data_2J8B
# 
_entry.id   2J8B 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.286 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2J8B         
PDBE  EBI-30300    
WWPDB D_1290030300 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 1CDQ unspecified 'CD59 (NMR, 20 STRUCTURES)'                                                                
PDB 1CDS unspecified 'CD59 COMPLEXED WITH GLCNAC-BETA-1,4-(FUC- ALPHA-1,6)- GLCNAC-BETA-1 (NMR, 10 STRUCTURES)' 
PDB 2UWR unspecified 'HIGH RESOLUTION STRUCTURE OF HUMAN CD59'                                                  
PDB 1CDR unspecified 'CD59 COMPLEXED WITH GLCNAC-BETA-1,4-GLCNAC -BETA-1 (NMR, 10 STRUCTURES)'                  
PDB 1ERG unspecified .                                                                                          
PDB 1ERH unspecified .                                                                                          
PDB 2UX2 unspecified 'HIGH RESOLUTION STRUCTURE OF HUMAN CD59'                                                  
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2J8B 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2006-10-24 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Leath, K.J.'   1 
'Johnson, S.'   2 
'Roversi, P.'   3 
'Morgan, B.P.'  4 
'Smith, R.A.G.' 5 
'Lea, S.M.'     6 
# 
_citation.id                        primary 
_citation.title                     'High-Resolution Structures of Bacterially Expressed Soluble Human Cd59.' 
_citation.journal_abbrev            'Acta Crystallogr.,Sect.F' 
_citation.journal_volume            63 
_citation.page_first                648 
_citation.page_last                 ? 
_citation.year                      2007 
_citation.journal_id_ASTM           ? 
_citation.country                   DK 
_citation.journal_id_ISSN           1744-3091 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   17671359 
_citation.pdbx_database_id_DOI      10.1107/S1744309107033477 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Leath, K.J.'   1 
primary 'Johnson, S.'   2 
primary 'Roversi, P.'   3 
primary 'Hughes, T.R.'  4 
primary 'Smith, R.A.G.' 5 
primary 'Mackenzie, L.' 6 
primary 'Morgan, B.P.'  7 
primary 'Lea, S.M.'     8 
# 
_cell.entry_id           2J8B 
_cell.length_a           31.948 
_cell.length_b           45.918 
_cell.length_c           46.033 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2J8B 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'CD59 GLYCOPROTEIN' 9158.354 1   ? ? 'MATURE POLYPEPTIDE, RESIDUES 26-103' ? 
2 water   nat water               18.015   117 ? ? ?                                     ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
;MEMBRANE ATTACK COMPLEX INHIBITION FACTOR, MACIF, MAC-INHIBITORY PROTEIN, MAC-IP, PROTECTIN, MEM43 ANTIGEN, MEMBRANE INHIBITOR OF REACTIVE LYSIS, MIRL, 20 KDA HOMOLOGOUS RESTRICTION FACTOR, HRF-20,HRF20,1F5 ANTIGEN, CD59
;
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       MLQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLENG 
_entity_poly.pdbx_seq_one_letter_code_can   MLQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLENG 
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  MET n 
1 2  LEU n 
1 3  GLN n 
1 4  CYS n 
1 5  TYR n 
1 6  ASN n 
1 7  CYS n 
1 8  PRO n 
1 9  ASN n 
1 10 PRO n 
1 11 THR n 
1 12 ALA n 
1 13 ASP n 
1 14 CYS n 
1 15 LYS n 
1 16 THR n 
1 17 ALA n 
1 18 VAL n 
1 19 ASN n 
1 20 CYS n 
1 21 SER n 
1 22 SER n 
1 23 ASP n 
1 24 PHE n 
1 25 ASP n 
1 26 ALA n 
1 27 CYS n 
1 28 LEU n 
1 29 ILE n 
1 30 THR n 
1 31 LYS n 
1 32 ALA n 
1 33 GLY n 
1 34 LEU n 
1 35 GLN n 
1 36 VAL n 
1 37 TYR n 
1 38 ASN n 
1 39 LYS n 
1 40 CYS n 
1 41 TRP n 
1 42 LYS n 
1 43 PHE n 
1 44 GLU n 
1 45 HIS n 
1 46 CYS n 
1 47 ASN n 
1 48 PHE n 
1 49 ASN n 
1 50 ASP n 
1 51 VAL n 
1 52 THR n 
1 53 THR n 
1 54 ARG n 
1 55 LEU n 
1 56 ARG n 
1 57 GLU n 
1 58 ASN n 
1 59 GLU n 
1 60 LEU n 
1 61 THR n 
1 62 TYR n 
1 63 TYR n 
1 64 CYS n 
1 65 CYS n 
1 66 LYS n 
1 67 LYS n 
1 68 ASP n 
1 69 LEU n 
1 70 CYS n 
1 71 ASN n 
1 72 PHE n 
1 73 ASN n 
1 74 GLU n 
1 75 GLN n 
1 76 LEU n 
1 77 GLU n 
1 78 ASN n 
1 79 GLY n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               HUMAN 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'HOMO SAPIENS' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 'LYMPHOCYTES, ERYTHROCYTES, PLATELETS, ENDOTHELIA, EPITHELIA' 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'ESCHERICHIA COLI' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'UT5600 (DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PET59-06 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   'PURIFIED FROM INCLUSION BODIES AFTER EXPRESSION IN ESCHERICHIA COLI' 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 PDB 2J8B       1 ? ? 2J8B   ? 
2 UNP CD59_HUMAN 1 ? ? P13987 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2J8B A 1 ? 1  ? 2J8B   0  ? 0   ? 0 0  
2 2 2J8B A 2 ? 79 ? P13987 26 ? 103 ? 1 78 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2J8B 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      1.84 
_exptl_crystal.density_percent_sol   33 
_exptl_crystal.description           NONE 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    '28 % PEG 4000 0.25M AMMONIUM SULPHATE' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC CCD' 
_diffrn_detector.pdbx_collection_date   2006-05-21 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
loop_
_diffrn_radiation_wavelength.id 
_diffrn_radiation_wavelength.wavelength 
_diffrn_radiation_wavelength.wt 
1 0.92 1.0 
2 1.24 1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE ID29' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ID29 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        '0.92, 1.24' 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     2J8B 
_reflns.observed_criterion_sigma_I   0.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             26.20 
_reflns.d_resolution_high            1.10 
_reflns.number_obs                   27724 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.0 
_reflns.pdbx_Rmerge_I_obs            0.10 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        20.70 
_reflns.B_iso_Wilson_estimate        8.40 
_reflns.pdbx_redundancy              12.0 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             1.10 
_reflns_shell.d_res_low              1.16 
_reflns_shell.percent_possible_all   93.3 
_reflns_shell.Rmerge_I_obs           0.24 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    3.70 
_reflns_shell.pdbx_redundancy        3.5 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 2J8B 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     23463 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             20.00 
_refine.ls_d_res_high                            1.15 
_refine.ls_percent_reflns_obs                    99.9 
_refine.ls_R_factor_obs                          0.165 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.164 
_refine.ls_R_factor_R_free                       0.197 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.000 
_refine.ls_number_reflns_R_free                  1238 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.966 
_refine.correlation_coeff_Fo_to_Fc_free          0.949 
_refine.B_iso_mean                               12.96 
_refine.aniso_B[1][1]                            -0.79000 
_refine.aniso_B[2][2]                            -0.66000 
_refine.aniso_B[3][3]                            1.45000 
_refine.aniso_B[1][2]                            0.00000 
_refine.aniso_B[1][3]                            0.00000 
_refine.aniso_B[2][3]                            0.00000 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS. RESIDUE 78 WAS NOT MODELLED' 
_refine.pdbx_starting_model                      'PDB ENTRY 1CDQ' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.042 
_refine.pdbx_overall_ESU_R_Free                  0.042 
_refine.overall_SU_ML                            0.023 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             1.043 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        629 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             117 
_refine_hist.number_atoms_total               746 
_refine_hist.d_res_high                       1.15 
_refine_hist.d_res_low                        20.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.010  0.022  ? 698 'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?      ?      ? ?   'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.410  1.931  ? 950 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?      ?      ? ?   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       7.145  5.000  ? 84  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       37.174 25.526 ? 38  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       12.342 15.000 ? 126 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       22.596 15.000 ? 3   'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.099  0.200  ? 100 'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.007  0.020  ? 538 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?      ? ?   'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.218  0.300  ? 281 'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?   'X-RAY DIFFRACTION' ? 
r_nbtor_refined              0.308  0.500  ? 486 'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?   'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.244  0.500  ? 123 'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?   'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?   'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.200  0.300  ? 47  'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.428  0.500  ? 52  'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?   'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?   'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?   'X-RAY DIFFRACTION' ? 
r_mcbond_it                  1.700  2.000  ? 427 'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?   'X-RAY DIFFRACTION' ? 
r_mcangle_it                 2.435  3.000  ? 677 'X-RAY DIFFRACTION' ? 
r_mcangle_other              ?      ?      ? ?   'X-RAY DIFFRACTION' ? 
r_scbond_it                  2.069  2.000  ? 308 'X-RAY DIFFRACTION' ? 
r_scbond_other               ?      ?      ? ?   'X-RAY DIFFRACTION' ? 
r_scangle_it                 2.728  3.000  ? 273 'X-RAY DIFFRACTION' ? 
r_scangle_other              ?      ?      ? ?   'X-RAY DIFFRACTION' ? 
r_long_range_B_refined       ?      ?      ? ?   'X-RAY DIFFRACTION' ? 
r_long_range_B_other         ?      ?      ? ?   'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?   'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?   'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?   'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       1.15 
_refine_ls_shell.d_res_low                        1.18 
_refine_ls_shell.number_reflns_R_work             1709 
_refine_ls_shell.R_factor_R_work                  0.2030 
_refine_ls_shell.percent_reflns_obs               ? 
_refine_ls_shell.R_factor_R_free                  0.2020 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             80 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  2J8B 
_struct.title                     'High resolution structure of human CD59' 
_struct.pdbx_descriptor           'CD59 GLYCOPROTEIN' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2J8B 
_struct_keywords.pdbx_keywords   'LIPID BINDING PROTEIN' 
_struct_keywords.text            
;LIPID-BINDING PROTEIN, GLYCOPROTEIN, LIPID-BINDING PROTEIN MAC, MEMBRANE, GPI-ANCHOR, COMPLEMENT, LIPOPROTEIN, LIPID BINDING PROTEIN
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 LYS A 42 ? CYS A 46 ? LYS A 41 CYS A 45 5 ? 5  
HELX_P HELX_P2 2 ASN A 47 ? ARG A 56 ? ASN A 46 ARG A 55 1 ? 10 
HELX_P HELX_P3 3 PHE A 72 ? LEU A 76 ? PHE A 71 LEU A 75 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 4  SG ? ? ? 1_555 A CYS 27 SG ? ? A CYS 3  A CYS 26 1_555 ? ? ? ? ? ? ? 2.039 ? 
disulf2 disulf ? ? A CYS 7  SG ? ? ? 1_555 A CYS 14 SG ? ? A CYS 6  A CYS 13 1_555 ? ? ? ? ? ? ? 2.056 ? 
disulf3 disulf ? ? A CYS 20 SG ? ? ? 1_555 A CYS 40 SG ? ? A CYS 19 A CYS 39 1_555 ? ? ? ? ? ? ? 2.029 ? 
disulf4 disulf ? ? A CYS 46 SG A ? ? 1_555 A CYS 64 SG ? ? A CYS 45 A CYS 63 1_555 ? ? ? ? ? ? ? 2.039 ? 
disulf5 disulf ? ? A CYS 46 SG B ? ? 1_555 A CYS 64 SG ? ? A CYS 45 A CYS 63 1_555 ? ? ? ? ? ? ? 1.971 ? 
disulf6 disulf ? ? A CYS 65 SG ? ? ? 1_555 A CYS 70 SG ? ? A CYS 64 A CYS 69 1_555 ? ? ? ? ? ? ? 2.020 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 2 ? 
AB ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? anti-parallel 
AB 1 2 ? anti-parallel 
AB 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 GLN A 3  ? TYR A 5  ? GLN A 2  TYR A 4  
AA 2 ALA A 17 ? ASN A 19 ? ALA A 16 ASN A 18 
AB 1 GLN A 35 ? TRP A 41 ? GLN A 34 TRP A 40 
AB 2 ALA A 26 ? ALA A 32 ? ALA A 25 ALA A 31 
AB 3 THR A 61 ? CYS A 65 ? THR A 60 CYS A 64 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N CYS A 4  ? N CYS A 3  O VAL A 18 ? O VAL A 17 
AB 1 2 N TRP A 41 ? N TRP A 40 O ALA A 26 ? O ALA A 25 
AB 2 3 N LYS A 31 ? N LYS A 30 O THR A 61 ? O THR A 60 
# 
_database_PDB_matrix.entry_id          2J8B 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2J8B 
_atom_sites.fract_transf_matrix[1][1]   0.031301 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.021778 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.021724 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1   N N   A MET A 1 1  ? -17.299 -8.127  9.442  0.50 9.00  ? 0    MET A N   1 
ATOM   2   N N   B MET A 1 1  ? -17.275 -8.205  9.762  0.50 11.96 ? 0    MET A N   1 
ATOM   3   C CA  A MET A 1 1  ? -15.929 -8.721  9.469  0.50 9.76  ? 0    MET A CA  1 
ATOM   4   C CA  B MET A 1 1  ? -15.912 -8.737  9.459  0.50 12.58 ? 0    MET A CA  1 
ATOM   5   C C   A MET A 1 1  ? -14.899 -7.646  9.817  0.50 9.15  ? 0    MET A C   1 
ATOM   6   C C   B MET A 1 1  ? -14.853 -7.668  9.700  0.50 11.16 ? 0    MET A C   1 
ATOM   7   O O   A MET A 1 1  ? -15.171 -6.449  9.696  0.50 9.80  ? 0    MET A O   1 
ATOM   8   O O   B MET A 1 1  ? -15.051 -6.498  9.368  0.50 11.54 ? 0    MET A O   1 
ATOM   9   C CB  A MET A 1 1  ? -15.600 -9.373  8.123  0.50 9.90  ? 0    MET A CB  1 
ATOM   10  C CB  B MET A 1 1  ? -15.831 -9.226  8.012  0.50 14.90 ? 0    MET A CB  1 
ATOM   11  C CG  A MET A 1 1  ? -16.584 -10.467 7.709  0.50 10.90 ? 0    MET A CG  1 
ATOM   12  C CG  B MET A 1 1  ? -16.877 -10.269 7.653  0.50 17.86 ? 0    MET A CG  1 
ATOM   13  S SD  A MET A 1 1  ? -16.297 -11.150 6.062  0.50 12.30 ? 0    MET A SD  1 
ATOM   14  S SD  B MET A 1 1  ? -16.491 -11.910 8.293  0.50 21.75 ? 0    MET A SD  1 
ATOM   15  C CE  A MET A 1 1  ? -14.963 -12.295 6.386  0.50 13.71 ? 0    MET A CE  1 
ATOM   16  C CE  B MET A 1 1  ? -15.316 -12.468 7.066  0.50 21.22 ? 0    MET A CE  1 
ATOM   17  N N   . LEU A 1 2  ? -13.727 -8.073  10.277 1.00 10.57 ? 1    LEU A N   1 
ATOM   18  C CA  . LEU A 1 2  ? -12.592 -7.172  10.486 1.00 9.56  ? 1    LEU A CA  1 
ATOM   19  C C   . LEU A 1 2  ? -11.744 -7.155  9.223  1.00 9.35  ? 1    LEU A C   1 
ATOM   20  O O   . LEU A 1 2  ? -11.294 -8.199  8.761  1.00 10.86 ? 1    LEU A O   1 
ATOM   21  C CB  . LEU A 1 2  ? -11.760 -7.637  11.682 1.00 10.30 ? 1    LEU A CB  1 
ATOM   22  C CG  . LEU A 1 2  ? -10.495 -6.823  11.974 1.00 9.90  ? 1    LEU A CG  1 
ATOM   23  C CD1 . LEU A 1 2  ? -10.810 -5.371  12.305 1.00 11.11 ? 1    LEU A CD1 1 
ATOM   24  C CD2 . LEU A 1 2  ? -9.722  -7.474  13.113 1.00 11.56 ? 1    LEU A CD2 1 
ATOM   25  N N   A GLN A 1 3  ? -11.530 -5.978  8.646  0.50 8.92  ? 2    GLN A N   1 
ATOM   26  N N   B GLN A 1 3  ? -11.533 -5.948  8.701  0.50 9.50  ? 2    GLN A N   1 
ATOM   27  C CA  A GLN A 1 3  ? -10.678 -5.862  7.463  0.50 9.04  ? 2    GLN A CA  1 
ATOM   28  C CA  B GLN A 1 3  ? -10.628 -5.699  7.588  0.50 9.76  ? 2    GLN A CA  1 
ATOM   29  C C   A GLN A 1 3  ? -9.310  -5.340  7.897  0.50 8.34  ? 2    GLN A C   1 
ATOM   30  C C   B GLN A 1 3  ? -9.243  -5.407  8.109  0.50 8.73  ? 2    GLN A C   1 
ATOM   31  O O   A GLN A 1 3  ? -9.233  -4.314  8.569  0.50 8.47  ? 2    GLN A O   1 
ATOM   32  O O   B GLN A 1 3  ? -9.069  -4.587  9.020  0.50 8.74  ? 2    GLN A O   1 
ATOM   33  C CB  A GLN A 1 3  ? -11.332 -4.942  6.417  0.50 10.04 ? 2    GLN A CB  1 
ATOM   34  C CB  B GLN A 1 3  ? -11.088 -4.482  6.790  0.50 12.33 ? 2    GLN A CB  1 
ATOM   35  C CG  A GLN A 1 3  ? -10.671 -5.007  5.038  0.50 10.35 ? 2    GLN A CG  1 
ATOM   36  C CG  B GLN A 1 3  ? -12.289 -4.734  5.928  0.50 14.99 ? 2    GLN A CG  1 
ATOM   37  C CD  A GLN A 1 3  ? -11.226 -4.018  4.017  0.50 10.84 ? 2    GLN A CD  1 
ATOM   38  C CD  B GLN A 1 3  ? -12.526 -3.618  4.945  0.50 17.05 ? 2    GLN A CD  1 
ATOM   39  O OE1 A GLN A 1 3  ? -11.677 -2.946  4.365  0.50 10.94 ? 2    GLN A OE1 1 
ATOM   40  O OE1 B GLN A 1 3  ? -12.087 -2.486  5.160  0.50 18.00 ? 2    GLN A OE1 1 
ATOM   41  N NE2 A GLN A 1 3  ? -11.159 -4.378  2.748  0.50 12.94 ? 2    GLN A NE2 1 
ATOM   42  N NE2 B GLN A 1 3  ? -13.232 -3.924  3.861  0.50 18.08 ? 2    GLN A NE2 1 
ATOM   43  N N   . CYS A 1 4  ? -8.252  -6.058  7.518  1.00 7.93  ? 3    CYS A N   1 
ATOM   44  C CA  . CYS A 1 4  ? -6.871  -5.739  7.872  1.00 7.53  ? 3    CYS A CA  1 
ATOM   45  C C   . CYS A 1 4  ? -6.037  -5.640  6.610  1.00 7.19  ? 3    CYS A C   1 
ATOM   46  O O   . CYS A 1 4  ? -6.359  -6.258  5.586  1.00 8.14  ? 3    CYS A O   1 
ATOM   47  C CB  . CYS A 1 4  ? -6.273  -6.858  8.738  1.00 7.44  ? 3    CYS A CB  1 
ATOM   48  S SG  . CYS A 1 4  ? -7.097  -7.165  10.325 1.00 7.65  ? 3    CYS A SG  1 
ATOM   49  N N   . TYR A 1 5  ? -4.930  -4.919  6.699  1.00 6.69  ? 4    TYR A N   1 
ATOM   50  C CA  . TYR A 1 5  ? -3.898  -5.097  5.699  1.00 6.95  ? 4    TYR A CA  1 
ATOM   51  C C   . TYR A 1 5  ? -3.292  -6.479  5.901  1.00 6.26  ? 4    TYR A C   1 
ATOM   52  O O   . TYR A 1 5  ? -2.956  -6.869  7.026  1.00 6.90  ? 4    TYR A O   1 
ATOM   53  C CB  . TYR A 1 5  ? -2.826  -4.005  5.790  1.00 7.87  ? 4    TYR A CB  1 
ATOM   54  C CG  . TYR A 1 5  ? -3.370  -2.639  5.437  1.00 8.31  ? 4    TYR A CG  1 
ATOM   55  C CD1 . TYR A 1 5  ? -3.771  -2.353  4.121  1.00 8.43  ? 4    TYR A CD1 1 
ATOM   56  C CD2 . TYR A 1 5  ? -3.500  -1.634  6.393  1.00 8.98  ? 4    TYR A CD2 1 
ATOM   57  C CE1 . TYR A 1 5  ? -4.284  -1.115  3.787  1.00 10.17 ? 4    TYR A CE1 1 
ATOM   58  C CE2 . TYR A 1 5  ? -4.007  -0.392  6.053  1.00 10.32 ? 4    TYR A CE2 1 
ATOM   59  C CZ  . TYR A 1 5  ? -4.395  -0.140  4.753  1.00 9.89  ? 4    TYR A CZ  1 
ATOM   60  O OH  . TYR A 1 5  ? -4.906  1.086   4.397  1.00 12.00 ? 4    TYR A OH  1 
ATOM   61  N N   . ASN A 1 6  ? -3.191  -7.247  4.822  1.00 6.99  ? 5    ASN A N   1 
ATOM   62  C CA  . ASN A 1 6  ? -2.700  -8.617  4.934  1.00 7.91  ? 5    ASN A CA  1 
ATOM   63  C C   . ASN A 1 6  ? -1.885  -8.937  3.686  1.00 8.42  ? 5    ASN A C   1 
ATOM   64  O O   . ASN A 1 6  ? -2.436  -9.115  2.599  1.00 11.26 ? 5    ASN A O   1 
ATOM   65  C CB  . ASN A 1 6  ? -3.855  -9.609  5.125  1.00 9.61  ? 5    ASN A CB  1 
ATOM   66  C CG  . ASN A 1 6  ? -3.364  -11.017 5.363  1.00 10.42 ? 5    ASN A CG  1 
ATOM   67  O OD1 . ASN A 1 6  ? -2.966  -11.376 6.479  1.00 11.22 ? 5    ASN A OD1 1 
ATOM   68  N ND2 . ASN A 1 6  ? -3.346  -11.814 4.304  1.00 15.19 ? 5    ASN A ND2 1 
ATOM   69  N N   . CYS A 1 7  ? -0.567  -8.963  3.822  1.00 8.98  ? 6    CYS A N   1 
ATOM   70  C CA  . CYS A 1 7  ? 0.325   -9.293  2.723  1.00 10.60 ? 6    CYS A CA  1 
ATOM   71  C C   . CYS A 1 7  ? 1.027   -10.607 3.086  1.00 9.87  ? 6    CYS A C   1 
ATOM   72  O O   . CYS A 1 7  ? 1.494   -10.795 4.206  1.00 11.08 ? 6    CYS A O   1 
ATOM   73  C CB  . CYS A 1 7  ? 1.338   -8.146  2.492  1.00 11.07 ? 6    CYS A CB  1 
ATOM   74  S SG  . CYS A 1 7  ? 0.641   -6.669  1.606  1.00 12.51 ? 6    CYS A SG  1 
ATOM   75  N N   . PRO A 1 8  ? 1.098   -11.551 2.137  1.00 12.15 ? 7    PRO A N   1 
ATOM   76  C CA  . PRO A 1 8  ? 1.721   -12.840 2.483  1.00 13.02 ? 7    PRO A CA  1 
ATOM   77  C C   . PRO A 1 8  ? 3.225   -12.757 2.716  1.00 13.01 ? 7    PRO A C   1 
ATOM   78  O O   . PRO A 1 8  ? 3.765   -13.574 3.442  1.00 14.43 ? 7    PRO A O   1 
ATOM   79  C CB  . PRO A 1 8  ? 1.433   -13.722 1.264  1.00 14.71 ? 7    PRO A CB  1 
ATOM   80  C CG  . PRO A 1 8  ? 1.273   -12.778 0.169  1.00 14.86 ? 7    PRO A CG  1 
ATOM   81  C CD  . PRO A 1 8  ? 0.623   -11.534 0.752  1.00 13.79 ? 7    PRO A CD  1 
ATOM   82  N N   . ASN A 1 9  ? 3.873   -11.767 2.099  1.00 12.40 ? 8    ASN A N   1 
ATOM   83  C CA  . ASN A 1 9  ? 5.310   -11.547 2.224  1.00 13.71 ? 8    ASN A CA  1 
ATOM   84  C C   . ASN A 1 9  ? 5.581   -10.161 2.848  1.00 12.85 ? 8    ASN A C   1 
ATOM   85  O O   . ASN A 1 9  ? 4.764   -9.260  2.701  1.00 13.49 ? 8    ASN A O   1 
ATOM   86  C CB  . ASN A 1 9  ? 5.990   -11.587 0.831  1.00 14.98 ? 8    ASN A CB  1 
ATOM   87  C CG  . ASN A 1 9  ? 5.432   -12.696 -0.127 1.00 15.82 ? 8    ASN A CG  1 
ATOM   88  O OD1 . ASN A 1 9  ? 5.071   -12.438 -1.301 1.00 17.11 ? 8    ASN A OD1 1 
ATOM   89  N ND2 . ASN A 1 9  ? 5.408   -13.924 0.357  1.00 15.01 ? 8    ASN A ND2 1 
ATOM   90  N N   . PRO A 1 10 ? 6.742   -9.964  3.496  1.00 12.33 ? 9    PRO A N   1 
ATOM   91  C CA  . PRO A 1 10 ? 7.049   -8.596  3.948  1.00 12.15 ? 9    PRO A CA  1 
ATOM   92  C C   . PRO A 1 10 ? 7.098   -7.631  2.764  1.00 11.41 ? 9    PRO A C   1 
ATOM   93  O O   . PRO A 1 10 ? 7.581   -7.984  1.678  1.00 12.69 ? 9    PRO A O   1 
ATOM   94  C CB  . PRO A 1 10 ? 8.405   -8.727  4.651  1.00 14.46 ? 9    PRO A CB  1 
ATOM   95  C CG  . PRO A 1 10 ? 8.927   -10.079 4.292  1.00 14.76 ? 9    PRO A CG  1 
ATOM   96  C CD  . PRO A 1 10 ? 7.780   -10.939 3.873  1.00 13.89 ? 9    PRO A CD  1 
ATOM   97  N N   . THR A 1 11 ? 6.593   -6.424  2.985  1.00 11.44 ? 10   THR A N   1 
ATOM   98  C CA  . THR A 1 11 ? 6.315   -5.480  1.911  1.00 14.01 ? 10   THR A CA  1 
ATOM   99  C C   . THR A 1 11 ? 6.520   -4.092  2.509  1.00 12.33 ? 10   THR A C   1 
ATOM   100 O O   . THR A 1 11 ? 6.056   -3.842  3.620  1.00 11.94 ? 10   THR A O   1 
ATOM   101 C CB  . THR A 1 11 ? 4.825   -5.635  1.457  1.00 15.47 ? 10   THR A CB  1 
ATOM   102 O OG1 . THR A 1 11 ? 4.576   -6.995  1.078  1.00 18.19 ? 10   THR A OG1 1 
ATOM   103 C CG2 . THR A 1 11 ? 4.491   -4.721  0.290  1.00 16.73 ? 10   THR A CG2 1 
ATOM   104 N N   . ALA A 1 12 ? 7.190   -3.186  1.797  1.00 12.63 ? 11   ALA A N   1 
ATOM   105 C CA  . ALA A 1 12 ? 7.486   -1.860  2.345  1.00 13.32 ? 11   ALA A CA  1 
ATOM   106 C C   . ALA A 1 12 ? 6.235   -1.083  2.740  1.00 11.85 ? 11   ALA A C   1 
ATOM   107 O O   . ALA A 1 12 ? 6.240   -0.346  3.730  1.00 12.98 ? 11   ALA A O   1 
ATOM   108 C CB  . ALA A 1 12 ? 8.322   -1.054  1.353  1.00 14.57 ? 11   ALA A CB  1 
ATOM   109 N N   . ASP A 1 13 ? 5.178   -1.202  1.950  1.00 11.04 ? 12   ASP A N   1 
ATOM   110 C CA  . ASP A 1 13 ? 3.927   -0.536  2.285  1.00 11.95 ? 12   ASP A CA  1 
ATOM   111 C C   . ASP A 1 13 ? 2.742   -1.314  1.773  1.00 11.17 ? 12   ASP A C   1 
ATOM   112 O O   . ASP A 1 13 ? 2.193   -1.045  0.708  1.00 12.38 ? 12   ASP A O   1 
ATOM   113 C CB  . ASP A 1 13 ? 3.851   0.920   1.853  1.00 15.43 ? 12   ASP A CB  1 
ATOM   114 C CG  . ASP A 1 13 ? 2.774   1.662   2.625  1.00 16.31 ? 12   ASP A CG  1 
ATOM   115 O OD1 . ASP A 1 13 ? 2.840   1.661   3.879  1.00 18.21 ? 12   ASP A OD1 1 
ATOM   116 O OD2 . ASP A 1 13 ? 1.853   2.196   1.995  1.00 16.79 ? 12   ASP A OD2 1 
ATOM   117 N N   . CYS A 1 14 ? 2.333   -2.276  2.576  1.00 10.46 ? 13   CYS A N   1 
ATOM   118 C CA  . CYS A 1 14 ? 1.248   -3.170  2.230  1.00 9.44  ? 13   CYS A CA  1 
ATOM   119 C C   . CYS A 1 14 ? -0.050  -2.399  2.052  1.00 11.13 ? 13   CYS A C   1 
ATOM   120 O O   . CYS A 1 14 ? -0.460  -1.644  2.937  1.00 13.15 ? 13   CYS A O   1 
ATOM   121 C CB  . CYS A 1 14 ? 1.096   -4.209  3.334  1.00 10.01 ? 13   CYS A CB  1 
ATOM   122 S SG  . CYS A 1 14 ? -0.180  -5.445  3.040  1.00 10.72 ? 13   CYS A SG  1 
ATOM   123 N N   . LYS A 1 15 ? -0.675  -2.565  0.889  1.00 11.88 ? 14   LYS A N   1 
ATOM   124 C CA  . LYS A 1 15 ? -1.939  -1.907  0.561  1.00 13.82 ? 14   LYS A CA  1 
ATOM   125 C C   . LYS A 1 15 ? -3.065  -2.905  0.333  1.00 14.33 ? 14   LYS A C   1 
ATOM   126 O O   . LYS A 1 15 ? -4.177  -2.513  -0.021 1.00 16.54 ? 14   LYS A O   1 
ATOM   127 C CB  . LYS A 1 15 ? -1.779  -1.012  -0.674 1.00 15.86 ? 14   LYS A CB  1 
ATOM   128 C CG  A LYS A 1 15 ? -1.122  0.316   -0.355 0.65 17.27 ? 14   LYS A CG  1 
ATOM   129 C CG  B LYS A 1 15 ? -0.799  0.136   -0.504 0.35 15.74 ? 14   LYS A CG  1 
ATOM   130 C CD  A LYS A 1 15 ? -0.801  1.102   -1.610 0.65 18.47 ? 14   LYS A CD  1 
ATOM   131 C CD  B LYS A 1 15 ? -1.385  1.261   0.343  0.35 16.14 ? 14   LYS A CD  1 
ATOM   132 C CE  A LYS A 1 15 ? 0.395   0.515   -2.341 0.65 19.82 ? 14   LYS A CE  1 
ATOM   133 C CE  B LYS A 1 15 ? -2.380  2.109   -0.437 0.35 15.97 ? 14   LYS A CE  1 
ATOM   134 N NZ  A LYS A 1 15 ? 0.686   1.215   -3.619 0.65 20.97 ? 14   LYS A NZ  1 
ATOM   135 N NZ  B LYS A 1 15 ? -2.808  3.336   0.309  0.35 15.44 ? 14   LYS A NZ  1 
ATOM   136 N N   . THR A 1 16 ? -2.762  -4.185  0.533  1.00 12.05 ? 15   THR A N   1 
ATOM   137 C CA  . THR A 1 16 ? -3.712  -5.257  0.292  1.00 12.80 ? 15   THR A CA  1 
ATOM   138 C C   . THR A 1 16 ? -4.647  -5.385  1.488  1.00 11.87 ? 15   THR A C   1 
ATOM   139 O O   . THR A 1 16 ? -4.261  -5.845  2.562  1.00 12.57 ? 15   THR A O   1 
ATOM   140 C CB  . THR A 1 16 ? -2.985  -6.582  0.047  1.00 13.57 ? 15   THR A CB  1 
ATOM   141 O OG1 . THR A 1 16 ? -2.067  -6.418  -1.039 1.00 16.72 ? 15   THR A OG1 1 
ATOM   142 C CG2 . THR A 1 16 ? -3.982  -7.684  -0.283 1.00 14.29 ? 15   THR A CG2 1 
ATOM   143 N N   . ALA A 1 17 ? -5.888  -4.963  1.288  1.00 12.24 ? 16   ALA A N   1 
ATOM   144 C CA  . ALA A 1 17 ? -6.933  -5.061  2.303  1.00 12.80 ? 16   ALA A CA  1 
ATOM   145 C C   . ALA A 1 17 ? -7.704  -6.359  2.131  1.00 12.32 ? 16   ALA A C   1 
ATOM   146 O O   . ALA A 1 17 ? -8.132  -6.671  1.023  1.00 14.47 ? 16   ALA A O   1 
ATOM   147 C CB  . ALA A 1 17 ? -7.878  -3.885  2.167  1.00 15.09 ? 16   ALA A CB  1 
ATOM   148 N N   . VAL A 1 18 ? -7.910  -7.105  3.208  1.00 11.47 ? 17   VAL A N   1 
ATOM   149 C CA  . VAL A 1 18 ? -8.676  -8.350  3.149  1.00 11.92 ? 17   VAL A CA  1 
ATOM   150 C C   . VAL A 1 18 ? -9.655  -8.407  4.299  1.00 11.41 ? 17   VAL A C   1 
ATOM   151 O O   . VAL A 1 18 ? -9.410  -7.834  5.353  1.00 12.15 ? 17   VAL A O   1 
ATOM   152 C CB  . VAL A 1 18 ? -7.784  -9.592  3.256  1.00 14.23 ? 17   VAL A CB  1 
ATOM   153 C CG1 . VAL A 1 18 ? -6.664  -9.554  2.238  1.00 15.48 ? 17   VAL A CG1 1 
ATOM   154 C CG2 . VAL A 1 18 ? -7.241  -9.729  4.656  1.00 16.08 ? 17   VAL A CG2 1 
ATOM   155 N N   . ASN A 1 19 ? -10.775 -9.088  4.097  1.00 10.34 ? 18   ASN A N   1 
ATOM   156 C CA  . ASN A 1 19 ? -11.675 -9.380  5.195  1.00 11.56 ? 18   ASN A CA  1 
ATOM   157 C C   . ASN A 1 19 ? -11.150 -10.617 5.901  1.00 11.77 ? 18   ASN A C   1 
ATOM   158 O O   . ASN A 1 19 ? -11.155 -11.709 5.324  1.00 14.29 ? 18   ASN A O   1 
ATOM   159 C CB  . ASN A 1 19 ? -13.083 -9.666  4.683  1.00 12.90 ? 18   ASN A CB  1 
ATOM   160 C CG  . ASN A 1 19 ? -13.738 -8.454  4.069  1.00 13.46 ? 18   ASN A CG  1 
ATOM   161 O OD1 . ASN A 1 19 ? -13.388 -7.312  4.361  1.00 14.57 ? 18   ASN A OD1 1 
ATOM   162 N ND2 . ASN A 1 19 ? -14.729 -8.701  3.223  1.00 15.35 ? 18   ASN A ND2 1 
ATOM   163 N N   . CYS A 1 20 ? -10.682 -10.464 7.134  1.00 10.61 ? 19   CYS A N   1 
ATOM   164 C CA  . CYS A 1 20 ? -10.156 -11.612 7.866  1.00 11.63 ? 19   CYS A CA  1 
ATOM   165 C C   . CYS A 1 20 ? -11.258 -12.606 8.189  1.00 12.09 ? 19   CYS A C   1 
ATOM   166 O O   . CYS A 1 20 ? -12.397 -12.233 8.434  1.00 13.10 ? 19   CYS A O   1 
ATOM   167 C CB  . CYS A 1 20 ? -9.471  -11.162 9.157  1.00 10.89 ? 19   CYS A CB  1 
ATOM   168 S SG  . CYS A 1 20 ? -8.125  -9.938  8.910  1.00 11.04 ? 19   CYS A SG  1 
ATOM   169 N N   . SER A 1 21 ? -10.930 -13.884 8.214  1.00 13.02 ? 20   SER A N   1 
ATOM   170 C CA  . SER A 1 21 ? -11.945 -14.832 8.656  1.00 14.92 ? 20   SER A CA  1 
ATOM   171 C C   . SER A 1 21 ? -12.190 -14.687 10.155 1.00 14.15 ? 20   SER A C   1 
ATOM   172 O O   . SER A 1 21 ? -11.405 -14.048 10.875 1.00 13.39 ? 20   SER A O   1 
ATOM   173 C CB  . SER A 1 21 ? -11.595 -16.267 8.278  1.00 17.08 ? 20   SER A CB  1 
ATOM   174 O OG  . SER A 1 21 ? -10.973 -16.932 9.354  1.00 18.26 ? 20   SER A OG  1 
ATOM   175 N N   . SER A 1 22 ? -13.292 -15.266 10.616 1.00 14.26 ? 21   SER A N   1 
ATOM   176 C CA  . SER A 1 22 ? -13.680 -15.163 12.011 1.00 15.50 ? 21   SER A CA  1 
ATOM   177 C C   . SER A 1 22 ? -12.726 -15.900 12.955 1.00 14.59 ? 21   SER A C   1 
ATOM   178 O O   . SER A 1 22 ? -12.845 -15.763 14.163 1.00 15.20 ? 21   SER A O   1 
ATOM   179 C CB  . SER A 1 22 ? -15.121 -15.640 12.214 1.00 17.41 ? 21   SER A CB  1 
ATOM   180 O OG  . SER A 1 22 ? -15.244 -17.025 11.948 1.00 19.75 ? 21   SER A OG  1 
ATOM   181 N N   . ASP A 1 23 ? -11.792 -16.670 12.405 1.00 13.90 ? 22   ASP A N   1 
ATOM   182 C CA  . ASP A 1 23 ? -10.716 -17.255 13.216 1.00 13.56 ? 22   ASP A CA  1 
ATOM   183 C C   . ASP A 1 23 ? -9.820  -16.177 13.830 1.00 12.30 ? 22   ASP A C   1 
ATOM   184 O O   . ASP A 1 23 ? -9.167  -16.419 14.849 1.00 14.22 ? 22   ASP A O   1 
ATOM   185 C CB  . ASP A 1 23 ? -9.822  -18.176 12.382 1.00 15.09 ? 22   ASP A CB  1 
ATOM   186 C CG  . ASP A 1 23 ? -10.431 -19.532 12.128 1.00 16.32 ? 22   ASP A CG  1 
ATOM   187 O OD1 . ASP A 1 23 ? -11.656 -19.721 12.337 1.00 18.09 ? 22   ASP A OD1 1 
ATOM   188 O OD2 . ASP A 1 23 ? -9.668  -20.416 11.703 1.00 17.59 ? 22   ASP A OD2 1 
ATOM   189 N N   A PHE A 1 24 ? -9.752  -15.019 13.198 0.50 11.05 ? 23   PHE A N   1 
ATOM   190 N N   B PHE A 1 24 ? -9.818  -14.987 13.212 0.50 11.61 ? 23   PHE A N   1 
ATOM   191 C CA  A PHE A 1 24 ? -8.821  -14.012 13.636 0.50 9.29  ? 23   PHE A CA  1 
ATOM   192 C CA  B PHE A 1 24 ? -8.882  -13.892 13.513 0.50 10.50 ? 23   PHE A CA  1 
ATOM   193 C C   A PHE A 1 24 ? -9.649  -12.931 14.320 0.50 9.19  ? 23   PHE A C   1 
ATOM   194 C C   B PHE A 1 24 ? -9.569  -12.685 14.146 0.50 10.40 ? 23   PHE A C   1 
ATOM   195 O O   A PHE A 1 24 ? -10.858 -12.833 14.076 0.50 9.05  ? 23   PHE A O   1 
ATOM   196 O O   B PHE A 1 24 ? -10.553 -12.152 13.623 0.50 11.72 ? 23   PHE A O   1 
ATOM   197 C CB  A PHE A 1 24 ? -7.952  -13.584 12.442 0.50 9.10  ? 23   PHE A CB  1 
ATOM   198 C CB  B PHE A 1 24 ? -8.200  -13.418 12.229 0.50 10.54 ? 23   PHE A CB  1 
ATOM   199 C CG  A PHE A 1 24 ? -7.257  -14.760 11.791 0.50 8.49  ? 23   PHE A CG  1 
ATOM   200 C CG  B PHE A 1 24 ? -7.456  -14.492 11.505 0.50 10.96 ? 23   PHE A CG  1 
ATOM   201 C CD1 A PHE A 1 24 ? -6.545  -15.665 12.573 0.50 8.00  ? 23   PHE A CD1 1 
ATOM   202 C CD1 B PHE A 1 24 ? -6.094  -14.624 11.657 0.50 10.73 ? 23   PHE A CD1 1 
ATOM   203 C CD2 A PHE A 1 24 ? -7.372  -15.008 10.434 0.50 9.21  ? 23   PHE A CD2 1 
ATOM   204 C CD2 B PHE A 1 24 ? -8.120  -15.371 10.669 0.50 12.04 ? 23   PHE A CD2 1 
ATOM   205 C CE1 A PHE A 1 24 ? -5.936  -16.768 12.017 0.50 9.46  ? 23   PHE A CE1 1 
ATOM   206 C CE1 B PHE A 1 24 ? -5.402  -15.614 10.990 0.50 11.12 ? 23   PHE A CE1 1 
ATOM   207 C CE2 A PHE A 1 24 ? -6.746  -16.113 9.867  0.50 10.24 ? 23   PHE A CE2 1 
ATOM   208 C CE2 B PHE A 1 24 ? -7.439  -16.368 9.999  0.50 11.97 ? 23   PHE A CE2 1 
ATOM   209 C CZ  A PHE A 1 24 ? -6.039  -17.001 10.672 0.50 9.84  ? 23   PHE A CZ  1 
ATOM   210 C CZ  B PHE A 1 24 ? -6.077  -16.485 10.154 0.50 11.74 ? 23   PHE A CZ  1 
ATOM   211 N N   . ASP A 1 25 ? -9.027  -12.218 15.256 1.00 8.47  ? 24   ASP A N   1 
ATOM   212 C CA  . ASP A 1 25 ? -9.663  -11.119 15.964 1.00 9.34  ? 24   ASP A CA  1 
ATOM   213 C C   . ASP A 1 25 ? -8.841  -9.830  15.979 1.00 8.31  ? 24   ASP A C   1 
ATOM   214 O O   . ASP A 1 25 ? -9.246  -8.850  16.614 1.00 9.37  ? 24   ASP A O   1 
ATOM   215 C CB  . ASP A 1 25 ? -10.046 -11.551 17.396 1.00 10.21 ? 24   ASP A CB  1 
ATOM   216 C CG  . ASP A 1 25 ? -8.849  -11.961 18.254 1.00 9.61  ? 24   ASP A CG  1 
ATOM   217 O OD1 . ASP A 1 25 ? -7.711  -11.809 17.808 1.00 9.37  ? 24   ASP A OD1 1 
ATOM   218 O OD2 . ASP A 1 25 ? -9.057  -12.397 19.417 1.00 12.38 ? 24   ASP A OD2 1 
ATOM   219 N N   . ALA A 1 26 ? -7.693  -9.830  15.305 1.00 7.50  ? 25   ALA A N   1 
ATOM   220 C CA  . ALA A 1 26 ? -6.790  -8.691  15.348 1.00 7.15  ? 25   ALA A CA  1 
ATOM   221 C C   . ALA A 1 26 ? -6.151  -8.457  14.001 1.00 6.36  ? 25   ALA A C   1 
ATOM   222 O O   . ALA A 1 26 ? -5.997  -9.383  13.207 1.00 7.18  ? 25   ALA A O   1 
ATOM   223 C CB  . ALA A 1 26 ? -5.689  -8.927  16.373 1.00 7.93  ? 25   ALA A CB  1 
ATOM   224 N N   . CYS A 1 27 ? -5.753  -7.207  13.790 1.00 6.14  ? 26   CYS A N   1 
ATOM   225 C CA  . CYS A 1 27 ? -4.805  -6.849  12.730 1.00 6.23  ? 26   CYS A CA  1 
ATOM   226 C C   . CYS A 1 27 ? -3.450  -6.623  13.378 1.00 6.12  ? 26   CYS A C   1 
ATOM   227 O O   . CYS A 1 27 ? -3.366  -5.910  14.383 1.00 8.00  ? 26   CYS A O   1 
ATOM   228 C CB  . CYS A 1 27 ? -5.199  -5.531  12.034 1.00 7.24  ? 26   CYS A CB  1 
ATOM   229 S SG  . CYS A 1 27 ? -6.888  -5.412  11.345 1.00 7.71  ? 26   CYS A SG  1 
ATOM   230 N N   . LEU A 1 28 ? -2.402  -7.204  12.795 1.00 5.64  ? 27   LEU A N   1 
ATOM   231 C CA  . LEU A 1 28 ? -1.030  -7.081  13.281 1.00 5.50  ? 27   LEU A CA  1 
ATOM   232 C C   . LEU A 1 28 ? -0.201  -6.260  12.288 1.00 5.13  ? 27   LEU A C   1 
ATOM   233 O O   . LEU A 1 28 ? -0.274  -6.502  11.071 1.00 5.15  ? 27   LEU A O   1 
ATOM   234 C CB  . LEU A 1 28 ? -0.401  -8.484  13.373 1.00 6.09  ? 27   LEU A CB  1 
ATOM   235 C CG  . LEU A 1 28 ? 1.104   -8.544  13.627 1.00 6.11  ? 27   LEU A CG  1 
ATOM   236 C CD1 . LEU A 1 28 ? 1.466   -8.087  15.035 1.00 7.62  ? 27   LEU A CD1 1 
ATOM   237 C CD2 . LEU A 1 28 ? 1.630   -9.941  13.355 1.00 7.90  ? 27   LEU A CD2 1 
ATOM   238 N N   . ILE A 1 29 ? 0.602   -5.332  12.782 1.00 4.95  ? 28   ILE A N   1 
ATOM   239 C CA  . ILE A 1 29 ? 1.732   -4.814  12.025 1.00 5.37  ? 28   ILE A CA  1 
ATOM   240 C C   . ILE A 1 29 ? 3.004   -5.040  12.844 1.00 5.61  ? 28   ILE A C   1 
ATOM   241 O O   . ILE A 1 29 ? 3.016   -4.797  14.052 1.00 6.22  ? 28   ILE A O   1 
ATOM   242 C CB  . ILE A 1 29 ? 1.561   -3.337  11.599 1.00 6.15  ? 28   ILE A CB  1 
ATOM   243 C CG1 . ILE A 1 29 ? 2.797   -2.879  10.804 1.00 7.35  ? 28   ILE A CG1 1 
ATOM   244 C CG2 . ILE A 1 29 ? 1.217   -2.401  12.787 1.00 6.69  ? 28   ILE A CG2 1 
ATOM   245 C CD1 . ILE A 1 29 ? 2.705   -1.525  10.191 1.00 9.22  ? 28   ILE A CD1 1 
ATOM   246 N N   . THR A 1 30 ? 4.055   -5.513  12.181 1.00 6.05  ? 29   THR A N   1 
ATOM   247 C CA  . THR A 1 30 ? 5.340   -5.732  12.815 1.00 7.34  ? 29   THR A CA  1 
ATOM   248 C C   . THR A 1 30 ? 6.431   -5.119  11.942 1.00 6.13  ? 29   THR A C   1 
ATOM   249 O O   . THR A 1 30 ? 6.399   -5.276  10.727 1.00 7.62  ? 29   THR A O   1 
ATOM   250 C CB  . THR A 1 30 ? 5.636   -7.252  12.959 1.00 9.90  ? 29   THR A CB  1 
ATOM   251 O OG1 . THR A 1 30 ? 4.645   -7.895  13.755 1.00 12.13 ? 29   THR A OG1 1 
ATOM   252 C CG2 . THR A 1 30 ? 6.957   -7.482  13.635 1.00 11.83 ? 29   THR A CG2 1 
ATOM   253 N N   . LYS A 1 31 ? 7.371   -4.424  12.572 1.00 6.51  ? 30   LYS A N   1 
ATOM   254 C CA  . LYS A 1 31 ? 8.557   -3.871  11.922 1.00 7.34  ? 30   LYS A CA  1 
ATOM   255 C C   . LYS A 1 31 ? 9.795   -4.577  12.448 1.00 7.19  ? 30   LYS A C   1 
ATOM   256 O O   . LYS A 1 31 ? 10.052  -4.560  13.645 1.00 7.63  ? 30   LYS A O   1 
ATOM   257 C CB  . LYS A 1 31 ? 8.668   -2.371  12.190 1.00 7.84  ? 30   LYS A CB  1 
ATOM   258 C CG  . LYS A 1 31 ? 7.584   -1.545  11.508 1.00 8.15  ? 30   LYS A CG  1 
ATOM   259 C CD  . LYS A 1 31 ? 7.684   -0.057  11.890 1.00 9.05  ? 30   LYS A CD  1 
ATOM   260 C CE  . LYS A 1 31 ? 6.766   0.816   11.041 1.00 10.15 ? 30   LYS A CE  1 
ATOM   261 N NZ  . LYS A 1 31 ? 6.913   2.261   11.398 1.00 10.66 ? 30   LYS A NZ  1 
ATOM   262 N N   . ALA A 1 32 ? 10.549  -5.205  11.561 1.00 9.07  ? 31   ALA A N   1 
ATOM   263 C CA  . ALA A 1 32 ? 11.780  -5.904  11.909 1.00 10.35 ? 31   ALA A CA  1 
ATOM   264 C C   . ALA A 1 32 ? 12.854  -5.374  10.954 1.00 10.67 ? 31   ALA A C   1 
ATOM   265 O O   . ALA A 1 32 ? 12.968  -5.828  9.818  1.00 10.47 ? 31   ALA A O   1 
ATOM   266 C CB  . ALA A 1 32 ? 11.595  -7.389  11.735 1.00 10.89 ? 31   ALA A CB  1 
ATOM   267 N N   . GLY A 1 33 ? 13.632  -4.393  11.397 1.00 13.17 ? 32   GLY A N   1 
ATOM   268 C CA  . GLY A 1 33 ? 14.557  -3.726  10.473 1.00 14.40 ? 32   GLY A CA  1 
ATOM   269 C C   . GLY A 1 33 ? 13.771  -2.997  9.390  1.00 15.11 ? 32   GLY A C   1 
ATOM   270 O O   . GLY A 1 33 ? 12.860  -2.228  9.709  1.00 18.10 ? 32   GLY A O   1 
ATOM   271 N N   . LEU A 1 34 ? 14.094  -3.246  8.114  1.00 14.33 ? 33   LEU A N   1 
ATOM   272 C CA  . LEU A 1 34 ? 13.329  -2.666  7.000  1.00 14.53 ? 33   LEU A CA  1 
ATOM   273 C C   . LEU A 1 34 ? 12.151  -3.530  6.587  1.00 14.27 ? 33   LEU A C   1 
ATOM   274 O O   . LEU A 1 34 ? 11.356  -3.131  5.732  1.00 16.02 ? 33   LEU A O   1 
ATOM   275 C CB  . LEU A 1 34 ? 14.221  -2.396  5.781  1.00 16.48 ? 33   LEU A CB  1 
ATOM   276 C CG  . LEU A 1 34 ? 15.279  -1.311  6.004  1.00 18.32 ? 33   LEU A CG  1 
ATOM   277 C CD1 . LEU A 1 34 ? 16.218  -1.224  4.814  1.00 19.50 ? 33   LEU A CD1 1 
ATOM   278 C CD2 . LEU A 1 34 ? 14.646  0.056   6.311  1.00 19.39 ? 33   LEU A CD2 1 
ATOM   279 N N   . GLN A 1 35 ? 12.052  -4.727  7.155  1.00 11.84 ? 34   GLN A N   1 
ATOM   280 C CA  . GLN A 1 35 ? 10.950  -5.612  6.826  1.00 11.46 ? 34   GLN A CA  1 
ATOM   281 C C   . GLN A 1 35 ? 9.707   -5.214  7.605  1.00 9.82  ? 34   GLN A C   1 
ATOM   282 O O   . GLN A 1 35 ? 9.748   -5.029  8.818  1.00 13.11 ? 34   GLN A O   1 
ATOM   283 C CB  . GLN A 1 35 ? 11.319  -7.063  7.123  1.00 11.83 ? 34   GLN A CB  1 
ATOM   284 C CG  . GLN A 1 35 ? 12.283  -7.707  6.119  1.00 12.23 ? 34   GLN A CG  1 
ATOM   285 C CD  . GLN A 1 35 ? 13.636  -7.036  6.070  1.00 12.52 ? 34   GLN A CD  1 
ATOM   286 O OE1 . GLN A 1 35 ? 14.318  -6.911  7.085  1.00 12.20 ? 34   GLN A OE1 1 
ATOM   287 N NE2 . GLN A 1 35 ? 14.032  -6.602  4.884  1.00 13.62 ? 34   GLN A NE2 1 
ATOM   288 N N   . VAL A 1 36 ? 8.602   -5.063  6.894  1.00 8.53  ? 35   VAL A N   1 
ATOM   289 C CA  . VAL A 1 36 ? 7.328   -4.758  7.522  1.00 7.21  ? 35   VAL A CA  1 
ATOM   290 C C   . VAL A 1 36 ? 6.334   -5.858  7.182  1.00 6.81  ? 35   VAL A C   1 
ATOM   291 O O   . VAL A 1 36 ? 6.187   -6.222  6.011  1.00 7.79  ? 35   VAL A O   1 
ATOM   292 C CB  . VAL A 1 36 ? 6.795   -3.374  7.099  1.00 7.97  ? 35   VAL A CB  1 
ATOM   293 C CG1 . VAL A 1 36 ? 5.536   -3.051  7.869  1.00 8.62  ? 35   VAL A CG1 1 
ATOM   294 C CG2 . VAL A 1 36 ? 7.863   -2.284  7.298  1.00 9.69  ? 35   VAL A CG2 1 
ATOM   295 N N   . TYR A 1 37 ? 5.665   -6.379  8.207  1.00 6.89  ? 36   TYR A N   1 
ATOM   296 C CA  . TYR A 1 37 ? 4.676   -7.444  8.058  1.00 6.58  ? 36   TYR A CA  1 
ATOM   297 C C   . TYR A 1 37 ? 3.311   -6.918  8.469  1.00 5.85  ? 36   TYR A C   1 
ATOM   298 O O   . TYR A 1 37 ? 3.199   -6.170  9.450  1.00 6.65  ? 36   TYR A O   1 
ATOM   299 C CB  . TYR A 1 37 ? 5.024   -8.647  8.938  1.00 8.04  ? 36   TYR A CB  1 
ATOM   300 C CG  . TYR A 1 37 ? 6.400   -9.250  8.703  1.00 9.08  ? 36   TYR A CG  1 
ATOM   301 C CD1 . TYR A 1 37 ? 6.560   -10.416 7.950  1.00 10.56 ? 36   TYR A CD1 1 
ATOM   302 C CD2 . TYR A 1 37 ? 7.548   -8.665  9.247  1.00 9.05  ? 36   TYR A CD2 1 
ATOM   303 C CE1 . TYR A 1 37 ? 7.831   -10.973 7.739  1.00 11.76 ? 36   TYR A CE1 1 
ATOM   304 C CE2 . TYR A 1 37 ? 8.819   -9.222  9.022  1.00 10.98 ? 36   TYR A CE2 1 
ATOM   305 C CZ  . TYR A 1 37 ? 8.941   -10.372 8.283  1.00 10.81 ? 36   TYR A CZ  1 
ATOM   306 O OH  . TYR A 1 37 ? 10.178  -10.938 8.053  1.00 12.70 ? 36   TYR A OH  1 
ATOM   307 N N   . ASN A 1 38 ? 2.278   -7.288  7.713  1.00 6.07  ? 37   ASN A N   1 
ATOM   308 C CA  . ASN A 1 38 ? 0.899   -6.878  7.979  1.00 6.01  ? 37   ASN A CA  1 
ATOM   309 C C   . ASN A 1 38 ? 0.040   -8.113  7.811  1.00 5.79  ? 37   ASN A C   1 
ATOM   310 O O   . ASN A 1 38 ? 0.035   -8.715  6.729  1.00 7.07  ? 37   ASN A O   1 
ATOM   311 C CB  . ASN A 1 38 ? 0.454   -5.805  6.970  1.00 7.31  ? 37   ASN A CB  1 
ATOM   312 C CG  . ASN A 1 38 ? 1.306   -4.540  7.002  1.00 7.42  ? 37   ASN A CG  1 
ATOM   313 O OD1 . ASN A 1 38 ? 0.929   -3.514  7.603  1.00 11.07 ? 37   ASN A OD1 1 
ATOM   314 N ND2 . ASN A 1 38 ? 2.441   -4.591  6.378  1.00 6.12  ? 37   ASN A ND2 1 
ATOM   315 N N   . LYS A 1 39 ? -0.682  -8.503  8.866  1.00 5.82  ? 38   LYS A N   1 
ATOM   316 C CA  . LYS A 1 39 ? -1.395  -9.786  8.863  1.00 6.85  ? 38   LYS A CA  1 
ATOM   317 C C   . LYS A 1 39 ? -2.721  -9.707  9.600  1.00 6.33  ? 38   LYS A C   1 
ATOM   318 O O   . LYS A 1 39 ? -2.834  -9.022  10.618 1.00 7.36  ? 38   LYS A O   1 
ATOM   319 C CB  . LYS A 1 39 ? -0.582  -10.871 9.597  1.00 8.36  ? 38   LYS A CB  1 
ATOM   320 C CG  . LYS A 1 39 ? 0.852   -11.072 9.183  1.00 8.85  ? 38   LYS A CG  1 
ATOM   321 C CD  . LYS A 1 39 ? 0.946   -11.812 7.877  1.00 10.33 ? 38   LYS A CD  1 
ATOM   322 C CE  . LYS A 1 39 ? 2.412   -12.013 7.491  1.00 11.52 ? 38   LYS A CE  1 
ATOM   323 N NZ  . LYS A 1 39 ? 2.566   -12.735 6.211  1.00 12.55 ? 38   LYS A NZ  1 
ATOM   324 N N   . CYS A 1 40 ? -3.701  -10.508 9.183  1.00 6.61  ? 39   CYS A N   1 
ATOM   325 C CA  . CYS A 1 40 ? -4.771  -10.972 10.069 1.00 6.28  ? 39   CYS A CA  1 
ATOM   326 C C   . CYS A 1 40 ? -4.150  -11.848 11.161 1.00 6.34  ? 39   CYS A C   1 
ATOM   327 O O   . CYS A 1 40 ? -3.315  -12.710 10.852 1.00 6.36  ? 39   CYS A O   1 
ATOM   328 C CB  . CYS A 1 40 ? -5.782  -11.818 9.287  1.00 7.23  ? 39   CYS A CB  1 
ATOM   329 S SG  . CYS A 1 40 ? -6.666  -10.963 7.942  1.00 9.22  ? 39   CYS A SG  1 
ATOM   330 N N   . TRP A 1 41 ? -4.556  -11.652 12.414 1.00 5.53  ? 40   TRP A N   1 
ATOM   331 C CA  . TRP A 1 41 ? -3.839  -12.298 13.526 1.00 5.79  ? 40   TRP A CA  1 
ATOM   332 C C   . TRP A 1 41 ? -4.791  -12.536 14.675 1.00 5.74  ? 40   TRP A C   1 
ATOM   333 O O   . TRP A 1 41 ? -5.986  -12.266 14.583 1.00 6.43  ? 40   TRP A O   1 
ATOM   334 C CB  . TRP A 1 41 ? -2.658  -11.398 13.952 1.00 6.69  ? 40   TRP A CB  1 
ATOM   335 C CG  . TRP A 1 41 ? -1.422  -12.058 14.511 1.00 6.26  ? 40   TRP A CG  1 
ATOM   336 C CD1 . TRP A 1 41 ? -0.981  -11.999 15.794 1.00 6.88  ? 40   TRP A CD1 1 
ATOM   337 C CD2 . TRP A 1 41 ? -0.430  -12.790 13.773 1.00 6.22  ? 40   TRP A CD2 1 
ATOM   338 N NE1 . TRP A 1 41 ? 0.224   -12.664 15.911 1.00 7.73  ? 40   TRP A NE1 1 
ATOM   339 C CE2 . TRP A 1 41 ? 0.584   -13.151 14.683 1.00 6.91  ? 40   TRP A CE2 1 
ATOM   340 C CE3 . TRP A 1 41 ? -0.300  -13.157 12.432 1.00 6.96  ? 40   TRP A CE3 1 
ATOM   341 C CZ2 . TRP A 1 41 ? 1.726   -13.852 14.285 1.00 7.89  ? 40   TRP A CZ2 1 
ATOM   342 C CZ3 . TRP A 1 41 ? 0.830   -13.873 12.041 1.00 8.02  ? 40   TRP A CZ3 1 
ATOM   343 C CH2 . TRP A 1 41 ? 1.826   -14.215 12.965 1.00 8.45  ? 40   TRP A CH2 1 
ATOM   344 N N   . LYS A 1 42 ? -4.254  -13.069 15.765 1.00 7.21  ? 41   LYS A N   1 
ATOM   345 C CA  . LYS A 1 42 ? -5.028  -13.243 16.993 1.00 7.37  ? 41   LYS A CA  1 
ATOM   346 C C   . LYS A 1 42 ? -4.366  -12.486 18.121 1.00 7.28  ? 41   LYS A C   1 
ATOM   347 O O   . LYS A 1 42 ? -3.145  -12.568 18.292 1.00 7.07  ? 41   LYS A O   1 
ATOM   348 C CB  . LYS A 1 42 ? -5.127  -14.720 17.368 1.00 8.73  ? 41   LYS A CB  1 
ATOM   349 C CG  . LYS A 1 42 ? -5.844  -15.547 16.320 1.00 11.64 ? 41   LYS A CG  1 
ATOM   350 C CD  . LYS A 1 42 ? -6.081  -16.972 16.786 1.00 15.83 ? 41   LYS A CD  1 
ATOM   351 C CE  . LYS A 1 42 ? -7.194  -17.045 17.827 1.00 18.14 ? 41   LYS A CE  1 
ATOM   352 N NZ  . LYS A 1 42 ? -7.502  -18.457 18.185 1.00 20.65 ? 41   LYS A NZ  1 
ATOM   353 N N   . PHE A 1 43 ? -5.174  -11.800 18.936 1.00 7.57  ? 42   PHE A N   1 
ATOM   354 C CA  . PHE A 1 43 ? -4.638  -11.111 20.116 1.00 7.52  ? 42   PHE A CA  1 
ATOM   355 C C   . PHE A 1 43 ? -3.878  -12.052 21.050 1.00 7.25  ? 42   PHE A C   1 
ATOM   356 O O   . PHE A 1 43 ? -2.888  -11.637 21.647 1.00 7.54  ? 42   PHE A O   1 
ATOM   357 C CB  . PHE A 1 43 ? -5.716  -10.356 20.890 1.00 7.98  ? 42   PHE A CB  1 
ATOM   358 C CG  . PHE A 1 43 ? -6.054  -9.001  20.314 1.00 7.74  ? 42   PHE A CG  1 
ATOM   359 C CD1 . PHE A 1 43 ? -5.176  -7.930  20.433 1.00 9.41  ? 42   PHE A CD1 1 
ATOM   360 C CD2 . PHE A 1 43 ? -7.267  -8.789  19.692 1.00 8.92  ? 42   PHE A CD2 1 
ATOM   361 C CE1 . PHE A 1 43 ? -5.515  -6.668  19.939 1.00 10.35 ? 42   PHE A CE1 1 
ATOM   362 C CE2 . PHE A 1 43 ? -7.596  -7.541  19.194 1.00 9.56  ? 42   PHE A CE2 1 
ATOM   363 C CZ  . PHE A 1 43 ? -6.714  -6.493  19.325 1.00 9.55  ? 42   PHE A CZ  1 
ATOM   364 N N   . GLU A 1 44 ? -4.284  -13.318 21.143 1.00 7.85  ? 43   GLU A N   1 
ATOM   365 C CA  . GLU A 1 44 ? -3.564  -14.256 22.011 1.00 9.33  ? 43   GLU A CA  1 
ATOM   366 C C   . GLU A 1 44 ? -2.113  -14.475 21.542 1.00 7.85  ? 43   GLU A C   1 
ATOM   367 O O   . GLU A 1 44 ? -1.278  -14.944 22.320 1.00 9.10  ? 43   GLU A O   1 
ATOM   368 C CB  . GLU A 1 44 ? -4.318  -15.588 22.126 1.00 10.79 ? 43   GLU A CB  1 
ATOM   369 C CG  . GLU A 1 44 ? -4.363  -16.415 20.878 1.00 14.16 ? 43   GLU A CG  1 
ATOM   370 C CD  . GLU A 1 44 ? -5.111  -17.730 21.052 1.00 15.88 ? 43   GLU A CD  1 
ATOM   371 O OE1 . GLU A 1 44 ? -5.503  -18.048 22.200 1.00 19.92 ? 43   GLU A OE1 1 
ATOM   372 O OE2 . GLU A 1 44 ? -5.309  -18.423 20.037 1.00 20.11 ? 43   GLU A OE2 1 
ATOM   373 N N   . HIS A 1 45 ? -1.810  -14.126 20.289 1.00 7.49  ? 44   HIS A N   1 
ATOM   374 C CA  . HIS A 1 45 ? -0.456  -14.231 19.763 1.00 7.29  ? 44   HIS A CA  1 
ATOM   375 C C   . HIS A 1 45 ? 0.155   -12.871 19.460 1.00 7.05  ? 44   HIS A C   1 
ATOM   376 O O   . HIS A 1 45 ? 1.171   -12.789 18.768 1.00 7.54  ? 44   HIS A O   1 
ATOM   377 C CB  . HIS A 1 45 ? -0.418  -15.134 18.529 1.00 7.86  ? 44   HIS A CB  1 
ATOM   378 C CG  . HIS A 1 45 ? -0.941  -16.505 18.807 1.00 8.24  ? 44   HIS A CG  1 
ATOM   379 N ND1 . HIS A 1 45 ? -1.837  -17.141 17.978 1.00 8.78  ? 44   HIS A ND1 1 
ATOM   380 C CD2 . HIS A 1 45 ? -0.750  -17.331 19.864 1.00 9.32  ? 44   HIS A CD2 1 
ATOM   381 C CE1 . HIS A 1 45 ? -2.153  -18.314 18.497 1.00 9.41  ? 44   HIS A CE1 1 
ATOM   382 N NE2 . HIS A 1 45 ? -1.505  -18.456 19.639 1.00 9.64  ? 44   HIS A NE2 1 
ATOM   383 N N   . CYS A 1 46 ? -0.451  -11.801 19.970 1.00 7.54  ? 45   CYS A N   1 
ATOM   384 C CA  . CYS A 1 46 ? 0.119   -10.477 19.831 1.00 8.48  ? 45   CYS A CA  1 
ATOM   385 C C   . CYS A 1 46 ? 1.027   -10.174 21.013 1.00 8.81  ? 45   CYS A C   1 
ATOM   386 O O   . CYS A 1 46 ? 0.699   -9.391  21.894 1.00 9.52  ? 45   CYS A O   1 
ATOM   387 C CB  A CYS A 1 46 ? -0.999  -9.423  19.766 0.65 8.72  ? 45   CYS A CB  1 
ATOM   388 C CB  B CYS A 1 46 ? -0.949  -9.420  19.642 0.35 9.82  ? 45   CYS A CB  1 
ATOM   389 S SG  A CYS A 1 46 ? -1.912  -9.406  18.208 0.65 7.29  ? 45   CYS A SG  1 
ATOM   390 S SG  B CYS A 1 46 ? -0.177  -8.076  18.810 0.35 11.44 ? 45   CYS A SG  1 
ATOM   391 N N   . ASN A 1 47 ? 2.188   -10.817 21.016 1.00 8.33  ? 46   ASN A N   1 
ATOM   392 C CA  . ASN A 1 47 ? 3.182   -10.663 22.087 1.00 9.05  ? 46   ASN A CA  1 
ATOM   393 C C   . ASN A 1 47 ? 4.527   -10.974 21.423 1.00 8.56  ? 46   ASN A C   1 
ATOM   394 O O   . ASN A 1 47 ? 4.574   -11.641 20.387 1.00 8.39  ? 46   ASN A O   1 
ATOM   395 C CB  . ASN A 1 47 ? 2.875   -11.548 23.356 1.00 11.91 ? 46   ASN A CB  1 
ATOM   396 C CG  . ASN A 1 47 ? 2.822   -13.019 22.997 1.00 10.06 ? 46   ASN A CG  1 
ATOM   397 O OD1 . ASN A 1 47 ? 3.858   -13.646 22.757 1.00 10.36 ? 46   ASN A OD1 1 
ATOM   398 N ND2 . ASN A 1 47 ? 1.608   -13.551 22.858 1.00 10.57 ? 46   ASN A ND2 1 
ATOM   399 N N   . PHE A 1 48 ? 5.613   -10.488 22.009 1.00 8.91  ? 47   PHE A N   1 
ATOM   400 C CA  . PHE A 1 48 ? 6.915   -10.560 21.378 1.00 8.98  ? 47   PHE A CA  1 
ATOM   401 C C   . PHE A 1 48 ? 7.311   -11.988 21.046 1.00 8.33  ? 47   PHE A C   1 
ATOM   402 O O   . PHE A 1 48 ? 7.727   -12.274 19.918 1.00 8.63  ? 47   PHE A O   1 
ATOM   403 C CB  . PHE A 1 48 ? 7.979   -9.900  22.276 1.00 9.41  ? 47   PHE A CB  1 
ATOM   404 C CG  . PHE A 1 48 ? 9.336   -9.824  21.642 1.00 8.80  ? 47   PHE A CG  1 
ATOM   405 C CD1 . PHE A 1 48 ? 9.712   -8.706  20.907 1.00 10.21 ? 47   PHE A CD1 1 
ATOM   406 C CD2 . PHE A 1 48 ? 10.243  -10.868 21.773 1.00 9.22  ? 47   PHE A CD2 1 
ATOM   407 C CE1 . PHE A 1 48 ? 10.967  -8.624  20.345 1.00 10.57 ? 47   PHE A CE1 1 
ATOM   408 C CE2 . PHE A 1 48 ? 11.505  -10.794 21.182 1.00 9.97  ? 47   PHE A CE2 1 
ATOM   409 C CZ  . PHE A 1 48 ? 11.851  -9.659  20.460 1.00 10.82 ? 47   PHE A CZ  1 
ATOM   410 N N   . ASN A 1 49 ? 7.204   -12.887 22.014 1.00 8.86  ? 48   ASN A N   1 
ATOM   411 C CA  . ASN A 1 49 ? 7.605   -14.257 21.771 1.00 8.39  ? 48   ASN A CA  1 
ATOM   412 C C   . ASN A 1 49 ? 6.834   -14.918 20.634 1.00 7.99  ? 48   ASN A C   1 
ATOM   413 O O   . ASN A 1 49 ? 7.424   -15.574 19.764 1.00 8.59  ? 48   ASN A O   1 
ATOM   414 C CB  . ASN A 1 49 ? 7.497   -15.077 23.058 1.00 10.76 ? 48   ASN A CB  1 
ATOM   415 C CG  . ASN A 1 49 ? 8.065   -16.462 22.906 1.00 12.23 ? 48   ASN A CG  1 
ATOM   416 O OD1 . ASN A 1 49 ? 9.241   -16.633 22.603 1.00 13.83 ? 48   ASN A OD1 1 
ATOM   417 N ND2 . ASN A 1 49 ? 7.220   -17.464 23.089 1.00 15.77 ? 48   ASN A ND2 1 
ATOM   418 N N   . ASP A 1 50 ? 5.520   -14.772 20.642 1.00 8.11  ? 49   ASP A N   1 
ATOM   419 C CA  . ASP A 1 50 ? 4.712   -15.428 19.628 1.00 7.67  ? 49   ASP A CA  1 
ATOM   420 C C   . ASP A 1 50 ? 4.914   -14.841 18.229 1.00 7.27  ? 49   ASP A C   1 
ATOM   421 O O   . ASP A 1 50 ? 4.890   -15.570 17.238 1.00 8.55  ? 49   ASP A O   1 
ATOM   422 C CB  . ASP A 1 50 ? 3.232   -15.413 20.028 1.00 9.86  ? 49   ASP A CB  1 
ATOM   423 C CG  . ASP A 1 50 ? 2.922   -16.340 21.208 1.00 11.86 ? 49   ASP A CG  1 
ATOM   424 O OD1 . ASP A 1 50 ? 3.778   -17.183 21.579 1.00 14.89 ? 49   ASP A OD1 1 
ATOM   425 O OD2 . ASP A 1 50 ? 1.811   -16.221 21.765 1.00 12.37 ? 49   ASP A OD2 1 
ATOM   426 N N   . VAL A 1 51 ? 5.150   -13.533 18.146 1.00 6.55  ? 50   VAL A N   1 
ATOM   427 C CA  . VAL A 1 51 ? 5.394   -12.905 16.843 1.00 7.31  ? 50   VAL A CA  1 
ATOM   428 C C   . VAL A 1 51 ? 6.779   -13.328 16.317 1.00 7.31  ? 50   VAL A C   1 
ATOM   429 O O   . VAL A 1 51 ? 6.911   -13.691 15.151 1.00 8.14  ? 50   VAL A O   1 
ATOM   430 C CB  . VAL A 1 51 ? 5.208   -11.367 16.896 1.00 7.44  ? 50   VAL A CB  1 
ATOM   431 C CG1 . VAL A 1 51 ? 5.635   -10.722 15.588 1.00 8.78  ? 50   VAL A CG1 1 
ATOM   432 C CG2 . VAL A 1 51 ? 3.757   -11.006 17.209 1.00 8.29  ? 50   VAL A CG2 1 
ATOM   433 N N   . THR A 1 52 ? 7.810   -13.303 17.160 1.00 8.14  ? 51   THR A N   1 
ATOM   434 C CA  . THR A 1 52 ? 9.143   -13.702 16.696 1.00 8.96  ? 51   THR A CA  1 
ATOM   435 C C   . THR A 1 52 ? 9.191   -15.156 16.211 1.00 8.98  ? 51   THR A C   1 
ATOM   436 O O   . THR A 1 52 ? 9.841   -15.443 15.208 1.00 9.08  ? 51   THR A O   1 
ATOM   437 C CB  . THR A 1 52 ? 10.250  -13.476 17.733 1.00 10.56 ? 51   THR A CB  1 
ATOM   438 O OG1 . THR A 1 52 ? 9.928   -14.171 18.932 1.00 13.00 ? 51   THR A OG1 1 
ATOM   439 C CG2 . THR A 1 52 ? 10.469  -11.976 18.020 1.00 12.43 ? 51   THR A CG2 1 
ATOM   440 N N   A THR A 1 53 ? 8.499   -16.070 16.892 0.50 8.88  ? 52   THR A N   1 
ATOM   441 N N   B THR A 1 53 ? 8.510   -16.042 16.920 0.50 8.79  ? 52   THR A N   1 
ATOM   442 C CA  A THR A 1 53 ? 8.549   -17.491 16.484 0.50 9.62  ? 52   THR A CA  1 
ATOM   443 C CA  B THR A 1 53 ? 8.512   -17.448 16.552 0.50 9.58  ? 52   THR A CA  1 
ATOM   444 C C   A THR A 1 53 ? 7.733   -17.784 15.230 0.50 8.70  ? 52   THR A C   1 
ATOM   445 C C   B THR A 1 53 ? 7.845   -17.628 15.178 0.50 8.51  ? 52   THR A C   1 
ATOM   446 O O   A THR A 1 53 ? 8.028   -18.723 14.480 0.50 9.15  ? 52   THR A O   1 
ATOM   447 O O   B THR A 1 53 ? 8.392   -18.280 14.276 0.50 9.10  ? 52   THR A O   1 
ATOM   448 C CB  A THR A 1 53 ? 8.102   -18.473 17.592 0.50 10.43 ? 52   THR A CB  1 
ATOM   449 C CB  B THR A 1 53 ? 7.814   -18.297 17.635 0.50 10.29 ? 52   THR A CB  1 
ATOM   450 O OG1 A THR A 1 53 ? 6.686   -18.371 17.818 0.50 10.75 ? 52   THR A OG1 1 
ATOM   451 O OG1 B THR A 1 53 ? 8.490   -18.123 18.889 0.50 11.86 ? 52   THR A OG1 1 
ATOM   452 C CG2 A THR A 1 53 ? 8.879   -18.228 18.879 0.50 11.05 ? 52   THR A CG2 1 
ATOM   453 C CG2 B THR A 1 53 ? 7.864   -19.748 17.273 0.50 11.28 ? 52   THR A CG2 1 
ATOM   454 N N   . ARG A 1 54 ? 6.680   -17.006 15.024 1.00 7.69  ? 53   ARG A N   1 
ATOM   455 C CA  . ARG A 1 54 ? 5.845   -17.184 13.839 1.00 7.88  ? 53   ARG A CA  1 
ATOM   456 C C   . ARG A 1 54 ? 6.426   -16.548 12.592 1.00 8.46  ? 53   ARG A C   1 
ATOM   457 O O   . ARG A 1 54 ? 6.377   -17.137 11.510 1.00 10.36 ? 53   ARG A O   1 
ATOM   458 C CB  . ARG A 1 54 ? 4.417   -16.709 14.127 1.00 8.08  ? 53   ARG A CB  1 
ATOM   459 C CG  A ARG A 1 54 ? 3.678   -17.500 15.142 0.50 7.12  ? 53   ARG A CG  1 
ATOM   460 C CG  B ARG A 1 54 ? 3.712   -17.775 15.001 0.50 8.96  ? 53   ARG A CG  1 
ATOM   461 C CD  A ARG A 1 54 ? 2.351   -16.836 15.546 0.50 6.68  ? 53   ARG A CD  1 
ATOM   462 C CD  B ARG A 1 54 ? 2.533   -17.344 15.899 0.50 9.09  ? 53   ARG A CD  1 
ATOM   463 N NE  A ARG A 1 54 ? 1.530   -17.836 16.212 0.50 6.51  ? 53   ARG A NE  1 
ATOM   464 N NE  B ARG A 1 54 ? 2.451   -18.259 17.052 0.50 9.88  ? 53   ARG A NE  1 
ATOM   465 C CZ  A ARG A 1 54 ? 1.864   -18.395 17.372 0.50 6.08  ? 53   ARG A CZ  1 
ATOM   466 C CZ  B ARG A 1 54 ? 1.421   -19.037 17.384 0.50 10.05 ? 53   ARG A CZ  1 
ATOM   467 N NH1 A ARG A 1 54 ? 1.088   -19.337 17.888 0.50 7.77  ? 53   ARG A NH1 1 
ATOM   468 N NH1 B ARG A 1 54 ? 1.537   -19.834 18.436 0.50 10.93 ? 53   ARG A NH1 1 
ATOM   469 N NH2 A ARG A 1 54 ? 2.973   -18.018 18.014 0.50 7.26  ? 53   ARG A NH2 1 
ATOM   470 N NH2 B ARG A 1 54 ? 0.280   -19.025 16.704 0.50 9.02  ? 53   ARG A NH2 1 
ATOM   471 N N   . LEU A 1 55 ? 6.987   -15.348 12.730 1.00 9.19  ? 54   LEU A N   1 
ATOM   472 C CA  . LEU A 1 55 ? 7.573   -14.643 11.595 1.00 11.00 ? 54   LEU A CA  1 
ATOM   473 C C   . LEU A 1 55 ? 9.057   -14.955 11.409 1.00 11.66 ? 54   LEU A C   1 
ATOM   474 O O   . LEU A 1 55 ? 9.649   -14.540 10.407 1.00 13.71 ? 54   LEU A O   1 
ATOM   475 C CB  . LEU A 1 55 ? 7.361   -13.134 11.732 1.00 12.16 ? 54   LEU A CB  1 
ATOM   476 C CG  . LEU A 1 55 ? 5.917   -12.665 11.863 1.00 12.76 ? 54   LEU A CG  1 
ATOM   477 C CD1 . LEU A 1 55 ? 5.821   -11.150 11.967 1.00 13.89 ? 54   LEU A CD1 1 
ATOM   478 C CD2 . LEU A 1 55 ? 5.054   -13.203 10.735 1.00 14.47 ? 54   LEU A CD2 1 
ATOM   479 N N   . ARG A 1 56 ? 9.648   -15.676 12.358 1.00 11.29 ? 55   ARG A N   1 
ATOM   480 C CA  . ARG A 1 56 ? 11.062  -16.074 12.319 1.00 13.01 ? 55   ARG A CA  1 
ATOM   481 C C   . ARG A 1 56 ? 11.998  -14.856 12.163 1.00 12.61 ? 55   ARG A C   1 
ATOM   482 O O   . ARG A 1 56 ? 12.923  -14.833 11.334 1.00 14.32 ? 55   ARG A O   1 
ATOM   483 C CB  . ARG A 1 56 ? 11.305  -17.180 11.282 1.00 13.98 ? 55   ARG A CB  1 
ATOM   484 C CG  . ARG A 1 56 ? 10.468  -18.455 11.556 1.00 15.01 ? 55   ARG A CG  1 
ATOM   485 C CD  . ARG A 1 56 ? 10.740  -19.557 10.523 1.00 16.35 ? 55   ARG A CD  1 
ATOM   486 N NE  . ARG A 1 56 ? 10.396  -19.118 9.176  1.00 19.52 ? 55   ARG A NE  1 
ATOM   487 C CZ  . ARG A 1 56 ? 9.199   -19.252 8.614  1.00 20.31 ? 55   ARG A CZ  1 
ATOM   488 N NH1 . ARG A 1 56 ? 8.207   -19.843 9.273  1.00 21.04 ? 55   ARG A NH1 1 
ATOM   489 N NH2 . ARG A 1 56 ? 8.998   -18.808 7.379  1.00 21.63 ? 55   ARG A NH2 1 
ATOM   490 N N   . GLU A 1 57 ? 11.735  -13.849 12.994 1.00 11.74 ? 56   GLU A N   1 
ATOM   491 C CA  . GLU A 1 57 ? 12.543  -12.636 13.127 1.00 12.69 ? 56   GLU A CA  1 
ATOM   492 C C   . GLU A 1 57 ? 12.973  -12.510 14.580 1.00 13.65 ? 56   GLU A C   1 
ATOM   493 O O   . GLU A 1 57 ? 12.134  -12.669 15.467 1.00 15.78 ? 56   GLU A O   1 
ATOM   494 C CB  . GLU A 1 57 ? 11.698  -11.410 12.766 1.00 12.05 ? 56   GLU A CB  1 
ATOM   495 C CG  . GLU A 1 57 ? 11.392  -11.267 11.295 1.00 12.58 ? 56   GLU A CG  1 
ATOM   496 C CD  . GLU A 1 57 ? 12.517  -10.580 10.518 1.00 12.76 ? 56   GLU A CD  1 
ATOM   497 O OE1 . GLU A 1 57 ? 13.645  -10.476 11.044 1.00 13.70 ? 56   GLU A OE1 1 
ATOM   498 O OE2 . GLU A 1 57 ? 12.265  -10.124 9.380  1.00 14.57 ? 56   GLU A OE2 1 
ATOM   499 N N   . ASN A 1 58 ? 14.253  -12.194 14.819 1.00 14.43 ? 57   ASN A N   1 
ATOM   500 C CA  . ASN A 1 58 ? 14.848  -12.066 16.157 1.00 15.89 ? 57   ASN A CA  1 
ATOM   501 C C   . ASN A 1 58 ? 14.459  -10.795 16.880 1.00 14.45 ? 57   ASN A C   1 
ATOM   502 O O   . ASN A 1 58 ? 14.259  -10.803 18.102 1.00 15.14 ? 57   ASN A O   1 
ATOM   503 C CB  . ASN A 1 58 ? 16.379  -12.017 16.048 1.00 17.93 ? 57   ASN A CB  1 
ATOM   504 C CG  . ASN A 1 58 ? 17.003  -13.348 15.685 1.00 19.18 ? 57   ASN A CG  1 
ATOM   505 O OD1 . ASN A 1 58 ? 16.436  -14.424 15.926 1.00 20.58 ? 57   ASN A OD1 1 
ATOM   506 N ND2 . ASN A 1 58 ? 18.205  -13.280 15.117 1.00 19.57 ? 57   ASN A ND2 1 
ATOM   507 N N   . GLU A 1 59 ? 14.455  -9.692  16.136 1.00 13.09 ? 58   GLU A N   1 
ATOM   508 C CA  . GLU A 1 59 ? 14.301  -8.360  16.706 1.00 14.15 ? 58   GLU A CA  1 
ATOM   509 C C   . GLU A 1 59 ? 13.199  -7.640  15.964 1.00 11.94 ? 58   GLU A C   1 
ATOM   510 O O   . GLU A 1 59 ? 13.215  -7.575  14.729 1.00 12.27 ? 58   GLU A O   1 
ATOM   511 C CB  . GLU A 1 59 ? 15.599  -7.542  16.582 1.00 15.76 ? 58   GLU A CB  1 
ATOM   512 C CG  . GLU A 1 59 ? 15.483  -6.159  17.237 1.00 19.43 ? 58   GLU A CG  1 
ATOM   513 C CD  . GLU A 1 59 ? 16.746  -5.319  17.160 1.00 20.48 ? 58   GLU A CD  1 
ATOM   514 O OE1 . GLU A 1 59 ? 17.239  -5.065  16.037 1.00 23.79 ? 58   GLU A OE1 1 
ATOM   515 O OE2 . GLU A 1 59 ? 17.245  -4.894  18.221 1.00 23.05 ? 58   GLU A OE2 1 
ATOM   516 N N   . LEU A 1 60 ? 12.252  -7.092  16.714 1.00 9.70  ? 59   LEU A N   1 
ATOM   517 C CA  . LEU A 1 60 ? 11.104  -6.460  16.089 1.00 9.06  ? 59   LEU A CA  1 
ATOM   518 C C   . LEU A 1 60 ? 10.329  -5.640  17.091 1.00 8.26  ? 59   LEU A C   1 
ATOM   519 O O   . LEU A 1 60 ? 10.535  -5.769  18.303 1.00 9.29  ? 59   LEU A O   1 
ATOM   520 C CB  . LEU A 1 60 ? 10.197  -7.534  15.466 1.00 9.91  ? 59   LEU A CB  1 
ATOM   521 C CG  . LEU A 1 60 ? 9.633   -8.617  16.393 1.00 10.91 ? 59   LEU A CG  1 
ATOM   522 C CD1 . LEU A 1 60 ? 8.410   -8.148  17.146 1.00 10.81 ? 59   LEU A CD1 1 
ATOM   523 C CD2 . LEU A 1 60 ? 9.313   -9.871  15.596 1.00 12.94 ? 59   LEU A CD2 1 
ATOM   524 N N   . THR A 1 61 ? 9.436   -4.790  16.587 1.00 7.59  ? 60   THR A N   1 
ATOM   525 C CA  . THR A 1 61 ? 8.370   -4.192  17.380 1.00 8.32  ? 60   THR A CA  1 
ATOM   526 C C   . THR A 1 61 ? 7.052   -4.546  16.696 1.00 7.26  ? 60   THR A C   1 
ATOM   527 O O   . THR A 1 61 ? 7.034   -4.850  15.499 1.00 7.64  ? 60   THR A O   1 
ATOM   528 C CB  . THR A 1 61 ? 8.525   -2.657  17.534 1.00 9.93  ? 60   THR A CB  1 
ATOM   529 O OG1 . THR A 1 61 ? 8.590   -2.019  16.249 1.00 11.38 ? 60   THR A OG1 1 
ATOM   530 C CG2 . THR A 1 61 ? 9.769   -2.319  18.355 1.00 12.00 ? 60   THR A CG2 1 
ATOM   531 N N   . TYR A 1 62 ? 5.965   -4.521  17.462 1.00 6.94  ? 61   TYR A N   1 
ATOM   532 C CA  . TYR A 1 62 ? 4.669   -4.943  16.911 1.00 7.50  ? 61   TYR A CA  1 
ATOM   533 C C   . TYR A 1 62 ? 3.534   -4.136  17.540 1.00 6.88  ? 61   TYR A C   1 
ATOM   534 O O   . TYR A 1 62 ? 3.678   -3.554  18.621 1.00 7.66  ? 61   TYR A O   1 
ATOM   535 C CB  . TYR A 1 62 ? 4.427   -6.460  17.111 1.00 8.32  ? 61   TYR A CB  1 
ATOM   536 C CG  . TYR A 1 62 ? 4.168   -6.755  18.575 1.00 9.17  ? 61   TYR A CG  1 
ATOM   537 C CD1 . TYR A 1 62 ? 2.868   -6.768  19.085 1.00 10.41 ? 61   TYR A CD1 1 
ATOM   538 C CD2 . TYR A 1 62 ? 5.217   -6.931  19.462 1.00 9.91  ? 61   TYR A CD2 1 
ATOM   539 C CE1 . TYR A 1 62 ? 2.622   -6.955  20.439 1.00 11.63 ? 61   TYR A CE1 1 
ATOM   540 C CE2 . TYR A 1 62 ? 4.974   -7.115  20.816 1.00 11.00 ? 61   TYR A CE2 1 
ATOM   541 C CZ  . TYR A 1 62 ? 3.677   -7.124  21.293 1.00 10.75 ? 61   TYR A CZ  1 
ATOM   542 O OH  . TYR A 1 62 ? 3.433   -7.308  22.638 1.00 13.31 ? 61   TYR A OH  1 
ATOM   543 N N   . TYR A 1 63 ? 2.404   -4.114  16.830 1.00 7.00  ? 62   TYR A N   1 
ATOM   544 C CA  . TYR A 1 63 ? 1.176   -3.470  17.264 1.00 7.61  ? 62   TYR A CA  1 
ATOM   545 C C   . TYR A 1 63 ? -0.011  -4.274  16.745 1.00 6.75  ? 62   TYR A C   1 
ATOM   546 O O   . TYR A 1 63 ? -0.031  -4.671  15.571 1.00 6.73  ? 62   TYR A O   1 
ATOM   547 C CB  . TYR A 1 63 ? 1.134   -2.037  16.729 1.00 9.02  ? 62   TYR A CB  1 
ATOM   548 C CG  . TYR A 1 63 ? -0.132  -1.265  17.032 1.00 10.19 ? 62   TYR A CG  1 
ATOM   549 C CD1 . TYR A 1 63 ? -0.352  -0.697  18.281 1.00 12.29 ? 62   TYR A CD1 1 
ATOM   550 C CD2 . TYR A 1 63 ? -1.117  -1.109  16.054 1.00 10.14 ? 62   TYR A CD2 1 
ATOM   551 C CE1 . TYR A 1 63 ? -1.520  0.008   18.533 1.00 14.20 ? 62   TYR A CE1 1 
ATOM   552 C CE2 . TYR A 1 63 ? -2.272  -0.409  16.307 1.00 12.39 ? 62   TYR A CE2 1 
ATOM   553 C CZ  . TYR A 1 63 ? -2.465  0.148   17.537 1.00 12.31 ? 62   TYR A CZ  1 
ATOM   554 O OH  . TYR A 1 63 ? -3.629  0.843   17.783 1.00 14.67 ? 62   TYR A OH  1 
ATOM   555 N N   . CYS A 1 64 ? -0.994  -4.493  17.619 1.00 7.32  ? 63   CYS A N   1 
ATOM   556 C CA  . CYS A 1 64 ? -2.249  -5.102  17.219 1.00 7.59  ? 63   CYS A CA  1 
ATOM   557 C C   . CYS A 1 64 ? -3.424  -4.219  17.561 1.00 7.44  ? 63   CYS A C   1 
ATOM   558 O O   . CYS A 1 64 ? -3.406  -3.499  18.555 1.00 9.07  ? 63   CYS A O   1 
ATOM   559 C CB  . CYS A 1 64 ? -2.453  -6.463  17.858 1.00 7.84  ? 63   CYS A CB  1 
ATOM   560 S SG  . CYS A 1 64 ? -1.314  -7.714  17.241 1.00 8.82  ? 63   CYS A SG  1 
ATOM   561 N N   . CYS A 1 65 ? -4.481  -4.346  16.779 1.00 7.40  ? 64   CYS A N   1 
ATOM   562 C CA  . CYS A 1 65 ? -5.660  -3.515  16.904 1.00 7.62  ? 64   CYS A CA  1 
ATOM   563 C C   . CYS A 1 65 ? -6.854  -4.207  16.253 1.00 7.67  ? 64   CYS A C   1 
ATOM   564 O O   . CYS A 1 65 ? -6.694  -5.225  15.594 1.00 8.54  ? 64   CYS A O   1 
ATOM   565 C CB  . CYS A 1 65 ? -5.382  -2.157  16.260 1.00 9.52  ? 64   CYS A CB  1 
ATOM   566 S SG  . CYS A 1 65 ? -4.735  -2.280  14.567 1.00 10.23 ? 64   CYS A SG  1 
ATOM   567 N N   . LYS A 1 66 ? -8.055  -3.680  16.462 1.00 8.32  ? 65   LYS A N   1 
ATOM   568 C CA  . LYS A 1 66 ? -9.254  -4.371  15.953 1.00 8.73  ? 65   LYS A CA  1 
ATOM   569 C C   . LYS A 1 66 ? -10.265 -3.417  15.308 1.00 8.82  ? 65   LYS A C   1 
ATOM   570 O O   . LYS A 1 66 ? -11.478 -3.605  15.406 1.00 11.44 ? 65   LYS A O   1 
ATOM   571 C CB  . LYS A 1 66 ? -9.921  -5.221  17.026 1.00 10.85 ? 65   LYS A CB  1 
ATOM   572 C CG  . LYS A 1 66 ? -10.211 -4.440  18.270 1.00 13.93 ? 65   LYS A CG  1 
ATOM   573 C CD  . LYS A 1 66 ? -10.914 -5.298  19.283 1.00 17.82 ? 65   LYS A CD  1 
ATOM   574 C CE  . LYS A 1 66 ? -11.994 -6.103  18.624 1.00 20.97 ? 65   LYS A CE  1 
ATOM   575 N NZ  . LYS A 1 66 ? -12.296 -7.309  19.427 1.00 23.22 ? 65   LYS A NZ  1 
ATOM   576 N N   . LYS A 1 67 ? -9.746  -2.383  14.651 1.00 9.71  ? 66   LYS A N   1 
ATOM   577 C CA  . LYS A 1 67 ? -10.543 -1.496  13.807 1.00 10.52 ? 66   LYS A CA  1 
ATOM   578 C C   . LYS A 1 67 ? -10.091 -1.634  12.355 1.00 9.63  ? 66   LYS A C   1 
ATOM   579 O O   . LYS A 1 67 ? -8.943  -1.978  12.092 1.00 9.61  ? 66   LYS A O   1 
ATOM   580 C CB  . LYS A 1 67 ? -10.409 -0.062  14.298 1.00 13.35 ? 66   LYS A CB  1 
ATOM   581 C CG  . LYS A 1 67 ? -11.077 0.131   15.642 1.00 16.74 ? 66   LYS A CG  1 
ATOM   582 C CD  . LYS A 1 67 ? -12.547 -0.267  15.551 1.00 20.54 ? 66   LYS A CD  1 
ATOM   583 C CE  . LYS A 1 67 ? -13.206 -0.447  16.914 1.00 22.57 ? 66   LYS A CE  1 
ATOM   584 N NZ  . LYS A 1 67 ? -13.023 -1.813  17.496 1.00 23.98 ? 66   LYS A NZ  1 
ATOM   585 N N   . ASP A 1 68 ? -10.988 -1.384  11.410 1.00 10.61 ? 67   ASP A N   1 
ATOM   586 C CA  . ASP A 1 68 ? -10.675 -1.661  10.017 1.00 10.78 ? 67   ASP A CA  1 
ATOM   587 C C   . ASP A 1 68 ? -9.414  -0.938  9.548  1.00 9.24  ? 67   ASP A C   1 
ATOM   588 O O   . ASP A 1 68 ? -9.260  0.287   9.730  1.00 9.63  ? 67   ASP A O   1 
ATOM   589 C CB  . ASP A 1 68 ? -11.845 -1.299  9.105  1.00 13.39 ? 67   ASP A CB  1 
ATOM   590 C CG  . ASP A 1 68 ? -12.908 -2.399  9.021  1.00 14.56 ? 67   ASP A CG  1 
ATOM   591 O OD1 . ASP A 1 68 ? -12.822 -3.444  9.708  1.00 14.95 ? 67   ASP A OD1 1 
ATOM   592 O OD2 . ASP A 1 68 ? -13.865 -2.204  8.240  1.00 16.47 ? 67   ASP A OD2 1 
ATOM   593 N N   . LEU A 1 69 ? -8.528  -1.713  8.935  1.00 9.09  ? 68   LEU A N   1 
ATOM   594 C CA  . LEU A 1 69 ? -7.311  -1.174  8.326  1.00 8.39  ? 68   LEU A CA  1 
ATOM   595 C C   . LEU A 1 69 ? -6.429  -0.416  9.324  1.00 8.18  ? 68   LEU A C   1 
ATOM   596 O O   . LEU A 1 69 ? -5.689  0.506   8.959  1.00 8.24  ? 68   LEU A O   1 
ATOM   597 C CB  . LEU A 1 69 ? -7.630  -0.326  7.093  1.00 9.95  ? 68   LEU A CB  1 
ATOM   598 C CG  . LEU A 1 69 ? -8.429  -1.109  6.042  1.00 10.56 ? 68   LEU A CG  1 
ATOM   599 C CD1 . LEU A 1 69 ? -8.675  -0.234  4.823  1.00 12.80 ? 68   LEU A CD1 1 
ATOM   600 C CD2 . LEU A 1 69 ? -7.725  -2.413  5.631  1.00 11.56 ? 68   LEU A CD2 1 
ATOM   601 N N   . CYS A 1 70 ? -6.447  -0.864  10.579 1.00 7.27  ? 69   CYS A N   1 
ATOM   602 C CA  . CYS A 1 70 ? -5.748  -0.160  11.635 1.00 7.40  ? 69   CYS A CA  1 
ATOM   603 C C   . CYS A 1 70 ? -4.279  -0.527  11.747 1.00 6.18  ? 69   CYS A C   1 
ATOM   604 O O   . CYS A 1 70 ? -3.530  0.157   12.451 1.00 6.84  ? 69   CYS A O   1 
ATOM   605 C CB  . CYS A 1 70 ? -6.453  -0.401  12.969 1.00 8.06  ? 69   CYS A CB  1 
ATOM   606 S SG  . CYS A 1 70 ? -6.439  -2.151  13.489 1.00 9.01  ? 69   CYS A SG  1 
ATOM   607 N N   . ASN A 1 71 ? -3.859  -1.595  11.069 1.00 6.00  ? 70   ASN A N   1 
ATOM   608 C CA  . ASN A 1 71 ? -2.468  -2.051  11.139 1.00 5.76  ? 70   ASN A CA  1 
ATOM   609 C C   . ASN A 1 71 ? -1.587  -1.376  10.088 1.00 5.40  ? 70   ASN A C   1 
ATOM   610 O O   . ASN A 1 71 ? -1.070  -2.022  9.168  1.00 6.32  ? 70   ASN A O   1 
ATOM   611 C CB  . ASN A 1 71 ? -2.367  -3.584  11.061 1.00 5.90  ? 70   ASN A CB  1 
ATOM   612 C CG  . ASN A 1 71 ? -2.946  -4.195  9.779  1.00 5.08  ? 70   ASN A CG  1 
ATOM   613 O OD1 . ASN A 1 71 ? -3.915  -3.699  9.184  1.00 5.76  ? 70   ASN A OD1 1 
ATOM   614 N ND2 . ASN A 1 71 ? -2.393  -5.343  9.412  1.00 5.68  ? 70   ASN A ND2 1 
ATOM   615 N N   . PHE A 1 72 ? -1.448  -0.060  10.219 1.00 6.49  ? 71   PHE A N   1 
ATOM   616 C CA  . PHE A 1 72 ? -0.688  0.765   9.286  1.00 6.35  ? 71   PHE A CA  1 
ATOM   617 C C   . PHE A 1 72 ? 0.623   1.230   9.901  1.00 5.79  ? 71   PHE A C   1 
ATOM   618 O O   . PHE A 1 72 ? 0.788   1.257   11.116 1.00 6.31  ? 71   PHE A O   1 
ATOM   619 C CB  . PHE A 1 72 ? -1.527  1.956   8.769  1.00 7.27  ? 71   PHE A CB  1 
ATOM   620 C CG  . PHE A 1 72 ? -2.088  2.846   9.856  1.00 6.93  ? 71   PHE A CG  1 
ATOM   621 C CD1 . PHE A 1 72 ? -3.366  2.646   10.344 1.00 7.00  ? 71   PHE A CD1 1 
ATOM   622 C CD2 . PHE A 1 72 ? -1.358  3.930   10.335 1.00 7.46  ? 71   PHE A CD2 1 
ATOM   623 C CE1 . PHE A 1 72 ? -3.894  3.479   11.333 1.00 8.18  ? 71   PHE A CE1 1 
ATOM   624 C CE2 . PHE A 1 72 ? -1.888  4.763   11.315 1.00 8.15  ? 71   PHE A CE2 1 
ATOM   625 C CZ  . PHE A 1 72 ? -3.153  4.534   11.818 1.00 8.53  ? 71   PHE A CZ  1 
ATOM   626 N N   . ASN A 1 73 ? 1.537   1.651   9.033  1.00 6.52  ? 72   ASN A N   1 
ATOM   627 C CA  . ASN A 1 73 ? 2.931   1.933   9.374  1.00 7.45  ? 72   ASN A CA  1 
ATOM   628 C C   . ASN A 1 73 ? 3.093   2.878   10.555 1.00 6.97  ? 72   ASN A C   1 
ATOM   629 O O   . ASN A 1 73 ? 3.867   2.627   11.487 1.00 7.79  ? 72   ASN A O   1 
ATOM   630 C CB  . ASN A 1 73 ? 3.637   2.520   8.137  1.00 8.84  ? 72   ASN A CB  1 
ATOM   631 C CG  . ASN A 1 73 ? 5.130   2.569   8.300  1.00 10.27 ? 72   ASN A CG  1 
ATOM   632 O OD1 . ASN A 1 73 ? 5.649   3.379   9.057  1.00 11.85 ? 72   ASN A OD1 1 
ATOM   633 N ND2 . ASN A 1 73 ? 5.831   1.693   7.589  1.00 13.30 ? 72   ASN A ND2 1 
ATOM   634 N N   . GLU A 1 74 ? 2.333   3.964   10.518 1.00 6.53  ? 73   GLU A N   1 
ATOM   635 C CA  . GLU A 1 74 ? 2.477   5.055   11.458 1.00 7.04  ? 73   GLU A CA  1 
ATOM   636 C C   . GLU A 1 74 ? 2.017   4.706   12.872 1.00 7.34  ? 73   GLU A C   1 
ATOM   637 O O   . GLU A 1 74 ? 2.249   5.499   13.785 1.00 8.67  ? 73   GLU A O   1 
ATOM   638 C CB  . GLU A 1 74 ? 1.733   6.292   10.956 1.00 7.31  ? 73   GLU A CB  1 
ATOM   639 C CG  . GLU A 1 74 ? 2.347   6.915   9.699  1.00 7.79  ? 73   GLU A CG  1 
ATOM   640 C CD  . GLU A 1 74 ? 1.933   6.292   8.370  1.00 7.35  ? 73   GLU A CD  1 
ATOM   641 O OE1 . GLU A 1 74 ? 1.135   5.320   8.306  1.00 7.61  ? 73   GLU A OE1 1 
ATOM   642 O OE2 . GLU A 1 74 ? 2.412   6.821   7.338  1.00 9.30  ? 73   GLU A OE2 1 
ATOM   643 N N   . GLN A 1 75 ? 1.415   3.530   13.085 1.00 7.20  ? 74   GLN A N   1 
ATOM   644 C CA  . GLN A 1 75 ? 1.069   3.057   14.420 1.00 8.30  ? 74   GLN A CA  1 
ATOM   645 C C   . GLN A 1 75 ? 2.299   2.700   15.249 1.00 9.12  ? 74   GLN A C   1 
ATOM   646 O O   . GLN A 1 75 ? 2.213   2.616   16.475 1.00 10.77 ? 74   GLN A O   1 
ATOM   647 C CB  . GLN A 1 75 ? 0.199   1.802   14.333 1.00 8.50  ? 74   GLN A CB  1 
ATOM   648 C CG  . GLN A 1 75 ? -1.164  1.986   13.688 1.00 9.03  ? 74   GLN A CG  1 
ATOM   649 C CD  . GLN A 1 75 ? -2.176  2.665   14.605 1.00 9.81  ? 74   GLN A CD  1 
ATOM   650 O OE1 . GLN A 1 75 ? -1.830  3.555   15.390 1.00 13.23 ? 74   GLN A OE1 1 
ATOM   651 N NE2 . GLN A 1 75 ? -3.440  2.303   14.462 1.00 9.11  ? 74   GLN A NE2 1 
ATOM   652 N N   . LEU A 1 76 ? 3.416   2.427   14.583 1.00 8.83  ? 75   LEU A N   1 
ATOM   653 C CA  . LEU A 1 76 ? 4.598   1.885   15.260 1.00 11.72 ? 75   LEU A CA  1 
ATOM   654 C C   . LEU A 1 76 ? 5.754   2.827   15.135 1.00 13.75 ? 75   LEU A C   1 
ATOM   655 O O   . LEU A 1 76 ? 6.312   2.982   14.041 1.00 14.60 ? 75   LEU A O   1 
ATOM   656 C CB  . LEU A 1 76 ? 5.032   0.557   14.631 1.00 14.20 ? 75   LEU A CB  1 
ATOM   657 C CG  . LEU A 1 76 ? 4.630   -0.756  15.295 1.00 15.33 ? 75   LEU A CG  1 
ATOM   658 C CD1 . LEU A 1 76 ? 5.222   -1.971  14.584 1.00 13.94 ? 75   LEU A CD1 1 
ATOM   659 C CD2 . LEU A 1 76 ? 5.013   -0.804  16.762 1.00 13.65 ? 75   LEU A CD2 1 
ATOM   660 N N   . GLU A 1 77 ? 6.137   3.436   16.259 1.00 16.80 ? 76   GLU A N   1 
ATOM   661 C CA  . GLU A 1 77 ? 7.221   4.408   16.248 1.00 21.52 ? 76   GLU A CA  1 
ATOM   662 C C   . GLU A 1 77 ? 8.513   3.705   15.859 1.00 22.26 ? 76   GLU A C   1 
ATOM   663 O O   . GLU A 1 77 ? 9.279   4.198   15.031 1.00 23.64 ? 76   GLU A O   1 
ATOM   664 C CB  . GLU A 1 77 ? 7.372   5.079   17.617 1.00 22.46 ? 76   GLU A CB  1 
ATOM   665 C CG  . GLU A 1 77 ? 6.157   5.870   18.083 1.00 24.63 ? 76   GLU A CG  1 
ATOM   666 C CD  . GLU A 1 77 ? 6.319   6.415   19.492 1.00 25.04 ? 76   GLU A CD  1 
ATOM   667 O OE1 . GLU A 1 77 ? 7.413   6.242   20.072 1.00 26.59 ? 76   GLU A OE1 1 
ATOM   668 O OE2 . GLU A 1 77 ? 5.354   7.012   20.023 1.00 26.86 ? 76   GLU A OE2 1 
ATOM   669 N N   . ASN A 1 78 ? 8.747   2.542   16.460 1.00 23.32 ? 77   ASN A N   1 
ATOM   670 C CA  . ASN A 1 78 ? 9.914   1.742   16.121 1.00 24.16 ? 77   ASN A CA  1 
ATOM   671 C C   . ASN A 1 78 ? 11.206  2.530   16.336 1.00 24.54 ? 77   ASN A C   1 
ATOM   672 O O   . ASN A 1 78 ? 11.958  2.787   15.399 1.00 23.78 ? 77   ASN A O   1 
ATOM   673 C CB  . ASN A 1 78 ? 9.810   1.261   14.671 1.00 24.77 ? 77   ASN A CB  1 
ATOM   674 C CG  . ASN A 1 78 ? 10.848  0.216   14.323 1.00 25.39 ? 77   ASN A CG  1 
ATOM   675 O OD1 . ASN A 1 78 ? 11.154  -0.672  15.124 1.00 25.85 ? 77   ASN A OD1 1 
ATOM   676 N ND2 . ASN A 1 78 ? 11.389  0.308   13.111 1.00 25.09 ? 77   ASN A ND2 1 
HETATM 677 O O   . HOH B 2 .  ? -15.368 -4.521  7.571  1.00 13.69 ? 2001 HOH A O   1 
HETATM 678 O O   . HOH B 2 .  ? -16.889 -7.345  12.394 1.00 13.83 ? 2002 HOH A O   1 
HETATM 679 O O   . HOH B 2 .  ? -9.029  1.252   1.531  1.00 31.41 ? 2003 HOH A O   1 
HETATM 680 O O   . HOH B 2 .  ? 12.225  -10.675 3.120  1.00 37.38 ? 2004 HOH A O   1 
HETATM 681 O O   . HOH B 2 .  ? -11.497 -1.300  2.168  1.00 35.40 ? 2005 HOH A O   1 
HETATM 682 O O   . HOH B 2 .  ? -11.421 -6.792  1.439  1.00 34.59 ? 2006 HOH A O   1 
HETATM 683 O O   . HOH B 2 .  ? -15.223 -5.292  4.881  1.00 14.69 ? 2007 HOH A O   1 
HETATM 684 O O   . HOH B 2 .  ? -14.285 -1.895  1.472  1.00 38.80 ? 2008 HOH A O   1 
HETATM 685 O O   . HOH B 2 .  ? -16.013 -4.195  2.491  1.00 25.93 ? 2009 HOH A O   1 
HETATM 686 O O   . HOH B 2 .  ? 10.510  -11.857 0.916  1.00 21.74 ? 2010 HOH A O   1 
HETATM 687 O O   . HOH B 2 .  ? 11.555  1.022   3.083  1.00 44.84 ? 2011 HOH A O   1 
HETATM 688 O O   . HOH B 2 .  ? 6.302   1.057   -1.139 1.00 15.86 ? 2012 HOH A O   1 
HETATM 689 O O   . HOH B 2 .  ? -5.296  2.611   6.777  1.00 17.25 ? 2013 HOH A O   1 
HETATM 690 O O   . HOH B 2 .  ? -6.415  1.413   2.170  1.00 21.47 ? 2014 HOH A O   1 
HETATM 691 O O   . HOH B 2 .  ? -3.551  -11.281 1.269  1.00 22.35 ? 2015 HOH A O   1 
HETATM 692 O O   . HOH B 2 .  ? -2.703  -13.580 8.185  1.00 18.87 ? 2016 HOH A O   1 
HETATM 693 O O   . HOH B 2 .  ? 3.217   -9.093  5.635  1.00 9.27  ? 2017 HOH A O   1 
HETATM 694 O O   . HOH B 2 .  ? 2.510   -16.330 3.740  1.00 36.67 ? 2018 HOH A O   1 
HETATM 695 O O   . HOH B 2 .  ? 8.931   -9.894  0.103  1.00 22.93 ? 2019 HOH A O   1 
HETATM 696 O O   . HOH B 2 .  ? 10.478  -6.045  1.897  1.00 31.95 ? 2020 HOH A O   1 
HETATM 697 O O   . HOH B 2 .  ? 3.899   -2.731  4.890  1.00 9.88  ? 2021 HOH A O   1 
HETATM 698 O O   . HOH B 2 .  ? 2.043   -8.476  -0.884 1.00 23.51 ? 2022 HOH A O   1 
HETATM 699 O O   . HOH B 2 .  ? 8.649   0.595   4.873  1.00 18.24 ? 2023 HOH A O   1 
HETATM 700 O O   . HOH B 2 .  ? 9.177   -4.335  -0.111 1.00 27.94 ? 2024 HOH A O   1 
HETATM 701 O O   . HOH B 2 .  ? 7.004   -15.027 7.141  1.00 30.02 ? 2025 HOH A O   1 
HETATM 702 O O   . HOH B 2 .  ? 5.187   -1.589  -0.939 1.00 20.35 ? 2026 HOH A O   1 
HETATM 703 O O   . HOH B 2 .  ? 2.577   -1.817  -1.881 1.00 27.56 ? 2027 HOH A O   1 
HETATM 704 O O   . HOH B 2 .  ? 5.134   2.534   4.594  1.00 24.37 ? 2028 HOH A O   1 
HETATM 705 O O   . HOH B 2 .  ? 4.070   0.014   5.897  1.00 17.99 ? 2029 HOH A O   1 
HETATM 706 O O   . HOH B 2 .  ? -10.141 -20.916 22.130 1.00 30.28 ? 2030 HOH A O   1 
HETATM 707 O O   . HOH B 2 .  ? -0.338  -0.879  5.546  1.00 16.42 ? 2031 HOH A O   1 
HETATM 708 O O   . HOH B 2 .  ? -5.733  -0.270  0.219  1.00 28.37 ? 2032 HOH A O   1 
HETATM 709 O O   . HOH B 2 .  ? 0.616   -3.814  -1.429 1.00 18.86 ? 2033 HOH A O   1 
HETATM 710 O O   . HOH B 2 .  ? -3.021  -6.084  -3.453 1.00 29.27 ? 2034 HOH A O   1 
HETATM 711 O O   . HOH B 2 .  ? -0.446  -8.749  -0.974 1.00 32.60 ? 2035 HOH A O   1 
HETATM 712 O O   . HOH B 2 .  ? 0.606   -6.352  -1.941 1.00 29.30 ? 2036 HOH A O   1 
HETATM 713 O O   . HOH B 2 .  ? -6.850  -4.620  -1.494 1.00 22.95 ? 2037 HOH A O   1 
HETATM 714 O O   . HOH B 2 .  ? 10.032  -13.508 5.130  1.00 47.30 ? 2038 HOH A O   1 
HETATM 715 O O   . HOH B 2 .  ? -14.544 -11.764 2.599  1.00 29.10 ? 2039 HOH A O   1 
HETATM 716 O O   . HOH B 2 .  ? -15.405 -6.566  1.159  1.00 25.07 ? 2040 HOH A O   1 
HETATM 717 O O   . HOH B 2 .  ? 18.106  -11.027 19.264 1.00 21.23 ? 2041 HOH A O   1 
HETATM 718 O O   . HOH B 2 .  ? -13.661 -10.997 10.496 1.00 16.30 ? 2042 HOH A O   1 
HETATM 719 O O   . HOH B 2 .  ? 7.258   -1.041  20.497 1.00 17.10 ? 2043 HOH A O   1 
HETATM 720 O O   . HOH B 2 .  ? -8.189  -14.510 7.062  1.00 21.00 ? 2044 HOH A O   1 
HETATM 721 O O   . HOH B 2 .  ? -15.355 -16.256 8.721  1.00 23.69 ? 2045 HOH A O   1 
HETATM 722 O O   . HOH B 2 .  ? -14.184 2.115   11.751 1.00 37.55 ? 2046 HOH A O   1 
HETATM 723 O O   . HOH B 2 .  ? -13.615 -19.013 10.243 1.00 33.78 ? 2047 HOH A O   1 
HETATM 724 O O   . HOH B 2 .  ? -9.144  -19.040 15.878 1.00 24.10 ? 2048 HOH A O   1 
HETATM 725 O O   . HOH B 2 .  ? -12.983 -11.496 12.953 1.00 23.27 ? 2049 HOH A O   1 
HETATM 726 O O   . HOH B 2 .  ? 5.287   8.372   16.021 1.00 19.58 ? 2050 HOH A O   1 
HETATM 727 O O   . HOH B 2 .  ? -9.783  -10.541 21.342 1.00 13.83 ? 2051 HOH A O   1 
HETATM 728 O O   . HOH B 2 .  ? -11.888 -8.403  16.943 1.00 17.83 ? 2052 HOH A O   1 
HETATM 729 O O   . HOH B 2 .  ? -6.952  -14.056 20.401 1.00 10.02 ? 2053 HOH A O   1 
HETATM 730 O O   . HOH B 2 .  ? -10.715 -13.607 21.220 1.00 16.07 ? 2054 HOH A O   1 
HETATM 731 O O   . HOH B 2 .  ? 11.418  7.605   18.309 1.00 15.48 ? 2055 HOH A O   1 
HETATM 732 O O   . HOH B 2 .  ? 10.521  -1.910  9.526  1.00 22.30 ? 2056 HOH A O   1 
HETATM 733 O O   . HOH B 2 .  ? 10.874  -0.678  4.811  1.00 30.23 ? 2057 HOH A O   1 
HETATM 734 O O   . HOH B 2 .  ? 9.266   -4.758  4.075  1.00 16.02 ? 2058 HOH A O   1 
HETATM 735 O O   . HOH B 2 .  ? 1.907   -0.844  7.023  1.00 22.71 ? 2059 HOH A O   1 
HETATM 736 O O   . HOH B 2 .  ? 3.676   -6.411  4.735  1.00 10.92 ? 2060 HOH A O   1 
HETATM 737 O O   . HOH B 2 .  ? 5.431   -13.277 6.148  1.00 21.24 ? 2061 HOH A O   1 
HETATM 738 O O   . HOH B 2 .  ? 0.785   -14.972 5.992  1.00 27.47 ? 2062 HOH A O   1 
HETATM 739 O O   . HOH B 2 .  ? -9.017  -20.528 20.384 1.00 24.03 ? 2063 HOH A O   1 
HETATM 740 O O   . HOH B 2 .  ? -9.760  -17.875 19.794 1.00 26.38 ? 2064 HOH A O   1 
HETATM 741 O O   . HOH B 2 .  ? -0.757  -11.911 23.545 1.00 12.61 ? 2065 HOH A O   1 
HETATM 742 O O   . HOH B 2 .  ? -2.566  -9.175  23.041 1.00 23.60 ? 2066 HOH A O   1 
HETATM 743 O O   . HOH B 2 .  ? -7.137  -20.244 22.011 1.00 18.16 ? 2067 HOH A O   1 
HETATM 744 O O   . HOH B 2 .  ? -7.758  -17.371 24.214 1.00 28.52 ? 2068 HOH A O   1 
HETATM 745 O O   . HOH B 2 .  ? -0.834  -15.160 25.011 1.00 16.99 ? 2069 HOH A O   1 
HETATM 746 O O   . HOH B 2 .  ? -8.386  -16.211 21.707 1.00 17.43 ? 2070 HOH A O   1 
HETATM 747 O O   . HOH B 2 .  ? 11.028  -14.390 21.886 1.00 18.64 ? 2071 HOH A O   1 
HETATM 748 O O   . HOH B 2 .  ? 5.849   -18.812 20.575 1.00 30.47 ? 2072 HOH A O   1 
HETATM 749 O O   . HOH B 2 .  ? 12.655  -16.258 15.639 1.00 27.72 ? 2073 HOH A O   1 
HETATM 750 O O   . HOH B 2 .  ? 10.258  -20.383 14.723 1.00 18.77 ? 2074 HOH A O   1 
HETATM 751 O O   . HOH B 2 .  ? -0.947  -21.408 16.944 1.00 11.32 ? 2075 HOH A O   1 
HETATM 752 O O   . HOH B 2 .  ? 0.531   -21.625 20.072 1.00 24.66 ? 2076 HOH A O   1 
HETATM 753 O O   . HOH B 2 .  ? 5.848   -16.847 8.830  1.00 18.08 ? 2077 HOH A O   1 
HETATM 754 O O   . HOH B 2 .  ? 9.470   -14.130 7.794  1.00 25.57 ? 2078 HOH A O   1 
HETATM 755 O O   . HOH B 2 .  ? 7.703   -20.463 12.061 1.00 11.04 ? 2079 HOH A O   1 
HETATM 756 O O   . HOH B 2 .  ? 14.584  -14.110 9.298  1.00 38.78 ? 2080 HOH A O   1 
HETATM 757 O O   . HOH B 2 .  ? 12.637  -18.028 7.813  1.00 36.53 ? 2081 HOH A O   1 
HETATM 758 O O   . HOH B 2 .  ? 15.807  -12.081 11.340 1.00 25.87 ? 2082 HOH A O   1 
HETATM 759 O O   . HOH B 2 .  ? 14.189  -13.138 19.819 1.00 26.86 ? 2083 HOH A O   1 
HETATM 760 O O   . HOH B 2 .  ? 15.763  -9.814  20.128 1.00 20.62 ? 2084 HOH A O   1 
HETATM 761 O O   . HOH B 2 .  ? 14.365  -15.109 17.191 1.00 30.97 ? 2085 HOH A O   1 
HETATM 762 O O   . HOH B 2 .  ? 16.066  -12.656 12.972 1.00 29.57 ? 2086 HOH A O   1 
HETATM 763 O O   . HOH B 2 .  ? 18.868  -10.176 14.457 1.00 21.46 ? 2087 HOH A O   1 
HETATM 764 O O   . HOH B 2 .  ? 16.830  -5.432  13.331 1.00 20.19 ? 2088 HOH A O   1 
HETATM 765 O O   . HOH B 2 .  ? 16.215  -9.710  13.457 1.00 19.42 ? 2089 HOH A O   1 
HETATM 766 O O   . HOH B 2 .  ? 18.857  -5.869  15.470 1.00 19.36 ? 2090 HOH A O   1 
HETATM 767 O O   . HOH B 2 .  ? 11.122  -5.084  20.869 1.00 20.97 ? 2091 HOH A O   1 
HETATM 768 O O   . HOH B 2 .  ? 13.384  -6.385  19.563 1.00 18.32 ? 2092 HOH A O   1 
HETATM 769 O O   . HOH B 2 .  ? 5.120   -8.322  23.987 1.00 17.18 ? 2093 HOH A O   1 
HETATM 770 O O   . HOH B 2 .  ? 6.588   -3.840  20.278 1.00 11.12 ? 2094 HOH A O   1 
HETATM 771 O O   . HOH B 2 .  ? 4.574   -4.043  22.246 1.00 26.62 ? 2095 HOH A O   1 
HETATM 772 O O   . HOH B 2 .  ? 1.108   -6.956  23.676 1.00 31.91 ? 2096 HOH A O   1 
HETATM 773 O O   . HOH B 2 .  ? -6.101  1.187   16.371 1.00 21.18 ? 2097 HOH A O   1 
HETATM 774 O O   . HOH B 2 .  ? -0.488  -3.891  20.472 1.00 15.45 ? 2098 HOH A O   1 
HETATM 775 O O   . HOH B 2 .  ? -4.895  -2.506  20.610 1.00 20.20 ? 2099 HOH A O   1 
HETATM 776 O O   . HOH B 2 .  ? -12.067 -6.763  21.613 1.00 24.47 ? 2100 HOH A O   1 
HETATM 777 O O   . HOH B 2 .  ? -11.924 -9.044  19.882 1.00 20.20 ? 2101 HOH A O   1 
HETATM 778 O O   . HOH B 2 .  ? -8.304  -1.169  18.025 1.00 20.95 ? 2102 HOH A O   1 
HETATM 779 O O   . HOH B 2 .  ? -13.211 -9.148  18.579 1.00 30.27 ? 2103 HOH A O   1 
HETATM 780 O O   . HOH B 2 .  ? -14.396 -3.745  11.690 1.00 27.19 ? 2104 HOH A O   1 
HETATM 781 O O   . HOH B 2 .  ? -13.735 -0.868  12.328 1.00 23.81 ? 2105 HOH A O   1 
HETATM 782 O O   . HOH B 2 .  ? 8.708   1.479   7.478  1.00 22.79 ? 2106 HOH A O   1 
HETATM 783 O O   . HOH B 2 .  ? 3.165   8.088   14.175 1.00 17.16 ? 2107 HOH A O   1 
HETATM 784 O O   . HOH B 2 .  ? 0.648   7.615   14.643 1.00 22.38 ? 2108 HOH A O   1 
HETATM 785 O O   . HOH B 2 .  ? 3.928   5.572   16.063 1.00 25.76 ? 2109 HOH A O   1 
HETATM 786 O O   . HOH B 2 .  ? -0.147  3.759   17.911 1.00 26.63 ? 2110 HOH A O   1 
HETATM 787 O O   . HOH B 2 .  ? 2.630   1.243   18.889 1.00 19.41 ? 2111 HOH A O   1 
HETATM 788 O O   . HOH B 2 .  ? -1.369  6.609   14.398 1.00 35.98 ? 2112 HOH A O   1 
HETATM 789 O O   . HOH B 2 .  ? 10.929  5.907   19.383 1.00 16.66 ? 2113 HOH A O   1 
HETATM 790 O O   . HOH B 2 .  ? 4.987   2.667   18.922 1.00 21.26 ? 2114 HOH A O   1 
HETATM 791 O O   . HOH B 2 .  ? 2.851   5.751   18.147 1.00 43.99 ? 2115 HOH A O   1 
HETATM 792 O O   . HOH B 2 .  ? 9.359   2.801   19.914 1.00 22.01 ? 2116 HOH A O   1 
HETATM 793 O O   . HOH B 2 .  ? 7.404   1.208   18.816 1.00 19.09 ? 2117 HOH A O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1   N N   A MET A 1  ? 0.0673 0.1377 0.1368 -0.0103 0.0059  -0.0002 0    MET A N   
2   N N   B MET A 1  ? 0.1178 0.1731 0.1633 0.0023  -0.0027 -0.0016 0    MET A N   
3   C CA  A MET A 1  ? 0.0936 0.1484 0.1286 -0.0074 0.0074  -0.0081 0    MET A CA  
4   C CA  B MET A 1  ? 0.1303 0.1793 0.1682 0.0000  0.0030  -0.0015 0    MET A CA  
5   C C   A MET A 1  ? 0.0928 0.1391 0.1156 -0.0093 0.0054  -0.0004 0    MET A C   
6   C C   B MET A 1  ? 0.1185 0.1646 0.1407 -0.0016 0.0017  0.0002  0    MET A C   
7   O O   A MET A 1  ? 0.0967 0.1403 0.1353 -0.0087 -0.0040 -0.0003 0    MET A O   
8   O O   B MET A 1  ? 0.1256 0.1668 0.1460 -0.0038 -0.0036 0.0020  0    MET A O   
9   C CB  A MET A 1  ? 0.1033 0.1451 0.1278 -0.0125 0.0056  -0.0064 0    MET A CB  
10  C CB  B MET A 1  ? 0.1699 0.2069 0.1892 0.0028  0.0004  0.0000  0    MET A CB  
11  C CG  A MET A 1  ? 0.1242 0.1556 0.1342 -0.0127 0.0018  -0.0102 0    MET A CG  
12  C CG  B MET A 1  ? 0.2101 0.2423 0.2260 -0.0068 -0.0014 -0.0031 0    MET A CG  
13  S SD  A MET A 1  ? 0.1434 0.1805 0.1433 -0.0232 0.0061  -0.0283 0    MET A SD  
14  S SD  B MET A 1  ? 0.2674 0.2826 0.2764 -0.0005 -0.0024 0.0079  0    MET A SD  
15  C CE  A MET A 1  ? 0.1697 0.1808 0.1704 -0.0167 0.0004  -0.0040 0    MET A CE  
16  C CE  B MET A 1  ? 0.2611 0.2788 0.2660 -0.0016 -0.0007 0.0034  0    MET A CE  
17  N N   . LEU A 2  ? 0.1096 0.1577 0.1340 -0.0047 0.0002  0.0020  1    LEU A N   
18  C CA  . LEU A 2  ? 0.0977 0.1531 0.1125 -0.0002 0.0026  0.0085  1    LEU A CA  
19  C C   . LEU A 2  ? 0.0944 0.1389 0.1218 -0.0024 -0.0087 0.0044  1    LEU A C   
20  O O   . LEU A 2  ? 0.1341 0.1445 0.1338 0.0042  0.0012  0.0145  1    LEU A O   
21  C CB  . LEU A 2  ? 0.1122 0.1605 0.1186 -0.0018 0.0025  0.0152  1    LEU A CB  
22  C CG  . LEU A 2  ? 0.1087 0.1674 0.0998 -0.0040 -0.0035 0.0029  1    LEU A CG  
23  C CD1 . LEU A 2  ? 0.1128 0.1789 0.1303 -0.0073 0.0057  -0.0124 1    LEU A CD1 
24  C CD2 . LEU A 2  ? 0.1292 0.1915 0.1183 0.0025  -0.0050 0.0118  1    LEU A CD2 
25  N N   A GLN A 3  ? 0.0888 0.1433 0.1065 0.0035  -0.0103 0.0157  2    GLN A N   
26  N N   B GLN A 3  ? 0.0962 0.1451 0.1194 0.0023  -0.0110 0.0181  2    GLN A N   
27  C CA  A GLN A 3  ? 0.1052 0.1325 0.1056 0.0032  -0.0048 0.0186  2    GLN A CA  
28  C CA  B GLN A 3  ? 0.1132 0.1359 0.1217 0.0008  -0.0056 0.0196  2    GLN A CA  
29  C C   A GLN A 3  ? 0.1066 0.1154 0.0946 -0.0030 -0.0024 0.0174  2    GLN A C   
30  C C   B GLN A 3  ? 0.1097 0.1176 0.1041 -0.0024 -0.0006 0.0224  2    GLN A C   
31  O O   A GLN A 3  ? 0.1120 0.0994 0.1101 -0.0059 0.0045  0.0138  2    GLN A O   
32  O O   B GLN A 3  ? 0.1149 0.1077 0.1094 -0.0004 0.0021  0.0239  2    GLN A O   
33  C CB  A GLN A 3  ? 0.1246 0.1448 0.1117 0.0066  -0.0084 0.0138  2    GLN A CB  
34  C CB  B GLN A 3  ? 0.1594 0.1608 0.1480 0.0047  -0.0058 0.0160  2    GLN A CB  
35  C CG  A GLN A 3  ? 0.1316 0.1503 0.1114 0.0012  -0.0101 0.0155  2    GLN A CG  
36  C CG  B GLN A 3  ? 0.1776 0.2081 0.1837 0.0001  -0.0028 0.0067  2    GLN A CG  
37  C CD  A GLN A 3  ? 0.1458 0.1582 0.1077 0.0009  -0.0106 0.0102  2    GLN A CD  
38  C CD  B GLN A 3  ? 0.2121 0.2238 0.2117 0.0021  -0.0024 0.0089  2    GLN A CD  
39  O OE1 A GLN A 3  ? 0.1558 0.1503 0.1094 0.0082  -0.0147 0.0098  2    GLN A OE1 
40  O OE1 B GLN A 3  ? 0.2273 0.2371 0.2195 -0.0036 -0.0050 0.0081  2    GLN A OE1 
41  N NE2 A GLN A 3  ? 0.1831 0.1786 0.1298 0.0022  -0.0020 0.0055  2    GLN A NE2 
42  N NE2 B GLN A 3  ? 0.2234 0.2387 0.2246 -0.0016 -0.0051 0.0032  2    GLN A NE2 
43  N N   . CYS A 4  ? 0.1073 0.1110 0.0830 -0.0007 -0.0070 0.0234  3    CYS A N   
44  C CA  . CYS A 4  ? 0.0957 0.1044 0.0857 -0.0040 -0.0016 0.0185  3    CYS A CA  
45  C C   . CYS A 4  ? 0.0985 0.1076 0.0669 -0.0091 -0.0087 0.0067  3    CYS A C   
46  O O   . CYS A 4  ? 0.1087 0.1305 0.0697 -0.0228 -0.0045 -0.0013 3    CYS A O   
47  C CB  . CYS A 4  ? 0.0971 0.1159 0.0696 -0.0009 0.0024  0.0209  3    CYS A CB  
48  S SG  . CYS A 4  ? 0.1027 0.1121 0.0757 -0.0096 -0.0068 0.0251  3    CYS A SG  
49  N N   . TYR A 5  ? 0.0963 0.1099 0.0480 -0.0142 -0.0086 0.0107  4    TYR A N   
50  C CA  . TYR A 5  ? 0.1066 0.1084 0.0488 -0.0142 -0.0033 0.0102  4    TYR A CA  
51  C C   . TYR A 5  ? 0.0975 0.1066 0.0334 -0.0098 0.0000  -0.0033 4    TYR A C   
52  O O   . TYR A 5  ? 0.1085 0.1094 0.0443 0.0027  -0.0169 -0.0009 4    TYR A O   
53  C CB  . TYR A 5  ? 0.1268 0.1060 0.0660 -0.0187 0.0027  0.0097  4    TYR A CB  
54  C CG  . TYR A 5  ? 0.1308 0.1179 0.0668 -0.0180 0.0033  0.0075  4    TYR A CG  
55  C CD1 . TYR A 5  ? 0.1460 0.1117 0.0623 -0.0117 0.0034  0.0058  4    TYR A CD1 
56  C CD2 . TYR A 5  ? 0.1327 0.1165 0.0920 -0.0188 0.0013  -0.0052 4    TYR A CD2 
57  C CE1 . TYR A 5  ? 0.1639 0.1208 0.1017 -0.0087 0.0041  0.0072  4    TYR A CE1 
58  C CE2 . TYR A 5  ? 0.1573 0.1283 0.1062 -0.0190 0.0016  0.0000  4    TYR A CE2 
59  C CZ  . TYR A 5  ? 0.1601 0.1096 0.1058 -0.0036 0.0101  0.0055  4    TYR A CZ  
60  O OH  . TYR A 5  ? 0.1928 0.1211 0.1418 -0.0018 0.0073  0.0123  4    TYR A OH  
61  N N   . ASN A 6  ? 0.1126 0.1105 0.0423 -0.0054 -0.0033 -0.0143 5    ASN A N   
62  C CA  . ASN A 6  ? 0.1197 0.1302 0.0503 -0.0053 -0.0027 -0.0071 5    ASN A CA  
63  C C   . ASN A 6  ? 0.1371 0.1473 0.0355 -0.0076 -0.0175 -0.0202 5    ASN A C   
64  O O   . ASN A 6  ? 0.1609 0.2055 0.0612 0.0009  -0.0189 -0.0339 5    ASN A O   
65  C CB  . ASN A 6  ? 0.1439 0.1307 0.0905 -0.0098 -0.0083 -0.0086 5    ASN A CB  
66  C CG  . ASN A 6  ? 0.1791 0.1227 0.0939 -0.0203 -0.0113 -0.0216 5    ASN A CG  
67  O OD1 . ASN A 6  ? 0.1877 0.1357 0.1026 -0.0094 -0.0133 -0.0068 5    ASN A OD1 
68  N ND2 . ASN A 6  ? 0.2492 0.1852 0.1426 -0.0058 -0.0073 -0.0317 5    ASN A ND2 
69  N N   . CYS A 7  ? 0.1331 0.1536 0.0542 0.0067  0.0122  -0.0273 6    CYS A N   
70  C CA  . CYS A 7  ? 0.1612 0.1518 0.0895 -0.0045 0.0124  -0.0229 6    CYS A CA  
71  C C   . CYS A 7  ? 0.1579 0.1392 0.0776 -0.0092 0.0288  -0.0344 6    CYS A C   
72  O O   . CYS A 7  ? 0.1633 0.1475 0.1099 0.0025  0.0167  -0.0439 6    CYS A O   
73  C CB  . CYS A 7  ? 0.1739 0.1515 0.0952 -0.0050 0.0210  -0.0014 6    CYS A CB  
74  S SG  . CYS A 7  ? 0.2017 0.1805 0.0928 -0.0134 0.0094  -0.0026 6    CYS A SG  
75  N N   . PRO A 8  ? 0.1942 0.1567 0.1106 -0.0056 0.0223  -0.0396 7    PRO A N   
76  C CA  . PRO A 8  ? 0.1973 0.1531 0.1441 -0.0019 0.0195  -0.0396 7    PRO A CA  
77  C C   . PRO A 8  ? 0.1926 0.1590 0.1426 0.0034  0.0275  -0.0373 7    PRO A C   
78  O O   . PRO A 8  ? 0.1979 0.1688 0.1813 -0.0081 0.0301  -0.0310 7    PRO A O   
79  C CB  . PRO A 8  ? 0.2155 0.1789 0.1644 -0.0028 0.0143  -0.0407 7    PRO A CB  
80  C CG  . PRO A 8  ? 0.2253 0.1872 0.1518 -0.0040 0.0092  -0.0409 7    PRO A CG  
81  C CD  . PRO A 8  ? 0.2247 0.1941 0.1051 -0.0019 0.0142  -0.0395 7    PRO A CD  
82  N N   . ASN A 9  ? 0.1853 0.1383 0.1475 0.0096  0.0305  -0.0426 8    ASN A N   
83  C CA  . ASN A 9  ? 0.1889 0.1590 0.1729 0.0103  0.0282  -0.0263 8    ASN A CA  
84  C C   . ASN A 9  ? 0.1765 0.1468 0.1647 0.0102  0.0282  -0.0158 8    ASN A C   
85  O O   . ASN A 9  ? 0.1758 0.1516 0.1851 0.0176  0.0305  -0.0122 8    ASN A O   
86  C CB  . ASN A 9  ? 0.2116 0.1916 0.1659 0.0109  0.0221  -0.0356 8    ASN A CB  
87  C CG  . ASN A 9  ? 0.2241 0.2011 0.1756 0.0075  0.0162  -0.0216 8    ASN A CG  
88  O OD1 . ASN A 9  ? 0.2347 0.2202 0.1952 0.0184  0.0314  -0.0314 8    ASN A OD1 
89  N ND2 . ASN A 9  ? 0.2135 0.1819 0.1748 0.0126  0.0278  -0.0281 8    ASN A ND2 
90  N N   . PRO A 10 ? 0.1778 0.1340 0.1565 0.0141  0.0300  -0.0180 9    PRO A N   
91  C CA  . PRO A 10 ? 0.1808 0.1403 0.1405 0.0089  0.0251  -0.0155 9    PRO A CA  
92  C C   . PRO A 10 ? 0.1701 0.1459 0.1175 0.0066  0.0375  -0.0208 9    PRO A C   
93  O O   . PRO A 10 ? 0.1858 0.1777 0.1186 0.0082  0.0445  -0.0308 9    PRO A O   
94  C CB  . PRO A 10 ? 0.1993 0.1651 0.1846 0.0042  0.0071  -0.0095 9    PRO A CB  
95  C CG  . PRO A 10 ? 0.1963 0.1716 0.1927 0.0079  0.0157  -0.0084 9    PRO A CG  
96  C CD  . PRO A 10 ? 0.1938 0.1588 0.1750 0.0117  0.0129  -0.0059 9    PRO A CD  
97  N N   . THR A 11 ? 0.1776 0.1413 0.1156 -0.0003 0.0372  -0.0026 10   THR A N   
98  C CA  . THR A 11 ? 0.2039 0.1591 0.1690 0.0019  0.0178  0.0094  10   THR A CA  
99  C C   . THR A 11 ? 0.1776 0.1538 0.1370 -0.0054 0.0208  0.0131  10   THR A C   
100 O O   . THR A 11 ? 0.1802 0.1520 0.1212 0.0062  0.0192  0.0047  10   THR A O   
101 C CB  . THR A 11 ? 0.2229 0.1801 0.1846 -0.0024 -0.0004 0.0099  10   THR A CB  
102 O OG1 . THR A 11 ? 0.2488 0.2087 0.2333 -0.0107 -0.0007 0.0017  10   THR A OG1 
103 C CG2 . THR A 11 ? 0.2275 0.2030 0.2051 0.0007  -0.0067 0.0112  10   THR A CG2 
104 N N   . ALA A 12 ? 0.1708 0.1676 0.1413 -0.0081 0.0355  0.0132  11   ALA A N   
105 C CA  . ALA A 12 ? 0.1603 0.1784 0.1673 -0.0087 0.0255  0.0094  11   ALA A CA  
106 C C   . ALA A 12 ? 0.1541 0.1518 0.1442 -0.0111 0.0241  0.0145  11   ALA A C   
107 O O   . ALA A 12 ? 0.1540 0.1742 0.1646 -0.0127 0.0175  0.0025  11   ALA A O   
108 C CB  . ALA A 12 ? 0.1747 0.1884 0.1903 -0.0100 0.0300  0.0109  11   ALA A CB  
109 N N   . ASP A 13 ? 0.1475 0.1416 0.1302 -0.0094 0.0276  0.0134  12   ASP A N   
110 C CA  . ASP A 13 ? 0.1585 0.1529 0.1424 -0.0065 0.0240  0.0002  12   ASP A CA  
111 C C   . ASP A 13 ? 0.1557 0.1472 0.1215 -0.0044 0.0068  0.0015  12   ASP A C   
112 O O   . ASP A 13 ? 0.1796 0.1668 0.1236 -0.0114 0.0064  0.0081  12   ASP A O   
113 C CB  . ASP A 13 ? 0.1971 0.1835 0.2057 0.0006  0.0160  0.0051  12   ASP A CB  
114 C CG  . ASP A 13 ? 0.2214 0.1946 0.2036 0.0002  0.0176  -0.0103 12   ASP A CG  
115 O OD1 . ASP A 13 ? 0.2477 0.2134 0.2306 0.0052  0.0258  -0.0025 12   ASP A OD1 
116 O OD2 . ASP A 13 ? 0.2265 0.2051 0.2062 0.0020  0.0192  -0.0214 12   ASP A OD2 
117 N N   . CYS A 14 ? 0.1514 0.1402 0.1058 -0.0165 0.0157  0.0001  13   CYS A N   
118 C CA  . CYS A 14 ? 0.1421 0.1477 0.0687 -0.0184 0.0065  0.0000  13   CYS A CA  
119 C C   . CYS A 14 ? 0.1587 0.1497 0.1142 -0.0147 0.0055  -0.0045 13   CYS A C   
120 O O   . CYS A 14 ? 0.1669 0.1797 0.1530 -0.0018 0.0103  -0.0167 13   CYS A O   
121 C CB  . CYS A 14 ? 0.1532 0.1365 0.0905 -0.0236 0.0049  0.0084  13   CYS A CB  
122 S SG  . CYS A 14 ? 0.1617 0.1591 0.0862 -0.0293 0.0187  0.0002  13   CYS A SG  
123 N N   . LYS A 15 ? 0.1647 0.1576 0.1288 -0.0047 -0.0083 0.0083  14   LYS A N   
124 C CA  . LYS A 15 ? 0.1786 0.1819 0.1647 -0.0053 -0.0109 0.0114  14   LYS A CA  
125 C C   . LYS A 15 ? 0.1814 0.1962 0.1667 -0.0090 -0.0129 0.0121  14   LYS A C   
126 O O   . LYS A 15 ? 0.1945 0.2222 0.2116 -0.0072 -0.0127 0.0176  14   LYS A O   
127 C CB  . LYS A 15 ? 0.2100 0.2006 0.1919 -0.0033 -0.0030 0.0142  14   LYS A CB  
128 C CG  A LYS A 15 ? 0.2253 0.2140 0.2166 -0.0042 -0.0032 0.0112  14   LYS A CG  
129 C CG  B LYS A 15 ? 0.2050 0.1990 0.1937 -0.0002 -0.0018 0.0072  14   LYS A CG  
130 C CD  A LYS A 15 ? 0.2444 0.2321 0.2253 -0.0054 -0.0012 0.0120  14   LYS A CD  
131 C CD  B LYS A 15 ? 0.2103 0.2059 0.1967 -0.0003 -0.0017 0.0009  14   LYS A CD  
132 C CE  A LYS A 15 ? 0.2535 0.2521 0.2474 -0.0026 -0.0006 0.0063  14   LYS A CE  
133 C CE  B LYS A 15 ? 0.2115 0.2005 0.1948 0.0001  -0.0008 -0.0013 14   LYS A CE  
134 N NZ  A LYS A 15 ? 0.2670 0.2712 0.2583 -0.0035 -0.0009 0.0056  14   LYS A NZ  
135 N NZ  B LYS A 15 ? 0.2107 0.1923 0.1833 -0.0006 -0.0051 -0.0015 14   LYS A NZ  
136 N N   . THR A 16 ? 0.1665 0.1854 0.1057 -0.0187 -0.0104 0.0096  15   THR A N   
137 C CA  . THR A 16 ? 0.1772 0.1989 0.1100 -0.0192 -0.0148 -0.0004 15   THR A CA  
138 C C   . THR A 16 ? 0.1827 0.1920 0.0763 -0.0157 -0.0138 0.0043  15   THR A C   
139 O O   . THR A 16 ? 0.2160 0.2001 0.0614 -0.0027 -0.0311 0.0075  15   THR A O   
140 C CB  . THR A 16 ? 0.1895 0.2041 0.1219 -0.0242 -0.0079 -0.0098 15   THR A CB  
141 O OG1 . THR A 16 ? 0.2068 0.2424 0.1860 -0.0257 0.0139  -0.0046 15   THR A OG1 
142 C CG2 . THR A 16 ? 0.1945 0.2124 0.1360 -0.0277 0.0029  -0.0074 15   THR A CG2 
143 N N   . ALA A 17 ? 0.1787 0.2162 0.0699 -0.0149 -0.0038 0.0171  16   ALA A N   
144 C CA  . ALA A 17 ? 0.1791 0.2191 0.0879 -0.0242 -0.0031 0.0055  16   ALA A CA  
145 C C   . ALA A 17 ? 0.1686 0.2187 0.0807 -0.0239 -0.0203 0.0035  16   ALA A C   
146 O O   . ALA A 17 ? 0.2004 0.2624 0.0870 -0.0295 -0.0334 -0.0031 16   ALA A O   
147 C CB  . ALA A 17 ? 0.2102 0.2365 0.1264 -0.0087 -0.0025 0.0082  16   ALA A CB  
148 N N   . VAL A 18 ? 0.1364 0.2159 0.0832 -0.0320 -0.0160 0.0014  17   VAL A N   
149 C CA  . VAL A 18 ? 0.1542 0.1961 0.1022 -0.0261 -0.0127 -0.0047 17   VAL A CA  
150 C C   . VAL A 18 ? 0.1414 0.1821 0.1099 -0.0262 -0.0140 -0.0101 17   VAL A C   
151 O O   . VAL A 18 ? 0.1547 0.2174 0.0894 -0.0382 0.0034  -0.0151 17   VAL A O   
152 C CB  . VAL A 18 ? 0.1843 0.2096 0.1466 -0.0135 -0.0008 -0.0071 17   VAL A CB  
153 C CG1 . VAL A 18 ? 0.1932 0.2328 0.1619 -0.0107 -0.0001 0.0000  17   VAL A CG1 
154 C CG2 . VAL A 18 ? 0.1975 0.2366 0.1768 -0.0143 -0.0073 0.0007  17   VAL A CG2 
155 N N   . ASN A 19 ? 0.1247 0.1582 0.1099 -0.0212 -0.0184 0.0023  18   ASN A N   
156 C CA  . ASN A 19 ? 0.1382 0.1629 0.1378 -0.0100 -0.0175 0.0068  18   ASN A CA  
157 C C   . ASN A 19 ? 0.1567 0.1491 0.1413 -0.0071 -0.0166 0.0084  18   ASN A C   
158 O O   . ASN A 19 ? 0.2081 0.1736 0.1612 -0.0026 -0.0233 0.0015  18   ASN A O   
159 C CB  . ASN A 19 ? 0.1437 0.1732 0.1729 -0.0113 -0.0201 0.0002  18   ASN A CB  
160 C CG  . ASN A 19 ? 0.1537 0.1822 0.1752 -0.0071 -0.0239 -0.0017 18   ASN A CG  
161 O OD1 . ASN A 19 ? 0.1602 0.1841 0.2093 0.0004  -0.0206 -0.0024 18   ASN A OD1 
162 N ND2 . ASN A 19 ? 0.1885 0.2146 0.1799 -0.0012 -0.0411 0.0005  18   ASN A ND2 
163 N N   . CYS A 20 ? 0.1279 0.1415 0.1335 -0.0089 -0.0168 0.0196  19   CYS A N   
164 C CA  . CYS A 20 ? 0.1441 0.1447 0.1529 -0.0102 -0.0235 0.0102  19   CYS A CA  
165 C C   . CYS A 20 ? 0.1485 0.1559 0.1547 -0.0063 -0.0256 0.0150  19   CYS A C   
166 O O   . CYS A 20 ? 0.1399 0.1762 0.1815 -0.0097 -0.0204 0.0246  19   CYS A O   
167 C CB  . CYS A 20 ? 0.1270 0.1393 0.1473 -0.0142 -0.0238 0.0070  19   CYS A CB  
168 S SG  . CYS A 20 ? 0.1261 0.1366 0.1566 -0.0079 -0.0207 0.0013  19   CYS A SG  
169 N N   . SER A 21 ? 0.1661 0.1578 0.1705 -0.0168 -0.0280 0.0163  20   SER A N   
170 C CA  . SER A 21 ? 0.2006 0.1796 0.1866 -0.0199 -0.0224 0.0183  20   SER A CA  
171 C C   . SER A 21 ? 0.1799 0.1712 0.1863 -0.0166 -0.0321 0.0210  20   SER A C   
172 O O   . SER A 21 ? 0.1787 0.1592 0.1707 -0.0188 -0.0464 0.0197  20   SER A O   
173 C CB  . SER A 21 ? 0.2253 0.2118 0.2118 -0.0005 -0.0205 0.0152  20   SER A CB  
174 O OG  . SER A 21 ? 0.2296 0.2625 0.2016 0.0127  -0.0269 0.0108  20   SER A OG  
175 N N   . SER A 22 ? 0.1639 0.1767 0.2009 -0.0172 -0.0364 0.0194  21   SER A N   
176 C CA  . SER A 22 ? 0.1752 0.1915 0.2220 -0.0053 -0.0212 0.0118  21   SER A CA  
177 C C   . SER A 22 ? 0.1633 0.1811 0.2097 -0.0085 -0.0162 0.0147  21   SER A C   
178 O O   . SER A 22 ? 0.1606 0.1963 0.2204 0.0053  -0.0066 0.0166  21   SER A O   
179 C CB  . SER A 22 ? 0.1945 0.2215 0.2453 -0.0085 -0.0216 0.0039  21   SER A CB  
180 O OG  . SER A 22 ? 0.2357 0.2368 0.2779 -0.0229 -0.0281 0.0088  21   SER A OG  
181 N N   . ASP A 23 ? 0.1610 0.1649 0.2020 -0.0074 -0.0194 0.0153  22   ASP A N   
182 C CA  . ASP A 23 ? 0.1593 0.1742 0.1816 0.0001  -0.0147 0.0142  22   ASP A CA  
183 C C   . ASP A 23 ? 0.1449 0.1671 0.1554 0.0012  -0.0098 0.0147  22   ASP A C   
184 O O   . ASP A 23 ? 0.1697 0.1974 0.1730 -0.0004 -0.0171 0.0329  22   ASP A O   
185 C CB  . ASP A 23 ? 0.1797 0.1785 0.2148 0.0063  -0.0093 0.0079  22   ASP A CB  
186 C CG  . ASP A 23 ? 0.1852 0.1946 0.2400 0.0028  -0.0032 0.0078  22   ASP A CG  
187 O OD1 . ASP A 23 ? 0.1950 0.2091 0.2831 -0.0102 -0.0059 0.0033  22   ASP A OD1 
188 O OD2 . ASP A 23 ? 0.1997 0.2059 0.2625 0.0076  -0.0057 0.0003  22   ASP A OD2 
189 N N   A PHE A 24 ? 0.1309 0.1533 0.1356 -0.0015 -0.0086 0.0096  23   PHE A N   
190 N N   B PHE A 24 ? 0.1394 0.1596 0.1420 0.0003  -0.0074 0.0099  23   PHE A N   
191 C CA  A PHE A 24 ? 0.1178 0.1320 0.1031 0.0051  -0.0065 0.0081  23   PHE A CA  
192 C CA  B PHE A 24 ? 0.1352 0.1485 0.1153 0.0047  -0.0055 0.0071  23   PHE A CA  
193 C C   A PHE A 24 ? 0.1095 0.1337 0.1057 0.0067  -0.0045 0.0105  23   PHE A C   
194 C C   B PHE A 24 ? 0.1289 0.1489 0.1171 0.0079  -0.0063 0.0086  23   PHE A C   
195 O O   A PHE A 24 ? 0.1099 0.1296 0.1042 -0.0039 -0.0016 0.0210  23   PHE A O   
196 O O   B PHE A 24 ? 0.1507 0.1672 0.1273 0.0118  -0.0119 0.0192  23   PHE A O   
197 C CB  A PHE A 24 ? 0.1243 0.1280 0.0933 0.0026  -0.0053 -0.0004 23   PHE A CB  
198 C CB  B PHE A 24 ? 0.1436 0.1466 0.1102 0.0030  -0.0030 0.0018  23   PHE A CB  
199 C CG  A PHE A 24 ? 0.1168 0.1091 0.0966 -0.0049 -0.0086 0.0026  23   PHE A CG  
200 C CG  B PHE A 24 ? 0.1432 0.1468 0.1263 -0.0034 0.0018  -0.0057 23   PHE A CG  
201 C CD1 A PHE A 24 ? 0.1056 0.1141 0.0842 -0.0043 -0.0014 0.0126  23   PHE A CD1 
202 C CD1 B PHE A 24 ? 0.1470 0.1406 0.1201 0.0013  -0.0027 -0.0032 23   PHE A CD1 
203 C CD2 A PHE A 24 ? 0.1252 0.1160 0.1086 -0.0073 -0.0083 -0.0039 23   PHE A CD2 
204 C CD2 B PHE A 24 ? 0.1555 0.1599 0.1421 -0.0008 0.0001  -0.0116 23   PHE A CD2 
205 C CE1 A PHE A 24 ? 0.1132 0.1235 0.1224 -0.0020 0.0019  0.0116  23   PHE A CE1 
206 C CE1 B PHE A 24 ? 0.1468 0.1433 0.1324 0.0004  -0.0013 -0.0053 23   PHE A CE1 
207 C CE2 A PHE A 24 ? 0.1353 0.1311 0.1225 0.0040  -0.0069 -0.0077 23   PHE A CE2 
208 C CE2 B PHE A 24 ? 0.1520 0.1587 0.1440 -0.0054 0.0037  -0.0121 23   PHE A CE2 
209 C CZ  A PHE A 24 ? 0.1271 0.1236 0.1232 -0.0031 -0.0032 0.0000  23   PHE A CZ  
210 C CZ  B PHE A 24 ? 0.1539 0.1574 0.1346 0.0031  -0.0034 -0.0105 23   PHE A CZ  
211 N N   . ASP A 25 ? 0.1015 0.1206 0.0997 -0.0041 -0.0019 0.0074  24   ASP A N   
212 C CA  . ASP A 25 ? 0.1112 0.1247 0.1190 -0.0001 0.0116  0.0053  24   ASP A CA  
213 C C   . ASP A 25 ? 0.1176 0.1087 0.0894 0.0035  0.0236  0.0079  24   ASP A C   
214 O O   . ASP A 25 ? 0.1261 0.1219 0.1077 0.0121  0.0283  -0.0061 24   ASP A O   
215 C CB  . ASP A 25 ? 0.1240 0.1372 0.1264 0.0005  0.0148  0.0137  24   ASP A CB  
216 C CG  . ASP A 25 ? 0.1315 0.1390 0.0943 0.0011  0.0192  0.0145  24   ASP A CG  
217 O OD1 . ASP A 25 ? 0.1335 0.1389 0.0834 0.0101  0.0085  0.0060  24   ASP A OD1 
218 O OD2 . ASP A 25 ? 0.1624 0.1799 0.1280 0.0038  0.0361  0.0325  24   ASP A OD2 
219 N N   . ALA A 26 ? 0.1081 0.0947 0.0821 0.0015  0.0176  0.0055  25   ALA A N   
220 C CA  . ALA A 26 ? 0.1124 0.1033 0.0557 0.0008  0.0182  -0.0001 25   ALA A CA  
221 C C   . ALA A 26 ? 0.0901 0.1040 0.0473 0.0103  0.0052  -0.0006 25   ALA A C   
222 O O   . ALA A 26 ? 0.1318 0.0918 0.0489 0.0092  0.0256  0.0029  25   ALA A O   
223 C CB  . ALA A 26 ? 0.1240 0.1261 0.0510 -0.0104 0.0037  0.0107  25   ALA A CB  
224 N N   . CYS A 27 ? 0.0919 0.0930 0.0481 0.0094  0.0017  0.0105  26   CYS A N   
225 C CA  . CYS A 27 ? 0.0890 0.1036 0.0441 0.0045  -0.0011 0.0153  26   CYS A CA  
226 C C   . CYS A 27 ? 0.0949 0.0974 0.0400 -0.0012 -0.0019 0.0100  26   CYS A C   
227 O O   . CYS A 27 ? 0.0980 0.1399 0.0659 0.0075  0.0008  -0.0206 26   CYS A O   
228 C CB  . CYS A 27 ? 0.0933 0.1080 0.0737 -0.0057 -0.0209 0.0186  26   CYS A CB  
229 S SG  . CYS A 27 ? 0.0992 0.1178 0.0757 0.0018  -0.0069 0.0183  26   CYS A SG  
230 N N   . LEU A 28 ? 0.0849 0.0896 0.0398 0.0033  0.0015  0.0102  27   LEU A N   
231 C CA  . LEU A 28 ? 0.0906 0.0837 0.0344 0.0004  -0.0023 0.0112  27   LEU A CA  
232 C C   . LEU A 28 ? 0.0867 0.0795 0.0284 -0.0005 0.0030  0.0025  27   LEU A C   
233 O O   . LEU A 28 ? 0.0904 0.0791 0.0260 0.0048  -0.0004 0.0059  27   LEU A O   
234 C CB  . LEU A 28 ? 0.0999 0.0797 0.0516 0.0009  -0.0079 0.0065  27   LEU A CB  
235 C CG  . LEU A 28 ? 0.1010 0.0794 0.0515 -0.0002 -0.0083 0.0053  27   LEU A CG  
236 C CD1 . LEU A 28 ? 0.1258 0.1103 0.0533 -0.0100 -0.0128 0.0146  27   LEU A CD1 
237 C CD2 . LEU A 28 ? 0.1167 0.0871 0.0961 -0.0004 -0.0054 0.0015  27   LEU A CD2 
238 N N   . ILE A 29 ? 0.0781 0.0778 0.0319 -0.0021 0.0055  0.0073  28   ILE A N   
239 C CA  . ILE A 29 ? 0.0954 0.0823 0.0263 -0.0037 -0.0003 0.0019  28   ILE A CA  
240 C C   . ILE A 29 ? 0.0909 0.0833 0.0388 -0.0015 0.0007  -0.0001 28   ILE A C   
241 O O   . ILE A 29 ? 0.1020 0.1080 0.0261 0.0059  -0.0079 -0.0014 28   ILE A O   
242 C CB  . ILE A 29 ? 0.1030 0.0785 0.0521 -0.0032 0.0030  0.0108  28   ILE A CB  
243 C CG1 . ILE A 29 ? 0.1159 0.0973 0.0660 -0.0013 0.0067  0.0036  28   ILE A CG1 
244 C CG2 . ILE A 29 ? 0.1284 0.0719 0.0538 0.0000  0.0034  0.0068  28   ILE A CG2 
245 C CD1 . ILE A 29 ? 0.1312 0.1100 0.1090 0.0063  0.0204  0.0208  28   ILE A CD1 
246 N N   . THR A 30 ? 0.0815 0.0978 0.0505 -0.0023 -0.0028 0.0078  29   THR A N   
247 C CA  . THR A 30 ? 0.0940 0.1165 0.0683 0.0014  -0.0031 0.0112  29   THR A CA  
248 C C   . THR A 30 ? 0.0800 0.1032 0.0497 0.0040  -0.0053 0.0095  29   THR A C   
249 O O   . THR A 30 ? 0.1013 0.1435 0.0446 -0.0109 -0.0068 -0.0062 29   THR A O   
250 C CB  . THR A 30 ? 0.1066 0.1426 0.1266 0.0034  -0.0257 0.0498  29   THR A CB  
251 O OG1 . THR A 30 ? 0.1428 0.1726 0.1452 0.0037  -0.0001 0.0290  29   THR A OG1 
252 C CG2 . THR A 30 ? 0.1144 0.1601 0.1750 -0.0083 -0.0303 0.0525  29   THR A CG2 
253 N N   . LYS A 31 ? 0.0827 0.1038 0.0607 0.0014  -0.0040 -0.0003 30   LYS A N   
254 C CA  . LYS A 31 ? 0.0985 0.1084 0.0720 0.0035  -0.0051 0.0037  30   LYS A CA  
255 C C   . LYS A 31 ? 0.1026 0.1055 0.0650 -0.0063 -0.0015 0.0083  30   LYS A C   
256 O O   . LYS A 31 ? 0.1089 0.1128 0.0680 -0.0022 -0.0079 -0.0002 30   LYS A O   
257 C CB  . LYS A 31 ? 0.1121 0.1106 0.0750 0.0007  -0.0056 0.0081  30   LYS A CB  
258 C CG  . LYS A 31 ? 0.1212 0.1117 0.0768 0.0084  -0.0120 0.0016  30   LYS A CG  
259 C CD  . LYS A 31 ? 0.1209 0.1148 0.1078 0.0087  -0.0185 0.0020  30   LYS A CD  
260 C CE  . LYS A 31 ? 0.1311 0.1233 0.1310 0.0099  -0.0105 0.0121  30   LYS A CE  
261 N NZ  . LYS A 31 ? 0.1449 0.1213 0.1387 0.0019  -0.0141 0.0117  30   LYS A NZ  
262 N N   . ALA A 32 ? 0.1025 0.1475 0.0945 0.0169  0.0014  0.0105  31   ALA A N   
263 C CA  . ALA A 32 ? 0.1177 0.1626 0.1126 0.0194  0.0078  0.0040  31   ALA A CA  
264 C C   . ALA A 32 ? 0.1147 0.1689 0.1216 0.0115  0.0035  0.0019  31   ALA A C   
265 O O   . ALA A 32 ? 0.1040 0.1710 0.1227 0.0068  0.0165  0.0050  31   ALA A O   
266 C CB  . ALA A 32 ? 0.1308 0.1664 0.1165 0.0143  0.0104  0.0135  31   ALA A CB  
267 N N   . GLY A 33 ? 0.1767 0.1810 0.1427 0.0020  0.0088  -0.0072 32   GLY A N   
268 C CA  . GLY A 33 ? 0.1836 0.2028 0.1606 -0.0083 0.0067  -0.0071 32   GLY A CA  
269 C C   . GLY A 33 ? 0.2030 0.2046 0.1665 0.0005  0.0144  0.0015  32   GLY A C   
270 O O   . GLY A 33 ? 0.2381 0.2454 0.2039 0.0129  0.0200  0.0025  32   GLY A O   
271 N N   . LEU A 34 ? 0.1908 0.1986 0.1550 -0.0082 0.0176  0.0001  33   LEU A N   
272 C CA  . LEU A 34 ? 0.1785 0.2058 0.1675 -0.0022 0.0217  0.0150  33   LEU A CA  
273 C C   . LEU A 34 ? 0.1632 0.2200 0.1589 0.0003  0.0145  0.0198  33   LEU A C   
274 O O   . LEU A 34 ? 0.1658 0.2465 0.1964 0.0026  0.0041  0.0300  33   LEU A O   
275 C CB  . LEU A 34 ? 0.2057 0.2205 0.1997 -0.0075 0.0260  0.0129  33   LEU A CB  
276 C CG  . LEU A 34 ? 0.2264 0.2343 0.2351 -0.0085 0.0109  0.0060  33   LEU A CG  
277 C CD1 . LEU A 34 ? 0.2396 0.2535 0.2479 -0.0138 0.0158  0.0057  33   LEU A CD1 
278 C CD2 . LEU A 34 ? 0.2434 0.2419 0.2513 -0.0055 0.0104  0.0049  33   LEU A CD2 
279 N N   . GLN A 35 ? 0.1215 0.2025 0.1257 0.0016  0.0168  0.0101  34   GLN A N   
280 C CA  . GLN A 35 ? 0.1139 0.2134 0.1080 0.0035  0.0110  0.0104  34   GLN A CA  
281 C C   . GLN A 35 ? 0.1061 0.2030 0.0638 0.0047  0.0090  0.0140  34   GLN A C   
282 O O   . GLN A 35 ? 0.1249 0.2883 0.0850 0.0184  0.0038  0.0001  34   GLN A O   
283 C CB  . GLN A 35 ? 0.1200 0.2018 0.1278 -0.0007 0.0125  -0.0058 34   GLN A CB  
284 C CG  . GLN A 35 ? 0.1348 0.1950 0.1346 -0.0041 0.0105  -0.0095 34   GLN A CG  
285 C CD  . GLN A 35 ? 0.1412 0.1994 0.1349 -0.0009 0.0004  -0.0017 34   GLN A CD  
286 O OE1 . GLN A 35 ? 0.1296 0.1974 0.1363 -0.0121 0.0078  -0.0002 34   GLN A OE1 
287 N NE2 . GLN A 35 ? 0.1519 0.2117 0.1538 0.0002  0.0078  -0.0003 34   GLN A NE2 
288 N N   . VAL A 36 ? 0.0926 0.1685 0.0629 0.0017  0.0128  0.0162  35   VAL A N   
289 C CA  . VAL A 36 ? 0.0915 0.1340 0.0484 -0.0043 0.0148  0.0045  35   VAL A CA  
290 C C   . VAL A 36 ? 0.0997 0.1142 0.0446 0.0050  0.0124  0.0036  35   VAL A C   
291 O O   . VAL A 36 ? 0.1133 0.1388 0.0436 0.0023  0.0177  0.0011  35   VAL A O   
292 C CB  . VAL A 36 ? 0.1013 0.1288 0.0725 -0.0143 0.0087  0.0002  35   VAL A CB  
293 C CG1 . VAL A 36 ? 0.1095 0.1369 0.0812 -0.0001 0.0105  -0.0045 35   VAL A CG1 
294 C CG2 . VAL A 36 ? 0.1282 0.1413 0.0987 -0.0148 0.0069  0.0014  35   VAL A CG2 
295 N N   . TYR A 37 ? 0.0897 0.1130 0.0588 0.0004  0.0100  0.0057  36   TYR A N   
296 C CA  . TYR A 37 ? 0.0981 0.1044 0.0472 0.0046  -0.0007 0.0095  36   TYR A CA  
297 C C   . TYR A 37 ? 0.0867 0.0998 0.0354 0.0027  0.0029  0.0145  36   TYR A C   
298 O O   . TYR A 37 ? 0.0942 0.1232 0.0352 -0.0022 0.0035  -0.0040 36   TYR A O   
299 C CB  . TYR A 37 ? 0.1106 0.1217 0.0731 0.0130  0.0062  0.0213  36   TYR A CB  
300 C CG  . TYR A 37 ? 0.1237 0.1301 0.0912 0.0191  0.0124  0.0183  36   TYR A CG  
301 C CD1 . TYR A 37 ? 0.1379 0.1451 0.1181 0.0244  0.0160  0.0104  36   TYR A CD1 
302 C CD2 . TYR A 37 ? 0.1123 0.1465 0.0850 0.0182  0.0074  0.0204  36   TYR A CD2 
303 C CE1 . TYR A 37 ? 0.1513 0.1708 0.1244 0.0321  0.0132  0.0086  36   TYR A CE1 
304 C CE2 . TYR A 37 ? 0.1326 0.1713 0.1133 0.0251  0.0057  0.0197  36   TYR A CE2 
305 C CZ  . TYR A 37 ? 0.1318 0.1666 0.1122 0.0340  0.0083  0.0180  36   TYR A CZ  
306 O OH  . TYR A 37 ? 0.1465 0.1948 0.1410 0.0420  0.0186  0.0122  36   TYR A OH  
307 N N   . ASN A 38 ? 0.0810 0.1130 0.0365 -0.0020 0.0064  0.0067  37   ASN A N   
308 C CA  . ASN A 38 ? 0.0937 0.1054 0.0293 0.0033  0.0072  0.0066  37   ASN A CA  
309 C C   . ASN A 38 ? 0.0815 0.1118 0.0263 0.0045  0.0029  0.0090  37   ASN A C   
310 O O   . ASN A 38 ? 0.1067 0.1275 0.0344 -0.0062 0.0040  -0.0034 37   ASN A O   
311 C CB  . ASN A 38 ? 0.1124 0.1162 0.0488 0.0074  0.0055  0.0099  37   ASN A CB  
312 C CG  . ASN A 38 ? 0.1211 0.1141 0.0467 0.0094  0.0000  0.0087  37   ASN A CG  
313 O OD1 . ASN A 38 ? 0.1800 0.1455 0.0948 0.0297  0.0051  0.0025  37   ASN A OD1 
314 N ND2 . ASN A 38 ? 0.1145 0.0819 0.0361 -0.0018 0.0161  0.0060  37   ASN A ND2 
315 N N   . LYS A 39 ? 0.0842 0.0994 0.0374 0.0004  0.0003  0.0107  38   LYS A N   
316 C CA  . LYS A 39 ? 0.0940 0.1104 0.0557 -0.0073 -0.0053 0.0019  38   LYS A CA  
317 C C   . LYS A 39 ? 0.0847 0.1095 0.0463 0.0000  0.0001  -0.0054 38   LYS A C   
318 O O   . LYS A 39 ? 0.1063 0.1191 0.0539 -0.0138 0.0060  -0.0132 38   LYS A O   
319 C CB  . LYS A 39 ? 0.1004 0.1102 0.1068 -0.0073 0.0019  0.0063  38   LYS A CB  
320 C CG  . LYS A 39 ? 0.1135 0.1122 0.1105 -0.0004 0.0041  0.0091  38   LYS A CG  
321 C CD  . LYS A 39 ? 0.1330 0.1312 0.1283 -0.0042 0.0148  0.0027  38   LYS A CD  
322 C CE  . LYS A 39 ? 0.1477 0.1454 0.1445 0.0021  0.0134  -0.0145 38   LYS A CE  
323 N NZ  . LYS A 39 ? 0.1794 0.1424 0.1549 0.0082  0.0264  -0.0079 38   LYS A NZ  
324 N N   . CYS A 40 ? 0.0878 0.1184 0.0449 -0.0094 -0.0077 0.0024  39   CYS A N   
325 C CA  . CYS A 40 ? 0.0824 0.1161 0.0399 -0.0037 -0.0049 -0.0018 39   CYS A CA  
326 C C   . CYS A 40 ? 0.0877 0.1027 0.0504 -0.0010 -0.0074 -0.0099 39   CYS A C   
327 O O   . CYS A 40 ? 0.1049 0.0995 0.0370 0.0004  -0.0030 -0.0141 39   CYS A O   
328 C CB  . CYS A 40 ? 0.0946 0.1224 0.0575 -0.0048 -0.0243 0.0123  39   CYS A CB  
329 S SG  . CYS A 40 ? 0.1205 0.1481 0.0815 -0.0133 -0.0268 0.0117  39   CYS A SG  
330 N N   . TRP A 41 ? 0.0873 0.0891 0.0334 -0.0019 -0.0023 -0.0042 40   TRP A N   
331 C CA  . TRP A 41 ? 0.0868 0.0914 0.0417 -0.0056 0.0053  -0.0017 40   TRP A CA  
332 C C   . TRP A 41 ? 0.0905 0.0879 0.0394 -0.0041 0.0105  0.0017  40   TRP A C   
333 O O   . TRP A 41 ? 0.1019 0.0908 0.0515 -0.0028 0.0052  0.0090  40   TRP A O   
334 C CB  . TRP A 41 ? 0.0936 0.1041 0.0561 -0.0040 0.0000  0.0005  40   TRP A CB  
335 C CG  . TRP A 41 ? 0.0952 0.0987 0.0437 -0.0062 0.0048  0.0063  40   TRP A CG  
336 C CD1 . TRP A 41 ? 0.0996 0.1149 0.0469 -0.0079 0.0049  0.0064  40   TRP A CD1 
337 C CD2 . TRP A 41 ? 0.0940 0.0895 0.0527 -0.0068 -0.0059 0.0107  40   TRP A CD2 
338 N NE1 . TRP A 41 ? 0.1071 0.1166 0.0698 -0.0006 -0.0075 0.0141  40   TRP A NE1 
339 C CE2 . TRP A 41 ? 0.0972 0.1014 0.0637 -0.0019 -0.0060 0.0170  40   TRP A CE2 
340 C CE3 . TRP A 41 ? 0.1044 0.1028 0.0572 0.0077  0.0022  0.0029  40   TRP A CE3 
341 C CZ2 . TRP A 41 ? 0.1167 0.1113 0.0715 0.0093  -0.0065 0.0232  40   TRP A CZ2 
342 C CZ3 . TRP A 41 ? 0.1061 0.1201 0.0782 0.0054  0.0003  0.0062  40   TRP A CZ3 
343 C CH2 . TRP A 41 ? 0.1135 0.1240 0.0834 0.0084  0.0039  0.0097  40   TRP A CH2 
344 N N   . LYS A 42 ? 0.0967 0.1400 0.0370 0.0032  0.0105  0.0065  41   LYS A N   
345 C CA  . LYS A 42 ? 0.1130 0.1336 0.0334 -0.0026 0.0150  0.0075  41   LYS A CA  
346 C C   . LYS A 42 ? 0.1166 0.1315 0.0282 0.0040  0.0123  0.0122  41   LYS A C   
347 O O   . LYS A 42 ? 0.1145 0.1231 0.0309 0.0079  0.0140  0.0074  41   LYS A O   
348 C CB  . LYS A 42 ? 0.1444 0.1419 0.0451 -0.0037 0.0170  -0.0096 41   LYS A CB  
349 C CG  . LYS A 42 ? 0.1785 0.1780 0.0854 -0.0125 0.0096  -0.0123 41   LYS A CG  
350 C CD  . LYS A 42 ? 0.2215 0.2074 0.1723 -0.0148 0.0051  -0.0039 41   LYS A CD  
351 C CE  . LYS A 42 ? 0.2378 0.2436 0.2078 -0.0155 0.0068  -0.0020 41   LYS A CE  
352 N NZ  . LYS A 42 ? 0.2682 0.2625 0.2536 -0.0131 0.0048  0.0075  41   LYS A NZ  
353 N N   . PHE A 43 ? 0.1235 0.1231 0.0408 0.0058  0.0220  0.0150  42   PHE A N   
354 C CA  . PHE A 43 ? 0.1247 0.1168 0.0443 0.0128  0.0135  0.0053  42   PHE A CA  
355 C C   . PHE A 43 ? 0.1318 0.1119 0.0315 0.0124  0.0193  0.0005  42   PHE A C   
356 O O   . PHE A 43 ? 0.1446 0.1040 0.0378 0.0134  0.0016  -0.0050 42   PHE A O   
357 C CB  . PHE A 43 ? 0.1264 0.1198 0.0569 0.0146  0.0276  0.0161  42   PHE A CB  
358 C CG  . PHE A 43 ? 0.1234 0.1233 0.0472 0.0076  0.0397  0.0125  42   PHE A CG  
359 C CD1 . PHE A 43 ? 0.1394 0.1264 0.0917 0.0134  0.0268  0.0027  42   PHE A CD1 
360 C CD2 . PHE A 43 ? 0.1411 0.1297 0.0680 0.0139  0.0260  0.0139  42   PHE A CD2 
361 C CE1 . PHE A 43 ? 0.1460 0.1296 0.1175 0.0103  0.0395  0.0043  42   PHE A CE1 
362 C CE2 . PHE A 43 ? 0.1607 0.1350 0.0672 0.0169  0.0231  0.0045  42   PHE A CE2 
363 C CZ  . PHE A 43 ? 0.1561 0.1344 0.0724 0.0117  0.0338  0.0066  42   PHE A CZ  
364 N N   . GLU A 44 ? 0.1419 0.1139 0.0425 0.0164  0.0147  0.0164  43   GLU A N   
365 C CA  . GLU A 44 ? 0.1635 0.1253 0.0655 0.0101  0.0038  0.0126  43   GLU A CA  
366 C C   . GLU A 44 ? 0.1488 0.1058 0.0437 0.0096  0.0010  0.0054  43   GLU A C   
367 O O   . GLU A 44 ? 0.1545 0.1374 0.0537 0.0106  -0.0001 0.0141  43   GLU A O   
368 C CB  . GLU A 44 ? 0.1776 0.1332 0.0990 0.0057  0.0140  0.0179  43   GLU A CB  
369 C CG  . GLU A 44 ? 0.2173 0.1728 0.1479 -0.0070 0.0120  0.0013  43   GLU A CG  
370 C CD  . GLU A 44 ? 0.2327 0.1934 0.1771 -0.0065 0.0066  0.0030  43   GLU A CD  
371 O OE1 . GLU A 44 ? 0.2776 0.2420 0.2369 -0.0094 0.0137  0.0162  43   GLU A OE1 
372 O OE2 . GLU A 44 ? 0.2870 0.2352 0.2417 -0.0107 0.0024  -0.0017 43   GLU A OE2 
373 N N   . HIS A 45 ? 0.1333 0.0981 0.0531 0.0105  0.0114  -0.0008 44   HIS A N   
374 C CA  . HIS A 45 ? 0.1238 0.1064 0.0466 0.0117  -0.0020 0.0038  44   HIS A CA  
375 C C   . HIS A 45 ? 0.1229 0.1062 0.0385 0.0136  -0.0129 0.0060  44   HIS A C   
376 O O   . HIS A 45 ? 0.1163 0.1240 0.0462 0.0001  -0.0075 0.0119  44   HIS A O   
377 C CB  . HIS A 45 ? 0.1341 0.1076 0.0568 0.0107  -0.0022 0.0035  44   HIS A CB  
378 C CG  . HIS A 45 ? 0.1339 0.1076 0.0716 0.0132  0.0163  0.0009  44   HIS A CG  
379 N ND1 . HIS A 45 ? 0.1472 0.1057 0.0807 0.0086  0.0211  -0.0119 44   HIS A ND1 
380 C CD2 . HIS A 45 ? 0.1450 0.1133 0.0958 0.0190  0.0198  0.0055  44   HIS A CD2 
381 C CE1 . HIS A 45 ? 0.1528 0.1175 0.0870 0.0084  0.0195  -0.0033 44   HIS A CE1 
382 N NE2 . HIS A 45 ? 0.1514 0.1157 0.0991 0.0117  0.0145  0.0022  44   HIS A NE2 
383 N N   . CYS A 46 ? 0.1253 0.1056 0.0554 0.0100  -0.0179 0.0069  45   CYS A N   
384 C CA  . CYS A 46 ? 0.1282 0.1103 0.0835 0.0110  -0.0121 0.0045  45   CYS A CA  
385 C C   . CYS A 46 ? 0.1403 0.1180 0.0763 0.0063  -0.0106 -0.0058 45   CYS A C   
386 O O   . CYS A 46 ? 0.1481 0.1244 0.0890 0.0100  -0.0105 -0.0171 45   CYS A O   
387 C CB  A CYS A 46 ? 0.1283 0.1140 0.0890 0.0065  -0.0154 0.0109  45   CYS A CB  
388 C CB  B CYS A 46 ? 0.1390 0.1257 0.1082 0.0067  -0.0101 0.0094  45   CYS A CB  
389 S SG  A CYS A 46 ? 0.1224 0.0962 0.0583 0.0055  -0.0086 0.0051  45   CYS A SG  
390 S SG  B CYS A 46 ? 0.1591 0.1418 0.1337 -0.0012 -0.0075 0.0187  45   CYS A SG  
391 N N   . ASN A 47 ? 0.1316 0.1168 0.0679 0.0071  -0.0215 -0.0040 46   ASN A N   
392 C CA  . ASN A 47 ? 0.1328 0.1422 0.0689 0.0046  -0.0275 -0.0088 46   ASN A CA  
393 C C   . ASN A 47 ? 0.1249 0.1279 0.0722 0.0074  -0.0388 -0.0111 46   ASN A C   
394 O O   . ASN A 47 ? 0.1240 0.1230 0.0718 0.0100  -0.0299 -0.0144 46   ASN A O   
395 C CB  . ASN A 47 ? 0.1789 0.1982 0.0753 0.0044  0.0027  -0.0013 46   ASN A CB  
396 C CG  . ASN A 47 ? 0.1498 0.1776 0.0547 0.0098  -0.0110 -0.0023 46   ASN A CG  
397 O OD1 . ASN A 47 ? 0.1583 0.1619 0.0731 0.0059  -0.0169 0.0005  46   ASN A OD1 
398 N ND2 . ASN A 47 ? 0.1582 0.1700 0.0732 -0.0010 -0.0039 0.0156  46   ASN A ND2 
399 N N   . PHE A 48 ? 0.1397 0.1311 0.0675 -0.0029 -0.0288 -0.0215 47   PHE A N   
400 C CA  . PHE A 48 ? 0.1342 0.1216 0.0851 -0.0033 -0.0332 -0.0163 47   PHE A CA  
401 C C   . PHE A 48 ? 0.1305 0.1196 0.0662 -0.0097 -0.0356 -0.0088 47   PHE A C   
402 O O   . PHE A 48 ? 0.1411 0.1258 0.0607 -0.0134 -0.0257 -0.0158 47   PHE A O   
403 C CB  . PHE A 48 ? 0.1518 0.1367 0.0690 -0.0100 -0.0396 -0.0189 47   PHE A CB  
404 C CG  . PHE A 48 ? 0.1411 0.1332 0.0601 -0.0153 -0.0519 -0.0042 47   PHE A CG  
405 C CD1 . PHE A 48 ? 0.1671 0.1334 0.0872 -0.0159 -0.0345 -0.0052 47   PHE A CD1 
406 C CD2 . PHE A 48 ? 0.1415 0.1401 0.0687 -0.0111 -0.0419 -0.0102 47   PHE A CD2 
407 C CE1 . PHE A 48 ? 0.1712 0.1520 0.0781 -0.0196 -0.0356 0.0022  47   PHE A CE1 
408 C CE2 . PHE A 48 ? 0.1455 0.1603 0.0728 -0.0173 -0.0525 -0.0044 47   PHE A CE2 
409 C CZ  . PHE A 48 ? 0.1607 0.1653 0.0849 -0.0181 -0.0348 -0.0103 47   PHE A CZ  
410 N N   . ASN A 49 ? 0.1344 0.1408 0.0614 0.0009  -0.0354 -0.0060 48   ASN A N   
411 C CA  . ASN A 49 ? 0.1395 0.1330 0.0463 -0.0035 -0.0357 -0.0012 48   ASN A CA  
412 C C   . ASN A 49 ? 0.1247 0.1134 0.0652 0.0024  -0.0320 0.0033  48   ASN A C   
413 O O   . ASN A 49 ? 0.1302 0.1219 0.0740 0.0095  -0.0262 0.0045  48   ASN A O   
414 C CB  . ASN A 49 ? 0.1695 0.1652 0.0741 -0.0052 -0.0307 0.0108  48   ASN A CB  
415 C CG  . ASN A 49 ? 0.1971 0.1755 0.0919 -0.0094 -0.0255 0.0092  48   ASN A CG  
416 O OD1 . ASN A 49 ? 0.2115 0.1747 0.1393 0.0218  -0.0434 0.0125  48   ASN A OD1 
417 N ND2 . ASN A 49 ? 0.2278 0.1879 0.1831 -0.0153 -0.0212 0.0102  48   ASN A ND2 
418 N N   . ASP A 50 ? 0.1226 0.1108 0.0746 -0.0030 -0.0209 0.0003  49   ASP A N   
419 C CA  . ASP A 50 ? 0.1224 0.1021 0.0666 -0.0027 -0.0268 0.0070  49   ASP A CA  
420 C C   . ASP A 50 ? 0.1204 0.1008 0.0550 -0.0041 -0.0366 -0.0030 49   ASP A C   
421 O O   . ASP A 50 ? 0.1631 0.0894 0.0720 -0.0095 -0.0391 -0.0099 49   ASP A O   
422 C CB  . ASP A 50 ? 0.1371 0.1306 0.1067 0.0061  -0.0090 0.0136  49   ASP A CB  
423 C CG  . ASP A 50 ? 0.1540 0.1494 0.1472 0.0194  -0.0078 0.0213  49   ASP A CG  
424 O OD1 . ASP A 50 ? 0.1842 0.1811 0.2004 0.0227  0.0025  0.0470  49   ASP A OD1 
425 O OD2 . ASP A 50 ? 0.1573 0.1579 0.1546 0.0094  -0.0011 0.0267  49   ASP A OD2 
426 N N   . VAL A 51 ? 0.1103 0.0826 0.0559 0.0016  -0.0252 0.0015  50   VAL A N   
427 C CA  . VAL A 51 ? 0.1199 0.0892 0.0686 -0.0086 -0.0106 -0.0045 50   VAL A CA  
428 C C   . VAL A 51 ? 0.1124 0.0864 0.0790 -0.0058 -0.0089 -0.0123 50   VAL A C   
429 O O   . VAL A 51 ? 0.1134 0.1083 0.0872 -0.0006 -0.0063 -0.0180 50   VAL A O   
430 C CB  . VAL A 51 ? 0.1151 0.0932 0.0742 -0.0017 -0.0123 0.0021  50   VAL A CB  
431 C CG1 . VAL A 51 ? 0.1324 0.1067 0.0946 0.0018  -0.0048 0.0003  50   VAL A CG1 
432 C CG2 . VAL A 51 ? 0.1328 0.1017 0.0804 -0.0012 0.0004  0.0096  50   VAL A CG2 
433 N N   . THR A 52 ? 0.0958 0.1129 0.1003 -0.0068 -0.0125 -0.0177 51   THR A N   
434 C CA  . THR A 52 ? 0.1093 0.1326 0.0985 -0.0041 -0.0146 -0.0217 51   THR A CA  
435 C C   . THR A 52 ? 0.1170 0.1267 0.0973 0.0023  -0.0096 -0.0132 51   THR A C   
436 O O   . THR A 52 ? 0.1140 0.1276 0.1034 -0.0053 -0.0009 -0.0203 51   THR A O   
437 C CB  . THR A 52 ? 0.1193 0.1599 0.1219 -0.0093 -0.0212 -0.0317 51   THR A CB  
438 O OG1 . THR A 52 ? 0.1447 0.2138 0.1352 -0.0146 -0.0224 -0.0197 51   THR A OG1 
439 C CG2 . THR A 52 ? 0.1341 0.1797 0.1585 -0.0091 -0.0218 -0.0438 51   THR A CG2 
440 N N   A THR A 53 ? 0.1165 0.1204 0.1005 0.0096  -0.0080 -0.0122 52   THR A N   
441 N N   B THR A 53 ? 0.1127 0.1225 0.0987 0.0101  -0.0076 -0.0113 52   THR A N   
442 C CA  A THR A 53 ? 0.1356 0.1196 0.1100 0.0096  -0.0063 -0.0045 52   THR A CA  
443 C CA  B THR A 53 ? 0.1306 0.1255 0.1075 0.0105  -0.0033 -0.0004 52   THR A CA  
444 C C   A THR A 53 ? 0.1226 0.1002 0.1075 0.0000  -0.0022 -0.0108 52   THR A C   
445 C C   B THR A 53 ? 0.1159 0.1072 0.1002 -0.0002 0.0017  -0.0055 52   THR A C   
446 O O   A THR A 53 ? 0.1362 0.0942 0.1170 0.0066  -0.0055 -0.0132 52   THR A O   
447 O O   B THR A 53 ? 0.1153 0.1152 0.1151 0.0027  0.0056  -0.0016 52   THR A O   
448 C CB  A THR A 53 ? 0.1464 0.1340 0.1159 0.0105  -0.0063 0.0018  52   THR A CB  
449 C CB  B THR A 53 ? 0.1354 0.1398 0.1155 0.0133  -0.0042 0.0068  52   THR A CB  
450 O OG1 A THR A 53 ? 0.1561 0.1284 0.1236 0.0052  -0.0091 -0.0051 52   THR A OG1 
451 O OG1 B THR A 53 ? 0.1543 0.1670 0.1294 0.0158  -0.0104 0.0117  52   THR A OG1 
452 C CG2 A THR A 53 ? 0.1459 0.1477 0.1263 0.0158  -0.0117 0.0051  52   THR A CG2 
453 C CG2 B THR A 53 ? 0.1526 0.1440 0.1318 0.0182  0.0027  0.0029  52   THR A CG2 
454 N N   . ARG A 54 ? 0.1114 0.1052 0.0753 -0.0013 -0.0062 -0.0033 53   ARG A N   
455 C CA  . ARG A 54 ? 0.1152 0.1193 0.0647 -0.0060 -0.0040 -0.0089 53   ARG A CA  
456 C C   . ARG A 54 ? 0.1239 0.1265 0.0707 -0.0097 0.0041  -0.0172 53   ARG A C   
457 O O   . ARG A 54 ? 0.1452 0.1674 0.0810 -0.0269 0.0144  -0.0242 53   ARG A O   
458 C CB  . ARG A 54 ? 0.1149 0.1274 0.0644 -0.0038 -0.0001 -0.0151 53   ARG A CB  
459 C CG  A ARG A 54 ? 0.1155 0.0954 0.0595 -0.0130 0.0022  -0.0266 53   ARG A CG  
460 C CG  B ARG A 54 ? 0.1236 0.1308 0.0859 -0.0049 0.0083  -0.0154 53   ARG A CG  
461 C CD  A ARG A 54 ? 0.1093 0.0964 0.0481 -0.0046 0.0055  -0.0011 53   ARG A CD  
462 C CD  B ARG A 54 ? 0.1188 0.1365 0.0901 -0.0057 0.0043  -0.0074 53   ARG A CD  
463 N NE  A ARG A 54 ? 0.1048 0.0884 0.0542 -0.0094 0.0059  -0.0031 53   ARG A NE  
464 N NE  B ARG A 54 ? 0.1282 0.1419 0.1052 -0.0040 0.0005  -0.0039 53   ARG A NE  
465 C CZ  A ARG A 54 ? 0.0995 0.0856 0.0458 -0.0034 0.0152  -0.0075 53   ARG A CZ  
466 C CZ  B ARG A 54 ? 0.1356 0.1411 0.1050 -0.0001 0.0102  -0.0060 53   ARG A CZ  
467 N NH1 A ARG A 54 ? 0.1072 0.1090 0.0788 -0.0074 0.0165  -0.0008 53   ARG A NH1 
468 N NH1 B ARG A 54 ? 0.1407 0.1473 0.1272 -0.0052 0.0114  0.0082  53   ARG A NH1 
469 N NH2 A ARG A 54 ? 0.1132 0.0985 0.0641 0.0087  0.0122  -0.0060 53   ARG A NH2 
470 N NH2 B ARG A 54 ? 0.1246 0.1215 0.0965 0.0031  0.0206  -0.0180 53   ARG A NH2 
471 N N   . LEU A 55 ? 0.1458 0.1240 0.0793 -0.0161 0.0088  -0.0017 54   LEU A N   
472 C CA  . LEU A 55 ? 0.1645 0.1537 0.0995 -0.0170 0.0096  0.0052  54   LEU A CA  
473 C C   . LEU A 55 ? 0.1690 0.1540 0.1197 -0.0209 0.0227  0.0034  54   LEU A C   
474 O O   . LEU A 55 ? 0.1906 0.2005 0.1298 -0.0285 0.0388  0.0071  54   LEU A O   
475 C CB  . LEU A 55 ? 0.1915 0.1653 0.1049 -0.0161 0.0188  0.0146  54   LEU A CB  
476 C CG  . LEU A 55 ? 0.2032 0.1727 0.1089 -0.0074 0.0026  0.0240  54   LEU A CG  
477 C CD1 . LEU A 55 ? 0.2269 0.1773 0.1235 0.0019  0.0105  0.0299  54   LEU A CD1 
478 C CD2 . LEU A 55 ? 0.2106 0.1950 0.1440 -0.0033 -0.0026 0.0128  54   LEU A CD2 
479 N N   . ARG A 56 ? 0.1466 0.1490 0.1331 -0.0188 0.0203  -0.0038 55   ARG A N   
480 C CA  . ARG A 56 ? 0.1632 0.1623 0.1686 -0.0174 0.0217  -0.0100 55   ARG A CA  
481 C C   . ARG A 56 ? 0.1503 0.1645 0.1639 -0.0150 0.0334  -0.0076 55   ARG A C   
482 O O   . ARG A 56 ? 0.1759 0.1790 0.1892 -0.0222 0.0483  -0.0183 55   ARG A O   
483 C CB  . ARG A 56 ? 0.1777 0.1670 0.1864 -0.0162 0.0236  -0.0120 55   ARG A CB  
484 C CG  . ARG A 56 ? 0.1953 0.1701 0.2046 -0.0218 0.0141  -0.0138 55   ARG A CG  
485 C CD  . ARG A 56 ? 0.2133 0.1877 0.2203 -0.0148 0.0151  -0.0168 55   ARG A CD  
486 N NE  . ARG A 56 ? 0.2545 0.2350 0.2519 -0.0097 0.0057  -0.0015 55   ARG A NE  
487 C CZ  . ARG A 56 ? 0.2652 0.2546 0.2517 -0.0089 0.0029  -0.0008 55   ARG A CZ  
488 N NH1 . ARG A 56 ? 0.2695 0.2632 0.2664 -0.0098 0.0054  0.0000  55   ARG A NH1 
489 N NH2 . ARG A 56 ? 0.2827 0.2720 0.2669 -0.0074 0.0002  0.0052  55   ARG A NH2 
490 N N   . GLU A 57 ? 0.1475 0.1439 0.1547 -0.0200 0.0126  -0.0041 56   GLU A N   
491 C CA  . GLU A 57 ? 0.1470 0.1548 0.1802 -0.0147 0.0012  0.0016  56   GLU A CA  
492 C C   . GLU A 57 ? 0.1640 0.1712 0.1833 -0.0141 -0.0006 0.0048  56   GLU A C   
493 O O   . GLU A 57 ? 0.1988 0.2056 0.1948 -0.0312 0.0024  0.0030  56   GLU A O   
494 C CB  . GLU A 57 ? 0.1259 0.1567 0.1749 -0.0056 0.0161  0.0063  56   GLU A CB  
495 C CG  . GLU A 57 ? 0.1282 0.1690 0.1806 0.0036  0.0167  0.0129  56   GLU A CG  
496 C CD  . GLU A 57 ? 0.1227 0.1748 0.1872 0.0133  0.0072  0.0203  56   GLU A CD  
497 O OE1 . GLU A 57 ? 0.1147 0.1870 0.2187 -0.0015 0.0188  0.0231  56   GLU A OE1 
498 O OE2 . GLU A 57 ? 0.1389 0.2164 0.1981 0.0258  0.0234  0.0319  56   GLU A OE2 
499 N N   . ASN A 58 ? 0.1703 0.1874 0.1906 0.0004  -0.0205 0.0148  57   ASN A N   
500 C CA  . ASN A 58 ? 0.1929 0.2127 0.1979 0.0093  -0.0185 0.0110  57   ASN A CA  
501 C C   . ASN A 58 ? 0.1642 0.2052 0.1795 0.0019  -0.0109 0.0124  57   ASN A C   
502 O O   . ASN A 58 ? 0.1810 0.2151 0.1790 0.0038  -0.0181 0.0219  57   ASN A O   
503 C CB  . ASN A 58 ? 0.2101 0.2362 0.2351 0.0090  -0.0081 0.0091  57   ASN A CB  
504 C CG  . ASN A 58 ? 0.2295 0.2383 0.2608 0.0004  -0.0024 0.0049  57   ASN A CG  
505 O OD1 . ASN A 58 ? 0.2577 0.2522 0.2720 -0.0083 -0.0002 0.0124  57   ASN A OD1 
506 N ND2 . ASN A 58 ? 0.2354 0.2471 0.2609 0.0076  0.0063  0.0005  57   ASN A ND2 
507 N N   . GLU A 59 ? 0.1376 0.1894 0.1702 0.0204  -0.0237 0.0105  58   GLU A N   
508 C CA  . GLU A 59 ? 0.1562 0.2022 0.1792 0.0174  -0.0172 0.0109  58   GLU A CA  
509 C C   . GLU A 59 ? 0.1292 0.1818 0.1424 0.0118  -0.0235 0.0065  58   GLU A C   
510 O O   . GLU A 59 ? 0.1397 0.1938 0.1325 0.0175  -0.0221 0.0042  58   GLU A O   
511 C CB  . GLU A 59 ? 0.1776 0.2191 0.2021 0.0036  -0.0165 0.0077  58   GLU A CB  
512 C CG  . GLU A 59 ? 0.2420 0.2547 0.2414 -0.0013 -0.0073 -0.0011 58   GLU A CG  
513 C CD  . GLU A 59 ? 0.2531 0.2667 0.2581 -0.0055 -0.0047 0.0013  58   GLU A CD  
514 O OE1 . GLU A 59 ? 0.3035 0.3120 0.2883 -0.0028 0.0067  0.0047  58   GLU A OE1 
515 O OE2 . GLU A 59 ? 0.2905 0.3090 0.2762 -0.0060 -0.0030 0.0015  58   GLU A OE2 
516 N N   . LEU A 60 ? 0.1159 0.1404 0.1122 0.0057  -0.0218 0.0177  59   LEU A N   
517 C CA  . LEU A 60 ? 0.1060 0.1347 0.1034 0.0074  -0.0256 0.0079  59   LEU A CA  
518 C C   . LEU A 60 ? 0.1150 0.1211 0.0775 -0.0055 -0.0189 0.0086  59   LEU A C   
519 O O   . LEU A 60 ? 0.1382 0.1408 0.0737 -0.0026 -0.0221 0.0126  59   LEU A O   
520 C CB  . LEU A 60 ? 0.1257 0.1291 0.1216 0.0055  -0.0195 0.0016  59   LEU A CB  
521 C CG  . LEU A 60 ? 0.1385 0.1160 0.1599 0.0009  -0.0166 0.0019  59   LEU A CG  
522 C CD1 . LEU A 60 ? 0.1434 0.1228 0.1444 -0.0023 -0.0152 0.0025  59   LEU A CD1 
523 C CD2 . LEU A 60 ? 0.1652 0.1415 0.1849 -0.0040 -0.0077 -0.0183 59   LEU A CD2 
524 N N   . THR A 61 ? 0.0973 0.1119 0.0790 -0.0049 -0.0163 -0.0045 60   THR A N   
525 C CA  . THR A 61 ? 0.1110 0.1162 0.0887 -0.0032 -0.0192 -0.0071 60   THR A CA  
526 C C   . THR A 61 ? 0.1011 0.0982 0.0762 -0.0025 -0.0192 -0.0032 60   THR A C   
527 O O   . THR A 61 ? 0.1040 0.1158 0.0701 -0.0072 -0.0135 -0.0063 60   THR A O   
528 C CB  . THR A 61 ? 0.1320 0.1343 0.1108 -0.0105 -0.0180 -0.0107 60   THR A CB  
529 O OG1 . THR A 61 ? 0.1526 0.1352 0.1445 -0.0099 -0.0215 0.0051  60   THR A OG1 
530 C CG2 . THR A 61 ? 0.1500 0.1587 0.1469 -0.0173 -0.0257 -0.0192 60   THR A CG2 
531 N N   . TYR A 62 ? 0.1035 0.0991 0.0609 0.0019  -0.0225 0.0062  61   TYR A N   
532 C CA  . TYR A 62 ? 0.1118 0.1083 0.0647 0.0025  -0.0207 0.0008  61   TYR A CA  
533 C C   . TYR A 62 ? 0.1084 0.1020 0.0507 0.0015  -0.0133 -0.0041 61   TYR A C   
534 O O   . TYR A 62 ? 0.1288 0.1136 0.0486 -0.0028 -0.0114 -0.0133 61   TYR A O   
535 C CB  . TYR A 62 ? 0.1378 0.1117 0.0666 -0.0057 -0.0163 0.0034  61   TYR A CB  
536 C CG  . TYR A 62 ? 0.1514 0.1101 0.0867 -0.0070 -0.0164 0.0039  61   TYR A CG  
537 C CD1 . TYR A 62 ? 0.1599 0.1267 0.1089 -0.0156 -0.0076 0.0101  61   TYR A CD1 
538 C CD2 . TYR A 62 ? 0.1703 0.1157 0.0904 -0.0066 -0.0193 0.0089  61   TYR A CD2 
539 C CE1 . TYR A 62 ? 0.1755 0.1475 0.1187 -0.0125 -0.0130 0.0111  61   TYR A CE1 
540 C CE2 . TYR A 62 ? 0.1813 0.1386 0.0980 -0.0075 -0.0214 0.0088  61   TYR A CE2 
541 C CZ  . TYR A 62 ? 0.1799 0.1455 0.0828 -0.0131 -0.0173 0.0149  61   TYR A CZ  
542 O OH  . TYR A 62 ? 0.2122 0.1898 0.1036 -0.0183 -0.0037 0.0216  61   TYR A OH  
543 N N   . TYR A 63 ? 0.1157 0.1131 0.0373 0.0051  -0.0039 -0.0053 62   TYR A N   
544 C CA  . TYR A 63 ? 0.1149 0.1103 0.0639 0.0040  -0.0054 0.0013  62   TYR A CA  
545 C C   . TYR A 63 ? 0.1088 0.0954 0.0522 0.0065  0.0026  0.0020  62   TYR A C   
546 O O   . TYR A 63 ? 0.1116 0.0991 0.0446 0.0026  0.0150  -0.0020 62   TYR A O   
547 C CB  . TYR A 63 ? 0.1319 0.1140 0.0965 0.0071  -0.0016 -0.0086 62   TYR A CB  
548 C CG  . TYR A 63 ? 0.1437 0.1261 0.1171 0.0045  -0.0044 -0.0060 62   TYR A CG  
549 C CD1 . TYR A 63 ? 0.1700 0.1587 0.1380 0.0124  0.0008  -0.0207 62   TYR A CD1 
550 C CD2 . TYR A 63 ? 0.1347 0.1282 0.1222 0.0061  -0.0034 0.0111  62   TYR A CD2 
551 C CE1 . TYR A 63 ? 0.1800 0.1765 0.1827 0.0179  -0.0013 -0.0109 62   TYR A CE1 
552 C CE2 . TYR A 63 ? 0.1535 0.1422 0.1750 0.0093  0.0027  0.0076  62   TYR A CE2 
553 C CZ  . TYR A 63 ? 0.1502 0.1461 0.1711 0.0210  0.0046  -0.0010 62   TYR A CZ  
554 O OH  . TYR A 63 ? 0.1713 0.1761 0.2100 0.0326  0.0082  -0.0038 62   TYR A OH  
555 N N   . CYS A 64 ? 0.1136 0.1093 0.0551 0.0029  0.0075  0.0005  63   CYS A N   
556 C CA  . CYS A 64 ? 0.1142 0.1104 0.0635 0.0108  0.0062  0.0034  63   CYS A CA  
557 C C   . CYS A 64 ? 0.1219 0.1131 0.0477 0.0092  0.0112  -0.0006 63   CYS A C   
558 O O   . CYS A 64 ? 0.1338 0.1429 0.0675 0.0184  0.0138  -0.0229 63   CYS A O   
559 C CB  . CYS A 64 ? 0.1148 0.1057 0.0773 0.0185  0.0071  -0.0004 63   CYS A CB  
560 S SG  . CYS A 64 ? 0.1357 0.1185 0.0808 0.0163  0.0180  0.0120  63   CYS A SG  
561 N N   . CYS A 65 ? 0.1083 0.1103 0.0624 0.0156  0.0148  0.0063  64   CYS A N   
562 C CA  . CYS A 65 ? 0.1031 0.1049 0.0814 0.0110  0.0134  0.0056  64   CYS A CA  
563 C C   . CYS A 65 ? 0.1054 0.1079 0.0779 0.0060  0.0189  0.0048  64   CYS A C   
564 O O   . CYS A 65 ? 0.1114 0.1334 0.0794 0.0059  0.0204  -0.0133 64   CYS A O   
565 C CB  . CYS A 65 ? 0.1328 0.1212 0.1074 0.0066  0.0065  0.0184  64   CYS A CB  
566 S SG  . CYS A 65 ? 0.1367 0.1461 0.1057 0.0078  0.0129  0.0419  64   CYS A SG  
567 N N   . LYS A 66 ? 0.1030 0.1169 0.0961 0.0132  0.0217  0.0117  65   LYS A N   
568 C CA  . LYS A 66 ? 0.1061 0.1251 0.1003 0.0070  0.0273  0.0200  65   LYS A CA  
569 C C   . LYS A 66 ? 0.1051 0.1230 0.1069 0.0093  0.0311  0.0095  65   LYS A C   
570 O O   . LYS A 66 ? 0.1203 0.1482 0.1658 0.0102  0.0214  0.0306  65   LYS A O   
571 C CB  . LYS A 66 ? 0.1335 0.1622 0.1162 0.0106  0.0334  0.0196  65   LYS A CB  
572 C CG  . LYS A 66 ? 0.1702 0.2114 0.1477 0.0008  0.0371  0.0051  65   LYS A CG  
573 C CD  . LYS A 66 ? 0.2252 0.2493 0.2024 -0.0035 0.0289  0.0153  65   LYS A CD  
574 C CE  . LYS A 66 ? 0.2652 0.2800 0.2515 -0.0056 0.0176  0.0003  65   LYS A CE  
575 N NZ  . LYS A 66 ? 0.3004 0.2936 0.2879 -0.0054 0.0163  0.0068  65   LYS A NZ  
576 N N   . LYS A 67 ? 0.1324 0.1152 0.1213 0.0145  0.0207  0.0252  66   LYS A N   
577 C CA  . LYS A 67 ? 0.1357 0.1290 0.1350 0.0136  0.0089  0.0179  66   LYS A CA  
578 C C   . LYS A 67 ? 0.1161 0.1263 0.1232 0.0035  0.0082  0.0186  66   LYS A C   
579 O O   . LYS A 67 ? 0.1052 0.1310 0.1288 0.0092  0.0010  0.0256  66   LYS A O   
580 C CB  . LYS A 67 ? 0.1834 0.1542 0.1695 0.0188  0.0112  0.0054  66   LYS A CB  
581 C CG  . LYS A 67 ? 0.2288 0.2044 0.2028 0.0187  0.0124  -0.0013 66   LYS A CG  
582 C CD  . LYS A 67 ? 0.2609 0.2583 0.2609 0.0032  0.0043  0.0022  66   LYS A CD  
583 C CE  . LYS A 67 ? 0.2897 0.2889 0.2789 0.0017  0.0065  0.0029  66   LYS A CE  
584 N NZ  . LYS A 67 ? 0.3016 0.3031 0.3062 0.0037  0.0020  0.0025  66   LYS A NZ  
585 N N   . ASP A 68 ? 0.1147 0.1495 0.1389 0.0146  -0.0012 0.0000  67   ASP A N   
586 C CA  . ASP A 68 ? 0.1200 0.1563 0.1333 -0.0073 -0.0030 0.0070  67   ASP A CA  
587 C C   . ASP A 68 ? 0.1133 0.1250 0.1128 -0.0046 -0.0092 0.0162  67   ASP A C   
588 O O   . ASP A 68 ? 0.1188 0.1282 0.1188 0.0115  -0.0077 0.0208  67   ASP A O   
589 C CB  . ASP A 68 ? 0.1357 0.1946 0.1783 -0.0051 -0.0088 0.0080  67   ASP A CB  
590 C CG  . ASP A 68 ? 0.1602 0.1944 0.1983 -0.0041 -0.0138 0.0129  67   ASP A CG  
591 O OD1 . ASP A 68 ? 0.1674 0.1863 0.2144 -0.0048 0.0123  0.0109  67   ASP A OD1 
592 O OD2 . ASP A 68 ? 0.1752 0.2252 0.2253 -0.0007 -0.0342 0.0167  67   ASP A OD2 
593 N N   . LEU A 69 ? 0.1173 0.1250 0.1029 -0.0015 -0.0109 0.0159  68   LEU A N   
594 C CA  . LEU A 69 ? 0.1101 0.1122 0.0964 -0.0010 -0.0118 0.0082  68   LEU A CA  
595 C C   . LEU A 69 ? 0.1133 0.1008 0.0965 -0.0009 -0.0107 0.0066  68   LEU A C   
596 O O   . LEU A 69 ? 0.1215 0.1147 0.0767 -0.0031 -0.0015 0.0068  68   LEU A O   
597 C CB  . LEU A 69 ? 0.1374 0.1296 0.1111 -0.0069 -0.0093 -0.0021 68   LEU A CB  
598 C CG  . LEU A 69 ? 0.1481 0.1367 0.1162 -0.0099 -0.0177 0.0000  68   LEU A CG  
599 C CD1 . LEU A 69 ? 0.1729 0.1647 0.1485 -0.0031 -0.0246 0.0102  68   LEU A CD1 
600 C CD2 . LEU A 69 ? 0.1535 0.1642 0.1216 -0.0016 -0.0011 -0.0109 68   LEU A CD2 
601 N N   . CYS A 70 ? 0.0997 0.0942 0.0824 0.0059  -0.0094 0.0017  69   CYS A N   
602 C CA  . CYS A 70 ? 0.1077 0.0941 0.0793 0.0075  0.0067  0.0062  69   CYS A CA  
603 C C   . CYS A 70 ? 0.0979 0.0787 0.0578 -0.0069 0.0102  0.0148  69   CYS A C   
604 O O   . CYS A 70 ? 0.1088 0.0882 0.0627 -0.0032 0.0050  -0.0007 69   CYS A O   
605 C CB  . CYS A 70 ? 0.1178 0.1101 0.0781 0.0116  0.0098  0.0050  69   CYS A CB  
606 S SG  . CYS A 70 ? 0.1297 0.1209 0.0915 0.0024  0.0220  0.0207  69   CYS A SG  
607 N N   . ASN A 71 ? 0.0992 0.0761 0.0525 0.0000  0.0021  0.0117  70   ASN A N   
608 C CA  . ASN A 71 ? 0.0922 0.0786 0.0480 -0.0042 -0.0085 0.0127  70   ASN A CA  
609 C C   . ASN A 71 ? 0.0906 0.0722 0.0421 0.0029  -0.0034 0.0084  70   ASN A C   
610 O O   . ASN A 71 ? 0.1043 0.0782 0.0576 -0.0043 0.0078  0.0063  70   ASN A O   
611 C CB  . ASN A 71 ? 0.0996 0.0795 0.0451 -0.0055 0.0008  -0.0006 70   ASN A CB  
612 C CG  . ASN A 71 ? 0.0884 0.0746 0.0299 -0.0124 -0.0008 0.0107  70   ASN A CG  
613 O OD1 . ASN A 71 ? 0.0987 0.0849 0.0352 -0.0057 -0.0090 0.0085  70   ASN A OD1 
614 N ND2 . ASN A 71 ? 0.1029 0.0785 0.0342 -0.0021 -0.0039 0.0061  70   ASN A ND2 
615 N N   . PHE A 72 ? 0.1088 0.0776 0.0598 -0.0031 0.0072  0.0031  71   PHE A N   
616 C CA  . PHE A 72 ? 0.1117 0.0830 0.0465 0.0001  0.0093  0.0082  71   PHE A CA  
617 C C   . PHE A 72 ? 0.1040 0.0660 0.0498 0.0114  0.0130  0.0118  71   PHE A C   
618 O O   . PHE A 72 ? 0.1134 0.0753 0.0511 -0.0010 0.0055  0.0124  71   PHE A O   
619 C CB  . PHE A 72 ? 0.1068 0.1027 0.0666 0.0028  0.0008  0.0207  71   PHE A CB  
620 C CG  . PHE A 72 ? 0.0980 0.0920 0.0731 0.0119  -0.0052 0.0252  71   PHE A CG  
621 C CD1 . PHE A 72 ? 0.1102 0.0764 0.0791 0.0140  -0.0044 0.0295  71   PHE A CD1 
622 C CD2 . PHE A 72 ? 0.1062 0.0844 0.0928 0.0123  -0.0012 0.0215  71   PHE A CD2 
623 C CE1 . PHE A 72 ? 0.1177 0.0935 0.0993 0.0167  0.0038  0.0159  71   PHE A CE1 
624 C CE2 . PHE A 72 ? 0.1074 0.0913 0.1109 0.0163  -0.0020 0.0203  71   PHE A CE2 
625 C CZ  . PHE A 72 ? 0.1235 0.0943 0.1061 0.0114  0.0080  0.0206  71   PHE A CZ  
626 N N   . ASN A 73 ? 0.1133 0.0856 0.0489 -0.0017 0.0080  0.0036  72   ASN A N   
627 C CA  . ASN A 73 ? 0.1137 0.1084 0.0609 -0.0013 0.0061  0.0013  72   ASN A CA  
628 C C   . ASN A 73 ? 0.1104 0.0869 0.0674 -0.0055 0.0013  0.0002  72   ASN A C   
629 O O   . ASN A 73 ? 0.1147 0.0975 0.0835 0.0007  -0.0071 0.0146  72   ASN A O   
630 C CB  . ASN A 73 ? 0.1220 0.1367 0.0769 -0.0051 0.0057  0.0003  72   ASN A CB  
631 C CG  . ASN A 73 ? 0.1462 0.1583 0.0856 -0.0043 0.0043  0.0036  72   ASN A CG  
632 O OD1 . ASN A 73 ? 0.1692 0.1553 0.1256 -0.0163 -0.0084 0.0210  72   ASN A OD1 
633 N ND2 . ASN A 73 ? 0.1617 0.2030 0.1404 0.0126  -0.0030 -0.0104 72   ASN A ND2 
634 N N   . GLU A 74 ? 0.1046 0.0758 0.0677 -0.0051 -0.0060 0.0075  73   GLU A N   
635 C CA  . GLU A 74 ? 0.1303 0.0876 0.0493 -0.0065 -0.0064 0.0038  73   GLU A CA  
636 C C   . GLU A 74 ? 0.1312 0.0863 0.0611 -0.0056 -0.0133 -0.0019 73   GLU A C   
637 O O   . GLU A 74 ? 0.1676 0.0936 0.0679 -0.0224 -0.0173 -0.0051 73   GLU A O   
638 C CB  . GLU A 74 ? 0.1373 0.0947 0.0454 -0.0037 0.0011  0.0158  73   GLU A CB  
639 C CG  . GLU A 74 ? 0.1426 0.0974 0.0558 -0.0118 -0.0030 0.0108  73   GLU A CG  
640 C CD  . GLU A 74 ? 0.1323 0.0967 0.0502 0.0023  -0.0046 0.0226  73   GLU A CD  
641 O OE1 . GLU A 74 ? 0.1305 0.1013 0.0572 -0.0020 0.0036  0.0173  73   GLU A OE1 
642 O OE2 . GLU A 74 ? 0.1588 0.1246 0.0697 -0.0112 0.0011  0.0297  73   GLU A OE2 
643 N N   . GLN A 75 ? 0.1312 0.0965 0.0458 -0.0146 0.0022  0.0032  74   GLN A N   
644 C CA  . GLN A 75 ? 0.1569 0.1125 0.0460 -0.0200 -0.0076 0.0098  74   GLN A CA  
645 C C   . GLN A 75 ? 0.1694 0.1126 0.0644 -0.0118 -0.0095 0.0144  74   GLN A C   
646 O O   . GLN A 75 ? 0.1878 0.1646 0.0568 -0.0014 -0.0134 0.0042  74   GLN A O   
647 C CB  . GLN A 75 ? 0.1384 0.1131 0.0713 -0.0205 -0.0045 -0.0005 74   GLN A CB  
648 C CG  . GLN A 75 ? 0.1361 0.1313 0.0756 -0.0122 0.0072  -0.0023 74   GLN A CG  
649 C CD  . GLN A 75 ? 0.1584 0.1244 0.0897 -0.0082 0.0047  -0.0206 74   GLN A CD  
650 O OE1 . GLN A 75 ? 0.1931 0.1676 0.1420 -0.0076 -0.0014 -0.0464 74   GLN A OE1 
651 N NE2 . GLN A 75 ? 0.1569 0.1227 0.0664 -0.0050 0.0150  -0.0077 74   GLN A NE2 
652 N N   . LEU A 76 ? 0.1623 0.1034 0.0698 -0.0135 -0.0254 0.0157  75   LEU A N   
653 C CA  . LEU A 76 ? 0.1982 0.1400 0.1070 0.0168  -0.0207 0.0175  75   LEU A CA  
654 C C   . LEU A 76 ? 0.1975 0.1896 0.1352 0.0165  -0.0207 0.0170  75   LEU A C   
655 O O   . LEU A 76 ? 0.1979 0.2091 0.1475 0.0214  -0.0134 0.0245  75   LEU A O   
656 C CB  . LEU A 76 ? 0.2350 0.1577 0.1467 0.0215  -0.0145 0.0071  75   LEU A CB  
657 C CG  . LEU A 76 ? 0.2466 0.1666 0.1693 0.0096  -0.0012 -0.0001 75   LEU A CG  
658 C CD1 . LEU A 76 ? 0.2245 0.1372 0.1679 -0.0061 0.0000  0.0003  75   LEU A CD1 
659 C CD2 . LEU A 76 ? 0.2222 0.1440 0.1524 0.0043  0.0047  0.0094  75   LEU A CD2 
660 N N   . GLU A 77 ? 0.2412 0.2300 0.1670 0.0108  -0.0239 0.0141  76   GLU A N   
661 C CA  . GLU A 77 ? 0.2804 0.2827 0.2545 -0.0017 -0.0148 0.0101  76   GLU A CA  
662 C C   . GLU A 77 ? 0.2853 0.2976 0.2628 -0.0017 -0.0128 0.0064  76   GLU A C   
663 O O   . GLU A 77 ? 0.2946 0.3186 0.2850 0.0012  -0.0150 0.0168  76   GLU A O   
664 C CB  . GLU A 77 ? 0.2957 0.2955 0.2621 -0.0021 -0.0084 0.0023  76   GLU A CB  
665 C CG  . GLU A 77 ? 0.3157 0.3197 0.3002 0.0016  -0.0063 -0.0005 76   GLU A CG  
666 C CD  . GLU A 77 ? 0.3220 0.3250 0.3044 0.0014  -0.0028 -0.0030 76   GLU A CD  
667 O OE1 . GLU A 77 ? 0.3366 0.3504 0.3231 -0.0017 -0.0088 -0.0013 76   GLU A OE1 
668 O OE2 . GLU A 77 ? 0.3396 0.3484 0.3325 0.0048  -0.0006 -0.0058 76   GLU A OE2 
669 N N   . ASN A 78 ? 0.2953 0.3065 0.2840 0.0032  -0.0145 0.0053  77   ASN A N   
670 C CA  . ASN A 78 ? 0.3018 0.3206 0.2954 0.0030  -0.0072 -0.0007 77   ASN A CA  
671 C C   . ASN A 78 ? 0.3025 0.3254 0.3045 0.0031  -0.0037 0.0043  77   ASN A C   
672 O O   . ASN A 78 ? 0.2891 0.3266 0.2876 0.0015  -0.0133 0.0043  77   ASN A O   
673 C CB  . ASN A 78 ? 0.3144 0.3255 0.3011 0.0014  -0.0073 0.0006  77   ASN A CB  
674 C CG  . ASN A 78 ? 0.3228 0.3324 0.3093 0.0025  -0.0026 0.0000  77   ASN A CG  
675 O OD1 . ASN A 78 ? 0.3249 0.3327 0.3245 0.0005  -0.0081 0.0031  77   ASN A OD1 
676 N ND2 . ASN A 78 ? 0.3152 0.3319 0.3059 -0.0036 -0.0018 -0.0014 77   ASN A ND2 
677 O O   . HOH B .  ? 0.1329 0.2373 0.1496 -0.0142 -0.0030 0.0279  2001 HOH A O   
678 O O   . HOH B .  ? 0.1395 0.1966 0.1894 0.0022  -0.0232 -0.0010 2002 HOH A O   
679 O O   . HOH B .  ? 0.4021 0.3998 0.3913 -0.0003 -0.0184 0.0020  2003 HOH A O   
680 O O   . HOH B .  ? 0.4644 0.4769 0.4787 -0.0007 -0.0012 0.0001  2004 HOH A O   
681 O O   . HOH B .  ? 0.4611 0.4518 0.4320 -0.0004 -0.0066 0.0012  2005 HOH A O   
682 O O   . HOH B .  ? 0.4508 0.4257 0.4375 0.0071  0.0017  -0.0047 2006 HOH A O   
683 O O   . HOH B .  ? 0.1675 0.2084 0.1820 -0.0026 0.0000  0.0072  2007 HOH A O   
684 O O   . HOH B .  ? 0.4949 0.4931 0.4859 -0.0023 -0.0020 -0.0034 2008 HOH A O   
685 O O   . HOH B .  ? 0.3397 0.3387 0.3067 0.0057  -0.0163 0.0010  2009 HOH A O   
686 O O   . HOH B .  ? 0.2723 0.2982 0.2555 0.0160  0.0189  -0.0275 2010 HOH A O   
687 O O   . HOH B .  ? 0.5709 0.5656 0.5669 -0.0035 0.0021  0.0013  2011 HOH A O   
688 O O   . HOH B .  ? 0.2358 0.2035 0.1631 -0.0225 0.0310  0.0155  2012 HOH A O   
689 O O   . HOH B .  ? 0.2325 0.2159 0.2069 0.0021  -0.0114 -0.0110 2013 HOH A O   
690 O O   . HOH B .  ? 0.3131 0.2443 0.2582 0.0177  -0.0072 0.0291  2014 HOH A O   
691 O O   . HOH B .  ? 0.2965 0.2848 0.2678 -0.0044 -0.0328 -0.0212 2015 HOH A O   
692 O O   . HOH B .  ? 0.2797 0.2446 0.1926 0.0051  0.0133  -0.0423 2016 HOH A O   
693 O O   . HOH B .  ? 0.1402 0.1279 0.0840 0.0138  0.0105  -0.0230 2017 HOH A O   
694 O O   . HOH B .  ? 0.4764 0.4489 0.4678 0.0000  -0.0025 -0.0005 2018 HOH A O   
695 O O   . HOH B .  ? 0.3091 0.2882 0.2736 0.0112  0.0039  -0.0266 2019 HOH A O   
696 O O   . HOH B .  ? 0.4088 0.4073 0.3976 0.0046  0.0059  0.0000  2020 HOH A O   
697 O O   . HOH B .  ? 0.1465 0.1333 0.0955 -0.0178 0.0056  0.0115  2021 HOH A O   
698 O O   . HOH B .  ? 0.3531 0.3021 0.2379 -0.0078 0.0095  0.0185  2022 HOH A O   
699 O O   . HOH B .  ? 0.2206 0.2389 0.2336 -0.0244 -0.0060 0.0002  2023 HOH A O   
700 O O   . HOH B .  ? 0.3561 0.3600 0.3453 0.0086  0.0137  -0.0051 2024 HOH A O   
701 O O   . HOH B .  ? 0.3836 0.3738 0.3830 0.0019  0.0060  0.0056  2025 HOH A O   
702 O O   . HOH B .  ? 0.2899 0.2649 0.2181 0.0008  0.0292  -0.0148 2026 HOH A O   
703 O O   . HOH B .  ? 0.3415 0.3504 0.3552 -0.0059 0.0065  -0.0122 2027 HOH A O   
704 O O   . HOH B .  ? 0.3290 0.2980 0.2989 0.0046  -0.0020 0.0095  2028 HOH A O   
705 O O   . HOH B .  ? 0.2778 0.2324 0.1733 0.0150  0.0092  -0.0307 2029 HOH A O   
706 O O   . HOH B .  ? 0.4007 0.3796 0.3700 0.0078  0.0040  -0.0094 2030 HOH A O   
707 O O   . HOH B .  ? 0.2073 0.1813 0.2353 -0.0263 0.0234  -0.0242 2031 HOH A O   
708 O O   . HOH B .  ? 0.3682 0.3566 0.3530 -0.0022 -0.0069 0.0055  2032 HOH A O   
709 O O   . HOH B .  ? 0.2695 0.2851 0.1619 0.0014  -0.0020 -0.0130 2033 HOH A O   
710 O O   . HOH B .  ? 0.3839 0.3858 0.3422 -0.0026 -0.0025 0.0002  2034 HOH A O   
711 O O   . HOH B .  ? 0.4205 0.4152 0.4028 -0.0032 0.0009  -0.0033 2035 HOH A O   
712 O O   . HOH B .  ? 0.3821 0.3726 0.3583 -0.0012 0.0013  -0.0066 2036 HOH A O   
713 O O   . HOH B .  ? 0.2974 0.3558 0.2186 -0.0014 -0.0327 0.0164  2037 HOH A O   
714 O O   . HOH B .  ? 0.5971 0.5969 0.6031 0.0019  -0.0011 0.0004  2038 HOH A O   
715 O O   . HOH B .  ? 0.3871 0.3687 0.3497 -0.0049 -0.0034 -0.0135 2039 HOH A O   
716 O O   . HOH B .  ? 0.3540 0.3150 0.2833 0.0007  -0.0123 -0.0096 2040 HOH A O   
717 O O   . HOH B .  ? 0.2646 0.3014 0.2405 -0.0032 0.0111  0.0171  2041 HOH A O   
718 O O   . HOH B .  ? 0.1895 0.1644 0.2652 0.0063  0.0115  0.0255  2042 HOH A O   
719 O O   . HOH B .  ? 0.2146 0.2177 0.2171 -0.0031 -0.0119 -0.0230 2043 HOH A O   
720 O O   . HOH B .  ? 0.2719 0.2567 0.2689 -0.0375 -0.0246 0.0148  2044 HOH A O   
721 O O   . HOH B .  ? 0.2720 0.3124 0.3157 -0.0232 -0.0163 -0.0068 2045 HOH A O   
722 O O   . HOH B .  ? 0.4725 0.4766 0.4776 -0.0012 -0.0002 0.0009  2046 HOH A O   
723 O O   . HOH B .  ? 0.4216 0.4219 0.4397 0.0000  -0.0046 0.0056  2047 HOH A O   
724 O O   . HOH B .  ? 0.3274 0.2814 0.3069 -0.0036 -0.0248 0.0134  2048 HOH A O   
725 O O   . HOH B .  ? 0.2871 0.3021 0.2947 0.0106  0.0122  0.0225  2049 HOH A O   
726 O O   . HOH B .  ? 0.2654 0.2506 0.2277 -0.0100 -0.0296 0.0251  2050 HOH A O   
727 O O   . HOH B .  ? 0.1683 0.2810 0.0760 -0.0388 0.0355  0.0182  2051 HOH A O   
728 O O   . HOH B .  ? 0.1494 0.2177 0.3101 0.0143  0.0600  -0.0009 2052 HOH A O   
729 O O   . HOH B .  ? 0.1488 0.1468 0.0849 -0.0079 0.0316  0.0080  2053 HOH A O   
730 O O   . HOH B .  ? 0.2115 0.2162 0.1829 -0.0004 0.0170  -0.0063 2054 HOH A O   
731 O O   . HOH B .  ? 0.2666 0.1941 0.1273 -0.0184 -0.0577 0.0232  2055 HOH A O   
732 O O   . HOH B .  ? 0.2740 0.2872 0.2858 0.0081  0.0144  -0.0101 2056 HOH A O   
733 O O   . HOH B .  ? 0.3793 0.3799 0.3893 0.0004  -0.0043 0.0132  2057 HOH A O   
734 O O   . HOH B .  ? 0.2087 0.2662 0.1335 0.0034  0.0106  0.0248  2058 HOH A O   
735 O O   . HOH B .  ? 0.3179 0.2842 0.2606 -0.0002 -0.0005 -0.0017 2059 HOH A O   
736 O O   . HOH B .  ? 0.1641 0.1742 0.0764 -0.0011 0.0016  0.0017  2060 HOH A O   
737 O O   . HOH B .  ? 0.2493 0.2299 0.3275 0.0119  0.0099  -0.0261 2061 HOH A O   
738 O O   . HOH B .  ? 0.3483 0.3236 0.3715 -0.0076 0.0089  -0.0062 2062 HOH A O   
739 O O   . HOH B .  ? 0.3242 0.2726 0.3160 -0.0073 0.0097  0.0059  2063 HOH A O   
740 O O   . HOH B .  ? 0.3481 0.3240 0.3302 -0.0048 -0.0015 -0.0046 2064 HOH A O   
741 O O   . HOH B .  ? 0.1873 0.2121 0.0797 0.0152  -0.0027 0.0524  2065 HOH A O   
742 O O   . HOH B .  ? 0.2848 0.3056 0.3061 0.0093  -0.0014 -0.0257 2066 HOH A O   
743 O O   . HOH B .  ? 0.2580 0.1922 0.2396 -0.0079 0.0220  0.0060  2067 HOH A O   
744 O O   . HOH B .  ? 0.3463 0.3798 0.3574 0.0018  -0.0142 0.0074  2068 HOH A O   
745 O O   . HOH B .  ? 0.2258 0.2716 0.1480 0.0056  -0.0015 0.0298  2069 HOH A O   
746 O O   . HOH B .  ? 0.2658 0.1827 0.2137 -0.0014 0.0304  0.0025  2070 HOH A O   
747 O O   . HOH B .  ? 0.2465 0.2366 0.2250 0.0015  -0.0203 -0.0087 2071 HOH A O   
748 O O   . HOH B .  ? 0.3957 0.3723 0.3898 -0.0027 0.0104  0.0023  2072 HOH A O   
749 O O   . HOH B .  ? 0.3402 0.3576 0.3552 0.0074  -0.0048 -0.0008 2073 HOH A O   
750 O O   . HOH B .  ? 0.2161 0.2389 0.2579 0.0258  -0.0156 -0.0072 2074 HOH A O   
751 O O   . HOH B .  ? 0.1671 0.1758 0.0871 -0.0040 0.0121  -0.0003 2075 HOH A O   
752 O O   . HOH B .  ? 0.3134 0.2989 0.3245 -0.0132 0.0007  -0.0081 2076 HOH A O   
753 O O   . HOH B .  ? 0.2496 0.2904 0.1469 -0.0391 0.0084  0.0134  2077 HOH A O   
754 O O   . HOH B .  ? 0.3279 0.3384 0.3051 -0.0002 -0.0028 0.0014  2078 HOH A O   
755 O O   . HOH B .  ? 0.1494 0.1159 0.1541 0.0123  0.0045  0.0195  2079 HOH A O   
756 O O   . HOH B .  ? 0.4912 0.4929 0.4892 0.0006  -0.0012 0.0019  2080 HOH A O   
757 O O   . HOH B .  ? 0.4606 0.4629 0.4644 -0.0089 0.0043  -0.0010 2081 HOH A O   
758 O O   . HOH B .  ? 0.2898 0.3276 0.3655 -0.0055 0.0140  0.0253  2082 HOH A O   
759 O O   . HOH B .  ? 0.3357 0.3388 0.3459 0.0019  0.0147  0.0251  2083 HOH A O   
760 O O   . HOH B .  ? 0.2631 0.3026 0.2176 -0.0131 0.0044  0.0132  2084 HOH A O   
761 O O   . HOH B .  ? 0.3920 0.3896 0.3949 0.0032  -0.0138 -0.0061 2085 HOH A O   
762 O O   . HOH B .  ? 0.3563 0.3876 0.3795 0.0063  -0.0029 -0.0033 2086 HOH A O   
763 O O   . HOH B .  ? 0.2542 0.2740 0.2869 0.0012  -0.0022 0.0204  2087 HOH A O   
764 O O   . HOH B .  ? 0.2157 0.2771 0.2742 -0.0228 -0.0110 -0.0009 2088 HOH A O   
765 O O   . HOH B .  ? 0.2234 0.2621 0.2521 0.0175  -0.0001 0.0123  2089 HOH A O   
766 O O   . HOH B .  ? 0.2089 0.2334 0.2932 -0.0035 0.0207  0.0267  2090 HOH A O   
767 O O   . HOH B .  ? 0.3185 0.2656 0.2127 0.0056  -0.0049 0.0047  2091 HOH A O   
768 O O   . HOH B .  ? 0.2482 0.2342 0.2136 -0.0088 -0.0309 0.0031  2092 HOH A O   
769 O O   . HOH B .  ? 0.2891 0.1894 0.1742 0.0101  -0.0108 -0.0026 2093 HOH A O   
770 O O   . HOH B .  ? 0.1763 0.1548 0.0912 -0.0074 -0.0290 -0.0221 2094 HOH A O   
771 O O   . HOH B .  ? 0.3384 0.3266 0.3461 -0.0069 0.0107  -0.0096 2095 HOH A O   
772 O O   . HOH B .  ? 0.4097 0.4140 0.3886 -0.0083 0.0044  -0.0053 2096 HOH A O   
773 O O   . HOH B .  ? 0.2907 0.2572 0.2566 0.0091  0.0150  -0.0129 2097 HOH A O   
774 O O   . HOH B .  ? 0.2266 0.2877 0.0727 -0.0034 0.0077  -0.0241 2098 HOH A O   
775 O O   . HOH B .  ? 0.2743 0.2648 0.2281 0.0163  0.0266  -0.0206 2099 HOH A O   
776 O O   . HOH B .  ? 0.3252 0.2982 0.3062 0.0031  -0.0120 0.0132  2100 HOH A O   
777 O O   . HOH B .  ? 0.2579 0.2522 0.2571 0.0102  0.0283  -0.0010 2101 HOH A O   
778 O O   . HOH B .  ? 0.2836 0.2663 0.2461 0.0261  0.0186  -0.0612 2102 HOH A O   
779 O O   . HOH B .  ? 0.3672 0.3930 0.3896 0.0006  0.0024  0.0032  2103 HOH A O   
780 O O   . HOH B .  ? 0.3325 0.3737 0.3268 0.0212  -0.0115 -0.0001 2104 HOH A O   
781 O O   . HOH B .  ? 0.2460 0.3299 0.3286 0.0100  0.0023  0.0050  2105 HOH A O   
782 O O   . HOH B .  ? 0.2501 0.3235 0.2923 -0.0132 -0.0049 -0.0201 2106 HOH A O   
783 O O   . HOH B .  ? 0.2836 0.1997 0.1684 -0.0130 -0.0317 0.0100  2107 HOH A O   
784 O O   . HOH B .  ? 0.2883 0.2558 0.3062 0.0011  0.0216  0.0137  2108 HOH A O   
785 O O   . HOH B .  ? 0.3358 0.3287 0.3142 -0.0025 -0.0177 -0.0006 2109 HOH A O   
786 O O   . HOH B .  ? 0.3676 0.3525 0.2917 0.0091  0.0077  -0.0022 2110 HOH A O   
787 O O   . HOH B .  ? 0.2942 0.2616 0.1815 -0.0016 -0.0168 0.0073  2111 HOH A O   
788 O O   . HOH B .  ? 0.4601 0.4565 0.4503 -0.0018 -0.0029 -0.0016 2112 HOH A O   
789 O O   . HOH B .  ? 0.2049 0.2352 0.1930 0.0222  -0.0299 0.0219  2113 HOH A O   
790 O O   . HOH B .  ? 0.2859 0.2698 0.2518 -0.0086 -0.0083 -0.0040 2114 HOH A O   
791 O O   . HOH B .  ? 0.5608 0.5546 0.5560 -0.0004 0.0030  -0.0037 2115 HOH A O   
792 O O   . HOH B .  ? 0.2860 0.2726 0.2773 -0.0020 -0.0158 0.0164  2116 HOH A O   
793 O O   . HOH B .  ? 0.2440 0.2509 0.2301 -0.0175 -0.0137 -0.0081 2117 HOH A O   
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  MET 1  0  0  MET MET A . n 
A 1 2  LEU 2  1  1  LEU LEU A . n 
A 1 3  GLN 3  2  2  GLN GLN A . n 
A 1 4  CYS 4  3  3  CYS CYS A . n 
A 1 5  TYR 5  4  4  TYR TYR A . n 
A 1 6  ASN 6  5  5  ASN ASN A . n 
A 1 7  CYS 7  6  6  CYS CYS A . n 
A 1 8  PRO 8  7  7  PRO PRO A . n 
A 1 9  ASN 9  8  8  ASN ASN A . n 
A 1 10 PRO 10 9  9  PRO PRO A . n 
A 1 11 THR 11 10 10 THR THR A . n 
A 1 12 ALA 12 11 11 ALA ALA A . n 
A 1 13 ASP 13 12 12 ASP ASP A . n 
A 1 14 CYS 14 13 13 CYS CYS A . n 
A 1 15 LYS 15 14 14 LYS LYS A . n 
A 1 16 THR 16 15 15 THR THR A . n 
A 1 17 ALA 17 16 16 ALA ALA A . n 
A 1 18 VAL 18 17 17 VAL VAL A . n 
A 1 19 ASN 19 18 18 ASN ASN A . n 
A 1 20 CYS 20 19 19 CYS CYS A . n 
A 1 21 SER 21 20 20 SER SER A . n 
A 1 22 SER 22 21 21 SER SER A . n 
A 1 23 ASP 23 22 22 ASP ASP A . n 
A 1 24 PHE 24 23 23 PHE PHE A . n 
A 1 25 ASP 25 24 24 ASP ASP A . n 
A 1 26 ALA 26 25 25 ALA ALA A . n 
A 1 27 CYS 27 26 26 CYS CYS A . n 
A 1 28 LEU 28 27 27 LEU LEU A . n 
A 1 29 ILE 29 28 28 ILE ILE A . n 
A 1 30 THR 30 29 29 THR THR A . n 
A 1 31 LYS 31 30 30 LYS LYS A . n 
A 1 32 ALA 32 31 31 ALA ALA A . n 
A 1 33 GLY 33 32 32 GLY GLY A . n 
A 1 34 LEU 34 33 33 LEU LEU A . n 
A 1 35 GLN 35 34 34 GLN GLN A . n 
A 1 36 VAL 36 35 35 VAL VAL A . n 
A 1 37 TYR 37 36 36 TYR TYR A . n 
A 1 38 ASN 38 37 37 ASN ASN A . n 
A 1 39 LYS 39 38 38 LYS LYS A . n 
A 1 40 CYS 40 39 39 CYS CYS A . n 
A 1 41 TRP 41 40 40 TRP TRP A . n 
A 1 42 LYS 42 41 41 LYS LYS A . n 
A 1 43 PHE 43 42 42 PHE PHE A . n 
A 1 44 GLU 44 43 43 GLU GLU A . n 
A 1 45 HIS 45 44 44 HIS HIS A . n 
A 1 46 CYS 46 45 45 CYS CYS A . n 
A 1 47 ASN 47 46 46 ASN ASN A . n 
A 1 48 PHE 48 47 47 PHE PHE A . n 
A 1 49 ASN 49 48 48 ASN ASN A . n 
A 1 50 ASP 50 49 49 ASP ASP A . n 
A 1 51 VAL 51 50 50 VAL VAL A . n 
A 1 52 THR 52 51 51 THR THR A . n 
A 1 53 THR 53 52 52 THR THR A . n 
A 1 54 ARG 54 53 53 ARG ARG A . n 
A 1 55 LEU 55 54 54 LEU LEU A . n 
A 1 56 ARG 56 55 55 ARG ARG A . n 
A 1 57 GLU 57 56 56 GLU GLU A . n 
A 1 58 ASN 58 57 57 ASN ASN A . n 
A 1 59 GLU 59 58 58 GLU GLU A . n 
A 1 60 LEU 60 59 59 LEU LEU A . n 
A 1 61 THR 61 60 60 THR THR A . n 
A 1 62 TYR 62 61 61 TYR TYR A . n 
A 1 63 TYR 63 62 62 TYR TYR A . n 
A 1 64 CYS 64 63 63 CYS CYS A . n 
A 1 65 CYS 65 64 64 CYS CYS A . n 
A 1 66 LYS 66 65 65 LYS LYS A . n 
A 1 67 LYS 67 66 66 LYS LYS A . n 
A 1 68 ASP 68 67 67 ASP ASP A . n 
A 1 69 LEU 69 68 68 LEU LEU A . n 
A 1 70 CYS 70 69 69 CYS CYS A . n 
A 1 71 ASN 71 70 70 ASN ASN A . n 
A 1 72 PHE 72 71 71 PHE PHE A . n 
A 1 73 ASN 73 72 72 ASN ASN A . n 
A 1 74 GLU 74 73 73 GLU GLU A . n 
A 1 75 GLN 75 74 74 GLN GLN A . n 
A 1 76 LEU 76 75 75 LEU LEU A . n 
A 1 77 GLU 77 76 76 GLU GLU A . n 
A 1 78 ASN 78 77 77 ASN ASN A . n 
A 1 79 GLY 79 78 ?  ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 HOH 1   2001 2001 HOH HOH A . 
B 2 HOH 2   2002 2002 HOH HOH A . 
B 2 HOH 3   2003 2003 HOH HOH A . 
B 2 HOH 4   2004 2004 HOH HOH A . 
B 2 HOH 5   2005 2005 HOH HOH A . 
B 2 HOH 6   2006 2006 HOH HOH A . 
B 2 HOH 7   2007 2007 HOH HOH A . 
B 2 HOH 8   2008 2008 HOH HOH A . 
B 2 HOH 9   2009 2009 HOH HOH A . 
B 2 HOH 10  2010 2010 HOH HOH A . 
B 2 HOH 11  2011 2011 HOH HOH A . 
B 2 HOH 12  2012 2012 HOH HOH A . 
B 2 HOH 13  2013 2013 HOH HOH A . 
B 2 HOH 14  2014 2014 HOH HOH A . 
B 2 HOH 15  2015 2015 HOH HOH A . 
B 2 HOH 16  2016 2016 HOH HOH A . 
B 2 HOH 17  2017 2017 HOH HOH A . 
B 2 HOH 18  2018 2018 HOH HOH A . 
B 2 HOH 19  2019 2019 HOH HOH A . 
B 2 HOH 20  2020 2020 HOH HOH A . 
B 2 HOH 21  2021 2021 HOH HOH A . 
B 2 HOH 22  2022 2022 HOH HOH A . 
B 2 HOH 23  2023 2023 HOH HOH A . 
B 2 HOH 24  2024 2024 HOH HOH A . 
B 2 HOH 25  2025 2025 HOH HOH A . 
B 2 HOH 26  2026 2026 HOH HOH A . 
B 2 HOH 27  2027 2027 HOH HOH A . 
B 2 HOH 28  2028 2028 HOH HOH A . 
B 2 HOH 29  2029 2029 HOH HOH A . 
B 2 HOH 30  2030 2030 HOH HOH A . 
B 2 HOH 31  2031 2031 HOH HOH A . 
B 2 HOH 32  2032 2032 HOH HOH A . 
B 2 HOH 33  2033 2033 HOH HOH A . 
B 2 HOH 34  2034 2034 HOH HOH A . 
B 2 HOH 35  2035 2035 HOH HOH A . 
B 2 HOH 36  2036 2036 HOH HOH A . 
B 2 HOH 37  2037 2037 HOH HOH A . 
B 2 HOH 38  2038 2038 HOH HOH A . 
B 2 HOH 39  2039 2039 HOH HOH A . 
B 2 HOH 40  2040 2040 HOH HOH A . 
B 2 HOH 41  2041 2041 HOH HOH A . 
B 2 HOH 42  2042 2042 HOH HOH A . 
B 2 HOH 43  2043 2043 HOH HOH A . 
B 2 HOH 44  2044 2044 HOH HOH A . 
B 2 HOH 45  2045 2045 HOH HOH A . 
B 2 HOH 46  2046 2046 HOH HOH A . 
B 2 HOH 47  2047 2047 HOH HOH A . 
B 2 HOH 48  2048 2048 HOH HOH A . 
B 2 HOH 49  2049 2049 HOH HOH A . 
B 2 HOH 50  2050 2050 HOH HOH A . 
B 2 HOH 51  2051 2051 HOH HOH A . 
B 2 HOH 52  2052 2052 HOH HOH A . 
B 2 HOH 53  2053 2053 HOH HOH A . 
B 2 HOH 54  2054 2054 HOH HOH A . 
B 2 HOH 55  2055 2055 HOH HOH A . 
B 2 HOH 56  2056 2056 HOH HOH A . 
B 2 HOH 57  2057 2057 HOH HOH A . 
B 2 HOH 58  2058 2058 HOH HOH A . 
B 2 HOH 59  2059 2059 HOH HOH A . 
B 2 HOH 60  2060 2060 HOH HOH A . 
B 2 HOH 61  2061 2061 HOH HOH A . 
B 2 HOH 62  2062 2062 HOH HOH A . 
B 2 HOH 63  2063 2063 HOH HOH A . 
B 2 HOH 64  2064 2064 HOH HOH A . 
B 2 HOH 65  2065 2065 HOH HOH A . 
B 2 HOH 66  2066 2066 HOH HOH A . 
B 2 HOH 67  2067 2067 HOH HOH A . 
B 2 HOH 68  2068 2068 HOH HOH A . 
B 2 HOH 69  2069 2069 HOH HOH A . 
B 2 HOH 70  2070 2070 HOH HOH A . 
B 2 HOH 71  2071 2071 HOH HOH A . 
B 2 HOH 72  2072 2072 HOH HOH A . 
B 2 HOH 73  2073 2073 HOH HOH A . 
B 2 HOH 74  2074 2074 HOH HOH A . 
B 2 HOH 75  2075 2075 HOH HOH A . 
B 2 HOH 76  2076 2076 HOH HOH A . 
B 2 HOH 77  2077 2077 HOH HOH A . 
B 2 HOH 78  2078 2078 HOH HOH A . 
B 2 HOH 79  2079 2079 HOH HOH A . 
B 2 HOH 80  2080 2080 HOH HOH A . 
B 2 HOH 81  2081 2081 HOH HOH A . 
B 2 HOH 82  2082 2082 HOH HOH A . 
B 2 HOH 83  2083 2083 HOH HOH A . 
B 2 HOH 84  2084 2084 HOH HOH A . 
B 2 HOH 85  2085 2085 HOH HOH A . 
B 2 HOH 86  2086 2086 HOH HOH A . 
B 2 HOH 87  2087 2087 HOH HOH A . 
B 2 HOH 88  2088 2088 HOH HOH A . 
B 2 HOH 89  2089 2089 HOH HOH A . 
B 2 HOH 90  2090 2090 HOH HOH A . 
B 2 HOH 91  2091 2091 HOH HOH A . 
B 2 HOH 92  2092 2092 HOH HOH A . 
B 2 HOH 93  2093 2093 HOH HOH A . 
B 2 HOH 94  2094 2094 HOH HOH A . 
B 2 HOH 95  2095 2095 HOH HOH A . 
B 2 HOH 96  2096 2096 HOH HOH A . 
B 2 HOH 97  2097 2097 HOH HOH A . 
B 2 HOH 98  2098 2098 HOH HOH A . 
B 2 HOH 99  2099 2099 HOH HOH A . 
B 2 HOH 100 2100 2100 HOH HOH A . 
B 2 HOH 101 2101 2101 HOH HOH A . 
B 2 HOH 102 2102 2102 HOH HOH A . 
B 2 HOH 103 2103 2103 HOH HOH A . 
B 2 HOH 104 2104 2104 HOH HOH A . 
B 2 HOH 105 2105 2105 HOH HOH A . 
B 2 HOH 106 2106 2106 HOH HOH A . 
B 2 HOH 107 2107 2107 HOH HOH A . 
B 2 HOH 108 2108 2108 HOH HOH A . 
B 2 HOH 109 2109 2109 HOH HOH A . 
B 2 HOH 110 2110 2110 HOH HOH A . 
B 2 HOH 111 2111 2111 HOH HOH A . 
B 2 HOH 112 2112 2112 HOH HOH A . 
B 2 HOH 113 2113 2113 HOH HOH A . 
B 2 HOH 114 2114 2114 HOH HOH A . 
B 2 HOH 115 2115 2115 HOH HOH A . 
B 2 HOH 116 2116 2116 HOH HOH A . 
B 2 HOH 117 2117 2117 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PQS 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2007-08-07 
2 'Structure model' 1 1 2011-05-08 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2017-10-18 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Data collection'           
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' diffrn        
2 4 'Structure model' diffrn_source 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
_software.date 
_software.type 
_software.location 
_software.language 
REFMAC refinement       5.2.0019 ? 1 ? ? ? ? 
MOSFLM 'data reduction' .        ? 2 ? ? ? ? 
SCALA  'data scaling'   .        ? 3 ? ? ? ? 
MOLREP phasing          .        ? 4 ? ? ? ? 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 O   A HOH 2082 ? ? O A HOH 2086 ? ? 1.75 
2 1 NZ  A LYS 65   ? ? O A HOH 2101 ? ? 1.83 
3 1 O   A HOH 2101 ? ? O A HOH 2103 ? ? 1.83 
4 1 OE1 A GLU 58   ? ? O A HOH 2090 ? ? 1.89 
5 1 O   A HOH 2055 ? ? O A HOH 2113 ? ? 2.07 
6 1 O   A HOH 2030 ? ? O A HOH 2063 ? ? 2.11 
# 
loop_
_pdbx_validate_symm_contact.id 
_pdbx_validate_symm_contact.PDB_model_num 
_pdbx_validate_symm_contact.auth_atom_id_1 
_pdbx_validate_symm_contact.auth_asym_id_1 
_pdbx_validate_symm_contact.auth_comp_id_1 
_pdbx_validate_symm_contact.auth_seq_id_1 
_pdbx_validate_symm_contact.PDB_ins_code_1 
_pdbx_validate_symm_contact.label_alt_id_1 
_pdbx_validate_symm_contact.site_symmetry_1 
_pdbx_validate_symm_contact.auth_atom_id_2 
_pdbx_validate_symm_contact.auth_asym_id_2 
_pdbx_validate_symm_contact.auth_comp_id_2 
_pdbx_validate_symm_contact.auth_seq_id_2 
_pdbx_validate_symm_contact.PDB_ins_code_2 
_pdbx_validate_symm_contact.label_alt_id_2 
_pdbx_validate_symm_contact.site_symmetry_2 
_pdbx_validate_symm_contact.dist 
1 1 O A HOH 2054 ? ? 1_555 O A HOH 2093 ? ? 4_446 1.33 
2 1 O A HOH 2016 ? ? 1_555 O A HOH 2107 ? ? 3_545 1.52 
3 1 O A HOH 2049 ? ? 1_555 O A HOH 2087 ? ? 1_455 2.00 
4 1 O A HOH 2041 ? ? 1_555 O A HOH 2103 ? ? 1_655 2.10 
# 
_pdbx_unobs_or_zero_occ_residues.id               1 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num    1 
_pdbx_unobs_or_zero_occ_residues.polymer_flag     Y 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag   1 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id     A 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id     GLY 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id      78 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code     ? 
_pdbx_unobs_or_zero_occ_residues.label_asym_id    A 
_pdbx_unobs_or_zero_occ_residues.label_comp_id    GLY 
_pdbx_unobs_or_zero_occ_residues.label_seq_id     79 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#