.'     4 
'Shore, G.C.'    5 
'Gehring, K.B.'  6 
# 
_citation.id                        primary 
_citation.title                     'The X-ray structure of a BAK homodimer reveals an inhibitory zinc binding site.' 
_citation.journal_abbrev            Mol.Cell 
_citation.journal_volume            24 
_citation.page_first                677 
_citation.page_last                 688 
_citation.year                      2006 
_citation.journal_id_ASTM           MOCEFL 
_citation.country                   US 
_citation.journal_id_ISSN           1097-2765 
_citation.journal_id_CSD            2168 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   17157251 
_citation.pdbx_database_id_DOI      10.1016/j.molcel.2006.10.014 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Moldoveanu, T.' 1 
primary 'Liu, Q.'        2 
primary 'Tocilj, A.'     3 
primary 'Watson, M.'     4 
primary 'Shore, G.'      5 
primary 'Gehring, K.'    6 
# 
_cell.entry_id           2IMT 
_cell.length_a           57.247 
_cell.length_b           53.646 
_cell.length_c           58.074 
_cell.angle_alpha        90.00 
_cell.angle_beta         114.87 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         2IMT 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Apoptosis regulator BAK' 19176.471 1   ? ? ? ? 
2 non-polymer syn 'ZINC ION'                65.409    1   ? ? ? ? 
3 water       nat water                     18.015    120 ? ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Bcl-2 homologous antagonist/killer, Bcl-2- like 7 protein' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;EPALPSASEEQVAQDTEEVFRSYVFYRHQQEQEAEGVAAPADPEMVTLPLQPSSTMGQVGRQLAIIGDDINRRYDSEFQT
MLQHLQPTAENAYEYFTKIATSLFESGINWGRVVALLGFGYRLALHVYQHGLTGFLGQVTRFVVDFMLHHCIARWIAQRG
GWVAALNLGNG
;
_entity_poly.pdbx_seq_one_letter_code_can   
;EPALPSASEEQVAQDTEEVFRSYVFYRHQQEQEAEGVAAPADPEMVTLPLQPSSTMGQVGRQLAIIGDDINRRYDSEFQT
MLQHLQPTAENAYEYFTKIATSLFESGINWGRVVALLGFGYRLALHVYQHGLTGFLGQVTRFVVDFMLHHCIARWIAQRG
GWVAALNLGNG
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLU n 
1 2   PRO n 
1 3   ALA n 
1 4   LEU n 
1 5   PRO n 
1 6   SER n 
1 7   ALA n 
1 8   SER n 
1 9   GLU n 
1 10  GLU n 
1 11  GLN n 
1 12  VAL n 
1 13  ALA n 
1 14  GLN n 
1 15  ASP n 
1 16  THR n 
1 17  GLU n 
1 18  GLU n 
1 19  VAL n 
1 20  PHE n 
1 21  ARG n 
1 22  SER n 
1 23  TYR n 
1 24  VAL n 
1 25  PHE n 
1 26  TYR n 
1 27  ARG n 
1 28  HIS n 
1 29  GLN n 
1 30  GLN n 
1 31  GLU n 
1 32  GLN n 
1 33  GLU n 
1 34  ALA n 
1 35  GLU n 
1 36  GLY n 
1 37  VAL n 
1 38  ALA n 
1 39  ALA n 
1 40  PRO n 
1 41  ALA n 
1 42  ASP n 
1 43  PRO n 
1 44  GLU n 
1 45  MET n 
1 46  VAL n 
1 47  THR n 
1 48  LEU n 
1 49  PRO n 
1 50  LEU n 
1 51  GLN n 
1 52  PRO n 
1 53  SER n 
1 54  SER n 
1 55  THR n 
1 56  MET n 
1 57  GLY n 
1 58  GLN n 
1 59  VAL n 
1 60  GLY n 
1 61  ARG n 
1 62  GLN n 
1 63  LEU n 
1 64  ALA n 
1 65  ILE n 
1 66  ILE n 
1 67  GLY n 
1 68  ASP n 
1 69  ASP n 
1 70  ILE n 
1 71  ASN n 
1 72  ARG n 
1 73  ARG n 
1 74  TYR n 
1 75  ASP n 
1 76  SER n 
1 77  GLU n 
1 78  PHE n 
1 79  GLN n 
1 80  THR n 
1 81  MET n 
1 82  LEU n 
1 83  GLN n 
1 84  HIS n 
1 85  LEU n 
1 86  GLN n 
1 87  PRO n 
1 88  THR n 
1 89  ALA n 
1 90  GLU n 
1 91  ASN n 
1 92  ALA n 
1 93  TYR n 
1 94  GLU n 
1 95  TYR n 
1 96  PHE n 
1 97  THR n 
1 98  LYS n 
1 99  ILE n 
1 100 ALA n 
1 101 THR n 
1 102 SER n 
1 103 LEU n 
1 104 PHE n 
1 105 GLU n 
1 106 SER n 
1 107 GLY n 
1 108 ILE n 
1 109 ASN n 
1 110 TRP n 
1 111 GLY n 
1 112 ARG n 
1 113 VAL n 
1 114 VAL n 
1 115 ALA n 
1 116 LEU n 
1 117 LEU n 
1 118 GLY n 
1 119 PHE n 
1 120 GLY n 
1 121 TYR n 
1 122 ARG n 
1 123 LEU n 
1 124 ALA n 
1 125 LEU n 
1 126 HIS n 
1 127 VAL n 
1 128 TYR n 
1 129 GLN n 
1 130 HIS n 
1 131 GLY n 
1 132 LEU n 
1 133 THR n 
1 134 GLY n 
1 135 PHE n 
1 136 LEU n 
1 137 GLY n 
1 138 GLN n 
1 139 VAL n 
1 140 THR n 
1 141 ARG n 
1 142 PHE n 
1 143 VAL n 
1 144 VAL n 
1 145 ASP n 
1 146 PHE n 
1 147 MET n 
1 148 LEU n 
1 149 HIS n 
1 150 HIS n 
1 151 CYS n 
1 152 ILE n 
1 153 ALA n 
1 154 ARG n 
1 155 TRP n 
1 156 ILE n 
1 157 ALA n 
1 158 GLN n 
1 159 ARG n 
1 160 GLY n 
1 161 GLY n 
1 162 TRP n 
1 163 VAL n 
1 164 ALA n 
1 165 ALA n 
1 166 LEU n 
1 167 ASN n 
1 168 LEU n 
1 169 GLY n 
1 170 ASN n 
1 171 GLY n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 'BAK1, BAK, BCL2L7' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    BAK_HUMAN 
_struct_ref.pdbx_db_accession          Q16611 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;EPALPSASEEQVAQDTEEVFRSYVFYRHQQEQEAEGVAAPADPEMVTLPLQPSSTMGQVGRQLAIIGDDINRRYDSEFQT
MLQHLQPTAENAYEYFTKIATSLFESGINWGRVVALLGFGYRLALHVYQHGLTGFLGQVTRFVVDFMLHHCIARWIAQRG
GWVAALNLGNG
;
_struct_ref.pdbx_align_begin           16 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2IMT 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 171 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q16611 
_struct_ref_seq.db_align_beg                  16 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  186 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       16 
_struct_ref_seq.pdbx_auth_seq_align_end       186 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
ZN  non-polymer         . 'ZINC ION'      ? 'Zn 2'           65.409  
# 
_exptl.entry_id          2IMT 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.11 
_exptl_crystal.density_percent_sol   41.67 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              4.6 
_exptl_crystal_grow.pdbx_details    
'PEG 3350 15-30% and 0.2 M ammonium fluoride, pH 4.6, VAPOR DIFFUSION, HANGING DROP, temperature 298K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU RAXIS IV' 
_diffrn_detector.pdbx_collection_date   2005-06-01 
_diffrn_detector.details                'Osmic multilayer confocal optics' 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        RIGAKU 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.5418 
# 
_reflns.entry_id                     2IMT 
_reflns.observed_criterion_sigma_I   1 
_reflns.observed_criterion_sigma_F   2 
_reflns.d_resolution_low             50 
_reflns.d_resolution_high            1.48 
_reflns.number_obs                   21001 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         ? 
_reflns.pdbx_Rmerge_I_obs            0.041 
_reflns.pdbx_Rsym_value              0.041 
_reflns.pdbx_netI_over_sigmaI        14.7 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              3.34 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             1.48 
_reflns_shell.d_res_low              1.54 
_reflns_shell.percent_possible_all   ? 
_reflns_shell.Rmerge_I_obs           0.271 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.7 
_reflns_shell.pdbx_redundancy        1.83 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 2IMT 
_refine.ls_number_reflns_obs                     19922 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             37.32 
_refine.ls_d_res_high                            1.49 
_refine.ls_percent_reflns_obs                    79.47 
_refine.ls_R_factor_obs                          0.19393 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1925 
_refine.ls_R_factor_R_free                       0.2201 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.1 
_refine.ls_number_reflns_R_free                  1074 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.963 
_refine.correlation_coeff_Fo_to_Fc_free          0.959 
_refine.B_iso_mean                               23.377 
_refine.aniso_B[1][1]                            0.20 
_refine.aniso_B[2][2]                            0.21 
_refine.aniso_B[3][3]                            -0.46 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            -0.06 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'BABINET MODEL WITH MASK' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      'PDB Entry 2IMS' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.099 
_refine.pdbx_overall_ESU_R_Free                  0.096 
_refine.overall_SU_ML                            0.079 
_refine.overall_SU_B                             2.482 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1301 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         1 
_refine_hist.number_atoms_solvent             120 
_refine_hist.number_atoms_total               1422 
_refine_hist.d_res_high                       1.49 
_refine_hist.d_res_low                        37.32 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.027 0.021 ? 1336 'X-RAY DIFFRACTION' ? 
r_bond_other_d               0.002 0.020 ? 1177 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.950 1.919 ? 1811 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            1.038 3.000 ? 2716 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       5.069 5.000 ? 162  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.127 0.200 ? 194  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.012 0.020 ? 1522 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           0.011 0.020 ? 297  'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.234 0.200 ? 340  'X-RAY DIFFRACTION' ? 
r_nbd_other                  0.254 0.200 ? 1340 'X-RAY DIFFRACTION' ? 
r_nbtor_refined              ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_other                0.095 0.200 ? 769  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.227 0.200 ? 82   'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          0.033 0.200 ? 1    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.206 0.200 ? 9    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         0.276 0.200 ? 53   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.489 0.200 ? 14   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  1.262 1.500 ? 807  'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_mcangle_it                 2.217 2.000 ? 1291 'X-RAY DIFFRACTION' ? 
r_scbond_it                  3.555 3.000 ? 529  'X-RAY DIFFRACTION' ? 
r_scangle_it                 5.787 4.500 ? 520  'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       1.49 
_refine_ls_shell.d_res_low                        1.524 
_refine_ls_shell.number_reflns_R_work             190 
_refine_ls_shell.R_factor_R_work                  0.36 
_refine_ls_shell.percent_reflns_obs               ? 
_refine_ls_shell.R_factor_R_free                  0.437 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             10 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2IMT 
_struct.title                     'The X-ray Structure of a Bak Homodimer Reveals an Inhibitory Zinc Binding Site' 
_struct.pdbx_descriptor           'Apoptosis regulator BAK' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2IMT 
_struct_keywords.pdbx_keywords   APOPTOSIS 
_struct_keywords.text            'dimer, APOPTOSIS' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  SER A 8   ? GLY A 36  ? SER A 23  GLY A 51  1 ? 29 
HELX_P HELX_P2  2  VAL A 37  ? ALA A 39  ? VAL A 52  ALA A 54  5 ? 3  
HELX_P HELX_P3  3  ASP A 42  ? VAL A 46  ? ASP A 57  VAL A 61  5 ? 5  
HELX_P HELX_P4  4  SER A 54  ? ASN A 71  ? SER A 69  ASN A 86  1 ? 18 
HELX_P HELX_P5  5  ASN A 71  ? GLN A 83  ? ASN A 86  GLN A 98  1 ? 13 
HELX_P HELX_P6  6  THR A 88  ? GLU A 105 ? THR A 103 GLU A 120 1 ? 18 
HELX_P HELX_P7  7  ASN A 109 ? HIS A 130 ? ASN A 124 HIS A 145 1 ? 22 
HELX_P HELX_P8  8  PHE A 135 ? HIS A 150 ? PHE A 150 HIS A 165 1 ? 16 
HELX_P HELX_P9  9  CYS A 151 ? ARG A 159 ? CYS A 166 ARG A 174 1 ? 9  
HELX_P HELX_P10 10 GLY A 161 ? LEU A 168 ? GLY A 176 LEU A 183 5 ? 8  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? B ZN . ZN ? ? ? 1_555 A ASP 145 OD1 ? ? A ZN 200 A ASP 160 1_555 ? ? ? ? ? ? ? 2.010 ? 
metalc2 metalc ? ? B ZN . ZN ? ? ? 1_555 A HIS 149 NE2 ? ? A ZN 200 A HIS 164 1_555 ? ? ? ? ? ? ? 2.096 ? 
metalc3 metalc ? ? B ZN . ZN ? ? ? 1_555 A ASP 145 OD1 ? ? A ZN 200 A ASP 160 2_555 ? ? ? ? ? ? ? 2.095 ? 
metalc4 metalc ? ? B ZN . ZN ? ? ? 1_555 A HIS 149 NE2 ? ? A ZN 200 A HIS 164 2_555 ? ? ? ? ? ? ? 1.951 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    4 
_struct_site.details              'BINDING SITE FOR RESIDUE ZN A 200' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 4 ASP A 145 ? ASP A 160 . ? 2_555 ? 
2 AC1 4 ASP A 145 ? ASP A 160 . ? 1_555 ? 
3 AC1 4 HIS A 149 ? HIS A 164 . ? 1_555 ? 
4 AC1 4 HIS A 149 ? HIS A 164 . ? 2_555 ? 
# 
_atom_sites.entry_id                    2IMT 
_atom_sites.fract_transf_matrix[1][1]   0.017468 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.008097 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.018641 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.018979 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
N  
O  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . SER A 1 6   ? -9.029  -21.080 15.969 1.00 44.78 ? 21  SER A N   1 
ATOM   2    C  CA  . SER A 1 6   ? -8.325  -21.620 14.815 1.00 44.47 ? 21  SER A CA  1 
ATOM   3    C  C   . SER A 1 6   ? -8.392  -20.627 13.633 1.00 42.82 ? 21  SER A C   1 
ATOM   4    O  O   . SER A 1 6   ? -8.404  -21.055 12.485 1.00 43.52 ? 21  SER A O   1 
ATOM   5    C  CB  . SER A 1 6   ? -8.868  -23.027 14.467 1.00 44.52 ? 21  SER A CB  1 
ATOM   6    O  OG  . SER A 1 6   ? -10.298 -23.078 14.372 1.00 46.91 ? 21  SER A OG  1 
ATOM   7    N  N   . ALA A 1 7   ? -8.376  -19.306 13.915 1.00 40.32 ? 22  ALA A N   1 
ATOM   8    C  CA  . ALA A 1 7   ? -8.209  -18.313 12.847 1.00 38.15 ? 22  ALA A CA  1 
ATOM   9    C  C   . ALA A 1 7   ? -7.044  -18.744 11.953 1.00 36.72 ? 22  ALA A C   1 
ATOM   10   O  O   . ALA A 1 7   ? -5.949  -19.079 12.444 1.00 36.46 ? 22  ALA A O   1 
ATOM   11   C  CB  . ALA A 1 7   ? -7.959  -16.850 13.421 1.00 38.03 ? 22  ALA A CB  1 
ATOM   12   N  N   . SER A 1 8   ? -7.309  -18.772 10.655 1.00 34.58 ? 23  SER A N   1 
ATOM   13   C  CA  . SER A 1 8   ? -6.305  -19.000 9.649  1.00 32.90 ? 23  SER A CA  1 
ATOM   14   C  C   . SER A 1 8   ? -5.373  -17.770 9.555  1.00 32.42 ? 23  SER A C   1 
ATOM   15   O  O   . SER A 1 8   ? -5.676  -16.703 10.102 1.00 31.24 ? 23  SER A O   1 
ATOM   16   C  CB  . SER A 1 8   ? -7.004  -19.248 8.329  1.00 33.21 ? 23  SER A CB  1 
ATOM   17   O  OG  . SER A 1 8   ? -7.712  -18.114 7.877  1.00 31.28 ? 23  SER A OG  1 
ATOM   18   N  N   . GLU A 1 9   ? -4.238  -17.957 8.913  1.00 30.97 ? 24  GLU A N   1 
ATOM   19   C  CA  . GLU A 1 9   ? -3.319  -16.878 8.542  1.00 30.41 ? 24  GLU A CA  1 
ATOM   20   C  C   . GLU A 1 9   ? -4.026  -15.781 7.792  1.00 30.62 ? 24  GLU A C   1 
ATOM   21   O  O   . GLU A 1 9   ? -3.771  -14.614 8.048  1.00 26.94 ? 24  GLU A O   1 
ATOM   22   C  CB  . GLU A 1 9   ? -2.114  -17.407 7.720  1.00 30.30 ? 24  GLU A CB  1 
ATOM   23   C  CG  . GLU A 1 9   ? -1.097  -16.331 7.308  1.00 30.89 ? 24  GLU A CG  1 
ATOM   24   C  CD  . GLU A 1 9   ? 0.042   -16.848 6.424  1.00 31.81 ? 24  GLU A CD  1 
ATOM   25   O  OE1 . GLU A 1 9   ? 0.980   -16.121 6.025  1.00 27.40 ? 24  GLU A OE1 1 
ATOM   26   O  OE2 . GLU A 1 9   ? 0.020   -18.047 6.128  1.00 35.23 ? 24  GLU A OE2 1 
ATOM   27   N  N   . GLU A 1 10  ? -4.834  -16.156 6.787  1.00 30.66 ? 25  GLU A N   1 
ATOM   28   C  CA  . GLU A 1 10  ? -5.662  -15.208 6.037  1.00 31.54 ? 25  GLU A CA  1 
ATOM   29   C  C   . GLU A 1 10  ? -6.588  -14.366 6.897  1.00 29.91 ? 25  GLU A C   1 
ATOM   30   O  O   . GLU A 1 10  ? -6.633  -13.166 6.733  1.00 29.68 ? 25  GLU A O   1 
ATOM   31   C  CB  . GLU A 1 10  ? -6.516  -15.946 4.981  1.00 32.46 ? 25  GLU A CB  1 
ATOM   32   C  CG  . GLU A 1 10  ? -5.683  -16.193 3.727  1.00 41.71 ? 25  GLU A CG  1 
ATOM   33   C  CD  . GLU A 1 10  ? -6.370  -17.068 2.630  1.00 49.91 ? 25  GLU A CD  1 
ATOM   34   O  OE1 . GLU A 1 10  ? -6.956  -18.157 2.961  1.00 53.48 ? 25  GLU A OE1 1 
ATOM   35   O  OE2 . GLU A 1 10  ? -6.290  -16.672 1.415  1.00 55.30 ? 25  GLU A OE2 1 
ATOM   36   N  N   . GLN A 1 11  ? -7.310  -15.016 7.788  1.00 29.20 ? 26  GLN A N   1 
ATOM   37   C  CA  . GLN A 1 11  ? -8.264  -14.378 8.624  1.00 29.09 ? 26  GLN A CA  1 
ATOM   38   C  C   . GLN A 1 11  ? -7.533  -13.422 9.573  1.00 26.36 ? 26  GLN A C   1 
ATOM   39   O  O   . GLN A 1 11  ? -8.013  -12.334 9.818  1.00 23.72 ? 26  GLN A O   1 
ATOM   40   C  CB  . GLN A 1 11  ? -8.966  -15.388 9.476  1.00 30.90 ? 26  GLN A CB  1 
ATOM   41   C  CG  . GLN A 1 11  ? -10.053 -16.166 8.798  1.00 37.67 ? 26  GLN A CG  1 
ATOM   42   C  CD  . GLN A 1 11  ? -10.589 -17.203 9.765  1.00 42.46 ? 26  GLN A CD  1 
ATOM   43   O  OE1 . GLN A 1 11  ? -10.165 -18.363 9.740  1.00 41.86 ? 26  GLN A OE1 1 
ATOM   44   N  NE2 . GLN A 1 11  ? -11.422 -16.743 10.718 1.00 49.26 ? 26  GLN A NE2 1 
ATOM   45   N  N   . VAL A 1 12  ? -6.425  -13.867 10.130 1.00 23.59 ? 27  VAL A N   1 
ATOM   46   C  CA  . VAL A 1 12  ? -5.601  -13.000 11.028 1.00 23.14 ? 27  VAL A CA  1 
ATOM   47   C  C   . VAL A 1 12  ? -5.130  -11.779 10.276 1.00 22.10 ? 27  VAL A C   1 
ATOM   48   O  O   . VAL A 1 12  ? -5.246  -10.685 10.750 1.00 19.26 ? 27  VAL A O   1 
ATOM   49   C  CB  . VAL A 1 12  ? -4.376  -13.727 11.648 1.00 23.02 ? 27  VAL A CB  1 
ATOM   50   C  CG1 . VAL A 1 12  ? -3.506  -12.729 12.446 1.00 21.82 ? 27  VAL A CG1 1 
ATOM   51   C  CG2 . VAL A 1 12  ? -4.840  -14.874 12.523 1.00 23.81 ? 27  VAL A CG2 1 
ATOM   52   N  N   . ALA A 1 13  ? -4.695  -11.988 9.039  1.00 20.47 ? 28  ALA A N   1 
ATOM   53   C  CA  . ALA A 1 13  ? -4.210  -10.945 8.193  1.00 22.04 ? 28  ALA A CA  1 
ATOM   54   C  C   . ALA A 1 13  ? -5.325  -9.903  7.944  1.00 23.03 ? 28  ALA A C   1 
ATOM   55   O  O   . ALA A 1 13  ? -5.077  -8.715  8.022  1.00 24.90 ? 28  ALA A O   1 
ATOM   56   C  CB  . ALA A 1 13  ? -3.720  -11.505 6.863  1.00 23.16 ? 28  ALA A CB  1 
ATOM   57   N  N   . GLN A 1 14  ? -6.548  -10.391 7.740  1.00 24.00 ? 29  GLN A N   1 
ATOM   58   C  CA  . GLN A 1 14  ? -7.726  -9.510  7.541  1.00 25.53 ? 29  GLN A CA  1 
ATOM   59   C  C   . GLN A 1 14  ? -8.094  -8.736  8.820  1.00 23.95 ? 29  GLN A C   1 
ATOM   60   O  O   . GLN A 1 14  ? -8.335  -7.508  8.798  1.00 25.55 ? 29  GLN A O   1 
ATOM   61   C  CB  . GLN A 1 14  ? -8.913  -10.339 7.069  1.00 27.44 ? 29  GLN A CB  1 
ATOM   62   C  CG  . GLN A 1 14  ? -8.711  -10.855 5.589  1.00 34.03 ? 29  GLN A CG  1 
ATOM   63   C  CD  . GLN A 1 14  ? -9.662  -12.028 5.135  1.00 39.53 ? 29  GLN A CD  1 
ATOM   64   O  OE1 . GLN A 1 14  ? -10.218 -12.791 5.948  1.00 42.34 ? 29  GLN A OE1 1 
ATOM   65   N  NE2 . GLN A 1 14  ? -9.806  -12.162 3.829  1.00 43.87 ? 29  GLN A NE2 1 
ATOM   66   N  N   . ASP A 1 15  ? -7.997  -9.423  9.931  1.00 23.22 ? 30  ASP A N   1 
ATOM   67   C  CA  . ASP A 1 15  ? -8.272  -8.873  11.255 1.00 22.22 ? 30  ASP A CA  1 
ATOM   68   C  C   . ASP A 1 15  ? -7.422  -7.701  11.696 1.00 20.91 ? 30  ASP A C   1 
ATOM   69   O  O   . ASP A 1 15  ? -7.854  -6.882  12.536 1.00 18.42 ? 30  ASP A O   1 
ATOM   70   C  CB  . ASP A 1 15  ? -8.138  -9.988  12.309 1.00 23.68 ? 30  ASP A CB  1 
ATOM   71   C  CG  . ASP A 1 15  ? -9.323  -10.950 12.347 1.00 23.60 ? 30  ASP A CG  1 
ATOM   72   O  OD1 . ASP A 1 15  ? -10.386 -10.648 11.769 1.00 27.33 ? 30  ASP A OD1 1 
ATOM   73   O  OD2 . ASP A 1 15  ? -9.214  -12.082 12.857 1.00 26.42 ? 30  ASP A OD2 1 
ATOM   74   N  N   . THR A 1 16  ? -6.229  -7.635  11.166 1.00 17.61 ? 31  THR A N   1 
ATOM   75   C  CA  . THR A 1 16  ? -5.204  -6.644  11.538 1.00 18.04 ? 31  THR A CA  1 
ATOM   76   C  C   . THR A 1 16  ? -5.780  -5.240  11.255 1.00 17.86 ? 31  THR A C   1 
ATOM   77   O  O   . THR A 1 16  ? -5.500  -4.324  11.993 1.00 15.05 ? 31  THR A O   1 
ATOM   78   C  CB  . THR A 1 16  ? -3.930  -6.908  10.683 1.00 17.90 ? 31  THR A CB  1 
ATOM   79   O  OG1 . THR A 1 16  ? -3.362  -8.188  11.000 1.00 17.75 ? 31  THR A OG1 1 
ATOM   80   C  CG2 . THR A 1 16  ? -2.890  -5.929  11.066 1.00 17.68 ? 31  THR A CG2 1 
ATOM   81   N  N   . GLU A 1 17  ? -6.585  -5.082  10.186 1.00 18.57 ? 32  GLU A N   1 
ATOM   82   C  CA  . GLU A 1 17  ? -7.160  -3.768  9.873  1.00 16.67 ? 32  GLU A CA  1 
ATOM   83   C  C   . GLU A 1 17  ? -7.962  -3.192  11.076 1.00 18.42 ? 32  GLU A C   1 
ATOM   84   O  O   . GLU A 1 17  ? -7.683  -2.094  11.585 1.00 16.36 ? 32  GLU A O   1 
ATOM   85   C  CB  . GLU A 1 17  ? -8.030  -3.826  8.593  1.00 19.83 ? 32  GLU A CB  1 
ATOM   86   C  CG  . GLU A 1 17  ? -8.565  -2.447  8.201  1.00 18.27 ? 32  GLU A CG  1 
ATOM   87   C  CD  . GLU A 1 17  ? -9.522  -2.485  7.056  1.00 25.76 ? 32  GLU A CD  1 
ATOM   88   O  OE1 . GLU A 1 17  ? -10.674 -2.913  7.209  1.00 30.12 ? 32  GLU A OE1 1 
ATOM   89   O  OE2 . GLU A 1 17  ? -9.019  -2.190  6.002  1.00 30.07 ? 32  GLU A OE2 1 
ATOM   90   N  N   . GLU A 1 18  ? -8.856  -4.012  11.608 1.00 16.86 ? 33  GLU A N   1 
ATOM   91   C  CA  . GLU A 1 18  ? -9.679  -3.608  12.728 1.00 17.62 ? 33  GLU A CA  1 
ATOM   92   C  C   . GLU A 1 18  ? -8.778  -3.441  13.994 1.00 16.83 ? 33  GLU A C   1 
ATOM   93   O  O   . GLU A 1 18  ? -9.002  -2.505  14.797 1.00 17.60 ? 33  GLU A O   1 
ATOM   94   C  CB  . GLU A 1 18  ? -10.821 -4.605  12.968 1.00 17.19 ? 33  GLU A CB  1 
ATOM   95   C  CG  . GLU A 1 18  ? -11.721 -4.063  14.038 1.00 22.87 ? 33  GLU A CG  1 
ATOM   96   C  CD  . GLU A 1 18  ? -13.050 -4.796  14.173 1.00 28.81 ? 33  GLU A CD  1 
ATOM   97   O  OE1 . GLU A 1 18  ? -13.943 -4.271  14.877 1.00 30.40 ? 33  GLU A OE1 1 
ATOM   98   O  OE2 . GLU A 1 18  ? -13.187 -5.904  13.556 1.00 32.48 ? 33  GLU A OE2 1 
ATOM   99   N  N   . VAL A 1 19  ? -7.847  -4.349  14.202 1.00 16.85 ? 34  VAL A N   1 
ATOM   100  C  CA  . VAL A 1 19  ? -6.990  -4.333  15.387 1.00 15.15 ? 34  VAL A CA  1 
ATOM   101  C  C   . VAL A 1 19  ? -6.243  -2.995  15.391 1.00 15.10 ? 34  VAL A C   1 
ATOM   102  O  O   . VAL A 1 19  ? -6.163  -2.334  16.437 1.00 13.97 ? 34  VAL A O   1 
ATOM   103  C  CB  . VAL A 1 19  ? -6.081  -5.535  15.492 1.00 16.75 ? 34  VAL A CB  1 
ATOM   104  C  CG1 . VAL A 1 19  ? -5.053  -5.360  16.621 1.00 15.97 ? 34  VAL A CG1 1 
ATOM   105  C  CG2 . VAL A 1 19  ? -6.917  -6.804  15.642 1.00 17.14 ? 34  VAL A CG2 1 
ATOM   106  N  N   . PHE A 1 20  ? -5.633  -2.679  14.268 1.00 15.65 ? 35  PHE A N   1 
ATOM   107  C  CA  . PHE A 1 20  ? -4.909  -1.425  14.126 1.00 13.18 ? 35  PHE A CA  1 
ATOM   108  C  C   . PHE A 1 20  ? -5.767  -0.149  14.250 1.00 15.82 ? 35  PHE A C   1 
ATOM   109  O  O   . PHE A 1 20  ? -5.397  0.718   15.036 1.00 13.74 ? 35  PHE A O   1 
ATOM   110  C  CB  . PHE A 1 20  ? -4.062  -1.370  12.874 1.00 14.75 ? 35  PHE A CB  1 
ATOM   111  C  CG  . PHE A 1 20  ? -3.249  -0.101  12.748 1.00 12.17 ? 35  PHE A CG  1 
ATOM   112  C  CD1 . PHE A 1 20  ? -2.156  0.066   13.543 1.00 14.31 ? 35  PHE A CD1 1 
ATOM   113  C  CD2 . PHE A 1 20  ? -3.574  0.911   11.859 1.00 14.47 ? 35  PHE A CD2 1 
ATOM   114  C  CE1 . PHE A 1 20  ? -1.370  1.198   13.500 1.00 14.44 ? 35  PHE A CE1 1 
ATOM   115  C  CE2 . PHE A 1 20  ? -2.765  2.054   11.761 1.00 14.27 ? 35  PHE A CE2 1 
ATOM   116  C  CZ  . PHE A 1 20  ? -1.669  2.219   12.597 1.00 13.89 ? 35  PHE A CZ  1 
ATOM   117  N  N   . ARG A 1 21  ? -6.924  -0.060  13.589 1.00 14.58 ? 36  ARG A N   1 
ATOM   118  C  CA  . ARG A 1 21  ? -7.823  1.073   13.711 1.00 16.11 ? 36  ARG A CA  1 
ATOM   119  C  C   . ARG A 1 21  ? -8.196  1.227   15.206 1.00 16.53 ? 36  ARG A C   1 
ATOM   120  O  O   . ARG A 1 21  ? -8.198  2.340   15.724 1.00 15.91 ? 36  ARG A O   1 
ATOM   121  C  CB  . ARG A 1 21  ? -9.061  0.864   12.847 1.00 16.84 ? 36  ARG A CB  1 
ATOM   122  C  CG  . ARG A 1 21  ? -8.859  0.948   11.372 1.00 19.65 ? 36  ARG A CG  1 
ATOM   123  C  CD  . ARG A 1 21  ? -10.166 0.630   10.609 1.00 22.15 ? 36  ARG A CD  1 
ATOM   124  N  NE  . ARG A 1 21  ? -10.026 1.010   9.235  1.00 27.42 ? 36  ARG A NE  1 
ATOM   125  C  CZ  . ARG A 1 21  ? -10.872 0.647   8.245  1.00 31.28 ? 36  ARG A CZ  1 
ATOM   126  N  NH1 . ARG A 1 21  ? -11.905 -0.138  8.470  1.00 37.37 ? 36  ARG A NH1 1 
ATOM   127  N  NH2 . ARG A 1 21  ? -10.701 1.107   7.032  1.00 34.56 ? 36  ARG A NH2 1 
ATOM   128  N  N   . SER A 1 22  ? -8.517  0.102   15.874 1.00 14.36 ? 37  SER A N   1 
ATOM   129  C  CA  . SER A 1 22  ? -8.942  0.158   17.236 1.00 16.36 ? 37  SER A CA  1 
ATOM   130  C  C   . SER A 1 22  ? -7.802  0.594   18.174 1.00 15.46 ? 37  SER A C   1 
ATOM   131  O  O   . SER A 1 22  ? -7.997  1.423   19.066 1.00 15.20 ? 37  SER A O   1 
ATOM   132  C  CB  . SER A 1 22  ? -9.457  -1.200  17.604 1.00 16.28 ? 37  SER A CB  1 
ATOM   133  O  OG  . SER A 1 22  ? -9.707  -1.209  19.026 1.00 28.04 ? 37  SER A OG  1 
ATOM   134  N  N   . TYR A 1 23  ? -6.606  0.040   17.914 1.00 15.47 ? 38  TYR A N   1 
ATOM   135  C  CA  . TYR A 1 23  ? -5.403  0.434   18.642 1.00 14.74 ? 38  TYR A CA  1 
ATOM   136  C  C   . TYR A 1 23  ? -5.164  1.939   18.514 1.00 15.39 ? 38  TYR A C   1 
ATOM   137  O  O   . TYR A 1 23  ? -5.026  2.624   19.492 1.00 14.40 ? 38  TYR A O   1 
ATOM   138  C  CB  . TYR A 1 23  ? -4.181  -0.342  18.170 1.00 14.34 ? 38  TYR A CB  1 
ATOM   139  C  CG  . TYR A 1 23  ? -2.867  0.100   18.756 1.00 16.94 ? 38  TYR A CG  1 
ATOM   140  C  CD1 . TYR A 1 23  ? -2.397  -0.420  19.994 1.00 17.87 ? 38  TYR A CD1 1 
ATOM   141  C  CD2 . TYR A 1 23  ? -2.088  1.085   18.130 1.00 17.11 ? 38  TYR A CD2 1 
ATOM   142  C  CE1 . TYR A 1 23  ? -1.221  0.024   20.525 1.00 19.03 ? 38  TYR A CE1 1 
ATOM   143  C  CE2 . TYR A 1 23  ? -0.838  1.539   18.694 1.00 14.97 ? 38  TYR A CE2 1 
ATOM   144  C  CZ  . TYR A 1 23  ? -0.474  1.036   19.923 1.00 18.19 ? 38  TYR A CZ  1 
ATOM   145  O  OH  . TYR A 1 23  ? 0.698   1.464   20.443 1.00 19.88 ? 38  TYR A OH  1 
ATOM   146  N  N   . VAL A 1 24  ? -5.247  2.444   17.303 1.00 13.73 ? 39  VAL A N   1 
ATOM   147  C  CA  . VAL A 1 24  ? -5.036  3.857   17.031 1.00 14.81 ? 39  VAL A CA  1 
ATOM   148  C  C   . VAL A 1 24  ? -6.039  4.696   17.786 1.00 15.41 ? 39  VAL A C   1 
ATOM   149  O  O   . VAL A 1 24  ? -5.681  5.648   18.527 1.00 14.97 ? 39  VAL A O   1 
ATOM   150  C  CB  . VAL A 1 24  ? -5.106  4.152   15.520 1.00 13.88 ? 39  VAL A CB  1 
ATOM   151  C  CG1 . VAL A 1 24  ? -5.268  5.650   15.301 1.00 13.23 ? 39  VAL A CG1 1 
ATOM   152  C  CG2 . VAL A 1 24  ? -3.844  3.658   14.818 1.00 15.84 ? 39  VAL A CG2 1 
ATOM   153  N  N   . PHE A 1 25  ? -7.325  4.347   17.654 1.00 14.83 ? 40  PHE A N   1 
ATOM   154  C  CA  . PHE A 1 25  ? -8.394  5.077   18.354 1.00 16.61 ? 40  PHE A CA  1 
ATOM   155  C  C   . PHE A 1 25  ? -8.114  5.147   19.881 1.00 16.28 ? 40  PHE A C   1 
ATOM   156  O  O   . PHE A 1 25  ? -8.250  6.194   20.530 1.00 15.24 ? 40  PHE A O   1 
ATOM   157  C  CB  . PHE A 1 25  ? -9.805  4.483   18.122 1.00 16.76 ? 40  PHE A CB  1 
ATOM   158  C  CG  . PHE A 1 25  ? -10.886 5.264   18.831 1.00 17.88 ? 40  PHE A CG  1 
ATOM   159  C  CD1 . PHE A 1 25  ? -11.393 6.394   18.272 1.00 19.54 ? 40  PHE A CD1 1 
ATOM   160  C  CD2 . PHE A 1 25  ? -11.305 4.865   20.072 1.00 18.86 ? 40  PHE A CD2 1 
ATOM   161  C  CE1 . PHE A 1 25  ? -12.344 7.223   18.984 1.00 21.27 ? 40  PHE A CE1 1 
ATOM   162  C  CE2 . PHE A 1 25  ? -12.285 5.639   20.783 1.00 20.44 ? 40  PHE A CE2 1 
ATOM   163  C  CZ  . PHE A 1 25  ? -12.784 6.787   20.223 1.00 21.67 ? 40  PHE A CZ  1 
ATOM   164  N  N   . TYR A 1 26  ? -7.883  4.006   20.472 1.00 15.64 ? 41  TYR A N   1 
ATOM   165  C  CA  . TYR A 1 26  ? -7.745  3.935   21.968 1.00 16.89 ? 41  TYR A CA  1 
ATOM   166  C  C   . TYR A 1 26  ? -6.421  4.462   22.478 1.00 17.16 ? 41  TYR A C   1 
ATOM   167  O  O   . TYR A 1 26  ? -6.358  5.103   23.558 1.00 19.38 ? 41  TYR A O   1 
ATOM   168  C  CB  . TYR A 1 26  ? -8.074  2.490   22.530 1.00 15.92 ? 41  TYR A CB  1 
ATOM   169  C  CG  . TYR A 1 26  ? -9.519  2.133   22.328 1.00 17.07 ? 41  TYR A CG  1 
ATOM   170  C  CD1 . TYR A 1 26  ? -10.563 2.831   23.045 1.00 18.57 ? 41  TYR A CD1 1 
ATOM   171  C  CD2 . TYR A 1 26  ? -9.888  1.188   21.431 1.00 20.99 ? 41  TYR A CD2 1 
ATOM   172  C  CE1 . TYR A 1 26  ? -11.855 2.582   22.879 1.00 17.55 ? 41  TYR A CE1 1 
ATOM   173  C  CE2 . TYR A 1 26  ? -11.254 0.914   21.201 1.00 23.57 ? 41  TYR A CE2 1 
ATOM   174  C  CZ  . TYR A 1 26  ? -12.253 1.607   21.957 1.00 26.24 ? 41  TYR A CZ  1 
ATOM   175  O  OH  . TYR A 1 26  ? -13.611 1.286   21.752 1.00 26.53 ? 41  TYR A OH  1 
ATOM   176  N  N   . ARG A 1 27  ? -5.386  4.301   21.676 1.00 17.10 ? 42  ARG A N   1 
ATOM   177  C  CA  . ARG A 1 27  ? -4.142  4.885   22.023 1.00 18.51 ? 42  ARG A CA  1 
ATOM   178  C  C   . ARG A 1 27  ? -4.283  6.394   21.960 1.00 18.67 ? 42  ARG A C   1 
ATOM   179  O  O   . ARG A 1 27  ? -3.816  7.117   22.910 1.00 20.98 ? 42  ARG A O   1 
ATOM   180  C  CB  . ARG A 1 27  ? -3.055  4.451   21.175 1.00 18.69 ? 42  ARG A CB  1 
ATOM   181  C  CG  . ARG A 1 27  ? -1.798  5.248   21.540 1.00 23.17 ? 42  ARG A CG  1 
ATOM   182  C  CD  . ARG A 1 27  ? -0.591  4.493   21.431 1.00 27.17 ? 42  ARG A CD  1 
ATOM   183  N  NE  . ARG A 1 27  ? 0.501   5.443   21.562 1.00 28.18 ? 42  ARG A NE  1 
ATOM   184  C  CZ  . ARG A 1 27  ? 1.708   5.277   21.098 1.00 28.90 ? 42  ARG A CZ  1 
ATOM   185  N  NH1 . ARG A 1 27  ? 2.042   4.186   20.444 1.00 25.55 ? 42  ARG A NH1 1 
ATOM   186  N  NH2 . ARG A 1 27  ? 2.587   6.260   21.248 1.00 29.40 ? 42  ARG A NH2 1 
ATOM   187  N  N   . HIS A 1 28  ? -4.952  6.903   20.939 1.00 16.14 ? 43  HIS A N   1 
ATOM   188  C  CA  . HIS A 1 28  ? -5.101  8.325   20.864 1.00 16.55 ? 43  HIS A CA  1 
ATOM   189  C  C   . HIS A 1 28  ? -5.981  8.861   22.013 1.00 16.65 ? 43  HIS A C   1 
ATOM   190  O  O   . HIS A 1 28  ? -5.725  9.963   22.517 1.00 16.65 ? 43  HIS A O   1 
ATOM   191  C  CB  . HIS A 1 28  ? -5.708  8.718   19.589 1.00 15.18 ? 43  HIS A CB  1 
ATOM   192  C  CG  . HIS A 1 28  ? -5.692  10.178  19.303 1.00 16.28 ? 43  HIS A CG  1 
ATOM   193  N  ND1 . HIS A 1 28  ? -4.535  10.870  18.963 1.00 18.60 ? 43  HIS A ND1 1 
ATOM   194  C  CD2 . HIS A 1 28  ? -6.712  11.051  19.179 1.00 17.88 ? 43  HIS A CD2 1 
ATOM   195  C  CE1 . HIS A 1 28  ? -4.861  12.128  18.712 1.00 18.79 ? 43  HIS A CE1 1 
ATOM   196  N  NE2 . HIS A 1 28  ? -6.162  12.259  18.817 1.00 18.25 ? 43  HIS A NE2 1 
ATOM   197  N  N   . GLN A 1 29  ? -7.036  8.113   22.392 1.00 17.26 ? 44  GLN A N   1 
ATOM   198  C  CA  . GLN A 1 29  ? -7.885  8.506   23.525 1.00 18.50 ? 44  GLN A CA  1 
ATOM   199  C  C   . GLN A 1 29  ? -7.018  8.518   24.813 1.00 19.64 ? 44  GLN A C   1 
ATOM   200  O  O   . GLN A 1 29  ? -7.097  9.481   25.662 1.00 21.91 ? 44  GLN A O   1 
ATOM   201  C  CB  . GLN A 1 29  ? -9.051  7.560   23.610 1.00 19.43 ? 44  GLN A CB  1 
ATOM   202  C  CG  . GLN A 1 29  ? -10.116 7.949   24.499 1.00 21.61 ? 44  GLN A CG  1 
ATOM   203  C  CD  . GLN A 1 29  ? -11.136 6.833   24.595 1.00 25.71 ? 44  GLN A CD  1 
ATOM   204  O  OE1 . GLN A 1 29  ? -10.803 5.725   25.048 1.00 24.49 ? 44  GLN A OE1 1 
ATOM   205  N  NE2 . GLN A 1 29  ? -12.313 7.081   24.083 1.00 27.90 ? 44  GLN A NE2 1 
ATOM   206  N  N   . GLN A 1 30  ? -6.176  7.508   24.968 1.00 17.95 ? 45  GLN A N   1 
ATOM   207  C  CA  . GLN A 1 30  ? -5.262  7.410   26.098 1.00 19.52 ? 45  GLN A CA  1 
ATOM   208  C  C   . GLN A 1 30  ? -4.313  8.580   26.163 1.00 20.79 ? 45  GLN A C   1 
ATOM   209  O  O   . GLN A 1 30  ? -4.092  9.112   27.274 1.00 20.59 ? 45  GLN A O   1 
ATOM   210  C  CB  . GLN A 1 30  ? -4.471  6.099   26.088 1.00 20.94 ? 45  GLN A CB  1 
ATOM   211  C  CG  . GLN A 1 30  ? -5.302  5.001   26.550 1.00 22.65 ? 45  GLN A CG  1 
ATOM   212  C  CD  . GLN A 1 30  ? -4.660  3.690   26.324 1.00 26.18 ? 45  GLN A CD  1 
ATOM   213  O  OE1 . GLN A 1 30  ? -3.428  3.594   26.204 1.00 29.42 ? 45  GLN A OE1 1 
ATOM   214  N  NE2 . GLN A 1 30  ? -5.485  2.662   26.255 1.00 29.37 ? 45  GLN A NE2 1 
ATOM   215  N  N   . GLU A 1 31  ? -3.781  8.986   25.017 1.00 20.32 ? 46  GLU A N   1 
ATOM   216  C  CA  . GLU A 1 31  ? -2.854  10.094  24.978 1.00 21.47 ? 46  GLU A CA  1 
ATOM   217  C  C   . GLU A 1 31  ? -3.559  11.383  25.373 1.00 23.30 ? 46  GLU A C   1 
ATOM   218  O  O   . GLU A 1 31  ? -2.959  12.207  26.149 1.00 22.98 ? 46  GLU A O   1 
ATOM   219  C  CB  . GLU A 1 31  ? -2.306  10.279  23.614 1.00 23.82 ? 46  GLU A CB  1 
ATOM   220  C  CG  . GLU A 1 31  ? -0.918  10.870  23.452 1.00 30.25 ? 46  GLU A CG  1 
ATOM   221  C  CD  . GLU A 1 31  ? -0.261  10.183  22.244 1.00 35.64 ? 46  GLU A CD  1 
ATOM   222  O  OE1 . GLU A 1 31  ? -0.367  10.743  21.149 1.00 31.18 ? 46  GLU A OE1 1 
ATOM   223  O  OE2 . GLU A 1 31  ? 0.205   9.015   22.392 1.00 42.64 ? 46  GLU A OE2 1 
ATOM   224  N  N   . GLN A 1 32  ? -4.783  11.553  24.876 1.00 21.97 ? 47  GLN A N   1 
ATOM   225  C  CA  . GLN A 1 32  ? -5.571  12.719  25.237 1.00 24.09 ? 47  GLN A CA  1 
ATOM   226  C  C   . GLN A 1 32  ? -5.796  12.687  26.778 1.00 23.72 ? 47  GLN A C   1 
ATOM   227  O  O   . GLN A 1 32  ? -5.732  13.734  27.426 1.00 23.10 ? 47  GLN A O   1 
ATOM   228  C  CB  . GLN A 1 32  ? -6.904  12.763  24.465 1.00 24.72 ? 47  GLN A CB  1 
ATOM   229  C  CG  . GLN A 1 32  ? -6.807  13.081  22.951 1.00 31.13 ? 47  GLN A CG  1 
ATOM   230  C  CD  . GLN A 1 32  ? -8.169  12.835  22.149 1.00 36.92 ? 47  GLN A CD  1 
ATOM   231  O  OE1 . GLN A 1 32  ? -9.003  11.937  22.513 1.00 41.10 ? 47  GLN A OE1 1 
ATOM   232  N  NE2 . GLN A 1 32  ? -8.368  13.629  21.075 1.00 33.50 ? 47  GLN A NE2 1 
ATOM   233  N  N   . GLU A 1 33  ? -6.064  11.514  27.350 1.00 23.41 ? 48  GLU A N   1 
ATOM   234  C  CA  . GLU A 1 33  ? -6.278  11.408  28.810 1.00 25.18 ? 48  GLU A CA  1 
ATOM   235  C  C   . GLU A 1 33  ? -5.054  11.717  29.661 1.00 24.17 ? 48  GLU A C   1 
ATOM   236  O  O   . GLU A 1 33  ? -5.180  12.326  30.712 1.00 23.32 ? 48  GLU A O   1 
ATOM   237  C  CB  . GLU A 1 33  ? -6.828  10.042  29.175 1.00 26.28 ? 48  GLU A CB  1 
ATOM   238  C  CG  . GLU A 1 33  ? -8.227  9.809   28.655 1.00 31.53 ? 48  GLU A CG  1 
ATOM   239  C  CD  . GLU A 1 33  ? -8.624  8.333   28.787 1.00 39.30 ? 48  GLU A CD  1 
ATOM   240  O  OE1 . GLU A 1 33  ? -8.436  7.739   29.896 1.00 46.87 ? 48  GLU A OE1 1 
ATOM   241  O  OE2 . GLU A 1 33  ? -9.099  7.782   27.777 1.00 47.25 ? 48  GLU A OE2 1 
ATOM   242  N  N   . ALA A 1 34  ? -3.885  11.339  29.158 1.00 22.59 ? 49  ALA A N   1 
ATOM   243  C  CA  . ALA A 1 34  ? -2.625  11.474  29.831 1.00 22.84 ? 49  ALA A CA  1 
ATOM   244  C  C   . ALA A 1 34  ? -2.012  12.856  29.636 1.00 22.42 ? 49  ALA A C   1 
ATOM   245  O  O   . ALA A 1 34  ? -1.356  13.350  30.577 1.00 20.99 ? 49  ALA A O   1 
ATOM   246  C  CB  . ALA A 1 34  ? -1.634  10.375  29.390 1.00 24.38 ? 49  ALA A CB  1 
ATOM   247  N  N   . GLU A 1 35  ? -2.176  13.449  28.460 1.00 21.11 ? 50  GLU A N   1 
ATOM   248  C  CA  . GLU A 1 35  ? -1.590  14.737  28.083 1.00 20.67 ? 50  GLU A CA  1 
ATOM   249  C  C   . GLU A 1 35  ? -2.515  15.957  28.048 1.00 20.14 ? 50  GLU A C   1 
ATOM   250  O  O   . GLU A 1 35  ? -2.040  17.118  28.025 1.00 20.63 ? 50  GLU A O   1 
ATOM   251  C  CB  . GLU A 1 35  ? -0.874  14.573  26.806 1.00 21.04 ? 50  GLU A CB  1 
ATOM   252  C  CG  . GLU A 1 35  ? 0.124   13.473  26.868 1.00 24.38 ? 50  GLU A CG  1 
ATOM   253  C  CD  . GLU A 1 35  ? 0.884   13.273  25.565 1.00 27.18 ? 50  GLU A CD  1 
ATOM   254  O  OE1 . GLU A 1 35  ? 0.722   13.979  24.550 1.00 29.43 ? 50  GLU A OE1 1 
ATOM   255  O  OE2 . GLU A 1 35  ? 1.717   12.379  25.603 1.00 31.89 ? 50  GLU A OE2 1 
ATOM   256  N  N   . GLY A 1 36  ? -3.828  15.737  27.976 1.00 21.15 ? 51  GLY A N   1 
ATOM   257  C  CA  . GLY A 1 36  ? -4.817  16.794  27.870 1.00 21.22 ? 51  GLY A CA  1 
ATOM   258  C  C   . GLY A 1 36  ? -4.493  17.706  26.703 1.00 22.79 ? 51  GLY A C   1 
ATOM   259  O  O   . GLY A 1 36  ? -4.143  17.199  25.617 1.00 23.30 ? 51  GLY A O   1 
ATOM   260  N  N   . VAL A 1 37  ? -4.514  19.021  26.925 1.00 22.04 ? 52  VAL A N   1 
ATOM   261  C  CA  . VAL A 1 37  ? -4.211  19.977  25.881 1.00 24.29 ? 52  VAL A CA  1 
ATOM   262  C  C   . VAL A 1 37  ? -2.826  19.891  25.245 1.00 22.30 ? 52  VAL A C   1 
ATOM   263  O  O   . VAL A 1 37  ? -2.555  20.537  24.259 1.00 24.09 ? 52  VAL A O   1 
ATOM   264  C  CB  . VAL A 1 37  ? -4.486  21.463  26.361 1.00 24.80 ? 52  VAL A CB  1 
ATOM   265  C  CG1 . VAL A 1 37  ? -5.951  21.602  26.693 1.00 29.86 ? 52  VAL A CG1 1 
ATOM   266  C  CG2 . VAL A 1 37  ? -3.604  21.883  27.553 1.00 26.81 ? 52  VAL A CG2 1 
ATOM   267  N  N   . ALA A 1 38  ? -1.899  19.160  25.842 1.00 22.15 ? 53  ALA A N   1 
ATOM   268  C  CA  . ALA A 1 38  ? -0.556  19.004  25.317 1.00 22.10 ? 53  ALA A CA  1 
ATOM   269  C  C   . ALA A 1 38  ? -0.522  17.804  24.350 1.00 22.57 ? 53  ALA A C   1 
ATOM   270  O  O   . ALA A 1 38  ? 0.479   17.605  23.676 1.00 25.22 ? 53  ALA A O   1 
ATOM   271  C  CB  . ALA A 1 38  ? 0.457   18.810  26.426 1.00 22.09 ? 53  ALA A CB  1 
ATOM   272  N  N   . ALA A 1 39  ? -1.615  17.018  24.312 1.00 21.87 ? 54  ALA A N   1 
ATOM   273  C  CA  . ALA A 1 39  ? -1.701  15.875  23.366 1.00 21.30 ? 54  ALA A CA  1 
ATOM   274  C  C   . ALA A 1 39  ? -1.628  16.408  21.902 1.00 21.14 ? 54  ALA A C   1 
ATOM   275  O  O   . ALA A 1 39  ? -2.275  17.363  21.603 1.00 21.23 ? 54  ALA A O   1 
ATOM   276  C  CB  . ALA A 1 39  ? -2.968  15.102  23.592 1.00 20.03 ? 54  ALA A CB  1 
ATOM   277  N  N   . PRO A 1 40  ? -0.799  15.807  21.047 1.00 21.98 ? 55  PRO A N   1 
ATOM   278  C  CA  . PRO A 1 40  ? -0.786  16.144  19.624 1.00 23.34 ? 55  PRO A CA  1 
ATOM   279  C  C   . PRO A 1 40  ? -2.203  15.881  19.031 1.00 21.49 ? 55  PRO A C   1 
ATOM   280  O  O   . PRO A 1 40  ? -2.785  14.789  19.191 1.00 22.66 ? 55  PRO A O   1 
ATOM   281  C  CB  . PRO A 1 40  ? 0.287   15.215  19.066 1.00 21.30 ? 55  PRO A CB  1 
ATOM   282  C  CG  . PRO A 1 40  ? 0.258   14.117  19.926 1.00 24.53 ? 55  PRO A CG  1 
ATOM   283  C  CD  . PRO A 1 40  ? 0.094   14.669  21.326 1.00 23.25 ? 55  PRO A CD  1 
ATOM   284  N  N   . ALA A 1 41  ? -2.728  16.860  18.328 1.00 21.51 ? 56  ALA A N   1 
ATOM   285  C  CA  . ALA A 1 41  ? -4.041  16.722  17.691 1.00 19.23 ? 56  ALA A CA  1 
ATOM   286  C  C   . ALA A 1 41  ? -3.971  15.933  16.374 1.00 19.13 ? 56  ALA A C   1 
ATOM   287  O  O   . ALA A 1 41  ? -3.068  16.129  15.507 1.00 20.78 ? 56  ALA A O   1 
ATOM   288  C  CB  . ALA A 1 41  ? -4.624  18.071  17.393 1.00 21.67 ? 56  ALA A CB  1 
ATOM   289  N  N   . ASP A 1 42  ? -4.953  15.058  16.226 1.00 17.48 ? 57  ASP A N   1 
ATOM   290  C  CA  . ASP A 1 42  ? -5.187  14.321  14.918 1.00 17.03 ? 57  ASP A CA  1 
ATOM   291  C  C   . ASP A 1 42  ? -6.625  13.841  14.911 1.00 17.72 ? 57  ASP A C   1 
ATOM   292  O  O   . ASP A 1 42  ? -6.976  12.730  15.313 1.00 16.14 ? 57  ASP A O   1 
ATOM   293  C  CB  . ASP A 1 42  ? -4.178  13.190  14.704 1.00 15.63 ? 57  ASP A CB  1 
ATOM   294  C  CG  . ASP A 1 42  ? -4.279  12.524  13.391 1.00 16.77 ? 57  ASP A CG  1 
ATOM   295  O  OD1 . ASP A 1 42  ? -5.279  12.780  12.693 1.00 16.12 ? 57  ASP A OD1 1 
ATOM   296  O  OD2 . ASP A 1 42  ? -3.387  11.774  12.935 1.00 16.29 ? 57  ASP A OD2 1 
ATOM   297  N  N   . PRO A 1 43  ? -7.495  14.691  14.404 1.00 18.65 ? 58  PRO A N   1 
ATOM   298  C  CA  . PRO A 1 43  ? -8.918  14.329  14.314 1.00 18.50 ? 58  PRO A CA  1 
ATOM   299  C  C   . PRO A 1 43  ? -9.150  13.088  13.506 1.00 16.68 ? 58  PRO A C   1 
ATOM   300  O  O   . PRO A 1 43  ? -10.158 12.415  13.748 1.00 17.28 ? 58  PRO A O   1 
ATOM   301  C  CB  . PRO A 1 43  ? -9.543  15.536  13.553 1.00 21.08 ? 58  PRO A CB  1 
ATOM   302  C  CG  . PRO A 1 43  ? -8.548  16.627  13.671 1.00 23.42 ? 58  PRO A CG  1 
ATOM   303  C  CD  . PRO A 1 43  ? -7.201  15.998  13.794 1.00 20.42 ? 58  PRO A CD  1 
ATOM   304  N  N   . GLU A 1 44  ? -8.253  12.746  12.557 1.00 16.99 ? 59  GLU A N   1 
ATOM   305  C  CA  . GLU A 1 44  ? -8.415  11.505  11.768 1.00 17.28 ? 59  GLU A CA  1 
ATOM   306  C  C   . GLU A 1 44  ? -8.521  10.279  12.631 1.00 16.39 ? 59  GLU A C   1 
ATOM   307  O  O   . GLU A 1 44  ? -9.161  9.288   12.231 1.00 18.74 ? 59  GLU A O   1 
ATOM   308  C  CB  . GLU A 1 44  ? -7.304  11.358  10.742 1.00 17.36 ? 59  GLU A CB  1 
ATOM   309  C  CG  . GLU A 1 44  ? -7.230  12.590  9.813  1.00 20.02 ? 59  GLU A CG  1 
ATOM   310  C  CD  . GLU A 1 44  ? -6.233  12.453  8.656  1.00 22.39 ? 59  GLU A CD  1 
ATOM   311  O  OE1 . GLU A 1 44  ? -5.322  11.598  8.823  1.00 20.59 ? 59  GLU A OE1 1 
ATOM   312  O  OE2 . GLU A 1 44  ? -6.328  13.235  7.649  1.00 22.65 ? 59  GLU A OE2 1 
ATOM   313  N  N   . MET A 1 45  ? -7.788  10.328  13.763 1.00 15.55 ? 60  MET A N   1 
ATOM   314  C  CA  . MET A 1 45  ? -7.708  9.244   14.776 1.00 16.37 ? 60  MET A CA  1 
ATOM   315  C  C   . MET A 1 45  ? -8.920  9.138   15.669 1.00 17.87 ? 60  MET A C   1 
ATOM   316  O  O   . MET A 1 45  ? -9.051  8.154   16.390 1.00 19.84 ? 60  MET A O   1 
ATOM   317  C  CB  . MET A 1 45  ? -6.463  9.350   15.609 1.00 15.52 ? 60  MET A CB  1 
ATOM   318  C  CG  . MET A 1 45  ? -5.167  9.240   14.755 1.00 16.89 ? 60  MET A CG  1 
ATOM   319  S  SD  . MET A 1 45  ? -3.736  9.316   15.847 1.00 17.90 ? 60  MET A SD  1 
ATOM   320  C  CE  . MET A 1 45  ? -2.442  8.683   14.617 1.00 15.60 ? 60  MET A CE  1 
ATOM   321  N  N   . VAL A 1 46  ? -9.769  10.134  15.601 1.00 19.94 ? 61  VAL A N   1 
ATOM   322  C  CA  . VAL A 1 46  ? -11.032 10.149  16.354 1.00 21.62 ? 61  VAL A CA  1 
ATOM   323  C  C   . VAL A 1 46  ? -12.194 9.618   15.532 1.00 22.90 ? 61  VAL A C   1 
ATOM   324  O  O   . VAL A 1 46  ? -13.038 8.884   16.038 1.00 24.55 ? 61  VAL A O   1 
ATOM   325  C  CB  . VAL A 1 46  ? -11.309 11.537  16.914 1.00 20.27 ? 61  VAL A CB  1 
ATOM   326  C  CG1 . VAL A 1 46  ? -12.574 11.513  17.818 1.00 22.98 ? 61  VAL A CG1 1 
ATOM   327  C  CG2 . VAL A 1 46  ? -10.098 12.038  17.663 1.00 22.37 ? 61  VAL A CG2 1 
ATOM   328  N  N   . THR A 1 47  ? -12.185 9.903   14.226 1.00 23.57 ? 62  THR A N   1 
ATOM   329  C  CA  . THR A 1 47  ? -13.362 9.691   13.374 1.00 24.99 ? 62  THR A CA  1 
ATOM   330  C  C   . THR A 1 47  ? -13.236 8.404   12.550 1.00 26.59 ? 62  THR A C   1 
ATOM   331  O  O   . THR A 1 47  ? -14.012 8.157   11.662 1.00 25.44 ? 62  THR A O   1 
ATOM   332  C  CB  . THR A 1 47  ? -13.522 10.888  12.413 1.00 24.45 ? 62  THR A CB  1 
ATOM   333  O  OG1 . THR A 1 47  ? -12.347 10.998  11.636 1.00 22.99 ? 62  THR A OG1 1 
ATOM   334  C  CG2 . THR A 1 47  ? -13.660 12.205  13.173 1.00 24.74 ? 62  THR A CG2 1 
ATOM   335  N  N   . LEU A 1 48  ? -12.184 7.613   12.767 1.00 28.31 ? 63  LEU A N   1 
ATOM   336  C  CA  . LEU A 1 48  ? -11.975 6.408   11.903 1.00 29.36 ? 63  LEU A CA  1 
ATOM   337  C  C   . LEU A 1 48  ? -13.026 5.335   12.281 1.00 29.11 ? 63  LEU A C   1 
ATOM   338  O  O   . LEU A 1 48  ? -13.585 5.356   13.370 1.00 26.65 ? 63  LEU A O   1 
ATOM   339  C  CB  . LEU A 1 48  ? -10.506 5.896   11.884 1.00 31.19 ? 63  LEU A CB  1 
ATOM   340  C  CG  . LEU A 1 48  ? -9.805  5.767   13.225 1.00 31.51 ? 63  LEU A CG  1 
ATOM   341  C  CD1 . LEU A 1 48  ? -10.749 5.586   14.335 1.00 30.14 ? 63  LEU A CD1 1 
ATOM   342  C  CD2 . LEU A 1 48  ? -8.643  4.696   13.265 1.00 29.04 ? 63  LEU A CD2 1 
ATOM   343  N  N   . PRO A 1 49  ? -13.318 4.418   11.356 1.00 30.28 ? 64  PRO A N   1 
ATOM   344  C  CA  . PRO A 1 49  ? -14.358 3.400   11.621 1.00 30.66 ? 64  PRO A CA  1 
ATOM   345  C  C   . PRO A 1 49  ? -13.979 2.510   12.796 1.00 29.82 ? 64  PRO A C   1 
ATOM   346  O  O   . PRO A 1 49  ? -12.811 2.084   12.892 1.00 29.57 ? 64  PRO A O   1 
ATOM   347  C  CB  . PRO A 1 49  ? -14.421 2.561   10.327 1.00 30.21 ? 64  PRO A CB  1 
ATOM   348  C  CG  . PRO A 1 49  ? -13.337 3.064   9.427  1.00 31.52 ? 64  PRO A CG  1 
ATOM   349  C  CD  . PRO A 1 49  ? -12.719 4.292   10.019 1.00 30.97 ? 64  PRO A CD  1 
ATOM   350  N  N   . LEU A 1 50  ? -14.944 2.263   13.668 1.00 28.64 ? 65  LEU A N   1 
ATOM   351  C  CA  . LEU A 1 50  ? -14.705 1.521   14.882 1.00 30.52 ? 65  LEU A CA  1 
ATOM   352  C  C   . LEU A 1 50  ? -15.894 0.641   15.237 1.00 30.79 ? 65  LEU A C   1 
ATOM   353  O  O   . LEU A 1 50  ? -17.013 1.068   15.049 1.00 30.84 ? 65  LEU A O   1 
ATOM   354  C  CB  . LEU A 1 50  ? -14.542 2.554   16.010 1.00 31.30 ? 65  LEU A CB  1 
ATOM   355  C  CG  . LEU A 1 50  ? -13.329 2.662   16.935 1.00 32.87 ? 65  LEU A CG  1 
ATOM   356  C  CD1 . LEU A 1 50  ? -13.872 2.877   18.283 1.00 34.71 ? 65  LEU A CD1 1 
ATOM   357  C  CD2 . LEU A 1 50  ? -12.378 1.502   16.883 1.00 33.57 ? 65  LEU A CD2 1 
ATOM   358  N  N   . GLN A 1 51  ? -15.643 -0.517  15.839 1.00 31.22 ? 66  GLN A N   1 
ATOM   359  C  CA  . GLN A 1 51  ? -16.670 -1.433  16.311 1.00 31.46 ? 66  GLN A CA  1 
ATOM   360  C  C   . GLN A 1 51  ? -16.263 -1.935  17.702 1.00 29.01 ? 66  GLN A C   1 
ATOM   361  O  O   . GLN A 1 51  ? -15.612 -2.968  17.839 1.00 27.61 ? 66  GLN A O   1 
ATOM   362  C  CB  . GLN A 1 51  ? -16.845 -2.572  15.311 1.00 33.29 ? 66  GLN A CB  1 
ATOM   363  C  CG  . GLN A 1 51  ? -18.134 -3.326  15.525 1.00 40.82 ? 66  GLN A CG  1 
ATOM   364  C  CD  . GLN A 1 51  ? -18.346 -4.437  14.501 1.00 47.13 ? 66  GLN A CD  1 
ATOM   365  O  OE1 . GLN A 1 51  ? -17.713 -4.418  13.440 1.00 50.98 ? 66  GLN A OE1 1 
ATOM   366  N  NE2 . GLN A 1 51  ? -19.226 -5.423  14.832 1.00 49.17 ? 66  GLN A NE2 1 
ATOM   367  N  N   . PRO A 1 52  ? -16.565 -1.127  18.721 1.00 27.98 ? 67  PRO A N   1 
ATOM   368  C  CA  . PRO A 1 52  ? -15.941 -1.258  20.061 1.00 27.36 ? 67  PRO A CA  1 
ATOM   369  C  C   . PRO A 1 52  ? -16.171 -2.551  20.758 1.00 26.74 ? 67  PRO A C   1 
ATOM   370  O  O   . PRO A 1 52  ? -15.295 -3.004  21.460 1.00 24.51 ? 67  PRO A O   1 
ATOM   371  C  CB  . PRO A 1 52  ? -16.539 -0.072  20.893 1.00 28.16 ? 67  PRO A CB  1 
ATOM   372  C  CG  . PRO A 1 52  ? -17.144 0.790   19.943 1.00 30.08 ? 67  PRO A CG  1 
ATOM   373  C  CD  . PRO A 1 52  ? -17.382 0.085   18.624 1.00 27.78 ? 67  PRO A CD  1 
ATOM   374  N  N   . SER A 1 53  ? -17.314 -3.187  20.524 1.00 26.81 ? 68  SER A N   1 
ATOM   375  C  CA  . SER A 1 53  ? -17.618 -4.420  21.232 1.00 26.64 ? 68  SER A CA  1 
ATOM   376  C  C   . SER A 1 53  ? -17.200 -5.650  20.491 1.00 25.60 ? 68  SER A C   1 
ATOM   377  O  O   . SER A 1 53  ? -17.389 -6.752  21.009 1.00 26.22 ? 68  SER A O   1 
ATOM   378  C  CB  . SER A 1 53  ? -19.127 -4.509  21.523 1.00 26.79 ? 68  SER A CB  1 
ATOM   379  O  OG  . SER A 1 53  ? -19.810 -4.624  20.290 1.00 28.53 ? 68  SER A OG  1 
ATOM   380  N  N   . SER A 1 54  ? -16.683 -5.533  19.271 1.00 24.55 ? 69  SER A N   1 
ATOM   381  C  CA  . SER A 1 54  ? -16.180 -6.730  18.579 1.00 22.92 ? 69  SER A CA  1 
ATOM   382  C  C   . SER A 1 54  ? -14.896 -7.273  19.222 1.00 22.94 ? 69  SER A C   1 
ATOM   383  O  O   . SER A 1 54  ? -14.206 -6.547  19.921 1.00 22.08 ? 69  SER A O   1 
ATOM   384  C  CB  . SER A 1 54  ? -15.890 -6.421  17.108 1.00 22.85 ? 69  SER A CB  1 
ATOM   385  O  OG  . SER A 1 54  ? -14.700 -5.612  16.958 1.00 20.28 ? 69  SER A OG  1 
ATOM   386  N  N   . THR A 1 55  ? -14.587 -8.535  18.933 1.00 22.16 ? 70  THR A N   1 
ATOM   387  C  CA  . THR A 1 55  ? -13.384 -9.127  19.406 1.00 22.77 ? 70  THR A CA  1 
ATOM   388  C  C   . THR A 1 55  ? -12.140 -8.327  19.008 1.00 21.73 ? 70  THR A C   1 
ATOM   389  O  O   . THR A 1 55  ? -11.318 -8.057  19.871 1.00 20.05 ? 70  THR A O   1 
ATOM   390  C  CB  . THR A 1 55  ? -13.246 -10.664 19.070 1.00 23.43 ? 70  THR A CB  1 
ATOM   391  O  OG1 . THR A 1 55  ? -14.450 -11.326 19.471 1.00 26.95 ? 70  THR A OG1 1 
ATOM   392  C  CG2 . THR A 1 55  ? -12.209 -11.311 19.977 1.00 25.43 ? 70  THR A CG2 1 
ATOM   393  N  N   . MET A 1 56  ? -12.009 -7.972  17.725 1.00 21.34 ? 71  MET A N   1 
ATOM   394  C  CA  . MET A 1 56  ? -10.825 -7.284  17.307 1.00 20.24 ? 71  MET A CA  1 
ATOM   395  C  C   . MET A 1 56  ? -10.805 -5.841  17.918 1.00 20.76 ? 71  MET A C   1 
ATOM   396  O  O   . MET A 1 56  ? -9.791  -5.284  18.136 1.00 19.59 ? 71  MET A O   1 
ATOM   397  C  CB  . MET A 1 56  ? -10.744 -7.235  15.795 1.00 20.92 ? 71  MET A CB  1 
ATOM   398  C  CG  . MET A 1 56  ? -10.541 -8.632  15.166 1.00 22.10 ? 71  MET A CG  1 
ATOM   399  S  SD  . MET A 1 56  ? -9.215  -9.559  15.870 1.00 21.56 ? 71  MET A SD  1 
ATOM   400  C  CE  . MET A 1 56  ? -9.960  -11.144 16.391 1.00 23.64 ? 71  MET A CE  1 
ATOM   401  N  N   . GLY A 1 57  ? -11.961 -5.256  18.125 1.00 21.29 ? 72  GLY A N   1 
ATOM   402  C  CA  . GLY A 1 57  ? -12.084 -3.969  18.797 1.00 19.72 ? 72  GLY A CA  1 
ATOM   403  C  C   . GLY A 1 57  ? -11.554 -4.061  20.190 1.00 20.20 ? 72  GLY A C   1 
ATOM   404  O  O   . GLY A 1 57  ? -10.767 -3.209  20.623 1.00 18.90 ? 72  GLY A O   1 
ATOM   405  N  N   . GLN A 1 58  ? -11.943 -5.141  20.880 1.00 18.85 ? 73  GLN A N   1 
ATOM   406  C  CA  . GLN A 1 58  ? -11.426 -5.457  22.199 1.00 19.26 ? 73  GLN A CA  1 
ATOM   407  C  C   . GLN A 1 58  ? -9.932  -5.717  22.221 1.00 18.54 ? 73  GLN A C   1 
ATOM   408  O  O   . GLN A 1 58  ? -9.236  -5.257  23.087 1.00 18.71 ? 73  GLN A O   1 
ATOM   409  C  CB  . GLN A 1 58  ? -12.160 -6.652  22.790 1.00 19.39 ? 73  GLN A CB  1 
ATOM   410  C  CG  . GLN A 1 58  ? -13.612 -6.394  23.261 1.00 19.27 ? 73  GLN A CG  1 
ATOM   411  C  CD  . GLN A 1 58  ? -14.264 -7.652  23.703 1.00 22.53 ? 73  GLN A CD  1 
ATOM   412  O  OE1 . GLN A 1 58  ? -13.838 -8.275  24.706 1.00 24.05 ? 73  GLN A OE1 1 
ATOM   413  N  NE2 . GLN A 1 58  ? -15.287 -8.052  22.993 1.00 22.37 ? 73  GLN A NE2 1 
ATOM   414  N  N   . VAL A 1 59  ? -9.440  -6.457  21.240 1.00 19.08 ? 74  VAL A N   1 
ATOM   415  C  CA  . VAL A 1 59  ? -8.035  -6.747  21.190 1.00 18.48 ? 74  VAL A CA  1 
ATOM   416  C  C   . VAL A 1 59  ? -7.195  -5.452  21.012 1.00 19.00 ? 74  VAL A C   1 
ATOM   417  O  O   . VAL A 1 59  ? -6.254  -5.216  21.748 1.00 18.58 ? 74  VAL A O   1 
ATOM   418  C  CB  . VAL A 1 59  ? -7.711  -7.701  20.051 1.00 17.72 ? 74  VAL A CB  1 
ATOM   419  C  CG1 . VAL A 1 59  ? -6.232  -7.804  19.845 1.00 19.20 ? 74  VAL A CG1 1 
ATOM   420  C  CG2 . VAL A 1 59  ? -8.233  -9.062  20.438 1.00 19.91 ? 74  VAL A CG2 1 
ATOM   421  N  N   . GLY A 1 60  ? -7.570  -4.609  20.060 1.00 17.46 ? 75  GLY A N   1 
ATOM   422  C  CA  . GLY A 1 60  ? -6.831  -3.392  19.834 1.00 19.14 ? 75  GLY A CA  1 
ATOM   423  C  C   . GLY A 1 60  ? -6.844  -2.521  21.032 1.00 20.07 ? 75  GLY A C   1 
ATOM   424  O  O   . GLY A 1 60  ? -5.804  -1.892  21.362 1.00 19.08 ? 75  GLY A O   1 
ATOM   425  N  N   . ARG A 1 61  ? -7.956  -2.545  21.754 1.00 20.97 ? 76  ARG A N   1 
ATOM   426  C  CA  . ARG A 1 61  ? -8.083  -1.745  22.923 1.00 21.20 ? 76  ARG A CA  1 
ATOM   427  C  C   . ARG A 1 61  ? -7.155  -2.252  24.021 1.00 20.82 ? 76  ARG A C   1 
ATOM   428  O  O   . ARG A 1 61  ? -6.462  -1.457  24.623 1.00 20.43 ? 76  ARG A O   1 
ATOM   429  C  CB  . ARG A 1 61  ? -9.506  -1.684  23.413 1.00 24.03 ? 76  ARG A CB  1 
ATOM   430  C  CG  . ARG A 1 61  ? -9.649  -0.813  24.568 1.00 27.73 ? 76  ARG A CG  1 
ATOM   431  C  CD  . ARG A 1 61  ? -10.278 -1.574  25.669 1.00 41.87 ? 76  ARG A CD  1 
ATOM   432  N  NE  . ARG A 1 61  ? -10.494 -0.878  26.927 1.00 46.37 ? 76  ARG A NE  1 
ATOM   433  C  CZ  . ARG A 1 61  ? -10.709 -1.513  28.084 1.00 49.32 ? 76  ARG A CZ  1 
ATOM   434  N  NH1 . ARG A 1 61  ? -10.879 -0.795  29.183 1.00 49.50 ? 76  ARG A NH1 1 
ATOM   435  N  NH2 . ARG A 1 61  ? -10.746 -2.850  28.151 1.00 47.94 ? 76  ARG A NH2 1 
ATOM   436  N  N   . GLN A 1 62  ? -7.112  -3.540  24.251 1.00 20.58 ? 77  GLN A N   1 
ATOM   437  C  CA  . GLN A 1 62  ? -6.182  -4.100  25.229 1.00 21.25 ? 77  GLN A CA  1 
ATOM   438  C  C   . GLN A 1 62  ? -4.719  -3.818  24.840 1.00 20.64 ? 77  GLN A C   1 
ATOM   439  O  O   . GLN A 1 62  ? -3.932  -3.514  25.694 1.00 19.99 ? 77  GLN A O   1 
ATOM   440  C  CB  . GLN A 1 62  ? -6.352  -5.614  25.352 1.00 21.91 ? 77  GLN A CB  1 
ATOM   441  C  CG  . GLN A 1 62  ? -7.531  -6.005  26.074 1.00 27.78 ? 77  GLN A CG  1 
ATOM   442  C  CD  . GLN A 1 62  ? -7.463  -5.534  27.506 1.00 28.95 ? 77  GLN A CD  1 
ATOM   443  O  OE1 . GLN A 1 62  ? -6.575  -5.947  28.259 1.00 36.34 ? 77  GLN A OE1 1 
ATOM   444  N  NE2 . GLN A 1 62  ? -8.348  -4.582  27.837 1.00 33.37 ? 77  GLN A NE2 1 
ATOM   445  N  N   . LEU A 1 63  ? -4.405  -3.891  23.529 1.00 18.94 ? 78  LEU A N   1 
ATOM   446  C  CA  . LEU A 1 63  ? -3.045  -3.700  23.071 1.00 19.16 ? 78  LEU A CA  1 
ATOM   447  C  C   . LEU A 1 63  ? -2.657  -2.232  23.344 1.00 18.88 ? 78  LEU A C   1 
ATOM   448  O  O   . LEU A 1 63  ? -1.550  -1.993  23.808 1.00 17.41 ? 78  LEU A O   1 
ATOM   449  C  CB  . LEU A 1 63  ? -2.866  -4.144  21.622 1.00 19.15 ? 78  LEU A CB  1 
ATOM   450  C  CG  . LEU A 1 63  ? -2.946  -5.660  21.486 1.00 20.47 ? 78  LEU A CG  1 
ATOM   451  C  CD1 . LEU A 1 63  ? -2.594  -6.022  20.120 1.00 22.70 ? 78  LEU A CD1 1 
ATOM   452  C  CD2 . LEU A 1 63  ? -2.036  -6.349  22.480 1.00 21.95 ? 78  LEU A CD2 1 
ATOM   453  N  N   . ALA A 1 64  ? -3.595  -1.296  23.138 1.00 18.69 ? 79  ALA A N   1 
ATOM   454  C  CA  . ALA A 1 64  ? -3.390  0.121   23.472 1.00 19.29 ? 79  ALA A CA  1 
ATOM   455  C  C   . ALA A 1 64  ? -3.115  0.327   24.946 1.00 20.53 ? 79  ALA A C   1 
ATOM   456  O  O   . ALA A 1 64  ? -2.189  1.025   25.280 1.00 20.21 ? 79  ALA A O   1 
ATOM   457  C  CB  . ALA A 1 64  ? -4.548  0.998   23.076 1.00 18.69 ? 79  ALA A CB  1 
ATOM   458  N  N   . ILE A 1 65  ? -3.883  -0.340  25.815 1.00 21.84 ? 80  ILE A N   1 
ATOM   459  C  CA  . ILE A 1 65  ? -3.710  -0.220  27.283 1.00 24.27 ? 80  ILE A CA  1 
ATOM   460  C  C   . ILE A 1 65  ? -2.399  -0.804  27.795 1.00 24.47 ? 80  ILE A C   1 
ATOM   461  O  O   . ILE A 1 65  ? -1.657  -0.166  28.548 1.00 26.26 ? 80  ILE A O   1 
ATOM   462  C  CB  . ILE A 1 65  ? -4.859  -0.910  27.944 1.00 25.46 ? 80  ILE A CB  1 
ATOM   463  C  CG1 . ILE A 1 65  ? -6.117  -0.097  27.682 1.00 26.79 ? 80  ILE A CG1 1 
ATOM   464  C  CG2 . ILE A 1 65  ? -4.576  -1.128  29.470 1.00 28.77 ? 80  ILE A CG2 1 
ATOM   465  C  CD1 . ILE A 1 65  ? -7.293  -0.768  28.079 1.00 28.58 ? 80  ILE A CD1 1 
ATOM   466  N  N   . ILE A 1 66  ? -2.064  -2.007  27.370 1.00 24.06 ? 81  ILE A N   1 
ATOM   467  C  CA  . ILE A 1 66  ? -0.821  -2.622  27.778 1.00 26.52 ? 81  ILE A CA  1 
ATOM   468  C  C   . ILE A 1 66  ? 0.421   -1.963  27.118 1.00 26.93 ? 81  ILE A C   1 
ATOM   469  O  O   . ILE A 1 66  ? 1.476   -1.902  27.708 1.00 28.50 ? 81  ILE A O   1 
ATOM   470  C  CB  . ILE A 1 66  ? -0.898  -4.192  27.626 1.00 26.64 ? 81  ILE A CB  1 
ATOM   471  C  CG1 . ILE A 1 66  ? -0.831  -4.623  26.197 1.00 27.55 ? 81  ILE A CG1 1 
ATOM   472  C  CG2 . ILE A 1 66  ? -2.188  -4.744  28.266 1.00 28.07 ? 81  ILE A CG2 1 
ATOM   473  C  CD1 . ILE A 1 66  ? 0.181   -5.612  26.026 1.00 32.99 ? 81  ILE A CD1 1 
ATOM   474  N  N   . GLY A 1 67  ? 0.280   -1.404  25.933 1.00 26.45 ? 82  GLY A N   1 
ATOM   475  C  CA  . GLY A 1 67  ? 1.363   -0.725  25.267 1.00 27.53 ? 82  GLY A CA  1 
ATOM   476  C  C   . GLY A 1 67  ? 1.707   0.550   26.023 1.00 29.27 ? 82  GLY A C   1 
ATOM   477  O  O   . GLY A 1 67  ? 2.832   0.976   26.023 1.00 29.26 ? 82  GLY A O   1 
ATOM   478  N  N   . ASP A 1 68  ? 0.732   1.152   26.691 1.00 32.20 ? 83  ASP A N   1 
ATOM   479  C  CA  . ASP A 1 68  ? 1.009   2.363   27.469 1.00 34.55 ? 83  ASP A CA  1 
ATOM   480  C  C   . ASP A 1 68  ? 2.203   2.156   28.449 1.00 35.55 ? 83  ASP A C   1 
ATOM   481  O  O   . ASP A 1 68  ? 2.933   3.093   28.758 1.00 36.19 ? 83  ASP A O   1 
ATOM   482  C  CB  . ASP A 1 68  ? -0.246  2.847   28.203 1.00 35.40 ? 83  ASP A CB  1 
ATOM   483  C  CG  . ASP A 1 68  ? 0.020   4.126   28.977 1.00 39.33 ? 83  ASP A CG  1 
ATOM   484  O  OD1 . ASP A 1 68  ? 0.013   5.217   28.377 1.00 43.17 ? 83  ASP A OD1 1 
ATOM   485  O  OD2 . ASP A 1 68  ? 0.337   4.136   30.173 1.00 43.32 ? 83  ASP A OD2 1 
ATOM   486  N  N   . ASP A 1 69  ? 2.369   0.935   28.938 1.00 36.84 ? 84  ASP A N   1 
ATOM   487  C  CA  . ASP A 1 69  ? 3.384   0.600   29.928 1.00 39.71 ? 84  ASP A CA  1 
ATOM   488  C  C   . ASP A 1 69  ? 4.676   0.081   29.272 1.00 39.77 ? 84  ASP A C   1 
ATOM   489  O  O   . ASP A 1 69  ? 5.743   0.592   29.510 1.00 41.24 ? 84  ASP A O   1 
ATOM   490  C  CB  . ASP A 1 69  ? 2.768   -0.417  30.864 1.00 40.15 ? 84  ASP A CB  1 
ATOM   491  C  CG  . ASP A 1 69  ? 1.379   0.026   31.322 1.00 47.31 ? 84  ASP A CG  1 
ATOM   492  O  OD1 . ASP A 1 69  ? 0.357   -0.568  30.850 1.00 54.63 ? 84  ASP A OD1 1 
ATOM   493  O  OD2 . ASP A 1 69  ? 1.211   1.032   32.094 1.00 51.93 ? 84  ASP A OD2 1 
ATOM   494  N  N   . ILE A 1 70  ? 4.538   -0.897  28.392 1.00 40.41 ? 85  ILE A N   1 
ATOM   495  C  CA  . ILE A 1 70  ? 5.683   -1.627  27.850 1.00 41.01 ? 85  ILE A CA  1 
ATOM   496  C  C   . ILE A 1 70  ? 6.307   -1.033  26.611 1.00 41.28 ? 85  ILE A C   1 
ATOM   497  O  O   . ILE A 1 70  ? 7.427   -1.377  26.288 1.00 42.38 ? 85  ILE A O   1 
ATOM   498  C  CB  . ILE A 1 70  ? 5.342   -3.140  27.651 1.00 40.65 ? 85  ILE A CB  1 
ATOM   499  C  CG1 . ILE A 1 70  ? 4.118   -3.398  26.756 1.00 42.22 ? 85  ILE A CG1 1 
ATOM   500  C  CG2 . ILE A 1 70  ? 5.088   -3.744  28.987 1.00 43.47 ? 85  ILE A CG2 1 
ATOM   501  C  CD1 . ILE A 1 70  ? 4.376   -3.403  25.354 1.00 42.72 ? 85  ILE A CD1 1 
ATOM   502  N  N   . ASN A 1 71  ? 5.608   -0.143  25.920 1.00 40.94 ? 86  ASN A N   1 
ATOM   503  C  CA  . ASN A 1 71  ? 6.042   0.334   24.623 1.00 40.88 ? 86  ASN A CA  1 
ATOM   504  C  C   . ASN A 1 71  ? 6.738   1.668   24.864 1.00 41.09 ? 86  ASN A C   1 
ATOM   505  O  O   . ASN A 1 71  ? 7.199   2.299   23.922 1.00 40.24 ? 86  ASN A O   1 
ATOM   506  C  CB  . ASN A 1 71  ? 4.794   0.468   23.684 1.00 40.65 ? 86  ASN A CB  1 
ATOM   507  C  CG  . ASN A 1 71  ? 5.154   0.702   22.197 1.00 40.52 ? 86  ASN A CG  1 
ATOM   508  O  OD1 . ASN A 1 71  ? 5.728   -0.149  21.560 1.00 39.41 ? 86  ASN A OD1 1 
ATOM   509  N  ND2 . ASN A 1 71  ? 4.773   1.863   21.659 1.00 38.42 ? 86  ASN A ND2 1 
ATOM   510  N  N   . ARG A 1 72  ? 6.832   2.111   26.131 1.00 42.03 ? 87  ARG A N   1 
ATOM   511  C  CA  . ARG A 1 72  ? 7.358   3.476   26.438 1.00 42.83 ? 87  ARG A CA  1 
ATOM   512  C  C   . ARG A 1 72  ? 8.687   3.815   25.797 1.00 43.32 ? 87  ARG A C   1 
ATOM   513  O  O   . ARG A 1 72  ? 8.894   4.916   25.250 1.00 44.35 ? 87  ARG A O   1 
ATOM   514  C  CB  . ARG A 1 72  ? 7.536   3.678   27.939 1.00 43.11 ? 87  ARG A CB  1 
ATOM   515  C  CG  . ARG A 1 72  ? 6.541   4.609   28.520 1.00 43.25 ? 87  ARG A CG  1 
ATOM   516  C  CD  . ARG A 1 72  ? 6.440   4.584   30.044 1.00 43.35 ? 87  ARG A CD  1 
ATOM   517  N  NE  . ARG A 1 72  ? 5.034   4.594   30.414 1.00 43.18 ? 87  ARG A NE  1 
ATOM   518  C  CZ  . ARG A 1 72  ? 4.576   4.670   31.641 1.00 42.87 ? 87  ARG A CZ  1 
ATOM   519  N  NH1 . ARG A 1 72  ? 5.409   4.769   32.660 1.00 40.61 ? 87  ARG A NH1 1 
ATOM   520  N  NH2 . ARG A 1 72  ? 3.266   4.645   31.843 1.00 44.54 ? 87  ARG A NH2 1 
ATOM   521  N  N   . ARG A 1 73  ? 9.608   2.866   25.856 1.00 44.18 ? 88  ARG A N   1 
ATOM   522  C  CA  . ARG A 1 73  ? 10.944  3.150   25.371 1.00 45.18 ? 88  ARG A CA  1 
ATOM   523  C  C   . ARG A 1 73  ? 11.026  3.079   23.825 1.00 43.85 ? 88  ARG A C   1 
ATOM   524  O  O   . ARG A 1 73  ? 11.727  3.906   23.231 1.00 43.73 ? 88  ARG A O   1 
ATOM   525  C  CB  . ARG A 1 73  ? 11.956  2.233   26.070 1.00 46.93 ? 88  ARG A CB  1 
ATOM   526  C  CG  . ARG A 1 73  ? 12.571  1.212   25.170 1.00 50.75 ? 88  ARG A CG  1 
ATOM   527  C  CD  . ARG A 1 73  ? 11.790  -0.119  24.972 1.00 54.96 ? 88  ARG A CD  1 
ATOM   528  N  NE  . ARG A 1 73  ? 12.681  -0.972  24.183 1.00 58.88 ? 88  ARG A NE  1 
ATOM   529  C  CZ  . ARG A 1 73  ? 12.599  -2.276  24.053 1.00 60.34 ? 88  ARG A CZ  1 
ATOM   530  N  NH1 . ARG A 1 73  ? 11.632  -2.950  24.627 1.00 60.54 ? 88  ARG A NH1 1 
ATOM   531  N  NH2 . ARG A 1 73  ? 13.501  -2.900  23.304 1.00 62.08 ? 88  ARG A NH2 1 
ATOM   532  N  N   . TYR A 1 74  ? 10.329  2.118   23.187 1.00 42.28 ? 89  TYR A N   1 
ATOM   533  C  CA  . TYR A 1 74  ? 10.257  2.094   21.693 1.00 41.02 ? 89  TYR A CA  1 
ATOM   534  C  C   . TYR A 1 74  ? 9.647   3.462   21.213 1.00 39.68 ? 89  TYR A C   1 
ATOM   535  O  O   . TYR A 1 74  ? 10.117  4.115   20.266 1.00 40.35 ? 89  TYR A O   1 
ATOM   536  C  CB  . TYR A 1 74  ? 9.379   0.961   21.176 1.00 41.15 ? 89  TYR A CB  1 
ATOM   537  C  CG  . TYR A 1 74  ? 9.961   -0.444  21.051 1.00 40.76 ? 89  TYR A CG  1 
ATOM   538  C  CD1 . TYR A 1 74  ? 11.062  -0.728  20.287 1.00 41.61 ? 89  TYR A CD1 1 
ATOM   539  C  CD2 . TYR A 1 74  ? 9.298   -1.490  21.623 1.00 45.17 ? 89  TYR A CD2 1 
ATOM   540  C  CE1 . TYR A 1 74  ? 11.522  -2.028  20.169 1.00 44.84 ? 89  TYR A CE1 1 
ATOM   541  C  CE2 . TYR A 1 74  ? 9.726   -2.806  21.516 1.00 47.13 ? 89  TYR A CE2 1 
ATOM   542  C  CZ  . TYR A 1 74  ? 10.832  -3.088  20.810 1.00 48.91 ? 89  TYR A CZ  1 
ATOM   543  O  OH  . TYR A 1 74  ? 11.206  -4.443  20.785 1.00 50.17 ? 89  TYR A OH  1 
ATOM   544  N  N   . ASP A 1 75  ? 8.635   3.904   21.939 1.00 37.97 ? 90  ASP A N   1 
ATOM   545  C  CA  . ASP A 1 75  ? 7.880   5.076   21.563 1.00 37.18 ? 90  ASP A CA  1 
ATOM   546  C  C   . ASP A 1 75  ? 8.682   6.340   21.592 1.00 37.21 ? 90  ASP A C   1 
ATOM   547  O  O   . ASP A 1 75  ? 8.569   7.214   20.724 1.00 35.08 ? 90  ASP A O   1 
ATOM   548  C  CB  . ASP A 1 75  ? 6.746   5.274   22.538 1.00 36.71 ? 90  ASP A CB  1 
ATOM   549  C  CG  . ASP A 1 75  ? 5.813   6.312   22.064 1.00 36.22 ? 90  ASP A CG  1 
ATOM   550  O  OD1 . ASP A 1 75  ? 5.595   7.354   22.739 1.00 31.36 ? 90  ASP A OD1 1 
ATOM   551  O  OD2 . ASP A 1 75  ? 5.302   6.164   20.960 1.00 30.95 ? 90  ASP A OD2 1 
ATOM   552  N  N   . SER A 1 76  ? 9.423   6.495   22.684 1.00 38.33 ? 91  SER A N   1 
ATOM   553  C  CA  . SER A 1 76  ? 10.109  7.755   22.920 1.00 39.35 ? 91  SER A CA  1 
ATOM   554  C  C   . SER A 1 76  ? 11.125  7.950   21.803 1.00 38.77 ? 91  SER A C   1 
ATOM   555  O  O   . SER A 1 76  ? 11.436  9.079   21.405 1.00 40.49 ? 91  SER A O   1 
ATOM   556  C  CB  . SER A 1 76  ? 10.827  7.746   24.276 1.00 39.37 ? 91  SER A CB  1 
ATOM   557  O  OG  . SER A 1 76  ? 11.970  8.559   24.158 1.00 40.76 ? 91  SER A OG  1 
ATOM   558  N  N   . GLU A 1 77  ? 11.672  6.848   21.308 1.00 38.51 ? 92  GLU A N   1 
ATOM   559  C  CA  . GLU A 1 77  ? 12.596  6.940   20.221 1.00 38.18 ? 92  GLU A CA  1 
ATOM   560  C  C   . GLU A 1 77  ? 11.924  7.203   18.909 1.00 37.85 ? 92  GLU A C   1 
ATOM   561  O  O   . GLU A 1 77  ? 12.483  7.965   18.090 1.00 36.77 ? 92  GLU A O   1 
ATOM   562  C  CB  . GLU A 1 77  ? 13.386  5.651   20.115 1.00 39.49 ? 92  GLU A CB  1 
ATOM   563  C  CG  . GLU A 1 77  ? 14.755  5.866   20.771 1.00 43.81 ? 92  GLU A CG  1 
ATOM   564  C  CD  . GLU A 1 77  ? 15.377  4.602   21.289 1.00 50.20 ? 92  GLU A CD  1 
ATOM   565  O  OE1 . GLU A 1 77  ? 16.252  4.737   22.213 1.00 55.38 ? 92  GLU A OE1 1 
ATOM   566  O  OE2 . GLU A 1 77  ? 14.985  3.502   20.780 1.00 51.13 ? 92  GLU A OE2 1 
ATOM   567  N  N   . PHE A 1 78  ? 10.772  6.524   18.686 1.00 36.85 ? 93  PHE A N   1 
ATOM   568  C  CA  . PHE A 1 78  ? 10.010  6.606   17.424 1.00 36.13 ? 93  PHE A CA  1 
ATOM   569  C  C   . PHE A 1 78  ? 9.748   8.116   17.311 1.00 36.51 ? 93  PHE A C   1 
ATOM   570  O  O   . PHE A 1 78  ? 9.939   8.721   16.277 1.00 36.81 ? 93  PHE A O   1 
ATOM   571  C  CB  . PHE A 1 78  ? 8.645   5.825   17.478 1.00 35.72 ? 93  PHE A CB  1 
ATOM   572  C  CG  . PHE A 1 78  ? 8.721   4.287   17.388 1.00 34.35 ? 93  PHE A CG  1 
ATOM   573  C  CD1 . PHE A 1 78  ? 9.704   3.592   16.668 1.00 32.86 ? 93  PHE A CD1 1 
ATOM   574  C  CD2 . PHE A 1 78  ? 7.722   3.518   18.030 1.00 33.59 ? 93  PHE A CD2 1 
ATOM   575  C  CE1 . PHE A 1 78  ? 9.691   2.161   16.586 1.00 32.49 ? 93  PHE A CE1 1 
ATOM   576  C  CE2 . PHE A 1 78  ? 7.715   2.093   17.949 1.00 31.48 ? 93  PHE A CE2 1 
ATOM   577  C  CZ  . PHE A 1 78  ? 8.709   1.432   17.246 1.00 33.34 ? 93  PHE A CZ  1 
ATOM   578  N  N   . GLN A 1 79  ? 9.379   8.733   18.430 1.00 37.89 ? 94  GLN A N   1 
ATOM   579  C  CA  . GLN A 1 79  ? 8.985   10.131  18.445 1.00 40.44 ? 94  GLN A CA  1 
ATOM   580  C  C   . GLN A 1 79  ? 10.155  11.041  18.078 1.00 40.26 ? 94  GLN A C   1 
ATOM   581  O  O   . GLN A 1 79  ? 10.001  11.971  17.299 1.00 41.62 ? 94  GLN A O   1 
ATOM   582  C  CB  . GLN A 1 79  ? 8.417   10.480  19.812 1.00 41.33 ? 94  GLN A CB  1 
ATOM   583  C  CG  . GLN A 1 79  ? 7.063   11.112  19.833 1.00 43.70 ? 94  GLN A CG  1 
ATOM   584  C  CD  . GLN A 1 79  ? 6.804   11.707  21.200 1.00 47.87 ? 94  GLN A CD  1 
ATOM   585  O  OE1 . GLN A 1 79  ? 6.555   12.913  21.333 1.00 54.97 ? 94  GLN A OE1 1 
ATOM   586  N  NE2 . GLN A 1 79  ? 6.940   10.878  22.234 1.00 49.62 ? 94  GLN A NE2 1 
ATOM   587  N  N   . THR A 1 80  ? 11.344  10.733  18.578 1.00 40.30 ? 95  THR A N   1 
ATOM   588  C  CA  . THR A 1 80  ? 12.534  11.461  18.149 1.00 40.66 ? 95  THR A CA  1 
ATOM   589  C  C   . THR A 1 80  ? 12.932  11.162  16.653 1.00 40.05 ? 95  THR A C   1 
ATOM   590  O  O   . THR A 1 80  ? 13.214  12.074  15.858 1.00 38.74 ? 95  THR A O   1 
ATOM   591  C  CB  . THR A 1 80  ? 13.710  11.138  19.108 1.00 40.74 ? 95  THR A CB  1 
ATOM   592  O  OG1 . THR A 1 80  ? 13.389  11.558  20.442 1.00 43.36 ? 95  THR A OG1 1 
ATOM   593  C  CG2 . THR A 1 80  ? 14.920  11.961  18.778 1.00 42.62 ? 95  THR A CG2 1 
ATOM   594  N  N   . MET A 1 81  ? 12.962  9.873   16.312 1.00 39.70 ? 96  MET A N   1 
ATOM   595  C  CA  . MET A 1 81  ? 13.497  9.438   15.043 1.00 40.39 ? 96  MET A CA  1 
ATOM   596  C  C   . MET A 1 81  ? 12.576  9.744   13.829 1.00 40.13 ? 96  MET A C   1 
ATOM   597  O  O   . MET A 1 81  ? 13.062  9.873   12.693 1.00 40.88 ? 96  MET A O   1 
ATOM   598  C  CB  . MET A 1 81  ? 13.884  7.968   15.138 1.00 41.45 ? 96  MET A CB  1 
ATOM   599  C  CG  . MET A 1 81  ? 12.818  6.982   15.532 1.00 44.15 ? 96  MET A CG  1 
ATOM   600  S  SD  . MET A 1 81  ? 13.452  5.377   16.393 1.00 45.52 ? 96  MET A SD  1 
ATOM   601  C  CE  . MET A 1 81  ? 13.868  4.324   14.793 1.00 46.63 ? 96  MET A CE  1 
ATOM   602  N  N   . LEU A 1 82  ? 11.272  9.941   14.078 1.00 37.48 ? 97  LEU A N   1 
ATOM   603  C  CA  . LEU A 1 82  ? 10.347  10.374  13.019 1.00 36.22 ? 97  LEU A CA  1 
ATOM   604  C  C   . LEU A 1 82  ? 10.439  11.834  12.750 1.00 36.30 ? 97  LEU A C   1 
ATOM   605  O  O   . LEU A 1 82  ? 10.091  12.210  11.648 1.00 33.49 ? 97  LEU A O   1 
ATOM   606  C  CB  . LEU A 1 82  ? 8.871   10.032  13.318 1.00 34.33 ? 97  LEU A CB  1 
ATOM   607  C  CG  . LEU A 1 82  ? 8.556   8.551   13.158 1.00 33.27 ? 97  LEU A CG  1 
ATOM   608  C  CD1 . LEU A 1 82  ? 7.397   8.115   14.068 1.00 34.28 ? 97  LEU A CD1 1 
ATOM   609  C  CD2 . LEU A 1 82  ? 8.244   8.208   11.736 1.00 32.74 ? 97  LEU A CD2 1 
ATOM   610  N  N   . GLN A 1 83  ? 10.870  12.662  13.726 1.00 36.98 ? 98  GLN A N   1 
ATOM   611  C  CA  . GLN A 1 83  ? 10.862  14.133  13.565 1.00 38.57 ? 98  GLN A CA  1 
ATOM   612  C  C   . GLN A 1 83  ? 11.440  14.565  12.223 1.00 39.22 ? 98  GLN A C   1 
ATOM   613  O  O   . GLN A 1 83  ? 10.974  15.575  11.643 1.00 39.15 ? 98  GLN A O   1 
ATOM   614  C  CB  . GLN A 1 83  ? 11.607  14.881  14.699 1.00 38.48 ? 98  GLN A CB  1 
ATOM   615  C  CG  . GLN A 1 83  ? 10.857  14.847  16.023 1.00 39.48 ? 98  GLN A CG  1 
ATOM   616  C  CD  . GLN A 1 83  ? 11.510  15.690  17.141 1.00 40.45 ? 98  GLN A CD  1 
ATOM   617  O  OE1 . GLN A 1 83  ? 12.191  16.658  16.856 1.00 36.01 ? 98  GLN A OE1 1 
ATOM   618  N  NE2 . GLN A 1 83  ? 11.246  15.327  18.418 1.00 39.97 ? 98  GLN A NE2 1 
ATOM   619  N  N   . HIS A 1 84  ? 12.401  13.785  11.724 1.00 39.90 ? 99  HIS A N   1 
ATOM   620  C  CA  . HIS A 1 84  ? 13.062  14.037  10.437 1.00 42.13 ? 99  HIS A CA  1 
ATOM   621  C  C   . HIS A 1 84  ? 12.385  13.509  9.161  1.00 42.19 ? 99  HIS A C   1 
ATOM   622  O  O   . HIS A 1 84  ? 12.926  13.716  8.077  1.00 43.04 ? 99  HIS A O   1 
ATOM   623  C  CB  . HIS A 1 84  ? 14.447  13.390  10.458 1.00 43.69 ? 99  HIS A CB  1 
ATOM   624  C  CG  . HIS A 1 84  ? 14.427  11.923  10.141 1.00 49.00 ? 99  HIS A CG  1 
ATOM   625  N  ND1 . HIS A 1 84  ? 13.737  11.001  10.903 1.00 54.11 ? 99  HIS A ND1 1 
ATOM   626  C  CD2 . HIS A 1 84  ? 14.961  11.227  9.108  1.00 54.51 ? 99  HIS A CD2 1 
ATOM   627  C  CE1 . HIS A 1 84  ? 13.868  9.800   10.365 1.00 56.54 ? 99  HIS A CE1 1 
ATOM   628  N  NE2 . HIS A 1 84  ? 14.612  9.907   9.278  1.00 56.85 ? 99  HIS A NE2 1 
ATOM   629  N  N   . LEU A 1 85  ? 11.253  12.805  9.251  1.00 41.16 ? 100 LEU A N   1 
ATOM   630  C  CA  . LEU A 1 85  ? 10.618  12.189  8.065  1.00 40.25 ? 100 LEU A CA  1 
ATOM   631  C  C   . LEU A 1 85  ? 9.855   13.225  7.139  1.00 40.40 ? 100 LEU A C   1 
ATOM   632  O  O   . LEU A 1 85  ? 9.078   14.047  7.643  1.00 39.55 ? 100 LEU A O   1 
ATOM   633  C  CB  . LEU A 1 85  ? 9.658   11.059  8.548  1.00 39.49 ? 100 LEU A CB  1 
ATOM   634  C  CG  . LEU A 1 85  ? 8.582   10.473  7.579  1.00 38.45 ? 100 LEU A CG  1 
ATOM   635  C  CD1 . LEU A 1 85  ? 9.143   9.796   6.322  1.00 38.84 ? 100 LEU A CD1 1 
ATOM   636  C  CD2 . LEU A 1 85  ? 7.718   9.524   8.365  1.00 36.16 ? 100 LEU A CD2 1 
ATOM   637  N  N   . GLN A 1 86  ? 10.021  13.138  5.807  1.00 40.49 ? 101 GLN A N   1 
ATOM   638  C  CA  . GLN A 1 86  ? 9.239   13.971  4.858  1.00 40.26 ? 101 GLN A CA  1 
ATOM   639  C  C   . GLN A 1 86  ? 7.792   13.464  4.551  1.00 39.03 ? 101 GLN A C   1 
ATOM   640  O  O   . GLN A 1 86  ? 7.596   12.287  4.372  1.00 38.68 ? 101 GLN A O   1 
ATOM   641  C  CB  . GLN A 1 86  ? 10.011  14.090  3.547  1.00 41.41 ? 101 GLN A CB  1 
ATOM   642  C  CG  . GLN A 1 86  ? 11.133  15.086  3.595  1.00 44.86 ? 101 GLN A CG  1 
ATOM   643  C  CD  . GLN A 1 86  ? 10.561  16.499  3.653  1.00 50.50 ? 101 GLN A CD  1 
ATOM   644  O  OE1 . GLN A 1 86  ? 9.442   16.738  3.160  1.00 55.80 ? 101 GLN A OE1 1 
ATOM   645  N  NE2 . GLN A 1 86  ? 11.291  17.421  4.273  1.00 53.45 ? 101 GLN A NE2 1 
ATOM   646  N  N   . PRO A 1 87  ? 6.767   14.340  4.496  1.00 37.46 ? 102 PRO A N   1 
ATOM   647  C  CA  . PRO A 1 87  ? 5.394   13.872  4.269  1.00 35.37 ? 102 PRO A CA  1 
ATOM   648  C  C   . PRO A 1 87  ? 5.088   13.619  2.828  1.00 32.70 ? 102 PRO A C   1 
ATOM   649  O  O   . PRO A 1 87  ? 4.262   14.306  2.209  1.00 32.67 ? 102 PRO A O   1 
ATOM   650  C  CB  . PRO A 1 87  ? 4.520   14.999  4.863  1.00 36.42 ? 102 PRO A CB  1 
ATOM   651  C  CG  . PRO A 1 87  ? 5.285   16.255  4.614  1.00 37.75 ? 102 PRO A CG  1 
ATOM   652  C  CD  . PRO A 1 87  ? 6.782   15.806  4.665  1.00 38.61 ? 102 PRO A CD  1 
ATOM   653  N  N   . THR A 1 88  ? 5.759   12.626  2.272  1.00 28.40 ? 103 THR A N   1 
ATOM   654  C  CA  . THR A 1 88  ? 5.285   12.040  1.043  1.00 26.04 ? 103 THR A CA  1 
ATOM   655  C  C   . THR A 1 88  ? 5.099   10.584  1.382  1.00 22.53 ? 103 THR A C   1 
ATOM   656  O  O   . THR A 1 88  ? 5.750   10.036  2.327  1.00 22.52 ? 103 THR A O   1 
ATOM   657  C  CB  . THR A 1 88  ? 6.283   12.114  -0.142 1.00 25.80 ? 103 THR A CB  1 
ATOM   658  O  OG1 . THR A 1 88  ? 7.469   11.373  0.185  1.00 26.82 ? 103 THR A OG1 1 
ATOM   659  C  CG2 . THR A 1 88  ? 6.778   13.486  -0.364 1.00 27.57 ? 103 THR A CG2 1 
ATOM   660  N  N   . ALA A 1 89  ? 4.298   10.013  0.523  1.00 20.69 ? 104 ALA A N   1 
ATOM   661  C  CA  . ALA A 1 89  ? 3.915   8.651   0.608  1.00 19.73 ? 104 ALA A CA  1 
ATOM   662  C  C   . ALA A 1 89  ? 5.175   7.794   0.498  1.00 20.81 ? 104 ALA A C   1 
ATOM   663  O  O   . ALA A 1 89  ? 5.322   6.787   1.213  1.00 18.95 ? 104 ALA A O   1 
ATOM   664  C  CB  . ALA A 1 89  ? 2.878   8.353   -0.438 1.00 20.50 ? 104 ALA A CB  1 
ATOM   665  N  N   . GLU A 1 90  ? 6.101   8.184   -0.415 1.00 18.22 ? 105 GLU A N   1 
ATOM   666  C  CA  . GLU A 1 90  ? 7.254   7.410   -0.653 1.00 18.65 ? 105 GLU A CA  1 
ATOM   667  C  C   . GLU A 1 90  ? 8.203   7.392   0.536  1.00 18.31 ? 105 GLU A C   1 
ATOM   668  O  O   . GLU A 1 90  ? 8.710   6.337   0.864  1.00 17.74 ? 105 GLU A O   1 
ATOM   669  C  CB  . GLU A 1 90  ? 7.969   7.874   -1.944 1.00 18.87 ? 105 GLU A CB  1 
ATOM   670  C  CG  . GLU A 1 90  ? 9.016   6.851   -2.395 1.00 22.25 ? 105 GLU A CG  1 
ATOM   671  C  CD  . GLU A 1 90  ? 8.459   5.475   -2.697 1.00 22.58 ? 105 GLU A CD  1 
ATOM   672  O  OE1 . GLU A 1 90  ? 7.233   5.294   -2.826 1.00 19.57 ? 105 GLU A OE1 1 
ATOM   673  O  OE2 . GLU A 1 90  ? 9.269   4.552   -2.765 1.00 29.89 ? 105 GLU A OE2 1 
ATOM   674  N  N   . ASN A 1 91  ? 8.462   8.570   1.123  1.00 19.08 ? 106 ASN A N   1 
ATOM   675  C  CA  . ASN A 1 91  ? 9.279   8.677   2.330  1.00 20.49 ? 106 ASN A CA  1 
ATOM   676  C  C   . ASN A 1 91  ? 8.656   7.887   3.437  1.00 18.64 ? 106 ASN A C   1 
ATOM   677  O  O   . ASN A 1 91  ? 9.367   7.163   4.154  1.00 17.71 ? 106 ASN A O   1 
ATOM   678  C  CB  . ASN A 1 91  ? 9.530   10.110  2.760  1.00 22.01 ? 106 ASN A CB  1 
ATOM   679  C  CG  . ASN A 1 91  ? 10.265  10.906  1.641  1.00 30.17 ? 106 ASN A CG  1 
ATOM   680  O  OD1 . ASN A 1 91  ? 11.281  10.441  1.141  1.00 34.72 ? 106 ASN A OD1 1 
ATOM   681  N  ND2 . ASN A 1 91  ? 9.685   12.058  1.191  1.00 34.13 ? 106 ASN A ND2 1 
ATOM   682  N  N   . ALA A 1 92  ? 7.352   8.048   3.581  1.00 17.54 ? 107 ALA A N   1 
ATOM   683  C  CA  . ALA A 1 92  ? 6.605   7.303   4.627  1.00 16.84 ? 107 ALA A CA  1 
ATOM   684  C  C   . ALA A 1 92  ? 6.812   5.793   4.517  1.00 17.98 ? 107 ALA A C   1 
ATOM   685  O  O   . ALA A 1 92  ? 7.095   5.090   5.507  1.00 20.04 ? 107 ALA A O   1 
ATOM   686  C  CB  . ALA A 1 92  ? 5.174   7.630   4.596  1.00 18.33 ? 107 ALA A CB  1 
ATOM   687  N  N   . TYR A 1 93  ? 6.628   5.294   3.318  1.00 17.95 ? 108 TYR A N   1 
ATOM   688  C  CA  . TYR A 1 93  ? 6.756   3.883   3.070  1.00 16.96 ? 108 TYR A CA  1 
ATOM   689  C  C   . TYR A 1 93  ? 8.152   3.402   3.275  1.00 17.44 ? 108 TYR A C   1 
ATOM   690  O  O   . TYR A 1 93  ? 8.368   2.382   3.934  1.00 18.22 ? 108 TYR A O   1 
ATOM   691  C  CB  . TYR A 1 93  ? 6.373   3.573   1.686  1.00 15.37 ? 108 TYR A CB  1 
ATOM   692  C  CG  . TYR A 1 93  ? 6.691   2.157   1.286  1.00 20.45 ? 108 TYR A CG  1 
ATOM   693  C  CD1 . TYR A 1 93  ? 5.921   1.131   1.790  1.00 21.44 ? 108 TYR A CD1 1 
ATOM   694  C  CD2 . TYR A 1 93  ? 7.785   1.854   0.472  1.00 22.86 ? 108 TYR A CD2 1 
ATOM   695  C  CE1 . TYR A 1 93  ? 6.136   -0.124  1.454  1.00 24.97 ? 108 TYR A CE1 1 
ATOM   696  C  CE2 . TYR A 1 93  ? 8.042   0.532   0.134  1.00 23.29 ? 108 TYR A CE2 1 
ATOM   697  C  CZ  . TYR A 1 93  ? 7.215   -0.438  0.704  1.00 23.01 ? 108 TYR A CZ  1 
ATOM   698  O  OH  . TYR A 1 93  ? 7.296   -1.793  0.484  1.00 31.54 ? 108 TYR A OH  1 
ATOM   699  N  N   . GLU A 1 94  ? 9.147   4.111   2.744  1.00 17.97 ? 109 GLU A N   1 
ATOM   700  C  CA  . GLU A 1 94  ? 10.528  3.759   2.949  1.00 19.56 ? 109 GLU A CA  1 
ATOM   701  C  C   . GLU A 1 94  ? 10.921  3.689   4.435  1.00 18.83 ? 109 GLU A C   1 
ATOM   702  O  O   . GLU A 1 94  ? 11.575  2.767   4.859  1.00 20.33 ? 109 GLU A O   1 
ATOM   703  C  CB  . GLU A 1 94  ? 11.457  4.747   2.188  1.00 20.39 ? 109 GLU A CB  1 
ATOM   704  C  CG  . GLU A 1 94  ? 11.372  4.533   0.667  1.00 24.85 ? 109 GLU A CG  1 
ATOM   705  C  CD  . GLU A 1 94  ? 12.291  5.501   -0.069 1.00 36.32 ? 109 GLU A CD  1 
ATOM   706  O  OE1 . GLU A 1 94  ? 13.371  5.055   -0.448 1.00 45.62 ? 109 GLU A OE1 1 
ATOM   707  O  OE2 . GLU A 1 94  ? 11.969  6.691   -0.219 1.00 40.74 ? 109 GLU A OE2 1 
ATOM   708  N  N   . TYR A 1 95  ? 10.526  4.694   5.215  1.00 19.30 ? 110 TYR A N   1 
ATOM   709  C  CA  . TYR A 1 95  ? 10.806  4.762   6.598  1.00 22.00 ? 110 TYR A CA  1 
ATOM   710  C  C   . TYR A 1 95  ? 10.055  3.655   7.397  1.00 21.30 ? 110 TYR A C   1 
ATOM   711  O  O   . TYR A 1 95  ? 10.671  2.975   8.234  1.00 18.47 ? 110 TYR A O   1 
ATOM   712  C  CB  . TYR A 1 95  ? 10.482  6.172   7.124  1.00 24.59 ? 110 TYR A CB  1 
ATOM   713  C  CG  . TYR A 1 95  ? 11.234  6.393   8.462  1.00 32.21 ? 110 TYR A CG  1 
ATOM   714  C  CD1 . TYR A 1 95  ? 12.638  6.513   8.511  1.00 41.43 ? 110 TYR A CD1 1 
ATOM   715  C  CD2 . TYR A 1 95  ? 10.554  6.325   9.659  1.00 40.61 ? 110 TYR A CD2 1 
ATOM   716  C  CE1 . TYR A 1 95  ? 13.343  6.620   9.737  1.00 44.32 ? 110 TYR A CE1 1 
ATOM   717  C  CE2 . TYR A 1 95  ? 11.242  6.461   10.910 1.00 42.95 ? 110 TYR A CE2 1 
ATOM   718  C  CZ  . TYR A 1 95  ? 12.624  6.608   10.938 1.00 45.42 ? 110 TYR A CZ  1 
ATOM   719  O  OH  . TYR A 1 95  ? 13.248  6.712   12.164 1.00 44.85 ? 110 TYR A OH  1 
ATOM   720  N  N   . PHE A 1 96  ? 8.797   3.401   7.001  1.00 19.81 ? 111 PHE A N   1 
ATOM   721  C  CA  . PHE A 1 96  ? 8.004   2.390   7.645  1.00 20.04 ? 111 PHE A CA  1 
ATOM   722  C  C   . PHE A 1 96  ? 8.668   1.021   7.486  1.00 17.75 ? 111 PHE A C   1 
ATOM   723  O  O   . PHE A 1 96  ? 8.774   0.235   8.418  1.00 16.09 ? 111 PHE A O   1 
ATOM   724  C  CB  . PHE A 1 96  ? 6.608   2.332   7.033  1.00 20.58 ? 111 PHE A CB  1 
ATOM   725  C  CG  . PHE A 1 96  ? 5.814   1.201   7.564  1.00 20.43 ? 111 PHE A CG  1 
ATOM   726  C  CD1 . PHE A 1 96  ? 5.108   1.285   8.756  1.00 18.72 ? 111 PHE A CD1 1 
ATOM   727  C  CD2 . PHE A 1 96  ? 5.770   0.034   6.879  1.00 14.96 ? 111 PHE A CD2 1 
ATOM   728  C  CE1 . PHE A 1 96  ? 4.413   0.098   9.259  1.00 17.09 ? 111 PHE A CE1 1 
ATOM   729  C  CE2 . PHE A 1 96  ? 5.106   -1.141  7.354  1.00 19.15 ? 111 PHE A CE2 1 
ATOM   730  C  CZ  . PHE A 1 96  ? 4.403   -1.075  8.558  1.00 17.62 ? 111 PHE A CZ  1 
ATOM   731  N  N   . THR A 1 97  ? 9.082   0.768   6.263  1.00 17.24 ? 112 THR A N   1 
ATOM   732  C  CA  . THR A 1 97  ? 9.612   -0.573  5.874  1.00 19.11 ? 112 THR A CA  1 
ATOM   733  C  C   . THR A 1 97  ? 10.928  -0.816  6.565  1.00 19.89 ? 112 THR A C   1 
ATOM   734  O  O   . THR A 1 97  ? 11.202  -1.927  7.069  1.00 21.14 ? 112 THR A O   1 
ATOM   735  C  CB  . THR A 1 97  ? 9.759   -0.625  4.394  1.00 20.09 ? 112 THR A CB  1 
ATOM   736  O  OG1 . THR A 1 97  ? 8.480   -0.494  3.746  1.00 19.04 ? 112 THR A OG1 1 
ATOM   737  C  CG2 . THR A 1 97  ? 10.292  -1.935  3.973  1.00 21.14 ? 112 THR A CG2 1 
ATOM   738  N  N   . LYS A 1 98  ? 11.764  0.208   6.607  1.00 20.49 ? 113 LYS A N   1 
ATOM   739  C  CA  . LYS A 1 98  ? 13.027  0.100   7.316  1.00 22.00 ? 113 LYS A CA  1 
ATOM   740  C  C   . LYS A 1 98  ? 12.914  -0.197  8.797  1.00 20.68 ? 113 LYS A C   1 
ATOM   741  O  O   . LYS A 1 98  ? 13.552  -1.146  9.310  1.00 22.57 ? 113 LYS A O   1 
ATOM   742  C  CB  . LYS A 1 98  ? 13.782  1.390   7.164  1.00 23.40 ? 113 LYS A CB  1 
ATOM   743  C  CG  . LYS A 1 98  ? 14.593  1.467   5.834  1.00 31.44 ? 113 LYS A CG  1 
ATOM   744  C  CD  . LYS A 1 98  ? 15.443  2.848   5.714  1.00 33.80 ? 113 LYS A CD  1 
ATOM   745  C  CE  . LYS A 1 98  ? 14.446  4.100   5.644  1.00 36.20 ? 113 LYS A CE  1 
ATOM   746  N  NZ  . LYS A 1 98  ? 14.920  5.535   5.632  1.00 33.96 ? 113 LYS A NZ  1 
ATOM   747  N  N   . ILE A 1 99  ? 12.092  0.565   9.487  1.00 19.56 ? 114 ILE A N   1 
ATOM   748  C  CA  . ILE A 1 99  ? 11.894  0.360   10.920 1.00 20.04 ? 114 ILE A CA  1 
ATOM   749  C  C   . ILE A 1 99  ? 11.179  -0.945  11.218 1.00 19.00 ? 114 ILE A C   1 
ATOM   750  O  O   . ILE A 1 99  ? 11.534  -1.663  12.161 1.00 19.34 ? 114 ILE A O   1 
ATOM   751  C  CB  . ILE A 1 99  ? 11.165  1.578   11.579 1.00 19.33 ? 114 ILE A CB  1 
ATOM   752  C  CG1 . ILE A 1 99  ? 11.979  2.867   11.329 1.00 23.06 ? 114 ILE A CG1 1 
ATOM   753  C  CG2 . ILE A 1 99  ? 10.862  1.314   13.013 1.00 22.71 ? 114 ILE A CG2 1 
ATOM   754  C  CD1 . ILE A 1 99  ? 13.508  2.723   11.660 1.00 26.68 ? 114 ILE A CD1 1 
ATOM   755  N  N   . ALA A 1 100 ? 10.127  -1.252  10.485 1.00 18.12 ? 115 ALA A N   1 
ATOM   756  C  CA  . ALA A 1 100 ? 9.317   -2.467  10.721 1.00 18.90 ? 115 ALA A CA  1 
ATOM   757  C  C   . ALA A 1 100 ? 10.226  -3.680  10.470 1.00 19.28 ? 115 ALA A C   1 
ATOM   758  O  O   . ALA A 1 100 ? 10.217  -4.634  11.229 1.00 19.04 ? 115 ALA A O   1 
ATOM   759  C  CB  . ALA A 1 100 ? 8.115   -2.511  9.803  1.00 19.80 ? 115 ALA A CB  1 
ATOM   760  N  N   . THR A 1 101 ? 11.059  -3.622  9.411  1.00 18.71 ? 116 THR A N   1 
ATOM   761  C  CA  . THR A 1 101 ? 11.967  -4.759  9.098  1.00 20.14 ? 116 THR A CA  1 
ATOM   762  C  C   . THR A 1 101 ? 12.973  -4.960  10.303 1.00 21.30 ? 116 THR A C   1 
ATOM   763  O  O   . THR A 1 101 ? 13.189  -6.071  10.804 1.00 22.86 ? 116 THR A O   1 
ATOM   764  C  CB  . THR A 1 101 ? 12.675  -4.499  7.795  1.00 20.67 ? 116 THR A CB  1 
ATOM   765  O  OG1 . THR A 1 101 ? 11.703  -4.375  6.752  1.00 20.19 ? 116 THR A OG1 1 
ATOM   766  C  CG2 . THR A 1 101 ? 13.520  -5.701  7.360  1.00 25.60 ? 116 THR A CG2 1 
ATOM   767  N  N   . SER A 1 102 ? 13.494  -3.857  10.818 1.00 22.79 ? 117 SER A N   1 
ATOM   768  C  CA  . SER A 1 102 ? 14.393  -3.877  11.952 1.00 24.24 ? 117 SER A CA  1 
ATOM   769  C  C   . SER A 1 102 ? 13.761  -4.427  13.211 1.00 23.75 ? 117 SER A C   1 
ATOM   770  O  O   . SER A 1 102 ? 14.383  -5.217  13.956 1.00 23.06 ? 117 SER A O   1 
ATOM   771  C  CB  . SER A 1 102 ? 14.938  -2.465  12.161 1.00 25.25 ? 117 SER A CB  1 
ATOM   772  O  OG  . SER A 1 102 ? 15.809  -2.480  13.279 1.00 34.73 ? 117 SER A OG  1 
ATOM   773  N  N   . LEU A 1 103 ? 12.505  -4.088  13.451 1.00 20.51 ? 118 LEU A N   1 
ATOM   774  C  CA  . LEU A 1 103 ? 11.777  -4.575  14.609 1.00 22.25 ? 118 LEU A CA  1 
ATOM   775  C  C   . LEU A 1 103 ? 11.750  -6.122  14.657 1.00 19.88 ? 118 LEU A C   1 
ATOM   776  O  O   . LEU A 1 103 ? 11.805  -6.671  15.720 1.00 22.49 ? 118 LEU A O   1 
ATOM   777  C  CB  . LEU A 1 103 ? 10.300  -4.087  14.660 1.00 21.69 ? 118 LEU A CB  1 
ATOM   778  C  CG  . LEU A 1 103 ? 9.991   -2.696  15.268 1.00 26.64 ? 118 LEU A CG  1 
ATOM   779  C  CD1 . LEU A 1 103 ? 8.517   -2.249  15.220 1.00 26.77 ? 118 LEU A CD1 1 
ATOM   780  C  CD2 . LEU A 1 103 ? 10.410  -2.724  16.707 1.00 29.23 ? 118 LEU A CD2 1 
ATOM   781  N  N   . PHE A 1 104 ? 11.626  -6.754  13.505 1.00 18.31 ? 119 PHE A N   1 
ATOM   782  C  CA  . PHE A 1 104 ? 11.404  -8.208  13.382 1.00 18.50 ? 119 PHE A CA  1 
ATOM   783  C  C   . PHE A 1 104 ? 12.627  -9.053  12.933 1.00 20.46 ? 119 PHE A C   1 
ATOM   784  O  O   . PHE A 1 104 ? 12.533  -10.272 12.753 1.00 21.10 ? 119 PHE A O   1 
ATOM   785  C  CB  . PHE A 1 104 ? 10.153  -8.505  12.513 1.00 19.63 ? 119 PHE A CB  1 
ATOM   786  C  CG  . PHE A 1 104 ? 8.884   -7.987  13.159 1.00 18.53 ? 119 PHE A CG  1 
ATOM   787  C  CD1 . PHE A 1 104 ? 8.286   -8.695  14.224 1.00 19.13 ? 119 PHE A CD1 1 
ATOM   788  C  CD2 . PHE A 1 104 ? 8.349   -6.752  12.831 1.00 19.95 ? 119 PHE A CD2 1 
ATOM   789  C  CE1 . PHE A 1 104 ? 7.187   -8.240  14.871 1.00 17.29 ? 119 PHE A CE1 1 
ATOM   790  C  CE2 . PHE A 1 104 ? 7.195   -6.286  13.531 1.00 20.14 ? 119 PHE A CE2 1 
ATOM   791  C  CZ  . PHE A 1 104 ? 6.671   -7.023  14.566 1.00 17.33 ? 119 PHE A CZ  1 
ATOM   792  N  N   . GLU A 1 105 ? 13.743  -8.388  12.763 1.00 22.90 ? 120 GLU A N   1 
ATOM   793  C  CA  . GLU A 1 105 ? 14.947  -9.017  12.245 1.00 24.08 ? 120 GLU A CA  1 
ATOM   794  C  C   . GLU A 1 105 ? 15.310  -10.279 13.081 1.00 24.97 ? 120 GLU A C   1 
ATOM   795  O  O   . GLU A 1 105 ? 15.762  -11.330 12.557 1.00 24.92 ? 120 GLU A O   1 
ATOM   796  C  CB  . GLU A 1 105 ? 16.100  -8.015  12.295 1.00 25.08 ? 120 GLU A CB  1 
ATOM   797  C  CG  . GLU A 1 105 ? 17.325  -8.497  11.535 1.00 29.59 ? 120 GLU A CG  1 
ATOM   798  C  CD  . GLU A 1 105 ? 18.361  -7.387  11.249 1.00 38.78 ? 120 GLU A CD  1 
ATOM   799  O  OE1 . GLU A 1 105 ? 19.338  -7.677  10.537 1.00 43.26 ? 120 GLU A OE1 1 
ATOM   800  O  OE2 . GLU A 1 105 ? 18.165  -6.224  11.663 1.00 46.03 ? 120 GLU A OE2 1 
ATOM   801  N  N   . SER A 1 106 ? 15.157  -10.137 14.399 1.00 24.37 ? 121 SER A N   1 
ATOM   802  C  CA  . SER A 1 106 ? 15.503  -11.249 15.331 1.00 25.47 ? 121 SER A CA  1 
ATOM   803  C  C   . SER A 1 106 ? 14.321  -12.083 15.746 1.00 26.35 ? 121 SER A C   1 
ATOM   804  O  O   . SER A 1 106 ? 14.383  -12.769 16.747 1.00 27.19 ? 121 SER A O   1 
ATOM   805  C  CB  . SER A 1 106 ? 16.111  -10.678 16.595 1.00 26.98 ? 121 SER A CB  1 
ATOM   806  O  OG  . SER A 1 106 ? 17.438  -10.347 16.310 1.00 30.55 ? 121 SER A OG  1 
ATOM   807  N  N   . GLY A 1 107 ? 13.219  -11.982 15.019 1.00 24.70 ? 122 GLY A N   1 
ATOM   808  C  CA  . GLY A 1 107 ? 12.047  -12.791 15.276 1.00 24.86 ? 122 GLY A CA  1 
ATOM   809  C  C   . GLY A 1 107 ? 10.869  -11.964 15.756 1.00 23.72 ? 122 GLY A C   1 
ATOM   810  O  O   . GLY A 1 107 ? 10.912  -10.718 15.814 1.00 22.78 ? 122 GLY A O   1 
ATOM   811  N  N   . ILE A 1 108 ? 9.816   -12.694 16.072 1.00 22.13 ? 123 ILE A N   1 
ATOM   812  C  CA  . ILE A 1 108 ? 8.524   -12.098 16.402 1.00 21.14 ? 123 ILE A CA  1 
ATOM   813  C  C   . ILE A 1 108 ? 8.138   -12.428 17.842 1.00 21.31 ? 123 ILE A C   1 
ATOM   814  O  O   . ILE A 1 108 ? 8.355   -13.565 18.329 1.00 22.32 ? 123 ILE A O   1 
ATOM   815  C  CB  . ILE A 1 108 ? 7.481   -12.661 15.442 1.00 20.31 ? 123 ILE A CB  1 
ATOM   816  C  CG1 . ILE A 1 108 ? 7.879   -12.465 13.957 1.00 18.47 ? 123 ILE A CG1 1 
ATOM   817  C  CG2 . ILE A 1 108 ? 6.074   -12.072 15.770 1.00 18.49 ? 123 ILE A CG2 1 
ATOM   818  C  CD1 . ILE A 1 108 ? 7.184   -13.407 13.067 1.00 22.93 ? 123 ILE A CD1 1 
ATOM   819  N  N   . ASN A 1 109 ? 7.694   -11.431 18.557 1.00 19.34 ? 124 ASN A N   1 
ATOM   820  C  CA  . ASN A 1 109 ? 7.027   -11.605 19.860 1.00 20.31 ? 124 ASN A CA  1 
ATOM   821  C  C   . ASN A 1 109 ? 5.917   -10.566 20.030 1.00 19.42 ? 124 ASN A C   1 
ATOM   822  O  O   . ASN A 1 109 ? 5.853   -9.582  19.293 1.00 16.75 ? 124 ASN A O   1 
ATOM   823  C  CB  . ASN A 1 109 ? 8.089   -11.672 20.977 1.00 20.54 ? 124 ASN A CB  1 
ATOM   824  C  CG  . ASN A 1 109 ? 8.805   -10.436 21.185 1.00 18.23 ? 124 ASN A CG  1 
ATOM   825  O  OD1 . ASN A 1 109 ? 8.192   -9.377  21.284 1.00 18.73 ? 124 ASN A OD1 1 
ATOM   826  N  ND2 . ASN A 1 109 ? 10.107  -10.520 21.383 1.00 19.29 ? 124 ASN A ND2 1 
ATOM   827  N  N   . TRP A 1 110 ? 5.042   -10.774 20.981 1.00 19.00 ? 125 TRP A N   1 
ATOM   828  C  CA  . TRP A 1 110 ? 3.899   -9.865  21.156 1.00 20.25 ? 125 TRP A CA  1 
ATOM   829  C  C   . TRP A 1 110 ? 4.328   -8.436  21.425 1.00 19.55 ? 125 TRP A C   1 
ATOM   830  O  O   . TRP A 1 110 ? 3.714   -7.492  20.904 1.00 19.87 ? 125 TRP A O   1 
ATOM   831  C  CB  . TRP A 1 110 ? 2.891   -10.329 22.229 1.00 20.80 ? 125 TRP A CB  1 
ATOM   832  C  CG  . TRP A 1 110 ? 2.059   -11.465 21.819 1.00 21.63 ? 125 TRP A CG  1 
ATOM   833  C  CD1 . TRP A 1 110 ? 2.110   -12.766 22.241 1.00 25.11 ? 125 TRP A CD1 1 
ATOM   834  C  CD2 . TRP A 1 110 ? 0.957   -11.395 20.884 1.00 22.00 ? 125 TRP A CD2 1 
ATOM   835  N  NE1 . TRP A 1 110 ? 1.120   -13.506 21.619 1.00 25.64 ? 125 TRP A NE1 1 
ATOM   836  C  CE2 . TRP A 1 110 ? 0.390   -12.683 20.793 1.00 26.84 ? 125 TRP A CE2 1 
ATOM   837  C  CE3 . TRP A 1 110 ? 0.401   -10.344 20.123 1.00 25.00 ? 125 TRP A CE3 1 
ATOM   838  C  CZ2 . TRP A 1 110 ? -0.682  -12.978 19.939 1.00 25.21 ? 125 TRP A CZ2 1 
ATOM   839  C  CZ3 . TRP A 1 110 ? -0.691  -10.632 19.277 1.00 23.12 ? 125 TRP A CZ3 1 
ATOM   840  C  CH2 . TRP A 1 110 ? -1.217  -11.940 19.199 1.00 25.41 ? 125 TRP A CH2 1 
ATOM   841  N  N   . GLY A 1 111 ? 5.362   -8.235  22.253 1.00 17.45 ? 126 GLY A N   1 
ATOM   842  C  CA  . GLY A 1 111 ? 5.815   -6.899  22.505 1.00 17.98 ? 126 GLY A CA  1 
ATOM   843  C  C   . GLY A 1 111 ? 6.246   -6.202  21.205 1.00 18.15 ? 126 GLY A C   1 
ATOM   844  O  O   . GLY A 1 111 ? 6.029   -5.016  21.081 1.00 18.47 ? 126 GLY A O   1 
ATOM   845  N  N   . ARG A 1 112 ? 6.833   -6.923  20.255 1.00 17.33 ? 127 ARG A N   1 
ATOM   846  C  CA  . ARG A 1 112 ? 7.217   -6.303  18.985 1.00 19.23 ? 127 ARG A CA  1 
ATOM   847  C  C   . ARG A 1 112 ? 6.022   -6.070  18.074 1.00 18.50 ? 127 ARG A C   1 
ATOM   848  O  O   . ARG A 1 112 ? 6.014   -5.089  17.321 1.00 18.23 ? 127 ARG A O   1 
ATOM   849  C  CB  . ARG A 1 112 ? 8.234   -7.142  18.205 1.00 18.58 ? 127 ARG A CB  1 
ATOM   850  C  CG  . ARG A 1 112 ? 9.569   -7.355  18.920 1.00 20.72 ? 127 ARG A CG  1 
ATOM   851  C  CD  . ARG A 1 112 ? 10.468  -8.366  18.259 1.00 22.11 ? 127 ARG A CD  1 
ATOM   852  N  NE  . ARG A 1 112 ? 11.745  -8.344  18.978 1.00 26.40 ? 127 ARG A NE  1 
ATOM   853  C  CZ  . ARG A 1 112 ? 12.679  -9.264  18.906 1.00 29.48 ? 127 ARG A CZ  1 
ATOM   854  N  NH1 . ARG A 1 112 ? 12.568  -10.284 18.107 1.00 29.20 ? 127 ARG A NH1 1 
ATOM   855  N  NH2 . ARG A 1 112 ? 13.757  -9.124  19.626 1.00 31.91 ? 127 ARG A NH2 1 
ATOM   856  N  N   . VAL A 1 113 ? 5.017   -6.927  18.148 1.00 18.79 ? 128 VAL A N   1 
ATOM   857  C  CA  . VAL A 1 113 ? 3.753   -6.635  17.506 1.00 19.32 ? 128 VAL A CA  1 
ATOM   858  C  C   . VAL A 1 113 ? 3.183   -5.293  17.989 1.00 20.10 ? 128 VAL A C   1 
ATOM   859  O  O   . VAL A 1 113 ? 2.817   -4.465  17.214 1.00 18.79 ? 128 VAL A O   1 
ATOM   860  C  CB  . VAL A 1 113 ? 2.789   -7.849  17.600 1.00 20.13 ? 128 VAL A CB  1 
ATOM   861  C  CG1 . VAL A 1 113 ? 1.415   -7.526  17.015 1.00 21.81 ? 128 VAL A CG1 1 
ATOM   862  C  CG2 . VAL A 1 113 ? 3.336   -8.995  16.824 1.00 18.08 ? 128 VAL A CG2 1 
ATOM   863  N  N   . VAL A 1 114 ? 3.150   -5.074  19.296 1.00 19.94 ? 129 VAL A N   1 
ATOM   864  C  CA  . VAL A 1 114 ? 2.621   -3.828  19.875 1.00 20.47 ? 129 VAL A CA  1 
ATOM   865  C  C   . VAL A 1 114 ? 3.495   -2.685  19.426 1.00 20.15 ? 129 VAL A C   1 
ATOM   866  O  O   . VAL A 1 114 ? 3.006   -1.565  19.148 1.00 19.53 ? 129 VAL A O   1 
ATOM   867  C  CB  . VAL A 1 114 ? 2.557   -3.912  21.420 1.00 21.66 ? 129 VAL A CB  1 
ATOM   868  C  CG1 . VAL A 1 114 ? 2.166   -2.556  21.998 1.00 20.59 ? 129 VAL A CG1 1 
ATOM   869  C  CG2 . VAL A 1 114 ? 1.553   -4.950  21.811 1.00 21.38 ? 129 VAL A CG2 1 
ATOM   870  N  N   . ALA A 1 115 ? 4.782   -2.917  19.368 1.00 18.93 ? 130 ALA A N   1 
ATOM   871  C  CA  . ALA A 1 115 ? 5.728   -1.891  18.916 1.00 18.61 ? 130 ALA A CA  1 
ATOM   872  C  C   . ALA A 1 115 ? 5.456   -1.452  17.476 1.00 18.39 ? 130 ALA A C   1 
ATOM   873  O  O   . ALA A 1 115 ? 5.577   -0.255  17.153 1.00 18.48 ? 130 ALA A O   1 
ATOM   874  C  CB  . ALA A 1 115 ? 7.160   -2.329  19.092 1.00 19.42 ? 130 ALA A CB  1 
ATOM   875  N  N   . LEU A 1 116 ? 5.177   -2.416  16.617 1.00 18.29 ? 131 LEU A N   1 
ATOM   876  C  CA  . LEU A 1 116 ? 4.866   -2.085  15.259 1.00 17.18 ? 131 LEU A CA  1 
ATOM   877  C  C   . LEU A 1 116 ? 3.601   -1.253  15.219 1.00 16.30 ? 131 LEU A C   1 
ATOM   878  O  O   . LEU A 1 116 ? 3.571   -0.275  14.533 1.00 16.14 ? 131 LEU A O   1 
ATOM   879  C  CB  . LEU A 1 116 ? 4.722   -3.349  14.418 1.00 18.30 ? 131 LEU A CB  1 
ATOM   880  C  CG  . LEU A 1 116 ? 4.290   -3.118  12.952 1.00 20.02 ? 131 LEU A CG  1 
ATOM   881  C  CD1 . LEU A 1 116 ? 5.357   -2.400  12.257 1.00 23.61 ? 131 LEU A CD1 1 
ATOM   882  C  CD2 . LEU A 1 116 ? 4.036   -4.405  12.255 1.00 23.32 ? 131 LEU A CD2 1 
ATOM   883  N  N   . LEU A 1 117 ? 2.528   -1.663  15.882 1.00 16.06 ? 132 LEU A N   1 
ATOM   884  C  CA  . LEU A 1 117 ? 1.286   -0.851  15.952 1.00 16.01 ? 132 LEU A CA  1 
ATOM   885  C  C   . LEU A 1 117 ? 1.621   0.554   16.445 1.00 15.47 ? 132 LEU A C   1 
ATOM   886  O  O   . LEU A 1 117 ? 1.144   1.520   15.827 1.00 13.40 ? 132 LEU A O   1 
ATOM   887  C  CB  . LEU A 1 117 ? 0.247   -1.527  16.899 1.00 17.88 ? 132 LEU A CB  1 
ATOM   888  C  CG  . LEU A 1 117 ? -0.155  -2.978  16.550 1.00 19.64 ? 132 LEU A CG  1 
ATOM   889  C  CD1 . LEU A 1 117 ? -1.180  -3.501  17.533 1.00 20.35 ? 132 LEU A CD1 1 
ATOM   890  C  CD2 . LEU A 1 117 ? -0.668  -3.222  15.142 1.00 22.01 ? 132 LEU A CD2 1 
ATOM   891  N  N   . GLY A 1 118 ? 2.398   0.668   17.549 1.00 15.17 ? 133 GLY A N   1 
ATOM   892  C  CA  . GLY A 1 118 ? 2.877   1.928   18.053 1.00 15.46 ? 133 GLY A CA  1 
ATOM   893  C  C   . GLY A 1 118 ? 3.629   2.787   17.050 1.00 15.38 ? 133 GLY A C   1 
ATOM   894  O  O   . GLY A 1 118 ? 3.430   4.019   16.994 1.00 15.77 ? 133 GLY A O   1 
ATOM   895  N  N   . PHE A 1 119 ? 4.447   2.151   16.224 1.00 17.35 ? 134 PHE A N   1 
ATOM   896  C  CA  . PHE A 1 119 ? 5.217   2.855   15.195 1.00 16.35 ? 134 PHE A CA  1 
ATOM   897  C  C   . PHE A 1 119 ? 4.255   3.394   14.157 1.00 15.14 ? 134 PHE A C   1 
ATOM   898  O  O   . PHE A 1 119 ? 4.379   4.567   13.799 1.00 14.68 ? 134 PHE A O   1 
ATOM   899  C  CB  . PHE A 1 119 ? 6.247   1.915   14.557 1.00 15.99 ? 134 PHE A CB  1 
ATOM   900  C  CG  . PHE A 1 119 ? 6.995   2.558   13.492 1.00 18.33 ? 134 PHE A CG  1 
ATOM   901  C  CD1 . PHE A 1 119 ? 7.792   3.664   13.765 1.00 21.62 ? 134 PHE A CD1 1 
ATOM   902  C  CD2 . PHE A 1 119 ? 6.875   2.158   12.195 1.00 29.45 ? 134 PHE A CD2 1 
ATOM   903  C  CE1 . PHE A 1 119 ? 8.460   4.378   12.782 1.00 26.35 ? 134 PHE A CE1 1 
ATOM   904  C  CE2 . PHE A 1 119 ? 7.542   2.906   11.193 1.00 28.00 ? 134 PHE A CE2 1 
ATOM   905  C  CZ  . PHE A 1 119 ? 8.312   3.995   11.513 1.00 25.78 ? 134 PHE A CZ  1 
ATOM   906  N  N   . GLY A 1 120 ? 3.309   2.539   13.685 1.00 15.26 ? 135 GLY A N   1 
ATOM   907  C  CA  . GLY A 1 120 ? 2.237   2.953   12.784 1.00 13.95 ? 135 GLY A CA  1 
ATOM   908  C  C   . GLY A 1 120 ? 1.478   4.190   13.268 1.00 14.89 ? 135 GLY A C   1 
ATOM   909  O  O   . GLY A 1 120 ? 1.351   5.146   12.578 1.00 15.64 ? 135 GLY A O   1 
ATOM   910  N  N   . TYR A 1 121 ? 1.082   4.123   14.522 1.00 14.64 ? 136 TYR A N   1 
ATOM   911  C  CA  . TYR A 1 121 ? 0.480   5.235   15.266 1.00 15.80 ? 136 TYR A CA  1 
ATOM   912  C  C   . TYR A 1 121 ? 1.348   6.513   15.159 1.00 16.74 ? 136 TYR A C   1 
ATOM   913  O  O   . TYR A 1 121 ? 0.893   7.544   14.646 1.00 14.95 ? 136 TYR A O   1 
ATOM   914  C  CB  . TYR A 1 121 ? 0.159   4.844   16.715 1.00 16.29 ? 136 TYR A CB  1 
ATOM   915  C  CG  . TYR A 1 121 ? -0.459  5.990   17.505 1.00 16.04 ? 136 TYR A CG  1 
ATOM   916  C  CD1 . TYR A 1 121 ? -1.842  6.237   17.491 1.00 18.65 ? 136 TYR A CD1 1 
ATOM   917  C  CD2 . TYR A 1 121 ? 0.339   6.860   18.242 1.00 20.07 ? 136 TYR A CD2 1 
ATOM   918  C  CE1 . TYR A 1 121 ? -2.371  7.323   18.197 1.00 17.67 ? 136 TYR A CE1 1 
ATOM   919  C  CE2 . TYR A 1 121 ? -0.204  7.976   18.938 1.00 19.97 ? 136 TYR A CE2 1 
ATOM   920  C  CZ  . TYR A 1 121 ? -1.555  8.189   18.921 1.00 17.93 ? 136 TYR A CZ  1 
ATOM   921  O  OH  . TYR A 1 121 ? -2.177  9.209   19.640 1.00 20.27 ? 136 TYR A OH  1 
ATOM   922  N  N   . ARG A 1 122 ? 2.617   6.433   15.543 1.00 17.46 ? 137 ARG A N   1 
ATOM   923  C  CA  . ARG A 1 122 ? 3.503   7.590   15.527 1.00 18.01 ? 137 ARG A CA  1 
ATOM   924  C  C   . ARG A 1 122 ? 3.757   8.119   14.089 1.00 17.53 ? 137 ARG A C   1 
ATOM   925  O  O   . ARG A 1 122 ? 3.828   9.357   13.887 1.00 17.22 ? 137 ARG A O   1 
ATOM   926  C  CB  . ARG A 1 122 ? 4.823   7.221   16.265 1.00 19.90 ? 137 ARG A CB  1 
ATOM   927  C  CG  . ARG A 1 122 ? 4.770   7.233   17.789 1.00 21.69 ? 137 ARG A CG  1 
ATOM   928  C  CD  . ARG A 1 122 ? 4.529   8.629   18.387 1.00 27.29 ? 137 ARG A CD  1 
ATOM   929  N  NE  . ARG A 1 122 ? 4.376   8.608   19.824 1.00 30.98 ? 137 ARG A NE  1 
ATOM   930  C  CZ  . ARG A 1 122 ? 3.598   9.429   20.546 1.00 32.24 ? 137 ARG A CZ  1 
ATOM   931  N  NH1 . ARG A 1 122 ? 2.889   10.424  19.998 1.00 29.38 ? 137 ARG A NH1 1 
ATOM   932  N  NH2 . ARG A 1 122 ? 3.572   9.267   21.871 1.00 35.47 ? 137 ARG A NH2 1 
ATOM   933  N  N   . LEU A 1 123 ? 3.970   7.199   13.147 1.00 16.27 ? 138 LEU A N   1 
ATOM   934  C  CA  . LEU A 1 123 ? 4.170   7.554   11.771 1.00 15.45 ? 138 LEU A CA  1 
ATOM   935  C  C   . LEU A 1 123 ? 2.941   8.328   11.238 1.00 15.60 ? 138 LEU A C   1 
ATOM   936  O  O   . LEU A 1 123 ? 3.129   9.425   10.665 1.00 17.24 ? 138 LEU A O   1 
ATOM   937  C  CB  . LEU A 1 123 ? 4.451   6.345   10.904 1.00 17.46 ? 138 LEU A CB  1 
ATOM   938  C  CG  . LEU A 1 123 ? 4.413   6.628   9.372  1.00 21.11 ? 138 LEU A CG  1 
ATOM   939  C  CD1 . LEU A 1 123 ? 5.470   7.565   8.940  1.00 26.86 ? 138 LEU A CD1 1 
ATOM   940  C  CD2 . LEU A 1 123 ? 4.592   5.350   8.599  1.00 24.94 ? 138 LEU A CD2 1 
ATOM   941  N  N   . ALA A 1 124 ? 1.740   7.801   11.466 1.00 16.03 ? 139 ALA A N   1 
ATOM   942  C  CA  . ALA A 1 124 ? 0.522   8.386   11.018 1.00 15.67 ? 139 ALA A CA  1 
ATOM   943  C  C   . ALA A 1 124 ? 0.335   9.795   11.630 1.00 17.93 ? 139 ALA A C   1 
ATOM   944  O  O   . ALA A 1 124 ? 0.005   10.805  10.934 1.00 15.69 ? 139 ALA A O   1 
ATOM   945  C  CB  . ALA A 1 124 ? -0.619  7.473   11.267 1.00 16.46 ? 139 ALA A CB  1 
ATOM   946  N  N   . LEU A 1 125 ? 0.602   9.906   12.923 1.00 17.51 ? 140 LEU A N   1 
ATOM   947  C  CA  . LEU A 1 125 ? 0.488   11.200  13.584 1.00 18.65 ? 140 LEU A CA  1 
ATOM   948  C  C   . LEU A 1 125 ? 1.527   12.233  13.081 1.00 18.36 ? 140 LEU A C   1 
ATOM   949  O  O   . LEU A 1 125 ? 1.171   13.347  12.819 1.00 18.71 ? 140 LEU A O   1 
ATOM   950  C  CB  . LEU A 1 125 ? 0.673   11.025  15.107 1.00 21.00 ? 140 LEU A CB  1 
ATOM   951  C  CG  . LEU A 1 125 ? 0.360   12.128  16.107 1.00 27.22 ? 140 LEU A CG  1 
ATOM   952  C  CD1 . LEU A 1 125 ? -0.553  13.187  15.659 1.00 24.87 ? 140 LEU A CD1 1 
ATOM   953  C  CD2 . LEU A 1 125 ? -0.139  11.577  17.468 1.00 29.38 ? 140 LEU A CD2 1 
ATOM   954  N  N   . HIS A 1 126 ? 2.780   11.834  12.888 1.00 20.77 ? 141 HIS A N   1 
ATOM   955  C  CA  . HIS A 1 126 ? 3.796   12.704  12.309 1.00 20.71 ? 141 HIS A CA  1 
ATOM   956  C  C   . HIS A 1 126 ? 3.426   13.248  10.953 1.00 21.03 ? 141 HIS A C   1 
ATOM   957  O  O   . HIS A 1 126 ? 3.499   14.511  10.713 1.00 22.53 ? 141 HIS A O   1 
ATOM   958  C  CB  . HIS A 1 126 ? 5.105   11.949  12.220 1.00 22.49 ? 141 HIS A CB  1 
ATOM   959  C  CG  . HIS A 1 126 ? 6.140   12.687  11.478 1.00 22.71 ? 141 HIS A CG  1 
ATOM   960  N  ND1 . HIS A 1 126 ? 6.931   13.625  12.090 1.00 24.91 ? 141 HIS A ND1 1 
ATOM   961  C  CD2 . HIS A 1 126 ? 6.491   12.683  10.166 1.00 29.06 ? 141 HIS A CD2 1 
ATOM   962  C  CE1 . HIS A 1 126 ? 7.756   14.138  11.199 1.00 24.83 ? 141 HIS A CE1 1 
ATOM   963  N  NE2 . HIS A 1 126 ? 7.493   13.603  10.021 1.00 29.36 ? 141 HIS A NE2 1 
ATOM   964  N  N   . VAL A 1 127 ? 3.118   12.336  10.031 1.00 20.71 ? 142 VAL A N   1 
ATOM   965  C  CA  . VAL A 1 127 ? 2.793   12.816  8.704  1.00 21.79 ? 142 VAL A CA  1 
ATOM   966  C  C   . VAL A 1 127 ? 1.560   13.718  8.746  1.00 21.90 ? 142 VAL A C   1 
ATOM   967  O  O   . VAL A 1 127 ? 1.532   14.721  8.034  1.00 22.71 ? 142 VAL A O   1 
ATOM   968  C  CB  . VAL A 1 127 ? 2.680   11.737  7.617  1.00 21.19 ? 142 VAL A CB  1 
ATOM   969  C  CG1 . VAL A 1 127 ? 3.940   10.955  7.471  1.00 21.85 ? 142 VAL A CG1 1 
ATOM   970  C  CG2 . VAL A 1 127 ? 1.446   10.887  7.805  1.00 22.90 ? 142 VAL A CG2 1 
ATOM   971  N  N   . TYR A 1 128 ? 0.561   13.432  9.569  1.00 20.75 ? 143 TYR A N   1 
ATOM   972  C  CA  . TYR A 1 128 ? -0.584  14.311  9.658  1.00 21.42 ? 143 TYR A CA  1 
ATOM   973  C  C   . TYR A 1 128 ? -0.144  15.747  10.137 1.00 21.21 ? 143 TYR A C   1 
ATOM   974  O  O   . TYR A 1 128 ? -0.532  16.779  9.593  1.00 21.50 ? 143 TYR A O   1 
ATOM   975  C  CB  . TYR A 1 128 ? -1.680  13.729  10.563 1.00 20.45 ? 143 TYR A CB  1 
ATOM   976  C  CG  . TYR A 1 128 ? -2.795  14.679  10.790 1.00 22.50 ? 143 TYR A CG  1 
ATOM   977  C  CD1 . TYR A 1 128 ? -3.786  14.812  9.831  1.00 20.00 ? 143 TYR A CD1 1 
ATOM   978  C  CD2 . TYR A 1 128 ? -2.803  15.550  11.868 1.00 19.58 ? 143 TYR A CD2 1 
ATOM   979  C  CE1 . TYR A 1 128 ? -4.850  15.770  10.012 1.00 19.13 ? 143 TYR A CE1 1 
ATOM   980  C  CE2 . TYR A 1 128 ? -3.807  16.491  12.046 1.00 19.53 ? 143 TYR A CE2 1 
ATOM   981  C  CZ  . TYR A 1 128 ? -4.835  16.590  11.125 1.00 22.35 ? 143 TYR A CZ  1 
ATOM   982  O  OH  . TYR A 1 128 ? -5.825  17.502  11.211 1.00 22.62 ? 143 TYR A OH  1 
ATOM   983  N  N   . GLN A 1 129 ? 0.681   15.784  11.157 1.00 23.65 ? 144 GLN A N   1 
ATOM   984  C  CA  . GLN A 1 129 ? 1.083   17.047  11.743 1.00 25.63 ? 144 GLN A CA  1 
ATOM   985  C  C   . GLN A 1 129 ? 1.890   17.867  10.731 1.00 26.56 ? 144 GLN A C   1 
ATOM   986  O  O   . GLN A 1 129 ? 1.942   19.092  10.828 1.00 26.86 ? 144 GLN A O   1 
ATOM   987  C  CB  . GLN A 1 129 ? 1.885   16.871  12.985 1.00 26.02 ? 144 GLN A CB  1 
ATOM   988  C  CG  . GLN A 1 129 ? 1.192   16.179  14.132 1.00 28.52 ? 144 GLN A CG  1 
ATOM   989  C  CD  . GLN A 1 129 ? 2.030   16.156  15.351 1.00 32.35 ? 144 GLN A CD  1 
ATOM   990  O  OE1 . GLN A 1 129 ? 2.930   15.348  15.475 1.00 37.83 ? 144 GLN A OE1 1 
ATOM   991  N  NE2 . GLN A 1 129 ? 1.777   17.089  16.252 1.00 39.22 ? 144 GLN A NE2 1 
ATOM   992  N  N   . HIS A 1 130 ? 2.522   17.220  9.785  1.00 25.24 ? 145 HIS A N   1 
ATOM   993  C  CA  . HIS A 1 130 ? 3.332   17.920  8.777  1.00 26.54 ? 145 HIS A CA  1 
ATOM   994  C  C   . HIS A 1 130 ? 2.517   18.130  7.499  1.00 26.90 ? 145 HIS A C   1 
ATOM   995  O  O   . HIS A 1 130 ? 3.055   18.317  6.428  1.00 28.49 ? 145 HIS A O   1 
ATOM   996  C  CB  . HIS A 1 130 ? 4.634   17.133  8.550  1.00 26.28 ? 145 HIS A CB  1 
ATOM   997  C  CG  . HIS A 1 130 ? 5.560   17.233  9.709  1.00 31.22 ? 145 HIS A CG  1 
ATOM   998  N  ND1 . HIS A 1 130 ? 6.808   17.828  9.620  1.00 39.09 ? 145 HIS A ND1 1 
ATOM   999  C  CD2 . HIS A 1 130 ? 5.390   16.915  11.011 1.00 32.05 ? 145 HIS A CD2 1 
ATOM   1000 C  CE1 . HIS A 1 130 ? 7.384   17.800  10.806 1.00 37.70 ? 145 HIS A CE1 1 
ATOM   1001 N  NE2 . HIS A 1 130 ? 6.527   17.281  11.672 1.00 37.95 ? 145 HIS A NE2 1 
ATOM   1002 N  N   . GLY A 1 131 ? 1.203   18.049  7.630  1.00 25.73 ? 146 GLY A N   1 
ATOM   1003 C  CA  . GLY A 1 131 ? 0.261   18.291  6.567  1.00 25.86 ? 146 GLY A CA  1 
ATOM   1004 C  C   . GLY A 1 131 ? -0.158  17.230  5.564  1.00 25.40 ? 146 GLY A C   1 
ATOM   1005 O  O   . GLY A 1 131 ? -0.728  17.592  4.563  1.00 25.93 ? 146 GLY A O   1 
ATOM   1006 N  N   . LEU A 1 132 ? 0.163   15.948  5.738  1.00 23.08 ? 147 LEU A N   1 
ATOM   1007 C  CA  . LEU A 1 132 ? -0.305  14.923  4.821  1.00 23.55 ? 147 LEU A CA  1 
ATOM   1008 C  C   . LEU A 1 132 ? -1.613  14.368  5.403  1.00 24.58 ? 147 LEU A C   1 
ATOM   1009 O  O   . LEU A 1 132 ? -1.588  13.586  6.336  1.00 24.77 ? 147 LEU A O   1 
ATOM   1010 C  CB  . LEU A 1 132 ? 0.748   13.823  4.715  1.00 23.22 ? 147 LEU A CB  1 
ATOM   1011 C  CG  . LEU A 1 132 ? 0.474   12.679  3.768  1.00 22.66 ? 147 LEU A CG  1 
ATOM   1012 C  CD1 . LEU A 1 132 ? 0.409   13.269  2.301  1.00 27.30 ? 147 LEU A CD1 1 
ATOM   1013 C  CD2 . LEU A 1 132 ? 1.608   11.702  3.837  1.00 25.98 ? 147 LEU A CD2 1 
ATOM   1014 N  N   . THR A 1 133 ? -2.755  14.829  4.923  1.00 23.70 ? 148 THR A N   1 
ATOM   1015 C  CA  . THR A 1 133 ? -4.083  14.381  5.364  1.00 24.03 ? 148 THR A CA  1 
ATOM   1016 C  C   . THR A 1 133 ? -4.455  13.181  4.536  1.00 21.60 ? 148 THR A C   1 
ATOM   1017 O  O   . THR A 1 133 ? -3.858  12.930  3.473  1.00 22.27 ? 148 THR A O   1 
ATOM   1018 C  CB  . THR A 1 133 ? -5.143  15.511  5.202  1.00 23.84 ? 148 THR A CB  1 
ATOM   1019 O  OG1 . THR A 1 133 ? -5.305  15.781  3.796  1.00 28.25 ? 148 THR A OG1 1 
ATOM   1020 C  CG2 . THR A 1 133 ? -4.689  16.733  5.831  1.00 23.58 ? 148 THR A CG2 1 
ATOM   1021 N  N   . GLY A 1 134 ? -5.439  12.423  5.006  1.00 22.38 ? 149 GLY A N   1 
ATOM   1022 C  CA  . GLY A 1 134 ? -5.983  11.298  4.219  1.00 20.61 ? 149 GLY A CA  1 
ATOM   1023 C  C   . GLY A 1 134 ? -5.054  10.127  4.086  1.00 21.05 ? 149 GLY A C   1 
ATOM   1024 O  O   . GLY A 1 134 ? -5.142  9.340   3.153  1.00 23.18 ? 149 GLY A O   1 
ATOM   1025 N  N   . PHE A 1 135 ? -4.096  10.027  5.015  1.00 19.45 ? 150 PHE A N   1 
ATOM   1026 C  CA  . PHE A 1 135 ? -3.000  9.021   4.923  1.00 18.18 ? 150 PHE A CA  1 
ATOM   1027 C  C   . PHE A 1 135 ? -3.099  7.942   6.023  1.00 18.62 ? 150 PHE A C   1 
ATOM   1028 O  O   . PHE A 1 135 ? -2.263  7.025   6.072  1.00 17.47 ? 150 PHE A O   1 
ATOM   1029 C  CB  . PHE A 1 135 ? -1.659  9.688   5.018  1.00 18.75 ? 150 PHE A CB  1 
ATOM   1030 C  CG  . PHE A 1 135 ? -0.560  8.922   4.405  1.00 15.77 ? 150 PHE A CG  1 
ATOM   1031 C  CD1 . PHE A 1 135 ? -0.440  8.880   3.014  1.00 20.15 ? 150 PHE A CD1 1 
ATOM   1032 C  CD2 . PHE A 1 135 ? 0.386   8.245   5.144  1.00 17.98 ? 150 PHE A CD2 1 
ATOM   1033 C  CE1 . PHE A 1 135 ? 0.577   8.111   2.434  1.00 18.54 ? 150 PHE A CE1 1 
ATOM   1034 C  CE2 . PHE A 1 135 ? 1.381   7.485   4.513  1.00 21.95 ? 150 PHE A CE2 1 
ATOM   1035 C  CZ  . PHE A 1 135 ? 1.443   7.450   3.173  1.00 20.39 ? 150 PHE A CZ  1 
ATOM   1036 N  N   . LEU A 1 136 ? -4.053  8.101   6.936  1.00 16.85 ? 151 LEU A N   1 
ATOM   1037 C  CA  . LEU A 1 136 ? -4.193  7.086   8.003  1.00 17.96 ? 151 LEU A CA  1 
ATOM   1038 C  C   . LEU A 1 136 ? -4.535  5.702   7.455  1.00 16.37 ? 151 LEU A C   1 
ATOM   1039 O  O   . LEU A 1 136 ? -3.992  4.665   7.921  1.00 16.46 ? 151 LEU A O   1 
ATOM   1040 C  CB  . LEU A 1 136 ? -5.167  7.549   9.082  1.00 16.42 ? 151 LEU A CB  1 
ATOM   1041 C  CG  . LEU A 1 136 ? -5.379  6.651   10.316 1.00 16.06 ? 151 LEU A CG  1 
ATOM   1042 C  CD1 . LEU A 1 136 ? -4.091  6.380   11.053 1.00 17.85 ? 151 LEU A CD1 1 
ATOM   1043 C  CD2 . LEU A 1 136 ? -6.454  7.404   11.181 1.00 16.85 ? 151 LEU A CD2 1 
ATOM   1044 N  N   . GLY A 1 137 ? -5.457  5.664   6.513  1.00 16.46 ? 152 GLY A N   1 
ATOM   1045 C  CA  . GLY A 1 137 ? -5.742  4.413   5.838  1.00 17.73 ? 152 GLY A CA  1 
ATOM   1046 C  C   . GLY A 1 137 ? -4.557  3.805   5.145  1.00 15.51 ? 152 GLY A C   1 
ATOM   1047 O  O   . GLY A 1 137 ? -4.382  2.581   5.183  1.00 16.93 ? 152 GLY A O   1 
ATOM   1048 N  N   . GLN A 1 138 ? -3.668  4.621   4.591  1.00 15.20 ? 153 GLN A N   1 
ATOM   1049 C  CA  . GLN A 1 138 ? -2.431  4.145   3.968  1.00 16.19 ? 153 GLN A CA  1 
ATOM   1050 C  C   . GLN A 1 138 ? -1.466  3.516   5.007  1.00 15.86 ? 153 GLN A C   1 
ATOM   1051 O  O   . GLN A 1 138 ? -0.857  2.481   4.746  1.00 14.58 ? 153 GLN A O   1 
ATOM   1052 C  CB  . GLN A 1 138 ? -1.736  5.216   3.127  1.00 17.26 ? 153 GLN A CB  1 
ATOM   1053 C  CG  . GLN A 1 138 ? -0.671  4.575   2.276  1.00 17.71 ? 153 GLN A CG  1 
ATOM   1054 C  CD  . GLN A 1 138 ? -1.200  3.467   1.328  1.00 19.60 ? 153 GLN A CD  1 
ATOM   1055 O  OE1 . GLN A 1 138 ? -2.127  3.702   0.549  1.00 19.69 ? 153 GLN A OE1 1 
ATOM   1056 N  NE2 . GLN A 1 138 ? -0.712  2.212   1.525  1.00 18.08 ? 153 GLN A NE2 1 
ATOM   1057 N  N   . VAL A 1 139 ? -1.320  4.154   6.184  1.00 14.52 ? 154 VAL A N   1 
ATOM   1058 C  CA  . VAL A 1 139 ? -0.499  3.557   7.158  1.00 14.40 ? 154 VAL A CA  1 
ATOM   1059 C  C   . VAL A 1 139 ? -1.128  2.247   7.602  1.00 15.45 ? 154 VAL A C   1 
ATOM   1060 O  O   . VAL A 1 139 ? -0.421  1.297   7.863  1.00 16.52 ? 154 VAL A O   1 
ATOM   1061 C  CB  . VAL A 1 139 ? -0.340  4.511   8.361  1.00 15.05 ? 154 VAL A CB  1 
ATOM   1062 C  CG1 . VAL A 1 139 ? 0.408   3.742   9.491  1.00 15.10 ? 154 VAL A CG1 1 
ATOM   1063 C  CG2 . VAL A 1 139 ? 0.425   5.731   7.951  1.00 15.36 ? 154 VAL A CG2 1 
ATOM   1064 N  N   . THR A 1 140 ? -2.441  2.188   7.706  1.00 15.92 ? 155 THR A N   1 
ATOM   1065 C  CA  . THR A 1 140 ? -3.109  0.941   8.171  1.00 15.48 ? 155 THR A CA  1 
ATOM   1066 C  C   . THR A 1 140 ? -2.730  -0.170  7.147  1.00 17.52 ? 155 THR A C   1 
ATOM   1067 O  O   . THR A 1 140 ? -2.393  -1.279  7.506  1.00 15.99 ? 155 THR A O   1 
ATOM   1068 C  CB  . THR A 1 140 ? -4.619  1.146   8.206  1.00 14.17 ? 155 THR A CB  1 
ATOM   1069 O  OG1 . THR A 1 140 ? -5.002  2.196   9.172  1.00 16.40 ? 155 THR A OG1 1 
ATOM   1070 C  CG2 . THR A 1 140 ? -5.407  -0.083  8.505  1.00 13.97 ? 155 THR A CG2 1 
ATOM   1071 N  N   . ARG A 1 141 ? -2.851  0.146   5.869  1.00 16.59 ? 156 ARG A N   1 
ATOM   1072 C  CA  . ARG A 1 141 ? -2.456  -0.754  4.766  1.00 16.81 ? 156 ARG A CA  1 
ATOM   1073 C  C   . ARG A 1 141 ? -0.989  -1.189  4.839  1.00 15.95 ? 156 ARG A C   1 
ATOM   1074 O  O   . ARG A 1 141 ? -0.684  -2.390  4.559  1.00 17.44 ? 156 ARG A O   1 
ATOM   1075 C  CB  . ARG A 1 141 ? -2.814  -0.149  3.432  1.00 15.21 ? 156 ARG A CB  1 
ATOM   1076 C  CG  . ARG A 1 141 ? -4.263  -0.172  3.197  1.00 17.83 ? 156 ARG A CG  1 
ATOM   1077 C  CD  . ARG A 1 141 ? -4.671  0.330   1.776  1.00 18.43 ? 156 ARG A CD  1 
ATOM   1078 N  NE  . ARG A 1 141 ? -4.346  1.692   1.429  1.00 20.04 ? 156 ARG A NE  1 
ATOM   1079 C  CZ  . ARG A 1 141 ? -5.097  2.753   1.753  1.00 23.23 ? 156 ARG A CZ  1 
ATOM   1080 N  NH1 . ARG A 1 141 ? -6.173  2.646   2.458  1.00 20.74 ? 156 ARG A NH1 1 
ATOM   1081 N  NH2 . ARG A 1 141 ? -4.743  3.936   1.393  1.00 22.41 ? 156 ARG A NH2 1 
ATOM   1082 N  N   . PHE A 1 142 ? -0.090  -0.281  5.226  1.00 16.84 ? 157 PHE A N   1 
ATOM   1083 C  CA  . PHE A 1 142 ? 1.361   -0.548  5.440  1.00 15.19 ? 157 PHE A CA  1 
ATOM   1084 C  C   . PHE A 1 142 ? 1.431   -1.690  6.523  1.00 16.03 ? 157 PHE A C   1 
ATOM   1085 O  O   . PHE A 1 142 ? 2.097   -2.652  6.365  1.00 15.24 ? 157 PHE A O   1 
ATOM   1086 C  CB  . PHE A 1 142 ? 2.139   0.655   5.941  1.00 16.18 ? 157 PHE A CB  1 
ATOM   1087 C  CG  . PHE A 1 142 ? 2.475   1.697   4.845  1.00 18.21 ? 157 PHE A CG  1 
ATOM   1088 C  CD1 . PHE A 1 142 ? 2.181   1.518   3.529  1.00 20.99 ? 157 PHE A CD1 1 
ATOM   1089 C  CD2 . PHE A 1 142 ? 2.972   2.895   5.224  1.00 17.37 ? 157 PHE A CD2 1 
ATOM   1090 C  CE1 . PHE A 1 142 ? 2.483   2.581   2.600  1.00 18.59 ? 157 PHE A CE1 1 
ATOM   1091 C  CE2 . PHE A 1 142 ? 3.271   3.916   4.275  1.00 18.78 ? 157 PHE A CE2 1 
ATOM   1092 C  CZ  . PHE A 1 142 ? 3.061   3.739   3.042  1.00 19.61 ? 157 PHE A CZ  1 
ATOM   1093 N  N   . VAL A 1 143 ? 0.729   -1.486  7.576  1.00 13.80 ? 158 VAL A N   1 
ATOM   1094 C  CA  . VAL A 1 143 ? 0.743   -2.441  8.702  1.00 13.78 ? 158 VAL A CA  1 
ATOM   1095 C  C   . VAL A 1 143 ? 0.171   -3.779  8.352  1.00 14.17 ? 158 VAL A C   1 
ATOM   1096 O  O   . VAL A 1 143 ? 0.851   -4.791  8.593  1.00 16.08 ? 158 VAL A O   1 
ATOM   1097 C  CB  . VAL A 1 143 ? 0.069   -1.835  9.969  1.00 14.58 ? 158 VAL A CB  1 
ATOM   1098 C  CG1 . VAL A 1 143 ? -0.008  -2.889  11.074 1.00 13.88 ? 158 VAL A CG1 1 
ATOM   1099 C  CG2 . VAL A 1 143 ? 0.858   -0.575  10.411 1.00 16.12 ? 158 VAL A CG2 1 
ATOM   1100 N  N   . VAL A 1 144 ? -1.014  -3.806  7.786  1.00 16.31 ? 159 VAL A N   1 
ATOM   1101 C  CA  . VAL A 1 144 ? -1.721  -5.041  7.425  1.00 16.89 ? 159 VAL A CA  1 
ATOM   1102 C  C   . VAL A 1 144 ? -0.878  -5.855  6.488  1.00 16.07 ? 159 VAL A C   1 
ATOM   1103 O  O   . VAL A 1 144 ? -0.658  -7.039  6.658  1.00 16.50 ? 159 VAL A O   1 
ATOM   1104 C  CB  . VAL A 1 144 ? -3.101  -4.749  6.799  1.00 16.34 ? 159 VAL A CB  1 
ATOM   1105 C  CG1 . VAL A 1 144 ? -3.767  -6.038  6.239  1.00 18.02 ? 159 VAL A CG1 1 
ATOM   1106 C  CG2 . VAL A 1 144 ? -4.083  -4.004  7.747  1.00 17.45 ? 159 VAL A CG2 1 
ATOM   1107 N  N   . ASP A 1 145 ? -0.327  -5.189  5.485  1.00 15.99 ? 160 ASP A N   1 
ATOM   1108 C  CA  . ASP A 1 145 ? 0.399   -5.896  4.423  1.00 17.20 ? 160 ASP A CA  1 
ATOM   1109 C  C   . ASP A 1 145 ? 1.770   -6.393  4.885  1.00 16.63 ? 160 ASP A C   1 
ATOM   1110 O  O   . ASP A 1 145 ? 2.188   -7.516  4.500  1.00 18.58 ? 160 ASP A O   1 
ATOM   1111 C  CB  . ASP A 1 145 ? 0.490   -5.031  3.176  1.00 16.76 ? 160 ASP A CB  1 
ATOM   1112 C  CG  . ASP A 1 145 ? 0.574   -5.904  1.872  1.00 18.40 ? 160 ASP A CG  1 
ATOM   1113 O  OD1 . ASP A 1 145 ? -0.354  -6.702  1.661  1.00 20.54 ? 160 ASP A OD1 1 
ATOM   1114 O  OD2 . ASP A 1 145 ? 1.513   -5.731  1.144  1.00 18.79 ? 160 ASP A OD2 1 
ATOM   1115 N  N   . PHE A 1 146 ? 2.464   -5.578  5.655  1.00 16.83 ? 161 PHE A N   1 
ATOM   1116 C  CA  . PHE A 1 146 ? 3.725   -5.962  6.202  1.00 16.00 ? 161 PHE A CA  1 
ATOM   1117 C  C   . PHE A 1 146 ? 3.522   -7.237  7.096  1.00 17.44 ? 161 PHE A C   1 
ATOM   1118 O  O   . PHE A 1 146 ? 4.262   -8.254  6.962  1.00 16.82 ? 161 PHE A O   1 
ATOM   1119 C  CB  . PHE A 1 146 ? 4.325   -4.886  7.071  1.00 15.90 ? 161 PHE A CB  1 
ATOM   1120 C  CG  . PHE A 1 146 ? 5.663   -5.261  7.640  1.00 19.14 ? 161 PHE A CG  1 
ATOM   1121 C  CD1 . PHE A 1 146 ? 6.854   -4.970  6.964  1.00 20.98 ? 161 PHE A CD1 1 
ATOM   1122 C  CD2 . PHE A 1 146 ? 5.712   -5.924  8.840  1.00 19.64 ? 161 PHE A CD2 1 
ATOM   1123 C  CE1 . PHE A 1 146 ? 8.056   -5.292  7.458  1.00 21.32 ? 161 PHE A CE1 1 
ATOM   1124 C  CE2 . PHE A 1 146 ? 6.946   -6.272  9.391  1.00 22.46 ? 161 PHE A CE2 1 
ATOM   1125 C  CZ  . PHE A 1 146 ? 8.110   -5.988  8.704  1.00 23.81 ? 161 PHE A CZ  1 
ATOM   1126 N  N   . MET A 1 147 ? 2.494   -7.201  7.937  1.00 15.39 ? 162 MET A N   1 
ATOM   1127 C  CA  . MET A 1 147 ? 2.217   -8.351  8.847  1.00 16.44 ? 162 MET A CA  1 
ATOM   1128 C  C   . MET A 1 147 ? 1.916   -9.628  8.081  1.00 18.24 ? 162 MET A C   1 
ATOM   1129 O  O   . MET A 1 147 ? 2.337   -10.682 8.469  1.00 20.14 ? 162 MET A O   1 
ATOM   1130 C  CB  . MET A 1 147 ? 1.152   -8.019  9.867  1.00 18.03 ? 162 MET A CB  1 
ATOM   1131 C  CG  . MET A 1 147 ? 1.665   -6.961  10.895 1.00 18.57 ? 162 MET A CG  1 
ATOM   1132 S  SD  . MET A 1 147 ? 0.546   -6.741  12.312 1.00 23.04 ? 162 MET A SD  1 
ATOM   1133 C  CE  . MET A 1 147 ? 0.373   -8.091  12.658 1.00 22.34 ? 162 MET A CE  1 
ATOM   1134 N  N   . LEU A 1 148 ? 1.281   -9.485  6.954  1.00 16.98 ? 163 LEU A N   1 
ATOM   1135 C  CA  . LEU A 1 148 ? 0.974   -10.617 6.154  1.00 18.27 ? 163 LEU A CA  1 
ATOM   1136 C  C   . LEU A 1 148 ? 2.213   -11.130 5.478  1.00 18.78 ? 163 LEU A C   1 
ATOM   1137 O  O   . LEU A 1 148 ? 2.541   -12.305 5.604  1.00 20.87 ? 163 LEU A O   1 
ATOM   1138 C  CB  . LEU A 1 148 ? -0.144  -10.278 5.156  1.00 19.46 ? 163 LEU A CB  1 
ATOM   1139 C  CG  . LEU A 1 148 ? -0.453  -11.361 4.086  1.00 19.51 ? 163 LEU A CG  1 
ATOM   1140 C  CD1 . LEU A 1 148 ? -0.844  -12.779 4.702  1.00 21.57 ? 163 LEU A CD1 1 
ATOM   1141 C  CD2 . LEU A 1 148 ? -1.477  -10.844 3.051  1.00 20.04 ? 163 LEU A CD2 1 
ATOM   1142 N  N   . HIS A 1 149 ? 2.924   -10.295 4.724  1.00 19.95 ? 164 HIS A N   1 
ATOM   1143 C  CA  . HIS A 1 149 ? 4.080   -10.773 3.937  1.00 20.38 ? 164 HIS A CA  1 
ATOM   1144 C  C   . HIS A 1 149 ? 5.328   -11.132 4.730  1.00 22.18 ? 164 HIS A C   1 
ATOM   1145 O  O   . HIS A 1 149 ? 6.211   -11.880 4.276  1.00 23.34 ? 164 HIS A O   1 
ATOM   1146 C  CB  . HIS A 1 149 ? 4.372   -9.797  2.805  1.00 21.08 ? 164 HIS A CB  1 
ATOM   1147 C  CG  . HIS A 1 149 ? 3.241   -9.654  1.862  1.00 20.47 ? 164 HIS A CG  1 
ATOM   1148 N  ND1 . HIS A 1 149 ? 2.740   -10.700 1.111  1.00 28.42 ? 164 HIS A ND1 1 
ATOM   1149 C  CD2 . HIS A 1 149 ? 2.463   -8.605  1.591  1.00 18.45 ? 164 HIS A CD2 1 
ATOM   1150 C  CE1 . HIS A 1 149 ? 1.720   -10.274 0.395  1.00 29.06 ? 164 HIS A CE1 1 
ATOM   1151 N  NE2 . HIS A 1 149 ? 1.512   -9.002  0.687  1.00 23.16 ? 164 HIS A NE2 1 
ATOM   1152 N  N   . HIS A 1 150 ? 5.423   -10.596 5.949  1.00 22.04 ? 165 HIS A N   1 
ATOM   1153 C  CA  . HIS A 1 150 ? 6.550   -10.855 6.793  1.00 20.64 ? 165 HIS A CA  1 
ATOM   1154 C  C   . HIS A 1 150 ? 6.207   -11.923 7.842  1.00 20.96 ? 165 HIS A C   1 
ATOM   1155 O  O   . HIS A 1 150 ? 6.931   -12.054 8.841  1.00 22.78 ? 165 HIS A O   1 
ATOM   1156 C  CB  . HIS A 1 150 ? 7.010   -9.582  7.417  1.00 21.95 ? 165 HIS A CB  1 
ATOM   1157 C  CG  . HIS A 1 150 ? 7.814   -8.741  6.487  1.00 22.03 ? 165 HIS A CG  1 
ATOM   1158 N  ND1 . HIS A 1 150 ? 7.278   -8.157  5.350  1.00 28.82 ? 165 HIS A ND1 1 
ATOM   1159 C  CD2 . HIS A 1 150 ? 9.111   -8.377  6.528  1.00 20.95 ? 165 HIS A CD2 1 
ATOM   1160 C  CE1 . HIS A 1 150 ? 8.227   -7.466  4.740  1.00 24.35 ? 165 HIS A CE1 1 
ATOM   1161 N  NE2 . HIS A 1 150 ? 9.338   -7.560  5.445  1.00 26.47 ? 165 HIS A NE2 1 
ATOM   1162 N  N   . CYS A 1 151 ? 5.158   -12.677 7.575  1.00 20.17 ? 166 CYS A N   1 
ATOM   1163 C  CA  . CYS A 1 151 ? 4.758   -13.887 8.361  1.00 22.89 ? 166 CYS A CA  1 
ATOM   1164 C  C   . CYS A 1 151 ? 4.417   -13.583 9.842  1.00 21.69 ? 166 CYS A C   1 
ATOM   1165 O  O   . CYS A 1 151 ? 4.453   -14.489 10.697 1.00 23.43 ? 166 CYS A O   1 
ATOM   1166 C  CB  . CYS A 1 151 ? 5.851   -14.946 8.300  1.00 24.81 ? 166 CYS A CB  1 
ATOM   1167 S  SG  . CYS A 1 151 ? 6.252   -15.471 6.648  1.00 32.65 ? 166 CYS A SG  1 
ATOM   1168 N  N   . ILE A 1 152 ? 4.054   -12.327 10.157 1.00 20.16 ? 167 ILE A N   1 
ATOM   1169 C  CA  . ILE A 1 152 ? 3.522   -11.967 11.467 1.00 20.78 ? 167 ILE A CA  1 
ATOM   1170 C  C   . ILE A 1 152 ? 2.139   -12.468 11.657 1.00 18.97 ? 167 ILE A C   1 
ATOM   1171 O  O   . ILE A 1 152 ? 1.816   -13.005 12.771 1.00 20.86 ? 167 ILE A O   1 
ATOM   1172 C  CB  . ILE A 1 152 ? 3.657   -10.461 11.677 1.00 20.74 ? 167 ILE A CB  1 
ATOM   1173 C  CG1 . ILE A 1 152 ? 5.167   -10.092 11.372 1.00 26.26 ? 167 ILE A CG1 1 
ATOM   1174 C  CG2 . ILE A 1 152 ? 3.149   -10.112 13.090 1.00 21.94 ? 167 ILE A CG2 1 
ATOM   1175 C  CD1 . ILE A 1 152 ? 5.430   -8.752  11.194 1.00 28.81 ? 167 ILE A CD1 1 
ATOM   1176 N  N   . ALA A 1 153 ? 1.299   -12.370 10.623 1.00 17.36 ? 168 ALA A N   1 
ATOM   1177 C  CA  . ALA A 1 153 ? -0.049  -12.896 10.674 1.00 17.84 ? 168 ALA A CA  1 
ATOM   1178 C  C   . ALA A 1 153 ? 0.009   -14.429 10.943 1.00 18.44 ? 168 ALA A C   1 
ATOM   1179 O  O   . ALA A 1 153 ? -0.813  -14.964 11.676 1.00 19.45 ? 168 ALA A O   1 
ATOM   1180 C  CB  . ALA A 1 153 ? -0.857  -12.612 9.381  1.00 18.50 ? 168 ALA A CB  1 
ATOM   1181 N  N   . ARG A 1 154 ? 0.948   -15.112 10.277 1.00 21.22 ? 169 ARG A N   1 
ATOM   1182 C  CA  . ARG A 1 154 ? 1.116   -16.563 10.401 1.00 21.99 ? 169 ARG A CA  1 
ATOM   1183 C  C   . ARG A 1 154 ? 1.510   -16.907 11.816 1.00 23.14 ? 169 ARG A C   1 
ATOM   1184 O  O   . ARG A 1 154 ? 0.893   -17.779 12.466 1.00 22.73 ? 169 ARG A O   1 
ATOM   1185 C  CB  . ARG A 1 154 ? 2.183   -17.091 9.412  1.00 20.72 ? 169 ARG A CB  1 
ATOM   1186 C  CG  . ARG A 1 154 ? 2.345   -18.602 9.435  1.00 27.00 ? 169 ARG A CG  1 
ATOM   1187 C  CD  . ARG A 1 154 ? 3.097   -19.143 8.247  1.00 35.00 ? 169 ARG A CD  1 
ATOM   1188 N  NE  . ARG A 1 154 ? 4.513   -19.019 8.570  1.00 44.83 ? 169 ARG A NE  1 
ATOM   1189 C  CZ  . ARG A 1 154 ? 5.521   -18.960 7.716  1.00 49.55 ? 169 ARG A CZ  1 
ATOM   1190 N  NH1 . ARG A 1 154 ? 5.311   -19.055 6.405  1.00 53.39 ? 169 ARG A NH1 1 
ATOM   1191 N  NH2 . ARG A 1 154 ? 6.763   -18.829 8.201  1.00 52.37 ? 169 ARG A NH2 1 
ATOM   1192 N  N   . TRP A 1 155 ? 2.497   -16.195 12.335 1.00 21.31 ? 170 TRP A N   1 
ATOM   1193 C  CA  . TRP A 1 155 ? 2.878   -16.337 13.745 1.00 20.56 ? 170 TRP A CA  1 
ATOM   1194 C  C   . TRP A 1 155 ? 1.726   -16.173 14.706 1.00 20.55 ? 170 TRP A C   1 
ATOM   1195 O  O   . TRP A 1 155 ? 1.540   -17.011 15.635 1.00 21.79 ? 170 TRP A O   1 
ATOM   1196 C  CB  . TRP A 1 155 ? 4.001   -15.343 14.072 1.00 20.94 ? 170 TRP A CB  1 
ATOM   1197 C  CG  . TRP A 1 155 ? 4.614   -15.483 15.460 1.00 21.36 ? 170 TRP A CG  1 
ATOM   1198 C  CD1 . TRP A 1 155 ? 5.721   -16.219 15.804 1.00 23.45 ? 170 TRP A CD1 1 
ATOM   1199 C  CD2 . TRP A 1 155 ? 4.201   -14.820 16.653 1.00 17.18 ? 170 TRP A CD2 1 
ATOM   1200 N  NE1 . TRP A 1 155 ? 5.981   -16.084 17.139 1.00 22.32 ? 170 TRP A NE1 1 
ATOM   1201 C  CE2 . TRP A 1 155 ? 5.069   -15.219 17.680 1.00 22.33 ? 170 TRP A CE2 1 
ATOM   1202 C  CE3 . TRP A 1 155 ? 3.166   -13.921 16.967 1.00 18.17 ? 170 TRP A CE3 1 
ATOM   1203 C  CZ2 . TRP A 1 155 ? 4.922   -14.764 18.968 1.00 20.47 ? 170 TRP A CZ2 1 
ATOM   1204 C  CZ3 . TRP A 1 155 ? 3.046   -13.454 18.271 1.00 21.22 ? 170 TRP A CZ3 1 
ATOM   1205 C  CH2 . TRP A 1 155 ? 3.910   -13.919 19.250 1.00 19.30 ? 170 TRP A CH2 1 
ATOM   1206 N  N   . ILE A 1 156 ? 0.945   -15.105 14.570 1.00 19.33 ? 171 ILE A N   1 
ATOM   1207 C  CA  . ILE A 1 156 ? -0.214  -14.855 15.431 1.00 18.81 ? 171 ILE A CA  1 
ATOM   1208 C  C   . ILE A 1 156 ? -1.212  -16.000 15.337 1.00 21.27 ? 171 ILE A C   1 
ATOM   1209 O  O   . ILE A 1 156 ? -1.729  -16.435 16.334 1.00 21.38 ? 171 ILE A O   1 
ATOM   1210 C  CB  . ILE A 1 156 ? -0.910  -13.452 15.124 1.00 18.19 ? 171 ILE A CB  1 
ATOM   1211 C  CG1 . ILE A 1 156 ? 0.063   -12.320 15.470 1.00 16.50 ? 171 ILE A CG1 1 
ATOM   1212 C  CG2 . ILE A 1 156 ? -2.233  -13.360 15.784 1.00 19.19 ? 171 ILE A CG2 1 
ATOM   1213 C  CD1 . ILE A 1 156 ? -0.371  -10.928 14.891 1.00 17.10 ? 171 ILE A CD1 1 
ATOM   1214 N  N   . ALA A 1 157 ? -1.433  -16.477 14.132 1.00 21.58 ? 172 ALA A N   1 
ATOM   1215 C  CA  . ALA A 1 157 ? -2.411  -17.508 13.894 1.00 24.08 ? 172 ALA A CA  1 
ATOM   1216 C  C   . ALA A 1 157 ? -1.972  -18.747 14.696 1.00 25.18 ? 172 ALA A C   1 
ATOM   1217 O  O   . ALA A 1 157 ? -2.804  -19.412 15.304 1.00 25.41 ? 172 ALA A O   1 
ATOM   1218 C  CB  . ALA A 1 157 ? -2.526  -17.805 12.420 1.00 24.20 ? 172 ALA A CB  1 
ATOM   1219 N  N   . GLN A 1 158 ? -0.667  -19.002 14.699 1.00 27.52 ? 173 GLN A N   1 
ATOM   1220 C  CA  . GLN A 1 158 ? -0.025  -20.149 15.368 1.00 28.85 ? 173 GLN A CA  1 
ATOM   1221 C  C   . GLN A 1 158 ? -0.172  -20.005 16.872 1.00 30.10 ? 173 GLN A C   1 
ATOM   1222 O  O   . GLN A 1 158 ? -0.251  -21.018 17.529 1.00 30.43 ? 173 GLN A O   1 
ATOM   1223 C  CB  . GLN A 1 158 ? 1.457   -20.277 14.999 1.00 30.35 ? 173 GLN A CB  1 
ATOM   1224 C  CG  . GLN A 1 158 ? 1.720   -20.678 13.580 1.00 33.64 ? 173 GLN A CG  1 
ATOM   1225 C  CD  . GLN A 1 158 ? 3.223   -20.649 13.171 1.00 39.22 ? 173 GLN A CD  1 
ATOM   1226 O  OE1 . GLN A 1 158 ? 4.078   -19.951 13.792 1.00 43.45 ? 173 GLN A OE1 1 
ATOM   1227 N  NE2 . GLN A 1 158 ? 3.537   -21.398 12.109 1.00 43.35 ? 173 GLN A NE2 1 
ATOM   1228 N  N   . ARG A 1 159 ? -0.196  -18.779 17.421 1.00 29.66 ? 174 ARG A N   1 
ATOM   1229 C  CA  . ARG A 1 159 ? -0.441  -18.522 18.866 1.00 29.21 ? 174 ARG A CA  1 
ATOM   1230 C  C   . ARG A 1 159 ? -1.913  -18.572 19.346 1.00 27.91 ? 174 ARG A C   1 
ATOM   1231 O  O   . ARG A 1 159 ? -2.221  -18.258 20.528 1.00 28.70 ? 174 ARG A O   1 
ATOM   1232 C  CB  . ARG A 1 159 ? 0.169   -17.142 19.218 1.00 30.21 ? 174 ARG A CB  1 
ATOM   1233 C  CG  . ARG A 1 159 ? 1.701   -17.032 18.997 1.00 33.30 ? 174 ARG A CG  1 
ATOM   1234 C  CD  . ARG A 1 159 ? 2.548   -17.923 19.939 1.00 37.59 ? 174 ARG A CD  1 
ATOM   1235 N  NE  . ARG A 1 159 ? 2.297   -17.362 21.260 1.00 45.45 ? 174 ARG A NE  1 
ATOM   1236 C  CZ  . ARG A 1 159 ? 2.442   -17.932 22.478 1.00 50.38 ? 174 ARG A CZ  1 
ATOM   1237 N  NH1 . ARG A 1 159 ? 2.161   -17.151 23.546 1.00 54.21 ? 174 ARG A NH1 1 
ATOM   1238 N  NH2 . ARG A 1 159 ? 2.844   -19.200 22.662 1.00 47.57 ? 174 ARG A NH2 1 
ATOM   1239 N  N   . GLY A 1 160 ? -2.818  -18.884 18.433 1.00 25.27 ? 175 GLY A N   1 
ATOM   1240 C  CA  . GLY A 1 160 ? -4.264  -18.835 18.633 1.00 26.03 ? 175 GLY A CA  1 
ATOM   1241 C  C   . GLY A 1 160 ? -5.058  -17.673 18.060 1.00 25.22 ? 175 GLY A C   1 
ATOM   1242 O  O   . GLY A 1 160 ? -6.183  -17.536 18.424 1.00 26.10 ? 175 GLY A O   1 
ATOM   1243 N  N   . GLY A 1 161 ? -4.471  -16.819 17.199 1.00 25.89 ? 176 GLY A N   1 
ATOM   1244 C  CA  . GLY A 1 161 ? -5.145  -15.671 16.614 1.00 23.99 ? 176 GLY A CA  1 
ATOM   1245 C  C   . GLY A 1 161 ? -4.943  -14.419 17.481 1.00 24.19 ? 176 GLY A C   1 
ATOM   1246 O  O   . GLY A 1 161 ? -4.390  -14.469 18.575 1.00 24.37 ? 176 GLY A O   1 
ATOM   1247 N  N   . TRP A 1 162 ? -5.420  -13.291 16.941 1.00 21.85 ? 177 TRP A N   1 
ATOM   1248 C  CA  . TRP A 1 162 ? -5.416  -12.016 17.633 1.00 21.52 ? 177 TRP A CA  1 
ATOM   1249 C  C   . TRP A 1 162 ? -6.107  -12.108 18.999 1.00 22.71 ? 177 TRP A C   1 
ATOM   1250 O  O   . TRP A 1 162 ? -5.702  -11.476 19.935 1.00 23.25 ? 177 TRP A O   1 
ATOM   1251 C  CB  . TRP A 1 162 ? -6.072  -10.973 16.791 1.00 20.70 ? 177 TRP A CB  1 
ATOM   1252 C  CG  . TRP A 1 162 ? -5.223  -10.327 15.766 1.00 18.64 ? 177 TRP A CG  1 
ATOM   1253 C  CD1 . TRP A 1 162 ? -5.425  -10.362 14.449 1.00 18.25 ? 177 TRP A CD1 1 
ATOM   1254 C  CD2 . TRP A 1 162 ? -4.102  -9.469  15.973 1.00 15.99 ? 177 TRP A CD2 1 
ATOM   1255 N  NE1 . TRP A 1 162 ? -4.489  -9.625  13.787 1.00 21.95 ? 177 TRP A NE1 1 
ATOM   1256 C  CE2 . TRP A 1 162 ? -3.676  -9.024  14.696 1.00 14.80 ? 177 TRP A CE2 1 
ATOM   1257 C  CE3 . TRP A 1 162 ? -3.457  -8.970  17.109 1.00 17.66 ? 177 TRP A CE3 1 
ATOM   1258 C  CZ2 . TRP A 1 162 ? -2.612  -8.109  14.509 1.00 17.23 ? 177 TRP A CZ2 1 
ATOM   1259 C  CZ3 . TRP A 1 162 ? -2.401  -8.098  16.960 1.00 16.20 ? 177 TRP A CZ3 1 
ATOM   1260 C  CH2 . TRP A 1 162 ? -1.982  -7.671  15.652 1.00 17.37 ? 177 TRP A CH2 1 
ATOM   1261 N  N   . VAL A 1 163 ? -7.096  -12.990 19.116 1.00 24.77 ? 178 VAL A N   1 
ATOM   1262 C  CA  . VAL A 1 163 ? -7.780  -13.171 20.395 1.00 26.98 ? 178 VAL A CA  1 
ATOM   1263 C  C   . VAL A 1 163 ? -6.818  -13.608 21.506 1.00 27.03 ? 178 VAL A C   1 
ATOM   1264 O  O   . VAL A 1 163 ? -7.038  -13.272 22.652 1.00 25.69 ? 178 VAL A O   1 
ATOM   1265 C  CB  . VAL A 1 163 ? -9.024  -14.125 20.207 1.00 27.80 ? 178 VAL A CB  1 
ATOM   1266 C  CG1 . VAL A 1 163 ? -8.561  -15.583 20.138 1.00 29.81 ? 178 VAL A CG1 1 
ATOM   1267 C  CG2 . VAL A 1 163 ? -10.101 -13.817 21.246 1.00 30.39 ? 178 VAL A CG2 1 
ATOM   1268 N  N   . ALA A 1 164 ? -5.743  -14.331 21.158 1.00 27.73 ? 179 ALA A N   1 
ATOM   1269 C  CA  . ALA A 1 164 ? -4.700  -14.691 22.124 1.00 29.21 ? 179 ALA A CA  1 
ATOM   1270 C  C   . ALA A 1 164 ? -4.113  -13.513 22.900 1.00 30.95 ? 179 ALA A C   1 
ATOM   1271 O  O   . ALA A 1 164 ? -3.677  -13.698 24.010 1.00 30.64 ? 179 ALA A O   1 
ATOM   1272 C  CB  . ALA A 1 164 ? -3.581  -15.486 21.478 1.00 30.09 ? 179 ALA A CB  1 
ATOM   1273 N  N   . ALA A 1 165 ? -4.106  -12.316 22.294 1.00 30.85 ? 180 ALA A N   1 
ATOM   1274 C  CA  . ALA A 1 165 ? -3.678  -11.052 22.921 1.00 32.19 ? 180 ALA A CA  1 
ATOM   1275 C  C   . ALA A 1 165 ? -4.531  -10.542 24.069 1.00 33.08 ? 180 ALA A C   1 
ATOM   1276 O  O   . ALA A 1 165 ? -4.055  -9.777  24.897 1.00 32.95 ? 180 ALA A O   1 
ATOM   1277 C  CB  . ALA A 1 165 ? -3.571  -9.932  21.794 1.00 31.53 ? 180 ALA A CB  1 
ATOM   1278 N  N   . LEU A 1 166 ? -5.815  -10.895 24.127 1.00 34.87 ? 181 LEU A N   1 
ATOM   1279 C  CA  . LEU A 1 166 ? -6.645  -10.403 25.236 1.00 36.75 ? 181 LEU A CA  1 
ATOM   1280 C  C   . LEU A 1 166 ? -6.206  -10.822 26.673 1.00 40.09 ? 181 LEU A C   1 
ATOM   1281 O  O   . LEU A 1 166 ? -6.608  -10.200 27.686 1.00 42.38 ? 181 LEU A O   1 
ATOM   1282 C  CB  . LEU A 1 166 ? -8.073  -10.844 25.057 1.00 35.79 ? 181 LEU A CB  1 
ATOM   1283 C  CG  . LEU A 1 166 ? -8.985  -10.008 24.202 1.00 32.07 ? 181 LEU A CG  1 
ATOM   1284 C  CD1 . LEU A 1 166 ? -10.338 -10.534 24.557 1.00 34.88 ? 181 LEU A CD1 1 
ATOM   1285 C  CD2 . LEU A 1 166 ? -8.929  -8.577  24.479 1.00 26.63 ? 181 LEU A CD2 1 
ATOM   1286 N  N   . ASN A 1 167 ? -5.439  -11.909 26.726 1.00 41.96 ? 182 ASN A N   1 
ATOM   1287 C  CA  . ASN A 1 167 ? -4.714  -12.387 27.905 1.00 44.04 ? 182 ASN A CA  1 
ATOM   1288 C  C   . ASN A 1 167 ? -3.475  -11.572 28.406 1.00 44.03 ? 182 ASN A C   1 
ATOM   1289 O  O   . ASN A 1 167 ? -3.112  -11.624 29.600 1.00 43.80 ? 182 ASN A O   1 
ATOM   1290 C  CB  . ASN A 1 167 ? -4.283  -13.845 27.602 1.00 45.21 ? 182 ASN A CB  1 
ATOM   1291 C  CG  . ASN A 1 167 ? -5.294  -14.883 28.165 1.00 48.22 ? 182 ASN A CG  1 
ATOM   1292 O  OD1 . ASN A 1 167 ? -6.527  -14.678 28.122 1.00 50.92 ? 182 ASN A OD1 1 
ATOM   1293 N  ND2 . ASN A 1 167 ? -4.760  -15.976 28.745 1.00 53.83 ? 182 ASN A ND2 1 
ATOM   1294 N  N   . LEU A 1 168 ? -2.843  -10.804 27.532 1.00 43.63 ? 183 LEU A N   1 
ATOM   1295 C  CA  . LEU A 1 168 ? -1.640  -10.072 27.949 1.00 44.15 ? 183 LEU A CA  1 
ATOM   1296 C  C   . LEU A 1 168 ? -1.871  -9.079  29.128 1.00 44.80 ? 183 LEU A C   1 
ATOM   1297 O  O   . LEU A 1 168 ? -2.997  -8.572  29.369 1.00 45.65 ? 183 LEU A O   1 
ATOM   1298 C  CB  . LEU A 1 168 ? -0.963  -9.392  26.744 1.00 43.22 ? 183 LEU A CB  1 
ATOM   1299 C  CG  . LEU A 1 168 ? -0.677  -10.367 25.586 1.00 41.37 ? 183 LEU A CG  1 
ATOM   1300 C  CD1 . LEU A 1 168 ? -0.005  -9.655  24.408 1.00 40.19 ? 183 LEU A CD1 1 
ATOM   1301 C  CD2 . LEU A 1 168 ? 0.134   -11.580 26.030 1.00 40.61 ? 183 LEU A CD2 1 
HETATM 1302 ZN ZN  . ZN  B 2 .   ? -0.110  -7.849  0.029  0.50 23.55 ? 200 ZN  A ZN  1 
HETATM 1303 O  O   . HOH C 3 .   ? 2.411   12.154  23.723 1.00 25.54 ? 201 HOH A O   1 
HETATM 1304 O  O   . HOH C 3 .   ? -4.995  6.762   3.340  1.00 17.75 ? 202 HOH A O   1 
HETATM 1305 O  O   . HOH C 3 .   ? -1.830  9.822   9.107  1.00 15.61 ? 203 HOH A O   1 
HETATM 1306 O  O   . HOH C 3 .   ? -3.050  11.567  7.256  1.00 16.29 ? 204 HOH A O   1 
HETATM 1307 O  O   . HOH C 3 .   ? 9.163   -7.147  22.826 1.00 19.42 ? 205 HOH A O   1 
HETATM 1308 O  O   . HOH C 3 .   ? -7.428  7.587   5.655  1.00 23.45 ? 206 HOH A O   1 
HETATM 1309 O  O   . HOH C 3 .   ? -3.792  10.600  10.848 1.00 17.49 ? 207 HOH A O   1 
HETATM 1310 O  O   . HOH C 3 .   ? -6.955  14.644  18.132 1.00 18.14 ? 208 HOH A O   1 
HETATM 1311 O  O   . HOH C 3 .   ? -10.201 9.011   10.028 1.00 26.75 ? 209 HOH A O   1 
HETATM 1312 O  O   . HOH C 3 .   ? -9.058  8.550   19.415 1.00 20.17 ? 210 HOH A O   1 
HETATM 1313 O  O   . HOH C 3 .   ? -14.499 6.758   15.735 1.00 32.80 ? 211 HOH A O   1 
HETATM 1314 O  O   . HOH C 3 .   ? 12.759  -8.451  9.631  1.00 23.20 ? 212 HOH A O   1 
HETATM 1315 O  O   . HOH C 3 .   ? -2.747  11.771  1.266  1.00 27.77 ? 213 HOH A O   1 
HETATM 1316 O  O   . HOH C 3 .   ? 2.356   14.190  -0.177 1.00 37.12 ? 214 HOH A O   1 
HETATM 1317 O  O   . HOH C 3 .   ? 3.797   -2.654  4.066  1.00 17.98 ? 215 HOH A O   1 
HETATM 1318 O  O   . HOH C 3 .   ? 1.723   -13.997 7.657  1.00 20.30 ? 216 HOH A O   1 
HETATM 1319 O  O   . HOH C 3 .   ? 6.586   13.977  7.507  1.00 87.83 ? 217 HOH A O   1 
HETATM 1320 O  O   . HOH C 3 .   ? -2.138  -8.481  8.541  1.00 22.79 ? 218 HOH A O   1 
HETATM 1321 O  O   . HOH C 3 .   ? -1.636  0.067   -0.165 1.00 22.81 ? 219 HOH A O   1 
HETATM 1322 O  O   . HOH C 3 .   ? -9.793  5.560   28.838 1.00 35.52 ? 220 HOH A O   1 
HETATM 1323 O  O   . HOH C 3 .   ? 14.033  -8.217  16.043 1.00 34.30 ? 221 HOH A O   1 
HETATM 1324 O  O   . HOH C 3 .   ? 13.211  -1.254  14.522 1.00 57.60 ? 222 HOH A O   1 
HETATM 1325 O  O   . HOH C 3 .   ? -9.101  15.876  17.408 1.00 24.12 ? 223 HOH A O   1 
HETATM 1326 O  O   . HOH C 3 .   ? 2.760   -13.589 1.766  1.00 37.04 ? 224 HOH A O   1 
HETATM 1327 O  O   . HOH C 3 .   ? 0.389   -10.594 31.699 1.00 62.86 ? 225 HOH A O   1 
HETATM 1328 O  O   . HOH C 3 .   ? -7.474  -13.347 14.502 1.00 28.35 ? 226 HOH A O   1 
HETATM 1329 O  O   . HOH C 3 .   ? -10.477 1.932   27.102 1.00 33.87 ? 227 HOH A O   1 
HETATM 1330 O  O   . HOH C 3 .   ? -7.725  2.706   8.569  1.00 21.18 ? 228 HOH A O   1 
HETATM 1331 O  O   . HOH C 3 .   ? -10.216 -6.120  10.058 1.00 24.63 ? 229 HOH A O   1 
HETATM 1332 O  O   . HOH C 3 .   ? -7.268  13.703  31.674 1.00 26.28 ? 230 HOH A O   1 
HETATM 1333 O  O   . HOH C 3 .   ? 4.836   -3.371  0.117  1.00 28.79 ? 231 HOH A O   1 
HETATM 1334 O  O   . HOH C 3 .   ? 4.745   3.929   19.782 1.00 27.54 ? 232 HOH A O   1 
HETATM 1335 O  O   . HOH C 3 .   ? -2.272  18.881  9.073  1.00 37.36 ? 233 HOH A O   1 
HETATM 1336 O  O   . HOH C 3 .   ? -17.449 -9.541  20.279 1.00 48.47 ? 234 HOH A O   1 
HETATM 1337 O  O   . HOH C 3 .   ? 6.775   -2.556  4.383  1.00 21.10 ? 235 HOH A O   1 
HETATM 1338 O  O   . HOH C 3 .   ? -2.772  -1.549  -1.832 1.00 32.10 ? 236 HOH A O   1 
HETATM 1339 O  O   . HOH C 3 .   ? -10.426 10.143  21.204 1.00 29.40 ? 237 HOH A O   1 
HETATM 1340 O  O   . HOH C 3 .   ? -7.619  0.282   3.281  1.00 28.42 ? 238 HOH A O   1 
HETATM 1341 O  O   . HOH C 3 .   ? -10.209 11.697  24.584 1.00 45.40 ? 239 HOH A O   1 
HETATM 1342 O  O   . HOH C 3 .   ? -5.266  -19.247 15.138 1.00 31.65 ? 240 HOH A O   1 
HETATM 1343 O  O   . HOH C 3 .   ? 1.205   7.270   24.573 1.00 49.82 ? 241 HOH A O   1 
HETATM 1344 O  O   . HOH C 3 .   ? 7.770   -4.803  3.001  1.00 31.35 ? 242 HOH A O   1 
HETATM 1345 O  O   . HOH C 3 .   ? -2.930  -6.616  2.695  1.00 25.72 ? 243 HOH A O   1 
HETATM 1346 O  O   . HOH C 3 .   ? 7.746   14.367  18.258 1.00 68.18 ? 244 HOH A O   1 
HETATM 1347 O  O   . HOH C 3 .   ? -17.353 4.307   15.090 1.00 53.83 ? 245 HOH A O   1 
HETATM 1348 O  O   . HOH C 3 .   ? 8.907   11.405  -1.907 1.00 42.02 ? 246 HOH A O   1 
HETATM 1349 O  O   . HOH C 3 .   ? -19.447 -8.178  13.807 1.00 54.33 ? 247 HOH A O   1 
HETATM 1350 O  O   . HOH C 3 .   ? -6.859  9.744   6.958  1.00 36.35 ? 248 HOH A O   1 
HETATM 1351 O  O   . HOH C 3 .   ? -11.945 -7.725  11.910 1.00 34.79 ? 249 HOH A O   1 
HETATM 1352 O  O   . HOH C 3 .   ? -2.417  12.360  20.651 1.00 28.01 ? 250 HOH A O   1 
HETATM 1353 O  O   . HOH C 3 .   ? 10.530  -9.501  8.734  1.00 29.14 ? 251 HOH A O   1 
HETATM 1354 O  O   . HOH C 3 .   ? -13.088 -1.875  15.658 1.00 29.43 ? 252 HOH A O   1 
HETATM 1355 O  O   . HOH C 3 .   ? -7.743  2.946   26.628 1.00 47.18 ? 253 HOH A O   1 
HETATM 1356 O  O   . HOH C 3 .   ? -13.941 -9.350  15.805 1.00 24.96 ? 254 HOH A O   1 
HETATM 1357 O  O   . HOH C 3 .   ? 8.284   -2.072  23.849 1.00 49.77 ? 255 HOH A O   1 
HETATM 1358 O  O   . HOH C 3 .   ? -0.922  2.664   24.205 1.00 34.10 ? 256 HOH A O   1 
HETATM 1359 O  O   . HOH C 3 .   ? 15.850  -2.349  8.297  1.00 25.59 ? 257 HOH A O   1 
HETATM 1360 O  O   . HOH C 3 .   ? 5.618   -2.695  22.934 1.00 30.90 ? 258 HOH A O   1 
HETATM 1361 O  O   . HOH C 3 .   ? -3.282  -4.249  2.932  1.00 30.06 ? 259 HOH A O   1 
HETATM 1362 O  O   . HOH C 3 .   ? 13.541  0.541   17.119 1.00 42.10 ? 260 HOH A O   1 
HETATM 1363 O  O   . HOH C 3 .   ? 5.707   -6.522  3.077  1.00 31.76 ? 261 HOH A O   1 
HETATM 1364 O  O   . HOH C 3 .   ? -4.858  -18.853 5.475  1.00 35.40 ? 262 HOH A O   1 
HETATM 1365 O  O   . HOH C 3 .   ? 14.872  -12.187 19.455 1.00 31.00 ? 263 HOH A O   1 
HETATM 1366 O  O   . HOH C 3 .   ? -19.129 -8.225  16.614 1.00 63.40 ? 264 HOH A O   1 
HETATM 1367 O  O   . HOH C 3 .   ? -13.821 -10.962 24.167 1.00 39.04 ? 265 HOH A O   1 
HETATM 1368 O  O   . HOH C 3 .   ? 4.860   10.878  15.891 1.00 31.28 ? 266 HOH A O   1 
HETATM 1369 O  O   . HOH C 3 .   ? -10.558 -25.471 16.215 1.00 34.32 ? 267 HOH A O   1 
HETATM 1370 O  O   . HOH C 3 .   ? -10.763 -4.761  25.431 1.00 23.22 ? 268 HOH A O   1 
HETATM 1371 O  O   . HOH C 3 .   ? 3.281   3.783   23.638 1.00 34.18 ? 269 HOH A O   1 
HETATM 1372 O  O   . HOH C 3 .   ? 16.912  -13.202 10.886 1.00 36.30 ? 270 HOH A O   1 
HETATM 1373 O  O   . HOH C 3 .   ? -8.755  -14.446 16.969 1.00 32.80 ? 271 HOH A O   1 
HETATM 1374 O  O   . HOH C 3 .   ? 15.141  14.039  16.179 1.00 39.35 ? 272 HOH A O   1 
HETATM 1375 O  O   . HOH C 3 .   ? 3.884   -4.756  2.487  1.00 29.51 ? 273 HOH A O   1 
HETATM 1376 O  O   . HOH C 3 .   ? -4.916  17.781  21.458 1.00 36.91 ? 274 HOH A O   1 
HETATM 1377 O  O   . HOH C 3 .   ? -6.406  15.754  20.655 1.00 38.89 ? 275 HOH A O   1 
HETATM 1378 O  O   . HOH C 3 .   ? 16.384  -4.630  9.492  1.00 38.77 ? 276 HOH A O   1 
HETATM 1379 O  O   . HOH C 3 .   ? 1.954   -15.225 3.239  1.00 44.88 ? 277 HOH A O   1 
HETATM 1380 O  O   . HOH C 3 .   ? -11.576 -25.615 13.965 1.00 45.23 ? 278 HOH A O   1 
HETATM 1381 O  O   . HOH C 3 .   ? 15.818  15.205  13.427 1.00 40.30 ? 279 HOH A O   1 
HETATM 1382 O  O   . HOH C 3 .   ? 13.091  1.225   3.275  1.00 31.34 ? 280 HOH A O   1 
HETATM 1383 O  O   . HOH C 3 .   ? -10.909 -13.436 12.781 1.00 40.88 ? 281 HOH A O   1 
HETATM 1384 O  O   . HOH C 3 .   ? 1.149   1.507   22.928 1.00 33.61 ? 282 HOH A O   1 
HETATM 1385 O  O   . HOH C 3 .   ? 9.028   2.318   -4.181 1.00 37.66 ? 283 HOH A O   1 
HETATM 1386 O  O   . HOH C 3 .   ? -10.499 15.336  19.935 1.00 32.69 ? 284 HOH A O   1 
HETATM 1387 O  O   . HOH C 3 .   ? 11.352  -12.552 11.676 1.00 38.66 ? 285 HOH A O   1 
HETATM 1388 O  O   . HOH C 3 .   ? -8.185  15.226  7.706  1.00 30.63 ? 286 HOH A O   1 
HETATM 1389 O  O   . HOH C 3 .   ? 11.971  -5.394  4.213  1.00 31.69 ? 287 HOH A O   1 
HETATM 1390 O  O   . HOH C 3 .   ? -8.255  -12.334 28.583 1.00 60.87 ? 288 HOH A O   1 
HETATM 1391 O  O   . HOH C 3 .   ? 9.849   -5.515  2.458  1.00 46.24 ? 289 HOH A O   1 
HETATM 1392 O  O   . HOH C 3 .   ? 9.726   18.139  6.447  1.00 42.18 ? 290 HOH A O   1 
HETATM 1393 O  O   . HOH C 3 .   ? 8.461   4.817   32.926 1.00 38.38 ? 291 HOH A O   1 
HETATM 1394 O  O   . HOH C 3 .   ? 8.598   -16.013 19.429 1.00 36.97 ? 292 HOH A O   1 
HETATM 1395 O  O   . HOH C 3 .   ? -0.644  5.085   25.785 1.00 34.00 ? 293 HOH A O   1 
HETATM 1396 O  O   . HOH C 3 .   ? 7.941   7.284   26.247 1.00 43.96 ? 294 HOH A O   1 
HETATM 1397 O  O   . HOH C 3 .   ? 3.142   16.079  -2.197 1.00 33.40 ? 295 HOH A O   1 
HETATM 1398 O  O   . HOH C 3 .   ? 15.689  -2.144  5.622  1.00 48.66 ? 296 HOH A O   1 
HETATM 1399 O  O   . HOH C 3 .   ? 16.668  -7.084  8.421  1.00 51.37 ? 297 HOH A O   1 
HETATM 1400 O  O   . HOH C 3 .   ? 9.010   -11.247 10.385 1.00 39.13 ? 298 HOH A O   1 
HETATM 1401 O  O   . HOH C 3 .   ? -5.755  -3.424  4.186  1.00 32.38 ? 299 HOH A O   1 
HETATM 1402 O  O   . HOH C 3 .   ? -10.729 -18.413 18.147 1.00 39.74 ? 300 HOH A O   1 
HETATM 1403 O  O   . HOH C 3 .   ? -8.960  3.668   30.314 1.00 39.88 ? 301 HOH A O   1 
HETATM 1404 O  O   . HOH C 3 .   ? -8.738  6.266   6.793  1.00 63.84 ? 302 HOH A O   1 
HETATM 1405 O  O   . HOH C 3 .   ? -4.136  7.527   29.733 1.00 40.67 ? 303 HOH A O   1 
HETATM 1406 O  O   . HOH C 3 .   ? -1.717  18.296  14.851 1.00 36.59 ? 304 HOH A O   1 
HETATM 1407 O  O   . HOH C 3 .   ? -11.721 -3.948  9.545  1.00 33.65 ? 305 HOH A O   1 
HETATM 1408 O  O   . HOH C 3 .   ? -4.492  -8.203  1.838  1.00 47.55 ? 306 HOH A O   1 
HETATM 1409 O  O   . HOH C 3 .   ? 6.620   -8.029  0.899  1.00 37.09 ? 307 HOH A O   1 
HETATM 1410 O  O   . HOH C 3 .   ? -12.547 -6.955  26.008 1.00 32.90 ? 308 HOH A O   1 
HETATM 1411 O  O   . HOH C 3 .   ? -12.144 3.850   26.419 0.50 28.63 ? 309 HOH A O   1 
HETATM 1412 O  O   . HOH C 3 .   ? 14.954  -8.930  8.431  1.00 50.45 ? 310 HOH A O   1 
HETATM 1413 O  O   . HOH C 3 .   ? -3.120  8.644   32.419 1.00 50.54 ? 311 HOH A O   1 
HETATM 1414 O  O   . HOH C 3 .   ? -12.257 -1.775  10.760 1.00 35.82 ? 312 HOH A O   1 
HETATM 1415 O  O   . HOH C 3 .   ? -5.797  19.287  13.130 1.00 36.52 ? 313 HOH A O   1 
HETATM 1416 O  O   . HOH C 3 .   ? -1.394  19.361  18.242 1.00 36.31 ? 314 HOH A O   1 
HETATM 1417 O  O   . HOH C 3 .   ? -6.876  -1.415  5.494  1.00 47.51 ? 315 HOH A O   1 
HETATM 1418 O  O   . HOH C 3 .   ? 9.895   -15.619 15.089 1.00 40.84 ? 316 HOH A O   1 
HETATM 1419 O  O   . HOH C 3 .   ? -11.673 -26.787 18.061 1.00 50.60 ? 317 HOH A O   1 
HETATM 1420 O  O   . HOH C 3 .   ? 2.476   19.060  3.462  1.00 43.13 ? 318 HOH A O   1 
HETATM 1421 O  O   . HOH C 3 .   ? -16.555 6.011   17.183 1.00 40.06 ? 319 HOH A O   1 
HETATM 1422 O  O   . HOH C 3 .   ? 3.847   -18.459 17.211 1.00 37.66 ? 320 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLU 1   16  ?   ?   ?   A . n 
A 1 2   PRO 2   17  ?   ?   ?   A . n 
A 1 3   ALA 3   18  ?   ?   ?   A . n 
A 1 4   LEU 4   19  ?   ?   ?   A . n 
A 1 5   PRO 5   20  ?   ?   ?   A . n 
A 1 6   SER 6   21  21  SER SER A . n 
A 1 7   ALA 7   22  22  ALA ALA A . n 
A 1 8   SER 8   23  23  SER SER A . n 
A 1 9   GLU 9   24  24  GLU GLU A . n 
A 1 10  GLU 10  25  25  GLU GLU A . n 
A 1 11  GLN 11  26  26  GLN GLN A . n 
A 1 12  VAL 12  27  27  VAL VAL A . n 
A 1 13  ALA 13  28  28  ALA ALA A . n 
A 1 14  GLN 14  29  29  GLN GLN A . n 
A 1 15  ASP 15  30  30  ASP ASP A . n 
A 1 16  THR 16  31  31  THR THR A . n 
A 1 17  GLU 17  32  32  GLU GLU A . n 
A 1 18  GLU 18  33  33  GLU GLU A . n 
A 1 19  VAL 19  34  34  VAL VAL A . n 
A 1 20  PHE 20  35  35  PHE PHE A . n 
A 1 21  ARG 21  36  36  ARG ARG A . n 
A 1 22  SER 22  37  37  SER SER A . n 
A 1 23  TYR 23  38  38  TYR TYR A . n 
A 1 24  VAL 24  39  39  VAL VAL A . n 
A 1 25  PHE 25  40  40  PHE PHE A . n 
A 1 26  TYR 26  41  41  TYR TYR A . n 
A 1 27  ARG 27  42  42  ARG ARG A . n 
A 1 28  HIS 28  43  43  HIS HIS A . n 
A 1 29  GLN 29  44  44  GLN GLN A . n 
A 1 30  GLN 30  45  45  GLN GLN A . n 
A 1 31  GLU 31  46  46  GLU GLU A . n 
A 1 32  GLN 32  47  47  GLN GLN A . n 
A 1 33  GLU 33  48  48  GLU GLU A . n 
A 1 34  ALA 34  49  49  ALA ALA A . n 
A 1 35  GLU 35  50  50  GLU GLU A . n 
A 1 36  GLY 36  51  51  GLY GLY A . n 
A 1 37  VAL 37  52  52  VAL VAL A . n 
A 1 38  ALA 38  53  53  ALA ALA A . n 
A 1 39  ALA 39  54  54  ALA ALA A . n 
A 1 40  PRO 40  55  55  PRO PRO A . n 
A 1 41  ALA 41  56  56  ALA ALA A . n 
A 1 42  ASP 42  57  57  ASP ASP A . n 
A 1 43  PRO 43  58  58  PRO PRO A . n 
A 1 44  GLU 44  59  59  GLU GLU A . n 
A 1 45  MET 45  60  60  MET MET A . n 
A 1 46  VAL 46  61  61  VAL VAL A . n 
A 1 47  THR 47  62  62  THR THR A . n 
A 1 48  LEU 48  63  63  LEU LEU A . n 
A 1 49  PRO 49  64  64  PRO PRO A . n 
A 1 50  LEU 50  65  65  LEU LEU A . n 
A 1 51  GLN 51  66  66  GLN GLN A . n 
A 1 52  PRO 52  67  67  PRO PRO A . n 
A 1 53  SER 53  68  68  SER SER A . n 
A 1 54  SER 54  69  69  SER SER A . n 
A 1 55  THR 55  70  70  THR THR A . n 
A 1 56  MET 56  71  71  MET MET A . n 
A 1 57  GLY 57  72  72  GLY GLY A . n 
A 1 58  GLN 58  73  73  GLN GLN A . n 
A 1 59  VAL 59  74  74  VAL VAL A . n 
A 1 60  GLY 60  75  75  GLY GLY A . n 
A 1 61  ARG 61  76  76  ARG ARG A . n 
A 1 62  GLN 62  77  77  GLN GLN A . n 
A 1 63  LEU 63  78  78  LEU LEU A . n 
A 1 64  ALA 64  79  79  ALA ALA A . n 
A 1 65  ILE 65  80  80  ILE ILE A . n 
A 1 66  ILE 66  81  81  ILE ILE A . n 
A 1 67  GLY 67  82  82  GLY GLY A . n 
A 1 68  ASP 68  83  83  ASP ASP A . n 
A 1 69  ASP 69  84  84  ASP ASP A . n 
A 1 70  ILE 70  85  85  ILE ILE A . n 
A 1 71  ASN 71  86  86  ASN ASN A . n 
A 1 72  ARG 72  87  87  ARG ARG A . n 
A 1 73  ARG 73  88  88  ARG ARG A . n 
A 1 74  TYR 74  89  89  TYR TYR A . n 
A 1 75  ASP 75  90  90  ASP ASP A . n 
A 1 76  SER 76  91  91  SER SER A . n 
A 1 77  GLU 77  92  92  GLU GLU A . n 
A 1 78  PHE 78  93  93  PHE PHE A . n 
A 1 79  GLN 79  94  94  GLN GLN A . n 
A 1 80  THR 80  95  95  THR THR A . n 
A 1 81  MET 81  96  96  MET MET A . n 
A 1 82  LEU 82  97  97  LEU LEU A . n 
A 1 83  GLN 83  98  98  GLN GLN A . n 
A 1 84  HIS 84  99  99  HIS HIS A . n 
A 1 85  LEU 85  100 100 LEU LEU A . n 
A 1 86  GLN 86  101 101 GLN GLN A . n 
A 1 87  PRO 87  102 102 PRO PRO A . n 
A 1 88  THR 88  103 103 THR THR A . n 
A 1 89  ALA 89  104 104 ALA ALA A . n 
A 1 90  GLU 90  105 105 GLU GLU A . n 
A 1 91  ASN 91  106 106 ASN ASN A . n 
A 1 92  ALA 92  107 107 ALA ALA A . n 
A 1 93  TYR 93  108 108 TYR TYR A . n 
A 1 94  GLU 94  109 109 GLU GLU A . n 
A 1 95  TYR 95  110 110 TYR TYR A . n 
A 1 96  PHE 96  111 111 PHE PHE A . n 
A 1 97  THR 97  112 112 THR THR A . n 
A 1 98  LYS 98  113 113 LYS LYS A . n 
A 1 99  ILE 99  114 114 ILE ILE A . n 
A 1 100 ALA 100 115 115 ALA ALA A . n 
A 1 101 THR 101 116 116 THR THR A . n 
A 1 102 SER 102 117 117 SER SER A . n 
A 1 103 LEU 103 118 118 LEU LEU A . n 
A 1 104 PHE 104 119 119 PHE PHE A . n 
A 1 105 GLU 105 120 120 GLU GLU A . n 
A 1 106 SER 106 121 121 SER SER A . n 
A 1 107 GLY 107 122 122 GLY GLY A . n 
A 1 108 ILE 108 123 123 ILE ILE A . n 
A 1 109 ASN 109 124 124 ASN ASN A . n 
A 1 110 TRP 110 125 125 TRP TRP A . n 
A 1 111 GLY 111 126 126 GLY GLY A . n 
A 1 112 ARG 112 127 127 ARG ARG A . n 
A 1 113 VAL 113 128 128 VAL VAL A . n 
A 1 114 VAL 114 129 129 VAL VAL A . n 
A 1 115 ALA 115 130 130 ALA ALA A . n 
A 1 116 LEU 116 131 131 LEU LEU A . n 
A 1 117 LEU 117 132 132 LEU LEU A . n 
A 1 118 GLY 118 133 133 GLY GLY A . n 
A 1 119 PHE 119 134 134 PHE PHE A . n 
A 1 120 GLY 120 135 135 GLY GLY A . n 
A 1 121 TYR 121 136 136 TYR TYR A . n 
A 1 122 ARG 122 137 137 ARG ARG A . n 
A 1 123 LEU 123 138 138 LEU LEU A . n 
A 1 124 ALA 124 139 139 ALA ALA A . n 
A 1 125 LEU 125 140 140 LEU LEU A . n 
A 1 126 HIS 126 141 141 HIS HIS A . n 
A 1 127 VAL 127 142 142 VAL VAL A . n 
A 1 128 TYR 128 143 143 TYR TYR A . n 
A 1 129 GLN 129 144 144 GLN GLN A . n 
A 1 130 HIS 130 145 145 HIS HIS A . n 
A 1 131 GLY 131 146 146 GLY GLY A . n 
A 1 132 LEU 132 147 147 LEU LEU A . n 
A 1 133 THR 133 148 148 THR THR A . n 
A 1 134 GLY 134 149 149 GLY GLY A . n 
A 1 135 PHE 135 150 150 PHE PHE A . n 
A 1 136 LEU 136 151 151 LEU LEU A . n 
A 1 137 GLY 137 152 152 GLY GLY A . n 
A 1 138 GLN 138 153 153 GLN GLN A . n 
A 1 139 VAL 139 154 154 VAL VAL A . n 
A 1 140 THR 140 155 155 THR THR A . n 
A 1 141 ARG 141 156 156 ARG ARG A . n 
A 1 142 PHE 142 157 157 PHE PHE A . n 
A 1 143 VAL 143 158 158 VAL VAL A . n 
A 1 144 VAL 144 159 159 VAL VAL A . n 
A 1 145 ASP 145 160 160 ASP ASP A . n 
A 1 146 PHE 146 161 161 PHE PHE A . n 
A 1 147 MET 147 162 162 MET MET A . n 
A 1 148 LEU 148 163 163 LEU LEU A . n 
A 1 149 HIS 149 164 164 HIS HIS A . n 
A 1 150 HIS 150 165 165 HIS HIS A . n 
A 1 151 CYS 151 166 166 CYS CYS A . n 
A 1 152 ILE 152 167 167 ILE ILE A . n 
A 1 153 ALA 153 168 168 ALA ALA A . n 
A 1 154 ARG 154 169 169 ARG ARG A . n 
A 1 155 TRP 155 170 170 TRP TRP A . n 
A 1 156 ILE 156 171 171 ILE ILE A . n 
A 1 157 ALA 157 172 172 ALA ALA A . n 
A 1 158 GLN 158 173 173 GLN GLN A . n 
A 1 159 ARG 159 174 174 ARG ARG A . n 
A 1 160 GLY 160 175 175 GLY GLY A . n 
A 1 161 GLY 161 176 176 GLY GLY A . n 
A 1 162 TRP 162 177 177 TRP TRP A . n 
A 1 163 VAL 163 178 178 VAL VAL A . n 
A 1 164 ALA 164 179 179 ALA ALA A . n 
A 1 165 ALA 165 180 180 ALA ALA A . n 
A 1 166 LEU 166 181 181 LEU LEU A . n 
A 1 167 ASN 167 182 182 ASN ASN A . n 
A 1 168 LEU 168 183 183 LEU LEU A . n 
A 1 169 GLY 169 184 ?   ?   ?   A . n 
A 1 170 ASN 170 185 ?   ?   ?   A . n 
A 1 171 GLY 171 186 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 ZN  1   200 200 ZN  ZN  A . 
C 3 HOH 1   201 1   HOH HOH A . 
C 3 HOH 2   202 2   HOH HOH A . 
C 3 HOH 3   203 3   HOH HOH A . 
C 3 HOH 4   204 4   HOH HOH A . 
C 3 HOH 5   205 5   HOH HOH A . 
C 3 HOH 6   206 6   HOH HOH A . 
C 3 HOH 7   207 7   HOH HOH A . 
C 3 HOH 8   208 8   HOH HOH A . 
C 3 HOH 9   209 9   HOH HOH A . 
C 3 HOH 10  210 10  HOH HOH A . 
C 3 HOH 11  211 11  HOH HOH A . 
C 3 HOH 12  212 12  HOH HOH A . 
C 3 HOH 13  213 13  HOH HOH A . 
C 3 HOH 14  214 14  HOH HOH A . 
C 3 HOH 15  215 15  HOH HOH A . 
C 3 HOH 16  216 16  HOH HOH A . 
C 3 HOH 17  217 17  HOH HOH A . 
C 3 HOH 18  218 18  HOH HOH A . 
C 3 HOH 19  219 19  HOH HOH A . 
C 3 HOH 20  220 20  HOH HOH A . 
C 3 HOH 21  221 21  HOH HOH A . 
C 3 HOH 22  222 22  HOH HOH A . 
C 3 HOH 23  223 23  HOH HOH A . 
C 3 HOH 24  224 24  HOH HOH A . 
C 3 HOH 25  225 25  HOH HOH A . 
C 3 HOH 26  226 26  HOH HOH A . 
C 3 HOH 27  227 27  HOH HOH A . 
C 3 HOH 28  228 28  HOH HOH A . 
C 3 HOH 29  229 29  HOH HOH A . 
C 3 HOH 30  230 30  HOH HOH A . 
C 3 HOH 31  231 31  HOH HOH A . 
C 3 HOH 32  232 32  HOH HOH A . 
C 3 HOH 33  233 33  HOH HOH A . 
C 3 HOH 34  234 34  HOH HOH A . 
C 3 HOH 35  235 35  HOH HOH A . 
C 3 HOH 36  236 36  HOH HOH A . 
C 3 HOH 37  237 37  HOH HOH A . 
C 3 HOH 38  238 38  HOH HOH A . 
C 3 HOH 39  239 39  HOH HOH A . 
C 3 HOH 40  240 40  HOH HOH A . 
C 3 HOH 41  241 41  HOH HOH A . 
C 3 HOH 42  242 42  HOH HOH A . 
C 3 HOH 43  243 43  HOH HOH A . 
C 3 HOH 44  244 44  HOH HOH A . 
C 3 HOH 45  245 45  HOH HOH A . 
C 3 HOH 46  246 46  HOH HOH A . 
C 3 HOH 47  247 47  HOH HOH A . 
C 3 HOH 48  248 48  HOH HOH A . 
C 3 HOH 49  249 49  HOH HOH A . 
C 3 HOH 50  250 50  HOH HOH A . 
C 3 HOH 51  251 51  HOH HOH A . 
C 3 HOH 52  252 52  HOH HOH A . 
C 3 HOH 53  253 53  HOH HOH A . 
C 3 HOH 54  254 54  HOH HOH A . 
C 3 HOH 55  255 55  HOH HOH A . 
C 3 HOH 56  256 56  HOH HOH A . 
C 3 HOH 57  257 57  HOH HOH A . 
C 3 HOH 58  258 58  HOH HOH A . 
C 3 HOH 59  259 59  HOH HOH A . 
C 3 HOH 60  260 60  HOH HOH A . 
C 3 HOH 61  261 61  HOH HOH A . 
C 3 HOH 62  262 62  HOH HOH A . 
C 3 HOH 63  263 63  HOH HOH A . 
C 3 HOH 64  264 64  HOH HOH A . 
C 3 HOH 65  265 65  HOH HOH A . 
C 3 HOH 66  266 66  HOH HOH A . 
C 3 HOH 67  267 67  HOH HOH A . 
C 3 HOH 68  268 68  HOH HOH A . 
C 3 HOH 69  269 69  HOH HOH A . 
C 3 HOH 70  270 70  HOH HOH A . 
C 3 HOH 71  271 71  HOH HOH A . 
C 3 HOH 72  272 72  HOH HOH A . 
C 3 HOH 73  273 73  HOH HOH A . 
C 3 HOH 74  274 74  HOH HOH A . 
C 3 HOH 75  275 75  HOH HOH A . 
C 3 HOH 76  276 76  HOH HOH A . 
C 3 HOH 77  277 77  HOH HOH A . 
C 3 HOH 78  278 78  HOH HOH A . 
C 3 HOH 79  279 79  HOH HOH A . 
C 3 HOH 80  280 80  HOH HOH A . 
C 3 HOH 81  281 81  HOH HOH A . 
C 3 HOH 82  282 82  HOH HOH A . 
C 3 HOH 83  283 83  HOH HOH A . 
C 3 HOH 84  284 84  HOH HOH A . 
C 3 HOH 85  285 85  HOH HOH A . 
C 3 HOH 86  286 86  HOH HOH A . 
C 3 HOH 87  287 87  HOH HOH A . 
C 3 HOH 88  288 88  HOH HOH A . 
C 3 HOH 89  289 89  HOH HOH A . 
C 3 HOH 90  290 90  HOH HOH A . 
C 3 HOH 91  291 91  HOH HOH A . 
C 3 HOH 92  292 92  HOH HOH A . 
C 3 HOH 93  293 93  HOH HOH A . 
C 3 HOH 94  294 94  HOH HOH A . 
C 3 HOH 95  295 95  HOH HOH A . 
C 3 HOH 96  296 96  HOH HOH A . 
C 3 HOH 97  297 97  HOH HOH A . 
C 3 HOH 98  298 98  HOH HOH A . 
C 3 HOH 99  299 99  HOH HOH A . 
C 3 HOH 100 300 100 HOH HOH A . 
C 3 HOH 101 301 101 HOH HOH A . 
C 3 HOH 102 302 102 HOH HOH A . 
C 3 HOH 103 303 103 HOH HOH A . 
C 3 HOH 104 304 104 HOH HOH A . 
C 3 HOH 105 305 105 HOH HOH A . 
C 3 HOH 106 306 106 HOH HOH A . 
C 3 HOH 107 307 107 HOH HOH A . 
C 3 HOH 108 308 108 HOH HOH A . 
C 3 HOH 109 309 109 HOH HOH A . 
C 3 HOH 110 310 110 HOH HOH A . 
C 3 HOH 111 311 111 HOH HOH A . 
C 3 HOH 112 312 112 HOH HOH A . 
C 3 HOH 113 313 113 HOH HOH A . 
C 3 HOH 114 314 114 HOH HOH A . 
C 3 HOH 115 315 115 HOH HOH A . 
C 3 HOH 116 316 116 HOH HOH A . 
C 3 HOH 117 317 117 HOH HOH A . 
C 3 HOH 118 318 118 HOH HOH A . 
C 3 HOH 119 319 119 HOH HOH A . 
C 3 HOH 120 320 120 HOH HOH A . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA dimeric   2 
2 software_defined_assembly            PQS  monomeric 1 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1,2 A,B,C 
2 1   A,B,C 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 1460  ? 
1 MORE         -128  ? 
1 'SSA (A^2)'  14840 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z   1.0000000000  0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000 
2 'crystal symmetry operation' 2_555 -x,y,-z -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 
# 
loop_
_pdbx_struct_special_symmetry.id 
_pdbx_struct_special_symmetry.PDB_model_num 
_pdbx_struct_special_symmetry.auth_asym_id 
_pdbx_struct_special_symmetry.auth_comp_id 
_pdbx_struct_special_symmetry.auth_seq_id 
_pdbx_struct_special_symmetry.PDB_ins_code 
_pdbx_struct_special_symmetry.label_asym_id 
_pdbx_struct_special_symmetry.label_comp_id 
_pdbx_struct_special_symmetry.label_seq_id 
1 1 A ZN  200 ? B ZN  . 
2 1 A HOH 309 ? C HOH . 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1 OD1 ? A ASP 145 ? A ASP 160 ? 1_555 ZN ? B ZN . ? A ZN 200 ? 1_555 NE2 ? A HIS 149 ? A HIS 164 ? 1_555 98.8  ? 
2 OD1 ? A ASP 145 ? A ASP 160 ? 1_555 ZN ? B ZN . ? A ZN 200 ? 1_555 OD1 ? A ASP 145 ? A ASP 160 ? 2_555 111.7 ? 
3 NE2 ? A HIS 149 ? A HIS 164 ? 1_555 ZN ? B ZN . ? A ZN 200 ? 1_555 OD1 ? A ASP 145 ? A ASP 160 ? 2_555 112.5 ? 
4 OD1 ? A ASP 145 ? A ASP 160 ? 1_555 ZN ? B ZN . ? A ZN 200 ? 1_555 NE2 ? A HIS 149 ? A HIS 164 ? 2_555 123.2 ? 
5 NE2 ? A HIS 149 ? A HIS 164 ? 1_555 ZN ? B ZN . ? A ZN 200 ? 1_555 NE2 ? A HIS 149 ? A HIS 164 ? 2_555 110.3 ? 
6 OD1 ? A ASP 145 ? A ASP 160 ? 2_555 ZN ? B ZN . ? A ZN 200 ? 1_555 NE2 ? A HIS 149 ? A HIS 164 ? 2_555 100.8 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2007-01-23 
2 'Structure model' 1 1 2008-05-01 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2017-10-18 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Derived calculations'      
3 3 'Structure model' 'Version format compliance' 
4 4 'Structure model' 'Refinement description'    
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    4 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            software 
# 
loop_
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
_software.pdbx_ordinal 
DENZO        .              ?                package 'Zbyszek Otwinowski' zbyszek@mix.swmed.edu    'data reduction'  
http://www.lnls.br/infra/linhasluz/denzo-hkl.htm ?          ? 1 
SCALEPACK    .              ?                package 'Zbyszek Otwinowski' zbyszek@mix.swmed.edu    'data scaling'    
http://www.lnls.br/infra/linhasluz/denzo-hkl.htm ?          ? 2 
REFMAC       5.1.24         ?                program 'Murshudov, G.N.'    ccp4@dl.ac.uk            refinement        
http://www.ccp4.ac.uk/main.html                  Fortran_77 ? 3 
PDB_EXTRACT  2.000          'April. 3, 2006' package PDB                  sw-help@rcsb.rutgers.edu 'data extraction' 
http://pdb.rutgers.edu/software/                 C++        ? 4 
CrystalClear '(MSC/RIGAKU)' ?                ?       ?                    ?                        'data collection' ? ?          
? 5 
d*TREK       .              ?                ?       ?                    ?                        'data reduction'  ? ?          
? 6 
d*TREK       .              ?                ?       ?                    ?                        'data scaling'    ? ?          
? 7 
MOLREP       .              ?                ?       ?                    ?                        phasing           ? ?          
? 8 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 OE2 A GLU 50  ? ? O A HOH 201 ? ? 2.02 
2 1 OD2 A ASP 30  ? ? O A HOH 281 ? ? 2.17 
3 1 O   A HOH 206 ? ? O A HOH 302 ? ? 2.18 
# 
_pdbx_validate_symm_contact.id                1 
_pdbx_validate_symm_contact.PDB_model_num     1 
_pdbx_validate_symm_contact.auth_atom_id_1    O 
_pdbx_validate_symm_contact.auth_asym_id_1    A 
_pdbx_validate_symm_contact.auth_comp_id_1    HOH 
_pdbx_validate_symm_contact.auth_seq_id_1     308 
_pdbx_validate_symm_contact.PDB_ins_code_1    ? 
_pdbx_validate_symm_contact.label_alt_id_1    ? 
_pdbx_validate_symm_contact.site_symmetry_1   1_555 
_pdbx_validate_symm_contact.auth_atom_id_2    O 
_pdbx_validate_symm_contact.auth_asym_id_2    A 
_pdbx_validate_symm_contact.auth_comp_id_2    HOH 
_pdbx_validate_symm_contact.auth_seq_id_2     308 
_pdbx_validate_symm_contact.PDB_ins_code_2    ? 
_pdbx_validate_symm_contact.label_alt_id_2    ? 
_pdbx_validate_symm_contact.site_symmetry_2   2_556 
_pdbx_validate_symm_contact.dist              0.95 
# 
_pdbx_validate_rmsd_bond.id                        1 
_pdbx_validate_rmsd_bond.PDB_model_num             1 
_pdbx_validate_rmsd_bond.auth_atom_id_1            SD 
_pdbx_validate_rmsd_bond.auth_asym_id_1            A 
_pdbx_validate_rmsd_bond.auth_comp_id_1            MET 
_pdbx_validate_rmsd_bond.auth_seq_id_1             162 
_pdbx_validate_rmsd_bond.PDB_ins_code_1            ? 
_pdbx_validate_rmsd_bond.label_alt_id_1            ? 
_pdbx_validate_rmsd_bond.auth_atom_id_2            CE 
_pdbx_validate_rmsd_bond.auth_asym_id_2            A 
_pdbx_validate_rmsd_bond.auth_comp_id_2            MET 
_pdbx_validate_rmsd_bond.auth_seq_id_2             162 
_pdbx_validate_rmsd_bond.PDB_ins_code_2            ? 
_pdbx_validate_rmsd_bond.label_alt_id_2            ? 
_pdbx_validate_rmsd_bond.bond_value                1.404 
_pdbx_validate_rmsd_bond.bond_target_value         1.774 
_pdbx_validate_rmsd_bond.bond_deviation            -0.370 
_pdbx_validate_rmsd_bond.bond_standard_deviation   0.056 
_pdbx_validate_rmsd_bond.linker_flag               N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 NE A ARG 174 ? ? CZ A ARG 174 ? ? NH1 A ARG 174 ? ? 116.45 120.30 -3.85 0.50 N 
2 1 NE A ARG 174 ? ? CZ A ARG 174 ? ? NH2 A ARG 174 ? ? 123.60 120.30 3.30  0.50 N 
# 
_pdbx_validate_torsion.id              1 
_pdbx_validate_torsion.PDB_model_num   1 
_pdbx_validate_torsion.auth_comp_id    ASP 
_pdbx_validate_torsion.auth_asym_id    A 
_pdbx_validate_torsion.auth_seq_id     57 
_pdbx_validate_torsion.PDB_ins_code    ? 
_pdbx_validate_torsion.label_alt_id    ? 
_pdbx_validate_torsion.phi             -158.74 
_pdbx_validate_torsion.psi             89.42 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A GLU 16  ? A GLU 1   
2 1 Y 1 A PRO 17  ? A PRO 2   
3 1 Y 1 A ALA 18  ? A ALA 3   
4 1 Y 1 A LEU 19  ? A LEU 4   
5 1 Y 1 A PRO 20  ? A PRO 5   
6 1 Y 1 A GLY 184 ? A GLY 169 
7 1 Y 1 A ASN 185 ? A ASN 170 
8 1 Y 1 A GLY 186 ? A GLY 171 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'ZINC ION' ZN  
3 water      HOH 
#