data_2JM5
# 
_entry.id   2JM5 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.321 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2JM5         
RCSB  RCSB100005   
WWPDB D_1000100005 
BMRB  7106         
# 
_pdbx_database_PDB_obs_spr.id               SPRSDE 
_pdbx_database_PDB_obs_spr.date             2012-06-20 
_pdbx_database_PDB_obs_spr.pdb_id           2JM5 
_pdbx_database_PDB_obs_spr.replace_pdb_id   2H33 
_pdbx_database_PDB_obs_spr.details          ? 
# 
loop_
_pdbx_database_related.db_id 
_pdbx_database_related.db_name 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
7106 BMRB 'chemical shift assignments' unspecified 
2owi PDB  .                            unspecified 
# 
_pdbx_database_status.deposit_site                    . 
_pdbx_database_status.entry_id                        2JM5 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2006-10-11 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  REL 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Higman, V.A.'                         1  
'Leidert, M.'                          2  
'Bray, J.'                             3  
'Elkins, J.'                           4  
'Soundararajan, M.'                    5  
'Doyle, D.A.'                          6  
'Gileadi, C.'                          7  
'Phillips, C.'                         8  
'Schoch, G.'                           9  
'Yang, X.'                             10 
'Brockmann, C.'                        11 
'Schmieder, P.'                        12 
'Diehl, A.'                            13 
'Sundstrom, M.'                        14 
'Arrowsmith, C.'                       15 
'Weigelt, J.'                          16 
'Edwards, A.'                          17 
'Oschkinat, H.'                        18 
'Ball, L.J.'                           19 
'Structural Genomics Consortium (SGC)' 20 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Structural diversity in the RGS domain and its interaction with heterotrimeric G protein alpha-subunits.' 
Proc.Natl.Acad.Sci.Usa 105 6457 6462 2008 PNASA6 US 0027-8424 0040 ? 18434541 10.1073/pnas.0801508105 
1       'NMR assignment of human RGS18'                                                                            
'To be Published'      ?   ?    ?    ?    ?      ?  ?         0353 ? ?        ?                       
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Soundararajan, M.' 1  ? 
primary 'Willard, F.S.'     2  ? 
primary 'Kimple, A.J.'      3  ? 
primary 'Turnbull, A.P.'    4  ? 
primary 'Ball, L.J.'        5  ? 
primary 'Schoch, G.A.'      6  ? 
primary 'Gileadi, C.'       7  ? 
primary 'Fedorov, O.Y.'     8  ? 
primary 'Dowler, E.F.'      9  ? 
primary 'Higman, V.A.'      10 ? 
primary 'Hutsell, S.Q.'     11 ? 
primary 'Sundstrom, M.'     12 ? 
primary 'Doyle, D.A.'       13 ? 
primary 'Siderovski, D.P.'  14 ? 
1       'Higman, V.A.'      15 ? 
1       'Leidert, M.'       16 ? 
1       'Diehl, A.'         17 ? 
1       'Elkins, J.'        18 ? 
1       'Soundararajan, M.' 19 ? 
1       'Edwards, H.'       20 ? 
1       'Ball, L.J.'        21 ? 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'Regulator of G-protein signaling 18' 
_entity.formula_weight             17786.023 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              'RGS domain, residues 75-223' 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        RGS18 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;SMVSPEEAVKWGESFDKLLSHRDGLEAFTRFLKTEFSEENIEFWIACEDFKKSKGPQQIHLKAKAIYEKFIQTDAPKEVN
LDFHTKEVITNSITQPTLHSFDAAQSRVYQLMEQDSYTRFLKSDIYLDLMEGRPQRPTNLRRRSRSFTCNE
;
_entity_poly.pdbx_seq_one_letter_code_can   
;SMVSPEEAVKWGESFDKLLSHRDGLEAFTRFLKTEFSEENIEFWIACEDFKKSKGPQQIHLKAKAIYEKFIQTDAPKEVN
LDFHTKEVITNSITQPTLHSFDAAQSRVYQLMEQDSYTRFLKSDIYLDLMEGRPQRPTNLRRRSRSFTCNE
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   MET n 
1 3   VAL n 
1 4   SER n 
1 5   PRO n 
1 6   GLU n 
1 7   GLU n 
1 8   ALA n 
1 9   VAL n 
1 10  LYS n 
1 11  TRP n 
1 12  GLY n 
1 13  GLU n 
1 14  SER n 
1 15  PHE n 
1 16  ASP n 
1 17  LYS n 
1 18  LEU n 
1 19  LEU n 
1 20  SER n 
1 21  HIS n 
1 22  ARG n 
1 23  ASP n 
1 24  GLY n 
1 25  LEU n 
1 26  GLU n 
1 27  ALA n 
1 28  PHE n 
1 29  THR n 
1 30  ARG n 
1 31  PHE n 
1 32  LEU n 
1 33  LYS n 
1 34  THR n 
1 35  GLU n 
1 36  PHE n 
1 37  SER n 
1 38  GLU n 
1 39  GLU n 
1 40  ASN n 
1 41  ILE n 
1 42  GLU n 
1 43  PHE n 
1 44  TRP n 
1 45  ILE n 
1 46  ALA n 
1 47  CYS n 
1 48  GLU n 
1 49  ASP n 
1 50  PHE n 
1 51  LYS n 
1 52  LYS n 
1 53  SER n 
1 54  LYS n 
1 55  GLY n 
1 56  PRO n 
1 57  GLN n 
1 58  GLN n 
1 59  ILE n 
1 60  HIS n 
1 61  LEU n 
1 62  LYS n 
1 63  ALA n 
1 64  LYS n 
1 65  ALA n 
1 66  ILE n 
1 67  TYR n 
1 68  GLU n 
1 69  LYS n 
1 70  PHE n 
1 71  ILE n 
1 72  GLN n 
1 73  THR n 
1 74  ASP n 
1 75  ALA n 
1 76  PRO n 
1 77  LYS n 
1 78  GLU n 
1 79  VAL n 
1 80  ASN n 
1 81  LEU n 
1 82  ASP n 
1 83  PHE n 
1 84  HIS n 
1 85  THR n 
1 86  LYS n 
1 87  GLU n 
1 88  VAL n 
1 89  ILE n 
1 90  THR n 
1 91  ASN n 
1 92  SER n 
1 93  ILE n 
1 94  THR n 
1 95  GLN n 
1 96  PRO n 
1 97  THR n 
1 98  LEU n 
1 99  HIS n 
1 100 SER n 
1 101 PHE n 
1 102 ASP n 
1 103 ALA n 
1 104 ALA n 
1 105 GLN n 
1 106 SER n 
1 107 ARG n 
1 108 VAL n 
1 109 TYR n 
1 110 GLN n 
1 111 LEU n 
1 112 MET n 
1 113 GLU n 
1 114 GLN n 
1 115 ASP n 
1 116 SER n 
1 117 TYR n 
1 118 THR n 
1 119 ARG n 
1 120 PHE n 
1 121 LEU n 
1 122 LYS n 
1 123 SER n 
1 124 ASP n 
1 125 ILE n 
1 126 TYR n 
1 127 LEU n 
1 128 ASP n 
1 129 LEU n 
1 130 MET n 
1 131 GLU n 
1 132 GLY n 
1 133 ARG n 
1 134 PRO n 
1 135 GLN n 
1 136 ARG n 
1 137 PRO n 
1 138 THR n 
1 139 ASN n 
1 140 LEU n 
1 141 ARG n 
1 142 ARG n 
1 143 ARG n 
1 144 SER n 
1 145 ARG n 
1 146 SER n 
1 147 PHE n 
1 148 THR n 
1 149 CYS n 
1 150 ASN n 
1 151 GLU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 'RGS18, RGS13' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21 (DE3) - Rosetta' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   'BL21 (DE3) strain enriched with genes that encode rare tRNAs' 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    RGS18_HUMAN 
_struct_ref.pdbx_db_accession          Q9NS28 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_align_begin           75 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2JM5 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 3 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 151 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q9NS28 
_struct_ref_seq.db_align_beg                  75 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  223 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       3 
_struct_ref_seq.pdbx_auth_seq_align_end       151 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2JM5 SER A 1 ? UNP Q9NS28 ? ? 'cloning artifact' 1 1 
1 2JM5 MET A 2 ? UNP Q9NS28 ? ? 'cloning artifact' 2 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.type 
1 1  2 '2D 1H-15N HSQC'       
1 2  2 '3D HNCO'              
1 3  2 '3D CBCA(CO)NNH'       
1 4  2 '3D CBCACONNH'         
1 5  2 '3D HN(CA)CO'          
1 6  2 '3D H(CCO)NNH'         
1 7  2 '3D HBHA(CO)NNH'       
1 8  2 '3D HCCH-TOCSY'        
1 9  2 '3D HCCH-COSY'         
1 10 1 '3D 1H-15N NOESY HSQC' 
1 11 2 '3D 1H-13C NOESY HSQC' 
1 12 3 '3D 1H-13C HMQC NOESY' 
1 13 3 '2D 1H-13C HSQC'       
1 14 3 '2D TOCSY'             
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      ? 
_pdbx_nmr_exptl_sample_conditions.pH                  6.0 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.temperature         297 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
loop_
_pdbx_nmr_sample_details.contents 
_pdbx_nmr_sample_details.solution_id 
_pdbx_nmr_sample_details.solvent_system 
'1 mM [U-95% 15N] RGS18, 20 mM sodium phosphate, 50 mM sodium chloride, 10 % D2O, 1 mM [U-99% 2H] DTT, 0.02 % sodium azide' 1 
'90% H2O/10% D2O' 
;1 mM [U-95% 13C; U-95% 15N] RGS18, 20 mM potassium phosphate, 50 mM sodium chloride, 10 % D2O, 1 mM [U-99% 2H] DTT, 0.02 % sodium azide
;
2 '90% H2O/10% D2O' 
;1 mM [U-95% 13C; U-95% 15N] RGS18, 20 mM potassium phosphate, 50 mM sodium chloride, 100 % D2O, 1 mM [U-99% 2H] DTT, 0.02 % sodium azide
;
3 '100% D2O'        
# 
loop_
_pdbx_nmr_spectrometer.field_strength 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.type 
600 Bruker DRX 1 'Bruker DRX' 
750 Bruker DMX 2 'Bruker DMX' 
600 Bruker DRX 3 'Bruker DRX' 
# 
_pdbx_nmr_refine.details            
;NOE ASSIGNMENT WITH CYANA, REFINEMENT BY SIMULATED ANNEALING IN XPLOR-NIH USING NOE RESTRAINTS AND H-BOND RESTRAINTS FROM H/D EXCHANGE DATA. WATER-REFINEMENT BY MOLECULAR DYNAMICS IN XPLOR-NIH. THE C-TERMINAL TAIL HAS BEEN TRUNCATED PAST RESIDUE 134 BECAUSE OF FLEXIBILITY AND LACK OF STRUCTURE IN THIS REGION. THIS IS INDICATED (A) BY A LACK OF NOE RESTRAINTS PAST RESIDUE 132 AND (B) BY 15N T1, T2 AND HETERONCULEAR NOE EXPERIMENTS RESIDUE 131 ONWARDS.
;
_pdbx_nmr_refine.entry_id           2JM5 
_pdbx_nmr_refine.method             'simulated annealing, molecular dynamics' 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'lowest energy' 
_pdbx_nmr_ensemble.conformers_calculated_total_number            200 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.entry_id                                      2JM5 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.entry_id             2JM5 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_software.authors 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.ordinal 
'Bruker Biospin'                                                      collection           XwinNMR           '2.6 and 3.1' 1 
'Bruker Biospin'                                                      processing           XwinNMR           '2.6 and 3.1' 2 
Vranken,Boucher,Stevens,Fogh,Pajon,Llinas,Ulrich,Markley,Ionides,Laue processing           'CcpNmr Analysis' 1.0.9-10      3 
Vranken,Boucher,Stevens,Fogh,Pajon,Llinas,Ulrich,Markley,Ionides,Laue 'data analysis'      'CcpNmr Analysis' 1.0.9-10      4 
Guntert,Mumenthaler,Wuthrich                                          'structure solution' CYANA             2.0           5 
Schwieters,Kuszewski,Tjandra,Clore                                    'structure solution' 'X-PLOR NIH'      2.14          6 
Schwieters,Kuszewski,Tjandra,Clore                                    refinement           'X-PLOR NIH'      2.14          7 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.entry_id                   2JM5 
_exptl.method                     'SOLUTION NMR' 
_exptl.method_details             ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      ? 
_exptl_crystal.density_percent_sol   ? 
_exptl_crystal.description           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_struct.entry_id                  2JM5 
_struct.title                     'Solution Structure of the RGS domain from human RGS18' 
_struct.pdbx_descriptor           'Regulator of G-protein signaling 18' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2JM5 
_struct_keywords.pdbx_keywords   'SIGNALING PROTEIN' 
_struct_keywords.text            'signaling protein, Structural Genomics, Structural Genomics Consortium, SGC' 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 SER A 4   ? GLY A 12  ? SER A 4   GLY A 12  1 ? 9  
HELX_P HELX_P2 2 SER A 14  ? HIS A 21  ? SER A 14  HIS A 21  1 ? 8  
HELX_P HELX_P3 3 HIS A 21  ? GLU A 35  ? HIS A 21  GLU A 35  1 ? 15 
HELX_P HELX_P4 4 ASN A 40  ? LYS A 52  ? ASN A 40  LYS A 52  1 ? 13 
HELX_P HELX_P5 5 GLY A 55  ? PHE A 70  ? GLY A 55  PHE A 70  1 ? 16 
HELX_P HELX_P6 6 ASP A 82  ? ILE A 93  ? ASP A 82  ILE A 93  1 ? 12 
HELX_P HELX_P7 7 PHE A 101 ? LYS A 122 ? PHE A 101 LYS A 122 1 ? 22 
HELX_P HELX_P8 8 SER A 123 ? GLU A 131 ? SER A 123 GLU A 131 1 ? 9  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_atom_sites.entry_id                    2JM5 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . SER A 1 1   ? 138.415 3.968   9.390   1.00 0.00 ? 1   SER A N    1  
ATOM 2     C CA   . SER A 1 1   ? 138.458 4.242   7.980   1.00 0.00 ? 1   SER A CA   1  
ATOM 3     C C    . SER A 1 1   ? 139.716 5.014   7.625   1.00 0.00 ? 1   SER A C    1  
ATOM 4     O O    . SER A 1 1   ? 140.045 6.016   8.259   1.00 0.00 ? 1   SER A O    1  
ATOM 5     C CB   . SER A 1 1   ? 137.207 5.008   7.560   1.00 0.00 ? 1   SER A CB   1  
ATOM 6     O OG   . SER A 1 1   ? 136.029 4.256   7.871   1.00 0.00 ? 1   SER A OG   1  
ATOM 7     H H1   . SER A 1 1   ? 138.433 4.864   9.925   1.00 0.00 ? 1   SER A H1   1  
ATOM 8     H H2   . SER A 1 1   ? 139.247 3.387   9.629   1.00 0.00 ? 1   SER A H2   1  
ATOM 9     H H3   . SER A 1 1   ? 137.559 3.426   9.634   1.00 0.00 ? 1   SER A H3   1  
ATOM 10    H HA   . SER A 1 1   ? 138.479 3.297   7.457   1.00 0.00 ? 1   SER A HA   1  
ATOM 11    H HB2  . SER A 1 1   ? 137.168 5.952   8.084   1.00 0.00 ? 1   SER A HB2  1  
ATOM 12    H HB3  . SER A 1 1   ? 137.232 5.186   6.496   1.00 0.00 ? 1   SER A HB3  1  
ATOM 13    H HG   . SER A 1 1   ? 136.197 3.326   7.642   1.00 0.00 ? 1   SER A HG   1  
ATOM 14    N N    . MET A 1 2   ? 140.425 4.529   6.640   1.00 0.00 ? 2   MET A N    1  
ATOM 15    C CA   . MET A 1 2   ? 141.631 5.168   6.173   1.00 0.00 ? 2   MET A CA   1  
ATOM 16    C C    . MET A 1 2   ? 141.718 5.019   4.669   1.00 0.00 ? 2   MET A C    1  
ATOM 17    O O    . MET A 1 2   ? 142.133 3.979   4.162   1.00 0.00 ? 2   MET A O    1  
ATOM 18    C CB   . MET A 1 2   ? 142.875 4.569   6.859   1.00 0.00 ? 2   MET A CB   1  
ATOM 19    C CG   . MET A 1 2   ? 144.196 5.204   6.432   1.00 0.00 ? 2   MET A CG   1  
ATOM 20    S SD   . MET A 1 2   ? 145.634 4.489   7.274   1.00 0.00 ? 2   MET A SD   1  
ATOM 21    C CE   . MET A 1 2   ? 145.523 2.776   6.739   1.00 0.00 ? 2   MET A CE   1  
ATOM 22    H H    . MET A 1 2   ? 140.109 3.703   6.198   1.00 0.00 ? 2   MET A H    1  
ATOM 23    H HA   . MET A 1 2   ? 141.562 6.218   6.414   1.00 0.00 ? 2   MET A HA   1  
ATOM 24    H HB2  . MET A 1 2   ? 142.773 4.693   7.927   1.00 0.00 ? 2   MET A HB2  1  
ATOM 25    H HB3  . MET A 1 2   ? 142.919 3.514   6.633   1.00 0.00 ? 2   MET A HB3  1  
ATOM 26    H HG2  . MET A 1 2   ? 144.316 5.065   5.368   1.00 0.00 ? 2   MET A HG2  1  
ATOM 27    H HG3  . MET A 1 2   ? 144.153 6.261   6.653   1.00 0.00 ? 2   MET A HG3  1  
ATOM 28    H HE1  . MET A 1 2   ? 144.580 2.358   7.060   1.00 0.00 ? 2   MET A HE1  1  
ATOM 29    H HE2  . MET A 1 2   ? 146.335 2.211   7.171   1.00 0.00 ? 2   MET A HE2  1  
ATOM 30    H HE3  . MET A 1 2   ? 145.590 2.732   5.663   1.00 0.00 ? 2   MET A HE3  1  
ATOM 31    N N    . VAL A 1 3   ? 141.269 6.021   3.966   1.00 0.00 ? 3   VAL A N    1  
ATOM 32    C CA   . VAL A 1 3   ? 141.264 6.004   2.519   1.00 0.00 ? 3   VAL A CA   1  
ATOM 33    C C    . VAL A 1 3   ? 141.966 7.240   1.957   1.00 0.00 ? 3   VAL A C    1  
ATOM 34    O O    . VAL A 1 3   ? 141.710 8.361   2.387   1.00 0.00 ? 3   VAL A O    1  
ATOM 35    C CB   . VAL A 1 3   ? 139.802 5.869   1.945   1.00 0.00 ? 3   VAL A CB   1  
ATOM 36    C CG1  . VAL A 1 3   ? 138.878 6.914   2.541   1.00 0.00 ? 3   VAL A CG1  1  
ATOM 37    C CG2  . VAL A 1 3   ? 139.789 6.005   0.436   1.00 0.00 ? 3   VAL A CG2  1  
ATOM 38    H H    . VAL A 1 3   ? 140.921 6.819   4.429   1.00 0.00 ? 3   VAL A H    1  
ATOM 39    H HA   . VAL A 1 3   ? 141.830 5.136   2.212   1.00 0.00 ? 3   VAL A HA   1  
ATOM 40    H HB   . VAL A 1 3   ? 139.414 4.889   2.195   1.00 0.00 ? 3   VAL A HB   1  
ATOM 41    H HG11 . VAL A 1 3   ? 138.842 6.797   3.614   1.00 0.00 ? 3   VAL A HG11 1  
ATOM 42    H HG12 . VAL A 1 3   ? 137.888 6.794   2.126   1.00 0.00 ? 3   VAL A HG12 1  
ATOM 43    H HG13 . VAL A 1 3   ? 139.258 7.894   2.294   1.00 0.00 ? 3   VAL A HG13 1  
ATOM 44    H HG21 . VAL A 1 3   ? 138.797 5.776   0.075   1.00 0.00 ? 3   VAL A HG21 1  
ATOM 45    H HG22 . VAL A 1 3   ? 140.504 5.329   -0.011  1.00 0.00 ? 3   VAL A HG22 1  
ATOM 46    H HG23 . VAL A 1 3   ? 140.023 7.025   0.161   1.00 0.00 ? 3   VAL A HG23 1  
ATOM 47    N N    . SER A 1 4   ? 142.867 7.025   1.044   1.00 0.00 ? 4   SER A N    1  
ATOM 48    C CA   . SER A 1 4   ? 143.544 8.098   0.383   1.00 0.00 ? 4   SER A CA   1  
ATOM 49    C C    . SER A 1 4   ? 142.577 8.789   -0.580  1.00 0.00 ? 4   SER A C    1  
ATOM 50    O O    . SER A 1 4   ? 141.745 8.118   -1.200  1.00 0.00 ? 4   SER A O    1  
ATOM 51    C CB   . SER A 1 4   ? 144.789 7.546   -0.335  1.00 0.00 ? 4   SER A CB   1  
ATOM 52    O OG   . SER A 1 4   ? 144.476 6.380   -1.104  1.00 0.00 ? 4   SER A OG   1  
ATOM 53    H H    . SER A 1 4   ? 143.089 6.104   0.781   1.00 0.00 ? 4   SER A H    1  
ATOM 54    H HA   . SER A 1 4   ? 143.851 8.829   1.114   1.00 0.00 ? 4   SER A HA   1  
ATOM 55    H HB2  . SER A 1 4   ? 145.183 8.302   -0.999  1.00 0.00 ? 4   SER A HB2  1  
ATOM 56    H HB3  . SER A 1 4   ? 145.538 7.288   0.400   1.00 0.00 ? 4   SER A HB3  1  
ATOM 57    H HG   . SER A 1 4   ? 145.275 6.134   -1.600  1.00 0.00 ? 4   SER A HG   1  
ATOM 58    N N    . PRO A 1 5   ? 142.620 10.145  -0.667  1.00 0.00 ? 5   PRO A N    1  
ATOM 59    C CA   . PRO A 1 5   ? 141.762 10.932  -1.576  1.00 0.00 ? 5   PRO A CA   1  
ATOM 60    C C    . PRO A 1 5   ? 141.698 10.358  -3.000  1.00 0.00 ? 5   PRO A C    1  
ATOM 61    O O    . PRO A 1 5   ? 140.667 10.454  -3.658  1.00 0.00 ? 5   PRO A O    1  
ATOM 62    C CB   . PRO A 1 5   ? 142.427 12.304  -1.573  1.00 0.00 ? 5   PRO A CB   1  
ATOM 63    C CG   . PRO A 1 5   ? 143.010 12.418  -0.210  1.00 0.00 ? 5   PRO A CG   1  
ATOM 64    C CD   . PRO A 1 5   ? 143.470 11.031  0.163   1.00 0.00 ? 5   PRO A CD   1  
ATOM 65    H HA   . PRO A 1 5   ? 140.758 11.013  -1.186  1.00 0.00 ? 5   PRO A HA   1  
ATOM 66    H HB2  . PRO A 1 5   ? 143.185 12.342  -2.339  1.00 0.00 ? 5   PRO A HB2  1  
ATOM 67    H HB3  . PRO A 1 5   ? 141.686 13.070  -1.750  1.00 0.00 ? 5   PRO A HB3  1  
ATOM 68    H HG2  . PRO A 1 5   ? 143.847 13.101  -0.225  1.00 0.00 ? 5   PRO A HG2  1  
ATOM 69    H HG3  . PRO A 1 5   ? 142.255 12.759  0.483   1.00 0.00 ? 5   PRO A HG3  1  
ATOM 70    H HD2  . PRO A 1 5   ? 144.513 10.902  -0.084  1.00 0.00 ? 5   PRO A HD2  1  
ATOM 71    H HD3  . PRO A 1 5   ? 143.303 10.848  1.214   1.00 0.00 ? 5   PRO A HD3  1  
ATOM 72    N N    . GLU A 1 6   ? 142.789 9.729   -3.442  1.00 0.00 ? 6   GLU A N    1  
ATOM 73    C CA   . GLU A 1 6   ? 142.831 9.083   -4.752  1.00 0.00 ? 6   GLU A CA   1  
ATOM 74    C C    . GLU A 1 6   ? 141.827 7.923   -4.801  1.00 0.00 ? 6   GLU A C    1  
ATOM 75    O O    . GLU A 1 6   ? 140.926 7.908   -5.618  1.00 0.00 ? 6   GLU A O    1  
ATOM 76    C CB   . GLU A 1 6   ? 144.233 8.563   -5.047  1.00 0.00 ? 6   GLU A CB   1  
ATOM 77    C CG   . GLU A 1 6   ? 144.354 7.871   -6.392  1.00 0.00 ? 6   GLU A CG   1  
ATOM 78    C CD   . GLU A 1 6   ? 145.724 7.330   -6.634  1.00 0.00 ? 6   GLU A CD   1  
ATOM 79    O OE1  . GLU A 1 6   ? 146.584 8.068   -7.143  1.00 0.00 ? 6   GLU A OE1  1  
ATOM 80    O OE2  . GLU A 1 6   ? 145.976 6.139   -6.321  1.00 0.00 ? 6   GLU A OE2  1  
ATOM 81    H H    . GLU A 1 6   ? 143.578 9.710   -2.856  1.00 0.00 ? 6   GLU A H    1  
ATOM 82    H HA   . GLU A 1 6   ? 142.557 9.818   -5.494  1.00 0.00 ? 6   GLU A HA   1  
ATOM 83    H HB2  . GLU A 1 6   ? 144.922 9.394   -5.033  1.00 0.00 ? 6   GLU A HB2  1  
ATOM 84    H HB3  . GLU A 1 6   ? 144.513 7.859   -4.278  1.00 0.00 ? 6   GLU A HB3  1  
ATOM 85    H HG2  . GLU A 1 6   ? 143.650 7.053   -6.426  1.00 0.00 ? 6   GLU A HG2  1  
ATOM 86    H HG3  . GLU A 1 6   ? 144.115 8.581   -7.170  1.00 0.00 ? 6   GLU A HG3  1  
ATOM 87    N N    . GLU A 1 7   ? 141.976 6.992   -3.878  1.00 0.00 ? 7   GLU A N    1  
ATOM 88    C CA   . GLU A 1 7   ? 141.118 5.813   -3.766  1.00 0.00 ? 7   GLU A CA   1  
ATOM 89    C C    . GLU A 1 7   ? 139.671 6.267   -3.527  1.00 0.00 ? 7   GLU A C    1  
ATOM 90    O O    . GLU A 1 7   ? 138.738 5.675   -4.043  1.00 0.00 ? 7   GLU A O    1  
ATOM 91    C CB   . GLU A 1 7   ? 141.668 4.967   -2.591  1.00 0.00 ? 7   GLU A CB   1  
ATOM 92    C CG   . GLU A 1 7   ? 140.809 3.818   -2.055  1.00 0.00 ? 7   GLU A CG   1  
ATOM 93    C CD   . GLU A 1 7   ? 140.516 2.727   -3.035  1.00 0.00 ? 7   GLU A CD   1  
ATOM 94    O OE1  . GLU A 1 7   ? 141.438 2.274   -3.765  1.00 0.00 ? 7   GLU A OE1  1  
ATOM 95    O OE2  . GLU A 1 7   ? 139.382 2.246   -3.056  1.00 0.00 ? 7   GLU A OE2  1  
ATOM 96    H H    . GLU A 1 7   ? 142.673 7.109   -3.198  1.00 0.00 ? 7   GLU A H    1  
ATOM 97    H HA   . GLU A 1 7   ? 141.166 5.240   -4.688  1.00 0.00 ? 7   GLU A HA   1  
ATOM 98    H HB2  . GLU A 1 7   ? 142.606 4.535   -2.905  1.00 0.00 ? 7   GLU A HB2  1  
ATOM 99    H HB3  . GLU A 1 7   ? 141.874 5.642   -1.774  1.00 0.00 ? 7   GLU A HB3  1  
ATOM 100   H HG2  . GLU A 1 7   ? 141.324 3.375   -1.216  1.00 0.00 ? 7   GLU A HG2  1  
ATOM 101   H HG3  . GLU A 1 7   ? 139.875 4.234   -1.706  1.00 0.00 ? 7   GLU A HG3  1  
ATOM 102   N N    . ALA A 1 8   ? 139.516 7.362   -2.796  1.00 0.00 ? 8   ALA A N    1  
ATOM 103   C CA   . ALA A 1 8   ? 138.211 7.917   -2.532  1.00 0.00 ? 8   ALA A CA   1  
ATOM 104   C C    . ALA A 1 8   ? 137.562 8.479   -3.812  1.00 0.00 ? 8   ALA A C    1  
ATOM 105   O O    . ALA A 1 8   ? 136.418 8.150   -4.098  1.00 0.00 ? 8   ALA A O    1  
ATOM 106   C CB   . ALA A 1 8   ? 138.253 8.941   -1.398  1.00 0.00 ? 8   ALA A CB   1  
ATOM 107   H H    . ALA A 1 8   ? 140.320 7.782   -2.416  1.00 0.00 ? 8   ALA A H    1  
ATOM 108   H HA   . ALA A 1 8   ? 137.598 7.085   -2.213  1.00 0.00 ? 8   ALA A HA   1  
ATOM 109   H HB1  . ALA A 1 8   ? 138.744 8.479   -0.552  1.00 0.00 ? 8   ALA A HB1  1  
ATOM 110   H HB2  . ALA A 1 8   ? 137.249 9.239   -1.118  1.00 0.00 ? 8   ALA A HB2  1  
ATOM 111   H HB3  . ALA A 1 8   ? 138.814 9.810   -1.709  1.00 0.00 ? 8   ALA A HB3  1  
ATOM 112   N N    . VAL A 1 9   ? 138.291 9.304   -4.611  1.00 0.00 ? 9   VAL A N    1  
ATOM 113   C CA   . VAL A 1 9   ? 137.727 9.823   -5.897  1.00 0.00 ? 9   VAL A CA   1  
ATOM 114   C C    . VAL A 1 9   ? 137.400 8.666   -6.845  1.00 0.00 ? 9   VAL A C    1  
ATOM 115   O O    . VAL A 1 9   ? 136.493 8.749   -7.681  1.00 0.00 ? 9   VAL A O    1  
ATOM 116   C CB   . VAL A 1 9   ? 138.633 10.877  -6.653  1.00 0.00 ? 9   VAL A CB   1  
ATOM 117   C CG1  . VAL A 1 9   ? 138.932 12.093  -5.807  1.00 0.00 ? 9   VAL A CG1  1  
ATOM 118   C CG2  . VAL A 1 9   ? 139.918 10.274  -7.197  1.00 0.00 ? 9   VAL A CG2  1  
ATOM 119   H H    . VAL A 1 9   ? 139.187 9.594   -4.327  1.00 0.00 ? 9   VAL A H    1  
ATOM 120   H HA   . VAL A 1 9   ? 136.785 10.285  -5.638  1.00 0.00 ? 9   VAL A HA   1  
ATOM 121   H HB   . VAL A 1 9   ? 138.049 11.232  -7.491  1.00 0.00 ? 9   VAL A HB   1  
ATOM 122   H HG11 . VAL A 1 9   ? 139.461 11.787  -4.916  1.00 0.00 ? 9   VAL A HG11 1  
ATOM 123   H HG12 . VAL A 1 9   ? 138.004 12.564  -5.518  1.00 0.00 ? 9   VAL A HG12 1  
ATOM 124   H HG13 . VAL A 1 9   ? 139.537 12.791  -6.367  1.00 0.00 ? 9   VAL A HG13 1  
ATOM 125   H HG21 . VAL A 1 9   ? 139.679 9.480   -7.890  1.00 0.00 ? 9   VAL A HG21 1  
ATOM 126   H HG22 . VAL A 1 9   ? 140.502 9.871   -6.383  1.00 0.00 ? 9   VAL A HG22 1  
ATOM 127   H HG23 . VAL A 1 9   ? 140.487 11.037  -7.707  1.00 0.00 ? 9   VAL A HG23 1  
ATOM 128   N N    . LYS A 1 10  ? 138.126 7.584   -6.673  1.00 0.00 ? 10  LYS A N    1  
ATOM 129   C CA   . LYS A 1 10  ? 137.945 6.361   -7.423  1.00 0.00 ? 10  LYS A CA   1  
ATOM 130   C C    . LYS A 1 10  ? 136.612 5.678   -7.086  1.00 0.00 ? 10  LYS A C    1  
ATOM 131   O O    . LYS A 1 10  ? 136.084 4.902   -7.870  1.00 0.00 ? 10  LYS A O    1  
ATOM 132   C CB   . LYS A 1 10  ? 139.108 5.435   -7.146  1.00 0.00 ? 10  LYS A CB   1  
ATOM 133   C CG   . LYS A 1 10  ? 140.421 5.870   -7.763  1.00 0.00 ? 10  LYS A CG   1  
ATOM 134   C CD   . LYS A 1 10  ? 140.415 5.636   -9.242  1.00 0.00 ? 10  LYS A CD   1  
ATOM 135   C CE   . LYS A 1 10  ? 140.285 4.155   -9.507  1.00 0.00 ? 10  LYS A CE   1  
ATOM 136   N NZ   . LYS A 1 10  ? 140.280 3.846   -10.952 1.00 0.00 ? 10  LYS A NZ   1  
ATOM 137   H H    . LYS A 1 10  ? 138.848 7.625   -6.004  1.00 0.00 ? 10  LYS A H    1  
ATOM 138   H HA   . LYS A 1 10  ? 137.951 6.612   -8.473  1.00 0.00 ? 10  LYS A HA   1  
ATOM 139   H HB2  . LYS A 1 10  ? 139.248 5.367   -6.077  1.00 0.00 ? 10  LYS A HB2  1  
ATOM 140   H HB3  . LYS A 1 10  ? 138.865 4.453   -7.526  1.00 0.00 ? 10  LYS A HB3  1  
ATOM 141   H HG2  . LYS A 1 10  ? 140.567 6.924   -7.574  1.00 0.00 ? 10  LYS A HG2  1  
ATOM 142   H HG3  . LYS A 1 10  ? 141.225 5.306   -7.316  1.00 0.00 ? 10  LYS A HG3  1  
ATOM 143   H HD2  . LYS A 1 10  ? 139.578 6.162   -9.678  1.00 0.00 ? 10  LYS A HD2  1  
ATOM 144   H HD3  . LYS A 1 10  ? 141.340 5.996   -9.665  1.00 0.00 ? 10  LYS A HD3  1  
ATOM 145   H HE2  . LYS A 1 10  ? 141.105 3.688   -8.979  1.00 0.00 ? 10  LYS A HE2  1  
ATOM 146   H HE3  . LYS A 1 10  ? 139.369 3.829   -9.035  1.00 0.00 ? 10  LYS A HE3  1  
ATOM 147   H HZ1  . LYS A 1 10  ? 139.454 4.262   -11.438 1.00 0.00 ? 10  LYS A HZ1  1  
ATOM 148   H HZ2  . LYS A 1 10  ? 140.289 2.816   -11.121 1.00 0.00 ? 10  LYS A HZ2  1  
ATOM 149   H HZ3  . LYS A 1 10  ? 141.147 4.227   -11.387 1.00 0.00 ? 10  LYS A HZ3  1  
ATOM 150   N N    . TRP A 1 11  ? 136.073 5.968   -5.926  1.00 0.00 ? 11  TRP A N    1  
ATOM 151   C CA   . TRP A 1 11  ? 134.767 5.447   -5.542  1.00 0.00 ? 11  TRP A CA   1  
ATOM 152   C C    . TRP A 1 11  ? 133.683 6.173   -6.311  1.00 0.00 ? 11  TRP A C    1  
ATOM 153   O O    . TRP A 1 11  ? 132.604 5.638   -6.540  1.00 0.00 ? 11  TRP A O    1  
ATOM 154   C CB   . TRP A 1 11  ? 134.516 5.619   -4.041  1.00 0.00 ? 11  TRP A CB   1  
ATOM 155   C CG   . TRP A 1 11  ? 135.466 4.875   -3.165  1.00 0.00 ? 11  TRP A CG   1  
ATOM 156   C CD1  . TRP A 1 11  ? 136.330 3.892   -3.535  1.00 0.00 ? 11  TRP A CD1  1  
ATOM 157   C CD2  . TRP A 1 11  ? 135.619 5.033   -1.759  1.00 0.00 ? 11  TRP A CD2  1  
ATOM 158   N NE1  . TRP A 1 11  ? 137.045 3.466   -2.458  1.00 0.00 ? 11  TRP A NE1  1  
ATOM 159   C CE2  . TRP A 1 11  ? 136.619 4.142   -1.348  1.00 0.00 ? 11  TRP A CE2  1  
ATOM 160   C CE3  . TRP A 1 11  ? 135.016 5.859   -0.810  1.00 0.00 ? 11  TRP A CE3  1  
ATOM 161   C CZ2  . TRP A 1 11  ? 137.024 4.048   -0.029  1.00 0.00 ? 11  TRP A CZ2  1  
ATOM 162   C CZ3  . TRP A 1 11  ? 135.417 5.756   0.504   1.00 0.00 ? 11  TRP A CZ3  1  
ATOM 163   C CH2  . TRP A 1 11  ? 136.410 4.861   0.881   1.00 0.00 ? 11  TRP A CH2  1  
ATOM 164   H H    . TRP A 1 11  ? 136.571 6.524   -5.287  1.00 0.00 ? 11  TRP A H    1  
ATOM 165   H HA   . TRP A 1 11  ? 134.736 4.396   -5.789  1.00 0.00 ? 11  TRP A HA   1  
ATOM 166   H HB2  . TRP A 1 11  ? 134.630 6.668   -3.806  1.00 0.00 ? 11  TRP A HB2  1  
ATOM 167   H HB3  . TRP A 1 11  ? 133.509 5.324   -3.789  1.00 0.00 ? 11  TRP A HB3  1  
ATOM 168   H HD1  . TRP A 1 11  ? 136.445 3.535   -4.549  1.00 0.00 ? 11  TRP A HD1  1  
ATOM 169   H HE1  . TRP A 1 11  ? 137.757 2.781   -2.515  1.00 0.00 ? 11  TRP A HE1  1  
ATOM 170   H HE3  . TRP A 1 11  ? 134.247 6.563   -1.095  1.00 0.00 ? 11  TRP A HE3  1  
ATOM 171   H HZ2  . TRP A 1 11  ? 137.793 3.359   0.285   1.00 0.00 ? 11  TRP A HZ2  1  
ATOM 172   H HZ3  . TRP A 1 11  ? 134.951 6.372   1.262   1.00 0.00 ? 11  TRP A HZ3  1  
ATOM 173   H HH2  . TRP A 1 11  ? 136.693 4.813   1.922   1.00 0.00 ? 11  TRP A HH2  1  
ATOM 174   N N    . GLY A 1 12  ? 134.014 7.369   -6.776  1.00 0.00 ? 12  GLY A N    1  
ATOM 175   C CA   . GLY A 1 12  ? 133.060 8.216   -7.458  1.00 0.00 ? 12  GLY A CA   1  
ATOM 176   C C    . GLY A 1 12  ? 132.938 7.898   -8.929  1.00 0.00 ? 12  GLY A C    1  
ATOM 177   O O    . GLY A 1 12  ? 132.314 8.646   -9.681  1.00 0.00 ? 12  GLY A O    1  
ATOM 178   H H    . GLY A 1 12  ? 134.939 7.682   -6.673  1.00 0.00 ? 12  GLY A H    1  
ATOM 179   H HA2  . GLY A 1 12  ? 132.092 8.094   -6.994  1.00 0.00 ? 12  GLY A HA2  1  
ATOM 180   H HA3  . GLY A 1 12  ? 133.369 9.245   -7.349  1.00 0.00 ? 12  GLY A HA3  1  
ATOM 181   N N    . GLU A 1 13  ? 133.563 6.815   -9.346  1.00 0.00 ? 13  GLU A N    1  
ATOM 182   C CA   . GLU A 1 13  ? 133.468 6.362   -10.719 1.00 0.00 ? 13  GLU A CA   1  
ATOM 183   C C    . GLU A 1 13  ? 132.968 4.918   -10.781 1.00 0.00 ? 13  GLU A C    1  
ATOM 184   O O    . GLU A 1 13  ? 132.727 4.376   -11.868 1.00 0.00 ? 13  GLU A O    1  
ATOM 185   C CB   . GLU A 1 13  ? 134.818 6.525   -11.443 1.00 0.00 ? 13  GLU A CB   1  
ATOM 186   C CG   . GLU A 1 13  ? 135.981 5.805   -10.774 1.00 0.00 ? 13  GLU A CG   1  
ATOM 187   C CD   . GLU A 1 13  ? 137.312 6.136   -11.394 1.00 0.00 ? 13  GLU A CD   1  
ATOM 188   O OE1  . GLU A 1 13  ? 137.713 7.312   -11.346 1.00 0.00 ? 13  GLU A OE1  1  
ATOM 189   O OE2  . GLU A 1 13  ? 137.997 5.228   -11.918 1.00 0.00 ? 13  GLU A OE2  1  
ATOM 190   H H    . GLU A 1 13  ? 134.123 6.321   -8.713  1.00 0.00 ? 13  GLU A H    1  
ATOM 191   H HA   . GLU A 1 13  ? 132.737 6.991   -11.206 1.00 0.00 ? 13  GLU A HA   1  
ATOM 192   H HB2  . GLU A 1 13  ? 134.722 6.140   -12.446 1.00 0.00 ? 13  GLU A HB2  1  
ATOM 193   H HB3  . GLU A 1 13  ? 135.057 7.578   -11.495 1.00 0.00 ? 13  GLU A HB3  1  
ATOM 194   H HG2  . GLU A 1 13  ? 136.009 6.086   -9.731  1.00 0.00 ? 13  GLU A HG2  1  
ATOM 195   H HG3  . GLU A 1 13  ? 135.817 4.740   -10.852 1.00 0.00 ? 13  GLU A HG3  1  
ATOM 196   N N    . SER A 1 14  ? 132.817 4.287   -9.618  1.00 0.00 ? 14  SER A N    1  
ATOM 197   C CA   . SER A 1 14  ? 132.355 2.907   -9.535  1.00 0.00 ? 14  SER A CA   1  
ATOM 198   C C    . SER A 1 14  ? 131.759 2.601   -8.147  1.00 0.00 ? 14  SER A C    1  
ATOM 199   O O    . SER A 1 14  ? 132.502 2.451   -7.162  1.00 0.00 ? 14  SER A O    1  
ATOM 200   C CB   . SER A 1 14  ? 133.516 1.925   -9.830  1.00 0.00 ? 14  SER A CB   1  
ATOM 201   O OG   . SER A 1 14  ? 134.053 2.120   -11.135 1.00 0.00 ? 14  SER A OG   1  
ATOM 202   H H    . SER A 1 14  ? 133.001 4.758   -8.779  1.00 0.00 ? 14  SER A H    1  
ATOM 203   H HA   . SER A 1 14  ? 131.588 2.768   -10.282 1.00 0.00 ? 14  SER A HA   1  
ATOM 204   H HB2  . SER A 1 14  ? 134.304 2.077   -9.107  1.00 0.00 ? 14  SER A HB2  1  
ATOM 205   H HB3  . SER A 1 14  ? 133.151 0.911   -9.750  1.00 0.00 ? 14  SER A HB3  1  
ATOM 206   H HG   . SER A 1 14  ? 133.560 2.859   -11.520 1.00 0.00 ? 14  SER A HG   1  
ATOM 207   N N    . PHE A 1 15  ? 130.427 2.504   -8.071  1.00 0.00 ? 15  PHE A N    1  
ATOM 208   C CA   . PHE A 1 15  ? 129.728 2.164   -6.826  1.00 0.00 ? 15  PHE A CA   1  
ATOM 209   C C    . PHE A 1 15  ? 130.177 0.802   -6.323  1.00 0.00 ? 15  PHE A C    1  
ATOM 210   O O    . PHE A 1 15  ? 130.305 0.594   -5.123  1.00 0.00 ? 15  PHE A O    1  
ATOM 211   C CB   . PHE A 1 15  ? 128.192 2.194   -7.016  1.00 0.00 ? 15  PHE A CB   1  
ATOM 212   C CG   . PHE A 1 15  ? 127.385 1.803   -5.786  1.00 0.00 ? 15  PHE A CG   1  
ATOM 213   C CD1  . PHE A 1 15  ? 127.520 2.492   -4.593  1.00 0.00 ? 15  PHE A CD1  1  
ATOM 214   C CD2  . PHE A 1 15  ? 126.483 0.752   -5.836  1.00 0.00 ? 15  PHE A CD2  1  
ATOM 215   C CE1  . PHE A 1 15  ? 126.777 2.142   -3.481  1.00 0.00 ? 15  PHE A CE1  1  
ATOM 216   C CE2  . PHE A 1 15  ? 125.741 0.402   -4.721  1.00 0.00 ? 15  PHE A CE2  1  
ATOM 217   C CZ   . PHE A 1 15  ? 125.890 1.097   -3.548  1.00 0.00 ? 15  PHE A CZ   1  
ATOM 218   H H    . PHE A 1 15  ? 129.889 2.659   -8.885  1.00 0.00 ? 15  PHE A H    1  
ATOM 219   H HA   . PHE A 1 15  ? 130.004 2.905   -6.090  1.00 0.00 ? 15  PHE A HA   1  
ATOM 220   H HB2  . PHE A 1 15  ? 127.888 3.192   -7.297  1.00 0.00 ? 15  PHE A HB2  1  
ATOM 221   H HB3  . PHE A 1 15  ? 127.929 1.511   -7.812  1.00 0.00 ? 15  PHE A HB3  1  
ATOM 222   H HD1  . PHE A 1 15  ? 128.217 3.315   -4.535  1.00 0.00 ? 15  PHE A HD1  1  
ATOM 223   H HD2  . PHE A 1 15  ? 126.362 0.200   -6.757  1.00 0.00 ? 15  PHE A HD2  1  
ATOM 224   H HE1  . PHE A 1 15  ? 126.887 2.677   -2.548  1.00 0.00 ? 15  PHE A HE1  1  
ATOM 225   H HE2  . PHE A 1 15  ? 125.040 -0.421  -4.756  1.00 0.00 ? 15  PHE A HE2  1  
ATOM 226   H HZ   . PHE A 1 15  ? 125.309 0.824   -2.680  1.00 0.00 ? 15  PHE A HZ   1  
ATOM 227   N N    . ASP A 1 16  ? 130.465 -0.102  -7.247  1.00 0.00 ? 16  ASP A N    1  
ATOM 228   C CA   . ASP A 1 16  ? 130.917 -1.441  -6.886  1.00 0.00 ? 16  ASP A CA   1  
ATOM 229   C C    . ASP A 1 16  ? 132.248 -1.382  -6.154  1.00 0.00 ? 16  ASP A C    1  
ATOM 230   O O    . ASP A 1 16  ? 132.467 -2.115  -5.197  1.00 0.00 ? 16  ASP A O    1  
ATOM 231   C CB   . ASP A 1 16  ? 131.040 -2.339  -8.112  1.00 0.00 ? 16  ASP A CB   1  
ATOM 232   C CG   . ASP A 1 16  ? 131.448 -3.743  -7.750  1.00 0.00 ? 16  ASP A CG   1  
ATOM 233   O OD1  . ASP A 1 16  ? 130.582 -4.530  -7.347  1.00 0.00 ? 16  ASP A OD1  1  
ATOM 234   O OD2  . ASP A 1 16  ? 132.637 -4.083  -7.875  1.00 0.00 ? 16  ASP A OD2  1  
ATOM 235   H H    . ASP A 1 16  ? 130.360 0.134   -8.199  1.00 0.00 ? 16  ASP A H    1  
ATOM 236   H HA   . ASP A 1 16  ? 130.179 -1.861  -6.217  1.00 0.00 ? 16  ASP A HA   1  
ATOM 237   H HB2  . ASP A 1 16  ? 130.086 -2.381  -8.616  1.00 0.00 ? 16  ASP A HB2  1  
ATOM 238   H HB3  . ASP A 1 16  ? 131.780 -1.927  -8.782  1.00 0.00 ? 16  ASP A HB3  1  
ATOM 239   N N    . LYS A 1 17  ? 133.114 -0.465  -6.573  1.00 0.00 ? 17  LYS A N    1  
ATOM 240   C CA   . LYS A 1 17  ? 134.420 -0.307  -5.946  1.00 0.00 ? 17  LYS A CA   1  
ATOM 241   C C    . LYS A 1 17  ? 134.250 0.189   -4.540  1.00 0.00 ? 17  LYS A C    1  
ATOM 242   O O    . LYS A 1 17  ? 134.850 -0.348  -3.606  1.00 0.00 ? 17  LYS A O    1  
ATOM 243   C CB   . LYS A 1 17  ? 135.296 0.667   -6.721  1.00 0.00 ? 17  LYS A CB   1  
ATOM 244   C CG   . LYS A 1 17  ? 136.571 1.025   -5.997  1.00 0.00 ? 17  LYS A CG   1  
ATOM 245   C CD   . LYS A 1 17  ? 137.436 1.948   -6.809  1.00 0.00 ? 17  LYS A CD   1  
ATOM 246   C CE   . LYS A 1 17  ? 138.650 2.378   -6.019  1.00 0.00 ? 17  LYS A CE   1  
ATOM 247   N NZ   . LYS A 1 17  ? 139.546 1.265   -5.658  1.00 0.00 ? 17  LYS A NZ   1  
ATOM 248   H H    . LYS A 1 17  ? 132.852 0.137   -7.303  1.00 0.00 ? 17  LYS A H    1  
ATOM 249   H HA   . LYS A 1 17  ? 134.901 -1.273  -5.922  1.00 0.00 ? 17  LYS A HA   1  
ATOM 250   H HB2  . LYS A 1 17  ? 135.548 0.254   -7.686  1.00 0.00 ? 17  LYS A HB2  1  
ATOM 251   H HB3  . LYS A 1 17  ? 134.740 1.581   -6.855  1.00 0.00 ? 17  LYS A HB3  1  
ATOM 252   H HG2  . LYS A 1 17  ? 136.270 1.540   -5.095  1.00 0.00 ? 17  LYS A HG2  1  
ATOM 253   H HG3  . LYS A 1 17  ? 137.112 0.124   -5.746  1.00 0.00 ? 17  LYS A HG3  1  
ATOM 254   H HD2  . LYS A 1 17  ? 137.755 1.444   -7.709  1.00 0.00 ? 17  LYS A HD2  1  
ATOM 255   H HD3  . LYS A 1 17  ? 136.862 2.828   -7.063  1.00 0.00 ? 17  LYS A HD3  1  
ATOM 256   H HE2  . LYS A 1 17  ? 139.209 3.088   -6.610  1.00 0.00 ? 17  LYS A HE2  1  
ATOM 257   H HE3  . LYS A 1 17  ? 138.315 2.865   -5.115  1.00 0.00 ? 17  LYS A HE3  1  
ATOM 258   H HZ1  . LYS A 1 17  ? 139.056 0.465   -5.201  1.00 0.00 ? 17  LYS A HZ1  1  
ATOM 259   H HZ2  . LYS A 1 17  ? 140.190 1.626   -4.919  1.00 0.00 ? 17  LYS A HZ2  1  
ATOM 260   H HZ3  . LYS A 1 17  ? 140.119 0.932   -6.461  1.00 0.00 ? 17  LYS A HZ3  1  
ATOM 261   N N    . LEU A 1 18  ? 133.407 1.184   -4.412  1.00 0.00 ? 18  LEU A N    1  
ATOM 262   C CA   . LEU A 1 18  ? 133.069 1.801   -3.153  1.00 0.00 ? 18  LEU A CA   1  
ATOM 263   C C    . LEU A 1 18  ? 132.570 0.758   -2.188  1.00 0.00 ? 18  LEU A C    1  
ATOM 264   O O    . LEU A 1 18  ? 133.110 0.572   -1.106  1.00 0.00 ? 18  LEU A O    1  
ATOM 265   C CB   . LEU A 1 18  ? 131.950 2.814   -3.418  1.00 0.00 ? 18  LEU A CB   1  
ATOM 266   C CG   . LEU A 1 18  ? 131.188 3.349   -2.210  1.00 0.00 ? 18  LEU A CG   1  
ATOM 267   C CD1  . LEU A 1 18  ? 132.075 4.177   -1.323  1.00 0.00 ? 18  LEU A CD1  1  
ATOM 268   C CD2  . LEU A 1 18  ? 130.019 4.155   -2.675  1.00 0.00 ? 18  LEU A CD2  1  
ATOM 269   H H    . LEU A 1 18  ? 132.960 1.519   -5.220  1.00 0.00 ? 18  LEU A H    1  
ATOM 270   H HA   . LEU A 1 18  ? 133.921 2.329   -2.753  1.00 0.00 ? 18  LEU A HA   1  
ATOM 271   H HB2  . LEU A 1 18  ? 132.381 3.657   -3.936  1.00 0.00 ? 18  LEU A HB2  1  
ATOM 272   H HB3  . LEU A 1 18  ? 131.238 2.343   -4.080  1.00 0.00 ? 18  LEU A HB3  1  
ATOM 273   H HG   . LEU A 1 18  ? 130.802 2.513   -1.639  1.00 0.00 ? 18  LEU A HG   1  
ATOM 274   H HD11 . LEU A 1 18  ? 132.475 5.007   -1.885  1.00 0.00 ? 18  LEU A HD11 1  
ATOM 275   H HD12 . LEU A 1 18  ? 132.887 3.565   -0.956  1.00 0.00 ? 18  LEU A HD12 1  
ATOM 276   H HD13 . LEU A 1 18  ? 131.502 4.553   -0.488  1.00 0.00 ? 18  LEU A HD13 1  
ATOM 277   H HD21 . LEU A 1 18  ? 129.473 4.534   -1.824  1.00 0.00 ? 18  LEU A HD21 1  
ATOM 278   H HD22 . LEU A 1 18  ? 129.387 3.522   -3.280  1.00 0.00 ? 18  LEU A HD22 1  
ATOM 279   H HD23 . LEU A 1 18  ? 130.392 4.973   -3.274  1.00 0.00 ? 18  LEU A HD23 1  
ATOM 280   N N    . LEU A 1 19  ? 131.597 0.046   -2.650  1.00 0.00 ? 19  LEU A N    1  
ATOM 281   C CA   . LEU A 1 19  ? 130.865 -0.901  -1.881  1.00 0.00 ? 19  LEU A CA   1  
ATOM 282   C C    . LEU A 1 19  ? 131.709 -2.117  -1.509  1.00 0.00 ? 19  LEU A C    1  
ATOM 283   O O    . LEU A 1 19  ? 131.537 -2.703  -0.443  1.00 0.00 ? 19  LEU A O    1  
ATOM 284   C CB   . LEU A 1 19  ? 129.684 -1.310  -2.707  1.00 0.00 ? 19  LEU A CB   1  
ATOM 285   C CG   . LEU A 1 19  ? 128.497 -1.813  -1.969  1.00 0.00 ? 19  LEU A CG   1  
ATOM 286   C CD1  . LEU A 1 19  ? 128.004 -0.730  -1.011  1.00 0.00 ? 19  LEU A CD1  1  
ATOM 287   C CD2  . LEU A 1 19  ? 127.441 -2.154  -2.977  1.00 0.00 ? 19  LEU A CD2  1  
ATOM 288   H H    . LEU A 1 19  ? 131.326 0.183   -3.586  1.00 0.00 ? 19  LEU A H    1  
ATOM 289   H HA   . LEU A 1 19  ? 130.492 -0.422  -0.987  1.00 0.00 ? 19  LEU A HA   1  
ATOM 290   H HB2  . LEU A 1 19  ? 129.375 -0.456  -3.291  1.00 0.00 ? 19  LEU A HB2  1  
ATOM 291   H HB3  . LEU A 1 19  ? 130.010 -2.081  -3.389  1.00 0.00 ? 19  LEU A HB3  1  
ATOM 292   H HG   . LEU A 1 19  ? 128.744 -2.705  -1.412  1.00 0.00 ? 19  LEU A HG   1  
ATOM 293   H HD11 . LEU A 1 19  ? 128.805 -0.463  -0.335  1.00 0.00 ? 19  LEU A HD11 1  
ATOM 294   H HD12 . LEU A 1 19  ? 127.160 -1.084  -0.438  1.00 0.00 ? 19  LEU A HD12 1  
ATOM 295   H HD13 . LEU A 1 19  ? 127.725 0.147   -1.577  1.00 0.00 ? 19  LEU A HD13 1  
ATOM 296   H HD21 . LEU A 1 19  ? 127.195 -1.260  -3.532  1.00 0.00 ? 19  LEU A HD21 1  
ATOM 297   H HD22 . LEU A 1 19  ? 126.560 -2.535  -2.484  1.00 0.00 ? 19  LEU A HD22 1  
ATOM 298   H HD23 . LEU A 1 19  ? 127.835 -2.891  -3.661  1.00 0.00 ? 19  LEU A HD23 1  
ATOM 299   N N    . SER A 1 20  ? 132.603 -2.502  -2.383  1.00 0.00 ? 20  SER A N    1  
ATOM 300   C CA   . SER A 1 20  ? 133.461 -3.627  -2.111  1.00 0.00 ? 20  SER A CA   1  
ATOM 301   C C    . SER A 1 20  ? 134.640 -3.220  -1.223  1.00 0.00 ? 20  SER A C    1  
ATOM 302   O O    . SER A 1 20  ? 135.219 -4.055  -0.519  1.00 0.00 ? 20  SER A O    1  
ATOM 303   C CB   . SER A 1 20  ? 133.942 -4.251  -3.414  1.00 0.00 ? 20  SER A CB   1  
ATOM 304   O OG   . SER A 1 20  ? 132.833 -4.652  -4.216  1.00 0.00 ? 20  SER A OG   1  
ATOM 305   H H    . SER A 1 20  ? 132.670 -2.036  -3.244  1.00 0.00 ? 20  SER A H    1  
ATOM 306   H HA   . SER A 1 20  ? 132.872 -4.357  -1.576  1.00 0.00 ? 20  SER A HA   1  
ATOM 307   H HB2  . SER A 1 20  ? 134.526 -3.527  -3.963  1.00 0.00 ? 20  SER A HB2  1  
ATOM 308   H HB3  . SER A 1 20  ? 134.547 -5.119  -3.197  1.00 0.00 ? 20  SER A HB3  1  
ATOM 309   H HG   . SER A 1 20  ? 132.565 -3.873  -4.723  1.00 0.00 ? 20  SER A HG   1  
ATOM 310   N N    . HIS A 1 21  ? 134.965 -1.941  -1.213  1.00 0.00 ? 21  HIS A N    1  
ATOM 311   C CA   . HIS A 1 21  ? 136.081 -1.457  -0.432  1.00 0.00 ? 21  HIS A CA   1  
ATOM 312   C C    . HIS A 1 21  ? 135.585 -1.353  0.985   1.00 0.00 ? 21  HIS A C    1  
ATOM 313   O O    . HIS A 1 21  ? 134.559 -0.738  1.214   1.00 0.00 ? 21  HIS A O    1  
ATOM 314   C CB   . HIS A 1 21  ? 136.542 -0.062  -0.924  1.00 0.00 ? 21  HIS A CB   1  
ATOM 315   C CG   . HIS A 1 21  ? 137.956 0.284   -0.571  1.00 0.00 ? 21  HIS A CG   1  
ATOM 316   N ND1  . HIS A 1 21  ? 138.303 1.178   0.410   1.00 0.00 ? 21  HIS A ND1  1  
ATOM 317   C CD2  . HIS A 1 21  ? 139.121 -0.141  -1.108  1.00 0.00 ? 21  HIS A CD2  1  
ATOM 318   C CE1  . HIS A 1 21  ? 139.613 1.280   0.462   1.00 0.00 ? 21  HIS A CE1  1  
ATOM 319   N NE2  . HIS A 1 21  ? 140.131 0.494   -0.440  1.00 0.00 ? 21  HIS A NE2  1  
ATOM 320   H H    . HIS A 1 21  ? 134.407 -1.301  -1.705  1.00 0.00 ? 21  HIS A H    1  
ATOM 321   H HA   . HIS A 1 21  ? 136.893 -2.165  -0.492  1.00 0.00 ? 21  HIS A HA   1  
ATOM 322   H HB2  . HIS A 1 21  ? 136.447 0.034   -1.993  1.00 0.00 ? 21  HIS A HB2  1  
ATOM 323   H HB3  . HIS A 1 21  ? 135.909 0.680   -0.460  1.00 0.00 ? 21  HIS A HB3  1  
ATOM 324   H HD1  . HIS A 1 21  ? 137.706 1.697   0.985   1.00 0.00 ? 21  HIS A HD1  1  
ATOM 325   H HD2  . HIS A 1 21  ? 139.213 -0.815  -1.948  1.00 0.00 ? 21  HIS A HD2  1  
ATOM 326   H HE1  . HIS A 1 21  ? 140.168 1.911   1.141   1.00 0.00 ? 21  HIS A HE1  1  
ATOM 327   H HE2  . HIS A 1 21  ? 141.070 0.581   -0.737  1.00 0.00 ? 21  HIS A HE2  1  
ATOM 328   N N    . ARG A 1 22  ? 136.288 -1.941  1.921   1.00 0.00 ? 22  ARG A N    1  
ATOM 329   C CA   . ARG A 1 22  ? 135.842 -1.949  3.329   1.00 0.00 ? 22  ARG A CA   1  
ATOM 330   C C    . ARG A 1 22  ? 135.635 -0.537  3.867   1.00 0.00 ? 22  ARG A C    1  
ATOM 331   O O    . ARG A 1 22  ? 134.645 -0.259  4.536   1.00 0.00 ? 22  ARG A O    1  
ATOM 332   C CB   . ARG A 1 22  ? 136.786 -2.765  4.234   1.00 0.00 ? 22  ARG A CB   1  
ATOM 333   C CG   . ARG A 1 22  ? 136.561 -4.282  4.217   1.00 0.00 ? 22  ARG A CG   1  
ATOM 334   C CD   . ARG A 1 22  ? 136.684 -4.897  2.831   1.00 0.00 ? 22  ARG A CD   1  
ATOM 335   N NE   . ARG A 1 22  ? 136.446 -6.340  2.861   1.00 0.00 ? 22  ARG A NE   1  
ATOM 336   C CZ   . ARG A 1 22  ? 135.718 -7.027  1.973   1.00 0.00 ? 22  ARG A CZ   1  
ATOM 337   N NH1  . ARG A 1 22  ? 135.099 -6.395  0.977   1.00 0.00 ? 22  ARG A NH1  1  
ATOM 338   N NH2  . ARG A 1 22  ? 135.618 -8.346  2.083   1.00 0.00 ? 22  ARG A NH2  1  
ATOM 339   H H    . ARG A 1 22  ? 137.144 -2.361  1.672   1.00 0.00 ? 22  ARG A H    1  
ATOM 340   H HA   . ARG A 1 22  ? 134.869 -2.422  3.330   1.00 0.00 ? 22  ARG A HA   1  
ATOM 341   H HB2  . ARG A 1 22  ? 137.804 -2.577  3.925   1.00 0.00 ? 22  ARG A HB2  1  
ATOM 342   H HB3  . ARG A 1 22  ? 136.667 -2.418  5.249   1.00 0.00 ? 22  ARG A HB3  1  
ATOM 343   H HG2  . ARG A 1 22  ? 137.295 -4.748  4.859   1.00 0.00 ? 22  ARG A HG2  1  
ATOM 344   H HG3  . ARG A 1 22  ? 135.574 -4.486  4.607   1.00 0.00 ? 22  ARG A HG3  1  
ATOM 345   H HD2  . ARG A 1 22  ? 135.960 -4.434  2.179   1.00 0.00 ? 22  ARG A HD2  1  
ATOM 346   H HD3  . ARG A 1 22  ? 137.679 -4.713  2.452   1.00 0.00 ? 22  ARG A HD3  1  
ATOM 347   H HE   . ARG A 1 22  ? 136.882 -6.806  3.618   1.00 0.00 ? 22  ARG A HE   1  
ATOM 348   H HH11 . ARG A 1 22  ? 135.154 -5.402  0.845   1.00 0.00 ? 22  ARG A HH11 1  
ATOM 349   H HH12 . ARG A 1 22  ? 134.522 -6.882  0.307   1.00 0.00 ? 22  ARG A HH12 1  
ATOM 350   H HH21 . ARG A 1 22  ? 136.088 -8.858  2.815   1.00 0.00 ? 22  ARG A HH21 1  
ATOM 351   H HH22 . ARG A 1 22  ? 135.060 -8.900  1.451   1.00 0.00 ? 22  ARG A HH22 1  
ATOM 352   N N    . ASP A 1 23  ? 136.541 0.357   3.525   1.00 0.00 ? 23  ASP A N    1  
ATOM 353   C CA   . ASP A 1 23  ? 136.427 1.769   3.919   1.00 0.00 ? 23  ASP A CA   1  
ATOM 354   C C    . ASP A 1 23  ? 135.297 2.462   3.180   1.00 0.00 ? 23  ASP A C    1  
ATOM 355   O O    . ASP A 1 23  ? 134.733 3.428   3.667   1.00 0.00 ? 23  ASP A O    1  
ATOM 356   C CB   . ASP A 1 23  ? 137.730 2.548   3.670   1.00 0.00 ? 23  ASP A CB   1  
ATOM 357   C CG   . ASP A 1 23  ? 138.888 2.059   4.491   1.00 0.00 ? 23  ASP A CG   1  
ATOM 358   O OD1  . ASP A 1 23  ? 138.975 2.394   5.681   1.00 0.00 ? 23  ASP A OD1  1  
ATOM 359   O OD2  . ASP A 1 23  ? 139.714 1.313   3.971   1.00 0.00 ? 23  ASP A OD2  1  
ATOM 360   H H    . ASP A 1 23  ? 137.332 0.022   3.040   1.00 0.00 ? 23  ASP A H    1  
ATOM 361   H HA   . ASP A 1 23  ? 136.209 1.792   4.977   1.00 0.00 ? 23  ASP A HA   1  
ATOM 362   H HB2  . ASP A 1 23  ? 138.000 2.459   2.628   1.00 0.00 ? 23  ASP A HB2  1  
ATOM 363   H HB3  . ASP A 1 23  ? 137.561 3.590   3.899   1.00 0.00 ? 23  ASP A HB3  1  
ATOM 364   N N    . GLY A 1 24  ? 134.947 1.949   2.017   1.00 0.00 ? 24  GLY A N    1  
ATOM 365   C CA   . GLY A 1 24  ? 133.933 2.596   1.212   1.00 0.00 ? 24  GLY A CA   1  
ATOM 366   C C    . GLY A 1 24  ? 132.577 2.168   1.608   1.00 0.00 ? 24  GLY A C    1  
ATOM 367   O O    . GLY A 1 24  ? 131.678 2.990   1.743   1.00 0.00 ? 24  GLY A O    1  
ATOM 368   H H    . GLY A 1 24  ? 135.326 1.094   1.723   1.00 0.00 ? 24  GLY A H    1  
ATOM 369   H HA2  . GLY A 1 24  ? 134.011 3.663   1.351   1.00 0.00 ? 24  GLY A HA2  1  
ATOM 370   H HA3  . GLY A 1 24  ? 134.076 2.374   0.172   1.00 0.00 ? 24  GLY A HA3  1  
ATOM 371   N N    . LEU A 1 25  ? 132.426 0.878   1.803   1.00 0.00 ? 25  LEU A N    1  
ATOM 372   C CA   . LEU A 1 25  ? 131.212 0.307   2.331   1.00 0.00 ? 25  LEU A CA   1  
ATOM 373   C C    . LEU A 1 25  ? 130.891 0.959   3.662   1.00 0.00 ? 25  LEU A C    1  
ATOM 374   O O    . LEU A 1 25  ? 129.741 1.189   3.996   1.00 0.00 ? 25  LEU A O    1  
ATOM 375   C CB   . LEU A 1 25  ? 131.361 -1.241  2.427   1.00 0.00 ? 25  LEU A CB   1  
ATOM 376   C CG   . LEU A 1 25  ? 130.816 -1.969  3.676   1.00 0.00 ? 25  LEU A CG   1  
ATOM 377   C CD1  . LEU A 1 25  ? 130.546 -3.427  3.334   1.00 0.00 ? 25  LEU A CD1  1  
ATOM 378   C CD2  . LEU A 1 25  ? 131.857 -1.925  4.804   1.00 0.00 ? 25  LEU A CD2  1  
ATOM 379   H H    . LEU A 1 25  ? 133.160 0.274   1.547   1.00 0.00 ? 25  LEU A H    1  
ATOM 380   H HA   . LEU A 1 25  ? 130.417 0.541   1.638   1.00 0.00 ? 25  LEU A HA   1  
ATOM 381   H HB2  . LEU A 1 25  ? 130.866 -1.671  1.570   1.00 0.00 ? 25  LEU A HB2  1  
ATOM 382   H HB3  . LEU A 1 25  ? 132.414 -1.468  2.344   1.00 0.00 ? 25  LEU A HB3  1  
ATOM 383   H HG   . LEU A 1 25  ? 129.908 -1.501  4.023   1.00 0.00 ? 25  LEU A HG   1  
ATOM 384   H HD11 . LEU A 1 25  ? 131.464 -3.902  3.022   1.00 0.00 ? 25  LEU A HD11 1  
ATOM 385   H HD12 . LEU A 1 25  ? 129.823 -3.480  2.533   1.00 0.00 ? 25  LEU A HD12 1  
ATOM 386   H HD13 . LEU A 1 25  ? 130.155 -3.934  4.204   1.00 0.00 ? 25  LEU A HD13 1  
ATOM 387   H HD21 . LEU A 1 25  ? 132.758 -2.406  4.451   1.00 0.00 ? 25  LEU A HD21 1  
ATOM 388   H HD22 . LEU A 1 25  ? 131.486 -2.450  5.672   1.00 0.00 ? 25  LEU A HD22 1  
ATOM 389   H HD23 . LEU A 1 25  ? 132.091 -0.902  5.075   1.00 0.00 ? 25  LEU A HD23 1  
ATOM 390   N N    . GLU A 1 26  ? 131.941 1.302   4.374   1.00 0.00 ? 26  GLU A N    1  
ATOM 391   C CA   . GLU A 1 26  ? 131.851 1.956   5.633   1.00 0.00 ? 26  GLU A CA   1  
ATOM 392   C C    . GLU A 1 26  ? 131.401 3.412   5.443   1.00 0.00 ? 26  GLU A C    1  
ATOM 393   O O    . GLU A 1 26  ? 130.539 3.885   6.173   1.00 0.00 ? 26  GLU A O    1  
ATOM 394   C CB   . GLU A 1 26  ? 133.195 1.874   6.312   1.00 0.00 ? 26  GLU A CB   1  
ATOM 395   C CG   . GLU A 1 26  ? 133.218 2.320   7.758   1.00 0.00 ? 26  GLU A CG   1  
ATOM 396   C CD   . GLU A 1 26  ? 132.365 1.447   8.635   1.00 0.00 ? 26  GLU A CD   1  
ATOM 397   O OE1  . GLU A 1 26  ? 132.599 0.219   8.669   1.00 0.00 ? 26  GLU A OE1  1  
ATOM 398   O OE2  . GLU A 1 26  ? 131.482 1.959   9.340   1.00 0.00 ? 26  GLU A OE2  1  
ATOM 399   H H    . GLU A 1 26  ? 132.830 1.079   4.024   1.00 0.00 ? 26  GLU A H    1  
ATOM 400   H HA   . GLU A 1 26  ? 131.122 1.434   6.234   1.00 0.00 ? 26  GLU A HA   1  
ATOM 401   H HB2  . GLU A 1 26  ? 133.461 0.825   6.268   1.00 0.00 ? 26  GLU A HB2  1  
ATOM 402   H HB3  . GLU A 1 26  ? 133.917 2.445   5.746   1.00 0.00 ? 26  GLU A HB3  1  
ATOM 403   H HG2  . GLU A 1 26  ? 134.235 2.284   8.119   1.00 0.00 ? 26  GLU A HG2  1  
ATOM 404   H HG3  . GLU A 1 26  ? 132.852 3.335   7.817   1.00 0.00 ? 26  GLU A HG3  1  
ATOM 405   N N    . ALA A 1 27  ? 131.936 4.105   4.421   1.00 0.00 ? 27  ALA A N    1  
ATOM 406   C CA   . ALA A 1 27  ? 131.532 5.500   4.185   1.00 0.00 ? 27  ALA A CA   1  
ATOM 407   C C    . ALA A 1 27  ? 130.068 5.534   3.754   1.00 0.00 ? 27  ALA A C    1  
ATOM 408   O O    . ALA A 1 27  ? 129.266 6.363   4.226   1.00 0.00 ? 27  ALA A O    1  
ATOM 409   C CB   . ALA A 1 27  ? 132.415 6.177   3.119   1.00 0.00 ? 27  ALA A CB   1  
ATOM 410   H H    . ALA A 1 27  ? 132.588 3.686   3.809   1.00 0.00 ? 27  ALA A H    1  
ATOM 411   H HA   . ALA A 1 27  ? 131.630 6.034   5.120   1.00 0.00 ? 27  ALA A HA   1  
ATOM 412   H HB1  . ALA A 1 27  ? 132.463 5.570   2.226   1.00 0.00 ? 27  ALA A HB1  1  
ATOM 413   H HB2  . ALA A 1 27  ? 133.413 6.389   3.477   1.00 0.00 ? 27  ALA A HB2  1  
ATOM 414   H HB3  . ALA A 1 27  ? 131.928 7.110   2.858   1.00 0.00 ? 27  ALA A HB3  1  
ATOM 415   N N    . PHE A 1 28  ? 129.714 4.587   2.914   1.00 0.00 ? 28  PHE A N    1  
ATOM 416   C CA   . PHE A 1 28  ? 128.385 4.508   2.366   1.00 0.00 ? 28  PHE A CA   1  
ATOM 417   C C    . PHE A 1 28  ? 127.394 4.069   3.427   1.00 0.00 ? 28  PHE A C    1  
ATOM 418   O O    . PHE A 1 28  ? 126.296 4.612   3.513   1.00 0.00 ? 28  PHE A O    1  
ATOM 419   C CB   . PHE A 1 28  ? 128.339 3.563   1.156   1.00 0.00 ? 28  PHE A CB   1  
ATOM 420   C CG   . PHE A 1 28  ? 127.031 3.598   0.417   1.00 0.00 ? 28  PHE A CG   1  
ATOM 421   C CD1  . PHE A 1 28  ? 126.758 4.629   -0.466  1.00 0.00 ? 28  PHE A CD1  1  
ATOM 422   C CD2  . PHE A 1 28  ? 126.073 2.619   0.610   1.00 0.00 ? 28  PHE A CD2  1  
ATOM 423   C CE1  . PHE A 1 28  ? 125.562 4.682   -1.141  1.00 0.00 ? 28  PHE A CE1  1  
ATOM 424   C CE2  . PHE A 1 28  ? 124.873 2.668   -0.062  1.00 0.00 ? 28  PHE A CE2  1  
ATOM 425   C CZ   . PHE A 1 28  ? 124.618 3.702   -0.940  1.00 0.00 ? 28  PHE A CZ   1  
ATOM 426   H H    . PHE A 1 28  ? 130.394 3.924   2.662   1.00 0.00 ? 28  PHE A H    1  
ATOM 427   H HA   . PHE A 1 28  ? 128.115 5.501   2.038   1.00 0.00 ? 28  PHE A HA   1  
ATOM 428   H HB2  . PHE A 1 28  ? 129.111 3.836   0.456   1.00 0.00 ? 28  PHE A HB2  1  
ATOM 429   H HB3  . PHE A 1 28  ? 128.504 2.551   1.492   1.00 0.00 ? 28  PHE A HB3  1  
ATOM 430   H HD1  . PHE A 1 28  ? 127.497 5.400   -0.625  1.00 0.00 ? 28  PHE A HD1  1  
ATOM 431   H HD2  . PHE A 1 28  ? 126.274 1.809   1.297   1.00 0.00 ? 28  PHE A HD2  1  
ATOM 432   H HE1  . PHE A 1 28  ? 125.363 5.493   -1.827  1.00 0.00 ? 28  PHE A HE1  1  
ATOM 433   H HE2  . PHE A 1 28  ? 124.132 1.897   0.095   1.00 0.00 ? 28  PHE A HE2  1  
ATOM 434   H HZ   . PHE A 1 28  ? 123.678 3.746   -1.471  1.00 0.00 ? 28  PHE A HZ   1  
ATOM 435   N N    . THR A 1 29  ? 127.787 3.110   4.268   1.00 0.00 ? 29  THR A N    1  
ATOM 436   C CA   . THR A 1 29  ? 126.892 2.634   5.285   1.00 0.00 ? 29  THR A CA   1  
ATOM 437   C C    . THR A 1 29  ? 126.611 3.730   6.301   1.00 0.00 ? 29  THR A C    1  
ATOM 438   O O    . THR A 1 29  ? 125.544 3.772   6.830   1.00 0.00 ? 29  THR A O    1  
ATOM 439   C CB   . THR A 1 29  ? 127.336 1.291   5.988   1.00 0.00 ? 29  THR A CB   1  
ATOM 440   O OG1  . THR A 1 29  ? 126.242 0.757   6.758   1.00 0.00 ? 29  THR A OG1  1  
ATOM 441   C CG2  . THR A 1 29  ? 128.517 1.496   6.930   1.00 0.00 ? 29  THR A CG2  1  
ATOM 442   H H    . THR A 1 29  ? 128.680 2.709   4.178   1.00 0.00 ? 29  THR A H    1  
ATOM 443   H HA   . THR A 1 29  ? 125.956 2.459   4.774   1.00 0.00 ? 29  THR A HA   1  
ATOM 444   H HB   . THR A 1 29  ? 127.606 0.578   5.222   1.00 0.00 ? 29  THR A HB   1  
ATOM 445   H HG1  . THR A 1 29  ? 125.519 1.391   6.724   1.00 0.00 ? 29  THR A HG1  1  
ATOM 446   H HG21 . THR A 1 29  ? 129.362 1.871   6.372   1.00 0.00 ? 29  THR A HG21 1  
ATOM 447   H HG22 . THR A 1 29  ? 128.780 0.556   7.390   1.00 0.00 ? 29  THR A HG22 1  
ATOM 448   H HG23 . THR A 1 29  ? 128.248 2.210   7.694   1.00 0.00 ? 29  THR A HG23 1  
ATOM 449   N N    . ARG A 1 30  ? 127.559 4.646   6.511   1.00 0.00 ? 30  ARG A N    1  
ATOM 450   C CA   . ARG A 1 30  ? 127.346 5.779   7.415   1.00 0.00 ? 30  ARG A CA   1  
ATOM 451   C C    . ARG A 1 30  ? 126.250 6.678   6.881   1.00 0.00 ? 30  ARG A C    1  
ATOM 452   O O    . ARG A 1 30  ? 125.317 7.044   7.607   1.00 0.00 ? 30  ARG A O    1  
ATOM 453   C CB   . ARG A 1 30  ? 128.627 6.570   7.612   1.00 0.00 ? 30  ARG A CB   1  
ATOM 454   C CG   . ARG A 1 30  ? 129.668 5.837   8.416   1.00 0.00 ? 30  ARG A CG   1  
ATOM 455   C CD   . ARG A 1 30  ? 130.967 6.610   8.482   1.00 0.00 ? 30  ARG A CD   1  
ATOM 456   N NE   . ARG A 1 30  ? 130.821 7.997   8.976   1.00 0.00 ? 30  ARG A NE   1  
ATOM 457   C CZ   . ARG A 1 30  ? 131.851 8.856   9.071   1.00 0.00 ? 30  ARG A CZ   1  
ATOM 458   N NH1  . ARG A 1 30  ? 133.088 8.414   8.908   1.00 0.00 ? 30  ARG A NH1  1  
ATOM 459   N NH2  . ARG A 1 30  ? 131.649 10.140  9.366   1.00 0.00 ? 30  ARG A NH2  1  
ATOM 460   H H    . ARG A 1 30  ? 128.423 4.554   6.049   1.00 0.00 ? 30  ARG A H    1  
ATOM 461   H HA   . ARG A 1 30  ? 127.024 5.377   8.365   1.00 0.00 ? 30  ARG A HA   1  
ATOM 462   H HB2  . ARG A 1 30  ? 129.046 6.800   6.644   1.00 0.00 ? 30  ARG A HB2  1  
ATOM 463   H HB3  . ARG A 1 30  ? 128.392 7.492   8.122   1.00 0.00 ? 30  ARG A HB3  1  
ATOM 464   H HG2  . ARG A 1 30  ? 129.291 5.644   9.406   1.00 0.00 ? 30  ARG A HG2  1  
ATOM 465   H HG3  . ARG A 1 30  ? 129.854 4.890   7.929   1.00 0.00 ? 30  ARG A HG3  1  
ATOM 466   H HD2  . ARG A 1 30  ? 131.644 6.084   9.140   1.00 0.00 ? 30  ARG A HD2  1  
ATOM 467   H HD3  . ARG A 1 30  ? 131.394 6.637   7.491   1.00 0.00 ? 30  ARG A HD3  1  
ATOM 468   H HE   . ARG A 1 30  ? 129.900 8.296   9.183   1.00 0.00 ? 30  ARG A HE   1  
ATOM 469   H HH11 . ARG A 1 30  ? 133.294 7.443   8.721   1.00 0.00 ? 30  ARG A HH11 1  
ATOM 470   H HH12 . ARG A 1 30  ? 133.893 9.020   8.958   1.00 0.00 ? 30  ARG A HH12 1  
ATOM 471   H HH21 . ARG A 1 30  ? 130.738 10.534  9.549   1.00 0.00 ? 30  ARG A HH21 1  
ATOM 472   H HH22 . ARG A 1 30  ? 132.404 10.806  9.375   1.00 0.00 ? 30  ARG A HH22 1  
ATOM 473   N N    . PHE A 1 31  ? 126.338 6.980   5.598   1.00 0.00 ? 31  PHE A N    1  
ATOM 474   C CA   . PHE A 1 31  ? 125.343 7.795   4.912   1.00 0.00 ? 31  PHE A CA   1  
ATOM 475   C C    . PHE A 1 31  ? 123.974 7.084   4.921   1.00 0.00 ? 31  PHE A C    1  
ATOM 476   O O    . PHE A 1 31  ? 122.916 7.711   4.999   1.00 0.00 ? 31  PHE A O    1  
ATOM 477   C CB   . PHE A 1 31  ? 125.813 8.062   3.468   1.00 0.00 ? 31  PHE A CB   1  
ATOM 478   C CG   . PHE A 1 31  ? 124.868 8.887   2.641   1.00 0.00 ? 31  PHE A CG   1  
ATOM 479   C CD1  . PHE A 1 31  ? 124.841 10.262  2.770   1.00 0.00 ? 31  PHE A CD1  1  
ATOM 480   C CD2  . PHE A 1 31  ? 124.011 8.286   1.732   1.00 0.00 ? 31  PHE A CD2  1  
ATOM 481   C CE1  . PHE A 1 31  ? 123.978 11.025  2.011   1.00 0.00 ? 31  PHE A CE1  1  
ATOM 482   C CE2  . PHE A 1 31  ? 123.146 9.043   0.974   1.00 0.00 ? 31  PHE A CE2  1  
ATOM 483   C CZ   . PHE A 1 31  ? 123.130 10.415  1.115   1.00 0.00 ? 31  PHE A CZ   1  
ATOM 484   H H    . PHE A 1 31  ? 127.116 6.655   5.091   1.00 0.00 ? 31  PHE A H    1  
ATOM 485   H HA   . PHE A 1 31  ? 125.257 8.736   5.436   1.00 0.00 ? 31  PHE A HA   1  
ATOM 486   H HB2  . PHE A 1 31  ? 126.758 8.582   3.496   1.00 0.00 ? 31  PHE A HB2  1  
ATOM 487   H HB3  . PHE A 1 31  ? 125.952 7.113   2.970   1.00 0.00 ? 31  PHE A HB3  1  
ATOM 488   H HD1  . PHE A 1 31  ? 125.504 10.743  3.474   1.00 0.00 ? 31  PHE A HD1  1  
ATOM 489   H HD2  . PHE A 1 31  ? 124.024 7.212   1.622   1.00 0.00 ? 31  PHE A HD2  1  
ATOM 490   H HE1  . PHE A 1 31  ? 123.966 12.099  2.123   1.00 0.00 ? 31  PHE A HE1  1  
ATOM 491   H HE2  . PHE A 1 31  ? 122.481 8.564   0.272   1.00 0.00 ? 31  PHE A HE2  1  
ATOM 492   H HZ   . PHE A 1 31  ? 122.454 11.010  0.520   1.00 0.00 ? 31  PHE A HZ   1  
ATOM 493   N N    . LEU A 1 32  ? 124.018 5.787   4.877   1.00 0.00 ? 32  LEU A N    1  
ATOM 494   C CA   . LEU A 1 32  ? 122.830 4.975   4.849   1.00 0.00 ? 32  LEU A CA   1  
ATOM 495   C C    . LEU A 1 32  ? 122.244 4.814   6.285   1.00 0.00 ? 32  LEU A C    1  
ATOM 496   O O    . LEU A 1 32  ? 121.024 4.720   6.475   1.00 0.00 ? 32  LEU A O    1  
ATOM 497   C CB   . LEU A 1 32  ? 123.208 3.630   4.235   1.00 0.00 ? 32  LEU A CB   1  
ATOM 498   C CG   . LEU A 1 32  ? 122.096 2.801   3.635   1.00 0.00 ? 32  LEU A CG   1  
ATOM 499   C CD1  . LEU A 1 32  ? 121.389 3.576   2.528   1.00 0.00 ? 32  LEU A CD1  1  
ATOM 500   C CD2  . LEU A 1 32  ? 122.673 1.517   3.083   1.00 0.00 ? 32  LEU A CD2  1  
ATOM 501   H H    . LEU A 1 32  ? 124.900 5.361   4.813   1.00 0.00 ? 32  LEU A H    1  
ATOM 502   H HA   . LEU A 1 32  ? 122.101 5.458   4.215   1.00 0.00 ? 32  LEU A HA   1  
ATOM 503   H HB2  . LEU A 1 32  ? 123.937 3.804   3.458   1.00 0.00 ? 32  LEU A HB2  1  
ATOM 504   H HB3  . LEU A 1 32  ? 123.682 3.041   5.008   1.00 0.00 ? 32  LEU A HB3  1  
ATOM 505   H HG   . LEU A 1 32  ? 121.373 2.547   4.396   1.00 0.00 ? 32  LEU A HG   1  
ATOM 506   H HD11 . LEU A 1 32  ? 120.597 2.972   2.111   1.00 0.00 ? 32  LEU A HD11 1  
ATOM 507   H HD12 . LEU A 1 32  ? 122.097 3.823   1.752   1.00 0.00 ? 32  LEU A HD12 1  
ATOM 508   H HD13 . LEU A 1 32  ? 120.972 4.485   2.936   1.00 0.00 ? 32  LEU A HD13 1  
ATOM 509   H HD21 . LEU A 1 32  ? 123.122 0.949   3.885   1.00 0.00 ? 32  LEU A HD21 1  
ATOM 510   H HD22 . LEU A 1 32  ? 123.434 1.757   2.354   1.00 0.00 ? 32  LEU A HD22 1  
ATOM 511   H HD23 . LEU A 1 32  ? 121.892 0.933   2.618   1.00 0.00 ? 32  LEU A HD23 1  
ATOM 512   N N    . LYS A 1 33  ? 123.126 4.808   7.283   1.00 0.00 ? 33  LYS A N    1  
ATOM 513   C CA   . LYS A 1 33  ? 122.752 4.688   8.699   1.00 0.00 ? 33  LYS A CA   1  
ATOM 514   C C    . LYS A 1 33  ? 122.123 5.959   9.225   1.00 0.00 ? 33  LYS A C    1  
ATOM 515   O O    . LYS A 1 33  ? 121.131 5.899   9.953   1.00 0.00 ? 33  LYS A O    1  
ATOM 516   C CB   . LYS A 1 33  ? 123.975 4.361   9.585   1.00 0.00 ? 33  LYS A CB   1  
ATOM 517   C CG   . LYS A 1 33  ? 124.488 2.932   9.514   1.00 0.00 ? 33  LYS A CG   1  
ATOM 518   C CD   . LYS A 1 33  ? 125.793 2.784   10.285  1.00 0.00 ? 33  LYS A CD   1  
ATOM 519   C CE   . LYS A 1 33  ? 126.258 1.333   10.357  1.00 0.00 ? 33  LYS A CE   1  
ATOM 520   N NZ   . LYS A 1 33  ? 125.358 0.503   11.186  1.00 0.00 ? 33  LYS A NZ   1  
ATOM 521   H H    . LYS A 1 33  ? 124.080 4.864   7.052   1.00 0.00 ? 33  LYS A H    1  
ATOM 522   H HA   . LYS A 1 33  ? 122.045 3.878   8.791   1.00 0.00 ? 33  LYS A HA   1  
ATOM 523   H HB2  . LYS A 1 33  ? 124.788 5.011   9.297   1.00 0.00 ? 33  LYS A HB2  1  
ATOM 524   H HB3  . LYS A 1 33  ? 123.717 4.578   10.611  1.00 0.00 ? 33  LYS A HB3  1  
ATOM 525   H HG2  . LYS A 1 33  ? 123.749 2.270   9.941   1.00 0.00 ? 33  LYS A HG2  1  
ATOM 526   H HG3  . LYS A 1 33  ? 124.658 2.671   8.481   1.00 0.00 ? 33  LYS A HG3  1  
ATOM 527   H HD2  . LYS A 1 33  ? 126.557 3.365   9.790   1.00 0.00 ? 33  LYS A HD2  1  
ATOM 528   H HD3  . LYS A 1 33  ? 125.652 3.159   11.289  1.00 0.00 ? 33  LYS A HD3  1  
ATOM 529   H HE2  . LYS A 1 33  ? 126.286 0.927   9.357   1.00 0.00 ? 33  LYS A HE2  1  
ATOM 530   H HE3  . LYS A 1 33  ? 127.252 1.308   10.781  1.00 0.00 ? 33  LYS A HE3  1  
ATOM 531   H HZ1  . LYS A 1 33  ? 124.381 0.469   10.815  1.00 0.00 ? 33  LYS A HZ1  1  
ATOM 532   H HZ2  . LYS A 1 33  ? 125.294 0.904   12.147  1.00 0.00 ? 33  LYS A HZ2  1  
ATOM 533   H HZ3  . LYS A 1 33  ? 125.698 -0.478  11.282  1.00 0.00 ? 33  LYS A HZ3  1  
ATOM 534   N N    . THR A 1 34  ? 122.686 7.095   8.844   1.00 0.00 ? 34  THR A N    1  
ATOM 535   C CA   . THR A 1 34  ? 122.277 8.389   9.374   1.00 0.00 ? 34  THR A CA   1  
ATOM 536   C C    . THR A 1 34  ? 120.771 8.702   9.140   1.00 0.00 ? 34  THR A C    1  
ATOM 537   O O    . THR A 1 34  ? 120.133 9.351   9.979   1.00 0.00 ? 34  THR A O    1  
ATOM 538   C CB   . THR A 1 34  ? 123.220 9.544   8.865   1.00 0.00 ? 34  THR A CB   1  
ATOM 539   O OG1  . THR A 1 34  ? 122.945 10.786  9.532   1.00 0.00 ? 34  THR A OG1  1  
ATOM 540   C CG2  . THR A 1 34  ? 123.104 9.754   7.375   1.00 0.00 ? 34  THR A CG2  1  
ATOM 541   H H    . THR A 1 34  ? 123.428 7.064   8.199   1.00 0.00 ? 34  THR A H    1  
ATOM 542   H HA   . THR A 1 34  ? 122.405 8.309   10.444  1.00 0.00 ? 34  THR A HA   1  
ATOM 543   H HB   . THR A 1 34  ? 124.237 9.263   9.097   1.00 0.00 ? 34  THR A HB   1  
ATOM 544   H HG1  . THR A 1 34  ? 122.935 10.586  10.482  1.00 0.00 ? 34  THR A HG1  1  
ATOM 545   H HG21 . THR A 1 34  ? 123.767 10.549  7.070   1.00 0.00 ? 34  THR A HG21 1  
ATOM 546   H HG22 . THR A 1 34  ? 122.087 10.020  7.127   1.00 0.00 ? 34  THR A HG22 1  
ATOM 547   H HG23 . THR A 1 34  ? 123.376 8.843   6.861   1.00 0.00 ? 34  THR A HG23 1  
ATOM 548   N N    . GLU A 1 35  ? 120.199 8.196   8.050   1.00 0.00 ? 35  GLU A N    1  
ATOM 549   C CA   . GLU A 1 35  ? 118.782 8.430   7.769   1.00 0.00 ? 35  GLU A CA   1  
ATOM 550   C C    . GLU A 1 35  ? 117.956 7.160   7.965   1.00 0.00 ? 35  GLU A C    1  
ATOM 551   O O    . GLU A 1 35  ? 116.765 7.113   7.627   1.00 0.00 ? 35  GLU A O    1  
ATOM 552   C CB   . GLU A 1 35  ? 118.588 8.991   6.366   1.00 0.00 ? 35  GLU A CB   1  
ATOM 553   C CG   . GLU A 1 35  ? 119.131 8.122   5.251   1.00 0.00 ? 35  GLU A CG   1  
ATOM 554   C CD   . GLU A 1 35  ? 118.890 8.748   3.912   1.00 0.00 ? 35  GLU A CD   1  
ATOM 555   O OE1  . GLU A 1 35  ? 119.391 9.856   3.675   1.00 0.00 ? 35  GLU A OE1  1  
ATOM 556   O OE2  . GLU A 1 35  ? 118.217 8.144   3.054   1.00 0.00 ? 35  GLU A OE2  1  
ATOM 557   H H    . GLU A 1 35  ? 120.735 7.668   7.423   1.00 0.00 ? 35  GLU A H    1  
ATOM 558   H HA   . GLU A 1 35  ? 118.439 9.161   8.486   1.00 0.00 ? 35  GLU A HA   1  
ATOM 559   H HB2  . GLU A 1 35  ? 117.531 9.130   6.194   1.00 0.00 ? 35  GLU A HB2  1  
ATOM 560   H HB3  . GLU A 1 35  ? 119.076 9.952   6.310   1.00 0.00 ? 35  GLU A HB3  1  
ATOM 561   H HG2  . GLU A 1 35  ? 120.194 7.993   5.392   1.00 0.00 ? 35  GLU A HG2  1  
ATOM 562   H HG3  . GLU A 1 35  ? 118.640 7.160   5.281   1.00 0.00 ? 35  GLU A HG3  1  
ATOM 563   N N    . PHE A 1 36  ? 118.595 6.155   8.541   1.00 0.00 ? 36  PHE A N    1  
ATOM 564   C CA   . PHE A 1 36  ? 117.994 4.856   8.835   1.00 0.00 ? 36  PHE A CA   1  
ATOM 565   C C    . PHE A 1 36  ? 117.462 4.141   7.588   1.00 0.00 ? 36  PHE A C    1  
ATOM 566   O O    . PHE A 1 36  ? 116.248 4.088   7.334   1.00 0.00 ? 36  PHE A O    1  
ATOM 567   C CB   . PHE A 1 36  ? 116.916 4.943   9.934   1.00 0.00 ? 36  PHE A CB   1  
ATOM 568   C CG   . PHE A 1 36  ? 117.426 5.437   11.261  1.00 0.00 ? 36  PHE A CG   1  
ATOM 569   C CD1  . PHE A 1 36  ? 117.433 6.792   11.560  1.00 0.00 ? 36  PHE A CD1  1  
ATOM 570   C CD2  . PHE A 1 36  ? 117.894 4.547   12.210  1.00 0.00 ? 36  PHE A CD2  1  
ATOM 571   C CE1  . PHE A 1 36  ? 117.896 7.246   12.776  1.00 0.00 ? 36  PHE A CE1  1  
ATOM 572   C CE2  . PHE A 1 36  ? 118.360 4.998   13.431  1.00 0.00 ? 36  PHE A CE2  1  
ATOM 573   C CZ   . PHE A 1 36  ? 118.361 6.348   13.714  1.00 0.00 ? 36  PHE A CZ   1  
ATOM 574   H H    . PHE A 1 36  ? 119.527 6.302   8.812   1.00 0.00 ? 36  PHE A H    1  
ATOM 575   H HA   . PHE A 1 36  ? 118.802 4.247   9.211   1.00 0.00 ? 36  PHE A HA   1  
ATOM 576   H HB2  . PHE A 1 36  ? 116.139 5.619   9.610   1.00 0.00 ? 36  PHE A HB2  1  
ATOM 577   H HB3  . PHE A 1 36  ? 116.488 3.962   10.083  1.00 0.00 ? 36  PHE A HB3  1  
ATOM 578   H HD1  . PHE A 1 36  ? 117.069 7.495   10.824  1.00 0.00 ? 36  PHE A HD1  1  
ATOM 579   H HD2  . PHE A 1 36  ? 117.894 3.490   11.989  1.00 0.00 ? 36  PHE A HD2  1  
ATOM 580   H HE1  . PHE A 1 36  ? 117.896 8.304   12.994  1.00 0.00 ? 36  PHE A HE1  1  
ATOM 581   H HE2  . PHE A 1 36  ? 118.722 4.292   14.164  1.00 0.00 ? 36  PHE A HE2  1  
ATOM 582   H HZ   . PHE A 1 36  ? 118.724 6.702   14.667  1.00 0.00 ? 36  PHE A HZ   1  
ATOM 583   N N    . SER A 1 37  ? 118.371 3.679   6.776   1.00 0.00 ? 37  SER A N    1  
ATOM 584   C CA   . SER A 1 37  ? 118.060 2.867   5.611   1.00 0.00 ? 37  SER A CA   1  
ATOM 585   C C    . SER A 1 37  ? 119.222 1.908   5.383   1.00 0.00 ? 37  SER A C    1  
ATOM 586   O O    . SER A 1 37  ? 119.430 1.379   4.290   1.00 0.00 ? 37  SER A O    1  
ATOM 587   C CB   . SER A 1 37  ? 117.845 3.762   4.390   1.00 0.00 ? 37  SER A CB   1  
ATOM 588   O OG   . SER A 1 37  ? 116.781 4.688   4.627   1.00 0.00 ? 37  SER A OG   1  
ATOM 589   H H    . SER A 1 37  ? 119.316 3.899   6.929   1.00 0.00 ? 37  SER A H    1  
ATOM 590   H HA   . SER A 1 37  ? 117.164 2.302   5.820   1.00 0.00 ? 37  SER A HA   1  
ATOM 591   H HB2  . SER A 1 37  ? 118.751 4.313   4.186   1.00 0.00 ? 37  SER A HB2  1  
ATOM 592   H HB3  . SER A 1 37  ? 117.589 3.151   3.537   1.00 0.00 ? 37  SER A HB3  1  
ATOM 593   H HG   . SER A 1 37  ? 116.505 4.517   5.538   1.00 0.00 ? 37  SER A HG   1  
ATOM 594   N N    . GLU A 1 38  ? 119.914 1.611   6.475   1.00 0.00 ? 38  GLU A N    1  
ATOM 595   C CA   . GLU A 1 38  ? 121.146 0.841   6.441   1.00 0.00 ? 38  GLU A CA   1  
ATOM 596   C C    . GLU A 1 38  ? 120.881 -0.641  6.185   1.00 0.00 ? 38  GLU A C    1  
ATOM 597   O O    . GLU A 1 38  ? 121.786 -1.386  5.798   1.00 0.00 ? 38  GLU A O    1  
ATOM 598   C CB   . GLU A 1 38  ? 121.906 1.026   7.753   1.00 0.00 ? 38  GLU A CB   1  
ATOM 599   C CG   . GLU A 1 38  ? 121.149 0.514   8.959   1.00 0.00 ? 38  GLU A CG   1  
ATOM 600   C CD   . GLU A 1 38  ? 121.825 0.804   10.259  1.00 0.00 ? 38  GLU A CD   1  
ATOM 601   O OE1  . GLU A 1 38  ? 122.836 0.171   10.563  1.00 0.00 ? 38  GLU A OE1  1  
ATOM 602   O OE2  . GLU A 1 38  ? 121.326 1.642   11.032  1.00 0.00 ? 38  GLU A OE2  1  
ATOM 603   H H    . GLU A 1 38  ? 119.537 1.885   7.341   1.00 0.00 ? 38  GLU A H    1  
ATOM 604   H HA   . GLU A 1 38  ? 121.755 1.232   5.639   1.00 0.00 ? 38  GLU A HA   1  
ATOM 605   H HB2  . GLU A 1 38  ? 122.846 0.499   7.689   1.00 0.00 ? 38  GLU A HB2  1  
ATOM 606   H HB3  . GLU A 1 38  ? 122.101 2.079   7.898   1.00 0.00 ? 38  GLU A HB3  1  
ATOM 607   H HG2  . GLU A 1 38  ? 120.174 0.978   8.978   1.00 0.00 ? 38  GLU A HG2  1  
ATOM 608   H HG3  . GLU A 1 38  ? 121.030 -0.555  8.858   1.00 0.00 ? 38  GLU A HG3  1  
ATOM 609   N N    . GLU A 1 39  ? 119.631 -1.054  6.335   1.00 0.00 ? 39  GLU A N    1  
ATOM 610   C CA   . GLU A 1 39  ? 119.287 -2.452  6.184   1.00 0.00 ? 39  GLU A CA   1  
ATOM 611   C C    . GLU A 1 39  ? 119.224 -2.884  4.732   1.00 0.00 ? 39  GLU A C    1  
ATOM 612   O O    . GLU A 1 39  ? 118.944 -4.016  4.451   1.00 0.00 ? 39  GLU A O    1  
ATOM 613   C CB   . GLU A 1 39  ? 118.017 -2.880  6.965   1.00 0.00 ? 39  GLU A CB   1  
ATOM 614   C CG   . GLU A 1 39  ? 116.732 -2.115  6.664   1.00 0.00 ? 39  GLU A CG   1  
ATOM 615   C CD   . GLU A 1 39  ? 116.739 -0.724  7.223   1.00 0.00 ? 39  GLU A CD   1  
ATOM 616   O OE1  . GLU A 1 39  ? 116.588 -0.556  8.459   1.00 0.00 ? 39  GLU A OE1  1  
ATOM 617   O OE2  . GLU A 1 39  ? 116.937 0.219   6.477   1.00 0.00 ? 39  GLU A OE2  1  
ATOM 618   H H    . GLU A 1 39  ? 118.925 -0.397  6.525   1.00 0.00 ? 39  GLU A H    1  
ATOM 619   H HA   . GLU A 1 39  ? 120.129 -2.984  6.605   1.00 0.00 ? 39  GLU A HA   1  
ATOM 620   H HB2  . GLU A 1 39  ? 117.825 -3.921  6.754   1.00 0.00 ? 39  GLU A HB2  1  
ATOM 621   H HB3  . GLU A 1 39  ? 118.227 -2.784  8.021   1.00 0.00 ? 39  GLU A HB3  1  
ATOM 622   H HG2  . GLU A 1 39  ? 116.609 -2.052  5.594   1.00 0.00 ? 39  GLU A HG2  1  
ATOM 623   H HG3  . GLU A 1 39  ? 115.900 -2.657  7.088   1.00 0.00 ? 39  GLU A HG3  1  
ATOM 624   N N    . ASN A 1 40  ? 119.497 -1.973  3.824   1.00 0.00 ? 40  ASN A N    1  
ATOM 625   C CA   . ASN A 1 40  ? 119.601 -2.323  2.409   1.00 0.00 ? 40  ASN A CA   1  
ATOM 626   C C    . ASN A 1 40  ? 120.998 -2.878  2.144   1.00 0.00 ? 40  ASN A C    1  
ATOM 627   O O    . ASN A 1 40  ? 121.185 -4.000  1.560   1.00 0.00 ? 40  ASN A O    1  
ATOM 628   C CB   . ASN A 1 40  ? 119.320 -1.107  1.510   1.00 0.00 ? 40  ASN A CB   1  
ATOM 629   C CG   . ASN A 1 40  ? 117.881 -0.632  1.590   1.00 0.00 ? 40  ASN A CG   1  
ATOM 630   O OD1  . ASN A 1 40  ? 116.963 -1.417  1.812   1.00 0.00 ? 40  ASN A OD1  1  
ATOM 631   N ND2  . ASN A 1 40  ? 117.666 0.637   1.383   1.00 0.00 ? 40  ASN A ND2  1  
ATOM 632   H H    . ASN A 1 40  ? 119.597 -1.043  4.118   1.00 0.00 ? 40  ASN A H    1  
ATOM 633   H HA   . ASN A 1 40  ? 118.878 -3.100  2.211   1.00 0.00 ? 40  ASN A HA   1  
ATOM 634   H HB2  . ASN A 1 40  ? 119.960 -0.291  1.810   1.00 0.00 ? 40  ASN A HB2  1  
ATOM 635   H HB3  . ASN A 1 40  ? 119.540 -1.369  0.486   1.00 0.00 ? 40  ASN A HB3  1  
ATOM 636   H HD21 . ASN A 1 40  ? 118.425 1.222   1.175   1.00 0.00 ? 40  ASN A HD21 1  
ATOM 637   H HD22 . ASN A 1 40  ? 116.742 0.970   1.456   1.00 0.00 ? 40  ASN A HD22 1  
ATOM 638   N N    . ILE A 1 41  ? 121.995 -2.156  2.648   1.00 0.00 ? 41  ILE A N    1  
ATOM 639   C CA   . ILE A 1 41  ? 123.360 -2.597  2.509   1.00 0.00 ? 41  ILE A CA   1  
ATOM 640   C C    . ILE A 1 41  ? 123.504 -3.879  3.314   1.00 0.00 ? 41  ILE A C    1  
ATOM 641   O O    . ILE A 1 41  ? 124.123 -4.840  2.878   1.00 0.00 ? 41  ILE A O    1  
ATOM 642   C CB   . ILE A 1 41  ? 124.411 -1.497  2.952   1.00 0.00 ? 41  ILE A CB   1  
ATOM 643   C CG1  . ILE A 1 41  ? 125.653 -1.546  2.038   1.00 0.00 ? 41  ILE A CG1  1  
ATOM 644   C CG2  . ILE A 1 41  ? 124.821 -1.613  4.443   1.00 0.00 ? 41  ILE A CG2  1  
ATOM 645   C CD1  . ILE A 1 41  ? 126.714 -0.515  2.370   1.00 0.00 ? 41  ILE A CD1  1  
ATOM 646   H H    . ILE A 1 41  ? 121.796 -1.313  3.105   1.00 0.00 ? 41  ILE A H    1  
ATOM 647   H HA   . ILE A 1 41  ? 123.505 -2.844  1.466   1.00 0.00 ? 41  ILE A HA   1  
ATOM 648   H HB   . ILE A 1 41  ? 123.936 -0.535  2.827   1.00 0.00 ? 41  ILE A HB   1  
ATOM 649   H HG12 . ILE A 1 41  ? 126.112 -2.522  2.033   1.00 0.00 ? 41  ILE A HG12 1  
ATOM 650   H HG13 . ILE A 1 41  ? 125.319 -1.340  1.031   1.00 0.00 ? 41  ILE A HG13 1  
ATOM 651   H HG21 . ILE A 1 41  ? 125.204 -2.603  4.656   1.00 0.00 ? 41  ILE A HG21 1  
ATOM 652   H HG22 . ILE A 1 41  ? 123.955 -1.442  5.068   1.00 0.00 ? 41  ILE A HG22 1  
ATOM 653   H HG23 . ILE A 1 41  ? 125.578 -0.878  4.670   1.00 0.00 ? 41  ILE A HG23 1  
ATOM 654   H HD11 . ILE A 1 41  ? 127.091 -0.682  3.368   1.00 0.00 ? 41  ILE A HD11 1  
ATOM 655   H HD12 . ILE A 1 41  ? 126.274 0.470   2.307   1.00 0.00 ? 41  ILE A HD12 1  
ATOM 656   H HD13 . ILE A 1 41  ? 127.519 -0.595  1.652   1.00 0.00 ? 41  ILE A HD13 1  
ATOM 657   N N    . GLU A 1 42  ? 122.824 -3.921  4.461   1.00 0.00 ? 42  GLU A N    1  
ATOM 658   C CA   . GLU A 1 42  ? 122.851 -5.083  5.268   1.00 0.00 ? 42  GLU A CA   1  
ATOM 659   C C    . GLU A 1 42  ? 121.839 -6.138  4.861   1.00 0.00 ? 42  GLU A C    1  
ATOM 660   O O    . GLU A 1 42  ? 121.844 -7.244  5.397   1.00 0.00 ? 42  GLU A O    1  
ATOM 661   C CB   . GLU A 1 42  ? 122.905 -4.803  6.756   1.00 0.00 ? 42  GLU A CB   1  
ATOM 662   C CG   . GLU A 1 42  ? 124.318 -4.467  7.222   1.00 0.00 ? 42  GLU A CG   1  
ATOM 663   C CD   . GLU A 1 42  ? 124.400 -4.160  8.686   1.00 0.00 ? 42  GLU A CD   1  
ATOM 664   O OE1  . GLU A 1 42  ? 124.388 -5.111  9.516   1.00 0.00 ? 42  GLU A OE1  1  
ATOM 665   O OE2  . GLU A 1 42  ? 124.482 -2.971  9.054   1.00 0.00 ? 42  GLU A OE2  1  
ATOM 666   H H    . GLU A 1 42  ? 122.326 -3.129  4.760   1.00 0.00 ? 42  GLU A H    1  
ATOM 667   H HA   . GLU A 1 42  ? 123.816 -5.452  4.973   1.00 0.00 ? 42  GLU A HA   1  
ATOM 668   H HB2  . GLU A 1 42  ? 122.259 -3.969  6.984   1.00 0.00 ? 42  GLU A HB2  1  
ATOM 669   H HB3  . GLU A 1 42  ? 122.571 -5.675  7.296   1.00 0.00 ? 42  GLU A HB3  1  
ATOM 670   H HG2  . GLU A 1 42  ? 124.937 -5.323  7.001   1.00 0.00 ? 42  GLU A HG2  1  
ATOM 671   H HG3  . GLU A 1 42  ? 124.747 -3.665  6.648   1.00 0.00 ? 42  GLU A HG3  1  
ATOM 672   N N    . PHE A 1 43  ? 120.993 -5.799  3.903   1.00 0.00 ? 43  PHE A N    1  
ATOM 673   C CA   . PHE A 1 43  ? 120.097 -6.754  3.278   1.00 0.00 ? 43  PHE A CA   1  
ATOM 674   C C    . PHE A 1 43  ? 120.936 -7.785  2.618   1.00 0.00 ? 43  PHE A C    1  
ATOM 675   O O    . PHE A 1 43  ? 120.861 -8.976  2.945   1.00 0.00 ? 43  PHE A O    1  
ATOM 676   C CB   . PHE A 1 43  ? 119.199 -6.067  2.224   1.00 0.00 ? 43  PHE A CB   1  
ATOM 677   C CG   . PHE A 1 43  ? 118.459 -6.990  1.297   1.00 0.00 ? 43  PHE A CG   1  
ATOM 678   C CD1  . PHE A 1 43  ? 117.219 -7.443  1.617   1.00 0.00 ? 43  PHE A CD1  1  
ATOM 679   C CD2  . PHE A 1 43  ? 119.021 -7.381  0.086   1.00 0.00 ? 43  PHE A CD2  1  
ATOM 680   C CE1  . PHE A 1 43  ? 116.533 -8.271  0.768   1.00 0.00 ? 43  PHE A CE1  1  
ATOM 681   C CE2  . PHE A 1 43  ? 118.346 -8.215  -0.771  1.00 0.00 ? 43  PHE A CE2  1  
ATOM 682   C CZ   . PHE A 1 43  ? 117.098 -8.661  -0.429  1.00 0.00 ? 43  PHE A CZ   1  
ATOM 683   H H    . PHE A 1 43  ? 120.940 -4.865  3.614   1.00 0.00 ? 43  PHE A H    1  
ATOM 684   H HA   . PHE A 1 43  ? 119.481 -7.210  4.038   1.00 0.00 ? 43  PHE A HA   1  
ATOM 685   H HB2  . PHE A 1 43  ? 118.461 -5.471  2.737   1.00 0.00 ? 43  PHE A HB2  1  
ATOM 686   H HB3  . PHE A 1 43  ? 119.815 -5.413  1.625   1.00 0.00 ? 43  PHE A HB3  1  
ATOM 687   H HD1  . PHE A 1 43  ? 116.772 -7.146  2.555   1.00 0.00 ? 43  PHE A HD1  1  
ATOM 688   H HD2  . PHE A 1 43  ? 120.004 -7.016  -0.174  1.00 0.00 ? 43  PHE A HD2  1  
ATOM 689   H HE1  . PHE A 1 43  ? 115.543 -8.598  1.050   1.00 0.00 ? 43  PHE A HE1  1  
ATOM 690   H HE2  . PHE A 1 43  ? 118.795 -8.515  -1.705  1.00 0.00 ? 43  PHE A HE2  1  
ATOM 691   H HZ   . PHE A 1 43  ? 116.553 -9.313  -1.096  1.00 0.00 ? 43  PHE A HZ   1  
ATOM 692   N N    . TRP A 1 44  ? 121.788 -7.347  1.706   1.00 0.00 ? 44  TRP A N    1  
ATOM 693   C CA   . TRP A 1 44  ? 122.613 -8.334  1.055   1.00 0.00 ? 44  TRP A CA   1  
ATOM 694   C C    . TRP A 1 44  ? 123.776 -8.820  1.895   1.00 0.00 ? 44  TRP A C    1  
ATOM 695   O O    . TRP A 1 44  ? 124.276 -9.907  1.677   1.00 0.00 ? 44  TRP A O    1  
ATOM 696   C CB   . TRP A 1 44  ? 122.943 -8.074  -0.416  1.00 0.00 ? 44  TRP A CB   1  
ATOM 697   C CG   . TRP A 1 44  ? 123.455 -6.727  -0.770  1.00 0.00 ? 44  TRP A CG   1  
ATOM 698   C CD1  . TRP A 1 44  ? 122.815 -5.810  -1.543  1.00 0.00 ? 44  TRP A CD1  1  
ATOM 699   C CD2  . TRP A 1 44  ? 124.703 -6.145  -0.395  1.00 0.00 ? 44  TRP A CD2  1  
ATOM 700   N NE1  . TRP A 1 44  ? 123.591 -4.705  -1.697  1.00 0.00 ? 44  TRP A NE1  1  
ATOM 701   C CE2  . TRP A 1 44  ? 124.750 -4.875  -0.977  1.00 0.00 ? 44  TRP A CE2  1  
ATOM 702   C CE3  . TRP A 1 44  ? 125.784 -6.570  0.385   1.00 0.00 ? 44  TRP A CE3  1  
ATOM 703   C CZ2  . TRP A 1 44  ? 125.831 -4.032  -0.812  1.00 0.00 ? 44  TRP A CZ2  1  
ATOM 704   C CZ3  . TRP A 1 44  ? 126.857 -5.727  0.548   1.00 0.00 ? 44  TRP A CZ3  1  
ATOM 705   C CH2  . TRP A 1 44  ? 126.872 -4.471  -0.043  1.00 0.00 ? 44  TRP A CH2  1  
ATOM 706   H H    . TRP A 1 44  ? 121.819 -6.378  1.500   1.00 0.00 ? 44  TRP A H    1  
ATOM 707   H HA   . TRP A 1 44  ? 121.953 -9.191  1.090   1.00 0.00 ? 44  TRP A HA   1  
ATOM 708   H HB2  . TRP A 1 44  ? 123.696 -8.783  -0.727  1.00 0.00 ? 44  TRP A HB2  1  
ATOM 709   H HB3  . TRP A 1 44  ? 122.050 -8.257  -0.996  1.00 0.00 ? 44  TRP A HB3  1  
ATOM 710   H HD1  . TRP A 1 44  ? 121.845 -5.965  -1.990  1.00 0.00 ? 44  TRP A HD1  1  
ATOM 711   H HE1  . TRP A 1 44  ? 123.339 -3.918  -2.225  1.00 0.00 ? 44  TRP A HE1  1  
ATOM 712   H HE3  . TRP A 1 44  ? 125.786 -7.545  0.850   1.00 0.00 ? 44  TRP A HE3  1  
ATOM 713   H HZ2  . TRP A 1 44  ? 125.861 -3.051  -1.261  1.00 0.00 ? 44  TRP A HZ2  1  
ATOM 714   H HZ3  . TRP A 1 44  ? 127.700 -6.038  1.149   1.00 0.00 ? 44  TRP A HZ3  1  
ATOM 715   H HH2  . TRP A 1 44  ? 127.734 -3.837  0.110   1.00 0.00 ? 44  TRP A HH2  1  
ATOM 716   N N    . ILE A 1 45  ? 124.175 -8.035  2.887   1.00 0.00 ? 45  ILE A N    1  
ATOM 717   C CA   . ILE A 1 45  ? 125.160 -8.495  3.863   1.00 0.00 ? 45  ILE A CA   1  
ATOM 718   C C    . ILE A 1 45  ? 124.586 -9.694  4.624   1.00 0.00 ? 45  ILE A C    1  
ATOM 719   O O    . ILE A 1 45  ? 125.296 -10.653 4.897   1.00 0.00 ? 45  ILE A O    1  
ATOM 720   C CB   . ILE A 1 45  ? 125.603 -7.338  4.822   1.00 0.00 ? 45  ILE A CB   1  
ATOM 721   C CG1  . ILE A 1 45  ? 126.546 -6.360  4.094   1.00 0.00 ? 45  ILE A CG1  1  
ATOM 722   C CG2  . ILE A 1 45  ? 126.173 -7.803  6.159   1.00 0.00 ? 45  ILE A CG2  1  
ATOM 723   C CD1  . ILE A 1 45  ? 127.023 -5.186  4.930   1.00 0.00 ? 45  ILE A CD1  1  
ATOM 724   H H    . ILE A 1 45  ? 123.823 -7.121  2.942   1.00 0.00 ? 45  ILE A H    1  
ATOM 725   H HA   . ILE A 1 45  ? 126.013 -8.844  3.299   1.00 0.00 ? 45  ILE A HA   1  
ATOM 726   H HB   . ILE A 1 45  ? 124.706 -6.809  5.074   1.00 0.00 ? 45  ILE A HB   1  
ATOM 727   H HG12 . ILE A 1 45  ? 127.423 -6.899  3.769   1.00 0.00 ? 45  ILE A HG12 1  
ATOM 728   H HG13 . ILE A 1 45  ? 126.036 -5.969  3.226   1.00 0.00 ? 45  ILE A HG13 1  
ATOM 729   H HG21 . ILE A 1 45  ? 125.470 -8.475  6.631   1.00 0.00 ? 45  ILE A HG21 1  
ATOM 730   H HG22 . ILE A 1 45  ? 126.251 -6.905  6.759   1.00 0.00 ? 45  ILE A HG22 1  
ATOM 731   H HG23 . ILE A 1 45  ? 127.141 -8.264  6.028   1.00 0.00 ? 45  ILE A HG23 1  
ATOM 732   H HD11 . ILE A 1 45  ? 126.172 -4.606  5.256   1.00 0.00 ? 45  ILE A HD11 1  
ATOM 733   H HD12 . ILE A 1 45  ? 127.676 -4.563  4.335   1.00 0.00 ? 45  ILE A HD12 1  
ATOM 734   H HD13 . ILE A 1 45  ? 127.561 -5.552  5.791   1.00 0.00 ? 45  ILE A HD13 1  
ATOM 735   N N    . ALA A 1 46  ? 123.281 -9.661  4.901   1.00 0.00 ? 46  ALA A N    1  
ATOM 736   C CA   . ALA A 1 46  ? 122.600 -10.787 5.530   1.00 0.00 ? 46  ALA A CA   1  
ATOM 737   C C    . ALA A 1 46  ? 122.621 -11.976 4.588   1.00 0.00 ? 46  ALA A C    1  
ATOM 738   O O    . ALA A 1 46  ? 122.893 -13.105 5.000   1.00 0.00 ? 46  ALA A O    1  
ATOM 739   C CB   . ALA A 1 46  ? 121.150 -10.450 5.875   1.00 0.00 ? 46  ALA A CB   1  
ATOM 740   H H    . ALA A 1 46  ? 122.765 -8.849  4.693   1.00 0.00 ? 46  ALA A H    1  
ATOM 741   H HA   . ALA A 1 46  ? 123.135 -11.023 6.439   1.00 0.00 ? 46  ALA A HA   1  
ATOM 742   H HB1  . ALA A 1 46  ? 120.619 -10.158 4.978   1.00 0.00 ? 46  ALA A HB1  1  
ATOM 743   H HB2  . ALA A 1 46  ? 121.097 -9.662  6.610   1.00 0.00 ? 46  ALA A HB2  1  
ATOM 744   H HB3  . ALA A 1 46  ? 120.682 -11.348 6.256   1.00 0.00 ? 46  ALA A HB3  1  
ATOM 745   N N    . CYS A 1 47  ? 122.354 -11.702 3.323   1.00 0.00 ? 47  CYS A N    1  
ATOM 746   C CA   . CYS A 1 47  ? 122.306 -12.720 2.285   1.00 0.00 ? 47  CYS A CA   1  
ATOM 747   C C    . CYS A 1 47  ? 123.662 -13.402 2.113   1.00 0.00 ? 47  CYS A C    1  
ATOM 748   O O    . CYS A 1 47  ? 123.747 -14.624 2.080   1.00 0.00 ? 47  CYS A O    1  
ATOM 749   C CB   . CYS A 1 47  ? 121.854 -12.092 0.969   1.00 0.00 ? 47  CYS A CB   1  
ATOM 750   S SG   . CYS A 1 47  ? 120.274 -11.220 1.084   1.00 0.00 ? 47  CYS A SG   1  
ATOM 751   H H    . CYS A 1 47  ? 122.177 -10.770 3.078   1.00 0.00 ? 47  CYS A H    1  
ATOM 752   H HA   . CYS A 1 47  ? 121.578 -13.460 2.580   1.00 0.00 ? 47  CYS A HA   1  
ATOM 753   H HB2  . CYS A 1 47  ? 122.599 -11.380 0.643   1.00 0.00 ? 47  CYS A HB2  1  
ATOM 754   H HB3  . CYS A 1 47  ? 121.751 -12.866 0.223   1.00 0.00 ? 47  CYS A HB3  1  
ATOM 755   H HG   . CYS A 1 47  ? 120.363 -10.287 2.026   1.00 0.00 ? 47  CYS A HG   1  
ATOM 756   N N    . GLU A 1 48  ? 124.718 -12.616 2.047   1.00 0.00 ? 48  GLU A N    1  
ATOM 757   C CA   . GLU A 1 48  ? 126.047 -13.160 1.880   1.00 0.00 ? 48  GLU A CA   1  
ATOM 758   C C    . GLU A 1 48  ? 126.541 -13.819 3.192   1.00 0.00 ? 48  GLU A C    1  
ATOM 759   O O    . GLU A 1 48  ? 127.387 -14.717 3.171   1.00 0.00 ? 48  GLU A O    1  
ATOM 760   C CB   . GLU A 1 48  ? 127.013 -12.089 1.357   1.00 0.00 ? 48  GLU A CB   1  
ATOM 761   C CG   . GLU A 1 48  ? 126.572 -11.439 0.027   1.00 0.00 ? 48  GLU A CG   1  
ATOM 762   C CD   . GLU A 1 48  ? 126.469 -12.407 -1.154  1.00 0.00 ? 48  GLU A CD   1  
ATOM 763   O OE1  . GLU A 1 48  ? 125.444 -13.103 -1.301  1.00 0.00 ? 48  GLU A OE1  1  
ATOM 764   O OE2  . GLU A 1 48  ? 127.426 -12.468 -1.981  1.00 0.00 ? 48  GLU A OE2  1  
ATOM 765   H H    . GLU A 1 48  ? 124.601 -11.639 2.074   1.00 0.00 ? 48  GLU A H    1  
ATOM 766   H HA   . GLU A 1 48  ? 125.960 -13.945 1.142   1.00 0.00 ? 48  GLU A HA   1  
ATOM 767   H HB2  . GLU A 1 48  ? 127.101 -11.310 2.102   1.00 0.00 ? 48  GLU A HB2  1  
ATOM 768   H HB3  . GLU A 1 48  ? 127.983 -12.539 1.206   1.00 0.00 ? 48  GLU A HB3  1  
ATOM 769   H HG2  . GLU A 1 48  ? 125.602 -10.987 0.173   1.00 0.00 ? 48  GLU A HG2  1  
ATOM 770   H HG3  . GLU A 1 48  ? 127.283 -10.664 -0.223  1.00 0.00 ? 48  GLU A HG3  1  
ATOM 771   N N    . ASP A 1 49  ? 125.986 -13.389 4.321   1.00 0.00 ? 49  ASP A N    1  
ATOM 772   C CA   . ASP A 1 49  ? 126.263 -14.028 5.631   1.00 0.00 ? 49  ASP A CA   1  
ATOM 773   C C    . ASP A 1 49  ? 125.662 -15.421 5.641   1.00 0.00 ? 49  ASP A C    1  
ATOM 774   O O    . ASP A 1 49  ? 126.219 -16.372 6.185   1.00 0.00 ? 49  ASP A O    1  
ATOM 775   C CB   . ASP A 1 49  ? 125.649 -13.209 6.778   1.00 0.00 ? 49  ASP A CB   1  
ATOM 776   C CG   . ASP A 1 49  ? 125.730 -13.910 8.118   1.00 0.00 ? 49  ASP A CG   1  
ATOM 777   O OD1  . ASP A 1 49  ? 126.773 -13.802 8.801   1.00 0.00 ? 49  ASP A OD1  1  
ATOM 778   O OD2  . ASP A 1 49  ? 124.753 -14.599 8.503   1.00 0.00 ? 49  ASP A OD2  1  
ATOM 779   H H    . ASP A 1 49  ? 125.388 -12.612 4.278   1.00 0.00 ? 49  ASP A H    1  
ATOM 780   H HA   . ASP A 1 49  ? 127.332 -14.096 5.762   1.00 0.00 ? 49  ASP A HA   1  
ATOM 781   H HB2  . ASP A 1 49  ? 126.172 -12.267 6.857   1.00 0.00 ? 49  ASP A HB2  1  
ATOM 782   H HB3  . ASP A 1 49  ? 124.611 -13.015 6.553   1.00 0.00 ? 49  ASP A HB3  1  
ATOM 783   N N    . PHE A 1 50  ? 124.529 -15.508 5.029   1.00 0.00 ? 50  PHE A N    1  
ATOM 784   C CA   . PHE A 1 50  ? 123.792 -16.728 4.861   1.00 0.00 ? 50  PHE A CA   1  
ATOM 785   C C    . PHE A 1 50  ? 124.500 -17.630 3.830   1.00 0.00 ? 50  PHE A C    1  
ATOM 786   O O    . PHE A 1 50  ? 124.602 -18.839 4.009   1.00 0.00 ? 50  PHE A O    1  
ATOM 787   C CB   . PHE A 1 50  ? 122.345 -16.325 4.513   1.00 0.00 ? 50  PHE A CB   1  
ATOM 788   C CG   . PHE A 1 50  ? 121.565 -17.209 3.620   1.00 0.00 ? 50  PHE A CG   1  
ATOM 789   C CD1  . PHE A 1 50  ? 121.395 -18.544 3.884   1.00 0.00 ? 50  PHE A CD1  1  
ATOM 790   C CD2  . PHE A 1 50  ? 120.984 -16.672 2.494   1.00 0.00 ? 50  PHE A CD2  1  
ATOM 791   C CE1  . PHE A 1 50  ? 120.665 -19.319 3.039   1.00 0.00 ? 50  PHE A CE1  1  
ATOM 792   C CE2  . PHE A 1 50  ? 120.245 -17.447 1.652   1.00 0.00 ? 50  PHE A CE2  1  
ATOM 793   C CZ   . PHE A 1 50  ? 120.088 -18.771 1.925   1.00 0.00 ? 50  PHE A CZ   1  
ATOM 794   H H    . PHE A 1 50  ? 124.150 -14.684 4.653   1.00 0.00 ? 50  PHE A H    1  
ATOM 795   H HA   . PHE A 1 50  ? 123.798 -17.237 5.813   1.00 0.00 ? 50  PHE A HA   1  
ATOM 796   H HB2  . PHE A 1 50  ? 121.783 -16.253 5.431   1.00 0.00 ? 50  PHE A HB2  1  
ATOM 797   H HB3  . PHE A 1 50  ? 122.376 -15.341 4.068   1.00 0.00 ? 50  PHE A HB3  1  
ATOM 798   H HD1  . PHE A 1 50  ? 121.851 -18.975 4.763   1.00 0.00 ? 50  PHE A HD1  1  
ATOM 799   H HD2  . PHE A 1 50  ? 121.122 -15.622 2.285   1.00 0.00 ? 50  PHE A HD2  1  
ATOM 800   H HE1  . PHE A 1 50  ? 120.541 -20.375 3.229   1.00 0.00 ? 50  PHE A HE1  1  
ATOM 801   H HE2  . PHE A 1 50  ? 119.794 -17.019 0.770   1.00 0.00 ? 50  PHE A HE2  1  
ATOM 802   H HZ   . PHE A 1 50  ? 119.504 -19.392 1.262   1.00 0.00 ? 50  PHE A HZ   1  
ATOM 803   N N    . LYS A 1 51  ? 125.032 -16.997 2.810   1.00 0.00 ? 51  LYS A N    1  
ATOM 804   C CA   . LYS A 1 51  ? 125.880 -17.621 1.780   1.00 0.00 ? 51  LYS A CA   1  
ATOM 805   C C    . LYS A 1 51  ? 127.114 -18.297 2.427   1.00 0.00 ? 51  LYS A C    1  
ATOM 806   O O    . LYS A 1 51  ? 127.670 -19.257 1.889   1.00 0.00 ? 51  LYS A O    1  
ATOM 807   C CB   . LYS A 1 51  ? 126.330 -16.498 0.849   1.00 0.00 ? 51  LYS A CB   1  
ATOM 808   C CG   . LYS A 1 51  ? 127.315 -16.829 -0.251  1.00 0.00 ? 51  LYS A CG   1  
ATOM 809   C CD   . LYS A 1 51  ? 127.848 -15.519 -0.792  1.00 0.00 ? 51  LYS A CD   1  
ATOM 810   C CE   . LYS A 1 51  ? 128.806 -15.670 -1.945  1.00 0.00 ? 51  LYS A CE   1  
ATOM 811   N NZ   . LYS A 1 51  ? 129.355 -14.350 -2.338  1.00 0.00 ? 51  LYS A NZ   1  
ATOM 812   H H    . LYS A 1 51  ? 124.800 -16.049 2.702   1.00 0.00 ? 51  LYS A H    1  
ATOM 813   H HA   . LYS A 1 51  ? 125.306 -18.341 1.217   1.00 0.00 ? 51  LYS A HA   1  
ATOM 814   H HB2  . LYS A 1 51  ? 125.451 -16.095 0.370   1.00 0.00 ? 51  LYS A HB2  1  
ATOM 815   H HB3  . LYS A 1 51  ? 126.758 -15.717 1.460   1.00 0.00 ? 51  LYS A HB3  1  
ATOM 816   H HG2  . LYS A 1 51  ? 128.124 -17.420 0.153   1.00 0.00 ? 51  LYS A HG2  1  
ATOM 817   H HG3  . LYS A 1 51  ? 126.815 -17.364 -1.044  1.00 0.00 ? 51  LYS A HG3  1  
ATOM 818   H HD2  . LYS A 1 51  ? 127.015 -14.921 -1.127  1.00 0.00 ? 51  LYS A HD2  1  
ATOM 819   H HD3  . LYS A 1 51  ? 128.346 -14.999 0.014   1.00 0.00 ? 51  LYS A HD3  1  
ATOM 820   H HE2  . LYS A 1 51  ? 129.617 -16.320 -1.645  1.00 0.00 ? 51  LYS A HE2  1  
ATOM 821   H HE3  . LYS A 1 51  ? 128.284 -16.101 -2.785  1.00 0.00 ? 51  LYS A HE3  1  
ATOM 822   H HZ1  . LYS A 1 51  ? 128.587 -13.652 -2.458  1.00 0.00 ? 51  LYS A HZ1  1  
ATOM 823   H HZ2  . LYS A 1 51  ? 129.896 -14.422 -3.226  1.00 0.00 ? 51  LYS A HZ2  1  
ATOM 824   H HZ3  . LYS A 1 51  ? 130.004 -13.988 -1.604  1.00 0.00 ? 51  LYS A HZ3  1  
ATOM 825   N N    . LYS A 1 52  ? 127.536 -17.770 3.574   1.00 0.00 ? 52  LYS A N    1  
ATOM 826   C CA   . LYS A 1 52  ? 128.658 -18.329 4.339   1.00 0.00 ? 52  LYS A CA   1  
ATOM 827   C C    . LYS A 1 52  ? 128.298 -19.669 5.013   1.00 0.00 ? 52  LYS A C    1  
ATOM 828   O O    . LYS A 1 52  ? 129.184 -20.388 5.472   1.00 0.00 ? 52  LYS A O    1  
ATOM 829   C CB   . LYS A 1 52  ? 129.135 -17.336 5.410   1.00 0.00 ? 52  LYS A CB   1  
ATOM 830   C CG   . LYS A 1 52  ? 129.679 -16.026 4.861   1.00 0.00 ? 52  LYS A CG   1  
ATOM 831   C CD   . LYS A 1 52  ? 130.017 -15.030 5.976   1.00 0.00 ? 52  LYS A CD   1  
ATOM 832   C CE   . LYS A 1 52  ? 131.072 -15.571 6.929   1.00 0.00 ? 52  LYS A CE   1  
ATOM 833   N NZ   . LYS A 1 52  ? 131.414 -14.601 7.995   1.00 0.00 ? 52  LYS A NZ   1  
ATOM 834   H H    . LYS A 1 52  ? 127.087 -16.953 3.885   1.00 0.00 ? 52  LYS A H    1  
ATOM 835   H HA   . LYS A 1 52  ? 129.470 -18.500 3.649   1.00 0.00 ? 52  LYS A HA   1  
ATOM 836   H HB2  . LYS A 1 52  ? 128.299 -17.097 6.053   1.00 0.00 ? 52  LYS A HB2  1  
ATOM 837   H HB3  . LYS A 1 52  ? 129.918 -17.810 5.986   1.00 0.00 ? 52  LYS A HB3  1  
ATOM 838   H HG2  . LYS A 1 52  ? 130.573 -16.233 4.294   1.00 0.00 ? 52  LYS A HG2  1  
ATOM 839   H HG3  . LYS A 1 52  ? 128.936 -15.588 4.212   1.00 0.00 ? 52  LYS A HG3  1  
ATOM 840   H HD2  . LYS A 1 52  ? 130.390 -14.120 5.528   1.00 0.00 ? 52  LYS A HD2  1  
ATOM 841   H HD3  . LYS A 1 52  ? 129.115 -14.813 6.530   1.00 0.00 ? 52  LYS A HD3  1  
ATOM 842   H HE2  . LYS A 1 52  ? 130.697 -16.474 7.387   1.00 0.00 ? 52  LYS A HE2  1  
ATOM 843   H HE3  . LYS A 1 52  ? 131.962 -15.802 6.362   1.00 0.00 ? 52  LYS A HE3  1  
ATOM 844   H HZ1  . LYS A 1 52  ? 130.591 -14.343 8.583   1.00 0.00 ? 52  LYS A HZ1  1  
ATOM 845   H HZ2  . LYS A 1 52  ? 131.799 -13.714 7.601   1.00 0.00 ? 52  LYS A HZ2  1  
ATOM 846   H HZ3  . LYS A 1 52  ? 132.144 -15.006 8.618   1.00 0.00 ? 52  LYS A HZ3  1  
ATOM 847   N N    . SER A 1 53  ? 127.024 -19.999 5.079   1.00 0.00 ? 53  SER A N    1  
ATOM 848   C CA   . SER A 1 53  ? 126.599 -21.233 5.712   1.00 0.00 ? 53  SER A CA   1  
ATOM 849   C C    . SER A 1 53  ? 126.713 -22.375 4.712   1.00 0.00 ? 53  SER A C    1  
ATOM 850   O O    . SER A 1 53  ? 126.682 -22.154 3.509   1.00 0.00 ? 53  SER A O    1  
ATOM 851   C CB   . SER A 1 53  ? 125.151 -21.112 6.217   1.00 0.00 ? 53  SER A CB   1  
ATOM 852   O OG   . SER A 1 53  ? 124.755 -22.275 6.936   1.00 0.00 ? 53  SER A OG   1  
ATOM 853   H H    . SER A 1 53  ? 126.339 -19.434 4.659   1.00 0.00 ? 53  SER A H    1  
ATOM 854   H HA   . SER A 1 53  ? 127.254 -21.426 6.548   1.00 0.00 ? 53  SER A HA   1  
ATOM 855   H HB2  . SER A 1 53  ? 125.075 -20.259 6.876   1.00 0.00 ? 53  SER A HB2  1  
ATOM 856   H HB3  . SER A 1 53  ? 124.489 -20.978 5.375   1.00 0.00 ? 53  SER A HB3  1  
ATOM 857   H HG   . SER A 1 53  ? 124.964 -22.116 7.870   1.00 0.00 ? 53  SER A HG   1  
ATOM 858   N N    . LYS A 1 54  ? 126.872 -23.578 5.191   1.00 0.00 ? 54  LYS A N    1  
ATOM 859   C CA   . LYS A 1 54  ? 126.967 -24.706 4.308   1.00 0.00 ? 54  LYS A CA   1  
ATOM 860   C C    . LYS A 1 54  ? 125.902 -25.730 4.643   1.00 0.00 ? 54  LYS A C    1  
ATOM 861   O O    . LYS A 1 54  ? 125.771 -26.754 3.968   1.00 0.00 ? 54  LYS A O    1  
ATOM 862   C CB   . LYS A 1 54  ? 128.406 -25.306 4.316   1.00 0.00 ? 54  LYS A CB   1  
ATOM 863   C CG   . LYS A 1 54  ? 128.937 -25.863 5.658   1.00 0.00 ? 54  LYS A CG   1  
ATOM 864   C CD   . LYS A 1 54  ? 128.334 -27.219 6.014   1.00 0.00 ? 54  LYS A CD   1  
ATOM 865   C CE   . LYS A 1 54  ? 128.946 -27.804 7.270   1.00 0.00 ? 54  LYS A CE   1  
ATOM 866   N NZ   . LYS A 1 54  ? 128.396 -29.143 7.559   1.00 0.00 ? 54  LYS A NZ   1  
ATOM 867   H H    . LYS A 1 54  ? 126.915 -23.718 6.166   1.00 0.00 ? 54  LYS A H    1  
ATOM 868   H HA   . LYS A 1 54  ? 126.756 -24.336 3.315   1.00 0.00 ? 54  LYS A HA   1  
ATOM 869   H HB2  . LYS A 1 54  ? 128.437 -26.115 3.603   1.00 0.00 ? 54  LYS A HB2  1  
ATOM 870   H HB3  . LYS A 1 54  ? 129.087 -24.538 3.979   1.00 0.00 ? 54  LYS A HB3  1  
ATOM 871   H HG2  . LYS A 1 54  ? 130.009 -25.972 5.593   1.00 0.00 ? 54  LYS A HG2  1  
ATOM 872   H HG3  . LYS A 1 54  ? 128.700 -25.155 6.440   1.00 0.00 ? 54  LYS A HG3  1  
ATOM 873   H HD2  . LYS A 1 54  ? 127.273 -27.097 6.171   1.00 0.00 ? 54  LYS A HD2  1  
ATOM 874   H HD3  . LYS A 1 54  ? 128.499 -27.898 5.191   1.00 0.00 ? 54  LYS A HD3  1  
ATOM 875   H HE2  . LYS A 1 54  ? 130.014 -27.883 7.136   1.00 0.00 ? 54  LYS A HE2  1  
ATOM 876   H HE3  . LYS A 1 54  ? 128.733 -27.148 8.100   1.00 0.00 ? 54  LYS A HE3  1  
ATOM 877   H HZ1  . LYS A 1 54  ? 127.393 -29.096 7.839   1.00 0.00 ? 54  LYS A HZ1  1  
ATOM 878   H HZ2  . LYS A 1 54  ? 128.933 -29.636 8.307   1.00 0.00 ? 54  LYS A HZ2  1  
ATOM 879   H HZ3  . LYS A 1 54  ? 128.463 -29.740 6.706   1.00 0.00 ? 54  LYS A HZ3  1  
ATOM 880   N N    . GLY A 1 55  ? 125.119 -25.431 5.652   1.00 0.00 ? 55  GLY A N    1  
ATOM 881   C CA   . GLY A 1 55  ? 124.133 -26.357 6.124   1.00 0.00 ? 55  GLY A CA   1  
ATOM 882   C C    . GLY A 1 55  ? 122.816 -26.092 5.476   1.00 0.00 ? 55  GLY A C    1  
ATOM 883   O O    . GLY A 1 55  ? 122.215 -25.065 5.743   1.00 0.00 ? 55  GLY A O    1  
ATOM 884   H H    . GLY A 1 55  ? 125.170 -24.532 6.050   1.00 0.00 ? 55  GLY A H    1  
ATOM 885   H HA2  . GLY A 1 55  ? 124.453 -27.362 5.888   1.00 0.00 ? 55  GLY A HA2  1  
ATOM 886   H HA3  . GLY A 1 55  ? 124.028 -26.254 7.193   1.00 0.00 ? 55  GLY A HA3  1  
ATOM 887   N N    . PRO A 1 56  ? 122.320 -27.009 4.629   1.00 0.00 ? 56  PRO A N    1  
ATOM 888   C CA   . PRO A 1 56  ? 121.087 -26.799 3.867   1.00 0.00 ? 56  PRO A CA   1  
ATOM 889   C C    . PRO A 1 56  ? 119.866 -26.512 4.751   1.00 0.00 ? 56  PRO A C    1  
ATOM 890   O O    . PRO A 1 56  ? 118.995 -25.727 4.371   1.00 0.00 ? 56  PRO A O    1  
ATOM 891   C CB   . PRO A 1 56  ? 120.913 -28.085 3.058   1.00 0.00 ? 56  PRO A CB   1  
ATOM 892   C CG   . PRO A 1 56  ? 122.263 -28.716 3.047   1.00 0.00 ? 56  PRO A CG   1  
ATOM 893   C CD   . PRO A 1 56  ? 122.914 -28.325 4.339   1.00 0.00 ? 56  PRO A CD   1  
ATOM 894   H HA   . PRO A 1 56  ? 121.225 -25.964 3.195   1.00 0.00 ? 56  PRO A HA   1  
ATOM 895   H HB2  . PRO A 1 56  ? 120.170 -28.721 3.517   1.00 0.00 ? 56  PRO A HB2  1  
ATOM 896   H HB3  . PRO A 1 56  ? 120.611 -27.811 2.058   1.00 0.00 ? 56  PRO A HB3  1  
ATOM 897   H HG2  . PRO A 1 56  ? 122.167 -29.790 2.986   1.00 0.00 ? 56  PRO A HG2  1  
ATOM 898   H HG3  . PRO A 1 56  ? 122.835 -28.343 2.211   1.00 0.00 ? 56  PRO A HG3  1  
ATOM 899   H HD2  . PRO A 1 56  ? 122.671 -29.036 5.114   1.00 0.00 ? 56  PRO A HD2  1  
ATOM 900   H HD3  . PRO A 1 56  ? 123.984 -28.245 4.221   1.00 0.00 ? 56  PRO A HD3  1  
ATOM 901   N N    . GLN A 1 57  ? 119.819 -27.102 5.948   1.00 0.00 ? 57  GLN A N    1  
ATOM 902   C CA   . GLN A 1 57  ? 118.715 -26.819 6.862   1.00 0.00 ? 57  GLN A CA   1  
ATOM 903   C C    . GLN A 1 57  ? 118.771 -25.361 7.328   1.00 0.00 ? 57  GLN A C    1  
ATOM 904   O O    . GLN A 1 57  ? 117.755 -24.683 7.386   1.00 0.00 ? 57  GLN A O    1  
ATOM 905   C CB   . GLN A 1 57  ? 118.651 -27.837 8.048   1.00 0.00 ? 57  GLN A CB   1  
ATOM 906   C CG   . GLN A 1 57  ? 119.857 -27.863 9.000   1.00 0.00 ? 57  GLN A CG   1  
ATOM 907   C CD   . GLN A 1 57  ? 119.829 -26.767 10.059  1.00 0.00 ? 57  GLN A CD   1  
ATOM 908   O OE1  . GLN A 1 57  ? 118.770 -26.345 10.509  1.00 0.00 ? 57  GLN A OE1  1  
ATOM 909   N NE2  . GLN A 1 57  ? 120.969 -26.283 10.428  1.00 0.00 ? 57  GLN A NE2  1  
ATOM 910   H H    . GLN A 1 57  ? 120.528 -27.737 6.189   1.00 0.00 ? 57  GLN A H    1  
ATOM 911   H HA   . GLN A 1 57  ? 117.818 -26.915 6.267   1.00 0.00 ? 57  GLN A HA   1  
ATOM 912   H HB2  . GLN A 1 57  ? 117.788 -27.585 8.646   1.00 0.00 ? 57  GLN A HB2  1  
ATOM 913   H HB3  . GLN A 1 57  ? 118.514 -28.829 7.643   1.00 0.00 ? 57  GLN A HB3  1  
ATOM 914   H HG2  . GLN A 1 57  ? 119.878 -28.819 9.503   1.00 0.00 ? 57  GLN A HG2  1  
ATOM 915   H HG3  . GLN A 1 57  ? 120.758 -27.758 8.413   1.00 0.00 ? 57  GLN A HG3  1  
ATOM 916   H HE21 . GLN A 1 57  ? 121.781 -26.651 10.003  1.00 0.00 ? 57  GLN A HE21 1  
ATOM 917   H HE22 . GLN A 1 57  ? 120.998 -25.579 11.108  1.00 0.00 ? 57  GLN A HE22 1  
ATOM 918   N N    . GLN A 1 58  ? 119.994 -24.869 7.546   1.00 0.00 ? 58  GLN A N    1  
ATOM 919   C CA   . GLN A 1 58  ? 120.240 -23.506 8.004   1.00 0.00 ? 58  GLN A CA   1  
ATOM 920   C C    . GLN A 1 58  ? 119.910 -22.541 6.885   1.00 0.00 ? 58  GLN A C    1  
ATOM 921   O O    . GLN A 1 58  ? 119.512 -21.401 7.129   1.00 0.00 ? 58  GLN A O    1  
ATOM 922   C CB   . GLN A 1 58  ? 121.707 -23.351 8.440   1.00 0.00 ? 58  GLN A CB   1  
ATOM 923   C CG   . GLN A 1 58  ? 122.105 -21.967 8.956   1.00 0.00 ? 58  GLN A CG   1  
ATOM 924   C CD   . GLN A 1 58  ? 121.377 -21.557 10.221  1.00 0.00 ? 58  GLN A CD   1  
ATOM 925   O OE1  . GLN A 1 58  ? 120.321 -20.928 10.175  1.00 0.00 ? 58  GLN A OE1  1  
ATOM 926   N NE2  . GLN A 1 58  ? 121.919 -21.923 11.347  1.00 0.00 ? 58  GLN A NE2  1  
ATOM 927   H H    . GLN A 1 58  ? 120.771 -25.438 7.367   1.00 0.00 ? 58  GLN A H    1  
ATOM 928   H HA   . GLN A 1 58  ? 119.593 -23.309 8.846   1.00 0.00 ? 58  GLN A HA   1  
ATOM 929   H HB2  . GLN A 1 58  ? 121.906 -24.064 9.227   1.00 0.00 ? 58  GLN A HB2  1  
ATOM 930   H HB3  . GLN A 1 58  ? 122.336 -23.590 7.595   1.00 0.00 ? 58  GLN A HB3  1  
ATOM 931   H HG2  . GLN A 1 58  ? 123.165 -21.965 9.162   1.00 0.00 ? 58  GLN A HG2  1  
ATOM 932   H HG3  . GLN A 1 58  ? 121.895 -21.243 8.184   1.00 0.00 ? 58  GLN A HG3  1  
ATOM 933   H HE21 . GLN A 1 58  ? 122.754 -22.445 11.311  1.00 0.00 ? 58  GLN A HE21 1  
ATOM 934   H HE22 . GLN A 1 58  ? 121.485 -21.647 12.184  1.00 0.00 ? 58  GLN A HE22 1  
ATOM 935   N N    . ILE A 1 59  ? 120.061 -23.023 5.656   1.00 0.00 ? 59  ILE A N    1  
ATOM 936   C CA   . ILE A 1 59  ? 119.723 -22.262 4.469   1.00 0.00 ? 59  ILE A CA   1  
ATOM 937   C C    . ILE A 1 59  ? 118.251 -21.891 4.520   1.00 0.00 ? 59  ILE A C    1  
ATOM 938   O O    . ILE A 1 59  ? 117.891 -20.749 4.314   1.00 0.00 ? 59  ILE A O    1  
ATOM 939   C CB   . ILE A 1 59  ? 119.992 -23.063 3.160   1.00 0.00 ? 59  ILE A CB   1  
ATOM 940   C CG1  . ILE A 1 59  ? 121.455 -23.545 3.078   1.00 0.00 ? 59  ILE A CG1  1  
ATOM 941   C CG2  . ILE A 1 59  ? 119.591 -22.273 1.921   1.00 0.00 ? 59  ILE A CG2  1  
ATOM 942   C CD1  . ILE A 1 59  ? 122.509 -22.484 3.267   1.00 0.00 ? 59  ILE A CD1  1  
ATOM 943   H H    . ILE A 1 59  ? 120.449 -23.919 5.566   1.00 0.00 ? 59  ILE A H    1  
ATOM 944   H HA   . ILE A 1 59  ? 120.320 -21.363 4.464   1.00 0.00 ? 59  ILE A HA   1  
ATOM 945   H HB   . ILE A 1 59  ? 119.351 -23.932 3.192   1.00 0.00 ? 59  ILE A HB   1  
ATOM 946   H HG12 . ILE A 1 59  ? 121.616 -24.275 3.856   1.00 0.00 ? 59  ILE A HG12 1  
ATOM 947   H HG13 . ILE A 1 59  ? 121.616 -24.012 2.118   1.00 0.00 ? 59  ILE A HG13 1  
ATOM 948   H HG21 . ILE A 1 59  ? 120.183 -21.372 1.852   1.00 0.00 ? 59  ILE A HG21 1  
ATOM 949   H HG22 . ILE A 1 59  ? 118.557 -21.972 2.021   1.00 0.00 ? 59  ILE A HG22 1  
ATOM 950   H HG23 . ILE A 1 59  ? 119.716 -22.864 1.025   1.00 0.00 ? 59  ILE A HG23 1  
ATOM 951   H HD11 . ILE A 1 59  ? 122.452 -21.760 2.467   1.00 0.00 ? 59  ILE A HD11 1  
ATOM 952   H HD12 . ILE A 1 59  ? 123.471 -22.976 3.278   1.00 0.00 ? 59  ILE A HD12 1  
ATOM 953   H HD13 . ILE A 1 59  ? 122.351 -21.999 4.219   1.00 0.00 ? 59  ILE A HD13 1  
ATOM 954   N N    . HIS A 1 60  ? 117.413 -22.875 4.845   1.00 0.00 ? 60  HIS A N    1  
ATOM 955   C CA   . HIS A 1 60  ? 115.960 -22.662 4.965   1.00 0.00 ? 60  HIS A CA   1  
ATOM 956   C C    . HIS A 1 60  ? 115.664 -21.599 5.981   1.00 0.00 ? 60  HIS A C    1  
ATOM 957   O O    . HIS A 1 60  ? 114.903 -20.667 5.723   1.00 0.00 ? 60  HIS A O    1  
ATOM 958   C CB   . HIS A 1 60  ? 115.219 -23.951 5.365   1.00 0.00 ? 60  HIS A CB   1  
ATOM 959   C CG   . HIS A 1 60  ? 115.106 -24.963 4.285   1.00 0.00 ? 60  HIS A CG   1  
ATOM 960   N ND1  . HIS A 1 60  ? 113.915 -25.315 3.711   1.00 0.00 ? 60  HIS A ND1  1  
ATOM 961   C CD2  . HIS A 1 60  ? 116.041 -25.688 3.670   1.00 0.00 ? 60  HIS A CD2  1  
ATOM 962   C CE1  . HIS A 1 60  ? 114.124 -26.211 2.778   1.00 0.00 ? 60  HIS A CE1  1  
ATOM 963   N NE2  . HIS A 1 60  ? 115.414 -26.456 2.727   1.00 0.00 ? 60  HIS A NE2  1  
ATOM 964   H H    . HIS A 1 60  ? 117.818 -23.751 5.019   1.00 0.00 ? 60  HIS A H    1  
ATOM 965   H HA   . HIS A 1 60  ? 115.593 -22.335 4.003   1.00 0.00 ? 60  HIS A HA   1  
ATOM 966   H HB2  . HIS A 1 60  ? 115.743 -24.415 6.187   1.00 0.00 ? 60  HIS A HB2  1  
ATOM 967   H HB3  . HIS A 1 60  ? 114.221 -23.691 5.689   1.00 0.00 ? 60  HIS A HB3  1  
ATOM 968   H HD1  . HIS A 1 60  ? 113.029 -24.965 3.987   1.00 0.00 ? 60  HIS A HD1  1  
ATOM 969   H HD2  . HIS A 1 60  ? 117.091 -25.664 3.930   1.00 0.00 ? 60  HIS A HD2  1  
ATOM 970   H HE1  . HIS A 1 60  ? 113.366 -26.667 2.158   1.00 0.00 ? 60  HIS A HE1  1  
ATOM 971   H HE2  . HIS A 1 60  ? 115.856 -26.680 1.870   1.00 0.00 ? 60  HIS A HE2  1  
ATOM 972   N N    . LEU A 1 61  ? 116.320 -21.724 7.103   1.00 0.00 ? 61  LEU A N    1  
ATOM 973   C CA   . LEU A 1 61  ? 116.121 -20.857 8.232   1.00 0.00 ? 61  LEU A CA   1  
ATOM 974   C C    . LEU A 1 61  ? 116.535 -19.444 7.886   1.00 0.00 ? 61  LEU A C    1  
ATOM 975   O O    . LEU A 1 61  ? 115.709 -18.530 7.887   1.00 0.00 ? 61  LEU A O    1  
ATOM 976   C CB   . LEU A 1 61  ? 116.969 -21.333 9.380   1.00 0.00 ? 61  LEU A CB   1  
ATOM 977   C CG   . LEU A 1 61  ? 117.006 -22.823 9.625   1.00 0.00 ? 61  LEU A CG   1  
ATOM 978   C CD1  . LEU A 1 61  ? 117.930 -23.117 10.755  1.00 0.00 ? 61  LEU A CD1  1  
ATOM 979   C CD2  . LEU A 1 61  ? 115.623 -23.395 9.866   1.00 0.00 ? 61  LEU A CD2  1  
ATOM 980   H H    . LEU A 1 61  ? 116.982 -22.445 7.172   1.00 0.00 ? 61  LEU A H    1  
ATOM 981   H HA   . LEU A 1 61  ? 115.083 -20.886 8.530   1.00 0.00 ? 61  LEU A HA   1  
ATOM 982   H HB2  . LEU A 1 61  ? 117.983 -21.004 9.201   1.00 0.00 ? 61  LEU A HB2  1  
ATOM 983   H HB3  . LEU A 1 61  ? 116.614 -20.854 10.282  1.00 0.00 ? 61  LEU A HB3  1  
ATOM 984   H HG   . LEU A 1 61  ? 117.422 -23.293 8.746   1.00 0.00 ? 61  LEU A HG   1  
ATOM 985   H HD11 . LEU A 1 61  ? 118.028 -24.185 10.889  1.00 0.00 ? 61  LEU A HD11 1  
ATOM 986   H HD12 . LEU A 1 61  ? 117.558 -22.644 11.651  1.00 0.00 ? 61  LEU A HD12 1  
ATOM 987   H HD13 . LEU A 1 61  ? 118.880 -22.687 10.472  1.00 0.00 ? 61  LEU A HD13 1  
ATOM 988   H HD21 . LEU A 1 61  ? 115.167 -22.928 10.724  1.00 0.00 ? 61  LEU A HD21 1  
ATOM 989   H HD22 . LEU A 1 61  ? 115.710 -24.463 10.007  1.00 0.00 ? 61  LEU A HD22 1  
ATOM 990   H HD23 . LEU A 1 61  ? 115.034 -23.205 8.980   1.00 0.00 ? 61  LEU A HD23 1  
ATOM 991   N N    . LYS A 1 62  ? 117.814 -19.272 7.590   1.00 0.00 ? 62  LYS A N    1  
ATOM 992   C CA   . LYS A 1 62  ? 118.347 -17.958 7.230   1.00 0.00 ? 62  LYS A CA   1  
ATOM 993   C C    . LYS A 1 62  ? 117.662 -17.314 6.022   1.00 0.00 ? 62  LYS A C    1  
ATOM 994   O O    . LYS A 1 62  ? 117.405 -16.105 6.050   1.00 0.00 ? 62  LYS A O    1  
ATOM 995   C CB   . LYS A 1 62  ? 119.872 -17.929 7.080   1.00 0.00 ? 62  LYS A CB   1  
ATOM 996   C CG   . LYS A 1 62  ? 120.630 -17.968 8.397   1.00 0.00 ? 62  LYS A CG   1  
ATOM 997   C CD   . LYS A 1 62  ? 122.112 -17.677 8.192   1.00 0.00 ? 62  LYS A CD   1  
ATOM 998   C CE   . LYS A 1 62  ? 122.830 -17.517 9.522   1.00 0.00 ? 62  LYS A CE   1  
ATOM 999   N NZ   . LYS A 1 62  ? 124.248 -17.124 9.359   1.00 0.00 ? 62  LYS A NZ   1  
ATOM 1000  H H    . LYS A 1 62  ? 118.396 -20.070 7.650   1.00 0.00 ? 62  LYS A H    1  
ATOM 1001  H HA   . LYS A 1 62  ? 118.090 -17.328 8.070   1.00 0.00 ? 62  LYS A HA   1  
ATOM 1002  H HB2  . LYS A 1 62  ? 120.181 -18.783 6.495   1.00 0.00 ? 62  LYS A HB2  1  
ATOM 1003  H HB3  . LYS A 1 62  ? 120.153 -17.028 6.555   1.00 0.00 ? 62  LYS A HB3  1  
ATOM 1004  H HG2  . LYS A 1 62  ? 120.216 -17.226 9.063   1.00 0.00 ? 62  LYS A HG2  1  
ATOM 1005  H HG3  . LYS A 1 62  ? 120.522 -18.949 8.837   1.00 0.00 ? 62  LYS A HG3  1  
ATOM 1006  H HD2  . LYS A 1 62  ? 122.560 -18.495 7.649   1.00 0.00 ? 62  LYS A HD2  1  
ATOM 1007  H HD3  . LYS A 1 62  ? 122.213 -16.763 7.624   1.00 0.00 ? 62  LYS A HD3  1  
ATOM 1008  H HE2  . LYS A 1 62  ? 122.326 -16.758 10.101  1.00 0.00 ? 62  LYS A HE2  1  
ATOM 1009  H HE3  . LYS A 1 62  ? 122.782 -18.458 10.053  1.00 0.00 ? 62  LYS A HE3  1  
ATOM 1010  H HZ1  . LYS A 1 62  ? 124.691 -17.016 10.298  1.00 0.00 ? 62  LYS A HZ1  1  
ATOM 1011  H HZ2  . LYS A 1 62  ? 124.371 -16.208 8.875   1.00 0.00 ? 62  LYS A HZ2  1  
ATOM 1012  H HZ3  . LYS A 1 62  ? 124.790 -17.871 8.869   1.00 0.00 ? 62  LYS A HZ3  1  
ATOM 1013  N N    . ALA A 1 63  ? 117.346 -18.095 4.986   1.00 0.00 ? 63  ALA A N    1  
ATOM 1014  C CA   . ALA A 1 63  ? 116.661 -17.542 3.815   1.00 0.00 ? 63  ALA A CA   1  
ATOM 1015  C C    . ALA A 1 63  ? 115.300 -17.013 4.209   1.00 0.00 ? 63  ALA A C    1  
ATOM 1016  O O    . ALA A 1 63  ? 114.994 -15.860 3.981   1.00 0.00 ? 63  ALA A O    1  
ATOM 1017  C CB   . ALA A 1 63  ? 116.525 -18.554 2.672   1.00 0.00 ? 63  ALA A CB   1  
ATOM 1018  H H    . ALA A 1 63  ? 117.581 -19.052 4.994   1.00 0.00 ? 63  ALA A H    1  
ATOM 1019  H HA   . ALA A 1 63  ? 117.252 -16.706 3.471   1.00 0.00 ? 63  ALA A HA   1  
ATOM 1020  H HB1  . ALA A 1 63  ? 117.486 -18.984 2.419   1.00 0.00 ? 63  ALA A HB1  1  
ATOM 1021  H HB2  . ALA A 1 63  ? 116.114 -18.072 1.793   1.00 0.00 ? 63  ALA A HB2  1  
ATOM 1022  H HB3  . ALA A 1 63  ? 115.851 -19.339 2.978   1.00 0.00 ? 63  ALA A HB3  1  
ATOM 1023  N N    . LYS A 1 64  ? 114.509 -17.835 4.859   1.00 0.00 ? 64  LYS A N    1  
ATOM 1024  C CA   . LYS A 1 64  ? 113.172 -17.434 5.279   1.00 0.00 ? 64  LYS A CA   1  
ATOM 1025  C C    . LYS A 1 64  ? 113.186 -16.319 6.317   1.00 0.00 ? 64  LYS A C    1  
ATOM 1026  O O    . LYS A 1 64  ? 112.246 -15.522 6.399   1.00 0.00 ? 64  LYS A O    1  
ATOM 1027  C CB   . LYS A 1 64  ? 112.378 -18.623 5.742   1.00 0.00 ? 64  LYS A CB   1  
ATOM 1028  C CG   . LYS A 1 64  ? 111.863 -19.466 4.591   1.00 0.00 ? 64  LYS A CG   1  
ATOM 1029  C CD   . LYS A 1 64  ? 111.248 -20.756 5.066   1.00 0.00 ? 64  LYS A CD   1  
ATOM 1030  C CE   . LYS A 1 64  ? 110.452 -21.432 3.961   1.00 0.00 ? 64  LYS A CE   1  
ATOM 1031  N NZ   . LYS A 1 64  ? 109.194 -20.716 3.688   1.00 0.00 ? 64  LYS A NZ   1  
ATOM 1032  H H    . LYS A 1 64  ? 114.829 -18.743 5.067   1.00 0.00 ? 64  LYS A H    1  
ATOM 1033  H HA   . LYS A 1 64  ? 112.695 -17.035 4.395   1.00 0.00 ? 64  LYS A HA   1  
ATOM 1034  H HB2  . LYS A 1 64  ? 113.029 -19.220 6.365   1.00 0.00 ? 64  LYS A HB2  1  
ATOM 1035  H HB3  . LYS A 1 64  ? 111.540 -18.278 6.328   1.00 0.00 ? 64  LYS A HB3  1  
ATOM 1036  H HG2  . LYS A 1 64  ? 111.113 -18.904 4.054   1.00 0.00 ? 64  LYS A HG2  1  
ATOM 1037  H HG3  . LYS A 1 64  ? 112.688 -19.688 3.930   1.00 0.00 ? 64  LYS A HG3  1  
ATOM 1038  H HD2  . LYS A 1 64  ? 112.053 -21.411 5.365   1.00 0.00 ? 64  LYS A HD2  1  
ATOM 1039  H HD3  . LYS A 1 64  ? 110.603 -20.552 5.907   1.00 0.00 ? 64  LYS A HD3  1  
ATOM 1040  H HE2  . LYS A 1 64  ? 111.050 -21.449 3.061   1.00 0.00 ? 64  LYS A HE2  1  
ATOM 1041  H HE3  . LYS A 1 64  ? 110.227 -22.445 4.262   1.00 0.00 ? 64  LYS A HE3  1  
ATOM 1042  H HZ1  . LYS A 1 64  ? 109.359 -19.695 3.562   1.00 0.00 ? 64  LYS A HZ1  1  
ATOM 1043  H HZ2  . LYS A 1 64  ? 108.544 -20.790 4.501   1.00 0.00 ? 64  LYS A HZ2  1  
ATOM 1044  H HZ3  . LYS A 1 64  ? 108.699 -21.069 2.839   1.00 0.00 ? 64  LYS A HZ3  1  
ATOM 1045  N N    . ALA A 1 65  ? 114.239 -16.256 7.093   1.00 0.00 ? 65  ALA A N    1  
ATOM 1046  C CA   . ALA A 1 65  ? 114.417 -15.174 8.048   1.00 0.00 ? 65  ALA A CA   1  
ATOM 1047  C C    . ALA A 1 65  ? 114.570 -13.842 7.307   1.00 0.00 ? 65  ALA A C    1  
ATOM 1048  O O    . ALA A 1 65  ? 113.855 -12.872 7.587   1.00 0.00 ? 65  ALA A O    1  
ATOM 1049  C CB   . ALA A 1 65  ? 115.620 -15.433 8.938   1.00 0.00 ? 65  ALA A CB   1  
ATOM 1050  H H    . ALA A 1 65  ? 114.894 -16.986 7.023   1.00 0.00 ? 65  ALA A H    1  
ATOM 1051  H HA   . ALA A 1 65  ? 113.528 -15.128 8.662   1.00 0.00 ? 65  ALA A HA   1  
ATOM 1052  H HB1  . ALA A 1 65  ? 115.490 -16.375 9.452   1.00 0.00 ? 65  ALA A HB1  1  
ATOM 1053  H HB2  . ALA A 1 65  ? 115.713 -14.637 9.661   1.00 0.00 ? 65  ALA A HB2  1  
ATOM 1054  H HB3  . ALA A 1 65  ? 116.511 -15.476 8.329   1.00 0.00 ? 65  ALA A HB3  1  
ATOM 1055  N N    . ILE A 1 66  ? 115.464 -13.822 6.336   1.00 0.00 ? 66  ILE A N    1  
ATOM 1056  C CA   . ILE A 1 66  ? 115.725 -12.631 5.525   1.00 0.00 ? 66  ILE A CA   1  
ATOM 1057  C C    . ILE A 1 66  ? 114.508 -12.326 4.649   1.00 0.00 ? 66  ILE A C    1  
ATOM 1058  O O    . ILE A 1 66  ? 114.131 -11.176 4.451   1.00 0.00 ? 66  ILE A O    1  
ATOM 1059  C CB   . ILE A 1 66  ? 117.000 -12.842 4.660   1.00 0.00 ? 66  ILE A CB   1  
ATOM 1060  C CG1  . ILE A 1 66  ? 118.210 -13.039 5.573   1.00 0.00 ? 66  ILE A CG1  1  
ATOM 1061  C CG2  . ILE A 1 66  ? 117.237 -11.678 3.697   1.00 0.00 ? 66  ILE A CG2  1  
ATOM 1062  C CD1  . ILE A 1 66  ? 119.484 -13.380 4.845   1.00 0.00 ? 66  ILE A CD1  1  
ATOM 1063  H H    . ILE A 1 66  ? 115.972 -14.644 6.149   1.00 0.00 ? 66  ILE A H    1  
ATOM 1064  H HA   . ILE A 1 66  ? 115.887 -11.802 6.199   1.00 0.00 ? 66  ILE A HA   1  
ATOM 1065  H HB   . ILE A 1 66  ? 116.868 -13.740 4.074   1.00 0.00 ? 66  ILE A HB   1  
ATOM 1066  H HG12 . ILE A 1 66  ? 118.385 -12.130 6.129   1.00 0.00 ? 66  ILE A HG12 1  
ATOM 1067  H HG13 . ILE A 1 66  ? 117.996 -13.840 6.265   1.00 0.00 ? 66  ILE A HG13 1  
ATOM 1068  H HG21 . ILE A 1 66  ? 118.175 -11.839 3.187   1.00 0.00 ? 66  ILE A HG21 1  
ATOM 1069  H HG22 . ILE A 1 66  ? 117.290 -10.751 4.251   1.00 0.00 ? 66  ILE A HG22 1  
ATOM 1070  H HG23 . ILE A 1 66  ? 116.432 -11.662 2.973   1.00 0.00 ? 66  ILE A HG23 1  
ATOM 1071  H HD11 . ILE A 1 66  ? 119.405 -14.353 4.383   1.00 0.00 ? 66  ILE A HD11 1  
ATOM 1072  H HD12 . ILE A 1 66  ? 120.308 -13.341 5.544   1.00 0.00 ? 66  ILE A HD12 1  
ATOM 1073  H HD13 . ILE A 1 66  ? 119.655 -12.632 4.085   1.00 0.00 ? 66  ILE A HD13 1  
ATOM 1074  N N    . TYR A 1 67  ? 113.891 -13.375 4.172   1.00 0.00 ? 67  TYR A N    1  
ATOM 1075  C CA   . TYR A 1 67  ? 112.683 -13.310 3.384   1.00 0.00 ? 67  TYR A CA   1  
ATOM 1076  C C    . TYR A 1 67  ? 111.582 -12.547 4.128   1.00 0.00 ? 67  TYR A C    1  
ATOM 1077  O O    . TYR A 1 67  ? 111.161 -11.481 3.687   1.00 0.00 ? 67  TYR A O    1  
ATOM 1078  C CB   . TYR A 1 67  ? 112.244 -14.736 3.075   1.00 0.00 ? 67  TYR A CB   1  
ATOM 1079  C CG   . TYR A 1 67  ? 110.971 -14.865 2.316   1.00 0.00 ? 67  TYR A CG   1  
ATOM 1080  C CD1  . TYR A 1 67  ? 110.889 -14.467 1.006   1.00 0.00 ? 67  TYR A CD1  1  
ATOM 1081  C CD2  . TYR A 1 67  ? 109.853 -15.397 2.914   1.00 0.00 ? 67  TYR A CD2  1  
ATOM 1082  C CE1  . TYR A 1 67  ? 109.724 -14.587 0.299   1.00 0.00 ? 67  TYR A CE1  1  
ATOM 1083  C CE2  . TYR A 1 67  ? 108.682 -15.534 2.227   1.00 0.00 ? 67  TYR A CE2  1  
ATOM 1084  C CZ   . TYR A 1 67  ? 108.607 -15.132 0.925   1.00 0.00 ? 67  TYR A CZ   1  
ATOM 1085  O OH   . TYR A 1 67  ? 107.428 -15.283 0.246   1.00 0.00 ? 67  TYR A OH   1  
ATOM 1086  H H    . TYR A 1 67  ? 114.292 -14.258 4.340   1.00 0.00 ? 67  TYR A H    1  
ATOM 1087  H HA   . TYR A 1 67  ? 112.878 -12.805 2.446   1.00 0.00 ? 67  TYR A HA   1  
ATOM 1088  H HB2  . TYR A 1 67  ? 113.012 -15.226 2.496   1.00 0.00 ? 67  TYR A HB2  1  
ATOM 1089  H HB3  . TYR A 1 67  ? 112.127 -15.263 4.011   1.00 0.00 ? 67  TYR A HB3  1  
ATOM 1090  H HD1  . TYR A 1 67  ? 111.766 -14.054 0.528   1.00 0.00 ? 67  TYR A HD1  1  
ATOM 1091  H HD2  . TYR A 1 67  ? 109.912 -15.713 3.945   1.00 0.00 ? 67  TYR A HD2  1  
ATOM 1092  H HE1  . TYR A 1 67  ? 109.727 -14.239 -0.725  1.00 0.00 ? 67  TYR A HE1  1  
ATOM 1093  H HE2  . TYR A 1 67  ? 107.816 -15.954 2.718   1.00 0.00 ? 67  TYR A HE2  1  
ATOM 1094  H HH   . TYR A 1 67  ? 106.674 -15.157 0.839   1.00 0.00 ? 67  TYR A HH   1  
ATOM 1095  N N    . GLU A 1 68  ? 111.186 -13.053 5.289   1.00 0.00 ? 68  GLU A N    1  
ATOM 1096  C CA   . GLU A 1 68  ? 110.087 -12.466 6.050   1.00 0.00 ? 68  GLU A CA   1  
ATOM 1097  C C    . GLU A 1 68  ? 110.417 -11.093 6.636   1.00 0.00 ? 68  GLU A C    1  
ATOM 1098  O O    . GLU A 1 68  ? 109.519 -10.323 6.953   1.00 0.00 ? 68  GLU A O    1  
ATOM 1099  C CB   . GLU A 1 68  ? 109.580 -13.418 7.132   1.00 0.00 ? 68  GLU A CB   1  
ATOM 1100  C CG   . GLU A 1 68  ? 109.018 -14.721 6.578   1.00 0.00 ? 68  GLU A CG   1  
ATOM 1101  C CD   . GLU A 1 68  ? 108.380 -15.589 7.635   1.00 0.00 ? 68  GLU A CD   1  
ATOM 1102  O OE1  . GLU A 1 68  ? 109.076 -16.418 8.259   1.00 0.00 ? 68  GLU A OE1  1  
ATOM 1103  O OE2  . GLU A 1 68  ? 107.163 -15.485 7.844   1.00 0.00 ? 68  GLU A OE2  1  
ATOM 1104  H H    . GLU A 1 68  ? 111.637 -13.850 5.650   1.00 0.00 ? 68  GLU A H    1  
ATOM 1105  H HA   . GLU A 1 68  ? 109.287 -12.318 5.340   1.00 0.00 ? 68  GLU A HA   1  
ATOM 1106  H HB2  . GLU A 1 68  ? 110.395 -13.649 7.802   1.00 0.00 ? 68  GLU A HB2  1  
ATOM 1107  H HB3  . GLU A 1 68  ? 108.800 -12.917 7.687   1.00 0.00 ? 68  GLU A HB3  1  
ATOM 1108  H HG2  . GLU A 1 68  ? 108.270 -14.483 5.837   1.00 0.00 ? 68  GLU A HG2  1  
ATOM 1109  H HG3  . GLU A 1 68  ? 109.819 -15.274 6.109   1.00 0.00 ? 68  GLU A HG3  1  
ATOM 1110  N N    . LYS A 1 69  ? 111.682 -10.793 6.765   1.00 0.00 ? 69  LYS A N    1  
ATOM 1111  C CA   . LYS A 1 69  ? 112.106 -9.514  7.310   1.00 0.00 ? 69  LYS A CA   1  
ATOM 1112  C C    . LYS A 1 69  ? 112.282 -8.446  6.217   1.00 0.00 ? 69  LYS A C    1  
ATOM 1113  O O    . LYS A 1 69  ? 112.082 -7.244  6.466   1.00 0.00 ? 69  LYS A O    1  
ATOM 1114  C CB   . LYS A 1 69  ? 113.425 -9.697  8.075   1.00 0.00 ? 69  LYS A CB   1  
ATOM 1115  C CG   . LYS A 1 69  ? 114.003 -8.426  8.677   1.00 0.00 ? 69  LYS A CG   1  
ATOM 1116  C CD   . LYS A 1 69  ? 115.307 -8.707  9.388   1.00 0.00 ? 69  LYS A CD   1  
ATOM 1117  C CE   . LYS A 1 69  ? 115.896 -7.448  9.991   1.00 0.00 ? 69  LYS A CE   1  
ATOM 1118  N NZ   . LYS A 1 69  ? 117.195 -7.710  10.621  1.00 0.00 ? 69  LYS A NZ   1  
ATOM 1119  H H    . LYS A 1 69  ? 112.355 -11.462 6.516   1.00 0.00 ? 69  LYS A H    1  
ATOM 1120  H HA   . LYS A 1 69  ? 111.355 -9.179  8.010   1.00 0.00 ? 69  LYS A HA   1  
ATOM 1121  H HB2  . LYS A 1 69  ? 113.263 -10.399 8.880   1.00 0.00 ? 69  LYS A HB2  1  
ATOM 1122  H HB3  . LYS A 1 69  ? 114.156 -10.113 7.397   1.00 0.00 ? 69  LYS A HB3  1  
ATOM 1123  H HG2  . LYS A 1 69  ? 114.196 -7.732  7.873   1.00 0.00 ? 69  LYS A HG2  1  
ATOM 1124  H HG3  . LYS A 1 69  ? 113.296 -8.001  9.372   1.00 0.00 ? 69  LYS A HG3  1  
ATOM 1125  H HD2  . LYS A 1 69  ? 115.129 -9.421  10.178  1.00 0.00 ? 69  LYS A HD2  1  
ATOM 1126  H HD3  . LYS A 1 69  ? 116.010 -9.122  8.680   1.00 0.00 ? 69  LYS A HD3  1  
ATOM 1127  H HE2  . LYS A 1 69  ? 116.027 -6.717  9.207   1.00 0.00 ? 69  LYS A HE2  1  
ATOM 1128  H HE3  . LYS A 1 69  ? 115.213 -7.062  10.733  1.00 0.00 ? 69  LYS A HE3  1  
ATOM 1129  H HZ1  . LYS A 1 69  ? 117.085 -8.466  11.334  1.00 0.00 ? 69  LYS A HZ1  1  
ATOM 1130  H HZ2  . LYS A 1 69  ? 117.555 -6.879  11.128  1.00 0.00 ? 69  LYS A HZ2  1  
ATOM 1131  H HZ3  . LYS A 1 69  ? 117.903 -8.042  9.927   1.00 0.00 ? 69  LYS A HZ3  1  
ATOM 1132  N N    . PHE A 1 70  ? 112.573 -8.872  5.013   1.00 0.00 ? 70  PHE A N    1  
ATOM 1133  C CA   . PHE A 1 70  ? 112.990 -7.947  3.982   1.00 0.00 ? 70  PHE A CA   1  
ATOM 1134  C C    . PHE A 1 70  ? 112.220 -8.128  2.695   1.00 0.00 ? 70  PHE A C    1  
ATOM 1135  O O    . PHE A 1 70  ? 111.616 -7.193  2.190   1.00 0.00 ? 70  PHE A O    1  
ATOM 1136  C CB   . PHE A 1 70  ? 114.483 -8.118  3.683   1.00 0.00 ? 70  PHE A CB   1  
ATOM 1137  C CG   . PHE A 1 70  ? 115.438 -7.675  4.752   1.00 0.00 ? 70  PHE A CG   1  
ATOM 1138  C CD1  . PHE A 1 70  ? 115.540 -6.338  5.095   1.00 0.00 ? 70  PHE A CD1  1  
ATOM 1139  C CD2  . PHE A 1 70  ? 116.257 -8.589  5.387   1.00 0.00 ? 70  PHE A CD2  1  
ATOM 1140  C CE1  . PHE A 1 70  ? 116.435 -5.925  6.056   1.00 0.00 ? 70  PHE A CE1  1  
ATOM 1141  C CE2  . PHE A 1 70  ? 117.160 -8.180  6.344   1.00 0.00 ? 70  PHE A CE2  1  
ATOM 1142  C CZ   . PHE A 1 70  ? 117.249 -6.844  6.679   1.00 0.00 ? 70  PHE A CZ   1  
ATOM 1143  H H    . PHE A 1 70  ? 112.453 -9.816  4.771   1.00 0.00 ? 70  PHE A H    1  
ATOM 1144  H HA   . PHE A 1 70  ? 112.845 -6.942  4.348   1.00 0.00 ? 70  PHE A HA   1  
ATOM 1145  H HB2  . PHE A 1 70  ? 114.680 -9.163  3.501   1.00 0.00 ? 70  PHE A HB2  1  
ATOM 1146  H HB3  . PHE A 1 70  ? 114.715 -7.569  2.781   1.00 0.00 ? 70  PHE A HB3  1  
ATOM 1147  H HD1  . PHE A 1 70  ? 114.902 -5.617  4.607   1.00 0.00 ? 70  PHE A HD1  1  
ATOM 1148  H HD2  . PHE A 1 70  ? 116.186 -9.634  5.126   1.00 0.00 ? 70  PHE A HD2  1  
ATOM 1149  H HE1  . PHE A 1 70  ? 116.502 -4.879  6.316   1.00 0.00 ? 70  PHE A HE1  1  
ATOM 1150  H HE2  . PHE A 1 70  ? 117.795 -8.903  6.834   1.00 0.00 ? 70  PHE A HE2  1  
ATOM 1151  H HZ   . PHE A 1 70  ? 117.955 -6.520  7.428   1.00 0.00 ? 70  PHE A HZ   1  
ATOM 1152  N N    . ILE A 1 71  ? 112.259 -9.335  2.169   1.00 0.00 ? 71  ILE A N    1  
ATOM 1153  C CA   . ILE A 1 71  ? 111.640 -9.673  0.877   1.00 0.00 ? 71  ILE A CA   1  
ATOM 1154  C C    . ILE A 1 71  ? 110.128 -9.464  0.945   1.00 0.00 ? 71  ILE A C    1  
ATOM 1155  O O    . ILE A 1 71  ? 109.462 -9.206  -0.068  1.00 0.00 ? 71  ILE A O    1  
ATOM 1156  C CB   . ILE A 1 71  ? 111.965 -11.154 0.499   1.00 0.00 ? 71  ILE A CB   1  
ATOM 1157  C CG1  . ILE A 1 71  ? 113.476 -11.355 0.451   1.00 0.00 ? 71  ILE A CG1  1  
ATOM 1158  C CG2  . ILE A 1 71  ? 111.331 -11.598 -0.829  1.00 0.00 ? 71  ILE A CG2  1  
ATOM 1159  C CD1  . ILE A 1 71  ? 114.183 -10.443 -0.528  1.00 0.00 ? 71  ILE A CD1  1  
ATOM 1160  H H    . ILE A 1 71  ? 112.714 -10.045 2.667   1.00 0.00 ? 71  ILE A H    1  
ATOM 1161  H HA   . ILE A 1 71  ? 112.077 -9.015  0.139   1.00 0.00 ? 71  ILE A HA   1  
ATOM 1162  H HB   . ILE A 1 71  ? 111.573 -11.791 1.279   1.00 0.00 ? 71  ILE A HB   1  
ATOM 1163  H HG12 . ILE A 1 71  ? 113.887 -11.167 1.431   1.00 0.00 ? 71  ILE A HG12 1  
ATOM 1164  H HG13 . ILE A 1 71  ? 113.688 -12.376 0.169   1.00 0.00 ? 71  ILE A HG13 1  
ATOM 1165  H HG21 . ILE A 1 71  ? 111.907 -11.230 -1.669  1.00 0.00 ? 71  ILE A HG21 1  
ATOM 1166  H HG22 . ILE A 1 71  ? 110.326 -11.208 -0.878  1.00 0.00 ? 71  ILE A HG22 1  
ATOM 1167  H HG23 . ILE A 1 71  ? 111.288 -12.682 -0.845  1.00 0.00 ? 71  ILE A HG23 1  
ATOM 1168  H HD11 . ILE A 1 71  ? 115.243 -10.657 -0.523  1.00 0.00 ? 71  ILE A HD11 1  
ATOM 1169  H HD12 . ILE A 1 71  ? 114.027 -9.413  -0.241  1.00 0.00 ? 71  ILE A HD12 1  
ATOM 1170  H HD13 . ILE A 1 71  ? 113.794 -10.586 -1.526  1.00 0.00 ? 71  ILE A HD13 1  
ATOM 1171  N N    . GLN A 1 72  ? 109.610 -9.562  2.144   1.00 0.00 ? 72  GLN A N    1  
ATOM 1172  C CA   . GLN A 1 72  ? 108.210 -9.356  2.382   1.00 0.00 ? 72  GLN A CA   1  
ATOM 1173  C C    . GLN A 1 72  ? 107.838 -7.919  2.278   1.00 0.00 ? 72  GLN A C    1  
ATOM 1174  O O    . GLN A 1 72  ? 108.625 -7.018  2.567   1.00 0.00 ? 72  GLN A O    1  
ATOM 1175  C CB   . GLN A 1 72  ? 107.818 -9.853  3.748   1.00 0.00 ? 72  GLN A CB   1  
ATOM 1176  C CG   . GLN A 1 72  ? 107.788 -11.322 3.843   1.00 0.00 ? 72  GLN A CG   1  
ATOM 1177  C CD   . GLN A 1 72  ? 106.513 -11.939 3.342   1.00 0.00 ? 72  GLN A CD   1  
ATOM 1178  O OE1  . GLN A 1 72  ? 105.443 -11.354 3.426   1.00 0.00 ? 72  GLN A OE1  1  
ATOM 1179  N NE2  . GLN A 1 72  ? 106.615 -13.113 2.816   1.00 0.00 ? 72  GLN A NE2  1  
ATOM 1180  H H    . GLN A 1 72  ? 110.218 -9.763  2.894   1.00 0.00 ? 72  GLN A H    1  
ATOM 1181  H HA   . GLN A 1 72  ? 107.653 -9.924  1.653   1.00 0.00 ? 72  GLN A HA   1  
ATOM 1182  H HB2  . GLN A 1 72  ? 108.533 -9.487  4.472   1.00 0.00 ? 72  GLN A HB2  1  
ATOM 1183  H HB3  . GLN A 1 72  ? 106.833 -9.476  3.984   1.00 0.00 ? 72  GLN A HB3  1  
ATOM 1184  H HG2  . GLN A 1 72  ? 108.544 -11.595 3.125   1.00 0.00 ? 72  GLN A HG2  1  
ATOM 1185  H HG3  . GLN A 1 72  ? 108.020 -11.620 4.854   1.00 0.00 ? 72  GLN A HG3  1  
ATOM 1186  H HE21 . GLN A 1 72  ? 107.502 -13.522 2.774   1.00 0.00 ? 72  GLN A HE21 1  
ATOM 1187  H HE22 . GLN A 1 72  ? 105.809 -13.564 2.479   1.00 0.00 ? 72  GLN A HE22 1  
ATOM 1188  N N    . THR A 1 73  ? 106.653 -7.731  1.885   1.00 0.00 ? 73  THR A N    1  
ATOM 1189  C CA   . THR A 1 73  ? 106.050 -6.440  1.843   1.00 0.00 ? 73  THR A CA   1  
ATOM 1190  C C    . THR A 1 73  ? 105.539 -6.198  3.249   1.00 0.00 ? 73  THR A C    1  
ATOM 1191  O O    . THR A 1 73  ? 105.791 -5.163  3.889   1.00 0.00 ? 73  THR A O    1  
ATOM 1192  C CB   . THR A 1 73  ? 104.875 -6.464  0.870   1.00 0.00 ? 73  THR A CB   1  
ATOM 1193  O OG1  . THR A 1 73  ? 105.307 -7.018  -0.377  1.00 0.00 ? 73  THR A OG1  1  
ATOM 1194  C CG2  . THR A 1 73  ? 104.352 -5.073  0.650   1.00 0.00 ? 73  THR A CG2  1  
ATOM 1195  H H    . THR A 1 73  ? 106.139 -8.535  1.640   1.00 0.00 ? 73  THR A H    1  
ATOM 1196  H HA   . THR A 1 73  ? 106.774 -5.693  1.552   1.00 0.00 ? 73  THR A HA   1  
ATOM 1197  H HB   . THR A 1 73  ? 104.090 -7.081  1.283   1.00 0.00 ? 73  THR A HB   1  
ATOM 1198  H HG1  . THR A 1 73  ? 104.515 -7.084  -0.940  1.00 0.00 ? 73  THR A HG1  1  
ATOM 1199  H HG21 . THR A 1 73  ? 105.156 -4.459  0.270   1.00 0.00 ? 73  THR A HG21 1  
ATOM 1200  H HG22 . THR A 1 73  ? 104.021 -4.693  1.605   1.00 0.00 ? 73  THR A HG22 1  
ATOM 1201  H HG23 . THR A 1 73  ? 103.531 -5.093  -0.051  1.00 0.00 ? 73  THR A HG23 1  
ATOM 1202  N N    . ASP A 1 74  ? 104.851 -7.199  3.738   1.00 0.00 ? 74  ASP A N    1  
ATOM 1203  C CA   . ASP A 1 74  ? 104.418 -7.245  5.105   1.00 0.00 ? 74  ASP A CA   1  
ATOM 1204  C C    . ASP A 1 74  ? 105.587 -7.766  5.923   1.00 0.00 ? 74  ASP A C    1  
ATOM 1205  O O    . ASP A 1 74  ? 105.711 -8.957  6.181   1.00 0.00 ? 74  ASP A O    1  
ATOM 1206  C CB   . ASP A 1 74  ? 103.198 -8.158  5.260   1.00 0.00 ? 74  ASP A CB   1  
ATOM 1207  C CG   . ASP A 1 74  ? 102.659 -8.188  6.668   1.00 0.00 ? 74  ASP A CG   1  
ATOM 1208  O OD1  . ASP A 1 74  ? 101.873 -7.288  7.026   1.00 0.00 ? 74  ASP A OD1  1  
ATOM 1209  O OD2  . ASP A 1 74  ? 102.976 -9.122  7.438   1.00 0.00 ? 74  ASP A OD2  1  
ATOM 1210  H H    . ASP A 1 74  ? 104.632 -7.942  3.128   1.00 0.00 ? 74  ASP A H    1  
ATOM 1211  H HA   . ASP A 1 74  ? 104.177 -6.242  5.422   1.00 0.00 ? 74  ASP A HA   1  
ATOM 1212  H HB2  . ASP A 1 74  ? 102.413 -7.809  4.607   1.00 0.00 ? 74  ASP A HB2  1  
ATOM 1213  H HB3  . ASP A 1 74  ? 103.473 -9.164  4.975   1.00 0.00 ? 74  ASP A HB3  1  
ATOM 1214  N N    . ALA A 1 75  ? 106.499 -6.881  6.206   1.00 0.00 ? 75  ALA A N    1  
ATOM 1215  C CA   . ALA A 1 75  ? 107.714 -7.205  6.892   1.00 0.00 ? 75  ALA A CA   1  
ATOM 1216  C C    . ALA A 1 75  ? 108.039 -6.108  7.871   1.00 0.00 ? 75  ALA A C    1  
ATOM 1217  O O    . ALA A 1 75  ? 107.552 -4.990  7.720   1.00 0.00 ? 75  ALA A O    1  
ATOM 1218  C CB   . ALA A 1 75  ? 108.852 -7.336  5.881   1.00 0.00 ? 75  ALA A CB   1  
ATOM 1219  H H    . ALA A 1 75  ? 106.353 -5.949  5.942   1.00 0.00 ? 75  ALA A H    1  
ATOM 1220  H HA   . ALA A 1 75  ? 107.600 -8.149  7.404   1.00 0.00 ? 75  ALA A HA   1  
ATOM 1221  H HB1  . ALA A 1 75  ? 109.776 -7.462  6.429   1.00 0.00 ? 75  ALA A HB1  1  
ATOM 1222  H HB2  . ALA A 1 75  ? 108.924 -6.462  5.249   1.00 0.00 ? 75  ALA A HB2  1  
ATOM 1223  H HB3  . ALA A 1 75  ? 108.684 -8.219  5.278   1.00 0.00 ? 75  ALA A HB3  1  
ATOM 1224  N N    . PRO A 1 76  ? 108.874 -6.397  8.887   1.00 0.00 ? 76  PRO A N    1  
ATOM 1225  C CA   . PRO A 1 76  ? 109.294 -5.396  9.876   1.00 0.00 ? 76  PRO A CA   1  
ATOM 1226  C C    . PRO A 1 76  ? 110.200 -4.335  9.251   1.00 0.00 ? 76  PRO A C    1  
ATOM 1227  O O    . PRO A 1 76  ? 110.376 -3.246  9.798   1.00 0.00 ? 76  PRO A O    1  
ATOM 1228  C CB   . PRO A 1 76  ? 110.081 -6.218  10.903  1.00 0.00 ? 76  PRO A CB   1  
ATOM 1229  C CG   . PRO A 1 76  ? 110.535 -7.421  10.158  1.00 0.00 ? 76  PRO A CG   1  
ATOM 1230  C CD   . PRO A 1 76  ? 109.448 -7.729  9.181   1.00 0.00 ? 76  PRO A CD   1  
ATOM 1231  H HA   . PRO A 1 76  ? 108.448 -4.921  10.351  1.00 0.00 ? 76  PRO A HA   1  
ATOM 1232  H HB2  . PRO A 1 76  ? 110.917 -5.637  11.264  1.00 0.00 ? 76  PRO A HB2  1  
ATOM 1233  H HB3  . PRO A 1 76  ? 109.435 -6.483  11.727  1.00 0.00 ? 76  PRO A HB3  1  
ATOM 1234  H HG2  . PRO A 1 76  ? 111.447 -7.201  9.624   1.00 0.00 ? 76  PRO A HG2  1  
ATOM 1235  H HG3  . PRO A 1 76  ? 110.677 -8.252  10.833  1.00 0.00 ? 76  PRO A HG3  1  
ATOM 1236  H HD2  . PRO A 1 76  ? 109.865 -8.169  8.288   1.00 0.00 ? 76  PRO A HD2  1  
ATOM 1237  H HD3  . PRO A 1 76  ? 108.705 -8.384  9.610   1.00 0.00 ? 76  PRO A HD3  1  
ATOM 1238  N N    . LYS A 1 77  ? 110.787 -4.673  8.117   1.00 0.00 ? 77  LYS A N    1  
ATOM 1239  C CA   . LYS A 1 77  ? 111.652 -3.766  7.403   1.00 0.00 ? 77  LYS A CA   1  
ATOM 1240  C C    . LYS A 1 77  ? 111.096 -3.456  6.036   1.00 0.00 ? 77  LYS A C    1  
ATOM 1241  O O    . LYS A 1 77  ? 110.795 -2.289  5.746   1.00 0.00 ? 77  LYS A O    1  
ATOM 1242  C CB   . LYS A 1 77  ? 113.078 -4.318  7.299   1.00 0.00 ? 77  LYS A CB   1  
ATOM 1243  C CG   . LYS A 1 77  ? 113.852 -4.273  8.602   1.00 0.00 ? 77  LYS A CG   1  
ATOM 1244  C CD   . LYS A 1 77  ? 114.080 -2.834  9.023   1.00 0.00 ? 77  LYS A CD   1  
ATOM 1245  C CE   . LYS A 1 77  ? 114.866 -2.738  10.307  1.00 0.00 ? 77  LYS A CE   1  
ATOM 1246  N NZ   . LYS A 1 77  ? 115.187 -1.337  10.637  1.00 0.00 ? 77  LYS A NZ   1  
ATOM 1247  H H    . LYS A 1 77  ? 110.601 -5.563  7.749   1.00 0.00 ? 77  LYS A H    1  
ATOM 1248  H HA   . LYS A 1 77  ? 111.682 -2.845  7.968   1.00 0.00 ? 77  LYS A HA   1  
ATOM 1249  H HB2  . LYS A 1 77  ? 113.025 -5.346  6.974   1.00 0.00 ? 77  LYS A HB2  1  
ATOM 1250  H HB3  . LYS A 1 77  ? 113.621 -3.746  6.562   1.00 0.00 ? 77  LYS A HB3  1  
ATOM 1251  H HG2  . LYS A 1 77  ? 113.284 -4.782  9.366   1.00 0.00 ? 77  LYS A HG2  1  
ATOM 1252  H HG3  . LYS A 1 77  ? 114.808 -4.759  8.468   1.00 0.00 ? 77  LYS A HG3  1  
ATOM 1253  H HD2  . LYS A 1 77  ? 114.622 -2.320  8.244   1.00 0.00 ? 77  LYS A HD2  1  
ATOM 1254  H HD3  . LYS A 1 77  ? 113.120 -2.359  9.161   1.00 0.00 ? 77  LYS A HD3  1  
ATOM 1255  H HE2  . LYS A 1 77  ? 114.281 -3.165  11.108  1.00 0.00 ? 77  LYS A HE2  1  
ATOM 1256  H HE3  . LYS A 1 77  ? 115.786 -3.294  10.195  1.00 0.00 ? 77  LYS A HE3  1  
ATOM 1257  H HZ1  . LYS A 1 77  ? 114.315 -0.770  10.723  1.00 0.00 ? 77  LYS A HZ1  1  
ATOM 1258  H HZ2  . LYS A 1 77  ? 115.767 -0.932  9.869   1.00 0.00 ? 77  LYS A HZ2  1  
ATOM 1259  H HZ3  . LYS A 1 77  ? 115.720 -1.298  11.536  1.00 0.00 ? 77  LYS A HZ3  1  
ATOM 1260  N N    . GLU A 1 78  ? 110.946 -4.509  5.216   1.00 0.00 ? 78  GLU A N    1  
ATOM 1261  C CA   . GLU A 1 78  ? 110.436 -4.413  3.834   1.00 0.00 ? 78  GLU A CA   1  
ATOM 1262  C C    . GLU A 1 78  ? 111.446 -3.713  2.899   1.00 0.00 ? 78  GLU A C    1  
ATOM 1263  O O    . GLU A 1 78  ? 111.893 -2.586  3.151   1.00 0.00 ? 78  GLU A O    1  
ATOM 1264  C CB   . GLU A 1 78  ? 109.074 -3.708  3.763   1.00 0.00 ? 78  GLU A CB   1  
ATOM 1265  C CG   . GLU A 1 78  ? 108.581 -3.473  2.346   1.00 0.00 ? 78  GLU A CG   1  
ATOM 1266  C CD   . GLU A 1 78  ? 107.380 -2.587  2.292   1.00 0.00 ? 78  GLU A CD   1  
ATOM 1267  O OE1  . GLU A 1 78  ? 107.320 -1.599  3.073   1.00 0.00 ? 78  GLU A OE1  1  
ATOM 1268  O OE2  . GLU A 1 78  ? 106.491 -2.826  1.480   1.00 0.00 ? 78  GLU A OE2  1  
ATOM 1269  H H    . GLU A 1 78  ? 111.221 -5.393  5.542   1.00 0.00 ? 78  GLU A H    1  
ATOM 1270  H HA   . GLU A 1 78  ? 110.312 -5.440  3.518   1.00 0.00 ? 78  GLU A HA   1  
ATOM 1271  H HB2  . GLU A 1 78  ? 108.342 -4.309  4.281   1.00 0.00 ? 78  GLU A HB2  1  
ATOM 1272  H HB3  . GLU A 1 78  ? 109.152 -2.750  4.256   1.00 0.00 ? 78  GLU A HB3  1  
ATOM 1273  H HG2  . GLU A 1 78  ? 109.372 -3.014  1.772   1.00 0.00 ? 78  GLU A HG2  1  
ATOM 1274  H HG3  . GLU A 1 78  ? 108.330 -4.428  1.908   1.00 0.00 ? 78  GLU A HG3  1  
ATOM 1275  N N    . VAL A 1 79  ? 111.781 -4.370  1.826   1.00 0.00 ? 79  VAL A N    1  
ATOM 1276  C CA   . VAL A 1 79  ? 112.732 -3.833  0.862   1.00 0.00 ? 79  VAL A CA   1  
ATOM 1277  C C    . VAL A 1 79  ? 111.963 -3.218  -0.300  1.00 0.00 ? 79  VAL A C    1  
ATOM 1278  O O    . VAL A 1 79  ? 110.835 -3.629  -0.593  1.00 0.00 ? 79  VAL A O    1  
ATOM 1279  C CB   . VAL A 1 79  ? 113.671 -4.965  0.319   1.00 0.00 ? 79  VAL A CB   1  
ATOM 1280  C CG1  . VAL A 1 79  ? 114.748 -4.440  -0.608  1.00 0.00 ? 79  VAL A CG1  1  
ATOM 1281  C CG2  . VAL A 1 79  ? 114.313 -5.697  1.442   1.00 0.00 ? 79  VAL A CG2  1  
ATOM 1282  H H    . VAL A 1 79  ? 111.362 -5.247  1.671   1.00 0.00 ? 79  VAL A H    1  
ATOM 1283  H HA   . VAL A 1 79  ? 113.331 -3.078  1.348   1.00 0.00 ? 79  VAL A HA   1  
ATOM 1284  H HB   . VAL A 1 79  ? 113.066 -5.670  -0.233  1.00 0.00 ? 79  VAL A HB   1  
ATOM 1285  H HG11 . VAL A 1 79  ? 115.350 -5.275  -0.935  1.00 0.00 ? 79  VAL A HG11 1  
ATOM 1286  H HG12 . VAL A 1 79  ? 115.365 -3.731  -0.077  1.00 0.00 ? 79  VAL A HG12 1  
ATOM 1287  H HG13 . VAL A 1 79  ? 114.289 -3.967  -1.462  1.00 0.00 ? 79  VAL A HG13 1  
ATOM 1288  H HG21 . VAL A 1 79  ? 114.956 -5.034  2.000   1.00 0.00 ? 79  VAL A HG21 1  
ATOM 1289  H HG22 . VAL A 1 79  ? 114.867 -6.548  1.065   1.00 0.00 ? 79  VAL A HG22 1  
ATOM 1290  H HG23 . VAL A 1 79  ? 113.537 -6.070  2.094   1.00 0.00 ? 79  VAL A HG23 1  
ATOM 1291  N N    . ASN A 1 80  ? 112.559 -2.245  -0.959  1.00 0.00 ? 80  ASN A N    1  
ATOM 1292  C CA   . ASN A 1 80  ? 111.988 -1.607  -2.162  1.00 0.00 ? 80  ASN A CA   1  
ATOM 1293  C C    . ASN A 1 80  ? 112.431 -2.427  -3.386  1.00 0.00 ? 80  ASN A C    1  
ATOM 1294  O O    . ASN A 1 80  ? 112.678 -1.902  -4.478  1.00 0.00 ? 80  ASN A O    1  
ATOM 1295  C CB   . ASN A 1 80  ? 112.517 -0.166  -2.295  1.00 0.00 ? 80  ASN A CB   1  
ATOM 1296  C CG   . ASN A 1 80  ? 112.271 0.720   -1.070  1.00 0.00 ? 80  ASN A CG   1  
ATOM 1297  O OD1  . ASN A 1 80  ? 113.060 1.618   -0.784  1.00 0.00 ? 80  ASN A OD1  1  
ATOM 1298  N ND2  . ASN A 1 80  ? 111.194 0.505   -0.356  1.00 0.00 ? 80  ASN A ND2  1  
ATOM 1299  H H    . ASN A 1 80  ? 113.431 -1.920  -0.624  1.00 0.00 ? 80  ASN A H    1  
ATOM 1300  H HA   . ASN A 1 80  ? 110.911 -1.607  -2.085  1.00 0.00 ? 80  ASN A HA   1  
ATOM 1301  H HB2  . ASN A 1 80  ? 113.582 -0.201  -2.467  1.00 0.00 ? 80  ASN A HB2  1  
ATOM 1302  H HB3  . ASN A 1 80  ? 112.044 0.297   -3.149  1.00 0.00 ? 80  ASN A HB3  1  
ATOM 1303  H HD21 . ASN A 1 80  ? 110.557 -0.204  -0.606  1.00 0.00 ? 80  ASN A HD21 1  
ATOM 1304  H HD22 . ASN A 1 80  ? 111.064 1.058   0.444   1.00 0.00 ? 80  ASN A HD22 1  
ATOM 1305  N N    . LEU A 1 81  ? 112.472 -3.718  -3.180  1.00 0.00 ? 81  LEU A N    1  
ATOM 1306  C CA   . LEU A 1 81  ? 112.964 -4.688  -4.118  1.00 0.00 ? 81  LEU A CA   1  
ATOM 1307  C C    . LEU A 1 81  ? 112.037 -4.859  -5.303  1.00 0.00 ? 81  LEU A C    1  
ATOM 1308  O O    . LEU A 1 81  ? 110.812 -4.780  -5.171  1.00 0.00 ? 81  LEU A O    1  
ATOM 1309  C CB   . LEU A 1 81  ? 113.139 -6.027  -3.389  1.00 0.00 ? 81  LEU A CB   1  
ATOM 1310  C CG   . LEU A 1 81  ? 113.620 -7.218  -4.194  1.00 0.00 ? 81  LEU A CG   1  
ATOM 1311  C CD1  . LEU A 1 81  ? 115.068 -7.051  -4.532  1.00 0.00 ? 81  LEU A CD1  1  
ATOM 1312  C CD2  . LEU A 1 81  ? 113.382 -8.511  -3.438  1.00 0.00 ? 81  LEU A CD2  1  
ATOM 1313  H H    . LEU A 1 81  ? 112.110 -4.043  -2.330  1.00 0.00 ? 81  LEU A H    1  
ATOM 1314  H HA   . LEU A 1 81  ? 113.938 -4.375  -4.462  1.00 0.00 ? 81  LEU A HA   1  
ATOM 1315  H HB2  . LEU A 1 81  ? 113.951 -5.840  -2.700  1.00 0.00 ? 81  LEU A HB2  1  
ATOM 1316  H HB3  . LEU A 1 81  ? 112.239 -6.288  -2.853  1.00 0.00 ? 81  LEU A HB3  1  
ATOM 1317  H HG   . LEU A 1 81  ? 113.082 -7.264  -5.130  1.00 0.00 ? 81  LEU A HG   1  
ATOM 1318  H HD11 . LEU A 1 81  ? 115.406 -7.899  -5.107  1.00 0.00 ? 81  LEU A HD11 1  
ATOM 1319  H HD12 . LEU A 1 81  ? 115.642 -6.992  -3.618  1.00 0.00 ? 81  LEU A HD12 1  
ATOM 1320  H HD13 . LEU A 1 81  ? 115.205 -6.147  -5.108  1.00 0.00 ? 81  LEU A HD13 1  
ATOM 1321  H HD21 . LEU A 1 81  ? 113.906 -8.502  -2.492  1.00 0.00 ? 81  LEU A HD21 1  
ATOM 1322  H HD22 . LEU A 1 81  ? 113.737 -9.343  -4.028  1.00 0.00 ? 81  LEU A HD22 1  
ATOM 1323  H HD23 . LEU A 1 81  ? 112.324 -8.630  -3.257  1.00 0.00 ? 81  LEU A HD23 1  
ATOM 1324  N N    . ASP A 1 82  ? 112.660 -5.049  -6.447  1.00 0.00 ? 82  ASP A N    1  
ATOM 1325  C CA   . ASP A 1 82  ? 112.007 -5.358  -7.709  1.00 0.00 ? 82  ASP A CA   1  
ATOM 1326  C C    . ASP A 1 82  ? 110.989 -6.484  -7.555  1.00 0.00 ? 82  ASP A C    1  
ATOM 1327  O O    . ASP A 1 82  ? 111.317 -7.583  -7.054  1.00 0.00 ? 82  ASP A O    1  
ATOM 1328  C CB   . ASP A 1 82  ? 113.068 -5.746  -8.738  1.00 0.00 ? 82  ASP A CB   1  
ATOM 1329  C CG   . ASP A 1 82  ? 112.486 -6.291  -10.012 1.00 0.00 ? 82  ASP A CG   1  
ATOM 1330  O OD1  . ASP A 1 82  ? 111.984 -5.498  -10.836 1.00 0.00 ? 82  ASP A OD1  1  
ATOM 1331  O OD2  . ASP A 1 82  ? 112.510 -7.530  -10.196 1.00 0.00 ? 82  ASP A OD2  1  
ATOM 1332  H H    . ASP A 1 82  ? 113.636 -4.935  -6.450  1.00 0.00 ? 82  ASP A H    1  
ATOM 1333  H HA   . ASP A 1 82  ? 111.504 -4.468  -8.058  1.00 0.00 ? 82  ASP A HA   1  
ATOM 1334  H HB2  . ASP A 1 82  ? 113.653 -4.872  -8.984  1.00 0.00 ? 82  ASP A HB2  1  
ATOM 1335  H HB3  . ASP A 1 82  ? 113.718 -6.493  -8.309  1.00 0.00 ? 82  ASP A HB3  1  
ATOM 1336  N N    . PHE A 1 83  ? 109.772 -6.196  -7.976  1.00 0.00 ? 83  PHE A N    1  
ATOM 1337  C CA   . PHE A 1 83  ? 108.647 -7.099  -7.882  1.00 0.00 ? 83  PHE A CA   1  
ATOM 1338  C C    . PHE A 1 83  ? 108.901 -8.440  -8.563  1.00 0.00 ? 83  PHE A C    1  
ATOM 1339  O O    . PHE A 1 83  ? 108.545 -9.476  -8.018  1.00 0.00 ? 83  PHE A O    1  
ATOM 1340  C CB   . PHE A 1 83  ? 107.369 -6.439  -8.423  1.00 0.00 ? 83  PHE A CB   1  
ATOM 1341  C CG   . PHE A 1 83  ? 106.141 -7.294  -8.277  1.00 0.00 ? 83  PHE A CG   1  
ATOM 1342  C CD1  . PHE A 1 83  ? 105.518 -7.419  -7.049  1.00 0.00 ? 83  PHE A CD1  1  
ATOM 1343  C CD2  . PHE A 1 83  ? 105.613 -7.973  -9.367  1.00 0.00 ? 83  PHE A CD2  1  
ATOM 1344  C CE1  . PHE A 1 83  ? 104.396 -8.205  -6.904  1.00 0.00 ? 83  PHE A CE1  1  
ATOM 1345  C CE2  . PHE A 1 83  ? 104.490 -8.759  -9.227  1.00 0.00 ? 83  PHE A CE2  1  
ATOM 1346  C CZ   . PHE A 1 83  ? 103.881 -8.876  -7.995  1.00 0.00 ? 83  PHE A CZ   1  
ATOM 1347  H H    . PHE A 1 83  ? 109.615 -5.295  -8.337  1.00 0.00 ? 83  PHE A H    1  
ATOM 1348  H HA   . PHE A 1 83  ? 108.496 -7.292  -6.830  1.00 0.00 ? 83  PHE A HA   1  
ATOM 1349  H HB2  . PHE A 1 83  ? 107.195 -5.515  -7.892  1.00 0.00 ? 83  PHE A HB2  1  
ATOM 1350  H HB3  . PHE A 1 83  ? 107.504 -6.223  -9.472  1.00 0.00 ? 83  PHE A HB3  1  
ATOM 1351  H HD1  . PHE A 1 83  ? 105.918 -6.895  -6.194  1.00 0.00 ? 83  PHE A HD1  1  
ATOM 1352  H HD2  . PHE A 1 83  ? 106.090 -7.881  -10.332 1.00 0.00 ? 83  PHE A HD2  1  
ATOM 1353  H HE1  . PHE A 1 83  ? 103.920 -8.295  -5.939  1.00 0.00 ? 83  PHE A HE1  1  
ATOM 1354  H HE2  . PHE A 1 83  ? 104.089 -9.285  -10.081 1.00 0.00 ? 83  PHE A HE2  1  
ATOM 1355  H HZ   . PHE A 1 83  ? 103.001 -9.492  -7.882  1.00 0.00 ? 83  PHE A HZ   1  
ATOM 1356  N N    . HIS A 1 84  ? 109.533 -8.439  -9.726  1.00 0.00 ? 84  HIS A N    1  
ATOM 1357  C CA   . HIS A 1 84  ? 109.786 -9.706  -10.409 1.00 0.00 ? 84  HIS A CA   1  
ATOM 1358  C C    . HIS A 1 84  ? 110.786 -10.555 -9.622  1.00 0.00 ? 84  HIS A C    1  
ATOM 1359  O O    . HIS A 1 84  ? 110.637 -11.771 -9.530  1.00 0.00 ? 84  HIS A O    1  
ATOM 1360  C CB   . HIS A 1 84  ? 110.224 -9.517  -11.878 1.00 0.00 ? 84  HIS A CB   1  
ATOM 1361  C CG   . HIS A 1 84  ? 110.510 -10.819 -12.595 1.00 0.00 ? 84  HIS A CG   1  
ATOM 1362  N ND1  . HIS A 1 84  ? 109.529 -11.689 -13.002 1.00 0.00 ? 84  HIS A ND1  1  
ATOM 1363  C CD2  . HIS A 1 84  ? 111.683 -11.417 -12.912 1.00 0.00 ? 84  HIS A CD2  1  
ATOM 1364  C CE1  . HIS A 1 84  ? 110.082 -12.760 -13.523 1.00 0.00 ? 84  HIS A CE1  1  
ATOM 1365  N NE2  . HIS A 1 84  ? 111.385 -12.616 -13.483 1.00 0.00 ? 84  HIS A NE2  1  
ATOM 1366  H H    . HIS A 1 84  ? 109.834 -7.587  -10.110 1.00 0.00 ? 84  HIS A H    1  
ATOM 1367  H HA   . HIS A 1 84  ? 108.846 -10.242 -10.388 1.00 0.00 ? 84  HIS A HA   1  
ATOM 1368  H HB2  . HIS A 1 84  ? 109.441 -9.006  -12.418 1.00 0.00 ? 84  HIS A HB2  1  
ATOM 1369  H HB3  . HIS A 1 84  ? 111.124 -8.918  -11.902 1.00 0.00 ? 84  HIS A HB3  1  
ATOM 1370  H HD1  . HIS A 1 84  ? 108.552 -11.542 -12.944 1.00 0.00 ? 84  HIS A HD1  1  
ATOM 1371  H HD2  . HIS A 1 84  ? 112.673 -11.015 -12.745 1.00 0.00 ? 84  HIS A HD2  1  
ATOM 1372  H HE1  . HIS A 1 84  ? 109.561 -13.627 -13.900 1.00 0.00 ? 84  HIS A HE1  1  
ATOM 1373  H HE2  . HIS A 1 84  ? 112.022 -13.374 -13.513 1.00 0.00 ? 84  HIS A HE2  1  
ATOM 1374  N N    . THR A 1 85  ? 111.772 -9.909  -9.049  1.00 0.00 ? 85  THR A N    1  
ATOM 1375  C CA   . THR A 1 85  ? 112.755 -10.587 -8.235  1.00 0.00 ? 85  THR A CA   1  
ATOM 1376  C C    . THR A 1 85  ? 112.088 -11.219 -7.009  1.00 0.00 ? 85  THR A C    1  
ATOM 1377  O O    . THR A 1 85  ? 112.199 -12.431 -6.790  1.00 0.00 ? 85  THR A O    1  
ATOM 1378  C CB   . THR A 1 85  ? 113.864 -9.617  -7.784  1.00 0.00 ? 85  THR A CB   1  
ATOM 1379  O OG1  . THR A 1 85  ? 114.431 -8.986  -8.942  1.00 0.00 ? 85  THR A OG1  1  
ATOM 1380  C CG2  . THR A 1 85  ? 114.962 -10.358 -7.012  1.00 0.00 ? 85  THR A CG2  1  
ATOM 1381  H H    . THR A 1 85  ? 111.841 -8.937  -9.201  1.00 0.00 ? 85  THR A H    1  
ATOM 1382  H HA   . THR A 1 85  ? 113.199 -11.370 -8.834  1.00 0.00 ? 85  THR A HA   1  
ATOM 1383  H HB   . THR A 1 85  ? 113.426 -8.862  -7.147  1.00 0.00 ? 85  THR A HB   1  
ATOM 1384  H HG1  . THR A 1 85  ? 113.711 -8.545  -9.424  1.00 0.00 ? 85  THR A HG1  1  
ATOM 1385  H HG21 . THR A 1 85  ? 115.696 -9.658  -6.636  1.00 0.00 ? 85  THR A HG21 1  
ATOM 1386  H HG22 . THR A 1 85  ? 115.467 -11.074 -7.647  1.00 0.00 ? 85  THR A HG22 1  
ATOM 1387  H HG23 . THR A 1 85  ? 114.520 -10.871 -6.171  1.00 0.00 ? 85  THR A HG23 1  
ATOM 1388  N N    . LYS A 1 86  ? 111.346 -10.407 -6.248  1.00 0.00 ? 86  LYS A N    1  
ATOM 1389  C CA   . LYS A 1 86  ? 110.678 -10.887 -5.041  1.00 0.00 ? 86  LYS A CA   1  
ATOM 1390  C C    . LYS A 1 86  ? 109.649 -11.959 -5.372  1.00 0.00 ? 86  LYS A C    1  
ATOM 1391  O O    . LYS A 1 86  ? 109.448 -12.877 -4.594  1.00 0.00 ? 86  LYS A O    1  
ATOM 1392  C CB   . LYS A 1 86  ? 110.051 -9.737  -4.238  1.00 0.00 ? 86  LYS A CB   1  
ATOM 1393  C CG   . LYS A 1 86  ? 108.958 -8.981  -4.961  1.00 0.00 ? 86  LYS A CG   1  
ATOM 1394  C CD   . LYS A 1 86  ? 108.446 -7.804  -4.164  1.00 0.00 ? 86  LYS A CD   1  
ATOM 1395  C CE   . LYS A 1 86  ? 107.772 -8.227  -2.870  1.00 0.00 ? 86  LYS A CE   1  
ATOM 1396  N NZ   . LYS A 1 86  ? 107.273 -7.054  -2.145  1.00 0.00 ? 86  LYS A NZ   1  
ATOM 1397  H H    . LYS A 1 86  ? 111.255 -9.464  -6.516  1.00 0.00 ? 86  LYS A H    1  
ATOM 1398  H HA   . LYS A 1 86  ? 111.444 -11.354 -4.439  1.00 0.00 ? 86  LYS A HA   1  
ATOM 1399  H HB2  . LYS A 1 86  ? 109.640 -10.127 -3.318  1.00 0.00 ? 86  LYS A HB2  1  
ATOM 1400  H HB3  . LYS A 1 86  ? 110.838 -9.039  -4.001  1.00 0.00 ? 86  LYS A HB3  1  
ATOM 1401  H HG2  . LYS A 1 86  ? 109.352 -8.615  -5.899  1.00 0.00 ? 86  LYS A HG2  1  
ATOM 1402  H HG3  . LYS A 1 86  ? 108.139 -9.658  -5.157  1.00 0.00 ? 86  LYS A HG3  1  
ATOM 1403  H HD2  . LYS A 1 86  ? 109.278 -7.158  -3.923  1.00 0.00 ? 86  LYS A HD2  1  
ATOM 1404  H HD3  . LYS A 1 86  ? 107.736 -7.260  -4.768  1.00 0.00 ? 86  LYS A HD3  1  
ATOM 1405  H HE2  . LYS A 1 86  ? 106.944 -8.880  -3.103  1.00 0.00 ? 86  LYS A HE2  1  
ATOM 1406  H HE3  . LYS A 1 86  ? 108.487 -8.750  -2.252  1.00 0.00 ? 86  LYS A HE3  1  
ATOM 1407  H HZ1  . LYS A 1 86  ? 106.766 -7.291  -1.265  1.00 0.00 ? 86  LYS A HZ1  1  
ATOM 1408  H HZ2  . LYS A 1 86  ? 106.605 -6.532  -2.756  1.00 0.00 ? 86  LYS A HZ2  1  
ATOM 1409  H HZ3  . LYS A 1 86  ? 108.047 -6.390  -1.928  1.00 0.00 ? 86  LYS A HZ3  1  
ATOM 1410  N N    . GLU A 1 87  ? 109.029 -11.847 -6.544  1.00 0.00 ? 87  GLU A N    1  
ATOM 1411  C CA   . GLU A 1 87  ? 108.091 -12.848 -7.026  1.00 0.00 ? 87  GLU A CA   1  
ATOM 1412  C C    . GLU A 1 87  ? 108.769 -14.206 -7.085  1.00 0.00 ? 87  GLU A C    1  
ATOM 1413  O O    . GLU A 1 87  ? 108.301 -15.172 -6.480  1.00 0.00 ? 87  GLU A O    1  
ATOM 1414  C CB   . GLU A 1 87  ? 107.549 -12.479 -8.408  1.00 0.00 ? 87  GLU A CB   1  
ATOM 1415  C CG   . GLU A 1 87  ? 106.643 -13.538 -9.006  1.00 0.00 ? 87  GLU A CG   1  
ATOM 1416  C CD   . GLU A 1 87  ? 106.123 -13.164 -10.357 1.00 0.00 ? 87  GLU A CD   1  
ATOM 1417  O OE1  . GLU A 1 87  ? 106.812 -13.433 -11.370 1.00 0.00 ? 87  GLU A OE1  1  
ATOM 1418  O OE2  . GLU A 1 87  ? 105.006 -12.608 -10.439 1.00 0.00 ? 87  GLU A OE2  1  
ATOM 1419  H H    . GLU A 1 87  ? 109.193 -11.042 -7.086  1.00 0.00 ? 87  GLU A H    1  
ATOM 1420  H HA   . GLU A 1 87  ? 107.271 -12.899 -6.325  1.00 0.00 ? 87  GLU A HA   1  
ATOM 1421  H HB2  . GLU A 1 87  ? 106.991 -11.557 -8.329  1.00 0.00 ? 87  GLU A HB2  1  
ATOM 1422  H HB3  . GLU A 1 87  ? 108.383 -12.325 -9.077  1.00 0.00 ? 87  GLU A HB3  1  
ATOM 1423  H HG2  . GLU A 1 87  ? 107.207 -14.455 -9.101  1.00 0.00 ? 87  GLU A HG2  1  
ATOM 1424  H HG3  . GLU A 1 87  ? 105.810 -13.697 -8.339  1.00 0.00 ? 87  GLU A HG3  1  
ATOM 1425  N N    . VAL A 1 88  ? 109.897 -14.273 -7.754  1.00 0.00 ? 88  VAL A N    1  
ATOM 1426  C CA   . VAL A 1 88  ? 110.609 -15.526 -7.885  1.00 0.00 ? 88  VAL A CA   1  
ATOM 1427  C C    . VAL A 1 88  ? 111.073 -16.025 -6.503  1.00 0.00 ? 88  VAL A C    1  
ATOM 1428  O O    . VAL A 1 88  ? 111.016 -17.225 -6.214  1.00 0.00 ? 88  VAL A O    1  
ATOM 1429  C CB   . VAL A 1 88  ? 111.800 -15.425 -8.869  1.00 0.00 ? 88  VAL A CB   1  
ATOM 1430  C CG1  . VAL A 1 88  ? 112.420 -16.791 -9.082  1.00 0.00 ? 88  VAL A CG1  1  
ATOM 1431  C CG2  . VAL A 1 88  ? 111.345 -14.837 -10.203 1.00 0.00 ? 88  VAL A CG2  1  
ATOM 1432  H H    . VAL A 1 88  ? 110.257 -13.460 -8.173  1.00 0.00 ? 88  VAL A H    1  
ATOM 1433  H HA   . VAL A 1 88  ? 109.897 -16.245 -8.266  1.00 0.00 ? 88  VAL A HA   1  
ATOM 1434  H HB   . VAL A 1 88  ? 112.548 -14.772 -8.443  1.00 0.00 ? 88  VAL A HB   1  
ATOM 1435  H HG11 . VAL A 1 88  ? 112.789 -17.163 -8.138  1.00 0.00 ? 88  VAL A HG11 1  
ATOM 1436  H HG12 . VAL A 1 88  ? 113.221 -16.731 -9.802  1.00 0.00 ? 88  VAL A HG12 1  
ATOM 1437  H HG13 . VAL A 1 88  ? 111.643 -17.451 -9.442  1.00 0.00 ? 88  VAL A HG13 1  
ATOM 1438  H HG21 . VAL A 1 88  ? 110.581 -15.464 -10.638 1.00 0.00 ? 88  VAL A HG21 1  
ATOM 1439  H HG22 . VAL A 1 88  ? 112.182 -14.775 -10.882 1.00 0.00 ? 88  VAL A HG22 1  
ATOM 1440  H HG23 . VAL A 1 88  ? 110.942 -13.848 -10.044 1.00 0.00 ? 88  VAL A HG23 1  
ATOM 1441  N N    . ILE A 1 89  ? 111.455 -15.088 -5.636  1.00 0.00 ? 89  ILE A N    1  
ATOM 1442  C CA   . ILE A 1 89  ? 111.851 -15.425 -4.271  1.00 0.00 ? 89  ILE A CA   1  
ATOM 1443  C C    . ILE A 1 89  ? 110.668 -16.052 -3.522  1.00 0.00 ? 89  ILE A C    1  
ATOM 1444  O O    . ILE A 1 89  ? 110.796 -17.125 -2.976  1.00 0.00 ? 89  ILE A O    1  
ATOM 1445  C CB   . ILE A 1 89  ? 112.360 -14.190 -3.471  1.00 0.00 ? 89  ILE A CB   1  
ATOM 1446  C CG1  . ILE A 1 89  ? 113.532 -13.521 -4.196  1.00 0.00 ? 89  ILE A CG1  1  
ATOM 1447  C CG2  . ILE A 1 89  ? 112.777 -14.596 -2.049  1.00 0.00 ? 89  ILE A CG2  1  
ATOM 1448  C CD1  . ILE A 1 89  ? 114.046 -12.277 -3.502  1.00 0.00 ? 89  ILE A CD1  1  
ATOM 1449  H H    . ILE A 1 89  ? 111.480 -14.152 -5.937  1.00 0.00 ? 89  ILE A H    1  
ATOM 1450  H HA   . ILE A 1 89  ? 112.643 -16.157 -4.334  1.00 0.00 ? 89  ILE A HA   1  
ATOM 1451  H HB   . ILE A 1 89  ? 111.546 -13.484 -3.391  1.00 0.00 ? 89  ILE A HB   1  
ATOM 1452  H HG12 . ILE A 1 89  ? 114.351 -14.221 -4.267  1.00 0.00 ? 89  ILE A HG12 1  
ATOM 1453  H HG13 . ILE A 1 89  ? 113.216 -13.242 -5.191  1.00 0.00 ? 89  ILE A HG13 1  
ATOM 1454  H HG21 . ILE A 1 89  ? 113.076 -13.709 -1.508  1.00 0.00 ? 89  ILE A HG21 1  
ATOM 1455  H HG22 . ILE A 1 89  ? 113.603 -15.292 -2.089  1.00 0.00 ? 89  ILE A HG22 1  
ATOM 1456  H HG23 . ILE A 1 89  ? 111.939 -15.052 -1.543  1.00 0.00 ? 89  ILE A HG23 1  
ATOM 1457  H HD11 . ILE A 1 89  ? 114.753 -11.754 -4.129  1.00 0.00 ? 89  ILE A HD11 1  
ATOM 1458  H HD12 . ILE A 1 89  ? 114.546 -12.583 -2.594  1.00 0.00 ? 89  ILE A HD12 1  
ATOM 1459  H HD13 . ILE A 1 89  ? 113.219 -11.630 -3.234  1.00 0.00 ? 89  ILE A HD13 1  
ATOM 1460  N N    . THR A 1 90  ? 109.508 -15.396 -3.561  1.00 0.00 ? 90  THR A N    1  
ATOM 1461  C CA   . THR A 1 90  ? 108.312 -15.884 -2.857  1.00 0.00 ? 90  THR A CA   1  
ATOM 1462  C C    . THR A 1 90  ? 107.899 -17.304 -3.322  1.00 0.00 ? 90  THR A C    1  
ATOM 1463  O O    . THR A 1 90  ? 107.376 -18.104 -2.543  1.00 0.00 ? 90  THR A O    1  
ATOM 1464  C CB   . THR A 1 90  ? 107.101 -14.898 -2.987  1.00 0.00 ? 90  THR A CB   1  
ATOM 1465  O OG1  . THR A 1 90  ? 106.757 -14.683 -4.365  1.00 0.00 ? 90  THR A OG1  1  
ATOM 1466  C CG2  . THR A 1 90  ? 107.398 -13.549 -2.342  1.00 0.00 ? 90  THR A CG2  1  
ATOM 1467  H H    . THR A 1 90  ? 109.463 -14.542 -4.049  1.00 0.00 ? 90  THR A H    1  
ATOM 1468  H HA   . THR A 1 90  ? 108.583 -15.954 -1.812  1.00 0.00 ? 90  THR A HA   1  
ATOM 1469  H HB   . THR A 1 90  ? 106.253 -15.343 -2.488  1.00 0.00 ? 90  THR A HB   1  
ATOM 1470  H HG1  . THR A 1 90  ? 107.554 -14.686 -4.909  1.00 0.00 ? 90  THR A HG1  1  
ATOM 1471  H HG21 . THR A 1 90  ? 107.609 -13.691 -1.292  1.00 0.00 ? 90  THR A HG21 1  
ATOM 1472  H HG22 . THR A 1 90  ? 106.542 -12.900 -2.455  1.00 0.00 ? 90  THR A HG22 1  
ATOM 1473  H HG23 . THR A 1 90  ? 108.254 -13.101 -2.824  1.00 0.00 ? 90  THR A HG23 1  
ATOM 1474  N N    . ASN A 1 91  ? 108.187 -17.623 -4.579  1.00 0.00 ? 91  ASN A N    1  
ATOM 1475  C CA   . ASN A 1 91  ? 107.834 -18.931 -5.134  1.00 0.00 ? 91  ASN A CA   1  
ATOM 1476  C C    . ASN A 1 91  ? 108.897 -19.981 -4.870  1.00 0.00 ? 91  ASN A C    1  
ATOM 1477  O O    . ASN A 1 91  ? 108.605 -21.170 -4.858  1.00 0.00 ? 91  ASN A O    1  
ATOM 1478  C CB   . ASN A 1 91  ? 107.566 -18.866 -6.646  1.00 0.00 ? 91  ASN A CB   1  
ATOM 1479  C CG   . ASN A 1 91  ? 106.286 -18.151 -7.013  1.00 0.00 ? 91  ASN A CG   1  
ATOM 1480  O OD1  . ASN A 1 91  ? 105.220 -18.760 -7.081  1.00 0.00 ? 91  ASN A OD1  1  
ATOM 1481  N ND2  . ASN A 1 91  ? 106.372 -16.881 -7.266  1.00 0.00 ? 91  ASN A ND2  1  
ATOM 1482  H H    . ASN A 1 91  ? 108.639 -16.956 -5.139  1.00 0.00 ? 91  ASN A H    1  
ATOM 1483  H HA   . ASN A 1 91  ? 106.923 -19.246 -4.647  1.00 0.00 ? 91  ASN A HA   1  
ATOM 1484  H HB2  . ASN A 1 91  ? 108.385 -18.348 -7.123  1.00 0.00 ? 91  ASN A HB2  1  
ATOM 1485  H HB3  . ASN A 1 91  ? 107.520 -19.873 -7.033  1.00 0.00 ? 91  ASN A HB3  1  
ATOM 1486  H HD21 . ASN A 1 91  ? 107.245 -16.434 -7.210  1.00 0.00 ? 91  ASN A HD21 1  
ATOM 1487  H HD22 . ASN A 1 91  ? 105.568 -16.369 -7.505  1.00 0.00 ? 91  ASN A HD22 1  
ATOM 1488  N N    . SER A 1 92  ? 110.115 -19.562 -4.651  1.00 0.00 ? 92  SER A N    1  
ATOM 1489  C CA   . SER A 1 92  ? 111.188 -20.512 -4.506  1.00 0.00 ? 92  SER A CA   1  
ATOM 1490  C C    . SER A 1 92  ? 111.853 -20.428 -3.129  1.00 0.00 ? 92  SER A C    1  
ATOM 1491  O O    . SER A 1 92  ? 112.882 -21.046 -2.905  1.00 0.00 ? 92  SER A O    1  
ATOM 1492  C CB   . SER A 1 92  ? 112.214 -20.313 -5.640  1.00 0.00 ? 92  SER A CB   1  
ATOM 1493  O OG   . SER A 1 92  ? 113.236 -21.315 -5.622  1.00 0.00 ? 92  SER A OG   1  
ATOM 1494  H H    . SER A 1 92  ? 110.311 -18.602 -4.598  1.00 0.00 ? 92  SER A H    1  
ATOM 1495  H HA   . SER A 1 92  ? 110.760 -21.497 -4.615  1.00 0.00 ? 92  SER A HA   1  
ATOM 1496  H HB2  . SER A 1 92  ? 111.703 -20.361 -6.591  1.00 0.00 ? 92  SER A HB2  1  
ATOM 1497  H HB3  . SER A 1 92  ? 112.675 -19.343 -5.533  1.00 0.00 ? 92  SER A HB3  1  
ATOM 1498  H HG   . SER A 1 92  ? 113.565 -21.351 -4.711  1.00 0.00 ? 92  SER A HG   1  
ATOM 1499  N N    . ILE A 1 93  ? 111.247 -19.716 -2.202  1.00 0.00 ? 93  ILE A N    1  
ATOM 1500  C CA   . ILE A 1 93  ? 111.815 -19.588 -0.855  1.00 0.00 ? 93  ILE A CA   1  
ATOM 1501  C C    . ILE A 1 93  ? 111.577 -20.897 -0.095  1.00 0.00 ? 93  ILE A C    1  
ATOM 1502  O O    . ILE A 1 93  ? 112.253 -21.216 0.879   1.00 0.00 ? 93  ILE A O    1  
ATOM 1503  C CB   . ILE A 1 93  ? 111.219 -18.371 -0.075  1.00 0.00 ? 93  ILE A CB   1  
ATOM 1504  C CG1  . ILE A 1 93  ? 111.960 -18.139 1.254   1.00 0.00 ? 93  ILE A CG1  1  
ATOM 1505  C CG2  . ILE A 1 93  ? 109.731 -18.549 0.161   1.00 0.00 ? 93  ILE A CG2  1  
ATOM 1506  C CD1  . ILE A 1 93  ? 113.412 -17.703 1.096   1.00 0.00 ? 93  ILE A CD1  1  
ATOM 1507  H H    . ILE A 1 93  ? 110.416 -19.245 -2.428  1.00 0.00 ? 93  ILE A H    1  
ATOM 1508  H HA   . ILE A 1 93  ? 112.882 -19.460 -0.973  1.00 0.00 ? 93  ILE A HA   1  
ATOM 1509  H HB   . ILE A 1 93  ? 111.344 -17.496 -0.697  1.00 0.00 ? 93  ILE A HB   1  
ATOM 1510  H HG12 . ILE A 1 93  ? 111.447 -17.369 1.810   1.00 0.00 ? 93  ILE A HG12 1  
ATOM 1511  H HG13 . ILE A 1 93  ? 111.946 -19.057 1.825   1.00 0.00 ? 93  ILE A HG13 1  
ATOM 1512  H HG21 . ILE A 1 93  ? 109.342 -17.725 0.742   1.00 0.00 ? 93  ILE A HG21 1  
ATOM 1513  H HG22 . ILE A 1 93  ? 109.566 -19.488 0.668   1.00 0.00 ? 93  ILE A HG22 1  
ATOM 1514  H HG23 . ILE A 1 93  ? 109.231 -18.590 -0.795  1.00 0.00 ? 93  ILE A HG23 1  
ATOM 1515  H HD11 . ILE A 1 93  ? 113.933 -18.373 0.430   1.00 0.00 ? 93  ILE A HD11 1  
ATOM 1516  H HD12 . ILE A 1 93  ? 113.898 -17.762 2.061   1.00 0.00 ? 93  ILE A HD12 1  
ATOM 1517  H HD13 . ILE A 1 93  ? 113.467 -16.686 0.730   1.00 0.00 ? 93  ILE A HD13 1  
ATOM 1518  N N    . THR A 1 94  ? 110.586 -21.639 -0.564  1.00 0.00 ? 94  THR A N    1  
ATOM 1519  C CA   . THR A 1 94  ? 110.312 -22.970 -0.087  1.00 0.00 ? 94  THR A CA   1  
ATOM 1520  C C    . THR A 1 94  ? 111.523 -23.893 -0.373  1.00 0.00 ? 94  THR A C    1  
ATOM 1521  O O    . THR A 1 94  ? 111.807 -24.817 0.390   1.00 0.00 ? 94  THR A O    1  
ATOM 1522  C CB   . THR A 1 94  ? 109.009 -23.535 -0.750  1.00 0.00 ? 94  THR A CB   1  
ATOM 1523  O OG1  . THR A 1 94  ? 108.728 -24.866 -0.289  1.00 0.00 ? 94  THR A OG1  1  
ATOM 1524  C CG2  . THR A 1 94  ? 109.103 -23.522 -2.275  1.00 0.00 ? 94  THR A CG2  1  
ATOM 1525  H H    . THR A 1 94  ? 109.989 -21.235 -1.231  1.00 0.00 ? 94  THR A H    1  
ATOM 1526  H HA   . THR A 1 94  ? 110.164 -22.914 0.982   1.00 0.00 ? 94  THR A HA   1  
ATOM 1527  H HB   . THR A 1 94  ? 108.189 -22.899 -0.448  1.00 0.00 ? 94  THR A HB   1  
ATOM 1528  H HG1  . THR A 1 94  ? 108.832 -24.834 0.679   1.00 0.00 ? 94  THR A HG1  1  
ATOM 1529  H HG21 . THR A 1 94  ? 109.927 -24.145 -2.589  1.00 0.00 ? 94  THR A HG21 1  
ATOM 1530  H HG22 . THR A 1 94  ? 109.273 -22.509 -2.610  1.00 0.00 ? 94  THR A HG22 1  
ATOM 1531  H HG23 . THR A 1 94  ? 108.182 -23.896 -2.701  1.00 0.00 ? 94  THR A HG23 1  
ATOM 1532  N N    . GLN A 1 95  ? 112.274 -23.576 -1.431  1.00 0.00 ? 95  GLN A N    1  
ATOM 1533  C CA   . GLN A 1 95  ? 113.441 -24.335 -1.835  1.00 0.00 ? 95  GLN A CA   1  
ATOM 1534  C C    . GLN A 1 95  ? 114.651 -23.391 -1.912  1.00 0.00 ? 95  GLN A C    1  
ATOM 1535  O O    . GLN A 1 95  ? 115.108 -23.026 -3.019  1.00 0.00 ? 95  GLN A O    1  
ATOM 1536  C CB   . GLN A 1 95  ? 113.225 -24.979 -3.208  1.00 0.00 ? 95  GLN A CB   1  
ATOM 1537  C CG   . GLN A 1 95  ? 112.058 -25.939 -3.304  1.00 0.00 ? 95  GLN A CG   1  
ATOM 1538  C CD   . GLN A 1 95  ? 111.906 -26.494 -4.702  1.00 0.00 ? 95  GLN A CD   1  
ATOM 1539  O OE1  . GLN A 1 95  ? 112.244 -25.834 -5.687  1.00 0.00 ? 95  GLN A OE1  1  
ATOM 1540  N NE2  . GLN A 1 95  ? 111.464 -27.709 -4.813  1.00 0.00 ? 95  GLN A NE2  1  
ATOM 1541  H H    . GLN A 1 95  ? 112.079 -22.761 -1.936  1.00 0.00 ? 95  GLN A H    1  
ATOM 1542  H HA   . GLN A 1 95  ? 113.627 -25.103 -1.099  1.00 0.00 ? 95  GLN A HA   1  
ATOM 1543  H HB2  . GLN A 1 95  ? 113.068 -24.196 -3.934  1.00 0.00 ? 95  GLN A HB2  1  
ATOM 1544  H HB3  . GLN A 1 95  ? 114.125 -25.515 -3.474  1.00 0.00 ? 95  GLN A HB3  1  
ATOM 1545  H HG2  . GLN A 1 95  ? 112.219 -26.755 -2.617  1.00 0.00 ? 95  GLN A HG2  1  
ATOM 1546  H HG3  . GLN A 1 95  ? 111.151 -25.415 -3.039  1.00 0.00 ? 95  GLN A HG3  1  
ATOM 1547  H HE21 . GLN A 1 95  ? 111.258 -28.217 -3.993  1.00 0.00 ? 95  GLN A HE21 1  
ATOM 1548  H HE22 . GLN A 1 95  ? 111.339 -28.081 -5.708  1.00 0.00 ? 95  GLN A HE22 1  
ATOM 1549  N N    . PRO A 1 96  ? 115.151 -22.928 -0.767  1.00 0.00 ? 96  PRO A N    1  
ATOM 1550  C CA   . PRO A 1 96  ? 116.231 -21.976 -0.730  1.00 0.00 ? 96  PRO A CA   1  
ATOM 1551  C C    . PRO A 1 96  ? 117.583 -22.573 -1.099  1.00 0.00 ? 96  PRO A C    1  
ATOM 1552  O O    . PRO A 1 96  ? 117.861 -23.774 -0.884  1.00 0.00 ? 96  PRO A O    1  
ATOM 1553  C CB   . PRO A 1 96  ? 116.231 -21.487 0.710   1.00 0.00 ? 96  PRO A CB   1  
ATOM 1554  C CG   . PRO A 1 96  ? 115.704 -22.631 1.479   1.00 0.00 ? 96  PRO A CG   1  
ATOM 1555  C CD   . PRO A 1 96  ? 114.701 -23.288 0.586   1.00 0.00 ? 96  PRO A CD   1  
ATOM 1556  H HA   . PRO A 1 96  ? 116.032 -21.139 -1.384  1.00 0.00 ? 96  PRO A HA   1  
ATOM 1557  H HB2  . PRO A 1 96  ? 117.236 -21.223 1.007   1.00 0.00 ? 96  PRO A HB2  1  
ATOM 1558  H HB3  . PRO A 1 96  ? 115.588 -20.624 0.799   1.00 0.00 ? 96  PRO A HB3  1  
ATOM 1559  H HG2  . PRO A 1 96  ? 116.508 -23.315 1.712   1.00 0.00 ? 96  PRO A HG2  1  
ATOM 1560  H HG3  . PRO A 1 96  ? 115.231 -22.282 2.385   1.00 0.00 ? 96  PRO A HG3  1  
ATOM 1561  H HD2  . PRO A 1 96  ? 114.686 -24.360 0.708   1.00 0.00 ? 96  PRO A HD2  1  
ATOM 1562  H HD3  . PRO A 1 96  ? 113.718 -22.879 0.770   1.00 0.00 ? 96  PRO A HD3  1  
ATOM 1563  N N    . THR A 1 97  ? 118.383 -21.726 -1.627  1.00 0.00 ? 97  THR A N    1  
ATOM 1564  C CA   . THR A 1 97  ? 119.715 -21.982 -2.053  1.00 0.00 ? 97  THR A CA   1  
ATOM 1565  C C    . THR A 1 97  ? 120.607 -21.062 -1.286  1.00 0.00 ? 97  THR A C    1  
ATOM 1566  O O    . THR A 1 97  ? 120.098 -20.145 -0.643  1.00 0.00 ? 97  THR A O    1  
ATOM 1567  C CB   . THR A 1 97  ? 119.838 -21.729 -3.567  1.00 0.00 ? 97  THR A CB   1  
ATOM 1568  O OG1  . THR A 1 97  ? 119.137 -20.498 -3.929  1.00 0.00 ? 97  THR A OG1  1  
ATOM 1569  C CG2  . THR A 1 97  ? 119.263 -22.892 -4.332  1.00 0.00 ? 97  THR A CG2  1  
ATOM 1570  H H    . THR A 1 97  ? 118.074 -20.797 -1.718  1.00 0.00 ? 97  THR A H    1  
ATOM 1571  H HA   . THR A 1 97  ? 120.022 -22.993 -1.824  1.00 0.00 ? 97  THR A HA   1  
ATOM 1572  H HB   . THR A 1 97  ? 120.884 -21.620 -3.812  1.00 0.00 ? 97  THR A HB   1  
ATOM 1573  H HG1  . THR A 1 97  ? 119.710 -20.006 -4.543  1.00 0.00 ? 97  THR A HG1  1  
ATOM 1574  H HG21 . THR A 1 97  ? 118.219 -23.000 -4.078  1.00 0.00 ? 97  THR A HG21 1  
ATOM 1575  H HG22 . THR A 1 97  ? 119.800 -23.778 -4.027  1.00 0.00 ? 97  THR A HG22 1  
ATOM 1576  H HG23 . THR A 1 97  ? 119.378 -22.734 -5.393  1.00 0.00 ? 97  THR A HG23 1  
ATOM 1577  N N    . LEU A 1 98  ? 121.905 -21.280 -1.392  1.00 0.00 ? 98  LEU A N    1  
ATOM 1578  C CA   . LEU A 1 98  ? 122.946 -20.578 -0.613  1.00 0.00 ? 98  LEU A CA   1  
ATOM 1579  C C    . LEU A 1 98  ? 122.732 -19.056 -0.566  1.00 0.00 ? 98  LEU A C    1  
ATOM 1580  O O    . LEU A 1 98  ? 123.039 -18.410 0.420   1.00 0.00 ? 98  LEU A O    1  
ATOM 1581  C CB   . LEU A 1 98  ? 124.310 -20.914 -1.192  1.00 0.00 ? 98  LEU A CB   1  
ATOM 1582  C CG   . LEU A 1 98  ? 125.428 -21.014 -0.185  1.00 0.00 ? 98  LEU A CG   1  
ATOM 1583  C CD1  . LEU A 1 98  ? 125.099 -22.123 0.796   1.00 0.00 ? 98  LEU A CD1  1  
ATOM 1584  C CD2  . LEU A 1 98  ? 126.740 -21.299 -0.887  1.00 0.00 ? 98  LEU A CD2  1  
ATOM 1585  H H    . LEU A 1 98  ? 122.190 -21.977 -2.026  1.00 0.00 ? 98  LEU A H    1  
ATOM 1586  H HA   . LEU A 1 98  ? 122.899 -20.943 0.403   1.00 0.00 ? 98  LEU A HA   1  
ATOM 1587  H HB2  . LEU A 1 98  ? 124.235 -21.858 -1.711  1.00 0.00 ? 98  LEU A HB2  1  
ATOM 1588  H HB3  . LEU A 1 98  ? 124.572 -20.150 -1.909  1.00 0.00 ? 98  LEU A HB3  1  
ATOM 1589  H HG   . LEU A 1 98  ? 125.515 -20.085 0.357   1.00 0.00 ? 98  LEU A HG   1  
ATOM 1590  H HD11 . LEU A 1 98  ? 125.015 -23.063 0.268   1.00 0.00 ? 98  LEU A HD11 1  
ATOM 1591  H HD12 . LEU A 1 98  ? 124.138 -21.912 1.245   1.00 0.00 ? 98  LEU A HD12 1  
ATOM 1592  H HD13 . LEU A 1 98  ? 125.862 -22.194 1.557   1.00 0.00 ? 98  LEU A HD13 1  
ATOM 1593  H HD21 . LEU A 1 98  ? 126.963 -20.493 -1.571  1.00 0.00 ? 98  LEU A HD21 1  
ATOM 1594  H HD22 . LEU A 1 98  ? 126.654 -22.223 -1.438  1.00 0.00 ? 98  LEU A HD22 1  
ATOM 1595  H HD23 . LEU A 1 98  ? 127.530 -21.383 -0.156  1.00 0.00 ? 98  LEU A HD23 1  
ATOM 1596  N N    . HIS A 1 99  ? 122.249 -18.503 -1.647  1.00 0.00 ? 99  HIS A N    1  
ATOM 1597  C CA   . HIS A 1 99  ? 121.785 -17.146 -1.671  1.00 0.00 ? 99  HIS A CA   1  
ATOM 1598  C C    . HIS A 1 99  ? 120.695 -16.970 -2.669  1.00 0.00 ? 99  HIS A C    1  
ATOM 1599  O O    . HIS A 1 99  ? 120.910 -16.558 -3.773  1.00 0.00 ? 99  HIS A O    1  
ATOM 1600  C CB   . HIS A 1 99  ? 122.890 -16.029 -1.692  1.00 0.00 ? 99  HIS A CB   1  
ATOM 1601  C CG   . HIS A 1 99  ? 123.857 -16.000 -2.847  1.00 0.00 ? 99  HIS A CG   1  
ATOM 1602  N ND1  . HIS A 1 99  ? 124.799 -15.007 -2.989  1.00 0.00 ? 99  HIS A ND1  1  
ATOM 1603  C CD2  . HIS A 1 99  ? 124.031 -16.822 -3.908  1.00 0.00 ? 99  HIS A CD2  1  
ATOM 1604  C CE1  . HIS A 1 99  ? 125.495 -15.213 -4.077  1.00 0.00 ? 99  HIS A CE1  1  
ATOM 1605  N NE2  . HIS A 1 99  ? 125.052 -16.303 -4.650  1.00 0.00 ? 99  HIS A NE2  1  
ATOM 1606  H H    . HIS A 1 99  ? 122.203 -19.053 -2.466  1.00 0.00 ? 99  HIS A H    1  
ATOM 1607  H HA   . HIS A 1 99  ? 121.190 -17.010 -0.780  1.00 0.00 ? 99  HIS A HA   1  
ATOM 1608  H HB2  . HIS A 1 99  ? 122.399 -15.068 -1.686  1.00 0.00 ? 99  HIS A HB2  1  
ATOM 1609  H HB3  . HIS A 1 99  ? 123.462 -16.115 -0.780  1.00 0.00 ? 99  HIS A HB3  1  
ATOM 1610  H HD1  . HIS A 1 99  ? 124.963 -14.248 -2.363  1.00 0.00 ? 99  HIS A HD1  1  
ATOM 1611  H HD2  . HIS A 1 99  ? 123.469 -17.720 -4.125  1.00 0.00 ? 99  HIS A HD2  1  
ATOM 1612  H HE1  . HIS A 1 99  ? 126.301 -14.591 -4.438  1.00 0.00 ? 99  HIS A HE1  1  
ATOM 1613  H HE2  . HIS A 1 99  ? 125.370 -16.639 -5.526  1.00 0.00 ? 99  HIS A HE2  1  
ATOM 1614  N N    . SER A 1 100 ? 119.494 -17.358 -2.251  1.00 0.00 ? 100 SER A N    1  
ATOM 1615  C CA   . SER A 1 100 ? 118.265 -17.230 -3.043  1.00 0.00 ? 100 SER A CA   1  
ATOM 1616  C C    . SER A 1 100 ? 117.926 -15.769 -3.317  1.00 0.00 ? 100 SER A C    1  
ATOM 1617  O O    . SER A 1 100 ? 117.058 -15.451 -4.123  1.00 0.00 ? 100 SER A O    1  
ATOM 1618  C CB   . SER A 1 100 ? 117.129 -17.920 -2.296  1.00 0.00 ? 100 SER A CB   1  
ATOM 1619  O OG   . SER A 1 100 ? 117.456 -19.267 -2.133  1.00 0.00 ? 100 SER A OG   1  
ATOM 1620  H H    . SER A 1 100 ? 119.422 -17.799 -1.375  1.00 0.00 ? 100 SER A H    1  
ATOM 1621  H HA   . SER A 1 100 ? 118.420 -17.739 -3.981  1.00 0.00 ? 100 SER A HA   1  
ATOM 1622  H HB2  . SER A 1 100 ? 117.002 -17.497 -1.306  1.00 0.00 ? 100 SER A HB2  1  
ATOM 1623  H HB3  . SER A 1 100 ? 116.208 -17.849 -2.854  1.00 0.00 ? 100 SER A HB3  1  
ATOM 1624  H HG   . SER A 1 100 ? 118.035 -19.498 -2.876  1.00 0.00 ? 100 SER A HG   1  
ATOM 1625  N N    . PHE A 1 101 ? 118.634 -14.901 -2.652  1.00 0.00 ? 101 PHE A N    1  
ATOM 1626  C CA   . PHE A 1 101 ? 118.470 -13.494 -2.808  1.00 0.00 ? 101 PHE A CA   1  
ATOM 1627  C C    . PHE A 1 101 ? 119.553 -12.974 -3.744  1.00 0.00 ? 101 PHE A C    1  
ATOM 1628  O O    . PHE A 1 101 ? 119.741 -11.789 -3.852  1.00 0.00 ? 101 PHE A O    1  
ATOM 1629  C CB   . PHE A 1 101 ? 118.606 -12.812 -1.452  1.00 0.00 ? 101 PHE A CB   1  
ATOM 1630  C CG   . PHE A 1 101 ? 117.849 -13.496 -0.357  1.00 0.00 ? 101 PHE A CG   1  
ATOM 1631  C CD1  . PHE A 1 101 ? 116.498 -13.282 -0.175  1.00 0.00 ? 101 PHE A CD1  1  
ATOM 1632  C CD2  . PHE A 1 101 ? 118.502 -14.376 0.489   1.00 0.00 ? 101 PHE A CD2  1  
ATOM 1633  C CE1  . PHE A 1 101 ? 115.820 -13.933 0.833   1.00 0.00 ? 101 PHE A CE1  1  
ATOM 1634  C CE2  . PHE A 1 101 ? 117.827 -15.021 1.486   1.00 0.00 ? 101 PHE A CE2  1  
ATOM 1635  C CZ   . PHE A 1 101 ? 116.488 -14.796 1.655   1.00 0.00 ? 101 PHE A CZ   1  
ATOM 1636  H H    . PHE A 1 101 ? 119.294 -15.236 -2.012  1.00 0.00 ? 101 PHE A H    1  
ATOM 1637  H HA   . PHE A 1 101 ? 117.490 -13.290 -3.212  1.00 0.00 ? 101 PHE A HA   1  
ATOM 1638  H HB2  . PHE A 1 101 ? 119.648 -12.790 -1.169  1.00 0.00 ? 101 PHE A HB2  1  
ATOM 1639  H HB3  . PHE A 1 101 ? 118.241 -11.799 -1.532  1.00 0.00 ? 101 PHE A HB3  1  
ATOM 1640  H HD1  . PHE A 1 101 ? 115.966 -12.602 -0.824  1.00 0.00 ? 101 PHE A HD1  1  
ATOM 1641  H HD2  . PHE A 1 101 ? 119.560 -14.551 0.356   1.00 0.00 ? 101 PHE A HD2  1  
ATOM 1642  H HE1  . PHE A 1 101 ? 114.766 -13.770 0.992   1.00 0.00 ? 101 PHE A HE1  1  
ATOM 1643  H HE2  . PHE A 1 101 ? 118.345 -15.709 2.139   1.00 0.00 ? 101 PHE A HE2  1  
ATOM 1644  H HZ   . PHE A 1 101 ? 115.954 -15.306 2.443   1.00 0.00 ? 101 PHE A HZ   1  
ATOM 1645  N N    . ASP A 1 102 ? 120.281 -13.894 -4.395  1.00 0.00 ? 102 ASP A N    1  
ATOM 1646  C CA   . ASP A 1 102 ? 121.355 -13.534 -5.371  1.00 0.00 ? 102 ASP A CA   1  
ATOM 1647  C C    . ASP A 1 102 ? 120.928 -12.447 -6.385  1.00 0.00 ? 102 ASP A C    1  
ATOM 1648  O O    . ASP A 1 102 ? 121.675 -11.491 -6.609  1.00 0.00 ? 102 ASP A O    1  
ATOM 1649  C CB   . ASP A 1 102 ? 121.930 -14.776 -6.111  1.00 0.00 ? 102 ASP A CB   1  
ATOM 1650  C CG   . ASP A 1 102 ? 120.951 -15.476 -7.042  1.00 0.00 ? 102 ASP A CG   1  
ATOM 1651  O OD1  . ASP A 1 102 ? 120.062 -16.226 -6.559  1.00 0.00 ? 102 ASP A OD1  1  
ATOM 1652  O OD2  . ASP A 1 102 ? 121.058 -15.301 -8.269  1.00 0.00 ? 102 ASP A OD2  1  
ATOM 1653  H H    . ASP A 1 102 ? 120.145 -14.848 -4.180  1.00 0.00 ? 102 ASP A H    1  
ATOM 1654  H HA   . ASP A 1 102 ? 122.147 -13.100 -4.778  1.00 0.00 ? 102 ASP A HA   1  
ATOM 1655  H HB2  . ASP A 1 102 ? 122.779 -14.469 -6.703  1.00 0.00 ? 102 ASP A HB2  1  
ATOM 1656  H HB3  . ASP A 1 102 ? 122.267 -15.487 -5.371  1.00 0.00 ? 102 ASP A HB3  1  
ATOM 1657  N N    . ALA A 1 103 ? 119.728 -12.558 -6.956  1.00 0.00 ? 103 ALA A N    1  
ATOM 1658  C CA   . ALA A 1 103 ? 119.250 -11.548 -7.907  1.00 0.00 ? 103 ALA A CA   1  
ATOM 1659  C C    . ALA A 1 103 ? 118.880 -10.268 -7.177  1.00 0.00 ? 103 ALA A C    1  
ATOM 1660  O O    . ALA A 1 103 ? 119.098 -9.155  -7.663  1.00 0.00 ? 103 ALA A O    1  
ATOM 1661  C CB   . ALA A 1 103 ? 118.047 -12.057 -8.695  1.00 0.00 ? 103 ALA A CB   1  
ATOM 1662  H H    . ALA A 1 103 ? 119.156 -13.337 -6.764  1.00 0.00 ? 103 ALA A H    1  
ATOM 1663  H HA   . ALA A 1 103 ? 120.053 -11.336 -8.598  1.00 0.00 ? 103 ALA A HA   1  
ATOM 1664  H HB1  . ALA A 1 103 ? 118.269 -13.022 -9.127  1.00 0.00 ? 103 ALA A HB1  1  
ATOM 1665  H HB2  . ALA A 1 103 ? 117.834 -11.355 -9.488  1.00 0.00 ? 103 ALA A HB2  1  
ATOM 1666  H HB3  . ALA A 1 103 ? 117.181 -12.124 -8.049  1.00 0.00 ? 103 ALA A HB3  1  
ATOM 1667  N N    . ALA A 1 104 ? 118.371 -10.439 -5.980  1.00 0.00 ? 104 ALA A N    1  
ATOM 1668  C CA   . ALA A 1 104 ? 117.912 -9.342  -5.158  1.00 0.00 ? 104 ALA A CA   1  
ATOM 1669  C C    . ALA A 1 104 ? 119.085 -8.538  -4.606  1.00 0.00 ? 104 ALA A C    1  
ATOM 1670  O O    . ALA A 1 104 ? 118.961 -7.340  -4.350  1.00 0.00 ? 104 ALA A O    1  
ATOM 1671  C CB   . ALA A 1 104 ? 117.007 -9.868  -4.062  1.00 0.00 ? 104 ALA A CB   1  
ATOM 1672  H H    . ALA A 1 104 ? 118.325 -11.356 -5.635  1.00 0.00 ? 104 ALA A H    1  
ATOM 1673  H HA   . ALA A 1 104 ? 117.332 -8.691  -5.794  1.00 0.00 ? 104 ALA A HA   1  
ATOM 1674  H HB1  . ALA A 1 104 ? 117.546 -10.557 -3.428  1.00 0.00 ? 104 ALA A HB1  1  
ATOM 1675  H HB2  . ALA A 1 104 ? 116.174 -10.365 -4.544  1.00 0.00 ? 104 ALA A HB2  1  
ATOM 1676  H HB3  . ALA A 1 104 ? 116.631 -9.037  -3.480  1.00 0.00 ? 104 ALA A HB3  1  
ATOM 1677  N N    . GLN A 1 105 ? 120.222 -9.198  -4.473  1.00 0.00 ? 105 GLN A N    1  
ATOM 1678  C CA   . GLN A 1 105 ? 121.469 -8.585  -4.050  1.00 0.00 ? 105 GLN A CA   1  
ATOM 1679  C C    . GLN A 1 105 ? 121.828 -7.486  -5.042  1.00 0.00 ? 105 GLN A C    1  
ATOM 1680  O O    . GLN A 1 105 ? 122.184 -6.369  -4.654  1.00 0.00 ? 105 GLN A O    1  
ATOM 1681  C CB   . GLN A 1 105 ? 122.564 -9.690  -3.958  1.00 0.00 ? 105 GLN A CB   1  
ATOM 1682  C CG   . GLN A 1 105 ? 123.953 -9.280  -3.427  1.00 0.00 ? 105 GLN A CG   1  
ATOM 1683  C CD   . GLN A 1 105 ? 124.911 -8.717  -4.467  1.00 0.00 ? 105 GLN A CD   1  
ATOM 1684  O OE1  . GLN A 1 105 ? 125.650 -9.467  -5.092  1.00 0.00 ? 105 GLN A OE1  1  
ATOM 1685  N NE2  . GLN A 1 105 ? 124.948 -7.421  -4.627  1.00 0.00 ? 105 GLN A NE2  1  
ATOM 1686  H H    . GLN A 1 105 ? 120.207 -10.167 -4.643  1.00 0.00 ? 105 GLN A H    1  
ATOM 1687  H HA   . GLN A 1 105 ? 121.317 -8.146  -3.074  1.00 0.00 ? 105 GLN A HA   1  
ATOM 1688  H HB2  . GLN A 1 105 ? 122.197 -10.472 -3.310  1.00 0.00 ? 105 GLN A HB2  1  
ATOM 1689  H HB3  . GLN A 1 105 ? 122.693 -10.111 -4.944  1.00 0.00 ? 105 GLN A HB3  1  
ATOM 1690  H HG2  . GLN A 1 105 ? 123.814 -8.525  -2.667  1.00 0.00 ? 105 GLN A HG2  1  
ATOM 1691  H HG3  . GLN A 1 105 ? 124.408 -10.147 -2.973  1.00 0.00 ? 105 GLN A HG3  1  
ATOM 1692  H HE21 . GLN A 1 105 ? 124.359 -6.858  -4.080  1.00 0.00 ? 105 GLN A HE21 1  
ATOM 1693  H HE22 . GLN A 1 105 ? 125.577 -7.061  -5.294  1.00 0.00 ? 105 GLN A HE22 1  
ATOM 1694  N N    . SER A 1 106 ? 121.669 -7.791  -6.310  1.00 0.00 ? 106 SER A N    1  
ATOM 1695  C CA   . SER A 1 106 ? 121.937 -6.855  -7.368  1.00 0.00 ? 106 SER A CA   1  
ATOM 1696  C C    . SER A 1 106 ? 120.867 -5.745  -7.399  1.00 0.00 ? 106 SER A C    1  
ATOM 1697  O O    . SER A 1 106 ? 121.183 -4.577  -7.638  1.00 0.00 ? 106 SER A O    1  
ATOM 1698  C CB   . SER A 1 106 ? 121.973 -7.606  -8.685  1.00 0.00 ? 106 SER A CB   1  
ATOM 1699  O OG   . SER A 1 106 ? 122.886 -8.694  -8.609  1.00 0.00 ? 106 SER A OG   1  
ATOM 1700  H H    . SER A 1 106 ? 121.373 -8.692  -6.563  1.00 0.00 ? 106 SER A H    1  
ATOM 1701  H HA   . SER A 1 106 ? 122.906 -6.412  -7.193  1.00 0.00 ? 106 SER A HA   1  
ATOM 1702  H HB2  . SER A 1 106 ? 120.988 -7.989  -8.910  1.00 0.00 ? 106 SER A HB2  1  
ATOM 1703  H HB3  . SER A 1 106 ? 122.292 -6.939  -9.473  1.00 0.00 ? 106 SER A HB3  1  
ATOM 1704  H HG   . SER A 1 106 ? 123.769 -8.300  -8.517  1.00 0.00 ? 106 SER A HG   1  
ATOM 1705  N N    . ARG A 1 107 ? 119.616 -6.113  -7.101  1.00 0.00 ? 107 ARG A N    1  
ATOM 1706  C CA   . ARG A 1 107 ? 118.505 -5.159  -7.093  1.00 0.00 ? 107 ARG A CA   1  
ATOM 1707  C C    . ARG A 1 107 ? 118.725 -4.091  -6.043  1.00 0.00 ? 107 ARG A C    1  
ATOM 1708  O O    . ARG A 1 107 ? 118.625 -2.902  -6.320  1.00 0.00 ? 107 ARG A O    1  
ATOM 1709  C CB   . ARG A 1 107 ? 117.179 -5.854  -6.824  1.00 0.00 ? 107 ARG A CB   1  
ATOM 1710  C CG   . ARG A 1 107 ? 116.798 -6.931  -7.816  1.00 0.00 ? 107 ARG A CG   1  
ATOM 1711  C CD   . ARG A 1 107 ? 116.677 -6.393  -9.225  1.00 0.00 ? 107 ARG A CD   1  
ATOM 1712  N NE   . ARG A 1 107 ? 116.341 -7.454  -10.174 1.00 0.00 ? 107 ARG A NE   1  
ATOM 1713  C CZ   . ARG A 1 107 ? 116.525 -7.398  -11.494 1.00 0.00 ? 107 ARG A CZ   1  
ATOM 1714  N NH1  . ARG A 1 107 ? 116.828 -6.251  -12.082 1.00 0.00 ? 107 ARG A NH1  1  
ATOM 1715  N NH2  . ARG A 1 107 ? 116.326 -8.467  -12.228 1.00 0.00 ? 107 ARG A NH2  1  
ATOM 1716  H H    . ARG A 1 107 ? 119.453 -7.055  -6.885  1.00 0.00 ? 107 ARG A H    1  
ATOM 1717  H HA   . ARG A 1 107 ? 118.446 -4.671  -8.051  1.00 0.00 ? 107 ARG A HA   1  
ATOM 1718  H HB2  . ARG A 1 107 ? 117.224 -6.310  -5.845  1.00 0.00 ? 107 ARG A HB2  1  
ATOM 1719  H HB3  . ARG A 1 107 ? 116.399 -5.109  -6.819  1.00 0.00 ? 107 ARG A HB3  1  
ATOM 1720  H HG2  . ARG A 1 107 ? 117.553 -7.704  -7.800  1.00 0.00 ? 107 ARG A HG2  1  
ATOM 1721  H HG3  . ARG A 1 107 ? 115.848 -7.347  -7.512  1.00 0.00 ? 107 ARG A HG3  1  
ATOM 1722  H HD2  . ARG A 1 107 ? 115.900 -5.643  -9.246  1.00 0.00 ? 107 ARG A HD2  1  
ATOM 1723  H HD3  . ARG A 1 107 ? 117.618 -5.948  -9.515  1.00 0.00 ? 107 ARG A HD3  1  
ATOM 1724  H HE   . ARG A 1 107 ? 115.982 -8.271  -9.751  1.00 0.00 ? 107 ARG A HE   1  
ATOM 1725  H HH11 . ARG A 1 107 ? 116.918 -5.396  -11.556 1.00 0.00 ? 107 ARG A HH11 1  
ATOM 1726  H HH12 . ARG A 1 107 ? 116.967 -6.182  -13.072 1.00 0.00 ? 107 ARG A HH12 1  
ATOM 1727  H HH21 . ARG A 1 107 ? 116.024 -9.346  -11.836 1.00 0.00 ? 107 ARG A HH21 1  
ATOM 1728  H HH22 . ARG A 1 107 ? 116.469 -8.457  -13.226 1.00 0.00 ? 107 ARG A HH22 1  
ATOM 1729  N N    . VAL A 1 108 ? 119.068 -4.517  -4.852  1.00 0.00 ? 108 VAL A N    1  
ATOM 1730  C CA   . VAL A 1 108 ? 119.289 -3.595  -3.751  1.00 0.00 ? 108 VAL A CA   1  
ATOM 1731  C C    . VAL A 1 108 ? 120.570 -2.785  -3.975  1.00 0.00 ? 108 VAL A C    1  
ATOM 1732  O O    . VAL A 1 108 ? 120.658 -1.612  -3.600  1.00 0.00 ? 108 VAL A O    1  
ATOM 1733  C CB   . VAL A 1 108 ? 119.303 -4.338  -2.402  1.00 0.00 ? 108 VAL A CB   1  
ATOM 1734  C CG1  . VAL A 1 108 ? 119.532 -3.379  -1.258  1.00 0.00 ? 108 VAL A CG1  1  
ATOM 1735  C CG2  . VAL A 1 108 ? 117.980 -5.051  -2.215  1.00 0.00 ? 108 VAL A CG2  1  
ATOM 1736  H H    . VAL A 1 108 ? 119.162 -5.485  -4.702  1.00 0.00 ? 108 VAL A H    1  
ATOM 1737  H HA   . VAL A 1 108 ? 118.461 -2.902  -3.760  1.00 0.00 ? 108 VAL A HA   1  
ATOM 1738  H HB   . VAL A 1 108 ? 120.085 -5.081  -2.407  1.00 0.00 ? 108 VAL A HB   1  
ATOM 1739  H HG11 . VAL A 1 108 ? 119.538 -3.936  -0.332  1.00 0.00 ? 108 VAL A HG11 1  
ATOM 1740  H HG12 . VAL A 1 108 ? 118.729 -2.655  -1.254  1.00 0.00 ? 108 VAL A HG12 1  
ATOM 1741  H HG13 . VAL A 1 108 ? 120.479 -2.873  -1.391  1.00 0.00 ? 108 VAL A HG13 1  
ATOM 1742  H HG21 . VAL A 1 108 ? 117.177 -4.328  -2.217  1.00 0.00 ? 108 VAL A HG21 1  
ATOM 1743  H HG22 . VAL A 1 108 ? 117.987 -5.579  -1.273  1.00 0.00 ? 108 VAL A HG22 1  
ATOM 1744  H HG23 . VAL A 1 108 ? 117.835 -5.754  -3.021  1.00 0.00 ? 108 VAL A HG23 1  
ATOM 1745  N N    . TYR A 1 109 ? 121.537 -3.410  -4.613  1.00 0.00 ? 109 TYR A N    1  
ATOM 1746  C CA   . TYR A 1 109 ? 122.759 -2.741  -5.022  1.00 0.00 ? 109 TYR A CA   1  
ATOM 1747  C C    . TYR A 1 109 ? 122.425 -1.559  -5.950  1.00 0.00 ? 109 TYR A C    1  
ATOM 1748  O O    . TYR A 1 109 ? 122.833 -0.429  -5.693  1.00 0.00 ? 109 TYR A O    1  
ATOM 1749  C CB   . TYR A 1 109 ? 123.699 -3.774  -5.689  1.00 0.00 ? 109 TYR A CB   1  
ATOM 1750  C CG   . TYR A 1 109 ? 124.850 -3.234  -6.533  1.00 0.00 ? 109 TYR A CG   1  
ATOM 1751  C CD1  . TYR A 1 109 ? 124.665 -2.918  -7.878  1.00 0.00 ? 109 TYR A CD1  1  
ATOM 1752  C CD2  . TYR A 1 109 ? 126.113 -3.064  -5.999  1.00 0.00 ? 109 TYR A CD2  1  
ATOM 1753  C CE1  . TYR A 1 109 ? 125.701 -2.447  -8.651  1.00 0.00 ? 109 TYR A CE1  1  
ATOM 1754  C CE2  . TYR A 1 109 ? 127.161 -2.597  -6.772  1.00 0.00 ? 109 TYR A CE2  1  
ATOM 1755  C CZ   . TYR A 1 109 ? 126.945 -2.289  -8.096  1.00 0.00 ? 109 TYR A CZ   1  
ATOM 1756  O OH   . TYR A 1 109 ? 127.985 -1.827  -8.871  1.00 0.00 ? 109 TYR A OH   1  
ATOM 1757  H H    . TYR A 1 109 ? 121.426 -4.364  -4.817  1.00 0.00 ? 109 TYR A H    1  
ATOM 1758  H HA   . TYR A 1 109 ? 123.233 -2.354  -4.131  1.00 0.00 ? 109 TYR A HA   1  
ATOM 1759  H HB2  . TYR A 1 109 ? 124.152 -4.344  -4.889  1.00 0.00 ? 109 TYR A HB2  1  
ATOM 1760  H HB3  . TYR A 1 109 ? 123.101 -4.452  -6.275  1.00 0.00 ? 109 TYR A HB3  1  
ATOM 1761  H HD1  . TYR A 1 109 ? 123.685 -3.041  -8.314  1.00 0.00 ? 109 TYR A HD1  1  
ATOM 1762  H HD2  . TYR A 1 109 ? 126.281 -3.300  -4.959  1.00 0.00 ? 109 TYR A HD2  1  
ATOM 1763  H HE1  . TYR A 1 109 ? 125.530 -2.206  -9.690  1.00 0.00 ? 109 TYR A HE1  1  
ATOM 1764  H HE2  . TYR A 1 109 ? 128.140 -2.471  -6.336  1.00 0.00 ? 109 TYR A HE2  1  
ATOM 1765  H HH   . TYR A 1 109 ? 128.736 -2.407  -8.703  1.00 0.00 ? 109 TYR A HH   1  
ATOM 1766  N N    . GLN A 1 110 ? 121.629 -1.811  -6.985  1.00 0.00 ? 110 GLN A N    1  
ATOM 1767  C CA   . GLN A 1 110 ? 121.257 -0.753  -7.917  1.00 0.00 ? 110 GLN A CA   1  
ATOM 1768  C C    . GLN A 1 110 ? 120.315 0.259   -7.266  1.00 0.00 ? 110 GLN A C    1  
ATOM 1769  O O    . GLN A 1 110 ? 120.342 1.440   -7.603  1.00 0.00 ? 110 GLN A O    1  
ATOM 1770  C CB   . GLN A 1 110 ? 120.731 -1.321  -9.257  1.00 0.00 ? 110 GLN A CB   1  
ATOM 1771  C CG   . GLN A 1 110 ? 119.464 -2.169  -9.197  1.00 0.00 ? 110 GLN A CG   1  
ATOM 1772  C CD   . GLN A 1 110 ? 118.190 -1.396  -9.494  1.00 0.00 ? 110 GLN A CD   1  
ATOM 1773  O OE1  . GLN A 1 110 ? 117.788 -1.268  -10.645 1.00 0.00 ? 110 GLN A OE1  1  
ATOM 1774  N NE2  . GLN A 1 110 ? 117.518 -0.939  -8.484  1.00 0.00 ? 110 GLN A NE2  1  
ATOM 1775  H H    . GLN A 1 110 ? 121.310 -2.730  -7.138  1.00 0.00 ? 110 GLN A H    1  
ATOM 1776  H HA   . GLN A 1 110 ? 122.175 -0.215  -8.108  1.00 0.00 ? 110 GLN A HA   1  
ATOM 1777  H HB2  . GLN A 1 110 ? 120.529 -0.492  -9.918  1.00 0.00 ? 110 GLN A HB2  1  
ATOM 1778  H HB3  . GLN A 1 110 ? 121.516 -1.918  -9.698  1.00 0.00 ? 110 GLN A HB3  1  
ATOM 1779  H HG2  . GLN A 1 110 ? 119.547 -3.001  -9.872  1.00 0.00 ? 110 GLN A HG2  1  
ATOM 1780  H HG3  . GLN A 1 110 ? 119.389 -2.560  -8.192  1.00 0.00 ? 110 GLN A HG3  1  
ATOM 1781  H HE21 . GLN A 1 110 ? 117.853 -1.113  -7.579  1.00 0.00 ? 110 GLN A HE21 1  
ATOM 1782  H HE22 . GLN A 1 110 ? 116.695 -0.432  -8.672  1.00 0.00 ? 110 GLN A HE22 1  
ATOM 1783  N N    . LEU A 1 111 ? 119.492 -0.214  -6.317  1.00 0.00 ? 111 LEU A N    1  
ATOM 1784  C CA   . LEU A 1 111 ? 118.627 0.676   -5.508  1.00 0.00 ? 111 LEU A CA   1  
ATOM 1785  C C    . LEU A 1 111 ? 119.465 1.730   -4.816  1.00 0.00 ? 111 LEU A C    1  
ATOM 1786  O O    . LEU A 1 111 ? 119.252 2.925   -4.993  1.00 0.00 ? 111 LEU A O    1  
ATOM 1787  C CB   . LEU A 1 111 ? 117.854 -0.092  -4.420  1.00 0.00 ? 111 LEU A CB   1  
ATOM 1788  C CG   . LEU A 1 111 ? 116.716 -1.002  -4.854  1.00 0.00 ? 111 LEU A CG   1  
ATOM 1789  C CD1  . LEU A 1 111 ? 116.150 -1.724  -3.636  1.00 0.00 ? 111 LEU A CD1  1  
ATOM 1790  C CD2  . LEU A 1 111 ? 115.622 -0.194  -5.541  1.00 0.00 ? 111 LEU A CD2  1  
ATOM 1791  H H    . LEU A 1 111 ? 119.464 -1.192  -6.201  1.00 0.00 ? 111 LEU A H    1  
ATOM 1792  H HA   . LEU A 1 111 ? 117.923 1.157   -6.170  1.00 0.00 ? 111 LEU A HA   1  
ATOM 1793  H HB2  . LEU A 1 111 ? 118.566 -0.701  -3.881  1.00 0.00 ? 111 LEU A HB2  1  
ATOM 1794  H HB3  . LEU A 1 111 ? 117.456 0.637   -3.729  1.00 0.00 ? 111 LEU A HB3  1  
ATOM 1795  H HG   . LEU A 1 111 ? 117.090 -1.741  -5.547  1.00 0.00 ? 111 LEU A HG   1  
ATOM 1796  H HD11 . LEU A 1 111 ? 115.740 -1.000  -2.948  1.00 0.00 ? 111 LEU A HD11 1  
ATOM 1797  H HD12 . LEU A 1 111 ? 116.944 -2.266  -3.140  1.00 0.00 ? 111 LEU A HD12 1  
ATOM 1798  H HD13 . LEU A 1 111 ? 115.375 -2.411  -3.943  1.00 0.00 ? 111 LEU A HD13 1  
ATOM 1799  H HD21 . LEU A 1 111 ? 116.030 0.297   -6.412  1.00 0.00 ? 111 LEU A HD21 1  
ATOM 1800  H HD22 . LEU A 1 111 ? 115.240 0.548   -4.855  1.00 0.00 ? 111 LEU A HD22 1  
ATOM 1801  H HD23 . LEU A 1 111 ? 114.822 -0.854  -5.840  1.00 0.00 ? 111 LEU A HD23 1  
ATOM 1802  N N    . MET A 1 112 ? 120.441 1.273   -4.051  1.00 0.00 ? 112 MET A N    1  
ATOM 1803  C CA   . MET A 1 112 ? 121.313 2.161   -3.298  1.00 0.00 ? 112 MET A CA   1  
ATOM 1804  C C    . MET A 1 112 ? 122.156 3.023   -4.206  1.00 0.00 ? 112 MET A C    1  
ATOM 1805  O O    . MET A 1 112 ? 122.497 4.133   -3.851  1.00 0.00 ? 112 MET A O    1  
ATOM 1806  C CB   . MET A 1 112 ? 122.200 1.390   -2.330  1.00 0.00 ? 112 MET A CB   1  
ATOM 1807  C CG   . MET A 1 112 ? 121.455 0.761   -1.168  1.00 0.00 ? 112 MET A CG   1  
ATOM 1808  S SD   . MET A 1 112 ? 122.536 -0.184  -0.084  1.00 0.00 ? 112 MET A SD   1  
ATOM 1809  C CE   . MET A 1 112 ? 123.115 -1.434  -1.215  1.00 0.00 ? 112 MET A CE   1  
ATOM 1810  H H    . MET A 1 112 ? 120.570 0.300   -3.988  1.00 0.00 ? 112 MET A H    1  
ATOM 1811  H HA   . MET A 1 112 ? 120.672 2.814   -2.723  1.00 0.00 ? 112 MET A HA   1  
ATOM 1812  H HB2  . MET A 1 112 ? 122.698 0.600   -2.874  1.00 0.00 ? 112 MET A HB2  1  
ATOM 1813  H HB3  . MET A 1 112 ? 122.944 2.062   -1.929  1.00 0.00 ? 112 MET A HB3  1  
ATOM 1814  H HG2  . MET A 1 112 ? 120.996 1.545   -0.585  1.00 0.00 ? 112 MET A HG2  1  
ATOM 1815  H HG3  . MET A 1 112 ? 120.690 0.103   -1.556  1.00 0.00 ? 112 MET A HG3  1  
ATOM 1816  H HE1  . MET A 1 112 ? 122.267 -2.003  -1.569  1.00 0.00 ? 112 MET A HE1  1  
ATOM 1817  H HE2  . MET A 1 112 ? 123.807 -2.091  -0.710  1.00 0.00 ? 112 MET A HE2  1  
ATOM 1818  H HE3  . MET A 1 112 ? 123.608 -0.964  -2.054  1.00 0.00 ? 112 MET A HE3  1  
ATOM 1819  N N    . GLU A 1 113 ? 122.474 2.512   -5.375  1.00 0.00 ? 113 GLU A N    1  
ATOM 1820  C CA   . GLU A 1 113 ? 123.254 3.240   -6.358  1.00 0.00 ? 113 GLU A CA   1  
ATOM 1821  C C    . GLU A 1 113 ? 122.476 4.494   -6.800  1.00 0.00 ? 113 GLU A C    1  
ATOM 1822  O O    . GLU A 1 113 ? 122.855 5.625   -6.471  1.00 0.00 ? 113 GLU A O    1  
ATOM 1823  C CB   . GLU A 1 113 ? 123.564 2.299   -7.557  1.00 0.00 ? 113 GLU A CB   1  
ATOM 1824  C CG   . GLU A 1 113 ? 124.579 2.792   -8.609  1.00 0.00 ? 113 GLU A CG   1  
ATOM 1825  C CD   . GLU A 1 113 ? 124.127 3.985   -9.426  1.00 0.00 ? 113 GLU A CD   1  
ATOM 1826  O OE1  . GLU A 1 113 ? 123.087 3.903   -10.107 1.00 0.00 ? 113 GLU A OE1  1  
ATOM 1827  O OE2  . GLU A 1 113 ? 124.801 5.025   -9.404  1.00 0.00 ? 113 GLU A OE2  1  
ATOM 1828  H H    . GLU A 1 113 ? 122.181 1.599   -5.583  1.00 0.00 ? 113 GLU A H    1  
ATOM 1829  H HA   . GLU A 1 113 ? 124.181 3.545   -5.894  1.00 0.00 ? 113 GLU A HA   1  
ATOM 1830  H HB2  . GLU A 1 113 ? 123.944 1.369   -7.161  1.00 0.00 ? 113 GLU A HB2  1  
ATOM 1831  H HB3  . GLU A 1 113 ? 122.631 2.090   -8.061  1.00 0.00 ? 113 GLU A HB3  1  
ATOM 1832  H HG2  . GLU A 1 113 ? 125.490 3.068   -8.098  1.00 0.00 ? 113 GLU A HG2  1  
ATOM 1833  H HG3  . GLU A 1 113 ? 124.794 1.973   -9.280  1.00 0.00 ? 113 GLU A HG3  1  
ATOM 1834  N N    . GLN A 1 114 ? 121.357 4.276   -7.456  1.00 0.00 ? 114 GLN A N    1  
ATOM 1835  C CA   . GLN A 1 114 ? 120.576 5.359   -8.036  1.00 0.00 ? 114 GLN A CA   1  
ATOM 1836  C C    . GLN A 1 114 ? 119.953 6.271   -6.982  1.00 0.00 ? 114 GLN A C    1  
ATOM 1837  O O    . GLN A 1 114 ? 119.756 7.455   -7.225  1.00 0.00 ? 114 GLN A O    1  
ATOM 1838  C CB   . GLN A 1 114 ? 119.512 4.800   -8.992  1.00 0.00 ? 114 GLN A CB   1  
ATOM 1839  C CG   . GLN A 1 114 ? 118.520 3.843   -8.345  1.00 0.00 ? 114 GLN A CG   1  
ATOM 1840  C CD   . GLN A 1 114 ? 117.629 3.169   -9.356  1.00 0.00 ? 114 GLN A CD   1  
ATOM 1841  O OE1  . GLN A 1 114 ? 116.550 3.664   -9.693  1.00 0.00 ? 114 GLN A OE1  1  
ATOM 1842  N NE2  . GLN A 1 114 ? 118.075 2.056   -9.869  1.00 0.00 ? 114 GLN A NE2  1  
ATOM 1843  H H    . GLN A 1 114 ? 121.049 3.348   -7.563  1.00 0.00 ? 114 GLN A H    1  
ATOM 1844  H HA   . GLN A 1 114 ? 121.263 5.956   -8.618  1.00 0.00 ? 114 GLN A HA   1  
ATOM 1845  H HB2  . GLN A 1 114 ? 118.954 5.624   -9.411  1.00 0.00 ? 114 GLN A HB2  1  
ATOM 1846  H HB3  . GLN A 1 114 ? 120.013 4.276   -9.794  1.00 0.00 ? 114 GLN A HB3  1  
ATOM 1847  H HG2  . GLN A 1 114 ? 119.068 3.083   -7.806  1.00 0.00 ? 114 GLN A HG2  1  
ATOM 1848  H HG3  . GLN A 1 114 ? 117.903 4.399   -7.654  1.00 0.00 ? 114 GLN A HG3  1  
ATOM 1849  H HE21 . GLN A 1 114 ? 118.955 1.732   -9.568  1.00 0.00 ? 114 GLN A HE21 1  
ATOM 1850  H HE22 . GLN A 1 114 ? 117.545 1.572   -10.539 1.00 0.00 ? 114 GLN A HE22 1  
ATOM 1851  N N    . ASP A 1 115 ? 119.667 5.729   -5.827  1.00 0.00 ? 115 ASP A N    1  
ATOM 1852  C CA   . ASP A 1 115 ? 119.032 6.505   -4.771  1.00 0.00 ? 115 ASP A CA   1  
ATOM 1853  C C    . ASP A 1 115 ? 120.033 7.181   -3.856  1.00 0.00 ? 115 ASP A C    1  
ATOM 1854  O O    . ASP A 1 115 ? 119.991 8.388   -3.663  1.00 0.00 ? 115 ASP A O    1  
ATOM 1855  C CB   . ASP A 1 115 ? 118.107 5.625   -3.930  1.00 0.00 ? 115 ASP A CB   1  
ATOM 1856  C CG   . ASP A 1 115 ? 117.485 6.358   -2.756  1.00 0.00 ? 115 ASP A CG   1  
ATOM 1857  O OD1  . ASP A 1 115 ? 118.112 6.415   -1.665  1.00 0.00 ? 115 ASP A OD1  1  
ATOM 1858  O OD2  . ASP A 1 115 ? 116.354 6.866   -2.895  1.00 0.00 ? 115 ASP A OD2  1  
ATOM 1859  H H    . ASP A 1 115 ? 119.869 4.778   -5.687  1.00 0.00 ? 115 ASP A H    1  
ATOM 1860  H HA   . ASP A 1 115 ? 118.424 7.265   -5.241  1.00 0.00 ? 115 ASP A HA   1  
ATOM 1861  H HB2  . ASP A 1 115 ? 117.309 5.255   -4.557  1.00 0.00 ? 115 ASP A HB2  1  
ATOM 1862  H HB3  . ASP A 1 115 ? 118.673 4.786   -3.550  1.00 0.00 ? 115 ASP A HB3  1  
ATOM 1863  N N    . SER A 1 116 ? 120.924 6.412   -3.293  1.00 0.00 ? 116 SER A N    1  
ATOM 1864  C CA   . SER A 1 116 ? 121.778 6.919   -2.255  1.00 0.00 ? 116 SER A CA   1  
ATOM 1865  C C    . SER A 1 116 ? 123.198 7.281   -2.731  1.00 0.00 ? 116 SER A C    1  
ATOM 1866  O O    . SER A 1 116 ? 123.764 8.229   -2.242  1.00 0.00 ? 116 SER A O    1  
ATOM 1867  C CB   . SER A 1 116 ? 121.823 5.914   -1.111  1.00 0.00 ? 116 SER A CB   1  
ATOM 1868  O OG   . SER A 1 116 ? 120.509 5.578   -0.678  1.00 0.00 ? 116 SER A OG   1  
ATOM 1869  H H    . SER A 1 116 ? 121.029 5.479   -3.577  1.00 0.00 ? 116 SER A H    1  
ATOM 1870  H HA   . SER A 1 116 ? 121.314 7.816   -1.873  1.00 0.00 ? 116 SER A HA   1  
ATOM 1871  H HB2  . SER A 1 116 ? 122.320 5.014   -1.442  1.00 0.00 ? 116 SER A HB2  1  
ATOM 1872  H HB3  . SER A 1 116 ? 122.365 6.340   -0.280  1.00 0.00 ? 116 SER A HB3  1  
ATOM 1873  H HG   . SER A 1 116 ? 119.838 5.942   -1.274  1.00 0.00 ? 116 SER A HG   1  
ATOM 1874  N N    . TYR A 1 117 ? 123.742 6.558   -3.702  1.00 0.00 ? 117 TYR A N    1  
ATOM 1875  C CA   . TYR A 1 117 ? 125.137 6.754   -4.149  1.00 0.00 ? 117 TYR A CA   1  
ATOM 1876  C C    . TYR A 1 117 ? 125.363 8.131   -4.750  1.00 0.00 ? 117 TYR A C    1  
ATOM 1877  O O    . TYR A 1 117 ? 126.396 8.756   -4.523  1.00 0.00 ? 117 TYR A O    1  
ATOM 1878  C CB   . TYR A 1 117 ? 125.526 5.639   -5.116  1.00 0.00 ? 117 TYR A CB   1  
ATOM 1879  C CG   . TYR A 1 117 ? 126.850 5.789   -5.834  1.00 0.00 ? 117 TYR A CG   1  
ATOM 1880  C CD1  . TYR A 1 117 ? 128.053 5.923   -5.156  1.00 0.00 ? 117 TYR A CD1  1  
ATOM 1881  C CD2  . TYR A 1 117 ? 126.882 5.756   -7.210  1.00 0.00 ? 117 TYR A CD2  1  
ATOM 1882  C CE1  . TYR A 1 117 ? 129.245 6.024   -5.852  1.00 0.00 ? 117 TYR A CE1  1  
ATOM 1883  C CE2  . TYR A 1 117 ? 128.056 5.858   -7.902  1.00 0.00 ? 117 TYR A CE2  1  
ATOM 1884  C CZ   . TYR A 1 117 ? 129.229 5.992   -7.231  1.00 0.00 ? 117 TYR A CZ   1  
ATOM 1885  O OH   . TYR A 1 117 ? 130.400 6.077   -7.939  1.00 0.00 ? 117 TYR A OH   1  
ATOM 1886  H H    . TYR A 1 117 ? 123.203 5.866   -4.151  1.00 0.00 ? 117 TYR A H    1  
ATOM 1887  H HA   . TYR A 1 117 ? 125.755 6.668   -3.267  1.00 0.00 ? 117 TYR A HA   1  
ATOM 1888  H HB2  . TYR A 1 117 ? 125.566 4.709   -4.569  1.00 0.00 ? 117 TYR A HB2  1  
ATOM 1889  H HB3  . TYR A 1 117 ? 124.749 5.593   -5.871  1.00 0.00 ? 117 TYR A HB3  1  
ATOM 1890  H HD1  . TYR A 1 117 ? 128.052 5.951   -4.076  1.00 0.00 ? 117 TYR A HD1  1  
ATOM 1891  H HD2  . TYR A 1 117 ? 125.954 5.650   -7.752  1.00 0.00 ? 117 TYR A HD2  1  
ATOM 1892  H HE1  . TYR A 1 117 ? 130.179 6.128   -5.320  1.00 0.00 ? 117 TYR A HE1  1  
ATOM 1893  H HE2  . TYR A 1 117 ? 128.055 5.835   -8.981  1.00 0.00 ? 117 TYR A HE2  1  
ATOM 1894  H HH   . TYR A 1 117 ? 131.096 5.684   -7.393  1.00 0.00 ? 117 TYR A HH   1  
ATOM 1895  N N    . THR A 1 118 ? 124.395 8.600   -5.464  1.00 0.00 ? 118 THR A N    1  
ATOM 1896  C CA   . THR A 1 118 ? 124.424 9.903   -6.086  1.00 0.00 ? 118 THR A CA   1  
ATOM 1897  C C    . THR A 1 118 ? 124.586 11.014  -5.014  1.00 0.00 ? 118 THR A C    1  
ATOM 1898  O O    . THR A 1 118 ? 125.557 11.828  -5.014  1.00 0.00 ? 118 THR A O    1  
ATOM 1899  C CB   . THR A 1 118 ? 123.101 10.060  -6.836  1.00 0.00 ? 118 THR A CB   1  
ATOM 1900  O OG1  . THR A 1 118 ? 122.059 9.524   -5.996  1.00 0.00 ? 118 THR A OG1  1  
ATOM 1901  C CG2  . THR A 1 118 ? 123.131 9.276   -8.133  1.00 0.00 ? 118 THR A CG2  1  
ATOM 1902  H H    . THR A 1 118 ? 123.581 8.061   -5.589  1.00 0.00 ? 118 THR A H    1  
ATOM 1903  H HA   . THR A 1 118 ? 125.235 9.943   -6.798  1.00 0.00 ? 118 THR A HA   1  
ATOM 1904  H HB   . THR A 1 118 ? 122.918 11.106  -7.038  1.00 0.00 ? 118 THR A HB   1  
ATOM 1905  H HG1  . THR A 1 118 ? 121.371 10.196  -5.854  1.00 0.00 ? 118 THR A HG1  1  
ATOM 1906  H HG21 . THR A 1 118 ? 122.184 9.377   -8.643  1.00 0.00 ? 118 THR A HG21 1  
ATOM 1907  H HG22 . THR A 1 118 ? 123.316 8.236   -7.905  1.00 0.00 ? 118 THR A HG22 1  
ATOM 1908  H HG23 . THR A 1 118 ? 123.925 9.650   -8.762  1.00 0.00 ? 118 THR A HG23 1  
ATOM 1909  N N    . ARG A 1 119 ? 123.685 11.004  -4.078  1.00 0.00 ? 119 ARG A N    1  
ATOM 1910  C CA   . ARG A 1 119 ? 123.703 11.948  -2.996  1.00 0.00 ? 119 ARG A CA   1  
ATOM 1911  C C    . ARG A 1 119 ? 124.843 11.652  -2.006  1.00 0.00 ? 119 ARG A C    1  
ATOM 1912  O O    . ARG A 1 119 ? 125.317 12.541  -1.324  1.00 0.00 ? 119 ARG A O    1  
ATOM 1913  C CB   . ARG A 1 119 ? 122.323 12.059  -2.349  1.00 0.00 ? 119 ARG A CB   1  
ATOM 1914  C CG   . ARG A 1 119 ? 121.675 10.735  -2.029  1.00 0.00 ? 119 ARG A CG   1  
ATOM 1915  C CD   . ARG A 1 119 ? 120.275 10.926  -1.502  1.00 0.00 ? 119 ARG A CD   1  
ATOM 1916  N NE   . ARG A 1 119 ? 119.643 9.650   -1.166  1.00 0.00 ? 119 ARG A NE   1  
ATOM 1917  C CZ   . ARG A 1 119 ? 119.317 9.285   0.073   1.00 0.00 ? 119 ARG A CZ   1  
ATOM 1918  N NH1  . ARG A 1 119 ? 119.561 10.107  1.076   1.00 0.00 ? 119 ARG A NH1  1  
ATOM 1919  N NH2  . ARG A 1 119 ? 118.732 8.123   0.306   1.00 0.00 ? 119 ARG A NH2  1  
ATOM 1920  H H    . ARG A 1 119 ? 122.973 10.330  -4.144  1.00 0.00 ? 119 ARG A H    1  
ATOM 1921  H HA   . ARG A 1 119 ? 123.945 12.896  -3.454  1.00 0.00 ? 119 ARG A HA   1  
ATOM 1922  H HB2  . ARG A 1 119 ? 122.418 12.614  -1.427  1.00 0.00 ? 119 ARG A HB2  1  
ATOM 1923  H HB3  . ARG A 1 119 ? 121.674 12.604  -3.019  1.00 0.00 ? 119 ARG A HB3  1  
ATOM 1924  H HG2  . ARG A 1 119 ? 121.634 10.137  -2.928  1.00 0.00 ? 119 ARG A HG2  1  
ATOM 1925  H HG3  . ARG A 1 119 ? 122.267 10.225  -1.284  1.00 0.00 ? 119 ARG A HG3  1  
ATOM 1926  H HD2  . ARG A 1 119 ? 120.318 11.540  -0.615  1.00 0.00 ? 119 ARG A HD2  1  
ATOM 1927  H HD3  . ARG A 1 119 ? 119.683 11.423  -2.256  1.00 0.00 ? 119 ARG A HD3  1  
ATOM 1928  H HE   . ARG A 1 119 ? 119.469 9.070   -1.948  1.00 0.00 ? 119 ARG A HE   1  
ATOM 1929  H HH11 . ARG A 1 119 ? 119.977 11.011  0.945   1.00 0.00 ? 119 ARG A HH11 1  
ATOM 1930  H HH12 . ARG A 1 119 ? 119.351 9.871   2.039   1.00 0.00 ? 119 ARG A HH12 1  
ATOM 1931  H HH21 . ARG A 1 119 ? 118.498 7.464   -0.427  1.00 0.00 ? 119 ARG A HH21 1  
ATOM 1932  H HH22 . ARG A 1 119 ? 118.511 7.859   1.252   1.00 0.00 ? 119 ARG A HH22 1  
ATOM 1933  N N    . PHE A 1 120 ? 125.296 10.403  -1.968  1.00 0.00 ? 120 PHE A N    1  
ATOM 1934  C CA   . PHE A 1 120 ? 126.487 10.038  -1.208  1.00 0.00 ? 120 PHE A CA   1  
ATOM 1935  C C    . PHE A 1 120 ? 127.689 10.759  -1.783  1.00 0.00 ? 120 PHE A C    1  
ATOM 1936  O O    . PHE A 1 120 ? 128.509 11.268  -1.052  1.00 0.00 ? 120 PHE A O    1  
ATOM 1937  C CB   . PHE A 1 120 ? 126.722 8.508   -1.200  1.00 0.00 ? 120 PHE A CB   1  
ATOM 1938  C CG   . PHE A 1 120 ? 128.100 8.085   -0.732  1.00 0.00 ? 120 PHE A CG   1  
ATOM 1939  C CD1  . PHE A 1 120 ? 128.436 8.054   0.617   1.00 0.00 ? 120 PHE A CD1  1  
ATOM 1940  C CD2  . PHE A 1 120 ? 129.069 7.738   -1.663  1.00 0.00 ? 120 PHE A CD2  1  
ATOM 1941  C CE1  . PHE A 1 120 ? 129.712 7.677   1.015   1.00 0.00 ? 120 PHE A CE1  1  
ATOM 1942  C CE2  . PHE A 1 120 ? 130.332 7.371   -1.267  1.00 0.00 ? 120 PHE A CE2  1  
ATOM 1943  C CZ   . PHE A 1 120 ? 130.654 7.339   0.070   1.00 0.00 ? 120 PHE A CZ   1  
ATOM 1944  H H    . PHE A 1 120 ? 124.799 9.695   -2.435  1.00 0.00 ? 120 PHE A H    1  
ATOM 1945  H HA   . PHE A 1 120 ? 126.339 10.383  -0.196  1.00 0.00 ? 120 PHE A HA   1  
ATOM 1946  H HB2  . PHE A 1 120 ? 126.001 8.046   -0.542  1.00 0.00 ? 120 PHE A HB2  1  
ATOM 1947  H HB3  . PHE A 1 120 ? 126.578 8.126   -2.200  1.00 0.00 ? 120 PHE A HB3  1  
ATOM 1948  H HD1  . PHE A 1 120 ? 127.695 8.321   1.356   1.00 0.00 ? 120 PHE A HD1  1  
ATOM 1949  H HD2  . PHE A 1 120 ? 128.821 7.759   -2.714  1.00 0.00 ? 120 PHE A HD2  1  
ATOM 1950  H HE1  . PHE A 1 120 ? 129.994 7.643   2.059   1.00 0.00 ? 120 PHE A HE1  1  
ATOM 1951  H HE2  . PHE A 1 120 ? 131.073 7.104   -2.006  1.00 0.00 ? 120 PHE A HE2  1  
ATOM 1952  H HZ   . PHE A 1 120 ? 131.648 7.051   0.378   1.00 0.00 ? 120 PHE A HZ   1  
ATOM 1953  N N    . LEU A 1 121 ? 127.762 10.833  -3.090  1.00 0.00 ? 121 LEU A N    1  
ATOM 1954  C CA   . LEU A 1 121 ? 128.844 11.547  -3.746  1.00 0.00 ? 121 LEU A CA   1  
ATOM 1955  C C    . LEU A 1 121 ? 128.819 13.022  -3.385  1.00 0.00 ? 121 LEU A C    1  
ATOM 1956  O O    . LEU A 1 121 ? 129.851 13.676  -3.345  1.00 0.00 ? 121 LEU A O    1  
ATOM 1957  C CB   . LEU A 1 121 ? 128.811 11.336  -5.262  1.00 0.00 ? 121 LEU A CB   1  
ATOM 1958  C CG   . LEU A 1 121 ? 129.058 9.898   -5.714  1.00 0.00 ? 121 LEU A CG   1  
ATOM 1959  C CD1  . LEU A 1 121 ? 128.953 9.774   -7.225  1.00 0.00 ? 121 LEU A CD1  1  
ATOM 1960  C CD2  . LEU A 1 121 ? 130.421 9.432   -5.233  1.00 0.00 ? 121 LEU A CD2  1  
ATOM 1961  H H    . LEU A 1 121 ? 127.087 10.374  -3.637  1.00 0.00 ? 121 LEU A H    1  
ATOM 1962  H HA   . LEU A 1 121 ? 129.764 11.134  -3.358  1.00 0.00 ? 121 LEU A HA   1  
ATOM 1963  H HB2  . LEU A 1 121 ? 127.842 11.647  -5.624  1.00 0.00 ? 121 LEU A HB2  1  
ATOM 1964  H HB3  . LEU A 1 121 ? 129.565 11.966  -5.710  1.00 0.00 ? 121 LEU A HB3  1  
ATOM 1965  H HG   . LEU A 1 121 ? 128.309 9.255   -5.274  1.00 0.00 ? 121 LEU A HG   1  
ATOM 1966  H HD11 . LEU A 1 121 ? 129.697 10.402  -7.692  1.00 0.00 ? 121 LEU A HD11 1  
ATOM 1967  H HD12 . LEU A 1 121 ? 127.967 10.082  -7.542  1.00 0.00 ? 121 LEU A HD12 1  
ATOM 1968  H HD13 . LEU A 1 121 ? 129.118 8.745   -7.511  1.00 0.00 ? 121 LEU A HD13 1  
ATOM 1969  H HD21 . LEU A 1 121 ? 131.186 10.015  -5.725  1.00 0.00 ? 121 LEU A HD21 1  
ATOM 1970  H HD22 . LEU A 1 121 ? 130.562 8.383   -5.443  1.00 0.00 ? 121 LEU A HD22 1  
ATOM 1971  H HD23 . LEU A 1 121 ? 130.495 9.609   -4.167  1.00 0.00 ? 121 LEU A HD23 1  
ATOM 1972  N N    . LYS A 1 122 ? 127.644 13.538  -3.108  1.00 0.00 ? 122 LYS A N    1  
ATOM 1973  C CA   . LYS A 1 122 ? 127.533 14.924  -2.669  1.00 0.00 ? 122 LYS A CA   1  
ATOM 1974  C C    . LYS A 1 122 ? 127.378 15.036  -1.104  1.00 0.00 ? 122 LYS A C    1  
ATOM 1975  O O    . LYS A 1 122 ? 127.156 16.122  -0.557  1.00 0.00 ? 122 LYS A O    1  
ATOM 1976  C CB   . LYS A 1 122 ? 126.386 15.619  -3.442  1.00 0.00 ? 122 LYS A CB   1  
ATOM 1977  C CG   . LYS A 1 122 ? 126.243 17.129  -3.210  1.00 0.00 ? 122 LYS A CG   1  
ATOM 1978  C CD   . LYS A 1 122 ? 127.538 17.898  -3.497  1.00 0.00 ? 122 LYS A CD   1  
ATOM 1979  C CE   . LYS A 1 122 ? 127.992 17.763  -4.939  1.00 0.00 ? 122 LYS A CE   1  
ATOM 1980  N NZ   . LYS A 1 122 ? 129.217 18.546  -5.196  1.00 0.00 ? 122 LYS A NZ   1  
ATOM 1981  H H    . LYS A 1 122 ? 126.846 12.976  -3.254  1.00 0.00 ? 122 LYS A H    1  
ATOM 1982  H HA   . LYS A 1 122 ? 128.467 15.406  -2.922  1.00 0.00 ? 122 LYS A HA   1  
ATOM 1983  H HB2  . LYS A 1 122 ? 126.549 15.467  -4.499  1.00 0.00 ? 122 LYS A HB2  1  
ATOM 1984  H HB3  . LYS A 1 122 ? 125.455 15.146  -3.168  1.00 0.00 ? 122 LYS A HB3  1  
ATOM 1985  H HG2  . LYS A 1 122 ? 125.469 17.509  -3.860  1.00 0.00 ? 122 LYS A HG2  1  
ATOM 1986  H HG3  . LYS A 1 122 ? 125.959 17.294  -2.181  1.00 0.00 ? 122 LYS A HG3  1  
ATOM 1987  H HD2  . LYS A 1 122 ? 127.375 18.944  -3.286  1.00 0.00 ? 122 LYS A HD2  1  
ATOM 1988  H HD3  . LYS A 1 122 ? 128.313 17.521  -2.846  1.00 0.00 ? 122 LYS A HD3  1  
ATOM 1989  H HE2  . LYS A 1 122 ? 128.190 16.722  -5.146  1.00 0.00 ? 122 LYS A HE2  1  
ATOM 1990  H HE3  . LYS A 1 122 ? 127.203 18.117  -5.587  1.00 0.00 ? 122 LYS A HE3  1  
ATOM 1991  H HZ1  . LYS A 1 122 ? 129.547 18.419  -6.176  1.00 0.00 ? 122 LYS A HZ1  1  
ATOM 1992  H HZ2  . LYS A 1 122 ? 130.012 18.263  -4.581  1.00 0.00 ? 122 LYS A HZ2  1  
ATOM 1993  H HZ3  . LYS A 1 122 ? 129.071 19.567  -5.044  1.00 0.00 ? 122 LYS A HZ3  1  
ATOM 1994  N N    . SER A 1 123 ? 127.507 13.931  -0.396  1.00 0.00 ? 123 SER A N    1  
ATOM 1995  C CA   . SER A 1 123 ? 127.418 13.963  1.065   1.00 0.00 ? 123 SER A CA   1  
ATOM 1996  C C    . SER A 1 123 ? 128.722 14.464  1.668   1.00 0.00 ? 123 SER A C    1  
ATOM 1997  O O    . SER A 1 123 ? 129.795 14.274  1.091   1.00 0.00 ? 123 SER A O    1  
ATOM 1998  C CB   . SER A 1 123 ? 127.118 12.580  1.639   1.00 0.00 ? 123 SER A CB   1  
ATOM 1999  O OG   . SER A 1 123 ? 128.225 11.697  1.479   1.00 0.00 ? 123 SER A OG   1  
ATOM 2000  H H    . SER A 1 123 ? 127.612 13.075  -0.862  1.00 0.00 ? 123 SER A H    1  
ATOM 2001  H HA   . SER A 1 123 ? 126.621 14.637  1.337   1.00 0.00 ? 123 SER A HA   1  
ATOM 2002  H HB2  . SER A 1 123 ? 126.901 12.673  2.693   1.00 0.00 ? 123 SER A HB2  1  
ATOM 2003  H HB3  . SER A 1 123 ? 126.262 12.161  1.132   1.00 0.00 ? 123 SER A HB3  1  
ATOM 2004  H HG   . SER A 1 123 ? 128.358 11.543  0.532   1.00 0.00 ? 123 SER A HG   1  
ATOM 2005  N N    . ASP A 1 124 ? 128.634 15.048  2.847   1.00 0.00 ? 124 ASP A N    1  
ATOM 2006  C CA   . ASP A 1 124 ? 129.802 15.563  3.558   1.00 0.00 ? 124 ASP A CA   1  
ATOM 2007  C C    . ASP A 1 124 ? 130.708 14.435  4.002   1.00 0.00 ? 124 ASP A C    1  
ATOM 2008  O O    . ASP A 1 124 ? 131.861 14.673  4.301   1.00 0.00 ? 124 ASP A O    1  
ATOM 2009  C CB   . ASP A 1 124 ? 129.421 16.392  4.794   1.00 0.00 ? 124 ASP A CB   1  
ATOM 2010  C CG   . ASP A 1 124 ? 128.888 15.550  5.932   1.00 0.00 ? 124 ASP A CG   1  
ATOM 2011  O OD1  . ASP A 1 124 ? 127.696 15.174  5.894   1.00 0.00 ? 124 ASP A OD1  1  
ATOM 2012  O OD2  . ASP A 1 124 ? 129.646 15.251  6.884   1.00 0.00 ? 124 ASP A OD2  1  
ATOM 2013  H H    . ASP A 1 124 ? 127.741 15.150  3.250   1.00 0.00 ? 124 ASP A H    1  
ATOM 2014  H HA   . ASP A 1 124 ? 130.348 16.195  2.874   1.00 0.00 ? 124 ASP A HA   1  
ATOM 2015  H HB2  . ASP A 1 124 ? 130.294 16.921  5.145   1.00 0.00 ? 124 ASP A HB2  1  
ATOM 2016  H HB3  . ASP A 1 124 ? 128.664 17.110  4.514   1.00 0.00 ? 124 ASP A HB3  1  
ATOM 2017  N N    . ILE A 1 125 ? 130.199 13.207  4.067   1.00 0.00 ? 125 ILE A N    1  
ATOM 2018  C CA   . ILE A 1 125 ? 131.047 12.111  4.463   1.00 0.00 ? 125 ILE A CA   1  
ATOM 2019  C C    . ILE A 1 125 ? 131.999 11.806  3.294   1.00 0.00 ? 125 ILE A C    1  
ATOM 2020  O O    . ILE A 1 125 ? 133.216 11.735  3.473   1.00 0.00 ? 125 ILE A O    1  
ATOM 2021  C CB   . ILE A 1 125 ? 130.225 10.838  4.978   1.00 0.00 ? 125 ILE A CB   1  
ATOM 2022  C CG1  . ILE A 1 125 ? 131.078 9.898   5.873   1.00 0.00 ? 125 ILE A CG1  1  
ATOM 2023  C CG2  . ILE A 1 125 ? 129.568 10.038  3.859   1.00 0.00 ? 125 ILE A CG2  1  
ATOM 2024  C CD1  . ILE A 1 125 ? 132.242 9.188   5.204   1.00 0.00 ? 125 ILE A CD1  1  
ATOM 2025  H H    . ILE A 1 125 ? 129.255 13.054  3.847   1.00 0.00 ? 125 ILE A H    1  
ATOM 2026  H HA   . ILE A 1 125 ? 131.661 12.497  5.266   1.00 0.00 ? 125 ILE A HA   1  
ATOM 2027  H HB   . ILE A 1 125 ? 129.417 11.226  5.583   1.00 0.00 ? 125 ILE A HB   1  
ATOM 2028  H HG12 . ILE A 1 125 ? 131.491 10.476  6.686   1.00 0.00 ? 125 ILE A HG12 1  
ATOM 2029  H HG13 . ILE A 1 125 ? 130.426 9.144   6.291   1.00 0.00 ? 125 ILE A HG13 1  
ATOM 2030  H HG21 . ILE A 1 125 ? 130.335 9.625   3.218   1.00 0.00 ? 125 ILE A HG21 1  
ATOM 2031  H HG22 . ILE A 1 125 ? 128.927 10.686  3.279   1.00 0.00 ? 125 ILE A HG22 1  
ATOM 2032  H HG23 . ILE A 1 125 ? 128.985 9.233   4.282   1.00 0.00 ? 125 ILE A HG23 1  
ATOM 2033  H HD11 . ILE A 1 125 ? 132.755 8.574   5.930   1.00 0.00 ? 125 ILE A HD11 1  
ATOM 2034  H HD12 . ILE A 1 125 ? 132.925 9.921   4.801   1.00 0.00 ? 125 ILE A HD12 1  
ATOM 2035  H HD13 . ILE A 1 125 ? 131.872 8.566   4.403   1.00 0.00 ? 125 ILE A HD13 1  
ATOM 2036  N N    . TYR A 1 126 ? 131.456 11.751  2.083   1.00 0.00 ? 126 TYR A N    1  
ATOM 2037  C CA   . TYR A 1 126 ? 132.273 11.494  0.926   1.00 0.00 ? 126 TYR A CA   1  
ATOM 2038  C C    . TYR A 1 126 ? 133.082 12.734  0.560   1.00 0.00 ? 126 TYR A C    1  
ATOM 2039  O O    . TYR A 1 126 ? 134.233 12.631  0.141   1.00 0.00 ? 126 TYR A O    1  
ATOM 2040  C CB   . TYR A 1 126 ? 131.444 10.994  -0.256  1.00 0.00 ? 126 TYR A CB   1  
ATOM 2041  C CG   . TYR A 1 126 ? 132.268 10.701  -1.487  1.00 0.00 ? 126 TYR A CG   1  
ATOM 2042  C CD1  . TYR A 1 126 ? 133.161 9.643   -1.507  1.00 0.00 ? 126 TYR A CD1  1  
ATOM 2043  C CD2  . TYR A 1 126 ? 132.189 11.509  -2.603  1.00 0.00 ? 126 TYR A CD2  1  
ATOM 2044  C CE1  . TYR A 1 126 ? 133.939 9.392   -2.607  1.00 0.00 ? 126 TYR A CE1  1  
ATOM 2045  C CE2  . TYR A 1 126 ? 132.964 11.276  -3.703  1.00 0.00 ? 126 TYR A CE2  1  
ATOM 2046  C CZ   . TYR A 1 126 ? 133.834 10.216  -3.709  1.00 0.00 ? 126 TYR A CZ   1  
ATOM 2047  O OH   . TYR A 1 126 ? 134.627 9.999   -4.808  1.00 0.00 ? 126 TYR A OH   1  
ATOM 2048  H H    . TYR A 1 126 ? 130.484 11.875  1.982   1.00 0.00 ? 126 TYR A H    1  
ATOM 2049  H HA   . TYR A 1 126 ? 132.975 10.723  1.211   1.00 0.00 ? 126 TYR A HA   1  
ATOM 2050  H HB2  . TYR A 1 126 ? 130.935 10.084  0.026   1.00 0.00 ? 126 TYR A HB2  1  
ATOM 2051  H HB3  . TYR A 1 126 ? 130.711 11.744  -0.516  1.00 0.00 ? 126 TYR A HB3  1  
ATOM 2052  H HD1  . TYR A 1 126 ? 133.233 9.003   -0.641  1.00 0.00 ? 126 TYR A HD1  1  
ATOM 2053  H HD2  . TYR A 1 126 ? 131.492 12.333  -2.614  1.00 0.00 ? 126 TYR A HD2  1  
ATOM 2054  H HE1  . TYR A 1 126 ? 134.619 8.550   -2.598  1.00 0.00 ? 126 TYR A HE1  1  
ATOM 2055  H HE2  . TYR A 1 126 ? 132.888 11.930  -4.559  1.00 0.00 ? 126 TYR A HE2  1  
ATOM 2056  H HH   . TYR A 1 126 ? 134.912 9.077   -4.752  1.00 0.00 ? 126 TYR A HH   1  
ATOM 2057  N N    . LEU A 1 127 ? 132.503 13.904  0.763   1.00 0.00 ? 127 LEU A N    1  
ATOM 2058  C CA   . LEU A 1 127 ? 133.199 15.152  0.496   1.00 0.00 ? 127 LEU A CA   1  
ATOM 2059  C C    . LEU A 1 127 ? 134.307 15.383  1.507   1.00 0.00 ? 127 LEU A C    1  
ATOM 2060  O O    . LEU A 1 127 ? 135.232 16.158  1.263   1.00 0.00 ? 127 LEU A O    1  
ATOM 2061  C CB   . LEU A 1 127 ? 132.241 16.346  0.439   1.00 0.00 ? 127 LEU A CB   1  
ATOM 2062  C CG   . LEU A 1 127 ? 131.182 16.291  -0.668  1.00 0.00 ? 127 LEU A CG   1  
ATOM 2063  C CD1  . LEU A 1 127 ? 130.327 17.542  -0.668  1.00 0.00 ? 127 LEU A CD1  1  
ATOM 2064  C CD2  . LEU A 1 127 ? 131.824 16.078  -2.028  1.00 0.00 ? 127 LEU A CD2  1  
ATOM 2065  H H    . LEU A 1 127 ? 131.566 13.934  1.067   1.00 0.00 ? 127 LEU A H    1  
ATOM 2066  H HA   . LEU A 1 127 ? 133.668 15.037  -0.470  1.00 0.00 ? 127 LEU A HA   1  
ATOM 2067  H HB2  . LEU A 1 127 ? 131.733 16.412  1.389   1.00 0.00 ? 127 LEU A HB2  1  
ATOM 2068  H HB3  . LEU A 1 127 ? 132.829 17.241  0.300   1.00 0.00 ? 127 LEU A HB3  1  
ATOM 2069  H HG   . LEU A 1 127 ? 130.527 15.454  -0.470  1.00 0.00 ? 127 LEU A HG   1  
ATOM 2070  H HD11 . LEU A 1 127 ? 129.839 17.643  0.290   1.00 0.00 ? 127 LEU A HD11 1  
ATOM 2071  H HD12 . LEU A 1 127 ? 129.579 17.458  -1.441  1.00 0.00 ? 127 LEU A HD12 1  
ATOM 2072  H HD13 . LEU A 1 127 ? 130.947 18.407  -0.854  1.00 0.00 ? 127 LEU A HD13 1  
ATOM 2073  H HD21 . LEU A 1 127 ? 131.047 16.028  -2.778  1.00 0.00 ? 127 LEU A HD21 1  
ATOM 2074  H HD22 . LEU A 1 127 ? 132.380 15.153  -2.022  1.00 0.00 ? 127 LEU A HD22 1  
ATOM 2075  H HD23 . LEU A 1 127 ? 132.487 16.900  -2.251  1.00 0.00 ? 127 LEU A HD23 1  
ATOM 2076  N N    . ASP A 1 128 ? 134.229 14.707  2.630   1.00 0.00 ? 128 ASP A N    1  
ATOM 2077  C CA   . ASP A 1 128 ? 135.288 14.767  3.619   1.00 0.00 ? 128 ASP A CA   1  
ATOM 2078  C C    . ASP A 1 128 ? 136.429 13.886  3.166   1.00 0.00 ? 128 ASP A C    1  
ATOM 2079  O O    . ASP A 1 128 ? 137.583 14.218  3.361   1.00 0.00 ? 128 ASP A O    1  
ATOM 2080  C CB   . ASP A 1 128 ? 134.810 14.330  4.995   1.00 0.00 ? 128 ASP A CB   1  
ATOM 2081  C CG   . ASP A 1 128 ? 135.856 14.535  6.055   1.00 0.00 ? 128 ASP A CG   1  
ATOM 2082  O OD1  . ASP A 1 128 ? 135.914 15.642  6.642   1.00 0.00 ? 128 ASP A OD1  1  
ATOM 2083  O OD2  . ASP A 1 128 ? 136.626 13.597  6.339   1.00 0.00 ? 128 ASP A OD2  1  
ATOM 2084  H H    . ASP A 1 128 ? 133.426 14.174  2.818   1.00 0.00 ? 128 ASP A H    1  
ATOM 2085  H HA   . ASP A 1 128 ? 135.638 15.788  3.663   1.00 0.00 ? 128 ASP A HA   1  
ATOM 2086  H HB2  . ASP A 1 128 ? 133.935 14.903  5.263   1.00 0.00 ? 128 ASP A HB2  1  
ATOM 2087  H HB3  . ASP A 1 128 ? 134.552 13.281  4.962   1.00 0.00 ? 128 ASP A HB3  1  
ATOM 2088  N N    . LEU A 1 129 ? 136.088 12.766  2.521   1.00 0.00 ? 129 LEU A N    1  
ATOM 2089  C CA   . LEU A 1 129 ? 137.093 11.866  1.941   1.00 0.00 ? 129 LEU A CA   1  
ATOM 2090  C C    . LEU A 1 129 ? 137.766 12.598  0.777   1.00 0.00 ? 129 LEU A C    1  
ATOM 2091  O O    . LEU A 1 129 ? 138.937 12.376  0.466   1.00 0.00 ? 129 LEU A O    1  
ATOM 2092  C CB   . LEU A 1 129 ? 136.439 10.580  1.400   1.00 0.00 ? 129 LEU A CB   1  
ATOM 2093  C CG   . LEU A 1 129 ? 135.417 9.882   2.310   1.00 0.00 ? 129 LEU A CG   1  
ATOM 2094  C CD1  . LEU A 1 129 ? 134.681 8.823   1.543   1.00 0.00 ? 129 LEU A CD1  1  
ATOM 2095  C CD2  . LEU A 1 129 ? 136.079 9.259   3.528   1.00 0.00 ? 129 LEU A CD2  1  
ATOM 2096  H H    . LEU A 1 129 ? 135.137 12.529  2.460   1.00 0.00 ? 129 LEU A H    1  
ATOM 2097  H HA   . LEU A 1 129 ? 137.825 11.623  2.698   1.00 0.00 ? 129 LEU A HA   1  
ATOM 2098  H HB2  . LEU A 1 129 ? 136.023 10.736  0.414   1.00 0.00 ? 129 LEU A HB2  1  
ATOM 2099  H HB3  . LEU A 1 129 ? 137.253 9.883   1.259   1.00 0.00 ? 129 LEU A HB3  1  
ATOM 2100  H HG   . LEU A 1 129 ? 134.695 10.610  2.649   1.00 0.00 ? 129 LEU A HG   1  
ATOM 2101  H HD11 . LEU A 1 129 ? 135.388 8.103   1.158   1.00 0.00 ? 129 LEU A HD11 1  
ATOM 2102  H HD12 . LEU A 1 129 ? 134.153 9.280   0.719   1.00 0.00 ? 129 LEU A HD12 1  
ATOM 2103  H HD13 . LEU A 1 129 ? 133.978 8.326   2.194   1.00 0.00 ? 129 LEU A HD13 1  
ATOM 2104  H HD21 . LEU A 1 129 ? 136.502 10.027  4.158   1.00 0.00 ? 129 LEU A HD21 1  
ATOM 2105  H HD22 . LEU A 1 129 ? 136.860 8.590   3.198   1.00 0.00 ? 129 LEU A HD22 1  
ATOM 2106  H HD23 . LEU A 1 129 ? 135.335 8.694   4.073   1.00 0.00 ? 129 LEU A HD23 1  
ATOM 2107  N N    . MET A 1 130 ? 136.989 13.469  0.135   1.00 0.00 ? 130 MET A N    1  
ATOM 2108  C CA   . MET A 1 130 ? 137.472 14.300  -0.954  1.00 0.00 ? 130 MET A CA   1  
ATOM 2109  C C    . MET A 1 130 ? 138.426 15.362  -0.445  1.00 0.00 ? 130 MET A C    1  
ATOM 2110  O O    . MET A 1 130 ? 139.443 15.637  -1.080  1.00 0.00 ? 130 MET A O    1  
ATOM 2111  C CB   . MET A 1 130 ? 136.308 14.987  -1.712  1.00 0.00 ? 130 MET A CB   1  
ATOM 2112  C CG   . MET A 1 130 ? 135.328 14.077  -2.485  1.00 0.00 ? 130 MET A CG   1  
ATOM 2113  S SD   . MET A 1 130 ? 136.072 13.160  -3.859  1.00 0.00 ? 130 MET A SD   1  
ATOM 2114  C CE   . MET A 1 130 ? 137.021 11.908  -2.997  1.00 0.00 ? 130 MET A CE   1  
ATOM 2115  H H    . MET A 1 130 ? 136.047 13.511  0.407   1.00 0.00 ? 130 MET A H    1  
ATOM 2116  H HA   . MET A 1 130 ? 138.001 13.663  -1.647  1.00 0.00 ? 130 MET A HA   1  
ATOM 2117  H HB2  . MET A 1 130 ? 135.728 15.546  -0.993  1.00 0.00 ? 130 MET A HB2  1  
ATOM 2118  H HB3  . MET A 1 130 ? 136.737 15.690  -2.411  1.00 0.00 ? 130 MET A HB3  1  
ATOM 2119  H HG2  . MET A 1 130 ? 134.905 13.350  -1.807  1.00 0.00 ? 130 MET A HG2  1  
ATOM 2120  H HG3  . MET A 1 130 ? 134.526 14.683  -2.879  1.00 0.00 ? 130 MET A HG3  1  
ATOM 2121  H HE1  . MET A 1 130 ? 136.353 11.272  -2.435  1.00 0.00 ? 130 MET A HE1  1  
ATOM 2122  H HE2  . MET A 1 130 ? 137.709 12.392  -2.319  1.00 0.00 ? 130 MET A HE2  1  
ATOM 2123  H HE3  . MET A 1 130 ? 137.583 11.310  -3.704  1.00 0.00 ? 130 MET A HE3  1  
ATOM 2124  N N    . GLU A 1 131 ? 138.094 15.936  0.704   1.00 0.00 ? 131 GLU A N    1  
ATOM 2125  C CA   . GLU A 1 131 ? 138.840 17.037  1.307   1.00 0.00 ? 131 GLU A CA   1  
ATOM 2126  C C    . GLU A 1 131 ? 138.820 18.273  0.424   1.00 0.00 ? 131 GLU A C    1  
ATOM 2127  O O    . GLU A 1 131 ? 139.682 18.470  -0.442  1.00 0.00 ? 131 GLU A O    1  
ATOM 2128  C CB   . GLU A 1 131 ? 140.265 16.648  1.745   1.00 0.00 ? 131 GLU A CB   1  
ATOM 2129  C CG   . GLU A 1 131 ? 140.275 15.671  2.901   1.00 0.00 ? 131 GLU A CG   1  
ATOM 2130  C CD   . GLU A 1 131 ? 141.645 15.335  3.404   1.00 0.00 ? 131 GLU A CD   1  
ATOM 2131  O OE1  . GLU A 1 131 ? 142.310 16.213  3.984   1.00 0.00 ? 131 GLU A OE1  1  
ATOM 2132  O OE2  . GLU A 1 131 ? 142.072 14.181  3.262   1.00 0.00 ? 131 GLU A OE2  1  
ATOM 2133  H H    . GLU A 1 131 ? 137.297 15.607  1.170   1.00 0.00 ? 131 GLU A H    1  
ATOM 2134  H HA   . GLU A 1 131 ? 138.269 17.300  2.186   1.00 0.00 ? 131 GLU A HA   1  
ATOM 2135  H HB2  . GLU A 1 131 ? 140.777 16.197  0.910   1.00 0.00 ? 131 GLU A HB2  1  
ATOM 2136  H HB3  . GLU A 1 131 ? 140.795 17.540  2.047   1.00 0.00 ? 131 GLU A HB3  1  
ATOM 2137  H HG2  . GLU A 1 131 ? 139.714 16.103  3.717   1.00 0.00 ? 131 GLU A HG2  1  
ATOM 2138  H HG3  . GLU A 1 131 ? 139.788 14.761  2.580   1.00 0.00 ? 131 GLU A HG3  1  
ATOM 2139  N N    . GLY A 1 132 ? 137.803 19.060  0.614   1.00 0.00 ? 132 GLY A N    1  
ATOM 2140  C CA   . GLY A 1 132 ? 137.620 20.264  -0.136  1.00 0.00 ? 132 GLY A CA   1  
ATOM 2141  C C    . GLY A 1 132 ? 136.637 21.139  0.564   1.00 0.00 ? 132 GLY A C    1  
ATOM 2142  O O    . GLY A 1 132 ? 137.014 22.123  1.223   1.00 0.00 ? 132 GLY A O    1  
ATOM 2143  H H    . GLY A 1 132 ? 137.147 18.834  1.314   1.00 0.00 ? 132 GLY A H    1  
ATOM 2144  H HA2  . GLY A 1 132 ? 138.567 20.776  -0.225  1.00 0.00 ? 132 GLY A HA2  1  
ATOM 2145  H HA3  . GLY A 1 132 ? 137.242 20.026  -1.118  1.00 0.00 ? 132 GLY A HA3  1  
ATOM 2146  N N    . ARG A 1 133 ? 135.383 20.775  0.460   1.00 0.00 ? 133 ARG A N    1  
ATOM 2147  C CA   . ARG A 1 133 ? 134.320 21.464  1.143   1.00 0.00 ? 133 ARG A CA   1  
ATOM 2148  C C    . ARG A 1 133 ? 133.089 20.576  1.234   1.00 0.00 ? 133 ARG A C    1  
ATOM 2149  O O    . ARG A 1 133 ? 132.826 19.776  0.327   1.00 0.00 ? 133 ARG A O    1  
ATOM 2150  C CB   . ARG A 1 133 ? 133.972 22.813  0.474   1.00 0.00 ? 133 ARG A CB   1  
ATOM 2151  C CG   . ARG A 1 133 ? 133.479 22.751  -0.968  1.00 0.00 ? 133 ARG A CG   1  
ATOM 2152  C CD   . ARG A 1 133 ? 133.123 24.147  -1.442  1.00 0.00 ? 133 ARG A CD   1  
ATOM 2153  N NE   . ARG A 1 133 ? 132.713 24.211  -2.852  1.00 0.00 ? 133 ARG A NE   1  
ATOM 2154  C CZ   . ARG A 1 133 ? 132.833 25.314  -3.622  1.00 0.00 ? 133 ARG A CZ   1  
ATOM 2155  N NH1  . ARG A 1 133 ? 133.284 26.459  -3.099  1.00 0.00 ? 133 ARG A NH1  1  
ATOM 2156  N NH2  . ARG A 1 133 ? 132.484 25.279  -4.894  1.00 0.00 ? 133 ARG A NH2  1  
ATOM 2157  H H    . ARG A 1 133 ? 135.149 20.004  -0.104  1.00 0.00 ? 133 ARG A H    1  
ATOM 2158  H HA   . ARG A 1 133 ? 134.667 21.655  2.148   1.00 0.00 ? 133 ARG A HA   1  
ATOM 2159  H HB2  . ARG A 1 133 ? 133.199 23.292  1.056   1.00 0.00 ? 133 ARG A HB2  1  
ATOM 2160  H HB3  . ARG A 1 133 ? 134.851 23.439  0.504   1.00 0.00 ? 133 ARG A HB3  1  
ATOM 2161  H HG2  . ARG A 1 133 ? 134.259 22.344  -1.595  1.00 0.00 ? 133 ARG A HG2  1  
ATOM 2162  H HG3  . ARG A 1 133 ? 132.600 22.123  -1.018  1.00 0.00 ? 133 ARG A HG3  1  
ATOM 2163  H HD2  . ARG A 1 133 ? 132.311 24.518  -0.836  1.00 0.00 ? 133 ARG A HD2  1  
ATOM 2164  H HD3  . ARG A 1 133 ? 133.985 24.782  -1.302  1.00 0.00 ? 133 ARG A HD3  1  
ATOM 2165  H HE   . ARG A 1 133 ? 132.341 23.375  -3.230  1.00 0.00 ? 133 ARG A HE   1  
ATOM 2166  H HH11 . ARG A 1 133 ? 133.539 26.523  -2.126  1.00 0.00 ? 133 ARG A HH11 1  
ATOM 2167  H HH12 . ARG A 1 133 ? 133.403 27.304  -3.636  1.00 0.00 ? 133 ARG A HH12 1  
ATOM 2168  H HH21 . ARG A 1 133 ? 132.116 24.449  -5.330  1.00 0.00 ? 133 ARG A HH21 1  
ATOM 2169  H HH22 . ARG A 1 133 ? 132.601 26.072  -5.504  1.00 0.00 ? 133 ARG A HH22 1  
ATOM 2170  N N    . PRO A 1 134 ? 132.368 20.637  2.357   1.00 0.00 ? 134 PRO A N    1  
ATOM 2171  C CA   . PRO A 1 134 ? 131.101 19.936  2.518   1.00 0.00 ? 134 PRO A CA   1  
ATOM 2172  C C    . PRO A 1 134 ? 130.017 20.643  1.711   1.00 0.00 ? 134 PRO A C    1  
ATOM 2173  O O    . PRO A 1 134 ? 130.217 21.788  1.260   1.00 0.00 ? 134 PRO A O    1  
ATOM 2174  C CB   . PRO A 1 134 ? 130.799 20.055  4.025   1.00 0.00 ? 134 PRO A CB   1  
ATOM 2175  C CG   . PRO A 1 134 ? 132.050 20.589  4.641   1.00 0.00 ? 134 PRO A CG   1  
ATOM 2176  C CD   . PRO A 1 134 ? 132.743 21.365  3.573   1.00 0.00 ? 134 PRO A CD   1  
ATOM 2177  H HA   . PRO A 1 134 ? 131.168 18.899  2.221   1.00 0.00 ? 134 PRO A HA   1  
ATOM 2178  H HB2  . PRO A 1 134 ? 129.968 20.727  4.174   1.00 0.00 ? 134 PRO A HB2  1  
ATOM 2179  H HB3  . PRO A 1 134 ? 130.552 19.081  4.419   1.00 0.00 ? 134 PRO A HB3  1  
ATOM 2180  H HG2  . PRO A 1 134 ? 131.802 21.236  5.468   1.00 0.00 ? 134 PRO A HG2  1  
ATOM 2181  H HG3  . PRO A 1 134 ? 132.673 19.773  4.977   1.00 0.00 ? 134 PRO A HG3  1  
ATOM 2182  H HD2  . PRO A 1 134 ? 132.383 22.383  3.547   1.00 0.00 ? 134 PRO A HD2  1  
ATOM 2183  H HD3  . PRO A 1 134 ? 133.814 21.344  3.720   1.00 0.00 ? 134 PRO A HD3  1  
ATOM 2184  N N    . SER A 1 1   ? 137.618 4.946   7.625   1.00 0.00 ? 1   SER A N    2  
ATOM 2185  C CA   . SER A 1 1   ? 138.345 6.130   7.225   1.00 0.00 ? 1   SER A CA   2  
ATOM 2186  C C    . SER A 1 1   ? 139.837 5.791   6.930   1.00 0.00 ? 1   SER A C    2  
ATOM 2187  O O    . SER A 1 1   ? 140.709 6.647   7.017   1.00 0.00 ? 1   SER A O    2  
ATOM 2188  C CB   . SER A 1 1   ? 138.244 7.124   8.363   1.00 0.00 ? 1   SER A CB   2  
ATOM 2189  O OG   . SER A 1 1   ? 136.883 7.295   8.754   1.00 0.00 ? 1   SER A OG   2  
ATOM 2190  H H1   . SER A 1 1   ? 138.088 4.538   8.462   1.00 0.00 ? 1   SER A H1   2  
ATOM 2191  H H2   . SER A 1 1   ? 137.595 4.231   6.865   1.00 0.00 ? 1   SER A H2   2  
ATOM 2192  H H3   . SER A 1 1   ? 136.647 5.197   7.906   1.00 0.00 ? 1   SER A H3   2  
ATOM 2193  H HA   . SER A 1 1   ? 137.884 6.552   6.343   1.00 0.00 ? 1   SER A HA   2  
ATOM 2194  H HB2  . SER A 1 1   ? 138.810 6.763   9.209   1.00 0.00 ? 1   SER A HB2  2  
ATOM 2195  H HB3  . SER A 1 1   ? 138.637 8.078   8.045   1.00 0.00 ? 1   SER A HB3  2  
ATOM 2196  H HG   . SER A 1 1   ? 136.534 8.076   8.291   1.00 0.00 ? 1   SER A HG   2  
ATOM 2197  N N    . MET A 1 2   ? 140.114 4.558   6.520   1.00 0.00 ? 2   MET A N    2  
ATOM 2198  C CA   . MET A 1 2   ? 141.488 4.097   6.254   1.00 0.00 ? 2   MET A CA   2  
ATOM 2199  C C    . MET A 1 2   ? 141.779 4.137   4.759   1.00 0.00 ? 2   MET A C    2  
ATOM 2200  O O    . MET A 1 2   ? 142.646 3.419   4.245   1.00 0.00 ? 2   MET A O    2  
ATOM 2201  C CB   . MET A 1 2   ? 141.684 2.667   6.775   1.00 0.00 ? 2   MET A CB   2  
ATOM 2202  C CG   . MET A 1 2   ? 141.574 2.502   8.280   1.00 0.00 ? 2   MET A CG   2  
ATOM 2203  S SD   . MET A 1 2   ? 142.848 3.413   9.177   1.00 0.00 ? 2   MET A SD   2  
ATOM 2204  C CE   . MET A 1 2   ? 142.482 2.918   10.861  1.00 0.00 ? 2   MET A CE   2  
ATOM 2205  H H    . MET A 1 2   ? 139.382 3.916   6.348   1.00 0.00 ? 2   MET A H    2  
ATOM 2206  H HA   . MET A 1 2   ? 142.171 4.761   6.758   1.00 0.00 ? 2   MET A HA   2  
ATOM 2207  H HB2  . MET A 1 2   ? 140.940 2.029   6.320   1.00 0.00 ? 2   MET A HB2  2  
ATOM 2208  H HB3  . MET A 1 2   ? 142.662 2.324   6.469   1.00 0.00 ? 2   MET A HB3  2  
ATOM 2209  H HG2  . MET A 1 2   ? 140.607 2.862   8.597   1.00 0.00 ? 2   MET A HG2  2  
ATOM 2210  H HG3  . MET A 1 2   ? 141.663 1.453   8.521   1.00 0.00 ? 2   MET A HG3  2  
ATOM 2211  H HE1  . MET A 1 2   ? 141.479 3.223   11.117  1.00 0.00 ? 2   MET A HE1  2  
ATOM 2212  H HE2  . MET A 1 2   ? 143.186 3.388   11.532  1.00 0.00 ? 2   MET A HE2  2  
ATOM 2213  H HE3  . MET A 1 2   ? 142.566 1.844   10.945  1.00 0.00 ? 2   MET A HE3  2  
ATOM 2214  N N    . VAL A 1 3   ? 141.095 4.994   4.086   1.00 0.00 ? 3   VAL A N    2  
ATOM 2215  C CA   . VAL A 1 3   ? 141.198 5.116   2.651   1.00 0.00 ? 3   VAL A CA   2  
ATOM 2216  C C    . VAL A 1 3   ? 142.043 6.335   2.250   1.00 0.00 ? 3   VAL A C    2  
ATOM 2217  O O    . VAL A 1 3   ? 142.052 7.359   2.939   1.00 0.00 ? 3   VAL A O    2  
ATOM 2218  C CB   . VAL A 1 3   ? 139.771 5.178   2.005   1.00 0.00 ? 3   VAL A CB   2  
ATOM 2219  C CG1  . VAL A 1 3   ? 138.960 6.328   2.572   1.00 0.00 ? 3   VAL A CG1  2  
ATOM 2220  C CG2  . VAL A 1 3   ? 139.831 5.288   0.491   1.00 0.00 ? 3   VAL A CG2  2  
ATOM 2221  H H    . VAL A 1 3   ? 140.504 5.587   4.593   1.00 0.00 ? 3   VAL A H    2  
ATOM 2222  H HA   . VAL A 1 3   ? 141.693 4.228   2.286   1.00 0.00 ? 3   VAL A HA   2  
ATOM 2223  H HB   . VAL A 1 3   ? 139.255 4.263   2.258   1.00 0.00 ? 3   VAL A HB   2  
ATOM 2224  H HG11 . VAL A 1 3   ? 138.850 6.180   3.637   1.00 0.00 ? 3   VAL A HG11 2  
ATOM 2225  H HG12 . VAL A 1 3   ? 137.986 6.322   2.106   1.00 0.00 ? 3   VAL A HG12 2  
ATOM 2226  H HG13 . VAL A 1 3   ? 139.463 7.264   2.377   1.00 0.00 ? 3   VAL A HG13 2  
ATOM 2227  H HG21 . VAL A 1 3   ? 138.840 5.113   0.094   1.00 0.00 ? 3   VAL A HG21 2  
ATOM 2228  H HG22 . VAL A 1 3   ? 140.530 4.580   0.075   1.00 0.00 ? 3   VAL A HG22 2  
ATOM 2229  H HG23 . VAL A 1 3   ? 140.116 6.297   0.223   1.00 0.00 ? 3   VAL A HG23 2  
ATOM 2230  N N    . SER A 1 4   ? 142.806 6.178   1.205   1.00 0.00 ? 4   SER A N    2  
ATOM 2231  C CA   . SER A 1 4   ? 143.539 7.257   0.601   1.00 0.00 ? 4   SER A CA   2  
ATOM 2232  C C    . SER A 1 4   ? 142.552 8.121   -0.178  1.00 0.00 ? 4   SER A C    2  
ATOM 2233  O O    . SER A 1 4   ? 141.602 7.590   -0.751  1.00 0.00 ? 4   SER A O    2  
ATOM 2234  C CB   . SER A 1 4   ? 144.592 6.670   -0.363  1.00 0.00 ? 4   SER A CB   2  
ATOM 2235  O OG   . SER A 1 4   ? 145.196 7.676   -1.162  1.00 0.00 ? 4   SER A OG   2  
ATOM 2236  H H    . SER A 1 4   ? 142.895 5.278   0.818   1.00 0.00 ? 4   SER A H    2  
ATOM 2237  H HA   . SER A 1 4   ? 144.033 7.835   1.366   1.00 0.00 ? 4   SER A HA   2  
ATOM 2238  H HB2  . SER A 1 4   ? 145.364 6.178   0.209   1.00 0.00 ? 4   SER A HB2  2  
ATOM 2239  H HB3  . SER A 1 4   ? 144.116 5.949   -1.011  1.00 0.00 ? 4   SER A HB3  2  
ATOM 2240  H HG   . SER A 1 4   ? 145.941 8.071   -0.680  1.00 0.00 ? 4   SER A HG   2  
ATOM 2241  N N    . PRO A 1 5   ? 142.747 9.455   -0.221  1.00 0.00 ? 5   PRO A N    2  
ATOM 2242  C CA   . PRO A 1 5   ? 141.883 10.356  -1.002  1.00 0.00 ? 5   PRO A CA   2  
ATOM 2243  C C    . PRO A 1 5   ? 141.843 9.947   -2.483  1.00 0.00 ? 5   PRO A C    2  
ATOM 2244  O O    . PRO A 1 5   ? 140.869 10.198  -3.185  1.00 0.00 ? 5   PRO A O    2  
ATOM 2245  C CB   . PRO A 1 5   ? 142.551 11.722  -0.844  1.00 0.00 ? 5   PRO A CB   2  
ATOM 2246  C CG   . PRO A 1 5   ? 143.307 11.621  0.431   1.00 0.00 ? 5   PRO A CG   2  
ATOM 2247  C CD   . PRO A 1 5   ? 143.790 10.203  0.511   1.00 0.00 ? 5   PRO A CD   2  
ATOM 2248  H HA   . PRO A 1 5   ? 140.875 10.380  -0.612  1.00 0.00 ? 5   PRO A HA   2  
ATOM 2249  H HB2  . PRO A 1 5   ? 143.206 11.901  -1.684  1.00 0.00 ? 5   PRO A HB2  2  
ATOM 2250  H HB3  . PRO A 1 5   ? 141.797 12.495  -0.794  1.00 0.00 ? 5   PRO A HB3  2  
ATOM 2251  H HG2  . PRO A 1 5   ? 144.142 12.306  0.418   1.00 0.00 ? 5   PRO A HG2  2  
ATOM 2252  H HG3  . PRO A 1 5   ? 142.653 11.840  1.263   1.00 0.00 ? 5   PRO A HG3  2  
ATOM 2253  H HD2  . PRO A 1 5   ? 144.749 10.105  0.025   1.00 0.00 ? 5   PRO A HD2  2  
ATOM 2254  H HD3  . PRO A 1 5   ? 143.847 9.876   1.538   1.00 0.00 ? 5   PRO A HD3  2  
ATOM 2255  N N    . GLU A 1 6   ? 142.902 9.297   -2.937  1.00 0.00 ? 6   GLU A N    2  
ATOM 2256  C CA   . GLU A 1 6   ? 142.973 8.791   -4.294  1.00 0.00 ? 6   GLU A CA   2  
ATOM 2257  C C    . GLU A 1 6   ? 142.063 7.582   -4.466  1.00 0.00 ? 6   GLU A C    2  
ATOM 2258  O O    . GLU A 1 6   ? 141.273 7.511   -5.401  1.00 0.00 ? 6   GLU A O    2  
ATOM 2259  C CB   . GLU A 1 6   ? 144.405 8.435   -4.649  1.00 0.00 ? 6   GLU A CB   2  
ATOM 2260  C CG   . GLU A 1 6   ? 145.307 9.635   -4.809  1.00 0.00 ? 6   GLU A CG   2  
ATOM 2261  C CD   . GLU A 1 6   ? 144.845 10.524  -5.934  1.00 0.00 ? 6   GLU A CD   2  
ATOM 2262  O OE1  . GLU A 1 6   ? 145.054 10.150  -7.110  1.00 0.00 ? 6   GLU A OE1  2  
ATOM 2263  O OE2  . GLU A 1 6   ? 144.253 11.598  -5.665  1.00 0.00 ? 6   GLU A OE2  2  
ATOM 2264  H H    . GLU A 1 6   ? 143.658 9.149   -2.329  1.00 0.00 ? 6   GLU A H    2  
ATOM 2265  H HA   . GLU A 1 6   ? 142.635 9.577   -4.952  1.00 0.00 ? 6   GLU A HA   2  
ATOM 2266  H HB2  . GLU A 1 6   ? 144.811 7.808   -3.868  1.00 0.00 ? 6   GLU A HB2  2  
ATOM 2267  H HB3  . GLU A 1 6   ? 144.407 7.882   -5.576  1.00 0.00 ? 6   GLU A HB3  2  
ATOM 2268  H HG2  . GLU A 1 6   ? 145.303 10.203  -3.889  1.00 0.00 ? 6   GLU A HG2  2  
ATOM 2269  H HG3  . GLU A 1 6   ? 146.311 9.297   -5.021  1.00 0.00 ? 6   GLU A HG3  2  
ATOM 2270  N N    . GLU A 1 7   ? 142.134 6.664   -3.536  1.00 0.00 ? 7   GLU A N    2  
ATOM 2271  C CA   . GLU A 1 7   ? 141.312 5.476   -3.603  1.00 0.00 ? 7   GLU A CA   2  
ATOM 2272  C C    . GLU A 1 7   ? 139.840 5.870   -3.396  1.00 0.00 ? 7   GLU A C    2  
ATOM 2273  O O    . GLU A 1 7   ? 138.931 5.277   -3.972  1.00 0.00 ? 7   GLU A O    2  
ATOM 2274  C CB   . GLU A 1 7   ? 141.760 4.459   -2.550  1.00 0.00 ? 7   GLU A CB   2  
ATOM 2275  C CG   . GLU A 1 7   ? 141.104 3.096   -2.681  1.00 0.00 ? 7   GLU A CG   2  
ATOM 2276  C CD   . GLU A 1 7   ? 141.458 2.410   -3.984  1.00 0.00 ? 7   GLU A CD   2  
ATOM 2277  O OE1  . GLU A 1 7   ? 140.780 2.626   -4.998  1.00 0.00 ? 7   GLU A OE1  2  
ATOM 2278  O OE2  . GLU A 1 7   ? 142.427 1.641   -4.014  1.00 0.00 ? 7   GLU A OE2  2  
ATOM 2279  H H    . GLU A 1 7   ? 142.747 6.793   -2.784  1.00 0.00 ? 7   GLU A H    2  
ATOM 2280  H HA   . GLU A 1 7   ? 141.425 5.050   -4.590  1.00 0.00 ? 7   GLU A HA   2  
ATOM 2281  H HB2  . GLU A 1 7   ? 142.828 4.325   -2.629  1.00 0.00 ? 7   GLU A HB2  2  
ATOM 2282  H HB3  . GLU A 1 7   ? 141.531 4.851   -1.569  1.00 0.00 ? 7   GLU A HB3  2  
ATOM 2283  H HG2  . GLU A 1 7   ? 141.428 2.473   -1.861  1.00 0.00 ? 7   GLU A HG2  2  
ATOM 2284  H HG3  . GLU A 1 7   ? 140.033 3.221   -2.636  1.00 0.00 ? 7   GLU A HG3  2  
ATOM 2285  N N    . ALA A 1 8   ? 139.631 6.901   -2.594  1.00 0.00 ? 8   ALA A N    2  
ATOM 2286  C CA   . ALA A 1 8   ? 138.310 7.415   -2.341  1.00 0.00 ? 8   ALA A CA   2  
ATOM 2287  C C    . ALA A 1 8   ? 137.714 8.068   -3.603  1.00 0.00 ? 8   ALA A C    2  
ATOM 2288  O O    . ALA A 1 8   ? 136.546 7.877   -3.880  1.00 0.00 ? 8   ALA A O    2  
ATOM 2289  C CB   . ALA A 1 8   ? 138.298 8.346   -1.115  1.00 0.00 ? 8   ALA A CB   2  
ATOM 2290  H H    . ALA A 1 8   ? 140.401 7.304   -2.134  1.00 0.00 ? 8   ALA A H    2  
ATOM 2291  H HA   . ALA A 1 8   ? 137.696 6.554   -2.117  1.00 0.00 ? 8   ALA A HA   2  
ATOM 2292  H HB1  . ALA A 1 8   ? 138.881 9.231   -1.330  1.00 0.00 ? 8   ALA A HB1  2  
ATOM 2293  H HB2  . ALA A 1 8   ? 138.771 7.810   -0.303  1.00 0.00 ? 8   ALA A HB2  2  
ATOM 2294  H HB3  . ALA A 1 8   ? 137.293 8.630   -0.819  1.00 0.00 ? 8   ALA A HB3  2  
ATOM 2295  N N    . VAL A 1 9   ? 138.527 8.811   -4.406  1.00 0.00 ? 9   VAL A N    2  
ATOM 2296  C CA   . VAL A 1 9   ? 137.993 9.392   -5.676  1.00 0.00 ? 9   VAL A CA   2  
ATOM 2297  C C    . VAL A 1 9   ? 137.601 8.296   -6.652  1.00 0.00 ? 9   VAL A C    2  
ATOM 2298  O O    . VAL A 1 9   ? 136.732 8.489   -7.514  1.00 0.00 ? 9   VAL A O    2  
ATOM 2299  C CB   . VAL A 1 9   ? 138.921 10.426  -6.409  1.00 0.00 ? 9   VAL A CB   2  
ATOM 2300  C CG1  . VAL A 1 9   ? 139.247 11.603  -5.544  1.00 0.00 ? 9   VAL A CG1  2  
ATOM 2301  C CG2  . VAL A 1 9   ? 140.184 9.809   -6.985  1.00 0.00 ? 9   VAL A CG2  2  
ATOM 2302  H H    . VAL A 1 9   ? 139.449 9.001   -4.131  1.00 0.00 ? 9   VAL A H    2  
ATOM 2303  H HA   . VAL A 1 9   ? 137.071 9.884   -5.395  1.00 0.00 ? 9   VAL A HA   2  
ATOM 2304  H HB   . VAL A 1 9   ? 138.332 10.807  -7.230  1.00 0.00 ? 9   VAL A HB   2  
ATOM 2305  H HG11 . VAL A 1 9   ? 138.335 12.123  -5.293  1.00 0.00 ? 9   VAL A HG11 2  
ATOM 2306  H HG12 . VAL A 1 9   ? 139.918 12.271  -6.063  1.00 0.00 ? 9   VAL A HG12 2  
ATOM 2307  H HG13 . VAL A 1 9   ? 139.712 11.254  -4.632  1.00 0.00 ? 9   VAL A HG13 2  
ATOM 2308  H HG21 . VAL A 1 9   ? 140.772 10.574  -7.474  1.00 0.00 ? 9   VAL A HG21 2  
ATOM 2309  H HG22 . VAL A 1 9   ? 139.914 9.048   -7.704  1.00 0.00 ? 9   VAL A HG22 2  
ATOM 2310  H HG23 . VAL A 1 9   ? 140.762 9.363   -6.190  1.00 0.00 ? 9   VAL A HG23 2  
ATOM 2311  N N    . LYS A 1 10  ? 138.230 7.141   -6.506  1.00 0.00 ? 10  LYS A N    2  
ATOM 2312  C CA   . LYS A 1 10  ? 137.905 5.985   -7.326  1.00 0.00 ? 10  LYS A CA   2  
ATOM 2313  C C    . LYS A 1 10  ? 136.508 5.446   -6.981  1.00 0.00 ? 10  LYS A C    2  
ATOM 2314  O O    . LYS A 1 10  ? 135.856 4.796   -7.792  1.00 0.00 ? 10  LYS A O    2  
ATOM 2315  C CB   . LYS A 1 10  ? 138.960 4.891   -7.174  1.00 0.00 ? 10  LYS A CB   2  
ATOM 2316  C CG   . LYS A 1 10  ? 140.373 5.351   -7.476  1.00 0.00 ? 10  LYS A CG   2  
ATOM 2317  C CD   . LYS A 1 10  ? 140.490 5.952   -8.860  1.00 0.00 ? 10  LYS A CD   2  
ATOM 2318  C CE   . LYS A 1 10  ? 141.885 6.477   -9.112  1.00 0.00 ? 10  LYS A CE   2  
ATOM 2319  N NZ   . LYS A 1 10  ? 141.980 7.148   -10.419 1.00 0.00 ? 10  LYS A NZ   2  
ATOM 2320  H H    . LYS A 1 10  ? 138.963 7.088   -5.849  1.00 0.00 ? 10  LYS A H    2  
ATOM 2321  H HA   . LYS A 1 10  ? 137.892 6.321   -8.353  1.00 0.00 ? 10  LYS A HA   2  
ATOM 2322  H HB2  . LYS A 1 10  ? 138.936 4.526   -6.158  1.00 0.00 ? 10  LYS A HB2  2  
ATOM 2323  H HB3  . LYS A 1 10  ? 138.717 4.077   -7.841  1.00 0.00 ? 10  LYS A HB3  2  
ATOM 2324  H HG2  . LYS A 1 10  ? 140.657 6.097   -6.748  1.00 0.00 ? 10  LYS A HG2  2  
ATOM 2325  H HG3  . LYS A 1 10  ? 141.038 4.503   -7.399  1.00 0.00 ? 10  LYS A HG3  2  
ATOM 2326  H HD2  . LYS A 1 10  ? 140.263 5.190   -9.590  1.00 0.00 ? 10  LYS A HD2  2  
ATOM 2327  H HD3  . LYS A 1 10  ? 139.782 6.763   -8.952  1.00 0.00 ? 10  LYS A HD3  2  
ATOM 2328  H HE2  . LYS A 1 10  ? 142.138 7.179   -8.331  1.00 0.00 ? 10  LYS A HE2  2  
ATOM 2329  H HE3  . LYS A 1 10  ? 142.575 5.646   -9.087  1.00 0.00 ? 10  LYS A HE3  2  
ATOM 2330  H HZ1  . LYS A 1 10  ? 141.722 6.505   -11.202 1.00 0.00 ? 10  LYS A HZ1  2  
ATOM 2331  H HZ2  . LYS A 1 10  ? 142.934 7.533   -10.583 1.00 0.00 ? 10  LYS A HZ2  2  
ATOM 2332  H HZ3  . LYS A 1 10  ? 141.330 7.963   -10.458 1.00 0.00 ? 10  LYS A HZ3  2  
ATOM 2333  N N    . TRP A 1 11  ? 136.030 5.762   -5.792  1.00 0.00 ? 11  TRP A N    2  
ATOM 2334  C CA   . TRP A 1 11  ? 134.695 5.347   -5.369  1.00 0.00 ? 11  TRP A CA   2  
ATOM 2335  C C    . TRP A 1 11  ? 133.642 6.120   -6.122  1.00 0.00 ? 11  TRP A C    2  
ATOM 2336  O O    . TRP A 1 11  ? 132.502 5.711   -6.194  1.00 0.00 ? 11  TRP A O    2  
ATOM 2337  C CB   . TRP A 1 11  ? 134.495 5.540   -3.874  1.00 0.00 ? 11  TRP A CB   2  
ATOM 2338  C CG   . TRP A 1 11  ? 135.371 4.683   -3.027  1.00 0.00 ? 11  TRP A CG   2  
ATOM 2339  C CD1  . TRP A 1 11  ? 136.092 3.602   -3.422  1.00 0.00 ? 11  TRP A CD1  2  
ATOM 2340  C CD2  . TRP A 1 11  ? 135.577 4.816   -1.629  1.00 0.00 ? 11  TRP A CD2  2  
ATOM 2341  N NE1  . TRP A 1 11  ? 136.760 3.068   -2.359  1.00 0.00 ? 11  TRP A NE1  2  
ATOM 2342  C CE2  . TRP A 1 11  ? 136.453 3.792   -1.239  1.00 0.00 ? 11  TRP A CE2  2  
ATOM 2343  C CE3  . TRP A 1 11  ? 135.109 5.711   -0.668  1.00 0.00 ? 11  TRP A CE3  2  
ATOM 2344  C CZ2  . TRP A 1 11  ? 136.868 3.635   0.070   1.00 0.00 ? 11  TRP A CZ2  2  
ATOM 2345  C CZ3  . TRP A 1 11  ? 135.520 5.548   0.638   1.00 0.00 ? 11  TRP A CZ3  2  
ATOM 2346  C CH2  . TRP A 1 11  ? 136.387 4.519   0.993   1.00 0.00 ? 11  TRP A CH2  2  
ATOM 2347  H H    . TRP A 1 11  ? 136.583 6.284   -5.170  1.00 0.00 ? 11  TRP A H    2  
ATOM 2348  H HA   . TRP A 1 11  ? 134.588 4.300   -5.606  1.00 0.00 ? 11  TRP A HA   2  
ATOM 2349  H HB2  . TRP A 1 11  ? 134.715 6.568   -3.627  1.00 0.00 ? 11  TRP A HB2  2  
ATOM 2350  H HB3  . TRP A 1 11  ? 133.466 5.335   -3.618  1.00 0.00 ? 11  TRP A HB3  2  
ATOM 2351  H HD1  . TRP A 1 11  ? 136.137 3.240   -4.440  1.00 0.00 ? 11  TRP A HD1  2  
ATOM 2352  H HE1  . TRP A 1 11  ? 137.352 2.289   -2.427  1.00 0.00 ? 11  TRP A HE1  2  
ATOM 2353  H HE3  . TRP A 1 11  ? 134.442 6.517   -0.947  1.00 0.00 ? 11  TRP A HE3  2  
ATOM 2354  H HZ2  . TRP A 1 11  ? 137.541 2.843   0.366   1.00 0.00 ? 11  TRP A HZ2  2  
ATOM 2355  H HZ3  . TRP A 1 11  ? 135.156 6.213   1.411   1.00 0.00 ? 11  TRP A HZ3  2  
ATOM 2356  H HH2  . TRP A 1 11  ? 136.683 4.429   2.029   1.00 0.00 ? 11  TRP A HH2  2  
ATOM 2357  N N    . GLY A 1 12  ? 134.053 7.228   -6.711  1.00 0.00 ? 12  GLY A N    2  
ATOM 2358  C CA   . GLY A 1 12  ? 133.153 8.039   -7.480  1.00 0.00 ? 12  GLY A CA   2  
ATOM 2359  C C    . GLY A 1 12  ? 133.079 7.572   -8.917  1.00 0.00 ? 12  GLY A C    2  
ATOM 2360  O O    . GLY A 1 12  ? 132.443 8.212   -9.753  1.00 0.00 ? 12  GLY A O    2  
ATOM 2361  H H    . GLY A 1 12  ? 134.995 7.491   -6.629  1.00 0.00 ? 12  GLY A H    2  
ATOM 2362  H HA2  . GLY A 1 12  ? 132.168 7.988   -7.040  1.00 0.00 ? 12  GLY A HA2  2  
ATOM 2363  H HA3  . GLY A 1 12  ? 133.496 9.063   -7.463  1.00 0.00 ? 12  GLY A HA3  2  
ATOM 2364  N N    . GLU A 1 13  ? 133.759 6.470   -9.215  1.00 0.00 ? 13  GLU A N    2  
ATOM 2365  C CA   . GLU A 1 13  ? 133.735 5.902   -10.550 1.00 0.00 ? 13  GLU A CA   2  
ATOM 2366  C C    . GLU A 1 13  ? 132.626 4.873   -10.648 1.00 0.00 ? 13  GLU A C    2  
ATOM 2367  O O    . GLU A 1 13  ? 131.955 4.759   -11.673 1.00 0.00 ? 13  GLU A O    2  
ATOM 2368  C CB   . GLU A 1 13  ? 135.054 5.204   -10.884 1.00 0.00 ? 13  GLU A CB   2  
ATOM 2369  C CG   . GLU A 1 13  ? 136.290 6.038   -10.664 1.00 0.00 ? 13  GLU A CG   2  
ATOM 2370  C CD   . GLU A 1 13  ? 137.542 5.315   -11.083 1.00 0.00 ? 13  GLU A CD   2  
ATOM 2371  O OE1  . GLU A 1 13  ? 137.947 4.349   -10.413 1.00 0.00 ? 13  GLU A OE1  2  
ATOM 2372  O OE2  . GLU A 1 13  ? 138.131 5.682   -12.123 1.00 0.00 ? 13  GLU A OE2  2  
ATOM 2373  H H    . GLU A 1 13  ? 134.293 6.042   -8.512  1.00 0.00 ? 13  GLU A H    2  
ATOM 2374  H HA   . GLU A 1 13  ? 133.563 6.692   -11.264 1.00 0.00 ? 13  GLU A HA   2  
ATOM 2375  H HB2  . GLU A 1 13  ? 135.140 4.319   -10.270 1.00 0.00 ? 13  GLU A HB2  2  
ATOM 2376  H HB3  . GLU A 1 13  ? 135.030 4.903   -11.921 1.00 0.00 ? 13  GLU A HB3  2  
ATOM 2377  H HG2  . GLU A 1 13  ? 136.203 6.959   -11.219 1.00 0.00 ? 13  GLU A HG2  2  
ATOM 2378  H HG3  . GLU A 1 13  ? 136.348 6.250   -9.606  1.00 0.00 ? 13  GLU A HG3  2  
ATOM 2379  N N    . SER A 1 14  ? 132.431 4.131   -9.584  1.00 0.00 ? 14  SER A N    2  
ATOM 2380  C CA   . SER A 1 14  ? 131.482 3.051   -9.583  1.00 0.00 ? 14  SER A CA   2  
ATOM 2381  C C    . SER A 1 14  ? 131.075 2.700   -8.165  1.00 0.00 ? 14  SER A C    2  
ATOM 2382  O O    . SER A 1 14  ? 131.941 2.512   -7.286  1.00 0.00 ? 14  SER A O    2  
ATOM 2383  C CB   . SER A 1 14  ? 132.103 1.822   -10.283 1.00 0.00 ? 14  SER A CB   2  
ATOM 2384  O OG   . SER A 1 14  ? 131.247 0.688   -10.243 1.00 0.00 ? 14  SER A OG   2  
ATOM 2385  H H    . SER A 1 14  ? 132.912 4.329   -8.753  1.00 0.00 ? 14  SER A H    2  
ATOM 2386  H HA   . SER A 1 14  ? 130.612 3.358   -10.143 1.00 0.00 ? 14  SER A HA   2  
ATOM 2387  H HB2  . SER A 1 14  ? 132.303 2.064   -11.315 1.00 0.00 ? 14  SER A HB2  2  
ATOM 2388  H HB3  . SER A 1 14  ? 133.032 1.572   -9.793  1.00 0.00 ? 14  SER A HB3  2  
ATOM 2389  H HG   . SER A 1 14  ? 130.628 0.733   -10.990 1.00 0.00 ? 14  SER A HG   2  
ATOM 2390  N N    . PHE A 1 15  ? 129.770 2.589   -7.952  1.00 0.00 ? 15  PHE A N    2  
ATOM 2391  C CA   . PHE A 1 15  ? 129.211 2.210   -6.669  1.00 0.00 ? 15  PHE A CA   2  
ATOM 2392  C C    . PHE A 1 15  ? 129.708 0.836   -6.259  1.00 0.00 ? 15  PHE A C    2  
ATOM 2393  O O    . PHE A 1 15  ? 129.954 0.600   -5.097  1.00 0.00 ? 15  PHE A O    2  
ATOM 2394  C CB   . PHE A 1 15  ? 127.678 2.249   -6.726  1.00 0.00 ? 15  PHE A CB   2  
ATOM 2395  C CG   . PHE A 1 15  ? 126.967 1.863   -5.450  1.00 0.00 ? 15  PHE A CG   2  
ATOM 2396  C CD1  . PHE A 1 15  ? 127.240 2.509   -4.260  1.00 0.00 ? 15  PHE A CD1  2  
ATOM 2397  C CD2  . PHE A 1 15  ? 126.000 0.875   -5.457  1.00 0.00 ? 15  PHE A CD2  2  
ATOM 2398  C CE1  . PHE A 1 15  ? 126.566 2.175   -3.106  1.00 0.00 ? 15  PHE A CE1  2  
ATOM 2399  C CE2  . PHE A 1 15  ? 125.327 0.540   -4.300  1.00 0.00 ? 15  PHE A CE2  2  
ATOM 2400  C CZ   . PHE A 1 15  ? 125.610 1.193   -3.128  1.00 0.00 ? 15  PHE A CZ   2  
ATOM 2401  H H    . PHE A 1 15  ? 129.155 2.788   -8.695  1.00 0.00 ? 15  PHE A H    2  
ATOM 2402  H HA   . PHE A 1 15  ? 129.550 2.929   -5.938  1.00 0.00 ? 15  PHE A HA   2  
ATOM 2403  H HB2  . PHE A 1 15  ? 127.363 3.251   -6.976  1.00 0.00 ? 15  PHE A HB2  2  
ATOM 2404  H HB3  . PHE A 1 15  ? 127.347 1.578   -7.506  1.00 0.00 ? 15  PHE A HB3  2  
ATOM 2405  H HD1  . PHE A 1 15  ? 127.992 3.283   -4.239  1.00 0.00 ? 15  PHE A HD1  2  
ATOM 2406  H HD2  . PHE A 1 15  ? 125.775 0.360   -6.378  1.00 0.00 ? 15  PHE A HD2  2  
ATOM 2407  H HE1  . PHE A 1 15  ? 126.783 2.677   -2.175  1.00 0.00 ? 15  PHE A HE1  2  
ATOM 2408  H HE2  . PHE A 1 15  ? 124.571 -0.231  -4.307  1.00 0.00 ? 15  PHE A HE2  2  
ATOM 2409  H HZ   . PHE A 1 15  ? 125.079 0.934   -2.223  1.00 0.00 ? 15  PHE A HZ   2  
ATOM 2410  N N    . ASP A 1 16  ? 129.890 -0.051  -7.228  1.00 0.00 ? 16  ASP A N    2  
ATOM 2411  C CA   . ASP A 1 16  ? 130.405 -1.394  -6.951  1.00 0.00 ? 16  ASP A CA   2  
ATOM 2412  C C    . ASP A 1 16  ? 131.797 -1.316  -6.344  1.00 0.00 ? 16  ASP A C    2  
ATOM 2413  O O    . ASP A 1 16  ? 132.107 -2.037  -5.409  1.00 0.00 ? 16  ASP A O    2  
ATOM 2414  C CB   . ASP A 1 16  ? 130.440 -2.265  -8.210  1.00 0.00 ? 16  ASP A CB   2  
ATOM 2415  C CG   . ASP A 1 16  ? 130.957 -3.670  -7.928  1.00 0.00 ? 16  ASP A CG   2  
ATOM 2416  O OD1  . ASP A 1 16  ? 130.148 -4.552  -7.551  1.00 0.00 ? 16  ASP A OD1  2  
ATOM 2417  O OD2  . ASP A 1 16  ? 132.174 -3.924  -8.086  1.00 0.00 ? 16  ASP A OD2  2  
ATOM 2418  H H    . ASP A 1 16  ? 129.648 0.200   -8.150  1.00 0.00 ? 16  ASP A H    2  
ATOM 2419  H HA   . ASP A 1 16  ? 129.742 -1.847  -6.226  1.00 0.00 ? 16  ASP A HA   2  
ATOM 2420  H HB2  . ASP A 1 16  ? 129.441 -2.344  -8.615  1.00 0.00 ? 16  ASP A HB2  2  
ATOM 2421  H HB3  . ASP A 1 16  ? 131.085 -1.803  -8.942  1.00 0.00 ? 16  ASP A HB3  2  
ATOM 2422  N N    . LYS A 1 17  ? 132.610 -0.389  -6.842  1.00 0.00 ? 17  LYS A N    2  
ATOM 2423  C CA   . LYS A 1 17  ? 133.968 -0.214  -6.337  1.00 0.00 ? 17  LYS A CA   2  
ATOM 2424  C C    . LYS A 1 17  ? 133.932 0.281   -4.898  1.00 0.00 ? 17  LYS A C    2  
ATOM 2425  O O    . LYS A 1 17  ? 134.673 -0.194  -4.033  1.00 0.00 ? 17  LYS A O    2  
ATOM 2426  C CB   . LYS A 1 17  ? 134.770 0.748   -7.226  1.00 0.00 ? 17  LYS A CB   2  
ATOM 2427  C CG   . LYS A 1 17  ? 136.100 1.133   -6.613  1.00 0.00 ? 17  LYS A CG   2  
ATOM 2428  C CD   . LYS A 1 17  ? 136.986 1.938   -7.531  1.00 0.00 ? 17  LYS A CD   2  
ATOM 2429  C CE   . LYS A 1 17  ? 137.372 1.180   -8.779  1.00 0.00 ? 17  LYS A CE   2  
ATOM 2430  N NZ   . LYS A 1 17  ? 138.414 1.897   -9.527  1.00 0.00 ? 17  LYS A NZ   2  
ATOM 2431  H H    . LYS A 1 17  ? 132.273 0.209   -7.543  1.00 0.00 ? 17  LYS A H    2  
ATOM 2432  H HA   . LYS A 1 17  ? 134.441 -1.186  -6.350  1.00 0.00 ? 17  LYS A HA   2  
ATOM 2433  H HB2  . LYS A 1 17  ? 134.955 0.273   -8.177  1.00 0.00 ? 17  LYS A HB2  2  
ATOM 2434  H HB3  . LYS A 1 17  ? 134.192 1.647   -7.382  1.00 0.00 ? 17  LYS A HB3  2  
ATOM 2435  H HG2  . LYS A 1 17  ? 135.878 1.748   -5.753  1.00 0.00 ? 17  LYS A HG2  2  
ATOM 2436  H HG3  . LYS A 1 17  ? 136.615 0.238   -6.296  1.00 0.00 ? 17  LYS A HG3  2  
ATOM 2437  H HD2  . LYS A 1 17  ? 136.464 2.836   -7.821  1.00 0.00 ? 17  LYS A HD2  2  
ATOM 2438  H HD3  . LYS A 1 17  ? 137.883 2.208   -6.993  1.00 0.00 ? 17  LYS A HD3  2  
ATOM 2439  H HE2  . LYS A 1 17  ? 137.744 0.205   -8.498  1.00 0.00 ? 17  LYS A HE2  2  
ATOM 2440  H HE3  . LYS A 1 17  ? 136.499 1.068   -9.405  1.00 0.00 ? 17  LYS A HE3  2  
ATOM 2441  H HZ1  . LYS A 1 17  ? 139.287 1.931   -8.955  1.00 0.00 ? 17  LYS A HZ1  2  
ATOM 2442  H HZ2  . LYS A 1 17  ? 138.129 2.879   -9.753  1.00 0.00 ? 17  LYS A HZ2  2  
ATOM 2443  H HZ3  . LYS A 1 17  ? 138.631 1.418   -10.425 1.00 0.00 ? 17  LYS A HZ3  2  
ATOM 2444  N N    . LEU A 1 18  ? 133.046 1.204   -4.663  1.00 0.00 ? 18  LEU A N    2  
ATOM 2445  C CA   . LEU A 1 18  ? 132.809 1.769   -3.355  1.00 0.00 ? 18  LEU A CA   2  
ATOM 2446  C C    . LEU A 1 18  ? 132.348 0.690   -2.383  1.00 0.00 ? 18  LEU A C    2  
ATOM 2447  O O    . LEU A 1 18  ? 132.913 0.506   -1.307  1.00 0.00 ? 18  LEU A O    2  
ATOM 2448  C CB   . LEU A 1 18  ? 131.711 2.829   -3.504  1.00 0.00 ? 18  LEU A CB   2  
ATOM 2449  C CG   . LEU A 1 18  ? 131.036 3.344   -2.235  1.00 0.00 ? 18  LEU A CG   2  
ATOM 2450  C CD1  . LEU A 1 18  ? 132.022 4.059   -1.340  1.00 0.00 ? 18  LEU A CD1  2  
ATOM 2451  C CD2  . LEU A 1 18  ? 129.911 4.264   -2.613  1.00 0.00 ? 18  LEU A CD2  2  
ATOM 2452  H H    . LEU A 1 18  ? 132.506 1.530   -5.416  1.00 0.00 ? 18  LEU A H    2  
ATOM 2453  H HA   . LEU A 1 18  ? 133.703 2.253   -2.993  1.00 0.00 ? 18  LEU A HA   2  
ATOM 2454  H HB2  . LEU A 1 18  ? 132.143 3.680   -4.009  1.00 0.00 ? 18  LEU A HB2  2  
ATOM 2455  H HB3  . LEU A 1 18  ? 130.945 2.418   -4.146  1.00 0.00 ? 18  LEU A HB3  2  
ATOM 2456  H HG   . LEU A 1 18  ? 130.611 2.506   -1.697  1.00 0.00 ? 18  LEU A HG   2  
ATOM 2457  H HD11 . LEU A 1 18  ? 132.810 3.377   -1.054  1.00 0.00 ? 18  LEU A HD11 2  
ATOM 2458  H HD12 . LEU A 1 18  ? 131.514 4.414   -0.456  1.00 0.00 ? 18  LEU A HD12 2  
ATOM 2459  H HD13 . LEU A 1 18  ? 132.449 4.897   -1.871  1.00 0.00 ? 18  LEU A HD13 2  
ATOM 2460  H HD21 . LEU A 1 18  ? 129.429 4.642   -1.723  1.00 0.00 ? 18  LEU A HD21 2  
ATOM 2461  H HD22 . LEU A 1 18  ? 129.203 3.719   -3.219  1.00 0.00 ? 18  LEU A HD22 2  
ATOM 2462  H HD23 . LEU A 1 18  ? 130.318 5.085   -3.184  1.00 0.00 ? 18  LEU A HD23 2  
ATOM 2463  N N    . LEU A 1 19  ? 131.374 -0.037  -2.823  1.00 0.00 ? 19  LEU A N    2  
ATOM 2464  C CA   . LEU A 1 19  ? 130.658 -0.992  -2.034  1.00 0.00 ? 19  LEU A CA   2  
ATOM 2465  C C    . LEU A 1 19  ? 131.467 -2.260  -1.753  1.00 0.00 ? 19  LEU A C    2  
ATOM 2466  O O    . LEU A 1 19  ? 131.245 -2.937  -0.748  1.00 0.00 ? 19  LEU A O    2  
ATOM 2467  C CB   . LEU A 1 19  ? 129.398 -1.326  -2.786  1.00 0.00 ? 19  LEU A CB   2  
ATOM 2468  C CG   . LEU A 1 19  ? 128.245 -1.822  -1.983  1.00 0.00 ? 19  LEU A CG   2  
ATOM 2469  C CD1  . LEU A 1 19  ? 127.873 -0.771  -0.934  1.00 0.00 ? 19  LEU A CD1  2  
ATOM 2470  C CD2  . LEU A 1 19  ? 127.091 -2.077  -2.927  1.00 0.00 ? 19  LEU A CD2  2  
ATOM 2471  H H    . LEU A 1 19  ? 131.084 0.093   -3.754  1.00 0.00 ? 19  LEU A H    2  
ATOM 2472  H HA   . LEU A 1 19  ? 130.368 -0.524  -1.106  1.00 0.00 ? 19  LEU A HA   2  
ATOM 2473  H HB2  . LEU A 1 19  ? 129.078 -0.436  -3.309  1.00 0.00 ? 19  LEU A HB2  2  
ATOM 2474  H HB3  . LEU A 1 19  ? 129.644 -2.076  -3.523  1.00 0.00 ? 19  LEU A HB3  2  
ATOM 2475  H HG   . LEU A 1 19  ? 128.498 -2.748  -1.490  1.00 0.00 ? 19  LEU A HG   2  
ATOM 2476  H HD11 . LEU A 1 19  ? 128.738 -0.572  -0.317  1.00 0.00 ? 19  LEU A HD11 2  
ATOM 2477  H HD12 . LEU A 1 19  ? 127.064 -1.119  -0.309  1.00 0.00 ? 19  LEU A HD12 2  
ATOM 2478  H HD13 . LEU A 1 19  ? 127.590 0.146   -1.431  1.00 0.00 ? 19  LEU A HD13 2  
ATOM 2479  H HD21 . LEU A 1 19  ? 126.227 -2.418  -2.376  1.00 0.00 ? 19  LEU A HD21 2  
ATOM 2480  H HD22 . LEU A 1 19  ? 127.384 -2.818  -3.656  1.00 0.00 ? 19  LEU A HD22 2  
ATOM 2481  H HD23 . LEU A 1 19  ? 126.850 -1.158  -3.441  1.00 0.00 ? 19  LEU A HD23 2  
ATOM 2482  N N    . SER A 1 20  ? 132.380 -2.592  -2.632  1.00 0.00 ? 20  SER A N    2  
ATOM 2483  C CA   . SER A 1 20  ? 133.192 -3.769  -2.431  1.00 0.00 ? 20  SER A CA   2  
ATOM 2484  C C    . SER A 1 20  ? 134.396 -3.468  -1.550  1.00 0.00 ? 20  SER A C    2  
ATOM 2485  O O    . SER A 1 20  ? 135.019 -4.376  -1.014  1.00 0.00 ? 20  SER A O    2  
ATOM 2486  C CB   . SER A 1 20  ? 133.613 -4.385  -3.775  1.00 0.00 ? 20  SER A CB   2  
ATOM 2487  O OG   . SER A 1 20  ? 134.220 -3.418  -4.625  1.00 0.00 ? 20  SER A OG   2  
ATOM 2488  H H    . SER A 1 20  ? 132.498 -2.049  -3.441  1.00 0.00 ? 20  SER A H    2  
ATOM 2489  H HA   . SER A 1 20  ? 132.574 -4.485  -1.907  1.00 0.00 ? 20  SER A HA   2  
ATOM 2490  H HB2  . SER A 1 20  ? 134.324 -5.178  -3.596  1.00 0.00 ? 20  SER A HB2  2  
ATOM 2491  H HB3  . SER A 1 20  ? 132.742 -4.788  -4.271  1.00 0.00 ? 20  SER A HB3  2  
ATOM 2492  H HG   . SER A 1 20  ? 133.483 -2.904  -4.992  1.00 0.00 ? 20  SER A HG   2  
ATOM 2493  N N    . HIS A 1 21  ? 134.694 -2.198  -1.379  1.00 0.00 ? 21  HIS A N    2  
ATOM 2494  C CA   . HIS A 1 21  ? 135.837 -1.775  -0.598  1.00 0.00 ? 21  HIS A CA   2  
ATOM 2495  C C    . HIS A 1 21  ? 135.399 -1.737  0.858   1.00 0.00 ? 21  HIS A C    2  
ATOM 2496  O O    . HIS A 1 21  ? 134.357 -1.162  1.145   1.00 0.00 ? 21  HIS A O    2  
ATOM 2497  C CB   . HIS A 1 21  ? 136.257 -0.362  -1.039  1.00 0.00 ? 21  HIS A CB   2  
ATOM 2498  C CG   . HIS A 1 21  ? 137.725 -0.082  -0.952  1.00 0.00 ? 21  HIS A CG   2  
ATOM 2499  N ND1  . HIS A 1 21  ? 138.319 0.634   0.070   1.00 0.00 ? 21  HIS A ND1  2  
ATOM 2500  C CD2  . HIS A 1 21  ? 138.721 -0.393  -1.808  1.00 0.00 ? 21  HIS A CD2  2  
ATOM 2501  C CE1  . HIS A 1 21  ? 139.609 0.749   -0.177  1.00 0.00 ? 21  HIS A CE1  2  
ATOM 2502  N NE2  . HIS A 1 21  ? 139.871 0.134   -1.305  1.00 0.00 ? 21  HIS A NE2  2  
ATOM 2503  H H    . HIS A 1 21  ? 134.098 -1.525  -1.772  1.00 0.00 ? 21  HIS A H    2  
ATOM 2504  H HA   . HIS A 1 21  ? 136.655 -2.465  -0.737  1.00 0.00 ? 21  HIS A HA   2  
ATOM 2505  H HB2  . HIS A 1 21  ? 135.949 -0.185  -2.058  1.00 0.00 ? 21  HIS A HB2  2  
ATOM 2506  H HB3  . HIS A 1 21  ? 135.751 0.349   -0.404  1.00 0.00 ? 21  HIS A HB3  2  
ATOM 2507  H HD1  . HIS A 1 21  ? 137.901 0.981   0.885   1.00 0.00 ? 21  HIS A HD1  2  
ATOM 2508  H HD2  . HIS A 1 21  ? 138.622 -0.955  -2.727  1.00 0.00 ? 21  HIS A HD2  2  
ATOM 2509  H HE1  . HIS A 1 21  ? 140.316 1.278   0.446   1.00 0.00 ? 21  HIS A HE1  2  
ATOM 2510  H HE2  . HIS A 1 21  ? 140.771 -0.126  -1.627  1.00 0.00 ? 21  HIS A HE2  2  
ATOM 2511  N N    . ARG A 1 22  ? 136.184 -2.314  1.772   1.00 0.00 ? 22  ARG A N    2  
ATOM 2512  C CA   . ARG A 1 22  ? 135.792 -2.351  3.203   1.00 0.00 ? 22  ARG A CA   2  
ATOM 2513  C C    . ARG A 1 22  ? 135.510 -0.955  3.741   1.00 0.00 ? 22  ARG A C    2  
ATOM 2514  O O    . ARG A 1 22  ? 134.463 -0.703  4.309   1.00 0.00 ? 22  ARG A O    2  
ATOM 2515  C CB   . ARG A 1 22  ? 136.833 -3.034  4.125   1.00 0.00 ? 22  ARG A CB   2  
ATOM 2516  C CG   . ARG A 1 22  ? 136.839 -4.573  4.187   1.00 0.00 ? 22  ARG A CG   2  
ATOM 2517  C CD   . ARG A 1 22  ? 137.722 -5.250  3.144   1.00 0.00 ? 22  ARG A CD   2  
ATOM 2518  N NE   . ARG A 1 22  ? 137.198 -5.218  1.783   1.00 0.00 ? 22  ARG A NE   2  
ATOM 2519  C CZ   . ARG A 1 22  ? 137.903 -5.574  0.691   1.00 0.00 ? 22  ARG A CZ   2  
ATOM 2520  N NH1  . ARG A 1 22  ? 139.154 -6.011  0.805   1.00 0.00 ? 22  ARG A NH1  2  
ATOM 2521  N NH2  . ARG A 1 22  ? 137.341 -5.509  -0.497  1.00 0.00 ? 22  ARG A NH2  2  
ATOM 2522  H H    . ARG A 1 22  ? 137.042 -2.697  1.473   1.00 0.00 ? 22  ARG A H    2  
ATOM 2523  H HA   . ARG A 1 22  ? 134.860 -2.897  3.268   1.00 0.00 ? 22  ARG A HA   2  
ATOM 2524  H HB2  . ARG A 1 22  ? 137.817 -2.729  3.801   1.00 0.00 ? 22  ARG A HB2  2  
ATOM 2525  H HB3  . ARG A 1 22  ? 136.683 -2.660  5.127   1.00 0.00 ? 22  ARG A HB3  2  
ATOM 2526  H HG2  . ARG A 1 22  ? 137.190 -4.873  5.162   1.00 0.00 ? 22  ARG A HG2  2  
ATOM 2527  H HG3  . ARG A 1 22  ? 135.822 -4.917  4.065   1.00 0.00 ? 22  ARG A HG3  2  
ATOM 2528  H HD2  . ARG A 1 22  ? 138.683 -4.758  3.140   1.00 0.00 ? 22  ARG A HD2  2  
ATOM 2529  H HD3  . ARG A 1 22  ? 137.861 -6.278  3.442   1.00 0.00 ? 22  ARG A HD3  2  
ATOM 2530  H HE   . ARG A 1 22  ? 136.255 -4.921  1.711   1.00 0.00 ? 22  ARG A HE   2  
ATOM 2531  H HH11 . ARG A 1 22  ? 139.634 -6.114  1.690   1.00 0.00 ? 22  ARG A HH11 2  
ATOM 2532  H HH12 . ARG A 1 22  ? 139.719 -6.240  -0.000  1.00 0.00 ? 22  ARG A HH12 2  
ATOM 2533  H HH21 . ARG A 1 22  ? 136.391 -5.193  -0.626  1.00 0.00 ? 22  ARG A HH21 2  
ATOM 2534  H HH22 . ARG A 1 22  ? 137.804 -5.755  -1.362  1.00 0.00 ? 22  ARG A HH22 2  
ATOM 2535  N N    . ASP A 1 23  ? 136.427 -0.046  3.514   1.00 0.00 ? 23  ASP A N    2  
ATOM 2536  C CA   . ASP A 1 23  ? 136.292 1.322   4.021   1.00 0.00 ? 23  ASP A CA   2  
ATOM 2537  C C    . ASP A 1 23  ? 135.228 2.100   3.237   1.00 0.00 ? 23  ASP A C    2  
ATOM 2538  O O    . ASP A 1 23  ? 134.710 3.112   3.697   1.00 0.00 ? 23  ASP A O    2  
ATOM 2539  C CB   . ASP A 1 23  ? 137.634 2.046   3.935   1.00 0.00 ? 23  ASP A CB   2  
ATOM 2540  C CG   . ASP A 1 23  ? 137.745 3.166   4.921   1.00 0.00 ? 23  ASP A CG   2  
ATOM 2541  O OD1  . ASP A 1 23  ? 138.082 2.900   6.085   1.00 0.00 ? 23  ASP A OD1  2  
ATOM 2542  O OD2  . ASP A 1 23  ? 137.528 4.316   4.581   1.00 0.00 ? 23  ASP A OD2  2  
ATOM 2543  H H    . ASP A 1 23  ? 137.252 -0.311  3.044   1.00 0.00 ? 23  ASP A H    2  
ATOM 2544  H HA   . ASP A 1 23  ? 135.991 1.266   5.057   1.00 0.00 ? 23  ASP A HA   2  
ATOM 2545  H HB2  . ASP A 1 23  ? 138.438 1.351   4.123   1.00 0.00 ? 23  ASP A HB2  2  
ATOM 2546  H HB3  . ASP A 1 23  ? 137.751 2.462   2.944   1.00 0.00 ? 23  ASP A HB3  2  
ATOM 2547  N N    . GLY A 1 24  ? 134.877 1.595   2.064   1.00 0.00 ? 24  GLY A N    2  
ATOM 2548  C CA   . GLY A 1 24  ? 133.915 2.277   1.227   1.00 0.00 ? 24  GLY A CA   2  
ATOM 2549  C C    . GLY A 1 24  ? 132.534 1.890   1.582   1.00 0.00 ? 24  GLY A C    2  
ATOM 2550  O O    . GLY A 1 24  ? 131.651 2.729   1.671   1.00 0.00 ? 24  GLY A O    2  
ATOM 2551  H H    . GLY A 1 24  ? 135.234 0.723   1.794   1.00 0.00 ? 24  GLY A H    2  
ATOM 2552  H HA2  . GLY A 1 24  ? 134.023 3.342   1.364   1.00 0.00 ? 24  GLY A HA2  2  
ATOM 2553  H HA3  . GLY A 1 24  ? 134.088 2.041   0.194   1.00 0.00 ? 24  GLY A HA3  2  
ATOM 2554  N N    . LEU A 1 25  ? 132.348 0.616   1.802   1.00 0.00 ? 25  LEU A N    2  
ATOM 2555  C CA   . LEU A 1 25  ? 131.102 0.086   2.282   1.00 0.00 ? 25  LEU A CA   2  
ATOM 2556  C C    . LEU A 1 25  ? 130.803 0.689   3.648   1.00 0.00 ? 25  LEU A C    2  
ATOM 2557  O O    . LEU A 1 25  ? 129.662 0.971   3.988   1.00 0.00 ? 25  LEU A O    2  
ATOM 2558  C CB   . LEU A 1 25  ? 131.161 -1.474  2.267   1.00 0.00 ? 25  LEU A CB   2  
ATOM 2559  C CG   . LEU A 1 25  ? 130.657 -2.271  3.489   1.00 0.00 ? 25  LEU A CG   2  
ATOM 2560  C CD1  . LEU A 1 25  ? 130.353 -3.696  3.062   1.00 0.00 ? 25  LEU A CD1  2  
ATOM 2561  C CD2  . LEU A 1 25  ? 131.734 -2.319  4.582   1.00 0.00 ? 25  LEU A CD2  2  
ATOM 2562  H H    . LEU A 1 25  ? 133.080 -0.014  1.610   1.00 0.00 ? 25  LEU A H    2  
ATOM 2563  H HA   . LEU A 1 25  ? 130.335 0.419   1.598   1.00 0.00 ? 25  LEU A HA   2  
ATOM 2564  H HB2  . LEU A 1 25  ? 130.590 -1.810  1.415   1.00 0.00 ? 25  LEU A HB2  2  
ATOM 2565  H HB3  . LEU A 1 25  ? 132.190 -1.749  2.092   1.00 0.00 ? 25  LEU A HB3  2  
ATOM 2566  H HG   . LEU A 1 25  ? 129.766 -1.818  3.898   1.00 0.00 ? 25  LEU A HG   2  
ATOM 2567  H HD11 . LEU A 1 25  ? 131.250 -4.155  2.674   1.00 0.00 ? 25  LEU A HD11 2  
ATOM 2568  H HD12 . LEU A 1 25  ? 129.593 -3.689  2.294   1.00 0.00 ? 25  LEU A HD12 2  
ATOM 2569  H HD13 . LEU A 1 25  ? 129.999 -4.262  3.912   1.00 0.00 ? 25  LEU A HD13 2  
ATOM 2570  H HD21 . LEU A 1 25  ? 131.380 -2.903  5.418   1.00 0.00 ? 25  LEU A HD21 2  
ATOM 2571  H HD22 . LEU A 1 25  ? 131.971 -1.318  4.922   1.00 0.00 ? 25  LEU A HD22 2  
ATOM 2572  H HD23 . LEU A 1 25  ? 132.635 -2.769  4.184   1.00 0.00 ? 25  LEU A HD23 2  
ATOM 2573  N N    . GLU A 1 26  ? 131.867 0.959   4.369   1.00 0.00 ? 26  GLU A N    2  
ATOM 2574  C CA   . GLU A 1 26  ? 131.803 1.561   5.661   1.00 0.00 ? 26  GLU A CA   2  
ATOM 2575  C C    . GLU A 1 26  ? 131.478 3.082   5.524   1.00 0.00 ? 26  GLU A C    2  
ATOM 2576  O O    . GLU A 1 26  ? 130.732 3.645   6.346   1.00 0.00 ? 26  GLU A O    2  
ATOM 2577  C CB   . GLU A 1 26  ? 133.132 1.312   6.368   1.00 0.00 ? 26  GLU A CB   2  
ATOM 2578  C CG   . GLU A 1 26  ? 133.139 1.588   7.855   1.00 0.00 ? 26  GLU A CG   2  
ATOM 2579  C CD   . GLU A 1 26  ? 132.198 0.682   8.617   1.00 0.00 ? 26  GLU A CD   2  
ATOM 2580  O OE1  . GLU A 1 26  ? 132.586 -0.435  8.991   1.00 0.00 ? 26  GLU A OE1  2  
ATOM 2581  O OE2  . GLU A 1 26  ? 131.063 1.087   8.893   1.00 0.00 ? 26  GLU A OE2  2  
ATOM 2582  H H    . GLU A 1 26  ? 132.744 0.703   4.012   1.00 0.00 ? 26  GLU A H    2  
ATOM 2583  H HA   . GLU A 1 26  ? 131.011 1.082   6.214   1.00 0.00 ? 26  GLU A HA   2  
ATOM 2584  H HB2  . GLU A 1 26  ? 133.358 0.265   6.217   1.00 0.00 ? 26  GLU A HB2  2  
ATOM 2585  H HB3  . GLU A 1 26  ? 133.899 1.906   5.894   1.00 0.00 ? 26  GLU A HB3  2  
ATOM 2586  H HG2  . GLU A 1 26  ? 134.138 1.439   8.233   1.00 0.00 ? 26  GLU A HG2  2  
ATOM 2587  H HG3  . GLU A 1 26  ? 132.841 2.613   8.017   1.00 0.00 ? 26  GLU A HG3  2  
ATOM 2588  N N    . ALA A 1 27  ? 131.990 3.736   4.458   1.00 0.00 ? 27  ALA A N    2  
ATOM 2589  C CA   . ALA A 1 27  ? 131.666 5.159   4.228   1.00 0.00 ? 27  ALA A CA   2  
ATOM 2590  C C    . ALA A 1 27  ? 130.228 5.273   3.787   1.00 0.00 ? 27  ALA A C    2  
ATOM 2591  O O    . ALA A 1 27  ? 129.459 6.114   4.283   1.00 0.00 ? 27  ALA A O    2  
ATOM 2592  C CB   . ALA A 1 27  ? 132.552 5.795   3.154   1.00 0.00 ? 27  ALA A CB   2  
ATOM 2593  H H    . ALA A 1 27  ? 132.587 3.270   3.826   1.00 0.00 ? 27  ALA A H    2  
ATOM 2594  H HA   . ALA A 1 27  ? 131.795 5.691   5.159   1.00 0.00 ? 27  ALA A HA   2  
ATOM 2595  H HB1  . ALA A 1 27  ? 132.160 6.790   2.968   1.00 0.00 ? 27  ALA A HB1  2  
ATOM 2596  H HB2  . ALA A 1 27  ? 132.501 5.219   2.242   1.00 0.00 ? 27  ALA A HB2  2  
ATOM 2597  H HB3  . ALA A 1 27  ? 133.585 5.869   3.465   1.00 0.00 ? 27  ALA A HB3  2  
ATOM 2598  N N    . PHE A 1 28  ? 129.850 4.403   2.871   1.00 0.00 ? 28  PHE A N    2  
ATOM 2599  C CA   . PHE A 1 28  ? 128.528 4.410   2.335   1.00 0.00 ? 28  PHE A CA   2  
ATOM 2600  C C    . PHE A 1 28  ? 127.520 4.072   3.406   1.00 0.00 ? 28  PHE A C    2  
ATOM 2601  O O    . PHE A 1 28  ? 126.471 4.693   3.474   1.00 0.00 ? 28  PHE A O    2  
ATOM 2602  C CB   . PHE A 1 28  ? 128.385 3.469   1.139   1.00 0.00 ? 28  PHE A CB   2  
ATOM 2603  C CG   . PHE A 1 28  ? 127.055 3.609   0.470   1.00 0.00 ? 28  PHE A CG   2  
ATOM 2604  C CD1  . PHE A 1 28  ? 126.811 4.678   -0.374  1.00 0.00 ? 28  PHE A CD1  2  
ATOM 2605  C CD2  . PHE A 1 28  ? 126.043 2.696   0.701   1.00 0.00 ? 28  PHE A CD2  2  
ATOM 2606  C CE1  . PHE A 1 28  ? 125.586 4.834   -0.975  1.00 0.00 ? 28  PHE A CE1  2  
ATOM 2607  C CE2  . PHE A 1 28  ? 124.820 2.847   0.101   1.00 0.00 ? 28  PHE A CE2  2  
ATOM 2608  C CZ   . PHE A 1 28  ? 124.590 3.919   -0.739  1.00 0.00 ? 28  PHE A CZ   2  
ATOM 2609  H H    . PHE A 1 28  ? 130.502 3.744   2.536   1.00 0.00 ? 28  PHE A H    2  
ATOM 2610  H HA   . PHE A 1 28  ? 128.330 5.419   2.002   1.00 0.00 ? 28  PHE A HA   2  
ATOM 2611  H HB2  . PHE A 1 28  ? 129.149 3.687   0.409   1.00 0.00 ? 28  PHE A HB2  2  
ATOM 2612  H HB3  . PHE A 1 28  ? 128.484 2.448   1.474   1.00 0.00 ? 28  PHE A HB3  2  
ATOM 2613  H HD1  . PHE A 1 28  ? 127.595 5.397   -0.560  1.00 0.00 ? 28  PHE A HD1  2  
ATOM 2614  H HD2  . PHE A 1 28  ? 126.224 1.858   1.358   1.00 0.00 ? 28  PHE A HD2  2  
ATOM 2615  H HE1  . PHE A 1 28  ? 125.408 5.672   -1.632  1.00 0.00 ? 28  PHE A HE1  2  
ATOM 2616  H HE2  . PHE A 1 28  ? 124.034 2.130   0.285   1.00 0.00 ? 28  PHE A HE2  2  
ATOM 2617  H HZ   . PHE A 1 28  ? 123.625 4.040   -1.212  1.00 0.00 ? 28  PHE A HZ   2  
ATOM 2618  N N    . THR A 1 29  ? 127.847 3.117   4.270   1.00 0.00 ? 29  THR A N    2  
ATOM 2619  C CA   . THR A 1 29  ? 126.934 2.761   5.318   1.00 0.00 ? 29  THR A CA   2  
ATOM 2620  C C    . THR A 1 29  ? 126.754 3.936   6.298   1.00 0.00 ? 29  THR A C    2  
ATOM 2621  O O    . THR A 1 29  ? 125.697 4.097   6.840   1.00 0.00 ? 29  THR A O    2  
ATOM 2622  C CB   . THR A 1 29  ? 127.294 1.424   6.053   1.00 0.00 ? 29  THR A CB   2  
ATOM 2623  O OG1  . THR A 1 29  ? 126.175 0.973   6.815   1.00 0.00 ? 29  THR A OG1  2  
ATOM 2624  C CG2  . THR A 1 29  ? 128.464 1.592   6.998   1.00 0.00 ? 29  THR A CG2  2  
ATOM 2625  H H    . THR A 1 29  ? 128.690 2.621   4.176   1.00 0.00 ? 29  THR A H    2  
ATOM 2626  H HA   . THR A 1 29  ? 125.980 2.641   4.825   1.00 0.00 ? 29  THR A HA   2  
ATOM 2627  H HB   . THR A 1 29  ? 127.539 0.676   5.313   1.00 0.00 ? 29  THR A HB   2  
ATOM 2628  H HG1  . THR A 1 29  ? 126.442 0.161   7.270   1.00 0.00 ? 29  THR A HG1  2  
ATOM 2629  H HG21 . THR A 1 29  ? 129.334 1.909   6.440   1.00 0.00 ? 29  THR A HG21 2  
ATOM 2630  H HG22 . THR A 1 29  ? 128.671 0.653   7.489   1.00 0.00 ? 29  THR A HG22 2  
ATOM 2631  H HG23 . THR A 1 29  ? 128.220 2.340   7.738   1.00 0.00 ? 29  THR A HG23 2  
ATOM 2632  N N    . ARG A 1 30  ? 127.787 4.802   6.465   1.00 0.00 ? 30  ARG A N    2  
ATOM 2633  C CA   . ARG A 1 30  ? 127.625 6.020   7.295   1.00 0.00 ? 30  ARG A CA   2  
ATOM 2634  C C    . ARG A 1 30  ? 126.483 6.849   6.745   1.00 0.00 ? 30  ARG A C    2  
ATOM 2635  O O    . ARG A 1 30  ? 125.577 7.272   7.482   1.00 0.00 ? 30  ARG A O    2  
ATOM 2636  C CB   . ARG A 1 30  ? 128.886 6.906   7.297   1.00 0.00 ? 30  ARG A CB   2  
ATOM 2637  C CG   . ARG A 1 30  ? 130.070 6.374   8.059   1.00 0.00 ? 30  ARG A CG   2  
ATOM 2638  C CD   . ARG A 1 30  ? 129.724 6.187   9.523   1.00 0.00 ? 30  ARG A CD   2  
ATOM 2639  N NE   . ARG A 1 30  ? 130.887 5.812   10.330  1.00 0.00 ? 30  ARG A NE   2  
ATOM 2640  C CZ   . ARG A 1 30  ? 131.472 4.612   10.328  1.00 0.00 ? 30  ARG A CZ   2  
ATOM 2641  N NH1  . ARG A 1 30  ? 131.058 3.676   9.480   1.00 0.00 ? 30  ARG A NH1  2  
ATOM 2642  N NH2  . ARG A 1 30  ? 132.484 4.367   11.156  1.00 0.00 ? 30  ARG A NH2  2  
ATOM 2643  H H    . ARG A 1 30  ? 128.645 4.612   6.024   1.00 0.00 ? 30  ARG A H    2  
ATOM 2644  H HA   . ARG A 1 30  ? 127.394 5.707   8.304   1.00 0.00 ? 30  ARG A HA   2  
ATOM 2645  H HB2  . ARG A 1 30  ? 129.200 7.046   6.273   1.00 0.00 ? 30  ARG A HB2  2  
ATOM 2646  H HB3  . ARG A 1 30  ? 128.622 7.870   7.707   1.00 0.00 ? 30  ARG A HB3  2  
ATOM 2647  H HG2  . ARG A 1 30  ? 130.361 5.422   7.642   1.00 0.00 ? 30  ARG A HG2  2  
ATOM 2648  H HG3  . ARG A 1 30  ? 130.888 7.074   7.976   1.00 0.00 ? 30  ARG A HG3  2  
ATOM 2649  H HD2  . ARG A 1 30  ? 129.322 7.117   9.897   1.00 0.00 ? 30  ARG A HD2  2  
ATOM 2650  H HD3  . ARG A 1 30  ? 128.974 5.414   9.602   1.00 0.00 ? 30  ARG A HD3  2  
ATOM 2651  H HE   . ARG A 1 30  ? 131.208 6.529   10.931  1.00 0.00 ? 30  ARG A HE   2  
ATOM 2652  H HH11 . ARG A 1 30  ? 130.321 3.845   8.827   1.00 0.00 ? 30  ARG A HH11 2  
ATOM 2653  H HH12 . ARG A 1 30  ? 131.415 2.734   9.429   1.00 0.00 ? 30  ARG A HH12 2  
ATOM 2654  H HH21 . ARG A 1 30  ? 132.817 5.066   11.801  1.00 0.00 ? 30  ARG A HH21 2  
ATOM 2655  H HH22 . ARG A 1 30  ? 132.991 3.495   11.170  1.00 0.00 ? 30  ARG A HH22 2  
ATOM 2656  N N    . PHE A 1 31  ? 126.516 7.037   5.444   1.00 0.00 ? 31  PHE A N    2  
ATOM 2657  C CA   . PHE A 1 31  ? 125.514 7.806   4.747   1.00 0.00 ? 31  PHE A CA   2  
ATOM 2658  C C    . PHE A 1 31  ? 124.168 7.066   4.731   1.00 0.00 ? 31  PHE A C    2  
ATOM 2659  O O    . PHE A 1 31  ? 123.109 7.662   4.899   1.00 0.00 ? 31  PHE A O    2  
ATOM 2660  C CB   . PHE A 1 31  ? 125.992 8.111   3.325   1.00 0.00 ? 31  PHE A CB   2  
ATOM 2661  C CG   . PHE A 1 31  ? 125.054 8.972   2.549   1.00 0.00 ? 31  PHE A CG   2  
ATOM 2662  C CD1  . PHE A 1 31  ? 125.027 10.331  2.756   1.00 0.00 ? 31  PHE A CD1  2  
ATOM 2663  C CD2  . PHE A 1 31  ? 124.198 8.423   1.616   1.00 0.00 ? 31  PHE A CD2  2  
ATOM 2664  C CE1  . PHE A 1 31  ? 124.164 11.129  2.051   1.00 0.00 ? 31  PHE A CE1  2  
ATOM 2665  C CE2  . PHE A 1 31  ? 123.333 9.220   0.907   1.00 0.00 ? 31  PHE A CE2  2  
ATOM 2666  C CZ   . PHE A 1 31  ? 123.317 10.572  1.126   1.00 0.00 ? 31  PHE A CZ   2  
ATOM 2667  H H    . PHE A 1 31  ? 127.254 6.635   4.930   1.00 0.00 ? 31  PHE A H    2  
ATOM 2668  H HA   . PHE A 1 31  ? 125.388 8.738   5.278   1.00 0.00 ? 31  PHE A HA   2  
ATOM 2669  H HB2  . PHE A 1 31  ? 126.942 8.621   3.373   1.00 0.00 ? 31  PHE A HB2  2  
ATOM 2670  H HB3  . PHE A 1 31  ? 126.117 7.181   2.789   1.00 0.00 ? 31  PHE A HB3  2  
ATOM 2671  H HD1  . PHE A 1 31  ? 125.695 10.769  3.483   1.00 0.00 ? 31  PHE A HD1  2  
ATOM 2672  H HD2  . PHE A 1 31  ? 124.212 7.356   1.446   1.00 0.00 ? 31  PHE A HD2  2  
ATOM 2673  H HE1  . PHE A 1 31  ? 124.152 12.195  2.222   1.00 0.00 ? 31  PHE A HE1  2  
ATOM 2674  H HE2  . PHE A 1 31  ? 122.667 8.781   0.180   1.00 0.00 ? 31  PHE A HE2  2  
ATOM 2675  H HZ   . PHE A 1 31  ? 122.638 11.200  0.568   1.00 0.00 ? 31  PHE A HZ   2  
ATOM 2676  N N    . LEU A 1 32  ? 124.223 5.777   4.570   1.00 0.00 ? 32  LEU A N    2  
ATOM 2677  C CA   . LEU A 1 32  ? 123.034 4.952   4.533   1.00 0.00 ? 32  LEU A CA   2  
ATOM 2678  C C    . LEU A 1 32  ? 122.355 4.966   5.914   1.00 0.00 ? 32  LEU A C    2  
ATOM 2679  O O    . LEU A 1 32  ? 121.132 4.932   6.030   1.00 0.00 ? 32  LEU A O    2  
ATOM 2680  C CB   . LEU A 1 32  ? 123.420 3.540   4.130   1.00 0.00 ? 32  LEU A CB   2  
ATOM 2681  C CG   . LEU A 1 32  ? 122.307 2.646   3.618   1.00 0.00 ? 32  LEU A CG   2  
ATOM 2682  C CD1  . LEU A 1 32  ? 121.642 3.275   2.401   1.00 0.00 ? 32  LEU A CD1  2  
ATOM 2683  C CD2  . LEU A 1 32  ? 122.869 1.293   3.253   1.00 0.00 ? 32  LEU A CD2  2  
ATOM 2684  H H    . LEU A 1 32  ? 125.103 5.359   4.425   1.00 0.00 ? 32  LEU A H    2  
ATOM 2685  H HA   . LEU A 1 32  ? 122.356 5.363   3.800   1.00 0.00 ? 32  LEU A HA   2  
ATOM 2686  H HB2  . LEU A 1 32  ? 124.193 3.577   3.379   1.00 0.00 ? 32  LEU A HB2  2  
ATOM 2687  H HB3  . LEU A 1 32  ? 123.835 3.086   5.018   1.00 0.00 ? 32  LEU A HB3  2  
ATOM 2688  H HG   . LEU A 1 32  ? 121.564 2.510   4.390   1.00 0.00 ? 32  LEU A HG   2  
ATOM 2689  H HD11 . LEU A 1 32  ? 120.851 2.630   2.048   1.00 0.00 ? 32  LEU A HD11 2  
ATOM 2690  H HD12 . LEU A 1 32  ? 122.374 3.407   1.618   1.00 0.00 ? 32  LEU A HD12 2  
ATOM 2691  H HD13 . LEU A 1 32  ? 121.228 4.236   2.670   1.00 0.00 ? 32  LEU A HD13 2  
ATOM 2692  H HD21 . LEU A 1 32  ? 122.081 0.662   2.872   1.00 0.00 ? 32  LEU A HD21 2  
ATOM 2693  H HD22 . LEU A 1 32  ? 123.305 0.838   4.131   1.00 0.00 ? 32  LEU A HD22 2  
ATOM 2694  H HD23 . LEU A 1 32  ? 123.632 1.417   2.497   1.00 0.00 ? 32  LEU A HD23 2  
ATOM 2695  N N    . LYS A 1 33  ? 123.164 5.049   6.947   1.00 0.00 ? 33  LYS A N    2  
ATOM 2696  C CA   . LYS A 1 33  ? 122.684 5.154   8.307   1.00 0.00 ? 33  LYS A CA   2  
ATOM 2697  C C    . LYS A 1 33  ? 122.118 6.548   8.582   1.00 0.00 ? 33  LYS A C    2  
ATOM 2698  O O    . LYS A 1 33  ? 121.143 6.692   9.305   1.00 0.00 ? 33  LYS A O    2  
ATOM 2699  C CB   . LYS A 1 33  ? 123.801 4.810   9.308   1.00 0.00 ? 33  LYS A CB   2  
ATOM 2700  C CG   . LYS A 1 33  ? 124.202 3.350   9.303   1.00 0.00 ? 33  LYS A CG   2  
ATOM 2701  C CD   . LYS A 1 33  ? 125.362 3.058   10.239  1.00 0.00 ? 33  LYS A CD   2  
ATOM 2702  C CE   . LYS A 1 33  ? 125.670 1.565   10.235  1.00 0.00 ? 33  LYS A CE   2  
ATOM 2703  N NZ   . LYS A 1 33  ? 126.731 1.183   11.193  1.00 0.00 ? 33  LYS A NZ   2  
ATOM 2704  H H    . LYS A 1 33  ? 124.133 5.002   6.785   1.00 0.00 ? 33  LYS A H    2  
ATOM 2705  H HA   . LYS A 1 33  ? 121.885 4.436   8.423   1.00 0.00 ? 33  LYS A HA   2  
ATOM 2706  H HB2  . LYS A 1 33  ? 124.675 5.397   9.066   1.00 0.00 ? 33  LYS A HB2  2  
ATOM 2707  H HB3  . LYS A 1 33  ? 123.470 5.070   10.303  1.00 0.00 ? 33  LYS A HB3  2  
ATOM 2708  H HG2  . LYS A 1 33  ? 123.354 2.756   9.614   1.00 0.00 ? 33  LYS A HG2  2  
ATOM 2709  H HG3  . LYS A 1 33  ? 124.483 3.073   8.298   1.00 0.00 ? 33  LYS A HG3  2  
ATOM 2710  H HD2  . LYS A 1 33  ? 126.225 3.611   9.893   1.00 0.00 ? 33  LYS A HD2  2  
ATOM 2711  H HD3  . LYS A 1 33  ? 125.101 3.368   11.240  1.00 0.00 ? 33  LYS A HD3  2  
ATOM 2712  H HE2  . LYS A 1 33  ? 124.770 1.027   10.489  1.00 0.00 ? 33  LYS A HE2  2  
ATOM 2713  H HE3  . LYS A 1 33  ? 125.979 1.284   9.238   1.00 0.00 ? 33  LYS A HE3  2  
ATOM 2714  H HZ1  . LYS A 1 33  ? 127.674 1.561   10.953  1.00 0.00 ? 33  LYS A HZ1  2  
ATOM 2715  H HZ2  . LYS A 1 33  ? 126.824 0.145   11.254  1.00 0.00 ? 33  LYS A HZ2  2  
ATOM 2716  H HZ3  . LYS A 1 33  ? 126.491 1.515   12.153  1.00 0.00 ? 33  LYS A HZ3  2  
ATOM 2717  N N    . THR A 1 34  ? 122.699 7.572   7.964   1.00 0.00 ? 34  THR A N    2  
ATOM 2718  C CA   . THR A 1 34  ? 122.241 8.931   8.186   1.00 0.00 ? 34  THR A CA   2  
ATOM 2719  C C    . THR A 1 34  ? 120.890 9.166   7.448   1.00 0.00 ? 34  THR A C    2  
ATOM 2720  O O    . THR A 1 34  ? 120.104 10.036  7.826   1.00 0.00 ? 34  THR A O    2  
ATOM 2721  C CB   . THR A 1 34  ? 123.345 10.008  7.809   1.00 0.00 ? 34  THR A CB   2  
ATOM 2722  O OG1  . THR A 1 34  ? 123.100 11.266  8.461   1.00 0.00 ? 34  THR A OG1  2  
ATOM 2723  C CG2  . THR A 1 34  ? 123.412 10.261  6.315   1.00 0.00 ? 34  THR A CG2  2  
ATOM 2724  H H    . THR A 1 34  ? 123.453 7.405   7.358   1.00 0.00 ? 34  THR A H    2  
ATOM 2725  H HA   . THR A 1 34  ? 122.030 8.997   9.245   1.00 0.00 ? 34  THR A HA   2  
ATOM 2726  H HB   . THR A 1 34  ? 124.303 9.632   8.142   1.00 0.00 ? 34  THR A HB   2  
ATOM 2727  H HG1  . THR A 1 34  ? 122.318 11.213  9.035   1.00 0.00 ? 34  THR A HG1  2  
ATOM 2728  H HG21 . THR A 1 34  ? 124.169 11.000  6.100   1.00 0.00 ? 34  THR A HG21 2  
ATOM 2729  H HG22 . THR A 1 34  ? 122.451 10.605  5.962   1.00 0.00 ? 34  THR A HG22 2  
ATOM 2730  H HG23 . THR A 1 34  ? 123.663 9.335   5.817   1.00 0.00 ? 34  THR A HG23 2  
ATOM 2731  N N    . GLU A 1 35  ? 120.613 8.364   6.412   1.00 0.00 ? 35  GLU A N    2  
ATOM 2732  C CA   . GLU A 1 35  ? 119.315 8.428   5.744   1.00 0.00 ? 35  GLU A CA   2  
ATOM 2733  C C    . GLU A 1 35  ? 118.361 7.400   6.344   1.00 0.00 ? 35  GLU A C    2  
ATOM 2734  O O    . GLU A 1 35  ? 117.201 7.289   5.919   1.00 0.00 ? 35  GLU A O    2  
ATOM 2735  C CB   . GLU A 1 35  ? 119.417 8.229   4.230   1.00 0.00 ? 35  GLU A CB   2  
ATOM 2736  C CG   . GLU A 1 35  ? 120.017 6.909   3.792   1.00 0.00 ? 35  GLU A CG   2  
ATOM 2737  C CD   . GLU A 1 35  ? 119.788 6.636   2.332   1.00 0.00 ? 35  GLU A CD   2  
ATOM 2738  O OE1  . GLU A 1 35  ? 120.435 7.261   1.483   1.00 0.00 ? 35  GLU A OE1  2  
ATOM 2739  O OE2  . GLU A 1 35  ? 118.928 5.793   2.011   1.00 0.00 ? 35  GLU A OE2  2  
ATOM 2740  H H    . GLU A 1 35  ? 121.297 7.742   6.078   1.00 0.00 ? 35  GLU A H    2  
ATOM 2741  H HA   . GLU A 1 35  ? 118.911 9.409   5.948   1.00 0.00 ? 35  GLU A HA   2  
ATOM 2742  H HB2  . GLU A 1 35  ? 118.429 8.302   3.801   1.00 0.00 ? 35  GLU A HB2  2  
ATOM 2743  H HB3  . GLU A 1 35  ? 120.031 9.024   3.832   1.00 0.00 ? 35  GLU A HB3  2  
ATOM 2744  H HG2  . GLU A 1 35  ? 121.080 6.928   3.977   1.00 0.00 ? 35  GLU A HG2  2  
ATOM 2745  H HG3  . GLU A 1 35  ? 119.566 6.114   4.368   1.00 0.00 ? 35  GLU A HG3  2  
ATOM 2746  N N    . PHE A 1 36  ? 118.874 6.661   7.335   1.00 0.00 ? 36  PHE A N    2  
ATOM 2747  C CA   . PHE A 1 36  ? 118.131 5.637   8.072   1.00 0.00 ? 36  PHE A CA   2  
ATOM 2748  C C    . PHE A 1 36  ? 117.645 4.509   7.155   1.00 0.00 ? 36  PHE A C    2  
ATOM 2749  O O    . PHE A 1 36  ? 116.510 4.040   7.269   1.00 0.00 ? 36  PHE A O    2  
ATOM 2750  C CB   . PHE A 1 36  ? 116.967 6.266   8.863   1.00 0.00 ? 36  PHE A CB   2  
ATOM 2751  C CG   . PHE A 1 36  ? 117.409 7.308   9.858   1.00 0.00 ? 36  PHE A CG   2  
ATOM 2752  C CD1  . PHE A 1 36  ? 118.017 6.937   11.045  1.00 0.00 ? 36  PHE A CD1  2  
ATOM 2753  C CD2  . PHE A 1 36  ? 117.226 8.658   9.597   1.00 0.00 ? 36  PHE A CD2  2  
ATOM 2754  C CE1  . PHE A 1 36  ? 118.432 7.889   11.955  1.00 0.00 ? 36  PHE A CE1  2  
ATOM 2755  C CE2  . PHE A 1 36  ? 117.640 9.614   10.502  1.00 0.00 ? 36  PHE A CE2  2  
ATOM 2756  C CZ   . PHE A 1 36  ? 118.244 9.230   11.683  1.00 0.00 ? 36  PHE A CZ   2  
ATOM 2757  H H    . PHE A 1 36  ? 119.803 6.826   7.596   1.00 0.00 ? 36  PHE A H    2  
ATOM 2758  H HA   . PHE A 1 36  ? 118.826 5.203   8.776   1.00 0.00 ? 36  PHE A HA   2  
ATOM 2759  H HB2  . PHE A 1 36  ? 116.288 6.740   8.171   1.00 0.00 ? 36  PHE A HB2  2  
ATOM 2760  H HB3  . PHE A 1 36  ? 116.443 5.490   9.400   1.00 0.00 ? 36  PHE A HB3  2  
ATOM 2761  H HD1  . PHE A 1 36  ? 118.166 5.889   11.259  1.00 0.00 ? 36  PHE A HD1  2  
ATOM 2762  H HD2  . PHE A 1 36  ? 116.753 8.958   8.674   1.00 0.00 ? 36  PHE A HD2  2  
ATOM 2763  H HE1  . PHE A 1 36  ? 118.904 7.585   12.878  1.00 0.00 ? 36  PHE A HE1  2  
ATOM 2764  H HE2  . PHE A 1 36  ? 117.492 10.663  10.288  1.00 0.00 ? 36  PHE A HE2  2  
ATOM 2765  H HZ   . PHE A 1 36  ? 118.568 9.977   12.392  1.00 0.00 ? 36  PHE A HZ   2  
ATOM 2766  N N    . SER A 1 37  ? 118.524 4.050   6.290   1.00 0.00 ? 37  SER A N    2  
ATOM 2767  C CA   . SER A 1 37  ? 118.206 2.977   5.369   1.00 0.00 ? 37  SER A CA   2  
ATOM 2768  C C    . SER A 1 37  ? 119.350 1.947   5.358   1.00 0.00 ? 37  SER A C    2  
ATOM 2769  O O    . SER A 1 37  ? 119.569 1.244   4.351   1.00 0.00 ? 37  SER A O    2  
ATOM 2770  C CB   . SER A 1 37  ? 118.052 3.553   3.972   1.00 0.00 ? 37  SER A CB   2  
ATOM 2771  O OG   . SER A 1 37  ? 117.184 4.680   3.942   1.00 0.00 ? 37  SER A OG   2  
ATOM 2772  H H    . SER A 1 37  ? 119.426 4.442   6.251   1.00 0.00 ? 37  SER A H    2  
ATOM 2773  H HA   . SER A 1 37  ? 117.279 2.510   5.668   1.00 0.00 ? 37  SER A HA   2  
ATOM 2774  H HB2  . SER A 1 37  ? 119.022 3.864   3.611   1.00 0.00 ? 37  SER A HB2  2  
ATOM 2775  H HB3  . SER A 1 37  ? 117.657 2.792   3.315   1.00 0.00 ? 37  SER A HB3  2  
ATOM 2776  H HG   . SER A 1 37  ? 117.612 5.259   3.294   1.00 0.00 ? 37  SER A HG   2  
ATOM 2777  N N    . GLU A 1 38  ? 120.020 1.791   6.499   1.00 0.00 ? 38  GLU A N    2  
ATOM 2778  C CA   . GLU A 1 38  ? 121.224 0.948   6.597   1.00 0.00 ? 38  GLU A CA   2  
ATOM 2779  C C    . GLU A 1 38  ? 120.917 -0.541  6.376   1.00 0.00 ? 38  GLU A C    2  
ATOM 2780  O O    . GLU A 1 38  ? 121.809 -1.328  6.034   1.00 0.00 ? 38  GLU A O    2  
ATOM 2781  C CB   . GLU A 1 38  ? 121.924 1.124   7.952   1.00 0.00 ? 38  GLU A CB   2  
ATOM 2782  C CG   . GLU A 1 38  ? 121.091 0.704   9.157   1.00 0.00 ? 38  GLU A CG   2  
ATOM 2783  C CD   . GLU A 1 38  ? 121.858 0.753   10.453  1.00 0.00 ? 38  GLU A CD   2  
ATOM 2784  O OE1  . GLU A 1 38  ? 122.572 -0.222  10.769  1.00 0.00 ? 38  GLU A OE1  2  
ATOM 2785  O OE2  . GLU A 1 38  ? 121.757 1.749   11.193  1.00 0.00 ? 38  GLU A OE2  2  
ATOM 2786  H H    . GLU A 1 38  ? 119.657 2.223   7.305   1.00 0.00 ? 38  GLU A H    2  
ATOM 2787  H HA   . GLU A 1 38  ? 121.900 1.283   5.820   1.00 0.00 ? 38  GLU A HA   2  
ATOM 2788  H HB2  . GLU A 1 38  ? 122.828 0.534   7.950   1.00 0.00 ? 38  GLU A HB2  2  
ATOM 2789  H HB3  . GLU A 1 38  ? 122.189 2.165   8.068   1.00 0.00 ? 38  GLU A HB3  2  
ATOM 2790  H HG2  . GLU A 1 38  ? 120.241 1.367   9.238   1.00 0.00 ? 38  GLU A HG2  2  
ATOM 2791  H HG3  . GLU A 1 38  ? 120.741 -0.306  8.998   1.00 0.00 ? 38  GLU A HG3  2  
ATOM 2792  N N    . GLU A 1 39  ? 119.653 -0.914  6.496   1.00 0.00 ? 39  GLU A N    2  
ATOM 2793  C CA   . GLU A 1 39  ? 119.268 -2.309  6.403   1.00 0.00 ? 39  GLU A CA   2  
ATOM 2794  C C    . GLU A 1 39  ? 119.212 -2.787  4.958   1.00 0.00 ? 39  GLU A C    2  
ATOM 2795  O O    . GLU A 1 39  ? 118.928 -3.931  4.700   1.00 0.00 ? 39  GLU A O    2  
ATOM 2796  C CB   . GLU A 1 39  ? 117.960 -2.641  7.173   1.00 0.00 ? 39  GLU A CB   2  
ATOM 2797  C CG   . GLU A 1 39  ? 116.674 -2.003  6.648   1.00 0.00 ? 39  GLU A CG   2  
ATOM 2798  C CD   . GLU A 1 39  ? 116.655 -0.507  6.753   1.00 0.00 ? 39  GLU A CD   2  
ATOM 2799  O OE1  . GLU A 1 39  ? 116.382 0.032   7.845   1.00 0.00 ? 39  GLU A OE1  2  
ATOM 2800  O OE2  . GLU A 1 39  ? 116.928 0.157   5.761   1.00 0.00 ? 39  GLU A OE2  2  
ATOM 2801  H H    . GLU A 1 39  ? 118.959 -0.227  6.614   1.00 0.00 ? 39  GLU A H    2  
ATOM 2802  H HA   . GLU A 1 39  ? 120.079 -2.852  6.866   1.00 0.00 ? 39  GLU A HA   2  
ATOM 2803  H HB2  . GLU A 1 39  ? 117.818 -3.712  7.152   1.00 0.00 ? 39  GLU A HB2  2  
ATOM 2804  H HB3  . GLU A 1 39  ? 118.091 -2.341  8.201   1.00 0.00 ? 39  GLU A HB3  2  
ATOM 2805  H HG2  . GLU A 1 39  ? 116.557 -2.268  5.608   1.00 0.00 ? 39  GLU A HG2  2  
ATOM 2806  H HG3  . GLU A 1 39  ? 115.840 -2.401  7.209   1.00 0.00 ? 39  GLU A HG3  2  
ATOM 2807  N N    . ASN A 1 40  ? 119.501 -1.902  4.025   1.00 0.00 ? 40  ASN A N    2  
ATOM 2808  C CA   . ASN A 1 40  ? 119.597 -2.288  2.619   1.00 0.00 ? 40  ASN A CA   2  
ATOM 2809  C C    . ASN A 1 40  ? 120.955 -2.897  2.360   1.00 0.00 ? 40  ASN A C    2  
ATOM 2810  O O    . ASN A 1 40  ? 121.093 -3.981  1.717   1.00 0.00 ? 40  ASN A O    2  
ATOM 2811  C CB   . ASN A 1 40  ? 119.345 -1.106  1.685   1.00 0.00 ? 40  ASN A CB   2  
ATOM 2812  C CG   . ASN A 1 40  ? 117.904 -0.672  1.696   1.00 0.00 ? 40  ASN A CG   2  
ATOM 2813  O OD1  . ASN A 1 40  ? 117.090 -1.189  0.943   1.00 0.00 ? 40  ASN A OD1  2  
ATOM 2814  N ND2  . ASN A 1 40  ? 117.579 0.282   2.519   1.00 0.00 ? 40  ASN A ND2  2  
ATOM 2815  H H    . ASN A 1 40  ? 119.622 -0.967  4.301   1.00 0.00 ? 40  ASN A H    2  
ATOM 2816  H HA   . ASN A 1 40  ? 118.850 -3.050  2.447   1.00 0.00 ? 40  ASN A HA   2  
ATOM 2817  H HB2  . ASN A 1 40  ? 119.954 -0.272  2.001   1.00 0.00 ? 40  ASN A HB2  2  
ATOM 2818  H HB3  . ASN A 1 40  ? 119.615 -1.384  0.677   1.00 0.00 ? 40  ASN A HB3  2  
ATOM 2819  H HD21 . ASN A 1 40  ? 118.275 0.681   3.086   1.00 0.00 ? 40  ASN A HD21 2  
ATOM 2820  H HD22 . ASN A 1 40  ? 116.633 0.538   2.572   1.00 0.00 ? 40  ASN A HD22 2  
ATOM 2821  N N    . ILE A 1 41  ? 121.973 -2.271  2.929   1.00 0.00 ? 41  ILE A N    2  
ATOM 2822  C CA   . ILE A 1 41  ? 123.297 -2.792  2.797   1.00 0.00 ? 41  ILE A CA   2  
ATOM 2823  C C    . ILE A 1 41  ? 123.341 -4.100  3.590   1.00 0.00 ? 41  ILE A C    2  
ATOM 2824  O O    . ILE A 1 41  ? 123.917 -5.083  3.152   1.00 0.00 ? 41  ILE A O    2  
ATOM 2825  C CB   . ILE A 1 41  ? 124.409 -1.758  3.241   1.00 0.00 ? 41  ILE A CB   2  
ATOM 2826  C CG1  . ILE A 1 41  ? 125.590 -1.794  2.248   1.00 0.00 ? 41  ILE A CG1  2  
ATOM 2827  C CG2  . ILE A 1 41  ? 124.892 -1.971  4.688   1.00 0.00 ? 41  ILE A CG2  2  
ATOM 2828  C CD1  . ILE A 1 41  ? 126.713 -0.820  2.559   1.00 0.00 ? 41  ILE A CD1  2  
ATOM 2829  H H    . ILE A 1 41  ? 121.815 -1.457  3.453   1.00 0.00 ? 41  ILE A H    2  
ATOM 2830  H HA   . ILE A 1 41  ? 123.425 -3.044  1.754   1.00 0.00 ? 41  ILE A HA   2  
ATOM 2831  H HB   . ILE A 1 41  ? 123.967 -0.774  3.200   1.00 0.00 ? 41  ILE A HB   2  
ATOM 2832  H HG12 . ILE A 1 41  ? 126.012 -2.783  2.170   1.00 0.00 ? 41  ILE A HG12 2  
ATOM 2833  H HG13 . ILE A 1 41  ? 125.204 -1.528  1.275   1.00 0.00 ? 41  ILE A HG13 2  
ATOM 2834  H HG21 . ILE A 1 41  ? 125.299 -2.966  4.789   1.00 0.00 ? 41  ILE A HG21 2  
ATOM 2835  H HG22 . ILE A 1 41  ? 124.060 -1.854  5.365   1.00 0.00 ? 41  ILE A HG22 2  
ATOM 2836  H HG23 . ILE A 1 41  ? 125.654 -1.242  4.923   1.00 0.00 ? 41  ILE A HG23 2  
ATOM 2837  H HD11 . ILE A 1 41  ? 126.323 0.186   2.591   1.00 0.00 ? 41  ILE A HD11 2  
ATOM 2838  H HD12 . ILE A 1 41  ? 127.451 -0.886  1.773   1.00 0.00 ? 41  ILE A HD12 2  
ATOM 2839  H HD13 . ILE A 1 41  ? 127.163 -1.071  3.508   1.00 0.00 ? 41  ILE A HD13 2  
ATOM 2840  N N    . GLU A 1 42  ? 122.603 -4.132  4.713   1.00 0.00 ? 42  GLU A N    2  
ATOM 2841  C CA   . GLU A 1 42  ? 122.492 -5.334  5.485   1.00 0.00 ? 42  GLU A CA   2  
ATOM 2842  C C    . GLU A 1 42  ? 121.435 -6.304  4.991   1.00 0.00 ? 42  GLU A C    2  
ATOM 2843  O O    . GLU A 1 42  ? 121.307 -7.393  5.519   1.00 0.00 ? 42  GLU A O    2  
ATOM 2844  C CB   . GLU A 1 42  ? 122.514 -5.131  6.996   1.00 0.00 ? 42  GLU A CB   2  
ATOM 2845  C CG   . GLU A 1 42  ? 123.924 -4.839  7.507   1.00 0.00 ? 42  GLU A CG   2  
ATOM 2846  C CD   . GLU A 1 42  ? 124.034 -4.858  9.007   1.00 0.00 ? 42  GLU A CD   2  
ATOM 2847  O OE1  . GLU A 1 42  ? 124.208 -5.957  9.585   1.00 0.00 ? 42  GLU A OE1  2  
ATOM 2848  O OE2  . GLU A 1 42  ? 123.976 -3.798  9.637   1.00 0.00 ? 42  GLU A OE2  2  
ATOM 2849  H H    . GLU A 1 42  ? 122.155 -3.312  5.016   1.00 0.00 ? 42  GLU A H    2  
ATOM 2850  H HA   . GLU A 1 42  ? 123.399 -5.844  5.220   1.00 0.00 ? 42  GLU A HA   2  
ATOM 2851  H HB2  . GLU A 1 42  ? 121.870 -4.302  7.249   1.00 0.00 ? 42  GLU A HB2  2  
ATOM 2852  H HB3  . GLU A 1 42  ? 122.157 -6.027  7.481   1.00 0.00 ? 42  GLU A HB3  2  
ATOM 2853  H HG2  . GLU A 1 42  ? 124.575 -5.606  7.114   1.00 0.00 ? 42  GLU A HG2  2  
ATOM 2854  H HG3  . GLU A 1 42  ? 124.267 -3.888  7.131   1.00 0.00 ? 42  GLU A HG3  2  
ATOM 2855  N N    . PHE A 1 43  ? 120.704 -5.912  3.967   1.00 0.00 ? 43  PHE A N    2  
ATOM 2856  C CA   . PHE A 1 43  ? 119.823 -6.809  3.262   1.00 0.00 ? 43  PHE A CA   2  
ATOM 2857  C C    . PHE A 1 43  ? 120.691 -7.814  2.541   1.00 0.00 ? 43  PHE A C    2  
ATOM 2858  O O    . PHE A 1 43  ? 120.603 -9.032  2.775   1.00 0.00 ? 43  PHE A O    2  
ATOM 2859  C CB   . PHE A 1 43  ? 118.955 -6.017  2.259   1.00 0.00 ? 43  PHE A CB   2  
ATOM 2860  C CG   . PHE A 1 43  ? 118.151 -6.841  1.298   1.00 0.00 ? 43  PHE A CG   2  
ATOM 2861  C CD1  . PHE A 1 43  ? 118.690 -7.233  0.081   1.00 0.00 ? 43  PHE A CD1  2  
ATOM 2862  C CD2  . PHE A 1 43  ? 116.870 -7.213  1.599   1.00 0.00 ? 43  PHE A CD2  2  
ATOM 2863  C CE1  . PHE A 1 43  ? 117.959 -7.983  -0.805  1.00 0.00 ? 43  PHE A CE1  2  
ATOM 2864  C CE2  . PHE A 1 43  ? 116.129 -7.961  0.717   1.00 0.00 ? 43  PHE A CE2  2  
ATOM 2865  C CZ   . PHE A 1 43  ? 116.674 -8.348  -0.489  1.00 0.00 ? 43  PHE A CZ   2  
ATOM 2866  H H    . PHE A 1 43  ? 120.706 -4.976  3.680   1.00 0.00 ? 43  PHE A H    2  
ATOM 2867  H HA   . PHE A 1 43  ? 119.191 -7.314  3.978   1.00 0.00 ? 43  PHE A HA   2  
ATOM 2868  H HB2  . PHE A 1 43  ? 118.259 -5.404  2.813   1.00 0.00 ? 43  PHE A HB2  2  
ATOM 2869  H HB3  . PHE A 1 43  ? 119.602 -5.368  1.687   1.00 0.00 ? 43  PHE A HB3  2  
ATOM 2870  H HD1  . PHE A 1 43  ? 119.699 -6.932  -0.161  1.00 0.00 ? 43  PHE A HD1  2  
ATOM 2871  H HD2  . PHE A 1 43  ? 116.439 -6.913  2.543   1.00 0.00 ? 43  PHE A HD2  2  
ATOM 2872  H HE1  . PHE A 1 43  ? 118.391 -8.281  -1.749  1.00 0.00 ? 43  PHE A HE1  2  
ATOM 2873  H HE2  . PHE A 1 43  ? 115.117 -8.237  0.974   1.00 0.00 ? 43  PHE A HE2  2  
ATOM 2874  H HZ   . PHE A 1 43  ? 116.093 -8.938  -1.181  1.00 0.00 ? 43  PHE A HZ   2  
ATOM 2875  N N    . TRP A 1 44  ? 121.583 -7.322  1.697   1.00 0.00 ? 44  TRP A N    2  
ATOM 2876  C CA   . TRP A 1 44  ? 122.441 -8.268  1.008   1.00 0.00 ? 44  TRP A CA   2  
ATOM 2877  C C    . TRP A 1 44  ? 123.658 -8.699  1.814   1.00 0.00 ? 44  TRP A C    2  
ATOM 2878  O O    . TRP A 1 44  ? 124.244 -9.736  1.541   1.00 0.00 ? 44  TRP A O    2  
ATOM 2879  C CB   . TRP A 1 44  ? 122.736 -7.948  -0.458  1.00 0.00 ? 44  TRP A CB   2  
ATOM 2880  C CG   . TRP A 1 44  ? 123.236 -6.591  -0.737  1.00 0.00 ? 44  TRP A CG   2  
ATOM 2881  C CD1  . TRP A 1 44  ? 122.560 -5.610  -1.381  1.00 0.00 ? 44  TRP A CD1  2  
ATOM 2882  C CD2  . TRP A 1 44  ? 124.516 -6.057  -0.402  1.00 0.00 ? 44  TRP A CD2  2  
ATOM 2883  N NE1  . TRP A 1 44  ? 123.336 -4.504  -1.480  1.00 0.00 ? 44  TRP A NE1  2  
ATOM 2884  C CE2  . TRP A 1 44  ? 124.542 -4.748  -0.870  1.00 0.00 ? 44  TRP A CE2  2  
ATOM 2885  C CE3  . TRP A 1 44  ? 125.643 -6.563  0.255   1.00 0.00 ? 44  TRP A CE3  2  
ATOM 2886  C CZ2  . TRP A 1 44  ? 125.642 -3.934  -0.705  1.00 0.00 ? 44  TRP A CZ2  2  
ATOM 2887  C CZ3  . TRP A 1 44  ? 126.737 -5.751  0.417   1.00 0.00 ? 44  TRP A CZ3  2  
ATOM 2888  C CH2  . TRP A 1 44  ? 126.729 -4.450  -0.057  1.00 0.00 ? 44  TRP A CH2  2  
ATOM 2889  H H    . TRP A 1 44  ? 121.630 -6.345  1.550   1.00 0.00 ? 44  TRP A H    2  
ATOM 2890  H HA   . TRP A 1 44  ? 121.826 -9.159  1.030   1.00 0.00 ? 44  TRP A HA   2  
ATOM 2891  H HB2  . TRP A 1 44  ? 123.482 -8.638  -0.821  1.00 0.00 ? 44  TRP A HB2  2  
ATOM 2892  H HB3  . TRP A 1 44  ? 121.830 -8.098  -1.028  1.00 0.00 ? 44  TRP A HB3  2  
ATOM 2893  H HD1  . TRP A 1 44  ? 121.559 -5.715  -1.769  1.00 0.00 ? 44  TRP A HD1  2  
ATOM 2894  H HE1  . TRP A 1 44  ? 123.056 -3.672  -1.916  1.00 0.00 ? 44  TRP A HE1  2  
ATOM 2895  H HE3  . TRP A 1 44  ? 125.661 -7.575  0.630   1.00 0.00 ? 44  TRP A HE3  2  
ATOM 2896  H HZ2  . TRP A 1 44  ? 125.656 -2.917  -1.068  1.00 0.00 ? 44  TRP A HZ2  2  
ATOM 2897  H HZ3  . TRP A 1 44  ? 127.615 -6.125  0.923   1.00 0.00 ? 44  TRP A HZ3  2  
ATOM 2898  H HH2  . TRP A 1 44  ? 127.611 -3.842  0.090   1.00 0.00 ? 44  TRP A HH2  2  
ATOM 2899  N N    . ILE A 1 45  ? 124.035 -7.919  2.819   1.00 0.00 ? 45  ILE A N    2  
ATOM 2900  C CA   . ILE A 1 45  ? 125.059 -8.366  3.758   1.00 0.00 ? 45  ILE A CA   2  
ATOM 2901  C C    . ILE A 1 45  ? 124.513 -9.536  4.577   1.00 0.00 ? 45  ILE A C    2  
ATOM 2902  O O    . ILE A 1 45  ? 125.263 -10.429 4.973   1.00 0.00 ? 45  ILE A O    2  
ATOM 2903  C CB   . ILE A 1 45  ? 125.621 -7.205  4.648   1.00 0.00 ? 45  ILE A CB   2  
ATOM 2904  C CG1  . ILE A 1 45  ? 126.740 -6.451  3.908   1.00 0.00 ? 45  ILE A CG1  2  
ATOM 2905  C CG2  . ILE A 1 45  ? 126.052 -7.643  6.046   1.00 0.00 ? 45  ILE A CG2  2  
ATOM 2906  C CD1  . ILE A 1 45  ? 127.277 -5.243  4.651   1.00 0.00 ? 45  ILE A CD1  2  
ATOM 2907  H H    . ILE A 1 45  ? 123.656 -7.017  2.908   1.00 0.00 ? 45  ILE A H    2  
ATOM 2908  H HA   . ILE A 1 45  ? 125.854 -8.767  3.144   1.00 0.00 ? 45  ILE A HA   2  
ATOM 2909  H HB   . ILE A 1 45  ? 124.812 -6.513  4.785   1.00 0.00 ? 45  ILE A HB   2  
ATOM 2910  H HG12 . ILE A 1 45  ? 127.567 -7.125  3.740   1.00 0.00 ? 45  ILE A HG12 2  
ATOM 2911  H HG13 . ILE A 1 45  ? 126.361 -6.116  2.953   1.00 0.00 ? 45  ILE A HG13 2  
ATOM 2912  H HG21 . ILE A 1 45  ? 126.903 -8.306  5.985   1.00 0.00 ? 45  ILE A HG21 2  
ATOM 2913  H HG22 . ILE A 1 45  ? 125.226 -8.168  6.505   1.00 0.00 ? 45  ILE A HG22 2  
ATOM 2914  H HG23 . ILE A 1 45  ? 126.290 -6.766  6.630   1.00 0.00 ? 45  ILE A HG23 2  
ATOM 2915  H HD11 . ILE A 1 45  ? 128.051 -4.770  4.063   1.00 0.00 ? 45  ILE A HD11 2  
ATOM 2916  H HD12 . ILE A 1 45  ? 127.687 -5.558  5.600   1.00 0.00 ? 45  ILE A HD12 2  
ATOM 2917  H HD13 . ILE A 1 45  ? 126.474 -4.541  4.822   1.00 0.00 ? 45  ILE A HD13 2  
ATOM 2918  N N    . ALA A 1 46  ? 123.187 -9.556  4.779   1.00 0.00 ? 46  ALA A N    2  
ATOM 2919  C CA   . ALA A 1 46  ? 122.547 -10.701 5.402   1.00 0.00 ? 46  ALA A CA   2  
ATOM 2920  C C    . ALA A 1 46  ? 122.663 -11.870 4.467   1.00 0.00 ? 46  ALA A C    2  
ATOM 2921  O O    . ALA A 1 46  ? 122.936 -12.961 4.886   1.00 0.00 ? 46  ALA A O    2  
ATOM 2922  C CB   . ALA A 1 46  ? 121.079 -10.457 5.696   1.00 0.00 ? 46  ALA A CB   2  
ATOM 2923  H H    . ALA A 1 46  ? 122.637 -8.784  4.530   1.00 0.00 ? 46  ALA A H    2  
ATOM 2924  H HA   . ALA A 1 46  ? 123.073 -10.905 6.324   1.00 0.00 ? 46  ALA A HA   2  
ATOM 2925  H HB1  . ALA A 1 46  ? 120.587 -10.121 4.794   1.00 0.00 ? 46  ALA A HB1  2  
ATOM 2926  H HB2  . ALA A 1 46  ? 120.957 -9.728  6.484   1.00 0.00 ? 46  ALA A HB2  2  
ATOM 2927  H HB3  . ALA A 1 46  ? 120.638 -11.404 5.982   1.00 0.00 ? 46  ALA A HB3  2  
ATOM 2928  N N    . CYS A 1 47  ? 122.478 -11.608 3.179   1.00 0.00 ? 47  CYS A N    2  
ATOM 2929  C CA   . CYS A 1 47  ? 122.594 -12.637 2.153   1.00 0.00 ? 47  CYS A CA   2  
ATOM 2930  C C    . CYS A 1 47  ? 124.022 -13.214 2.109   1.00 0.00 ? 47  CYS A C    2  
ATOM 2931  O O    . CYS A 1 47  ? 124.212 -14.390 1.839   1.00 0.00 ? 47  CYS A O    2  
ATOM 2932  C CB   . CYS A 1 47  ? 122.186 -12.074 0.795   1.00 0.00 ? 47  CYS A CB   2  
ATOM 2933  S SG   . CYS A 1 47  ? 120.515 -11.374 0.765   1.00 0.00 ? 47  CYS A SG   2  
ATOM 2934  H H    . CYS A 1 47  ? 122.236 -10.695 2.915   1.00 0.00 ? 47  CYS A H    2  
ATOM 2935  H HA   . CYS A 1 47  ? 121.914 -13.433 2.421   1.00 0.00 ? 47  CYS A HA   2  
ATOM 2936  H HB2  . CYS A 1 47  ? 122.874 -11.288 0.517   1.00 0.00 ? 47  CYS A HB2  2  
ATOM 2937  H HB3  . CYS A 1 47  ? 122.228 -12.860 0.056   1.00 0.00 ? 47  CYS A HB3  2  
ATOM 2938  H HG   . CYS A 1 47  ? 120.406 -10.463 1.725   1.00 0.00 ? 47  CYS A HG   2  
ATOM 2939  N N    . GLU A 1 48  ? 125.009 -12.383 2.392   1.00 0.00 ? 48  GLU A N    2  
ATOM 2940  C CA   . GLU A 1 48  ? 126.396 -12.830 2.476   1.00 0.00 ? 48  GLU A CA   2  
ATOM 2941  C C    . GLU A 1 48  ? 126.607 -13.610 3.774   1.00 0.00 ? 48  GLU A C    2  
ATOM 2942  O O    . GLU A 1 48  ? 127.307 -14.618 3.813   1.00 0.00 ? 48  GLU A O    2  
ATOM 2943  C CB   . GLU A 1 48  ? 127.350 -11.642 2.404   1.00 0.00 ? 48  GLU A CB   2  
ATOM 2944  C CG   . GLU A 1 48  ? 127.260 -10.858 1.107   1.00 0.00 ? 48  GLU A CG   2  
ATOM 2945  C CD   . GLU A 1 48  ? 127.583 -11.696 -0.106  1.00 0.00 ? 48  GLU A CD   2  
ATOM 2946  O OE1  . GLU A 1 48  ? 128.773 -11.853 -0.432  1.00 0.00 ? 48  GLU A OE1  2  
ATOM 2947  O OE2  . GLU A 1 48  ? 126.656 -12.202 -0.769  1.00 0.00 ? 48  GLU A OE2  2  
ATOM 2948  H H    . GLU A 1 48  ? 124.800 -11.431 2.515   1.00 0.00 ? 48  GLU A H    2  
ATOM 2949  H HA   . GLU A 1 48  ? 126.580 -13.492 1.641   1.00 0.00 ? 48  GLU A HA   2  
ATOM 2950  H HB2  . GLU A 1 48  ? 127.129 -10.970 3.220   1.00 0.00 ? 48  GLU A HB2  2  
ATOM 2951  H HB3  . GLU A 1 48  ? 128.363 -12.002 2.512   1.00 0.00 ? 48  GLU A HB3  2  
ATOM 2952  H HG2  . GLU A 1 48  ? 126.255 -10.476 1.003   1.00 0.00 ? 48  GLU A HG2  2  
ATOM 2953  H HG3  . GLU A 1 48  ? 127.954 -10.032 1.153   1.00 0.00 ? 48  GLU A HG3  2  
ATOM 2954  N N    . ASP A 1 49  ? 125.961 -13.154 4.827   1.00 0.00 ? 49  ASP A N    2  
ATOM 2955  C CA   . ASP A 1 49  ? 125.993 -13.827 6.134   1.00 0.00 ? 49  ASP A CA   2  
ATOM 2956  C C    . ASP A 1 49  ? 125.342 -15.193 6.011   1.00 0.00 ? 49  ASP A C    2  
ATOM 2957  O O    . ASP A 1 49  ? 125.728 -16.164 6.651   1.00 0.00 ? 49  ASP A O    2  
ATOM 2958  C CB   . ASP A 1 49  ? 125.243 -12.993 7.171   1.00 0.00 ? 49  ASP A CB   2  
ATOM 2959  C CG   . ASP A 1 49  ? 125.245 -13.619 8.535   1.00 0.00 ? 49  ASP A CG   2  
ATOM 2960  O OD1  . ASP A 1 49  ? 126.248 -13.473 9.242   1.00 0.00 ? 49  ASP A OD1  2  
ATOM 2961  O OD2  . ASP A 1 49  ? 124.232 -14.243 8.932   1.00 0.00 ? 49  ASP A OD2  2  
ATOM 2962  H H    . ASP A 1 49  ? 125.446 -12.321 4.728   1.00 0.00 ? 49  ASP A H    2  
ATOM 2963  H HA   . ASP A 1 49  ? 127.023 -13.942 6.439   1.00 0.00 ? 49  ASP A HA   2  
ATOM 2964  H HB2  . ASP A 1 49  ? 125.705 -12.019 7.245   1.00 0.00 ? 49  ASP A HB2  2  
ATOM 2965  H HB3  . ASP A 1 49  ? 124.218 -12.873 6.848   1.00 0.00 ? 49  ASP A HB3  2  
ATOM 2966  N N    . PHE A 1 50  ? 124.370 -15.231 5.167   1.00 0.00 ? 50  PHE A N    2  
ATOM 2967  C CA   . PHE A 1 50  ? 123.632 -16.401 4.822   1.00 0.00 ? 50  PHE A CA   2  
ATOM 2968  C C    . PHE A 1 50  ? 124.445 -17.310 3.872   1.00 0.00 ? 50  PHE A C    2  
ATOM 2969  O O    . PHE A 1 50  ? 124.388 -18.526 3.975   1.00 0.00 ? 50  PHE A O    2  
ATOM 2970  C CB   . PHE A 1 50  ? 122.285 -15.943 4.264   1.00 0.00 ? 50  PHE A CB   2  
ATOM 2971  C CG   . PHE A 1 50  ? 121.498 -16.928 3.506   1.00 0.00 ? 50  PHE A CG   2  
ATOM 2972  C CD1  . PHE A 1 50  ? 121.077 -18.100 4.072   1.00 0.00 ? 50  PHE A CD1  2  
ATOM 2973  C CD2  . PHE A 1 50  ? 121.175 -16.660 2.202   1.00 0.00 ? 50  PHE A CD2  2  
ATOM 2974  C CE1  . PHE A 1 50  ? 120.345 -18.991 3.345   1.00 0.00 ? 50  PHE A CE1  2  
ATOM 2975  C CE2  . PHE A 1 50  ? 120.438 -17.545 1.465   1.00 0.00 ? 50  PHE A CE2  2  
ATOM 2976  C CZ   . PHE A 1 50  ? 120.022 -18.714 2.037   1.00 0.00 ? 50  PHE A CZ   2  
ATOM 2977  H H    . PHE A 1 50  ? 124.097 -14.377 4.764   1.00 0.00 ? 50  PHE A H    2  
ATOM 2978  H HA   . PHE A 1 50  ? 123.467 -16.923 5.751   1.00 0.00 ? 50  PHE A HA   2  
ATOM 2979  H HB2  . PHE A 1 50  ? 121.665 -15.620 5.086   1.00 0.00 ? 50  PHE A HB2  2  
ATOM 2980  H HB3  . PHE A 1 50  ? 122.462 -15.092 3.622   1.00 0.00 ? 50  PHE A HB3  2  
ATOM 2981  H HD1  . PHE A 1 50  ? 121.331 -18.312 5.100   1.00 0.00 ? 50  PHE A HD1  2  
ATOM 2982  H HD2  . PHE A 1 50  ? 121.519 -15.726 1.780   1.00 0.00 ? 50  PHE A HD2  2  
ATOM 2983  H HE1  . PHE A 1 50  ? 120.015 -19.916 3.794   1.00 0.00 ? 50  PHE A HE1  2  
ATOM 2984  H HE2  . PHE A 1 50  ? 120.192 -17.327 0.436   1.00 0.00 ? 50  PHE A HE2  2  
ATOM 2985  H HZ   . PHE A 1 50  ? 119.440 -19.420 1.464   1.00 0.00 ? 50  PHE A HZ   2  
ATOM 2986  N N    . LYS A 1 51  ? 125.202 -16.705 2.984   1.00 0.00 ? 51  LYS A N    2  
ATOM 2987  C CA   . LYS A 1 51  ? 126.176 -17.408 2.116   1.00 0.00 ? 51  LYS A CA   2  
ATOM 2988  C C    . LYS A 1 51  ? 127.227 -18.162 2.984   1.00 0.00 ? 51  LYS A C    2  
ATOM 2989  O O    . LYS A 1 51  ? 127.835 -19.160 2.553   1.00 0.00 ? 51  LYS A O    2  
ATOM 2990  C CB   . LYS A 1 51  ? 126.879 -16.363 1.224   1.00 0.00 ? 51  LYS A CB   2  
ATOM 2991  C CG   . LYS A 1 51  ? 127.972 -16.896 0.314   1.00 0.00 ? 51  LYS A CG   2  
ATOM 2992  C CD   . LYS A 1 51  ? 128.704 -15.760 -0.377  1.00 0.00 ? 51  LYS A CD   2  
ATOM 2993  C CE   . LYS A 1 51  ? 129.812 -16.281 -1.268  1.00 0.00 ? 51  LYS A CE   2  
ATOM 2994  N NZ   . LYS A 1 51  ? 130.569 -15.190 -1.911  1.00 0.00 ? 51  LYS A NZ   2  
ATOM 2995  H H    . LYS A 1 51  ? 125.058 -15.743 2.846   1.00 0.00 ? 51  LYS A H    2  
ATOM 2996  H HA   . LYS A 1 51  ? 125.656 -18.126 1.494   1.00 0.00 ? 51  LYS A HA   2  
ATOM 2997  H HB2  . LYS A 1 51  ? 126.136 -15.893 0.598   1.00 0.00 ? 51  LYS A HB2  2  
ATOM 2998  H HB3  . LYS A 1 51  ? 127.311 -15.607 1.864   1.00 0.00 ? 51  LYS A HB3  2  
ATOM 2999  H HG2  . LYS A 1 51  ? 128.676 -17.462 0.906   1.00 0.00 ? 51  LYS A HG2  2  
ATOM 3000  H HG3  . LYS A 1 51  ? 127.526 -17.537 -0.433  1.00 0.00 ? 51  LYS A HG3  2  
ATOM 3001  H HD2  . LYS A 1 51  ? 128.000 -15.205 -0.980  1.00 0.00 ? 51  LYS A HD2  2  
ATOM 3002  H HD3  . LYS A 1 51  ? 129.128 -15.109 0.374   1.00 0.00 ? 51  LYS A HD3  2  
ATOM 3003  H HE2  . LYS A 1 51  ? 130.490 -16.872 -0.671  1.00 0.00 ? 51  LYS A HE2  2  
ATOM 3004  H HE3  . LYS A 1 51  ? 129.376 -16.907 -2.034  1.00 0.00 ? 51  LYS A HE3  2  
ATOM 3005  H HZ1  . LYS A 1 51  ? 131.269 -15.570 -2.583  1.00 0.00 ? 51  LYS A HZ1  2  
ATOM 3006  H HZ2  . LYS A 1 51  ? 131.114 -14.659 -1.195  1.00 0.00 ? 51  LYS A HZ2  2  
ATOM 3007  H HZ3  . LYS A 1 51  ? 129.946 -14.521 -2.417  1.00 0.00 ? 51  LYS A HZ3  2  
ATOM 3008  N N    . LYS A 1 52  ? 127.426 -17.673 4.201   1.00 0.00 ? 52  LYS A N    2  
ATOM 3009  C CA   . LYS A 1 52  ? 128.336 -18.285 5.177   1.00 0.00 ? 52  LYS A CA   2  
ATOM 3010  C C    . LYS A 1 52  ? 127.792 -19.623 5.716   1.00 0.00 ? 52  LYS A C    2  
ATOM 3011  O O    . LYS A 1 52  ? 128.522 -20.369 6.379   1.00 0.00 ? 52  LYS A O    2  
ATOM 3012  C CB   . LYS A 1 52  ? 128.556 -17.350 6.364   1.00 0.00 ? 52  LYS A CB   2  
ATOM 3013  C CG   . LYS A 1 52  ? 129.238 -16.033 6.047   1.00 0.00 ? 52  LYS A CG   2  
ATOM 3014  C CD   . LYS A 1 52  ? 129.216 -15.131 7.271   1.00 0.00 ? 52  LYS A CD   2  
ATOM 3015  C CE   . LYS A 1 52  ? 130.042 -13.870 7.088   1.00 0.00 ? 52  LYS A CE   2  
ATOM 3016  N NZ   . LYS A 1 52  ? 129.593 -13.013 5.969   1.00 0.00 ? 52  LYS A NZ   2  
ATOM 3017  H H    . LYS A 1 52  ? 126.962 -16.838 4.432   1.00 0.00 ? 52  LYS A H    2  
ATOM 3018  H HA   . LYS A 1 52  ? 129.287 -18.456 4.696   1.00 0.00 ? 52  LYS A HA   2  
ATOM 3019  H HB2  . LYS A 1 52  ? 127.590 -17.113 6.790   1.00 0.00 ? 52  LYS A HB2  2  
ATOM 3020  H HB3  . LYS A 1 52  ? 129.157 -17.874 7.095   1.00 0.00 ? 52  LYS A HB3  2  
ATOM 3021  H HG2  . LYS A 1 52  ? 130.262 -16.223 5.761   1.00 0.00 ? 52  LYS A HG2  2  
ATOM 3022  H HG3  . LYS A 1 52  ? 128.711 -15.547 5.240   1.00 0.00 ? 52  LYS A HG3  2  
ATOM 3023  H HD2  . LYS A 1 52  ? 128.194 -14.846 7.472   1.00 0.00 ? 52  LYS A HD2  2  
ATOM 3024  H HD3  . LYS A 1 52  ? 129.600 -15.686 8.114   1.00 0.00 ? 52  LYS A HD3  2  
ATOM 3025  H HE2  . LYS A 1 52  ? 129.948 -13.300 7.999   1.00 0.00 ? 52  LYS A HE2  2  
ATOM 3026  H HE3  . LYS A 1 52  ? 131.071 -14.160 6.934   1.00 0.00 ? 52  LYS A HE3  2  
ATOM 3027  H HZ1  . LYS A 1 52  ? 128.637 -12.618 6.098   1.00 0.00 ? 52  LYS A HZ1  2  
ATOM 3028  H HZ2  . LYS A 1 52  ? 129.643 -13.485 5.038   1.00 0.00 ? 52  LYS A HZ2  2  
ATOM 3029  H HZ3  . LYS A 1 52  ? 130.237 -12.197 5.895   1.00 0.00 ? 52  LYS A HZ3  2  
ATOM 3030  N N    . SER A 1 53  ? 126.525 -19.920 5.451   1.00 0.00 ? 53  SER A N    2  
ATOM 3031  C CA   . SER A 1 53  ? 125.906 -21.137 5.955   1.00 0.00 ? 53  SER A CA   2  
ATOM 3032  C C    . SER A 1 53  ? 126.583 -22.377 5.388   1.00 0.00 ? 53  SER A C    2  
ATOM 3033  O O    . SER A 1 53  ? 126.707 -22.540 4.168   1.00 0.00 ? 53  SER A O    2  
ATOM 3034  C CB   . SER A 1 53  ? 124.416 -21.135 5.667   1.00 0.00 ? 53  SER A CB   2  
ATOM 3035  O OG   . SER A 1 53  ? 123.824 -19.936 6.154   1.00 0.00 ? 53  SER A OG   2  
ATOM 3036  H H    . SER A 1 53  ? 125.994 -19.313 4.893   1.00 0.00 ? 53  SER A H    2  
ATOM 3037  H HA   . SER A 1 53  ? 126.053 -21.142 7.026   1.00 0.00 ? 53  SER A HA   2  
ATOM 3038  H HB2  . SER A 1 53  ? 124.254 -21.200 4.601   1.00 0.00 ? 53  SER A HB2  2  
ATOM 3039  H HB3  . SER A 1 53  ? 123.951 -21.976 6.160   1.00 0.00 ? 53  SER A HB3  2  
ATOM 3040  H HG   . SER A 1 53  ? 123.764 -19.368 5.372   1.00 0.00 ? 53  SER A HG   2  
ATOM 3041  N N    . LYS A 1 54  ? 127.021 -23.234 6.276   1.00 0.00 ? 54  LYS A N    2  
ATOM 3042  C CA   . LYS A 1 54  ? 127.785 -24.410 5.907   1.00 0.00 ? 54  LYS A CA   2  
ATOM 3043  C C    . LYS A 1 54  ? 126.905 -25.618 5.596   1.00 0.00 ? 54  LYS A C    2  
ATOM 3044  O O    . LYS A 1 54  ? 127.415 -26.675 5.211   1.00 0.00 ? 54  LYS A O    2  
ATOM 3045  C CB   . LYS A 1 54  ? 128.837 -24.734 7.015   1.00 0.00 ? 54  LYS A CB   2  
ATOM 3046  C CG   . LYS A 1 54  ? 128.275 -25.007 8.434   1.00 0.00 ? 54  LYS A CG   2  
ATOM 3047  C CD   . LYS A 1 54  ? 127.638 -26.393 8.566   1.00 0.00 ? 54  LYS A CD   2  
ATOM 3048  C CE   . LYS A 1 54  ? 126.997 -26.599 9.924   1.00 0.00 ? 54  LYS A CE   2  
ATOM 3049  N NZ   . LYS A 1 54  ? 126.433 -27.964 10.065  1.00 0.00 ? 54  LYS A NZ   2  
ATOM 3050  H H    . LYS A 1 54  ? 126.829 -23.060 7.228   1.00 0.00 ? 54  LYS A H    2  
ATOM 3051  H HA   . LYS A 1 54  ? 128.328 -24.160 5.007   1.00 0.00 ? 54  LYS A HA   2  
ATOM 3052  H HB2  . LYS A 1 54  ? 129.391 -25.611 6.715   1.00 0.00 ? 54  LYS A HB2  2  
ATOM 3053  H HB3  . LYS A 1 54  ? 129.524 -23.902 7.081   1.00 0.00 ? 54  LYS A HB3  2  
ATOM 3054  H HG2  . LYS A 1 54  ? 129.082 -24.934 9.148   1.00 0.00 ? 54  LYS A HG2  2  
ATOM 3055  H HG3  . LYS A 1 54  ? 127.532 -24.256 8.660   1.00 0.00 ? 54  LYS A HG3  2  
ATOM 3056  H HD2  . LYS A 1 54  ? 126.877 -26.499 7.807   1.00 0.00 ? 54  LYS A HD2  2  
ATOM 3057  H HD3  . LYS A 1 54  ? 128.401 -27.143 8.417   1.00 0.00 ? 54  LYS A HD3  2  
ATOM 3058  H HE2  . LYS A 1 54  ? 127.743 -26.448 10.689  1.00 0.00 ? 54  LYS A HE2  2  
ATOM 3059  H HE3  . LYS A 1 54  ? 126.204 -25.876 10.049  1.00 0.00 ? 54  LYS A HE3  2  
ATOM 3060  H HZ1  . LYS A 1 54  ? 127.199 -28.671 10.029  1.00 0.00 ? 54  LYS A HZ1  2  
ATOM 3061  H HZ2  . LYS A 1 54  ? 125.795 -28.203 9.272   1.00 0.00 ? 54  LYS A HZ2  2  
ATOM 3062  H HZ3  . LYS A 1 54  ? 125.912 -28.079 10.961  1.00 0.00 ? 54  LYS A HZ3  2  
ATOM 3063  N N    . GLY A 1 55  ? 125.608 -25.469 5.730   1.00 0.00 ? 55  GLY A N    2  
ATOM 3064  C CA   . GLY A 1 55  ? 124.743 -26.604 5.575   1.00 0.00 ? 55  GLY A CA   2  
ATOM 3065  C C    . GLY A 1 55  ? 123.424 -26.224 4.989   1.00 0.00 ? 55  GLY A C    2  
ATOM 3066  O O    . GLY A 1 55  ? 122.926 -25.131 5.274   1.00 0.00 ? 55  GLY A O    2  
ATOM 3067  H H    . GLY A 1 55  ? 125.201 -24.587 5.878   1.00 0.00 ? 55  GLY A H    2  
ATOM 3068  H HA2  . GLY A 1 55  ? 125.223 -27.323 4.927   1.00 0.00 ? 55  GLY A HA2  2  
ATOM 3069  H HA3  . GLY A 1 55  ? 124.580 -27.057 6.542   1.00 0.00 ? 55  GLY A HA3  2  
ATOM 3070  N N    . PRO A 1 56  ? 122.821 -27.107 4.169   1.00 0.00 ? 56  PRO A N    2  
ATOM 3071  C CA   . PRO A 1 56  ? 121.554 -26.830 3.488   1.00 0.00 ? 56  PRO A CA   2  
ATOM 3072  C C    . PRO A 1 56  ? 120.381 -26.618 4.450   1.00 0.00 ? 56  PRO A C    2  
ATOM 3073  O O    . PRO A 1 56  ? 119.445 -25.883 4.141   1.00 0.00 ? 56  PRO A O    2  
ATOM 3074  C CB   . PRO A 1 56  ? 121.322 -28.056 2.601   1.00 0.00 ? 56  PRO A CB   2  
ATOM 3075  C CG   . PRO A 1 56  ? 122.181 -29.127 3.175   1.00 0.00 ? 56  PRO A CG   2  
ATOM 3076  C CD   . PRO A 1 56  ? 123.346 -28.445 3.826   1.00 0.00 ? 56  PRO A CD   2  
ATOM 3077  H HA   . PRO A 1 56  ? 121.648 -25.950 2.867   1.00 0.00 ? 56  PRO A HA   2  
ATOM 3078  H HB2  . PRO A 1 56  ? 120.278 -28.330 2.629   1.00 0.00 ? 56  PRO A HB2  2  
ATOM 3079  H HB3  . PRO A 1 56  ? 121.612 -27.821 1.588   1.00 0.00 ? 56  PRO A HB3  2  
ATOM 3080  H HG2  . PRO A 1 56  ? 121.623 -29.690 3.909   1.00 0.00 ? 56  PRO A HG2  2  
ATOM 3081  H HG3  . PRO A 1 56  ? 122.525 -29.781 2.388   1.00 0.00 ? 56  PRO A HG3  2  
ATOM 3082  H HD2  . PRO A 1 56  ? 123.647 -28.979 4.715   1.00 0.00 ? 56  PRO A HD2  2  
ATOM 3083  H HD3  . PRO A 1 56  ? 124.172 -28.366 3.136   1.00 0.00 ? 56  PRO A HD3  2  
ATOM 3084  N N    . GLN A 1 57  ? 120.450 -27.228 5.618   1.00 0.00 ? 57  GLN A N    2  
ATOM 3085  C CA   . GLN A 1 57  ? 119.402 -27.089 6.618   1.00 0.00 ? 57  GLN A CA   2  
ATOM 3086  C C    . GLN A 1 57  ? 119.375 -25.666 7.136   1.00 0.00 ? 57  GLN A C    2  
ATOM 3087  O O    . GLN A 1 57  ? 118.304 -25.053 7.242   1.00 0.00 ? 57  GLN A O    2  
ATOM 3088  C CB   . GLN A 1 57  ? 119.579 -28.076 7.792   1.00 0.00 ? 57  GLN A CB   2  
ATOM 3089  C CG   . GLN A 1 57  ? 119.435 -29.563 7.437   1.00 0.00 ? 57  GLN A CG   2  
ATOM 3090  C CD   . GLN A 1 57  ? 120.525 -30.090 6.514   1.00 0.00 ? 57  GLN A CD   2  
ATOM 3091  O OE1  . GLN A 1 57  ? 121.668 -29.624 6.540   1.00 0.00 ? 57  GLN A OE1  2  
ATOM 3092  N NE2  . GLN A 1 57  ? 120.183 -31.026 5.683   1.00 0.00 ? 57  GLN A NE2  2  
ATOM 3093  H H    . GLN A 1 57  ? 121.234 -27.790 5.811   1.00 0.00 ? 57  GLN A H    2  
ATOM 3094  H HA   . GLN A 1 57  ? 118.461 -27.289 6.127   1.00 0.00 ? 57  GLN A HA   2  
ATOM 3095  H HB2  . GLN A 1 57  ? 120.561 -27.926 8.215   1.00 0.00 ? 57  GLN A HB2  2  
ATOM 3096  H HB3  . GLN A 1 57  ? 118.843 -27.829 8.544   1.00 0.00 ? 57  GLN A HB3  2  
ATOM 3097  H HG2  . GLN A 1 57  ? 119.464 -30.139 8.350   1.00 0.00 ? 57  GLN A HG2  2  
ATOM 3098  H HG3  . GLN A 1 57  ? 118.477 -29.708 6.959   1.00 0.00 ? 57  GLN A HG3  2  
ATOM 3099  H HE21 . GLN A 1 57  ? 119.251 -31.349 5.681   1.00 0.00 ? 57  GLN A HE21 2  
ATOM 3100  H HE22 . GLN A 1 57  ? 120.862 -31.393 5.069   1.00 0.00 ? 57  GLN A HE22 2  
ATOM 3101  N N    . GLN A 1 58  ? 120.566 -25.139 7.396   1.00 0.00 ? 58  GLN A N    2  
ATOM 3102  C CA   . GLN A 1 58  ? 120.762 -23.784 7.895   1.00 0.00 ? 58  GLN A CA   2  
ATOM 3103  C C    . GLN A 1 58  ? 120.290 -22.775 6.849   1.00 0.00 ? 58  GLN A C    2  
ATOM 3104  O O    . GLN A 1 58  ? 119.769 -21.702 7.186   1.00 0.00 ? 58  GLN A O    2  
ATOM 3105  C CB   . GLN A 1 58  ? 122.255 -23.568 8.198   1.00 0.00 ? 58  GLN A CB   2  
ATOM 3106  C CG   . GLN A 1 58  ? 122.582 -22.313 8.998   1.00 0.00 ? 58  GLN A CG   2  
ATOM 3107  C CD   . GLN A 1 58  ? 121.951 -22.327 10.379  1.00 0.00 ? 58  GLN A CD   2  
ATOM 3108  O OE1  . GLN A 1 58  ? 121.727 -23.384 10.960  1.00 0.00 ? 58  GLN A OE1  2  
ATOM 3109  N NE2  . GLN A 1 58  ? 121.699 -21.177 10.930  1.00 0.00 ? 58  GLN A NE2  2  
ATOM 3110  H H    . GLN A 1 58  ? 121.357 -25.709 7.264   1.00 0.00 ? 58  GLN A H    2  
ATOM 3111  H HA   . GLN A 1 58  ? 120.195 -23.662 8.807   1.00 0.00 ? 58  GLN A HA   2  
ATOM 3112  H HB2  . GLN A 1 58  ? 122.620 -24.418 8.757   1.00 0.00 ? 58  GLN A HB2  2  
ATOM 3113  H HB3  . GLN A 1 58  ? 122.787 -23.520 7.259   1.00 0.00 ? 58  GLN A HB3  2  
ATOM 3114  H HG2  . GLN A 1 58  ? 123.654 -22.239 9.109   1.00 0.00 ? 58  GLN A HG2  2  
ATOM 3115  H HG3  . GLN A 1 58  ? 122.216 -21.452 8.458   1.00 0.00 ? 58  GLN A HG3  2  
ATOM 3116  H HE21 . GLN A 1 58  ? 121.928 -20.356 10.446  1.00 0.00 ? 58  GLN A HE21 2  
ATOM 3117  H HE22 . GLN A 1 58  ? 121.271 -21.183 11.818  1.00 0.00 ? 58  GLN A HE22 2  
ATOM 3118  N N    . ILE A 1 59  ? 120.459 -23.148 5.580   1.00 0.00 ? 59  ILE A N    2  
ATOM 3119  C CA   . ILE A 1 59  ? 120.060 -22.321 4.446   1.00 0.00 ? 59  ILE A CA   2  
ATOM 3120  C C    . ILE A 1 59  ? 118.577 -21.963 4.550   1.00 0.00 ? 59  ILE A C    2  
ATOM 3121  O O    . ILE A 1 59  ? 118.217 -20.807 4.497   1.00 0.00 ? 59  ILE A O    2  
ATOM 3122  C CB   . ILE A 1 59  ? 120.284 -23.046 3.076   1.00 0.00 ? 59  ILE A CB   2  
ATOM 3123  C CG1  . ILE A 1 59  ? 121.733 -23.528 2.903   1.00 0.00 ? 59  ILE A CG1  2  
ATOM 3124  C CG2  . ILE A 1 59  ? 119.877 -22.161 1.915   1.00 0.00 ? 59  ILE A CG2  2  
ATOM 3125  C CD1  . ILE A 1 59  ? 122.792 -22.459 2.964   1.00 0.00 ? 59  ILE A CD1  2  
ATOM 3126  H H    . ILE A 1 59  ? 120.889 -24.015 5.416   1.00 0.00 ? 59  ILE A H    2  
ATOM 3127  H HA   . ILE A 1 59  ? 120.648 -21.416 4.460   1.00 0.00 ? 59  ILE A HA   2  
ATOM 3128  H HB   . ILE A 1 59  ? 119.629 -23.905 3.065   1.00 0.00 ? 59  ILE A HB   2  
ATOM 3129  H HG12 . ILE A 1 59  ? 121.957 -24.237 3.686   1.00 0.00 ? 59  ILE A HG12 2  
ATOM 3130  H HG13 . ILE A 1 59  ? 121.817 -24.027 1.948   1.00 0.00 ? 59  ILE A HG13 2  
ATOM 3131  H HG21 . ILE A 1 59  ? 119.999 -22.696 0.984   1.00 0.00 ? 59  ILE A HG21 2  
ATOM 3132  H HG22 . ILE A 1 59  ? 120.497 -21.277 1.908   1.00 0.00 ? 59  ILE A HG22 2  
ATOM 3133  H HG23 . ILE A 1 59  ? 118.844 -21.864 2.033   1.00 0.00 ? 59  ILE A HG23 2  
ATOM 3134  H HD11 . ILE A 1 59  ? 123.757 -22.947 2.975   1.00 0.00 ? 59  ILE A HD11 2  
ATOM 3135  H HD12 . ILE A 1 59  ? 122.671 -21.888 3.872   1.00 0.00 ? 59  ILE A HD12 2  
ATOM 3136  H HD13 . ILE A 1 59  ? 122.724 -21.817 2.098   1.00 0.00 ? 59  ILE A HD13 2  
ATOM 3137  N N    . HIS A 1 60  ? 117.741 -22.972 4.756   1.00 0.00 ? 60  HIS A N    2  
ATOM 3138  C CA   . HIS A 1 60  ? 116.274 -22.786 4.792   1.00 0.00 ? 60  HIS A CA   2  
ATOM 3139  C C    . HIS A 1 60  ? 115.847 -21.751 5.804   1.00 0.00 ? 60  HIS A C    2  
ATOM 3140  O O    . HIS A 1 60  ? 115.169 -20.786 5.468   1.00 0.00 ? 60  HIS A O    2  
ATOM 3141  C CB   . HIS A 1 60  ? 115.538 -24.097 5.085   1.00 0.00 ? 60  HIS A CB   2  
ATOM 3142  C CG   . HIS A 1 60  ? 115.591 -25.093 3.975   1.00 0.00 ? 60  HIS A CG   2  
ATOM 3143  N ND1  . HIS A 1 60  ? 114.603 -25.224 3.029   1.00 0.00 ? 60  HIS A ND1  2  
ATOM 3144  C CD2  . HIS A 1 60  ? 116.519 -26.016 3.669   1.00 0.00 ? 60  HIS A CD2  2  
ATOM 3145  C CE1  . HIS A 1 60  ? 114.926 -26.196 2.191   1.00 0.00 ? 60  HIS A CE1  2  
ATOM 3146  N NE2  . HIS A 1 60  ? 116.085 -26.685 2.565   1.00 0.00 ? 60  HIS A NE2  2  
ATOM 3147  H H    . HIS A 1 60  ? 118.144 -23.854 4.902   1.00 0.00 ? 60  HIS A H    2  
ATOM 3148  H HA   . HIS A 1 60  ? 115.974 -22.444 3.813   1.00 0.00 ? 60  HIS A HA   2  
ATOM 3149  H HB2  . HIS A 1 60  ? 115.978 -24.544 5.966   1.00 0.00 ? 60  HIS A HB2  2  
ATOM 3150  H HB3  . HIS A 1 60  ? 114.501 -23.875 5.293   1.00 0.00 ? 60  HIS A HB3  2  
ATOM 3151  H HD1  . HIS A 1 60  ? 113.785 -24.669 2.976   1.00 0.00 ? 60  HIS A HD1  2  
ATOM 3152  H HD2  . HIS A 1 60  ? 117.445 -26.177 4.205   1.00 0.00 ? 60  HIS A HD2  2  
ATOM 3153  H HE1  . HIS A 1 60  ? 114.338 -26.529 1.349   1.00 0.00 ? 60  HIS A HE1  2  
ATOM 3154  H HE2  . HIS A 1 60  ? 116.664 -27.280 2.023   1.00 0.00 ? 60  HIS A HE2  2  
ATOM 3155  N N    . LEU A 1 61  ? 116.301 -21.924 7.013   1.00 0.00 ? 61  LEU A N    2  
ATOM 3156  C CA   . LEU A 1 61  ? 115.890 -21.091 8.116   1.00 0.00 ? 61  LEU A CA   2  
ATOM 3157  C C    . LEU A 1 61  ? 116.460 -19.676 8.040   1.00 0.00 ? 61  LEU A C    2  
ATOM 3158  O O    . LEU A 1 61  ? 115.782 -18.708 8.399   1.00 0.00 ? 61  LEU A O    2  
ATOM 3159  C CB   . LEU A 1 61  ? 116.203 -21.805 9.423   1.00 0.00 ? 61  LEU A CB   2  
ATOM 3160  C CG   . LEU A 1 61  ? 117.644 -22.246 9.629   1.00 0.00 ? 61  LEU A CG   2  
ATOM 3161  C CD1  . LEU A 1 61  ? 118.392 -21.285 10.525  1.00 0.00 ? 61  LEU A CD1  2  
ATOM 3162  C CD2  . LEU A 1 61  ? 117.700 -23.677 10.140  1.00 0.00 ? 61  LEU A CD2  2  
ATOM 3163  H H    . LEU A 1 61  ? 116.948 -22.642 7.175   1.00 0.00 ? 61  LEU A H    2  
ATOM 3164  H HA   . LEU A 1 61  ? 114.816 -21.002 8.038   1.00 0.00 ? 61  LEU A HA   2  
ATOM 3165  H HB2  . LEU A 1 61  ? 115.913 -21.173 10.248  1.00 0.00 ? 61  LEU A HB2  2  
ATOM 3166  H HB3  . LEU A 1 61  ? 115.589 -22.690 9.432   1.00 0.00 ? 61  LEU A HB3  2  
ATOM 3167  H HG   . LEU A 1 61  ? 118.133 -22.220 8.665   1.00 0.00 ? 61  LEU A HG   2  
ATOM 3168  H HD11 . LEU A 1 61  ? 119.408 -21.632 10.652  1.00 0.00 ? 61  LEU A HD11 2  
ATOM 3169  H HD12 . LEU A 1 61  ? 117.903 -21.231 11.485  1.00 0.00 ? 61  LEU A HD12 2  
ATOM 3170  H HD13 . LEU A 1 61  ? 118.404 -20.307 10.067  1.00 0.00 ? 61  LEU A HD13 2  
ATOM 3171  H HD21 . LEU A 1 61  ? 117.154 -23.766 11.068  1.00 0.00 ? 61  LEU A HD21 2  
ATOM 3172  H HD22 . LEU A 1 61  ? 118.730 -23.968 10.287  1.00 0.00 ? 61  LEU A HD22 2  
ATOM 3173  H HD23 . LEU A 1 61  ? 117.258 -24.321 9.391   1.00 0.00 ? 61  LEU A HD23 2  
ATOM 3174  N N    . LYS A 1 62  ? 117.681 -19.545 7.550   1.00 0.00 ? 62  LYS A N    2  
ATOM 3175  C CA   . LYS A 1 62  ? 118.272 -18.214 7.380   1.00 0.00 ? 62  LYS A CA   2  
ATOM 3176  C C    . LYS A 1 62  ? 117.686 -17.501 6.174   1.00 0.00 ? 62  LYS A C    2  
ATOM 3177  O O    . LYS A 1 62  ? 117.577 -16.268 6.167   1.00 0.00 ? 62  LYS A O    2  
ATOM 3178  C CB   . LYS A 1 62  ? 119.798 -18.241 7.309   1.00 0.00 ? 62  LYS A CB   2  
ATOM 3179  C CG   . LYS A 1 62  ? 120.476 -18.567 8.628   1.00 0.00 ? 62  LYS A CG   2  
ATOM 3180  C CD   . LYS A 1 62  ? 121.992 -18.604 8.482   1.00 0.00 ? 62  LYS A CD   2  
ATOM 3181  C CE   . LYS A 1 62  ? 122.618 -17.241 8.137   1.00 0.00 ? 62  LYS A CE   2  
ATOM 3182  N NZ   . LYS A 1 62  ? 122.501 -16.248 9.232   1.00 0.00 ? 62  LYS A NZ   2  
ATOM 3183  H H    . LYS A 1 62  ? 118.175 -20.363 7.319   1.00 0.00 ? 62  LYS A H    2  
ATOM 3184  H HA   . LYS A 1 62  ? 117.974 -17.649 8.249   1.00 0.00 ? 62  LYS A HA   2  
ATOM 3185  H HB2  . LYS A 1 62  ? 120.099 -18.984 6.585   1.00 0.00 ? 62  LYS A HB2  2  
ATOM 3186  H HB3  . LYS A 1 62  ? 120.145 -17.273 6.982   1.00 0.00 ? 62  LYS A HB3  2  
ATOM 3187  H HG2  . LYS A 1 62  ? 120.214 -17.812 9.355   1.00 0.00 ? 62  LYS A HG2  2  
ATOM 3188  H HG3  . LYS A 1 62  ? 120.131 -19.533 8.968   1.00 0.00 ? 62  LYS A HG3  2  
ATOM 3189  H HD2  . LYS A 1 62  ? 122.416 -18.945 9.414   1.00 0.00 ? 62  LYS A HD2  2  
ATOM 3190  H HD3  . LYS A 1 62  ? 122.241 -19.309 7.703   1.00 0.00 ? 62  LYS A HD3  2  
ATOM 3191  H HE2  . LYS A 1 62  ? 123.665 -17.388 7.919   1.00 0.00 ? 62  LYS A HE2  2  
ATOM 3192  H HE3  . LYS A 1 62  ? 122.126 -16.855 7.256   1.00 0.00 ? 62  LYS A HE3  2  
ATOM 3193  H HZ1  . LYS A 1 62  ? 121.533 -15.880 9.343   1.00 0.00 ? 62  LYS A HZ1  2  
ATOM 3194  H HZ2  . LYS A 1 62  ? 123.148 -15.444 9.063   1.00 0.00 ? 62  LYS A HZ2  2  
ATOM 3195  H HZ3  . LYS A 1 62  ? 122.795 -16.695 10.129  1.00 0.00 ? 62  LYS A HZ3  2  
ATOM 3196  N N    . ALA A 1 63  ? 117.306 -18.264 5.160   1.00 0.00 ? 63  ALA A N    2  
ATOM 3197  C CA   . ALA A 1 63  ? 116.646 -17.699 4.006   1.00 0.00 ? 63  ALA A CA   2  
ATOM 3198  C C    . ALA A 1 63  ? 115.285 -17.191 4.426   1.00 0.00 ? 63  ALA A C    2  
ATOM 3199  O O    . ALA A 1 63  ? 114.919 -16.075 4.108   1.00 0.00 ? 63  ALA A O    2  
ATOM 3200  C CB   . ALA A 1 63  ? 116.527 -18.711 2.881   1.00 0.00 ? 63  ALA A CB   2  
ATOM 3201  H H    . ALA A 1 63  ? 117.489 -19.231 5.174   1.00 0.00 ? 63  ALA A H    2  
ATOM 3202  H HA   . ALA A 1 63  ? 117.238 -16.859 3.669   1.00 0.00 ? 63  ALA A HA   2  
ATOM 3203  H HB1  . ALA A 1 63  ? 117.495 -19.137 2.657   1.00 0.00 ? 63  ALA A HB1  2  
ATOM 3204  H HB2  . ALA A 1 63  ? 116.157 -18.220 1.989   1.00 0.00 ? 63  ALA A HB2  2  
ATOM 3205  H HB3  . ALA A 1 63  ? 115.844 -19.492 3.185   1.00 0.00 ? 63  ALA A HB3  2  
ATOM 3206  N N    . LYS A 1 64  ? 114.561 -18.021 5.190   1.00 0.00 ? 64  LYS A N    2  
ATOM 3207  C CA   . LYS A 1 64  ? 113.270 -17.644 5.787   1.00 0.00 ? 64  LYS A CA   2  
ATOM 3208  C C    . LYS A 1 64  ? 113.389 -16.348 6.562   1.00 0.00 ? 64  LYS A C    2  
ATOM 3209  O O    . LYS A 1 64  ? 112.546 -15.469 6.437   1.00 0.00 ? 64  LYS A O    2  
ATOM 3210  C CB   . LYS A 1 64  ? 112.771 -18.731 6.739   1.00 0.00 ? 64  LYS A CB   2  
ATOM 3211  C CG   . LYS A 1 64  ? 112.049 -19.895 6.098   1.00 0.00 ? 64  LYS A CG   2  
ATOM 3212  C CD   . LYS A 1 64  ? 110.683 -19.471 5.595   1.00 0.00 ? 64  LYS A CD   2  
ATOM 3213  C CE   . LYS A 1 64  ? 109.856 -20.672 5.191   1.00 0.00 ? 64  LYS A CE   2  
ATOM 3214  N NZ   . LYS A 1 64  ? 108.489 -20.294 4.795   1.00 0.00 ? 64  LYS A NZ   2  
ATOM 3215  H H    . LYS A 1 64  ? 114.907 -18.930 5.339   1.00 0.00 ? 64  LYS A H    2  
ATOM 3216  H HA   . LYS A 1 64  ? 112.551 -17.520 4.992   1.00 0.00 ? 64  LYS A HA   2  
ATOM 3217  H HB2  . LYS A 1 64  ? 113.620 -19.129 7.275   1.00 0.00 ? 64  LYS A HB2  2  
ATOM 3218  H HB3  . LYS A 1 64  ? 112.105 -18.271 7.453   1.00 0.00 ? 64  LYS A HB3  2  
ATOM 3219  H HG2  . LYS A 1 64  ? 112.633 -20.255 5.265   1.00 0.00 ? 64  LYS A HG2  2  
ATOM 3220  H HG3  . LYS A 1 64  ? 111.927 -20.682 6.827   1.00 0.00 ? 64  LYS A HG3  2  
ATOM 3221  H HD2  . LYS A 1 64  ? 110.168 -18.937 6.379   1.00 0.00 ? 64  LYS A HD2  2  
ATOM 3222  H HD3  . LYS A 1 64  ? 110.810 -18.825 4.738   1.00 0.00 ? 64  LYS A HD3  2  
ATOM 3223  H HE2  . LYS A 1 64  ? 110.337 -21.162 4.359   1.00 0.00 ? 64  LYS A HE2  2  
ATOM 3224  H HE3  . LYS A 1 64  ? 109.805 -21.353 6.028   1.00 0.00 ? 64  LYS A HE3  2  
ATOM 3225  H HZ1  . LYS A 1 64  ? 107.916 -21.139 4.576   1.00 0.00 ? 64  LYS A HZ1  2  
ATOM 3226  H HZ2  . LYS A 1 64  ? 108.491 -19.696 3.939   1.00 0.00 ? 64  LYS A HZ2  2  
ATOM 3227  H HZ3  . LYS A 1 64  ? 107.992 -19.745 5.529   1.00 0.00 ? 64  LYS A HZ3  2  
ATOM 3228  N N    . ALA A 1 65  ? 114.458 -16.238 7.335   1.00 0.00 ? 65  ALA A N    2  
ATOM 3229  C CA   . ALA A 1 65  ? 114.717 -15.065 8.145   1.00 0.00 ? 65  ALA A CA   2  
ATOM 3230  C C    . ALA A 1 65  ? 114.790 -13.812 7.284   1.00 0.00 ? 65  ALA A C    2  
ATOM 3231  O O    . ALA A 1 65  ? 114.049 -12.874 7.504   1.00 0.00 ? 65  ALA A O    2  
ATOM 3232  C CB   . ALA A 1 65  ? 115.996 -15.238 8.956   1.00 0.00 ? 65  ALA A CB   2  
ATOM 3233  H H    . ALA A 1 65  ? 115.088 -16.990 7.359   1.00 0.00 ? 65  ALA A H    2  
ATOM 3234  H HA   . ALA A 1 65  ? 113.891 -14.955 8.833   1.00 0.00 ? 65  ALA A HA   2  
ATOM 3235  H HB1  . ALA A 1 65  ? 115.920 -16.130 9.558   1.00 0.00 ? 65  ALA A HB1  2  
ATOM 3236  H HB2  . ALA A 1 65  ? 116.139 -14.382 9.596   1.00 0.00 ? 65  ALA A HB2  2  
ATOM 3237  H HB3  . ALA A 1 65  ? 116.837 -15.328 8.284   1.00 0.00 ? 65  ALA A HB3  2  
ATOM 3238  N N    . ILE A 1 66  ? 115.637 -13.832 6.264   1.00 0.00 ? 66  ILE A N    2  
ATOM 3239  C CA   . ILE A 1 66  ? 115.808 -12.672 5.383   1.00 0.00 ? 66  ILE A CA   2  
ATOM 3240  C C    . ILE A 1 66  ? 114.532 -12.437 4.561   1.00 0.00 ? 66  ILE A C    2  
ATOM 3241  O O    . ILE A 1 66  ? 114.129 -11.300 4.310   1.00 0.00 ? 66  ILE A O    2  
ATOM 3242  C CB   . ILE A 1 66  ? 117.027 -12.857 4.439   1.00 0.00 ? 66  ILE A CB   2  
ATOM 3243  C CG1  . ILE A 1 66  ? 118.293 -13.110 5.261   1.00 0.00 ? 66  ILE A CG1  2  
ATOM 3244  C CG2  . ILE A 1 66  ? 117.212 -11.630 3.541   1.00 0.00 ? 66  ILE A CG2  2  
ATOM 3245  C CD1  . ILE A 1 66  ? 119.529 -13.375 4.431   1.00 0.00 ? 66  ILE A CD1  2  
ATOM 3246  H H    . ILE A 1 66  ? 116.156 -14.650 6.097   1.00 0.00 ? 66  ILE A H    2  
ATOM 3247  H HA   . ILE A 1 66  ? 115.976 -11.809 6.012   1.00 0.00 ? 66  ILE A HA   2  
ATOM 3248  H HB   . ILE A 1 66  ? 116.844 -13.716 3.811   1.00 0.00 ? 66  ILE A HB   2  
ATOM 3249  H HG12 . ILE A 1 66  ? 118.492 -12.244 5.876   1.00 0.00 ? 66  ILE A HG12 2  
ATOM 3250  H HG13 . ILE A 1 66  ? 118.129 -13.966 5.899   1.00 0.00 ? 66  ILE A HG13 2  
ATOM 3251  H HG21 . ILE A 1 66  ? 117.337 -10.752 4.159   1.00 0.00 ? 66  ILE A HG21 2  
ATOM 3252  H HG22 . ILE A 1 66  ? 116.342 -11.523 2.909   1.00 0.00 ? 66  ILE A HG22 2  
ATOM 3253  H HG23 . ILE A 1 66  ? 118.090 -11.770 2.927   1.00 0.00 ? 66  ILE A HG23 2  
ATOM 3254  H HD11 . ILE A 1 66  ? 119.647 -12.571 3.719   1.00 0.00 ? 66  ILE A HD11 2  
ATOM 3255  H HD12 . ILE A 1 66  ? 119.481 -14.325 3.919   1.00 0.00 ? 66  ILE A HD12 2  
ATOM 3256  H HD13 . ILE A 1 66  ? 120.381 -13.349 5.095   1.00 0.00 ? 66  ILE A HD13 2  
ATOM 3257  N N    . TYR A 1 67  ? 113.897 -13.518 4.183   1.00 0.00 ? 67  TYR A N    2  
ATOM 3258  C CA   . TYR A 1 67  ? 112.659 -13.488 3.442   1.00 0.00 ? 67  TYR A CA   2  
ATOM 3259  C C    . TYR A 1 67  ? 111.569 -12.747 4.226   1.00 0.00 ? 67  TYR A C    2  
ATOM 3260  O O    . TYR A 1 67  ? 111.077 -11.718 3.790   1.00 0.00 ? 67  TYR A O    2  
ATOM 3261  C CB   . TYR A 1 67  ? 112.215 -14.928 3.141   1.00 0.00 ? 67  TYR A CB   2  
ATOM 3262  C CG   . TYR A 1 67  ? 110.889 -15.033 2.466   1.00 0.00 ? 67  TYR A CG   2  
ATOM 3263  C CD1  . TYR A 1 67  ? 110.764 -14.801 1.116   1.00 0.00 ? 67  TYR A CD1  2  
ATOM 3264  C CD2  . TYR A 1 67  ? 109.750 -15.336 3.194   1.00 0.00 ? 67  TYR A CD2  2  
ATOM 3265  C CE1  . TYR A 1 67  ? 109.549 -14.863 0.503   1.00 0.00 ? 67  TYR A CE1  2  
ATOM 3266  C CE2  . TYR A 1 67  ? 108.527 -15.411 2.596   1.00 0.00 ? 67  TYR A CE2  2  
ATOM 3267  C CZ   . TYR A 1 67  ? 108.417 -15.175 1.255   1.00 0.00 ? 67  TYR A CZ   2  
ATOM 3268  O OH   . TYR A 1 67  ? 107.173 -15.218 0.673   1.00 0.00 ? 67  TYR A OH   2  
ATOM 3269  H H    . TYR A 1 67  ? 114.286 -14.395 4.407   1.00 0.00 ? 67  TYR A H    2  
ATOM 3270  H HA   . TYR A 1 67  ? 112.806 -12.975 2.499   1.00 0.00 ? 67  TYR A HA   2  
ATOM 3271  H HB2  . TYR A 1 67  ? 112.946 -15.394 2.495   1.00 0.00 ? 67  TYR A HB2  2  
ATOM 3272  H HB3  . TYR A 1 67  ? 112.165 -15.479 4.069   1.00 0.00 ? 67  TYR A HB3  2  
ATOM 3273  H HD1  . TYR A 1 67  ? 111.639 -14.565 0.525   1.00 0.00 ? 67  TYR A HD1  2  
ATOM 3274  H HD2  . TYR A 1 67  ? 109.840 -15.522 4.253   1.00 0.00 ? 67  TYR A HD2  2  
ATOM 3275  H HE1  . TYR A 1 67  ? 109.539 -14.661 -0.558  1.00 0.00 ? 67  TYR A HE1  2  
ATOM 3276  H HE2  . TYR A 1 67  ? 107.654 -15.655 3.183   1.00 0.00 ? 67  TYR A HE2  2  
ATOM 3277  H HH   . TYR A 1 67  ? 107.156 -15.917 0.003   1.00 0.00 ? 67  TYR A HH   2  
ATOM 3278  N N    . GLU A 1 68  ? 111.265 -13.232 5.406   1.00 0.00 ? 68  GLU A N    2  
ATOM 3279  C CA   . GLU A 1 68  ? 110.158 -12.708 6.198   1.00 0.00 ? 68  GLU A CA   2  
ATOM 3280  C C    . GLU A 1 68  ? 110.497 -11.392 6.872   1.00 0.00 ? 68  GLU A C    2  
ATOM 3281  O O    . GLU A 1 68  ? 109.633 -10.736 7.442   1.00 0.00 ? 68  GLU A O    2  
ATOM 3282  C CB   . GLU A 1 68  ? 109.744 -13.718 7.241   1.00 0.00 ? 68  GLU A CB   2  
ATOM 3283  C CG   . GLU A 1 68  ? 109.349 -15.060 6.666   1.00 0.00 ? 68  GLU A CG   2  
ATOM 3284  C CD   . GLU A 1 68  ? 108.863 -16.018 7.705   1.00 0.00 ? 68  GLU A CD   2  
ATOM 3285  O OE1  . GLU A 1 68  ? 109.653 -16.460 8.557   1.00 0.00 ? 68  GLU A OE1  2  
ATOM 3286  O OE2  . GLU A 1 68  ? 107.658 -16.350 7.698   1.00 0.00 ? 68  GLU A OE2  2  
ATOM 3287  H H    . GLU A 1 68  ? 111.794 -13.979 5.773   1.00 0.00 ? 68  GLU A H    2  
ATOM 3288  H HA   . GLU A 1 68  ? 109.323 -12.551 5.533   1.00 0.00 ? 68  GLU A HA   2  
ATOM 3289  H HB2  . GLU A 1 68  ? 110.568 -13.862 7.925   1.00 0.00 ? 68  GLU A HB2  2  
ATOM 3290  H HB3  . GLU A 1 68  ? 108.909 -13.305 7.785   1.00 0.00 ? 68  GLU A HB3  2  
ATOM 3291  H HG2  . GLU A 1 68  ? 108.557 -14.908 5.949   1.00 0.00 ? 68  GLU A HG2  2  
ATOM 3292  H HG3  . GLU A 1 68  ? 110.204 -15.493 6.166   1.00 0.00 ? 68  GLU A HG3  2  
ATOM 3293  N N    . LYS A 1 69  ? 111.741 -11.046 6.854   1.00 0.00 ? 69  LYS A N    2  
ATOM 3294  C CA   . LYS A 1 69  ? 112.192 -9.811  7.449   1.00 0.00 ? 69  LYS A CA   2  
ATOM 3295  C C    . LYS A 1 69  ? 112.356 -8.702  6.403   1.00 0.00 ? 69  LYS A C    2  
ATOM 3296  O O    . LYS A 1 69  ? 112.327 -7.520  6.749   1.00 0.00 ? 69  LYS A O    2  
ATOM 3297  C CB   . LYS A 1 69  ? 113.509 -10.057 8.194   1.00 0.00 ? 69  LYS A CB   2  
ATOM 3298  C CG   . LYS A 1 69  ? 114.101 -8.864  8.908   1.00 0.00 ? 69  LYS A CG   2  
ATOM 3299  C CD   . LYS A 1 69  ? 115.377 -9.252  9.620   1.00 0.00 ? 69  LYS A CD   2  
ATOM 3300  C CE   . LYS A 1 69  ? 115.970 -8.079  10.355  1.00 0.00 ? 69  LYS A CE   2  
ATOM 3301  N NZ   . LYS A 1 69  ? 117.228 -8.435  11.027  1.00 0.00 ? 69  LYS A NZ   2  
ATOM 3302  H H    . LYS A 1 69  ? 112.382 -11.674 6.461   1.00 0.00 ? 69  LYS A H    2  
ATOM 3303  H HA   . LYS A 1 69  ? 111.451 -9.501  8.169   1.00 0.00 ? 69  LYS A HA   2  
ATOM 3304  H HB2  . LYS A 1 69  ? 113.343 -10.827 8.933   1.00 0.00 ? 69  LYS A HB2  2  
ATOM 3305  H HB3  . LYS A 1 69  ? 114.236 -10.422 7.483   1.00 0.00 ? 69  LYS A HB3  2  
ATOM 3306  H HG2  . LYS A 1 69  ? 114.331 -8.114  8.165   1.00 0.00 ? 69  LYS A HG2  2  
ATOM 3307  H HG3  . LYS A 1 69  ? 113.390 -8.478  9.622   1.00 0.00 ? 69  LYS A HG3  2  
ATOM 3308  H HD2  . LYS A 1 69  ? 115.160 -10.038 10.329  1.00 0.00 ? 69  LYS A HD2  2  
ATOM 3309  H HD3  . LYS A 1 69  ? 116.088 -9.608  8.890   1.00 0.00 ? 69  LYS A HD3  2  
ATOM 3310  H HE2  . LYS A 1 69  ? 116.164 -7.286  9.648   1.00 0.00 ? 69  LYS A HE2  2  
ATOM 3311  H HE3  . LYS A 1 69  ? 115.260 -7.737  11.095  1.00 0.00 ? 69  LYS A HE3  2  
ATOM 3312  H HZ1  . LYS A 1 69  ? 117.570 -7.620  11.581  1.00 0.00 ? 69  LYS A HZ1  2  
ATOM 3313  H HZ2  . LYS A 1 69  ? 117.964 -8.653  10.322  1.00 0.00 ? 69  LYS A HZ2  2  
ATOM 3314  H HZ3  . LYS A 1 69  ? 117.123 -9.253  11.666  1.00 0.00 ? 69  LYS A HZ3  2  
ATOM 3315  N N    . PHE A 1 70  ? 112.468 -9.073  5.135   1.00 0.00 ? 70  PHE A N    2  
ATOM 3316  C CA   . PHE A 1 70  ? 112.768 -8.091  4.095   1.00 0.00 ? 70  PHE A CA   2  
ATOM 3317  C C    . PHE A 1 70  ? 111.959 -8.324  2.822   1.00 0.00 ? 70  PHE A C    2  
ATOM 3318  O O    . PHE A 1 70  ? 111.307 -7.422  2.322   1.00 0.00 ? 70  PHE A O    2  
ATOM 3319  C CB   . PHE A 1 70  ? 114.265 -8.108  3.735   1.00 0.00 ? 70  PHE A CB   2  
ATOM 3320  C CG   . PHE A 1 70  ? 115.216 -7.651  4.810   1.00 0.00 ? 70  PHE A CG   2  
ATOM 3321  C CD1  . PHE A 1 70  ? 115.321 -6.307  5.132   1.00 0.00 ? 70  PHE A CD1  2  
ATOM 3322  C CD2  . PHE A 1 70  ? 116.017 -8.560  5.482   1.00 0.00 ? 70  PHE A CD2  2  
ATOM 3323  C CE1  . PHE A 1 70  ? 116.203 -5.881  6.103   1.00 0.00 ? 70  PHE A CE1  2  
ATOM 3324  C CE2  . PHE A 1 70  ? 116.904 -8.139  6.451   1.00 0.00 ? 70  PHE A CE2  2  
ATOM 3325  C CZ   . PHE A 1 70  ? 116.996 -6.797  6.763   1.00 0.00 ? 70  PHE A CZ   2  
ATOM 3326  H H    . PHE A 1 70  ? 112.314 -10.007 4.875   1.00 0.00 ? 70  PHE A H    2  
ATOM 3327  H HA   . PHE A 1 70  ? 112.532 -7.112  4.487   1.00 0.00 ? 70  PHE A HA   2  
ATOM 3328  H HB2  . PHE A 1 70  ? 114.546 -9.118  3.476   1.00 0.00 ? 70  PHE A HB2  2  
ATOM 3329  H HB3  . PHE A 1 70  ? 114.414 -7.480  2.870   1.00 0.00 ? 70  PHE A HB3  2  
ATOM 3330  H HD1  . PHE A 1 70  ? 114.701 -5.590  4.616   1.00 0.00 ? 70  PHE A HD1  2  
ATOM 3331  H HD2  . PHE A 1 70  ? 115.942 -9.609  5.238   1.00 0.00 ? 70  PHE A HD2  2  
ATOM 3332  H HE1  . PHE A 1 70  ? 116.274 -4.831  6.344   1.00 0.00 ? 70  PHE A HE1  2  
ATOM 3333  H HE2  . PHE A 1 70  ? 117.522 -8.858  6.968   1.00 0.00 ? 70  PHE A HE2  2  
ATOM 3334  H HZ   . PHE A 1 70  ? 117.688 -6.465  7.522   1.00 0.00 ? 70  PHE A HZ   2  
ATOM 3335  N N    . ILE A 1 71  ? 112.025 -9.539  2.298   1.00 0.00 ? 71  ILE A N    2  
ATOM 3336  C CA   . ILE A 1 71  ? 111.354 -9.909  1.026   1.00 0.00 ? 71  ILE A CA   2  
ATOM 3337  C C    . ILE A 1 71  ? 109.835 -9.813  1.170   1.00 0.00 ? 71  ILE A C    2  
ATOM 3338  O O    . ILE A 1 71  ? 109.109 -9.609  0.183   1.00 0.00 ? 71  ILE A O    2  
ATOM 3339  C CB   . ILE A 1 71  ? 111.763 -11.362 0.579   1.00 0.00 ? 71  ILE A CB   2  
ATOM 3340  C CG1  . ILE A 1 71  ? 113.275 -11.424 0.404   1.00 0.00 ? 71  ILE A CG1  2  
ATOM 3341  C CG2  . ILE A 1 71  ? 111.036 -11.868 -0.705  1.00 0.00 ? 71  ILE A CG2  2  
ATOM 3342  C CD1  . ILE A 1 71  ? 113.834 -10.357 -0.516  1.00 0.00 ? 71  ILE A CD1  2  
ATOM 3343  H H    . ILE A 1 71  ? 112.544 -10.219 2.774   1.00 0.00 ? 71  ILE A H    2  
ATOM 3344  H HA   . ILE A 1 71  ? 111.721 -9.195  0.301   1.00 0.00 ? 71  ILE A HA   2  
ATOM 3345  H HB   . ILE A 1 71  ? 111.497 -12.034 1.382   1.00 0.00 ? 71  ILE A HB   2  
ATOM 3346  H HG12 . ILE A 1 71  ? 113.747 -11.306 1.368   1.00 0.00 ? 71  ILE A HG12 2  
ATOM 3347  H HG13 . ILE A 1 71  ? 113.543 -12.388 -0.004  1.00 0.00 ? 71  ILE A HG13 2  
ATOM 3348  H HG21 . ILE A 1 71  ? 110.002 -11.556 -0.714  1.00 0.00 ? 71  ILE A HG21 2  
ATOM 3349  H HG22 . ILE A 1 71  ? 110.992 -12.955 -0.671  1.00 0.00 ? 71  ILE A HG22 2  
ATOM 3350  H HG23 . ILE A 1 71  ? 111.548 -11.546 -1.603  1.00 0.00 ? 71  ILE A HG23 2  
ATOM 3351  H HD11 . ILE A 1 71  ? 113.378 -10.424 -1.495  1.00 0.00 ? 71  ILE A HD11 2  
ATOM 3352  H HD12 . ILE A 1 71  ? 114.901 -10.487 -0.613  1.00 0.00 ? 71  ILE A HD12 2  
ATOM 3353  H HD13 . ILE A 1 71  ? 113.632 -9.381  -0.100  1.00 0.00 ? 71  ILE A HD13 2  
ATOM 3354  N N    . GLN A 1 72  ? 109.386 -9.965  2.405   1.00 0.00 ? 72  GLN A N    2  
ATOM 3355  C CA   . GLN A 1 72  ? 107.991 -9.837  2.775   1.00 0.00 ? 72  GLN A CA   2  
ATOM 3356  C C    . GLN A 1 72  ? 107.561 -8.435  2.342   1.00 0.00 ? 72  GLN A C    2  
ATOM 3357  O O    . GLN A 1 72  ? 108.243 -7.463  2.653   1.00 0.00 ? 72  GLN A O    2  
ATOM 3358  C CB   . GLN A 1 72  ? 107.897 -9.971  4.301   1.00 0.00 ? 72  GLN A CB   2  
ATOM 3359  C CG   . GLN A 1 72  ? 106.611 -10.562 4.875   1.00 0.00 ? 72  GLN A CG   2  
ATOM 3360  C CD   . GLN A 1 72  ? 105.317 -9.816  4.559   1.00 0.00 ? 72  GLN A CD   2  
ATOM 3361  O OE1  . GLN A 1 72  ? 105.292 -8.603  4.410   1.00 0.00 ? 72  GLN A OE1  2  
ATOM 3362  N NE2  . GLN A 1 72  ? 104.241 -10.543 4.456   1.00 0.00 ? 72  GLN A NE2  2  
ATOM 3363  H H    . GLN A 1 72  ? 110.057 -10.163 3.097   1.00 0.00 ? 72  GLN A H    2  
ATOM 3364  H HA   . GLN A 1 72  ? 107.398 -10.597 2.289   1.00 0.00 ? 72  GLN A HA   2  
ATOM 3365  H HB2  . GLN A 1 72  ? 108.706 -10.610 4.629   1.00 0.00 ? 72  GLN A HB2  2  
ATOM 3366  H HB3  . GLN A 1 72  ? 108.032 -8.985  4.724   1.00 0.00 ? 72  GLN A HB3  2  
ATOM 3367  H HG2  . GLN A 1 72  ? 106.505 -11.593 4.575   1.00 0.00 ? 72  GLN A HG2  2  
ATOM 3368  H HG3  . GLN A 1 72  ? 106.777 -10.506 5.940   1.00 0.00 ? 72  GLN A HG3  2  
ATOM 3369  H HE21 . GLN A 1 72  ? 104.331 -11.517 4.584   1.00 0.00 ? 72  GLN A HE21 2  
ATOM 3370  H HE22 . GLN A 1 72  ? 103.389 -10.101 4.260   1.00 0.00 ? 72  GLN A HE22 2  
ATOM 3371  N N    . THR A 1 73  ? 106.472 -8.352  1.615   1.00 0.00 ? 73  THR A N    2  
ATOM 3372  C CA   . THR A 1 73  ? 105.983 -7.112  1.034   1.00 0.00 ? 73  THR A CA   2  
ATOM 3373  C C    . THR A 1 73  ? 105.962 -5.916  2.030   1.00 0.00 ? 73  THR A C    2  
ATOM 3374  O O    . THR A 1 73  ? 106.424 -4.806  1.695   1.00 0.00 ? 73  THR A O    2  
ATOM 3375  C CB   . THR A 1 73  ? 104.595 -7.336  0.426   1.00 0.00 ? 73  THR A CB   2  
ATOM 3376  O OG1  . THR A 1 73  ? 104.668 -8.389  -0.571  1.00 0.00 ? 73  THR A OG1  2  
ATOM 3377  C CG2  . THR A 1 73  ? 104.076 -6.057  -0.196  1.00 0.00 ? 73  THR A CG2  2  
ATOM 3378  H H    . THR A 1 73  ? 105.954 -9.171  1.451   1.00 0.00 ? 73  THR A H    2  
ATOM 3379  H HA   . THR A 1 73  ? 106.656 -6.858  0.227   1.00 0.00 ? 73  THR A HA   2  
ATOM 3380  H HB   . THR A 1 73  ? 103.926 -7.651  1.213   1.00 0.00 ? 73  THR A HB   2  
ATOM 3381  H HG1  . THR A 1 73  ? 103.907 -8.309  -1.166  1.00 0.00 ? 73  THR A HG1  2  
ATOM 3382  H HG21 . THR A 1 73  ? 104.751 -5.741  -0.978  1.00 0.00 ? 73  THR A HG21 2  
ATOM 3383  H HG22 . THR A 1 73  ? 104.071 -5.319  0.593   1.00 0.00 ? 73  THR A HG22 2  
ATOM 3384  H HG23 . THR A 1 73  ? 103.079 -6.205  -0.580  1.00 0.00 ? 73  THR A HG23 2  
ATOM 3385  N N    . ASP A 1 74  ? 105.460 -6.140  3.223   1.00 0.00 ? 74  ASP A N    2  
ATOM 3386  C CA   . ASP A 1 74  ? 105.433 -5.098  4.240   1.00 0.00 ? 74  ASP A CA   2  
ATOM 3387  C C    . ASP A 1 74  ? 106.576 -5.304  5.169   1.00 0.00 ? 74  ASP A C    2  
ATOM 3388  O O    . ASP A 1 74  ? 107.335 -4.378  5.443   1.00 0.00 ? 74  ASP A O    2  
ATOM 3389  C CB   . ASP A 1 74  ? 104.130 -5.091  5.037   1.00 0.00 ? 74  ASP A CB   2  
ATOM 3390  C CG   . ASP A 1 74  ? 102.931 -4.787  4.202   1.00 0.00 ? 74  ASP A CG   2  
ATOM 3391  O OD1  . ASP A 1 74  ? 102.846 -3.681  3.641   1.00 0.00 ? 74  ASP A OD1  2  
ATOM 3392  O OD2  . ASP A 1 74  ? 102.023 -5.648  4.101   1.00 0.00 ? 74  ASP A OD2  2  
ATOM 3393  H H    . ASP A 1 74  ? 105.139 -7.046  3.440   1.00 0.00 ? 74  ASP A H    2  
ATOM 3394  H HA   . ASP A 1 74  ? 105.555 -4.147  3.741   1.00 0.00 ? 74  ASP A HA   2  
ATOM 3395  H HB2  . ASP A 1 74  ? 103.987 -6.062  5.487   1.00 0.00 ? 74  ASP A HB2  2  
ATOM 3396  H HB3  . ASP A 1 74  ? 104.204 -4.349  5.820   1.00 0.00 ? 74  ASP A HB3  2  
ATOM 3397  N N    . ALA A 1 75  ? 106.678 -6.534  5.665   1.00 0.00 ? 75  ALA A N    2  
ATOM 3398  C CA   . ALA A 1 75  ? 107.772 -6.990  6.539   1.00 0.00 ? 75  ALA A CA   2  
ATOM 3399  C C    . ALA A 1 75  ? 107.969 -6.106  7.805   1.00 0.00 ? 75  ALA A C    2  
ATOM 3400  O O    . ALA A 1 75  ? 107.203 -5.174  8.060   1.00 0.00 ? 75  ALA A O    2  
ATOM 3401  C CB   . ALA A 1 75  ? 109.056 -7.050  5.707   1.00 0.00 ? 75  ALA A CB   2  
ATOM 3402  H H    . ALA A 1 75  ? 105.981 -7.174  5.393   1.00 0.00 ? 75  ALA A H    2  
ATOM 3403  H HA   . ALA A 1 75  ? 107.543 -7.997  6.855   1.00 0.00 ? 75  ALA A HA   2  
ATOM 3404  H HB1  . ALA A 1 75  ? 109.295 -6.067  5.314   1.00 0.00 ? 75  ALA A HB1  2  
ATOM 3405  H HB2  . ALA A 1 75  ? 108.888 -7.757  4.908   1.00 0.00 ? 75  ALA A HB2  2  
ATOM 3406  H HB3  . ALA A 1 75  ? 109.861 -7.411  6.329   1.00 0.00 ? 75  ALA A HB3  2  
ATOM 3407  N N    . PRO A 1 76  ? 108.934 -6.455  8.690   1.00 0.00 ? 76  PRO A N    2  
ATOM 3408  C CA   . PRO A 1 76  ? 109.359 -5.546  9.743   1.00 0.00 ? 76  PRO A CA   2  
ATOM 3409  C C    . PRO A 1 76  ? 110.223 -4.423  9.146   1.00 0.00 ? 76  PRO A C    2  
ATOM 3410  O O    . PRO A 1 76  ? 110.346 -3.333  9.725   1.00 0.00 ? 76  PRO A O    2  
ATOM 3411  C CB   . PRO A 1 76  ? 110.197 -6.423  10.672  1.00 0.00 ? 76  PRO A CB   2  
ATOM 3412  C CG   . PRO A 1 76  ? 110.658 -7.550  9.828   1.00 0.00 ? 76  PRO A CG   2  
ATOM 3413  C CD   . PRO A 1 76  ? 109.569 -7.787  8.829   1.00 0.00 ? 76  PRO A CD   2  
ATOM 3414  H HA   . PRO A 1 76  ? 108.517 -5.120  10.269  1.00 0.00 ? 76  PRO A HA   2  
ATOM 3415  H HB2  . PRO A 1 76  ? 111.030 -5.849  11.054  1.00 0.00 ? 76  PRO A HB2  2  
ATOM 3416  H HB3  . PRO A 1 76  ? 109.586 -6.770  11.492  1.00 0.00 ? 76  PRO A HB3  2  
ATOM 3417  H HG2  . PRO A 1 76  ? 111.575 -7.281  9.324   1.00 0.00 ? 76  PRO A HG2  2  
ATOM 3418  H HG3  . PRO A 1 76  ? 110.805 -8.429  10.437  1.00 0.00 ? 76  PRO A HG3  2  
ATOM 3419  H HD2  . PRO A 1 76  ? 109.984 -8.117  7.889   1.00 0.00 ? 76  PRO A HD2  2  
ATOM 3420  H HD3  . PRO A 1 76  ? 108.861 -8.511  9.206   1.00 0.00 ? 76  PRO A HD3  2  
ATOM 3421  N N    . LYS A 1 77  ? 110.807 -4.713  7.990   1.00 0.00 ? 77  LYS A N    2  
ATOM 3422  C CA   . LYS A 1 77  ? 111.636 -3.797  7.227   1.00 0.00 ? 77  LYS A CA   2  
ATOM 3423  C C    . LYS A 1 77  ? 111.396 -4.013  5.745   1.00 0.00 ? 77  LYS A C    2  
ATOM 3424  O O    . LYS A 1 77  ? 112.017 -4.876  5.132   1.00 0.00 ? 77  LYS A O    2  
ATOM 3425  C CB   . LYS A 1 77  ? 113.136 -3.989  7.554   1.00 0.00 ? 77  LYS A CB   2  
ATOM 3426  C CG   . LYS A 1 77  ? 113.617 -3.447  8.911   1.00 0.00 ? 77  LYS A CG   2  
ATOM 3427  C CD   . LYS A 1 77  ? 113.851 -1.924  8.893   1.00 0.00 ? 77  LYS A CD   2  
ATOM 3428  C CE   . LYS A 1 77  ? 112.583 -1.111  8.702   1.00 0.00 ? 77  LYS A CE   2  
ATOM 3429  N NZ   . LYS A 1 77  ? 112.865 0.328   8.531   1.00 0.00 ? 77  LYS A NZ   2  
ATOM 3430  H H    . LYS A 1 77  ? 110.662 -5.606  7.607   1.00 0.00 ? 77  LYS A H    2  
ATOM 3431  H HA   . LYS A 1 77  ? 111.344 -2.790  7.487   1.00 0.00 ? 77  LYS A HA   2  
ATOM 3432  H HB2  . LYS A 1 77  ? 113.357 -5.045  7.532   1.00 0.00 ? 77  LYS A HB2  2  
ATOM 3433  H HB3  . LYS A 1 77  ? 113.712 -3.508  6.777   1.00 0.00 ? 77  LYS A HB3  2  
ATOM 3434  H HG2  . LYS A 1 77  ? 112.870 -3.669  9.659   1.00 0.00 ? 77  LYS A HG2  2  
ATOM 3435  H HG3  . LYS A 1 77  ? 114.541 -3.941  9.173   1.00 0.00 ? 77  LYS A HG3  2  
ATOM 3436  H HD2  . LYS A 1 77  ? 114.299 -1.631  9.833   1.00 0.00 ? 77  LYS A HD2  2  
ATOM 3437  H HD3  . LYS A 1 77  ? 114.539 -1.695  8.092   1.00 0.00 ? 77  LYS A HD3  2  
ATOM 3438  H HE2  . LYS A 1 77  ? 112.069 -1.472  7.824   1.00 0.00 ? 77  LYS A HE2  2  
ATOM 3439  H HE3  . LYS A 1 77  ? 111.951 -1.248  9.568   1.00 0.00 ? 77  LYS A HE3  2  
ATOM 3440  H HZ1  . LYS A 1 77  ? 113.485 0.495   7.708   1.00 0.00 ? 77  LYS A HZ1  2  
ATOM 3441  H HZ2  . LYS A 1 77  ? 113.309 0.759   9.371   1.00 0.00 ? 77  LYS A HZ2  2  
ATOM 3442  H HZ3  . LYS A 1 77  ? 111.974 0.835   8.339   1.00 0.00 ? 77  LYS A HZ3  2  
ATOM 3443  N N    . GLU A 1 78  ? 110.443 -3.285  5.198   1.00 0.00 ? 78  GLU A N    2  
ATOM 3444  C CA   . GLU A 1 78  ? 110.100 -3.400  3.791   1.00 0.00 ? 78  GLU A CA   2  
ATOM 3445  C C    . GLU A 1 78  ? 111.263 -2.971  2.889   1.00 0.00 ? 78  GLU A C    2  
ATOM 3446  O O    . GLU A 1 78  ? 112.027 -2.037  3.209   1.00 0.00 ? 78  GLU A O    2  
ATOM 3447  C CB   . GLU A 1 78  ? 108.812 -2.608  3.429   1.00 0.00 ? 78  GLU A CB   2  
ATOM 3448  C CG   . GLU A 1 78  ? 108.889 -1.069  3.489   1.00 0.00 ? 78  GLU A CG   2  
ATOM 3449  C CD   . GLU A 1 78  ? 109.233 -0.500  4.847   1.00 0.00 ? 78  GLU A CD   2  
ATOM 3450  O OE1  . GLU A 1 78  ? 108.461 -0.675  5.791   1.00 0.00 ? 78  GLU A OE1  2  
ATOM 3451  O OE2  . GLU A 1 78  ? 110.298 0.156   4.981   1.00 0.00 ? 78  GLU A OE2  2  
ATOM 3452  H H    . GLU A 1 78  ? 109.923 -2.664  5.748   1.00 0.00 ? 78  GLU A H    2  
ATOM 3453  H HA   . GLU A 1 78  ? 109.909 -4.452  3.633   1.00 0.00 ? 78  GLU A HA   2  
ATOM 3454  H HB2  . GLU A 1 78  ? 108.524 -2.874  2.422   1.00 0.00 ? 78  GLU A HB2  2  
ATOM 3455  H HB3  . GLU A 1 78  ? 108.025 -2.931  4.097   1.00 0.00 ? 78  GLU A HB3  2  
ATOM 3456  H HG2  . GLU A 1 78  ? 109.644 -0.737  2.793   1.00 0.00 ? 78  GLU A HG2  2  
ATOM 3457  H HG3  . GLU A 1 78  ? 107.933 -0.673  3.180   1.00 0.00 ? 78  GLU A HG3  2  
ATOM 3458  N N    . VAL A 1 79  ? 111.396 -3.637  1.789   1.00 0.00 ? 79  VAL A N    2  
ATOM 3459  C CA   . VAL A 1 79  ? 112.440 -3.350  0.840   1.00 0.00 ? 79  VAL A CA   2  
ATOM 3460  C C    . VAL A 1 79  ? 111.779 -2.718  -0.374  1.00 0.00 ? 79  VAL A C    2  
ATOM 3461  O O    . VAL A 1 79  ? 110.641 -3.040  -0.687  1.00 0.00 ? 79  VAL A O    2  
ATOM 3462  C CB   . VAL A 1 79  ? 113.168 -4.672  0.392   1.00 0.00 ? 79  VAL A CB   2  
ATOM 3463  C CG1  . VAL A 1 79  ? 114.334 -4.396  -0.531  1.00 0.00 ? 79  VAL A CG1  2  
ATOM 3464  C CG2  . VAL A 1 79  ? 113.651 -5.478  1.574   1.00 0.00 ? 79  VAL A CG2  2  
ATOM 3465  H H    . VAL A 1 79  ? 110.739 -4.341  1.576   1.00 0.00 ? 79  VAL A H    2  
ATOM 3466  H HA   . VAL A 1 79  ? 113.156 -2.673  1.280   1.00 0.00 ? 79  VAL A HA   2  
ATOM 3467  H HB   . VAL A 1 79  ? 112.454 -5.271  -0.155  1.00 0.00 ? 79  VAL A HB   2  
ATOM 3468  H HG11 . VAL A 1 79  ? 115.056 -3.775  -0.022  1.00 0.00 ? 79  VAL A HG11 2  
ATOM 3469  H HG12 . VAL A 1 79  ? 113.982 -3.903  -1.425  1.00 0.00 ? 79  VAL A HG12 2  
ATOM 3470  H HG13 . VAL A 1 79  ? 114.790 -5.341  -0.788  1.00 0.00 ? 79  VAL A HG13 2  
ATOM 3471  H HG21 . VAL A 1 79  ? 114.446 -4.959  2.091   1.00 0.00 ? 79  VAL A HG21 2  
ATOM 3472  H HG22 . VAL A 1 79  ? 113.989 -6.448  1.229   1.00 0.00 ? 79  VAL A HG22 2  
ATOM 3473  H HG23 . VAL A 1 79  ? 112.823 -5.639  2.249   1.00 0.00 ? 79  VAL A HG23 2  
ATOM 3474  N N    . ASN A 1 80  ? 112.468 -1.839  -1.066  1.00 0.00 ? 80  ASN A N    2  
ATOM 3475  C CA   . ASN A 1 80  ? 111.940 -1.247  -2.312  1.00 0.00 ? 80  ASN A CA   2  
ATOM 3476  C C    . ASN A 1 80  ? 112.180 -2.195  -3.498  1.00 0.00 ? 80  ASN A C    2  
ATOM 3477  O O    . ASN A 1 80  ? 112.317 -1.773  -4.654  1.00 0.00 ? 80  ASN A O    2  
ATOM 3478  C CB   . ASN A 1 80  ? 112.559 0.142   -2.575  1.00 0.00 ? 80  ASN A CB   2  
ATOM 3479  C CG   . ASN A 1 80  ? 112.012 1.227   -1.650  1.00 0.00 ? 80  ASN A CG   2  
ATOM 3480  O OD1  . ASN A 1 80  ? 111.033 1.904   -1.978  1.00 0.00 ? 80  ASN A OD1  2  
ATOM 3481  N ND2  . ASN A 1 80  ? 112.609 1.393   -0.500  1.00 0.00 ? 80  ASN A ND2  2  
ATOM 3482  H H    . ASN A 1 80  ? 113.354 -1.547  -0.744  1.00 0.00 ? 80  ASN A H    2  
ATOM 3483  H HA   . ASN A 1 80  ? 110.873 -1.145  -2.179  1.00 0.00 ? 80  ASN A HA   2  
ATOM 3484  H HB2  . ASN A 1 80  ? 113.627 0.083   -2.434  1.00 0.00 ? 80  ASN A HB2  2  
ATOM 3485  H HB3  . ASN A 1 80  ? 112.354 0.426   -3.596  1.00 0.00 ? 80  ASN A HB3  2  
ATOM 3486  H HD21 . ASN A 1 80  ? 113.377 0.816   -0.279  1.00 0.00 ? 80  ASN A HD21 2  
ATOM 3487  H HD22 . ASN A 1 80  ? 112.274 2.093   0.106   1.00 0.00 ? 80  ASN A HD22 2  
ATOM 3488  N N    . LEU A 1 81  ? 112.166 -3.482  -3.190  1.00 0.00 ? 81  LEU A N    2  
ATOM 3489  C CA   . LEU A 1 81  ? 112.363 -4.562  -4.132  1.00 0.00 ? 81  LEU A CA   2  
ATOM 3490  C C    . LEU A 1 81  ? 111.130 -4.682  -5.008  1.00 0.00 ? 81  LEU A C    2  
ATOM 3491  O O    . LEU A 1 81  ? 110.004 -4.535  -4.513  1.00 0.00 ? 81  LEU A O    2  
ATOM 3492  C CB   . LEU A 1 81  ? 112.541 -5.873  -3.348  1.00 0.00 ? 81  LEU A CB   2  
ATOM 3493  C CG   . LEU A 1 81  ? 112.833 -7.135  -4.157  1.00 0.00 ? 81  LEU A CG   2  
ATOM 3494  C CD1  . LEU A 1 81  ? 114.238 -7.103  -4.681  1.00 0.00 ? 81  LEU A CD1  2  
ATOM 3495  C CD2  . LEU A 1 81  ? 112.573 -8.394  -3.330  1.00 0.00 ? 81  LEU A CD2  2  
ATOM 3496  H H    . LEU A 1 81  ? 111.969 -3.708  -2.258  1.00 0.00 ? 81  LEU A H    2  
ATOM 3497  H HA   . LEU A 1 81  ? 113.247 -4.381  -4.725  1.00 0.00 ? 81  LEU A HA   2  
ATOM 3498  H HB2  . LEU A 1 81  ? 113.377 -5.727  -2.679  1.00 0.00 ? 81  LEU A HB2  2  
ATOM 3499  H HB3  . LEU A 1 81  ? 111.652 -6.042  -2.758  1.00 0.00 ? 81  LEU A HB3  2  
ATOM 3500  H HG   . LEU A 1 81  ? 112.197 -7.162  -5.029  1.00 0.00 ? 81  LEU A HG   2  
ATOM 3501  H HD11 . LEU A 1 81  ? 114.932 -7.093  -3.852  1.00 0.00 ? 81  LEU A HD11 2  
ATOM 3502  H HD12 . LEU A 1 81  ? 114.384 -6.223  -5.289  1.00 0.00 ? 81  LEU A HD12 2  
ATOM 3503  H HD13 . LEU A 1 81  ? 114.416 -7.988  -5.275  1.00 0.00 ? 81  LEU A HD13 2  
ATOM 3504  H HD21 . LEU A 1 81  ? 111.543 -8.413  -3.008  1.00 0.00 ? 81  LEU A HD21 2  
ATOM 3505  H HD22 . LEU A 1 81  ? 113.213 -8.428  -2.458  1.00 0.00 ? 81  LEU A HD22 2  
ATOM 3506  H HD23 . LEU A 1 81  ? 112.764 -9.271  -3.930  1.00 0.00 ? 81  LEU A HD23 2  
ATOM 3507  N N    . ASP A 1 82  ? 111.327 -4.963  -6.280  1.00 0.00 ? 82  ASP A N    2  
ATOM 3508  C CA   . ASP A 1 82  ? 110.218 -5.126  -7.223  1.00 0.00 ? 82  ASP A CA   2  
ATOM 3509  C C    . ASP A 1 82  ? 109.387 -6.375  -6.886  1.00 0.00 ? 82  ASP A C    2  
ATOM 3510  O O    . ASP A 1 82  ? 109.738 -7.173  -5.974  1.00 0.00 ? 82  ASP A O    2  
ATOM 3511  C CB   . ASP A 1 82  ? 110.711 -5.196  -8.678  1.00 0.00 ? 82  ASP A CB   2  
ATOM 3512  C CG   . ASP A 1 82  ? 111.506 -6.431  -8.970  1.00 0.00 ? 82  ASP A CG   2  
ATOM 3513  O OD1  . ASP A 1 82  ? 112.686 -6.482  -8.627  1.00 0.00 ? 82  ASP A OD1  2  
ATOM 3514  O OD2  . ASP A 1 82  ? 110.967 -7.381  -9.548  1.00 0.00 ? 82  ASP A OD2  2  
ATOM 3515  H H    . ASP A 1 82  ? 112.243 -5.065  -6.620  1.00 0.00 ? 82  ASP A H    2  
ATOM 3516  H HA   . ASP A 1 82  ? 109.580 -4.261  -7.110  1.00 0.00 ? 82  ASP A HA   2  
ATOM 3517  H HB2  . ASP A 1 82  ? 109.859 -5.192  -9.340  1.00 0.00 ? 82  ASP A HB2  2  
ATOM 3518  H HB3  . ASP A 1 82  ? 111.329 -4.340  -8.903  1.00 0.00 ? 82  ASP A HB3  2  
ATOM 3519  N N    . PHE A 1 83  ? 108.319 -6.574  -7.613  1.00 0.00 ? 83  PHE A N    2  
ATOM 3520  C CA   . PHE A 1 83  ? 107.391 -7.637  -7.322  1.00 0.00 ? 83  PHE A CA   2  
ATOM 3521  C C    . PHE A 1 83  ? 107.787 -8.917  -8.050  1.00 0.00 ? 83  PHE A C    2  
ATOM 3522  O O    . PHE A 1 83  ? 107.482 -10.019 -7.593  1.00 0.00 ? 83  PHE A O    2  
ATOM 3523  C CB   . PHE A 1 83  ? 105.965 -7.202  -7.693  1.00 0.00 ? 83  PHE A CB   2  
ATOM 3524  C CG   . PHE A 1 83  ? 104.875 -8.103  -7.176  1.00 0.00 ? 83  PHE A CG   2  
ATOM 3525  C CD1  . PHE A 1 83  ? 104.565 -8.124  -5.827  1.00 0.00 ? 83  PHE A CD1  2  
ATOM 3526  C CD2  . PHE A 1 83  ? 104.161 -8.918  -8.032  1.00 0.00 ? 83  PHE A CD2  2  
ATOM 3527  C CE1  . PHE A 1 83  ? 103.566 -8.942  -5.344  1.00 0.00 ? 83  PHE A CE1  2  
ATOM 3528  C CE2  . PHE A 1 83  ? 103.160 -9.737  -7.555  1.00 0.00 ? 83  PHE A CE2  2  
ATOM 3529  C CZ   . PHE A 1 83  ? 102.861 -9.750  -6.210  1.00 0.00 ? 83  PHE A CZ   2  
ATOM 3530  H H    . PHE A 1 83  ? 108.151 -6.002  -8.401  1.00 0.00 ? 83  PHE A H    2  
ATOM 3531  H HA   . PHE A 1 83  ? 107.428 -7.820  -6.259  1.00 0.00 ? 83  PHE A HA   2  
ATOM 3532  H HB2  . PHE A 1 83  ? 105.785 -6.215  -7.292  1.00 0.00 ? 83  PHE A HB2  2  
ATOM 3533  H HB3  . PHE A 1 83  ? 105.883 -7.162  -8.770  1.00 0.00 ? 83  PHE A HB3  2  
ATOM 3534  H HD1  . PHE A 1 83  ? 105.117 -7.491  -5.147  1.00 0.00 ? 83  PHE A HD1  2  
ATOM 3535  H HD2  . PHE A 1 83  ? 104.394 -8.912  -9.087  1.00 0.00 ? 83  PHE A HD2  2  
ATOM 3536  H HE1  . PHE A 1 83  ? 103.334 -8.949  -4.288  1.00 0.00 ? 83  PHE A HE1  2  
ATOM 3537  H HE2  . PHE A 1 83  ? 102.609 -10.369 -8.236  1.00 0.00 ? 83  PHE A HE2  2  
ATOM 3538  H HZ   . PHE A 1 83  ? 102.077 -10.391 -5.834  1.00 0.00 ? 83  PHE A HZ   2  
ATOM 3539  N N    . HIS A 1 84  ? 108.510 -8.779  -9.136  1.00 0.00 ? 84  HIS A N    2  
ATOM 3540  C CA   . HIS A 1 84  ? 108.918 -9.930  -9.915  1.00 0.00 ? 84  HIS A CA   2  
ATOM 3541  C C    . HIS A 1 84  ? 110.090 -10.655 -9.255  1.00 0.00 ? 84  HIS A C    2  
ATOM 3542  O O    . HIS A 1 84  ? 110.132 -11.883 -9.253  1.00 0.00 ? 84  HIS A O    2  
ATOM 3543  C CB   . HIS A 1 84  ? 109.225 -9.548  -11.377 1.00 0.00 ? 84  HIS A CB   2  
ATOM 3544  C CG   . HIS A 1 84  ? 109.717 -10.693 -12.221 1.00 0.00 ? 84  HIS A CG   2  
ATOM 3545  N ND1  . HIS A 1 84  ? 108.915 -11.730 -12.646 1.00 0.00 ? 84  HIS A ND1  2  
ATOM 3546  C CD2  . HIS A 1 84  ? 110.950 -10.972 -12.679 1.00 0.00 ? 84  HIS A CD2  2  
ATOM 3547  C CE1  . HIS A 1 84  ? 109.638 -12.590 -13.322 1.00 0.00 ? 84  HIS A CE1  2  
ATOM 3548  N NE2  . HIS A 1 84  ? 110.874 -12.156 -13.359 1.00 0.00 ? 84  HIS A NE2  2  
ATOM 3549  H H    . HIS A 1 84  ? 108.797 -7.882  -9.420  1.00 0.00 ? 84  HIS A H    2  
ATOM 3550  H HA   . HIS A 1 84  ? 108.077 -10.610 -9.908  1.00 0.00 ? 84  HIS A HA   2  
ATOM 3551  H HB2  . HIS A 1 84  ? 108.328 -9.162  -11.836 1.00 0.00 ? 84  HIS A HB2  2  
ATOM 3552  H HB3  . HIS A 1 84  ? 109.983 -8.778  -11.384 1.00 0.00 ? 84  HIS A HB3  2  
ATOM 3553  H HD1  . HIS A 1 84  ? 107.946 -11.839 -12.477 1.00 0.00 ? 84  HIS A HD1  2  
ATOM 3554  H HD2  . HIS A 1 84  ? 111.827 -10.357 -12.528 1.00 0.00 ? 84  HIS A HD2  2  
ATOM 3555  H HE1  . HIS A 1 84  ? 109.280 -13.507 -13.765 1.00 0.00 ? 84  HIS A HE1  2  
ATOM 3556  H HE2  . HIS A 1 84  ? 111.527 -12.457 -14.038 1.00 0.00 ? 84  HIS A HE2  2  
ATOM 3557  N N    . THR A 1 85  ? 111.028 -9.907  -8.711  1.00 0.00 ? 85  THR A N    2  
ATOM 3558  C CA   . THR A 1 85  ? 112.138 -10.504 -8.003  1.00 0.00 ? 85  THR A CA   2  
ATOM 3559  C C    . THR A 1 85  ? 111.636 -11.264 -6.791  1.00 0.00 ? 85  THR A C    2  
ATOM 3560  O O    . THR A 1 85  ? 111.965 -12.433 -6.622  1.00 0.00 ? 85  THR A O    2  
ATOM 3561  C CB   . THR A 1 85  ? 113.200 -9.465  -7.580  1.00 0.00 ? 85  THR A CB   2  
ATOM 3562  O OG1  . THR A 1 85  ? 113.724 -8.816  -8.747  1.00 0.00 ? 85  THR A OG1  2  
ATOM 3563  C CG2  . THR A 1 85  ? 114.337 -10.128 -6.811  1.00 0.00 ? 85  THR A CG2  2  
ATOM 3564  H H    . THR A 1 85  ? 110.991 -8.927  -8.832  1.00 0.00 ? 85  THR A H    2  
ATOM 3565  H HA   . THR A 1 85  ? 112.595 -11.215 -8.676  1.00 0.00 ? 85  THR A HA   2  
ATOM 3566  H HB   . THR A 1 85  ? 112.727 -8.725  -6.950  1.00 0.00 ? 85  THR A HB   2  
ATOM 3567  H HG1  . THR A 1 85  ? 113.328 -7.923  -8.739  1.00 0.00 ? 85  THR A HG1  2  
ATOM 3568  H HG21 . THR A 1 85  ? 114.803 -10.880 -7.428  1.00 0.00 ? 85  THR A HG21 2  
ATOM 3569  H HG22 . THR A 1 85  ? 113.954 -10.581 -5.907  1.00 0.00 ? 85  THR A HG22 2  
ATOM 3570  H HG23 . THR A 1 85  ? 115.075 -9.395  -6.520  1.00 0.00 ? 85  THR A HG23 2  
ATOM 3571  N N    . LYS A 1 86  ? 110.776 -10.623 -5.982  1.00 0.00 ? 86  LYS A N    2  
ATOM 3572  C CA   . LYS A 1 86  ? 110.240 -11.292 -4.805  1.00 0.00 ? 86  LYS A CA   2  
ATOM 3573  C C    . LYS A 1 86  ? 109.437 -12.512 -5.202  1.00 0.00 ? 86  LYS A C    2  
ATOM 3574  O O    . LYS A 1 86  ? 109.449 -13.494 -4.507  1.00 0.00 ? 86  LYS A O    2  
ATOM 3575  C CB   . LYS A 1 86  ? 109.425 -10.369 -3.877  1.00 0.00 ? 86  LYS A CB   2  
ATOM 3576  C CG   . LYS A 1 86  ? 108.177 -9.740  -4.480  1.00 0.00 ? 86  LYS A CG   2  
ATOM 3577  C CD   . LYS A 1 86  ? 107.306 -9.076  -3.408  1.00 0.00 ? 86  LYS A CD   2  
ATOM 3578  C CE   . LYS A 1 86  ? 108.042 -7.981  -2.641  1.00 0.00 ? 86  LYS A CE   2  
ATOM 3579  N NZ   . LYS A 1 86  ? 108.395 -6.820  -3.490  1.00 0.00 ? 86  LYS A NZ   2  
ATOM 3580  H H    . LYS A 1 86  ? 110.519 -9.702  -6.199  1.00 0.00 ? 86  LYS A H    2  
ATOM 3581  H HA   . LYS A 1 86  ? 111.103 -11.656 -4.264  1.00 0.00 ? 86  LYS A HA   2  
ATOM 3582  H HB2  . LYS A 1 86  ? 109.125 -10.922 -3.000  1.00 0.00 ? 86  LYS A HB2  2  
ATOM 3583  H HB3  . LYS A 1 86  ? 110.084 -9.570  -3.575  1.00 0.00 ? 86  LYS A HB3  2  
ATOM 3584  H HG2  . LYS A 1 86  ? 108.475 -8.993  -5.200  1.00 0.00 ? 86  LYS A HG2  2  
ATOM 3585  H HG3  . LYS A 1 86  ? 107.602 -10.509 -4.974  1.00 0.00 ? 86  LYS A HG3  2  
ATOM 3586  H HD2  . LYS A 1 86  ? 106.443 -8.635  -3.887  1.00 0.00 ? 86  LYS A HD2  2  
ATOM 3587  H HD3  . LYS A 1 86  ? 106.978 -9.834  -2.714  1.00 0.00 ? 86  LYS A HD3  2  
ATOM 3588  H HE2  . LYS A 1 86  ? 107.411 -7.640  -1.833  1.00 0.00 ? 86  LYS A HE2  2  
ATOM 3589  H HE3  . LYS A 1 86  ? 108.946 -8.403  -2.226  1.00 0.00 ? 86  LYS A HE3  2  
ATOM 3590  H HZ1  . LYS A 1 86  ? 107.531 -6.340  -3.830  1.00 0.00 ? 86  LYS A HZ1  2  
ATOM 3591  H HZ2  . LYS A 1 86  ? 108.990 -7.063  -4.309  1.00 0.00 ? 86  LYS A HZ2  2  
ATOM 3592  H HZ3  . LYS A 1 86  ? 108.915 -6.127  -2.907  1.00 0.00 ? 86  LYS A HZ3  2  
ATOM 3593  N N    . GLU A 1 87  ? 108.791 -12.443 -6.355  1.00 0.00 ? 87  GLU A N    2  
ATOM 3594  C CA   . GLU A 1 87  ? 108.030 -13.566 -6.895  1.00 0.00 ? 87  GLU A CA   2  
ATOM 3595  C C    . GLU A 1 87  ? 108.938 -14.785 -7.047  1.00 0.00 ? 87  GLU A C    2  
ATOM 3596  O O    . GLU A 1 87  ? 108.661 -15.855 -6.513  1.00 0.00 ? 87  GLU A O    2  
ATOM 3597  C CB   . GLU A 1 87  ? 107.474 -13.212 -8.265  1.00 0.00 ? 87  GLU A CB   2  
ATOM 3598  C CG   . GLU A 1 87  ? 106.543 -14.251 -8.822  1.00 0.00 ? 87  GLU A CG   2  
ATOM 3599  C CD   . GLU A 1 87  ? 105.221 -14.263 -8.106  1.00 0.00 ? 87  GLU A CD   2  
ATOM 3600  O OE1  . GLU A 1 87  ? 104.353 -13.441 -8.452  1.00 0.00 ? 87  GLU A OE1  2  
ATOM 3601  O OE2  . GLU A 1 87  ? 105.019 -15.073 -7.185  1.00 0.00 ? 87  GLU A OE2  2  
ATOM 3602  H H    . GLU A 1 87  ? 108.818 -11.594 -6.844  1.00 0.00 ? 87  GLU A H    2  
ATOM 3603  H HA   . GLU A 1 87  ? 107.213 -13.795 -6.227  1.00 0.00 ? 87  GLU A HA   2  
ATOM 3604  H HB2  . GLU A 1 87  ? 106.936 -12.279 -8.192  1.00 0.00 ? 87  GLU A HB2  2  
ATOM 3605  H HB3  . GLU A 1 87  ? 108.298 -13.092 -8.952  1.00 0.00 ? 87  GLU A HB3  2  
ATOM 3606  H HG2  . GLU A 1 87  ? 106.398 -14.069 -9.876  1.00 0.00 ? 87  GLU A HG2  2  
ATOM 3607  H HG3  . GLU A 1 87  ? 107.028 -15.205 -8.674  1.00 0.00 ? 87  GLU A HG3  2  
ATOM 3608  N N    . VAL A 1 88  ? 110.042 -14.595 -7.726  1.00 0.00 ? 88  VAL A N    2  
ATOM 3609  C CA   . VAL A 1 88  ? 110.977 -15.671 -7.968  1.00 0.00 ? 88  VAL A CA   2  
ATOM 3610  C C    . VAL A 1 88  ? 111.604 -16.140 -6.642  1.00 0.00 ? 88  VAL A C    2  
ATOM 3611  O O    . VAL A 1 88  ? 111.849 -17.332 -6.445  1.00 0.00 ? 88  VAL A O    2  
ATOM 3612  C CB   . VAL A 1 88  ? 112.049 -15.259 -9.008  1.00 0.00 ? 88  VAL A CB   2  
ATOM 3613  C CG1  . VAL A 1 88  ? 112.988 -16.416 -9.310  1.00 0.00 ? 88  VAL A CG1  2  
ATOM 3614  C CG2  . VAL A 1 88  ? 111.363 -14.784 -10.290 1.00 0.00 ? 88  VAL A CG2  2  
ATOM 3615  H H    . VAL A 1 88  ? 110.240 -13.698 -8.075  1.00 0.00 ? 88  VAL A H    2  
ATOM 3616  H HA   . VAL A 1 88  ? 110.401 -16.496 -8.363  1.00 0.00 ? 88  VAL A HA   2  
ATOM 3617  H HB   . VAL A 1 88  ? 112.623 -14.438 -8.609  1.00 0.00 ? 88  VAL A HB   2  
ATOM 3618  H HG11 . VAL A 1 88  ? 113.722 -16.104 -10.039 1.00 0.00 ? 88  VAL A HG11 2  
ATOM 3619  H HG12 . VAL A 1 88  ? 112.418 -17.248 -9.698  1.00 0.00 ? 88  VAL A HG12 2  
ATOM 3620  H HG13 . VAL A 1 88  ? 113.487 -16.717 -8.402  1.00 0.00 ? 88  VAL A HG13 2  
ATOM 3621  H HG21 . VAL A 1 88  ? 110.717 -13.949 -10.064 1.00 0.00 ? 88  VAL A HG21 2  
ATOM 3622  H HG22 . VAL A 1 88  ? 110.758 -15.585 -10.690 1.00 0.00 ? 88  VAL A HG22 2  
ATOM 3623  H HG23 . VAL A 1 88  ? 112.102 -14.486 -11.018 1.00 0.00 ? 88  VAL A HG23 2  
ATOM 3624  N N    . ILE A 1 89  ? 111.791 -15.205 -5.719  1.00 0.00 ? 89  ILE A N    2  
ATOM 3625  C CA   . ILE A 1 89  ? 112.269 -15.525 -4.377  1.00 0.00 ? 89  ILE A CA   2  
ATOM 3626  C C    . ILE A 1 89  ? 111.264 -16.423 -3.679  1.00 0.00 ? 89  ILE A C    2  
ATOM 3627  O O    . ILE A 1 89  ? 111.626 -17.437 -3.150  1.00 0.00 ? 89  ILE A O    2  
ATOM 3628  C CB   . ILE A 1 89  ? 112.492 -14.255 -3.519  1.00 0.00 ? 89  ILE A CB   2  
ATOM 3629  C CG1  . ILE A 1 89  ? 113.559 -13.382 -4.165  1.00 0.00 ? 89  ILE A CG1  2  
ATOM 3630  C CG2  . ILE A 1 89  ? 112.863 -14.605 -2.062  1.00 0.00 ? 89  ILE A CG2  2  
ATOM 3631  C CD1  . ILE A 1 89  ? 113.792 -12.083 -3.455  1.00 0.00 ? 89  ILE A CD1  2  
ATOM 3632  H H    . ILE A 1 89  ? 111.614 -14.269 -5.960  1.00 0.00 ? 89  ILE A H    2  
ATOM 3633  H HA   . ILE A 1 89  ? 113.204 -16.056 -4.473  1.00 0.00 ? 89  ILE A HA   2  
ATOM 3634  H HB   . ILE A 1 89  ? 111.563 -13.703 -3.496  1.00 0.00 ? 89  ILE A HB   2  
ATOM 3635  H HG12 . ILE A 1 89  ? 114.495 -13.921 -4.178  1.00 0.00 ? 89  ILE A HG12 2  
ATOM 3636  H HG13 . ILE A 1 89  ? 113.263 -13.161 -5.180  1.00 0.00 ? 89  ILE A HG13 2  
ATOM 3637  H HG21 . ILE A 1 89  ? 112.106 -15.241 -1.626  1.00 0.00 ? 89  ILE A HG21 2  
ATOM 3638  H HG22 . ILE A 1 89  ? 112.887 -13.695 -1.479  1.00 0.00 ? 89  ILE A HG22 2  
ATOM 3639  H HG23 . ILE A 1 89  ? 113.825 -15.096 -2.026  1.00 0.00 ? 89  ILE A HG23 2  
ATOM 3640  H HD11 . ILE A 1 89  ? 112.843 -11.604 -3.249  1.00 0.00 ? 89  ILE A HD11 2  
ATOM 3641  H HD12 . ILE A 1 89  ? 114.391 -11.445 -4.090  1.00 0.00 ? 89  ILE A HD12 2  
ATOM 3642  H HD13 . ILE A 1 89  ? 114.314 -12.267 -2.528  1.00 0.00 ? 89  ILE A HD13 2  
ATOM 3643  N N    . THR A 1 90  ? 109.987 -16.067 -3.743  1.00 0.00 ? 90  THR A N    2  
ATOM 3644  C CA   . THR A 1 90  ? 108.950 -16.845 -3.088  1.00 0.00 ? 90  THR A CA   2  
ATOM 3645  C C    . THR A 1 90  ? 108.854 -18.269 -3.686  1.00 0.00 ? 90  THR A C    2  
ATOM 3646  O O    . THR A 1 90  ? 108.382 -19.199 -3.041  1.00 0.00 ? 90  THR A O    2  
ATOM 3647  C CB   . THR A 1 90  ? 107.566 -16.128 -3.108  1.00 0.00 ? 90  THR A CB   2  
ATOM 3648  O OG1  . THR A 1 90  ? 107.089 -15.980 -4.441  1.00 0.00 ? 90  THR A OG1  2  
ATOM 3649  C CG2  . THR A 1 90  ? 107.655 -14.749 -2.460  1.00 0.00 ? 90  THR A CG2  2  
ATOM 3650  H H    . THR A 1 90  ? 109.746 -15.240 -4.220  1.00 0.00 ? 90  THR A H    2  
ATOM 3651  H HA   . THR A 1 90  ? 109.265 -16.957 -2.060  1.00 0.00 ? 90  THR A HA   2  
ATOM 3652  H HB   . THR A 1 90  ? 106.862 -16.726 -2.547  1.00 0.00 ? 90  THR A HB   2  
ATOM 3653  H HG1  . THR A 1 90  ? 107.811 -15.791 -5.058  1.00 0.00 ? 90  THR A HG1  2  
ATOM 3654  H HG21 . THR A 1 90  ? 107.993 -14.830 -1.437  1.00 0.00 ? 90  THR A HG21 2  
ATOM 3655  H HG22 . THR A 1 90  ? 106.688 -14.269 -2.490  1.00 0.00 ? 90  THR A HG22 2  
ATOM 3656  H HG23 . THR A 1 90  ? 108.362 -14.143 -3.011  1.00 0.00 ? 90  THR A HG23 2  
ATOM 3657  N N    . ASN A 1 91  ? 109.329 -18.425 -4.909  1.00 0.00 ? 91  ASN A N    2  
ATOM 3658  C CA   . ASN A 1 91  ? 109.402 -19.733 -5.544  1.00 0.00 ? 91  ASN A CA   2  
ATOM 3659  C C    . ASN A 1 91  ? 110.608 -20.482 -4.999  1.00 0.00 ? 91  ASN A C    2  
ATOM 3660  O O    . ASN A 1 91  ? 110.498 -21.596 -4.498  1.00 0.00 ? 91  ASN A O    2  
ATOM 3661  C CB   . ASN A 1 91  ? 109.562 -19.614 -7.073  1.00 0.00 ? 91  ASN A CB   2  
ATOM 3662  C CG   . ASN A 1 91  ? 108.427 -18.906 -7.785  1.00 0.00 ? 91  ASN A CG   2  
ATOM 3663  O OD1  . ASN A 1 91  ? 108.653 -18.229 -8.787  1.00 0.00 ? 91  ASN A OD1  2  
ATOM 3664  N ND2  . ASN A 1 91  ? 107.213 -19.086 -7.333  1.00 0.00 ? 91  ASN A ND2  2  
ATOM 3665  H H    . ASN A 1 91  ? 109.631 -17.626 -5.393  1.00 0.00 ? 91  ASN A H    2  
ATOM 3666  H HA   . ASN A 1 91  ? 108.498 -20.281 -5.319  1.00 0.00 ? 91  ASN A HA   2  
ATOM 3667  H HB2  . ASN A 1 91  ? 110.468 -19.065 -7.282  1.00 0.00 ? 91  ASN A HB2  2  
ATOM 3668  H HB3  . ASN A 1 91  ? 109.660 -20.608 -7.485  1.00 0.00 ? 91  ASN A HB3  2  
ATOM 3669  H HD21 . ASN A 1 91  ? 107.072 -19.676 -6.562  1.00 0.00 ? 91  ASN A HD21 2  
ATOM 3670  H HD22 . ASN A 1 91  ? 106.479 -18.611 -7.775  1.00 0.00 ? 91  ASN A HD22 2  
ATOM 3671  N N    . SER A 1 92  ? 111.748 -19.842 -5.051  1.00 0.00 ? 92  SER A N    2  
ATOM 3672  C CA   . SER A 1 92  ? 113.002 -20.451 -4.667  1.00 0.00 ? 92  SER A CA   2  
ATOM 3673  C C    . SER A 1 92  ? 113.327 -20.263 -3.164  1.00 0.00 ? 92  SER A C    2  
ATOM 3674  O O    . SER A 1 92  ? 114.467 -20.443 -2.749  1.00 0.00 ? 92  SER A O    2  
ATOM 3675  C CB   . SER A 1 92  ? 114.105 -19.854 -5.539  1.00 0.00 ? 92  SER A CB   2  
ATOM 3676  O OG   . SER A 1 92  ? 113.785 -20.006 -6.930  1.00 0.00 ? 92  SER A OG   2  
ATOM 3677  H H    . SER A 1 92  ? 111.776 -18.913 -5.377  1.00 0.00 ? 92  SER A H    2  
ATOM 3678  H HA   . SER A 1 92  ? 112.943 -21.507 -4.884  1.00 0.00 ? 92  SER A HA   2  
ATOM 3679  H HB2  . SER A 1 92  ? 114.209 -18.802 -5.317  1.00 0.00 ? 92  SER A HB2  2  
ATOM 3680  H HB3  . SER A 1 92  ? 115.037 -20.361 -5.340  1.00 0.00 ? 92  SER A HB3  2  
ATOM 3681  H HG   . SER A 1 92  ? 113.101 -20.687 -7.018  1.00 0.00 ? 92  SER A HG   2  
ATOM 3682  N N    . ILE A 1 93  ? 112.335 -19.921 -2.355  1.00 0.00 ? 93  ILE A N    2  
ATOM 3683  C CA   . ILE A 1 93  ? 112.571 -19.735 -0.924  1.00 0.00 ? 93  ILE A CA   2  
ATOM 3684  C C    . ILE A 1 93  ? 112.249 -21.026 -0.167  1.00 0.00 ? 93  ILE A C    2  
ATOM 3685  O O    . ILE A 1 93  ? 112.795 -21.296 0.906   1.00 0.00 ? 93  ILE A O    2  
ATOM 3686  C CB   . ILE A 1 93  ? 111.769 -18.515 -0.343  1.00 0.00 ? 93  ILE A CB   2  
ATOM 3687  C CG1  . ILE A 1 93  ? 112.260 -18.150 1.055   1.00 0.00 ? 93  ILE A CG1  2  
ATOM 3688  C CG2  . ILE A 1 93  ? 110.268 -18.759 -0.329  1.00 0.00 ? 93  ILE A CG2  2  
ATOM 3689  C CD1  . ILE A 1 93  ? 113.688 -17.654 1.069   1.00 0.00 ? 93  ILE A CD1  2  
ATOM 3690  H H    . ILE A 1 93  ? 111.455 -19.732 -2.744  1.00 0.00 ? 93  ILE A H    2  
ATOM 3691  H HA   . ILE A 1 93  ? 113.629 -19.546 -0.810  1.00 0.00 ? 93  ILE A HA   2  
ATOM 3692  H HB   . ILE A 1 93  ? 111.950 -17.672 -0.995  1.00 0.00 ? 93  ILE A HB   2  
ATOM 3693  H HG12 . ILE A 1 93  ? 111.634 -17.369 1.458   1.00 0.00 ? 93  ILE A HG12 2  
ATOM 3694  H HG13 . ILE A 1 93  ? 112.201 -19.021 1.690   1.00 0.00 ? 93  ILE A HG13 2  
ATOM 3695  H HG21 . ILE A 1 93  ? 110.023 -19.505 0.412   1.00 0.00 ? 93  ILE A HG21 2  
ATOM 3696  H HG22 . ILE A 1 93  ? 109.992 -19.148 -1.300  1.00 0.00 ? 93  ILE A HG22 2  
ATOM 3697  H HG23 . ILE A 1 93  ? 109.753 -17.827 -0.131  1.00 0.00 ? 93  ILE A HG23 2  
ATOM 3698  H HD11 . ILE A 1 93  ? 113.980 -17.419 2.082   1.00 0.00 ? 93  ILE A HD11 2  
ATOM 3699  H HD12 . ILE A 1 93  ? 113.765 -16.765 0.462   1.00 0.00 ? 93  ILE A HD12 2  
ATOM 3700  H HD13 . ILE A 1 93  ? 114.342 -18.419 0.677   1.00 0.00 ? 93  ILE A HD13 2  
ATOM 3701  N N    . THR A 1 94  ? 111.372 -21.831 -0.749  1.00 0.00 ? 94  THR A N    2  
ATOM 3702  C CA   . THR A 1 94  ? 111.042 -23.132 -0.186  1.00 0.00 ? 94  THR A CA   2  
ATOM 3703  C C    . THR A 1 94  ? 112.244 -24.089 -0.337  1.00 0.00 ? 94  THR A C    2  
ATOM 3704  O O    . THR A 1 94  ? 112.459 -24.984 0.482   1.00 0.00 ? 94  THR A O    2  
ATOM 3705  C CB   . THR A 1 94  ? 109.735 -23.728 -0.812  1.00 0.00 ? 94  THR A CB   2  
ATOM 3706  O OG1  . THR A 1 94  ? 109.398 -24.998 -0.216  1.00 0.00 ? 94  THR A OG1  2  
ATOM 3707  C CG2  . THR A 1 94  ? 109.865 -23.888 -2.320  1.00 0.00 ? 94  THR A CG2  2  
ATOM 3708  H H    . THR A 1 94  ? 110.919 -21.506 -1.555  1.00 0.00 ? 94  THR A H    2  
ATOM 3709  H HA   . THR A 1 94  ? 110.889 -22.972 0.872   1.00 0.00 ? 94  THR A HA   2  
ATOM 3710  H HB   . THR A 1 94  ? 108.928 -23.038 -0.605  1.00 0.00 ? 94  THR A HB   2  
ATOM 3711  H HG1  . THR A 1 94  ? 109.026 -24.826 0.665   1.00 0.00 ? 94  THR A HG1  2  
ATOM 3712  H HG21 . THR A 1 94  ? 108.943 -24.274 -2.729  1.00 0.00 ? 94  THR A HG21 2  
ATOM 3713  H HG22 . THR A 1 94  ? 110.675 -24.567 -2.539  1.00 0.00 ? 94  THR A HG22 2  
ATOM 3714  H HG23 . THR A 1 94  ? 110.081 -22.923 -2.757  1.00 0.00 ? 94  THR A HG23 2  
ATOM 3715  N N    . GLN A 1 95  ? 113.054 -23.842 -1.350  1.00 0.00 ? 95  GLN A N    2  
ATOM 3716  C CA   . GLN A 1 95  ? 114.269 -24.590 -1.595  1.00 0.00 ? 95  GLN A CA   2  
ATOM 3717  C C    . GLN A 1 95  ? 115.345 -23.592 -1.993  1.00 0.00 ? 95  GLN A C    2  
ATOM 3718  O O    . GLN A 1 95  ? 115.641 -23.417 -3.176  1.00 0.00 ? 95  GLN A O    2  
ATOM 3719  C CB   . GLN A 1 95  ? 114.102 -25.656 -2.691  1.00 0.00 ? 95  GLN A CB   2  
ATOM 3720  C CG   . GLN A 1 95  ? 113.049 -26.712 -2.401  1.00 0.00 ? 95  GLN A CG   2  
ATOM 3721  C CD   . GLN A 1 95  ? 112.974 -27.793 -3.464  1.00 0.00 ? 95  GLN A CD   2  
ATOM 3722  O OE1  . GLN A 1 95  ? 112.637 -28.947 -3.168  1.00 0.00 ? 95  GLN A OE1  2  
ATOM 3723  N NE2  . GLN A 1 95  ? 113.259 -27.443 -4.696  1.00 0.00 ? 95  GLN A NE2  2  
ATOM 3724  H H    . GLN A 1 95  ? 112.873 -23.085 -1.940  1.00 0.00 ? 95  GLN A H    2  
ATOM 3725  H HA   . GLN A 1 95  ? 114.559 -25.054 -0.664  1.00 0.00 ? 95  GLN A HA   2  
ATOM 3726  H HB2  . GLN A 1 95  ? 113.833 -25.166 -3.615  1.00 0.00 ? 95  GLN A HB2  2  
ATOM 3727  H HB3  . GLN A 1 95  ? 115.051 -26.153 -2.831  1.00 0.00 ? 95  GLN A HB3  2  
ATOM 3728  H HG2  . GLN A 1 95  ? 113.283 -27.178 -1.455  1.00 0.00 ? 95  GLN A HG2  2  
ATOM 3729  H HG3  . GLN A 1 95  ? 112.089 -26.224 -2.331  1.00 0.00 ? 95  GLN A HG3  2  
ATOM 3730  H HE21 . GLN A 1 95  ? 113.497 -26.507 -4.888  1.00 0.00 ? 95  GLN A HE21 2  
ATOM 3731  H HE22 . GLN A 1 95  ? 113.248 -28.129 -5.402  1.00 0.00 ? 95  GLN A HE22 2  
ATOM 3732  N N    . PRO A 1 96  ? 115.861 -22.847 -1.019  1.00 0.00 ? 96  PRO A N    2  
ATOM 3733  C CA   . PRO A 1 96  ? 116.844 -21.812 -1.259  1.00 0.00 ? 96  PRO A CA   2  
ATOM 3734  C C    . PRO A 1 96  ? 118.258 -22.319 -1.316  1.00 0.00 ? 96  PRO A C    2  
ATOM 3735  O O    . PRO A 1 96  ? 118.597 -23.376 -0.768  1.00 0.00 ? 96  PRO A O    2  
ATOM 3736  C CB   . PRO A 1 96  ? 116.657 -20.894 -0.064  1.00 0.00 ? 96  PRO A CB   2  
ATOM 3737  C CG   . PRO A 1 96  ? 116.283 -21.816 1.045   1.00 0.00 ? 96  PRO A CG   2  
ATOM 3738  C CD   . PRO A 1 96  ? 115.503 -22.930 0.408   1.00 0.00 ? 96  PRO A CD   2  
ATOM 3739  H HA   . PRO A 1 96  ? 116.677 -21.252 -2.167  1.00 0.00 ? 96  PRO A HA   2  
ATOM 3740  H HB2  . PRO A 1 96  ? 117.582 -20.374 0.140   1.00 0.00 ? 96  PRO A HB2  2  
ATOM 3741  H HB3  . PRO A 1 96  ? 115.870 -20.183 -0.265  1.00 0.00 ? 96  PRO A HB3  2  
ATOM 3742  H HG2  . PRO A 1 96  ? 117.175 -22.204 1.516   1.00 0.00 ? 96  PRO A HG2  2  
ATOM 3743  H HG3  . PRO A 1 96  ? 115.673 -21.296 1.769   1.00 0.00 ? 96  PRO A HG3  2  
ATOM 3744  H HD2  . PRO A 1 96  ? 115.759 -23.898 0.808   1.00 0.00 ? 96  PRO A HD2  2  
ATOM 3745  H HD3  . PRO A 1 96  ? 114.445 -22.752 0.532   1.00 0.00 ? 96  PRO A HD3  2  
ATOM 3746  N N    . THR A 1 97  ? 119.056 -21.577 -1.995  1.00 0.00 ? 97  THR A N    2  
ATOM 3747  C CA   . THR A 1 97  ? 120.440 -21.823 -2.098  1.00 0.00 ? 97  THR A CA   2  
ATOM 3748  C C    . THR A 1 97  ? 121.141 -20.592 -1.467  1.00 0.00 ? 97  THR A C    2  
ATOM 3749  O O    . THR A 1 97  ? 120.433 -19.693 -0.980  1.00 0.00 ? 97  THR A O    2  
ATOM 3750  C CB   . THR A 1 97  ? 120.798 -21.973 -3.589  1.00 0.00 ? 97  THR A CB   2  
ATOM 3751  O OG1  . THR A 1 97  ? 119.656 -22.543 -4.286  1.00 0.00 ? 97  THR A OG1  2  
ATOM 3752  C CG2  . THR A 1 97  ? 121.945 -22.934 -3.737  1.00 0.00 ? 97  THR A CG2  2  
ATOM 3753  H H    . THR A 1 97  ? 118.690 -20.806 -2.480  1.00 0.00 ? 97  THR A H    2  
ATOM 3754  H HA   . THR A 1 97  ? 120.690 -22.725 -1.559  1.00 0.00 ? 97  THR A HA   2  
ATOM 3755  H HB   . THR A 1 97  ? 121.067 -21.013 -4.005  1.00 0.00 ? 97  THR A HB   2  
ATOM 3756  H HG1  . THR A 1 97  ? 118.956 -21.872 -4.232  1.00 0.00 ? 97  THR A HG1  2  
ATOM 3757  H HG21 . THR A 1 97  ? 122.193 -23.036 -4.783  1.00 0.00 ? 97  THR A HG21 2  
ATOM 3758  H HG22 . THR A 1 97  ? 121.624 -23.884 -3.338  1.00 0.00 ? 97  THR A HG22 2  
ATOM 3759  H HG23 . THR A 1 97  ? 122.795 -22.565 -3.182  1.00 0.00 ? 97  THR A HG23 2  
ATOM 3760  N N    . LEU A 1 98  ? 122.484 -20.532 -1.496  1.00 0.00 ? 98  LEU A N    2  
ATOM 3761  C CA   . LEU A 1 98  ? 123.268 -19.424 -0.873  1.00 0.00 ? 98  LEU A CA   2  
ATOM 3762  C C    . LEU A 1 98  ? 122.782 -18.039 -1.248  1.00 0.00 ? 98  LEU A C    2  
ATOM 3763  O O    . LEU A 1 98  ? 122.854 -17.118 -0.453  1.00 0.00 ? 98  LEU A O    2  
ATOM 3764  C CB   . LEU A 1 98  ? 124.754 -19.534 -1.194  1.00 0.00 ? 98  LEU A CB   2  
ATOM 3765  C CG   . LEU A 1 98  ? 125.643 -20.214 -0.154  1.00 0.00 ? 98  LEU A CG   2  
ATOM 3766  C CD1  . LEU A 1 98  ? 125.162 -21.611 0.185   1.00 0.00 ? 98  LEU A CD1  2  
ATOM 3767  C CD2  . LEU A 1 98  ? 127.072 -20.236 -0.645  1.00 0.00 ? 98  LEU A CD2  2  
ATOM 3768  H H    . LEU A 1 98  ? 122.978 -21.242 -1.957  1.00 0.00 ? 98  LEU A H    2  
ATOM 3769  H HA   . LEU A 1 98  ? 123.152 -19.525 0.196   1.00 0.00 ? 98  LEU A HA   2  
ATOM 3770  H HB2  . LEU A 1 98  ? 124.853 -20.072 -2.125  1.00 0.00 ? 98  LEU A HB2  2  
ATOM 3771  H HB3  . LEU A 1 98  ? 125.128 -18.533 -1.350  1.00 0.00 ? 98  LEU A HB3  2  
ATOM 3772  H HG   . LEU A 1 98  ? 125.619 -19.630 0.754   1.00 0.00 ? 98  LEU A HG   2  
ATOM 3773  H HD11 . LEU A 1 98  ? 125.126 -22.217 -0.708  1.00 0.00 ? 98  LEU A HD11 2  
ATOM 3774  H HD12 . LEU A 1 98  ? 124.183 -21.543 0.637   1.00 0.00 ? 98  LEU A HD12 2  
ATOM 3775  H HD13 . LEU A 1 98  ? 125.848 -22.046 0.896   1.00 0.00 ? 98  LEU A HD13 2  
ATOM 3776  H HD21 . LEU A 1 98  ? 127.410 -19.222 -0.803  1.00 0.00 ? 98  LEU A HD21 2  
ATOM 3777  H HD22 . LEU A 1 98  ? 127.128 -20.783 -1.574  1.00 0.00 ? 98  LEU A HD22 2  
ATOM 3778  H HD23 . LEU A 1 98  ? 127.699 -20.712 0.095   1.00 0.00 ? 98  LEU A HD23 2  
ATOM 3779  N N    . HIS A 1 99  ? 122.344 -17.870 -2.453  1.00 0.00 ? 99  HIS A N    2  
ATOM 3780  C CA   . HIS A 1 99  ? 121.783 -16.620 -2.842  1.00 0.00 ? 99  HIS A CA   2  
ATOM 3781  C C    . HIS A 1 99  ? 120.427 -16.806 -3.467  1.00 0.00 ? 99  HIS A C    2  
ATOM 3782  O O    . HIS A 1 99  ? 120.263 -16.700 -4.674  1.00 0.00 ? 99  HIS A O    2  
ATOM 3783  C CB   . HIS A 1 99  ? 122.715 -15.772 -3.735  1.00 0.00 ? 99  HIS A CB   2  
ATOM 3784  C CG   . HIS A 1 99  ? 123.972 -15.272 -3.056  1.00 0.00 ? 99  HIS A CG   2  
ATOM 3785  N ND1  . HIS A 1 99  ? 125.218 -15.405 -3.605  1.00 0.00 ? 99  HIS A ND1  2  
ATOM 3786  C CD2  . HIS A 1 99  ? 124.152 -14.584 -1.898  1.00 0.00 ? 99  HIS A CD2  2  
ATOM 3787  C CE1  . HIS A 1 99  ? 126.104 -14.822 -2.832  1.00 0.00 ? 99  HIS A CE1  2  
ATOM 3788  N NE2  . HIS A 1 99  ? 125.489 -14.315 -1.791  1.00 0.00 ? 99  HIS A NE2  2  
ATOM 3789  H H    . HIS A 1 99  ? 122.403 -18.607 -3.107  1.00 0.00 ? 99  HIS A H    2  
ATOM 3790  H HA   . HIS A 1 99  ? 121.609 -16.075 -1.925  1.00 0.00 ? 99  HIS A HA   2  
ATOM 3791  H HB2  . HIS A 1 99  ? 123.020 -16.366 -4.584  1.00 0.00 ? 99  HIS A HB2  2  
ATOM 3792  H HB3  . HIS A 1 99  ? 122.167 -14.912 -4.091  1.00 0.00 ? 99  HIS A HB3  2  
ATOM 3793  H HD1  . HIS A 1 99  ? 125.412 -15.853 -4.468  1.00 0.00 ? 99  HIS A HD1  2  
ATOM 3794  H HD2  . HIS A 1 99  ? 123.384 -14.318 -1.187  1.00 0.00 ? 99  HIS A HD2  2  
ATOM 3795  H HE1  . HIS A 1 99  ? 127.167 -14.770 -3.022  1.00 0.00 ? 99  HIS A HE1  2  
ATOM 3796  H HE2  . HIS A 1 99  ? 125.850 -13.516 -1.319  1.00 0.00 ? 99  HIS A HE2  2  
ATOM 3797  N N    . SER A 1 100 ? 119.452 -17.147 -2.639  1.00 0.00 ? 100 SER A N    2  
ATOM 3798  C CA   . SER A 1 100 ? 118.059 -17.231 -3.084  1.00 0.00 ? 100 SER A CA   2  
ATOM 3799  C C    . SER A 1 100 ? 117.579 -15.805 -3.421  1.00 0.00 ? 100 SER A C    2  
ATOM 3800  O O    . SER A 1 100 ? 116.714 -15.570 -4.277  1.00 0.00 ? 100 SER A O    2  
ATOM 3801  C CB   . SER A 1 100 ? 117.184 -17.870 -1.967  1.00 0.00 ? 100 SER A CB   2  
ATOM 3802  O OG   . SER A 1 100 ? 115.837 -18.028 -2.377  1.00 0.00 ? 100 SER A OG   2  
ATOM 3803  H H    . SER A 1 100 ? 119.675 -17.397 -1.716  1.00 0.00 ? 100 SER A H    2  
ATOM 3804  H HA   . SER A 1 100 ? 118.025 -17.838 -3.977  1.00 0.00 ? 100 SER A HA   2  
ATOM 3805  H HB2  . SER A 1 100 ? 117.577 -18.844 -1.719  1.00 0.00 ? 100 SER A HB2  2  
ATOM 3806  H HB3  . SER A 1 100 ? 117.206 -17.262 -1.073  1.00 0.00 ? 100 SER A HB3  2  
ATOM 3807  H HG   . SER A 1 100 ? 115.602 -18.963 -2.438  1.00 0.00 ? 100 SER A HG   2  
ATOM 3808  N N    . PHE A 1 101 ? 118.241 -14.859 -2.791  1.00 0.00 ? 101 PHE A N    2  
ATOM 3809  C CA   . PHE A 1 101 ? 117.966 -13.451 -2.931  1.00 0.00 ? 101 PHE A CA   2  
ATOM 3810  C C    . PHE A 1 101 ? 118.928 -12.858 -3.963  1.00 0.00 ? 101 PHE A C    2  
ATOM 3811  O O    . PHE A 1 101 ? 119.159 -11.663 -3.972  1.00 0.00 ? 101 PHE A O    2  
ATOM 3812  C CB   . PHE A 1 101 ? 118.199 -12.773 -1.577  1.00 0.00 ? 101 PHE A CB   2  
ATOM 3813  C CG   . PHE A 1 101 ? 117.548 -13.485 -0.422  1.00 0.00 ? 101 PHE A CG   2  
ATOM 3814  C CD1  . PHE A 1 101 ? 116.239 -13.238 -0.091  1.00 0.00 ? 101 PHE A CD1  2  
ATOM 3815  C CD2  . PHE A 1 101 ? 118.260 -14.419 0.325   1.00 0.00 ? 101 PHE A CD2  2  
ATOM 3816  C CE1  . PHE A 1 101 ? 115.644 -13.899 0.961   1.00 0.00 ? 101 PHE A CE1  2  
ATOM 3817  C CE2  . PHE A 1 101 ? 117.668 -15.081 1.370   1.00 0.00 ? 101 PHE A CE2  2  
ATOM 3818  C CZ   . PHE A 1 101 ? 116.359 -14.820 1.688   1.00 0.00 ? 101 PHE A CZ   2  
ATOM 3819  H H    . PHE A 1 101 ? 118.956 -15.132 -2.181  1.00 0.00 ? 101 PHE A H    2  
ATOM 3820  H HA   . PHE A 1 101 ? 116.943 -13.299 -3.238  1.00 0.00 ? 101 PHE A HA   2  
ATOM 3821  H HB2  . PHE A 1 101 ? 119.261 -12.731 -1.381  1.00 0.00 ? 101 PHE A HB2  2  
ATOM 3822  H HB3  . PHE A 1 101 ? 117.806 -11.768 -1.616  1.00 0.00 ? 101 PHE A HB3  2  
ATOM 3823  H HD1  . PHE A 1 101 ? 115.673 -12.516 -0.662  1.00 0.00 ? 101 PHE A HD1  2  
ATOM 3824  H HD2  . PHE A 1 101 ? 119.290 -14.627 0.080   1.00 0.00 ? 101 PHE A HD2  2  
ATOM 3825  H HE1  . PHE A 1 101 ? 114.616 -13.693 1.218   1.00 0.00 ? 101 PHE A HE1  2  
ATOM 3826  H HE2  . PHE A 1 101 ? 118.229 -15.803 1.943   1.00 0.00 ? 101 PHE A HE2  2  
ATOM 3827  H HZ   . PHE A 1 101 ? 115.891 -15.341 2.510   1.00 0.00 ? 101 PHE A HZ   2  
ATOM 3828  N N    . ASP A 1 102 ? 119.454 -13.721 -4.839  1.00 0.00 ? 102 ASP A N    2  
ATOM 3829  C CA   . ASP A 1 102 ? 120.448 -13.360 -5.880  1.00 0.00 ? 102 ASP A CA   2  
ATOM 3830  C C    . ASP A 1 102 ? 120.120 -12.067 -6.618  1.00 0.00 ? 102 ASP A C    2  
ATOM 3831  O O    . ASP A 1 102 ? 120.927 -11.135 -6.635  1.00 0.00 ? 102 ASP A O    2  
ATOM 3832  C CB   . ASP A 1 102 ? 120.596 -14.487 -6.898  1.00 0.00 ? 102 ASP A CB   2  
ATOM 3833  C CG   . ASP A 1 102 ? 121.605 -14.167 -7.978  1.00 0.00 ? 102 ASP A CG   2  
ATOM 3834  O OD1  . ASP A 1 102 ? 122.806 -14.421 -7.771  1.00 0.00 ? 102 ASP A OD1  2  
ATOM 3835  O OD2  . ASP A 1 102 ? 121.211 -13.663 -9.050  1.00 0.00 ? 102 ASP A OD2  2  
ATOM 3836  H H    . ASP A 1 102 ? 119.159 -14.656 -4.783  1.00 0.00 ? 102 ASP A H    2  
ATOM 3837  H HA   . ASP A 1 102 ? 121.401 -13.235 -5.386  1.00 0.00 ? 102 ASP A HA   2  
ATOM 3838  H HB2  . ASP A 1 102 ? 120.916 -15.385 -6.389  1.00 0.00 ? 102 ASP A HB2  2  
ATOM 3839  H HB3  . ASP A 1 102 ? 119.639 -14.666 -7.365  1.00 0.00 ? 102 ASP A HB3  2  
ATOM 3840  N N    . ALA A 1 103 ? 118.927 -11.996 -7.158  1.00 0.00 ? 103 ALA A N    2  
ATOM 3841  C CA   . ALA A 1 103 ? 118.514 -10.864 -7.969  1.00 0.00 ? 103 ALA A CA   2  
ATOM 3842  C C    . ALA A 1 103 ? 118.116 -9.699  -7.090  1.00 0.00 ? 103 ALA A C    2  
ATOM 3843  O O    . ALA A 1 103 ? 118.258 -8.530  -7.464  1.00 0.00 ? 103 ALA A O    2  
ATOM 3844  C CB   . ALA A 1 103 ? 117.358 -11.262 -8.862  1.00 0.00 ? 103 ALA A CB   2  
ATOM 3845  H H    . ALA A 1 103 ? 118.280 -12.714 -6.981  1.00 0.00 ? 103 ALA A H    2  
ATOM 3846  H HA   . ALA A 1 103 ? 119.344 -10.572 -8.595  1.00 0.00 ? 103 ALA A HA   2  
ATOM 3847  H HB1  . ALA A 1 103 ? 116.519 -11.539 -8.239  1.00 0.00 ? 103 ALA A HB1  2  
ATOM 3848  H HB2  . ALA A 1 103 ? 117.645 -12.102 -9.476  1.00 0.00 ? 103 ALA A HB2  2  
ATOM 3849  H HB3  . ALA A 1 103 ? 117.077 -10.428 -9.488  1.00 0.00 ? 103 ALA A HB3  2  
ATOM 3850  N N    . ALA A 1 104 ? 117.652 -10.021 -5.910  1.00 0.00 ? 104 ALA A N    2  
ATOM 3851  C CA   . ALA A 1 104 ? 117.203 -9.026  -4.974  1.00 0.00 ? 104 ALA A CA   2  
ATOM 3852  C C    . ALA A 1 104 ? 118.362 -8.206  -4.438  1.00 0.00 ? 104 ALA A C    2  
ATOM 3853  O O    . ALA A 1 104 ? 118.208 -7.012  -4.186  1.00 0.00 ? 104 ALA A O    2  
ATOM 3854  C CB   . ALA A 1 104 ? 116.393 -9.664  -3.873  1.00 0.00 ? 104 ALA A CB   2  
ATOM 3855  H H    . ALA A 1 104 ? 117.617 -10.972 -5.669  1.00 0.00 ? 104 ALA A H    2  
ATOM 3856  H HA   . ALA A 1 104 ? 116.555 -8.357  -5.523  1.00 0.00 ? 104 ALA A HA   2  
ATOM 3857  H HB1  . ALA A 1 104 ? 115.580 -10.191 -4.357  1.00 0.00 ? 104 ALA A HB1  2  
ATOM 3858  H HB2  . ALA A 1 104 ? 115.987 -8.881  -3.247  1.00 0.00 ? 104 ALA A HB2  2  
ATOM 3859  H HB3  . ALA A 1 104 ? 116.996 -10.351 -3.298  1.00 0.00 ? 104 ALA A HB3  2  
ATOM 3860  N N    . GLN A 1 105 ? 119.526 -8.842  -4.301  1.00 0.00 ? 105 GLN A N    2  
ATOM 3861  C CA   . GLN A 1 105 ? 120.749 -8.149  -3.888  1.00 0.00 ? 105 GLN A CA   2  
ATOM 3862  C C    . GLN A 1 105 ? 121.045 -7.060  -4.900  1.00 0.00 ? 105 GLN A C    2  
ATOM 3863  O O    . GLN A 1 105 ? 121.278 -5.914  -4.543  1.00 0.00 ? 105 GLN A O    2  
ATOM 3864  C CB   . GLN A 1 105 ? 121.939 -9.101  -3.871  1.00 0.00 ? 105 GLN A CB   2  
ATOM 3865  C CG   . GLN A 1 105 ? 121.745 -10.353 -3.058  1.00 0.00 ? 105 GLN A CG   2  
ATOM 3866  C CD   . GLN A 1 105 ? 122.902 -11.295 -3.220  1.00 0.00 ? 105 GLN A CD   2  
ATOM 3867  O OE1  . GLN A 1 105 ? 123.840 -11.304 -2.435  1.00 0.00 ? 105 GLN A OE1  2  
ATOM 3868  N NE2  . GLN A 1 105 ? 122.881 -12.031 -4.293  1.00 0.00 ? 105 GLN A NE2  2  
ATOM 3869  H H    . GLN A 1 105 ? 119.538 -9.811  -4.465  1.00 0.00 ? 105 GLN A H    2  
ATOM 3870  H HA   . GLN A 1 105 ? 120.606 -7.721  -2.907  1.00 0.00 ? 105 GLN A HA   2  
ATOM 3871  H HB2  . GLN A 1 105 ? 122.154 -9.398  -4.887  1.00 0.00 ? 105 GLN A HB2  2  
ATOM 3872  H HB3  . GLN A 1 105 ? 122.794 -8.572  -3.479  1.00 0.00 ? 105 GLN A HB3  2  
ATOM 3873  H HG2  . GLN A 1 105 ? 121.660 -10.077 -2.018  1.00 0.00 ? 105 GLN A HG2  2  
ATOM 3874  H HG3  . GLN A 1 105 ? 120.840 -10.848 -3.380  1.00 0.00 ? 105 GLN A HG3  2  
ATOM 3875  H HE21 . GLN A 1 105 ? 122.117 -11.906 -4.894  1.00 0.00 ? 105 GLN A HE21 2  
ATOM 3876  H HE22 . GLN A 1 105 ? 123.625 -12.636 -4.511  1.00 0.00 ? 105 GLN A HE22 2  
ATOM 3877  N N    . SER A 1 106 ? 120.994 -7.441  -6.171  1.00 0.00 ? 106 SER A N    2  
ATOM 3878  C CA   . SER A 1 106 ? 121.237 -6.551  -7.279  1.00 0.00 ? 106 SER A CA   2  
ATOM 3879  C C    . SER A 1 106 ? 120.213 -5.409  -7.316  1.00 0.00 ? 106 SER A C    2  
ATOM 3880  O O    . SER A 1 106 ? 120.579 -4.263  -7.574  1.00 0.00 ? 106 SER A O    2  
ATOM 3881  C CB   . SER A 1 106 ? 121.225 -7.357  -8.564  1.00 0.00 ? 106 SER A CB   2  
ATOM 3882  O OG   . SER A 1 106 ? 122.172 -8.413  -8.472  1.00 0.00 ? 106 SER A OG   2  
ATOM 3883  H H    . SER A 1 106 ? 120.799 -8.378  -6.383  1.00 0.00 ? 106 SER A H    2  
ATOM 3884  H HA   . SER A 1 106 ? 122.221 -6.126  -7.149  1.00 0.00 ? 106 SER A HA   2  
ATOM 3885  H HB2  . SER A 1 106 ? 120.242 -7.774  -8.720  1.00 0.00 ? 106 SER A HB2  2  
ATOM 3886  H HB3  . SER A 1 106 ? 121.492 -6.722  -9.396  1.00 0.00 ? 106 SER A HB3  2  
ATOM 3887  H HG   . SER A 1 106 ? 123.042 -7.991  -8.413  1.00 0.00 ? 106 SER A HG   2  
ATOM 3888  N N    . ARG A 1 107 ? 118.941 -5.726  -7.033  1.00 0.00 ? 107 ARG A N    2  
ATOM 3889  C CA   . ARG A 1 107 ? 117.893 -4.707  -6.940  1.00 0.00 ? 107 ARG A CA   2  
ATOM 3890  C C    . ARG A 1 107 ? 118.236 -3.672  -5.897  1.00 0.00 ? 107 ARG A C    2  
ATOM 3891  O O    . ARG A 1 107 ? 118.256 -2.491  -6.178  1.00 0.00 ? 107 ARG A O    2  
ATOM 3892  C CB   . ARG A 1 107 ? 116.529 -5.313  -6.611  1.00 0.00 ? 107 ARG A CB   2  
ATOM 3893  C CG   . ARG A 1 107 ? 115.817 -5.966  -7.773  1.00 0.00 ? 107 ARG A CG   2  
ATOM 3894  C CD   . ARG A 1 107 ? 115.536 -4.944  -8.864  1.00 0.00 ? 107 ARG A CD   2  
ATOM 3895  N NE   . ARG A 1 107 ? 114.792 -5.514  -9.984  1.00 0.00 ? 107 ARG A NE   2  
ATOM 3896  C CZ   . ARG A 1 107 ? 115.103 -5.322  -11.268 1.00 0.00 ? 107 ARG A CZ   2  
ATOM 3897  N NH1  . ARG A 1 107 ? 116.063 -4.472  -11.580 1.00 0.00 ? 107 ARG A NH1  2  
ATOM 3898  N NH2  . ARG A 1 107 ? 114.427 -5.937  -12.233 1.00 0.00 ? 107 ARG A NH2  2  
ATOM 3899  H H    . ARG A 1 107 ? 118.716 -6.674  -6.899  1.00 0.00 ? 107 ARG A H    2  
ATOM 3900  H HA   . ARG A 1 107 ? 117.826 -4.210  -7.897  1.00 0.00 ? 107 ARG A HA   2  
ATOM 3901  H HB2  . ARG A 1 107 ? 116.661 -6.063  -5.844  1.00 0.00 ? 107 ARG A HB2  2  
ATOM 3902  H HB3  . ARG A 1 107 ? 115.894 -4.531  -6.220  1.00 0.00 ? 107 ARG A HB3  2  
ATOM 3903  H HG2  . ARG A 1 107 ? 116.428 -6.763  -8.169  1.00 0.00 ? 107 ARG A HG2  2  
ATOM 3904  H HG3  . ARG A 1 107 ? 114.878 -6.365  -7.410  1.00 0.00 ? 107 ARG A HG3  2  
ATOM 3905  H HD2  . ARG A 1 107 ? 114.961 -4.133  -8.441  1.00 0.00 ? 107 ARG A HD2  2  
ATOM 3906  H HD3  . ARG A 1 107 ? 116.478 -4.561  -9.228  1.00 0.00 ? 107 ARG A HD3  2  
ATOM 3907  H HE   . ARG A 1 107 ? 114.022 -6.061  -9.681  1.00 0.00 ? 107 ARG A HE   2  
ATOM 3908  H HH11 . ARG A 1 107 ? 116.555 -3.961  -10.875 1.00 0.00 ? 107 ARG A HH11 2  
ATOM 3909  H HH12 . ARG A 1 107 ? 116.363 -4.274  -12.522 1.00 0.00 ? 107 ARG A HH12 2  
ATOM 3910  H HH21 . ARG A 1 107 ? 113.657 -6.565  -12.054 1.00 0.00 ? 107 ARG A HH21 2  
ATOM 3911  H HH22 . ARG A 1 107 ? 114.673 -5.800  -13.199 1.00 0.00 ? 107 ARG A HH22 2  
ATOM 3912  N N    . VAL A 1 108 ? 118.551 -4.135  -4.717  1.00 0.00 ? 108 VAL A N    2  
ATOM 3913  C CA   . VAL A 1 108 ? 118.880 -3.265  -3.608  1.00 0.00 ? 108 VAL A CA   2  
ATOM 3914  C C    . VAL A 1 108 ? 120.151 -2.478  -3.890  1.00 0.00 ? 108 VAL A C    2  
ATOM 3915  O O    . VAL A 1 108 ? 120.204 -1.277  -3.676  1.00 0.00 ? 108 VAL A O    2  
ATOM 3916  C CB   . VAL A 1 108 ? 118.964 -4.073  -2.307  1.00 0.00 ? 108 VAL A CB   2  
ATOM 3917  C CG1  . VAL A 1 108 ? 119.365 -3.212  -1.138  1.00 0.00 ? 108 VAL A CG1  2  
ATOM 3918  C CG2  . VAL A 1 108 ? 117.616 -4.690  -2.052  1.00 0.00 ? 108 VAL A CG2  2  
ATOM 3919  H H    . VAL A 1 108 ? 118.560 -5.109  -4.582  1.00 0.00 ? 108 VAL A H    2  
ATOM 3920  H HA   . VAL A 1 108 ? 118.071 -2.554  -3.519  1.00 0.00 ? 108 VAL A HA   2  
ATOM 3921  H HB   . VAL A 1 108 ? 119.673 -4.879  -2.422  1.00 0.00 ? 108 VAL A HB   2  
ATOM 3922  H HG11 . VAL A 1 108 ? 120.347 -2.790  -1.303  1.00 0.00 ? 108 VAL A HG11 2  
ATOM 3923  H HG12 . VAL A 1 108 ? 119.381 -3.824  -0.246  1.00 0.00 ? 108 VAL A HG12 2  
ATOM 3924  H HG13 . VAL A 1 108 ? 118.638 -2.419  -1.034  1.00 0.00 ? 108 VAL A HG13 2  
ATOM 3925  H HG21 . VAL A 1 108 ? 117.638 -5.282  -1.149  1.00 0.00 ? 108 VAL A HG21 2  
ATOM 3926  H HG22 . VAL A 1 108 ? 117.359 -5.305  -2.902  1.00 0.00 ? 108 VAL A HG22 2  
ATOM 3927  H HG23 . VAL A 1 108 ? 116.884 -3.901  -1.960  1.00 0.00 ? 108 VAL A HG23 2  
ATOM 3928  N N    . TYR A 1 109 ? 121.133 -3.154  -4.422  1.00 0.00 ? 109 TYR A N    2  
ATOM 3929  C CA   . TYR A 1 109 ? 122.375 -2.543  -4.854  1.00 0.00 ? 109 TYR A CA   2  
ATOM 3930  C C    . TYR A 1 109 ? 122.116 -1.366  -5.812  1.00 0.00 ? 109 TYR A C    2  
ATOM 3931  O O    . TYR A 1 109 ? 122.635 -0.274  -5.605  1.00 0.00 ? 109 TYR A O    2  
ATOM 3932  C CB   . TYR A 1 109 ? 123.270 -3.642  -5.456  1.00 0.00 ? 109 TYR A CB   2  
ATOM 3933  C CG   . TYR A 1 109 ? 124.309 -3.234  -6.481  1.00 0.00 ? 109 TYR A CG   2  
ATOM 3934  C CD1  . TYR A 1 109 ? 123.977 -3.178  -7.829  1.00 0.00 ? 109 TYR A CD1  2  
ATOM 3935  C CD2  . TYR A 1 109 ? 125.615 -2.963  -6.120  1.00 0.00 ? 109 TYR A CD2  2  
ATOM 3936  C CE1  . TYR A 1 109 ? 124.907 -2.869  -8.782  1.00 0.00 ? 109 TYR A CE1  2  
ATOM 3937  C CE2  . TYR A 1 109 ? 126.561 -2.637  -7.071  1.00 0.00 ? 109 TYR A CE2  2  
ATOM 3938  C CZ   . TYR A 1 109 ? 126.203 -2.596  -8.401  1.00 0.00 ? 109 TYR A CZ   2  
ATOM 3939  O OH   . TYR A 1 109 ? 127.159 -2.321  -9.357  1.00 0.00 ? 109 TYR A OH   2  
ATOM 3940  H H    . TYR A 1 109 ? 121.025 -4.126  -4.529  1.00 0.00 ? 109 TYR A H    2  
ATOM 3941  H HA   . TYR A 1 109 ? 122.856 -2.147  -3.972  1.00 0.00 ? 109 TYR A HA   2  
ATOM 3942  H HB2  . TYR A 1 109 ? 123.816 -4.093  -4.641  1.00 0.00 ? 109 TYR A HB2  2  
ATOM 3943  H HB3  . TYR A 1 109 ? 122.635 -4.401  -5.882  1.00 0.00 ? 109 TYR A HB3  2  
ATOM 3944  H HD1  . TYR A 1 109 ? 122.960 -3.389  -8.124  1.00 0.00 ? 109 TYR A HD1  2  
ATOM 3945  H HD2  . TYR A 1 109 ? 125.891 -2.996  -5.077  1.00 0.00 ? 109 TYR A HD2  2  
ATOM 3946  H HE1  . TYR A 1 109 ? 124.594 -2.832  -9.815  1.00 0.00 ? 109 TYR A HE1  2  
ATOM 3947  H HE2  . TYR A 1 109 ? 127.577 -2.425  -6.772  1.00 0.00 ? 109 TYR A HE2  2  
ATOM 3948  H HH   . TYR A 1 109 ? 127.872 -2.955  -9.201  1.00 0.00 ? 109 TYR A HH   2  
ATOM 3949  N N    . GLN A 1 110 ? 121.275 -1.565  -6.818  1.00 0.00 ? 110 GLN A N    2  
ATOM 3950  C CA   . GLN A 1 110 ? 120.970 -0.480  -7.730  1.00 0.00 ? 110 GLN A CA   2  
ATOM 3951  C C    . GLN A 1 110 ? 120.073 0.584   -7.082  1.00 0.00 ? 110 GLN A C    2  
ATOM 3952  O O    . GLN A 1 110 ? 120.172 1.767   -7.441  1.00 0.00 ? 110 GLN A O    2  
ATOM 3953  C CB   . GLN A 1 110 ? 120.416 -0.953  -9.080  1.00 0.00 ? 110 GLN A CB   2  
ATOM 3954  C CG   . GLN A 1 110 ? 119.225 -1.874  -8.998  1.00 0.00 ? 110 GLN A CG   2  
ATOM 3955  C CD   . GLN A 1 110 ? 118.549 -2.065  -10.329 1.00 0.00 ? 110 GLN A CD   2  
ATOM 3956  O OE1  . GLN A 1 110 ? 117.647 -1.315  -10.692 1.00 0.00 ? 110 GLN A OE1  2  
ATOM 3957  N NE2  . GLN A 1 110 ? 118.964 -3.050  -11.074 1.00 0.00 ? 110 GLN A NE2  2  
ATOM 3958  H H    . GLN A 1 110 ? 120.869 -2.453  -6.946  1.00 0.00 ? 110 GLN A H    2  
ATOM 3959  H HA   . GLN A 1 110 ? 121.921 0.006   -7.902  1.00 0.00 ? 110 GLN A HA   2  
ATOM 3960  H HB2  . GLN A 1 110 ? 120.122 -0.087  -9.654  1.00 0.00 ? 110 GLN A HB2  2  
ATOM 3961  H HB3  . GLN A 1 110 ? 121.205 -1.465  -9.612  1.00 0.00 ? 110 GLN A HB3  2  
ATOM 3962  H HG2  . GLN A 1 110 ? 119.602 -2.836  -8.677  1.00 0.00 ? 110 GLN A HG2  2  
ATOM 3963  H HG3  . GLN A 1 110 ? 118.525 -1.521  -8.257  1.00 0.00 ? 110 GLN A HG3  2  
ATOM 3964  H HE21 . GLN A 1 110 ? 119.692 -3.627  -10.753 1.00 0.00 ? 110 GLN A HE21 2  
ATOM 3965  H HE22 . GLN A 1 110 ? 118.545 -3.187  -11.956 1.00 0.00 ? 110 GLN A HE22 2  
ATOM 3966  N N    . LEU A 1 111 ? 119.230 0.163   -6.113  1.00 0.00 ? 111 LEU A N    2  
ATOM 3967  C CA   . LEU A 1 111 ? 118.362 1.080   -5.343  1.00 0.00 ? 111 LEU A CA   2  
ATOM 3968  C C    . LEU A 1 111 ? 119.189 2.177   -4.723  1.00 0.00 ? 111 LEU A C    2  
ATOM 3969  O O    . LEU A 1 111 ? 119.067 3.354   -5.099  1.00 0.00 ? 111 LEU A O    2  
ATOM 3970  C CB   . LEU A 1 111 ? 117.602 0.361   -4.203  1.00 0.00 ? 111 LEU A CB   2  
ATOM 3971  C CG   . LEU A 1 111 ? 116.534 -0.655  -4.582  1.00 0.00 ? 111 LEU A CG   2  
ATOM 3972  C CD1  . LEU A 1 111 ? 115.991 -1.331  -3.329  1.00 0.00 ? 111 LEU A CD1  2  
ATOM 3973  C CD2  . LEU A 1 111 ? 115.409 0.020   -5.331  1.00 0.00 ? 111 LEU A CD2  2  
ATOM 3974  H H    . LEU A 1 111 ? 119.180 -0.799  -5.917  1.00 0.00 ? 111 LEU A H    2  
ATOM 3975  H HA   . LEU A 1 111 ? 117.645 1.516   -6.023  1.00 0.00 ? 111 LEU A HA   2  
ATOM 3976  H HB2  . LEU A 1 111 ? 118.335 -0.156  -3.600  1.00 0.00 ? 111 LEU A HB2  2  
ATOM 3977  H HB3  . LEU A 1 111 ? 117.143 1.120   -3.587  1.00 0.00 ? 111 LEU A HB3  2  
ATOM 3978  H HG   . LEU A 1 111 ? 116.968 -1.413  -5.217  1.00 0.00 ? 111 LEU A HG   2  
ATOM 3979  H HD11 . LEU A 1 111 ? 115.250 -2.067  -3.606  1.00 0.00 ? 111 LEU A HD11 2  
ATOM 3980  H HD12 . LEU A 1 111 ? 115.536 -0.589  -2.692  1.00 0.00 ? 111 LEU A HD12 2  
ATOM 3981  H HD13 . LEU A 1 111 ? 116.800 -1.812  -2.796  1.00 0.00 ? 111 LEU A HD13 2  
ATOM 3982  H HD21 . LEU A 1 111 ? 114.965 0.781   -4.706  1.00 0.00 ? 111 LEU A HD21 2  
ATOM 3983  H HD22 . LEU A 1 111 ? 114.661 -0.713  -5.595  1.00 0.00 ? 111 LEU A HD22 2  
ATOM 3984  H HD23 . LEU A 1 111 ? 115.798 0.476   -6.230  1.00 0.00 ? 111 LEU A HD23 2  
ATOM 3985  N N    . MET A 1 112 ? 120.085 1.808   -3.813  1.00 0.00 ? 112 MET A N    2  
ATOM 3986  C CA   . MET A 1 112 ? 120.871 2.827   -3.173  1.00 0.00 ? 112 MET A CA   2  
ATOM 3987  C C    . MET A 1 112 ? 121.954 3.382   -4.069  1.00 0.00 ? 112 MET A C    2  
ATOM 3988  O O    . MET A 1 112 ? 122.537 4.378   -3.750  1.00 0.00 ? 112 MET A O    2  
ATOM 3989  C CB   . MET A 1 112 ? 121.397 2.504   -1.752  1.00 0.00 ? 112 MET A CB   2  
ATOM 3990  C CG   . MET A 1 112 ? 122.283 1.295   -1.594  1.00 0.00 ? 112 MET A CG   2  
ATOM 3991  S SD   . MET A 1 112 ? 121.367 -0.183  -1.218  1.00 0.00 ? 112 MET A SD   2  
ATOM 3992  C CE   . MET A 1 112 ? 122.700 -1.349  -1.053  1.00 0.00 ? 112 MET A CE   2  
ATOM 3993  H H    . MET A 1 112 ? 120.204 0.854   -3.590  1.00 0.00 ? 112 MET A H    2  
ATOM 3994  H HA   . MET A 1 112 ? 120.170 3.645   -3.085  1.00 0.00 ? 112 MET A HA   2  
ATOM 3995  H HB2  . MET A 1 112 ? 121.975 3.348   -1.405  1.00 0.00 ? 112 MET A HB2  2  
ATOM 3996  H HB3  . MET A 1 112 ? 120.546 2.382   -1.099  1.00 0.00 ? 112 MET A HB3  2  
ATOM 3997  H HG2  . MET A 1 112 ? 122.830 1.136   -2.511  1.00 0.00 ? 112 MET A HG2  2  
ATOM 3998  H HG3  . MET A 1 112 ? 122.978 1.484   -0.790  1.00 0.00 ? 112 MET A HG3  2  
ATOM 3999  H HE1  . MET A 1 112 ? 123.293 -1.371  -1.956  1.00 0.00 ? 112 MET A HE1  2  
ATOM 4000  H HE2  . MET A 1 112 ? 122.268 -2.327  -0.894  1.00 0.00 ? 112 MET A HE2  2  
ATOM 4001  H HE3  . MET A 1 112 ? 123.320 -1.084  -0.209  1.00 0.00 ? 112 MET A HE3  2  
ATOM 4002  N N    . GLU A 1 113 ? 122.221 2.750   -5.195  1.00 0.00 ? 113 GLU A N    2  
ATOM 4003  C CA   . GLU A 1 113 ? 123.139 3.342   -6.145  1.00 0.00 ? 113 GLU A CA   2  
ATOM 4004  C C    . GLU A 1 113 ? 122.534 4.638   -6.710  1.00 0.00 ? 113 GLU A C    2  
ATOM 4005  O O    . GLU A 1 113 ? 123.015 5.733   -6.426  1.00 0.00 ? 113 GLU A O    2  
ATOM 4006  C CB   . GLU A 1 113 ? 123.495 2.385   -7.285  1.00 0.00 ? 113 GLU A CB   2  
ATOM 4007  C CG   . GLU A 1 113 ? 124.478 2.980   -8.282  1.00 0.00 ? 113 GLU A CG   2  
ATOM 4008  C CD   . GLU A 1 113 ? 124.814 2.051   -9.409  1.00 0.00 ? 113 GLU A CD   2  
ATOM 4009  O OE1  . GLU A 1 113 ? 123.953 1.831   -10.279 1.00 0.00 ? 113 GLU A OE1  2  
ATOM 4010  O OE2  . GLU A 1 113 ? 125.949 1.540   -9.467  1.00 0.00 ? 113 GLU A OE2  2  
ATOM 4011  H H    . GLU A 1 113 ? 121.825 1.869   -5.369  1.00 0.00 ? 113 GLU A H    2  
ATOM 4012  H HA   . GLU A 1 113 ? 124.036 3.604   -5.600  1.00 0.00 ? 113 GLU A HA   2  
ATOM 4013  H HB2  . GLU A 1 113 ? 123.933 1.490   -6.867  1.00 0.00 ? 113 GLU A HB2  2  
ATOM 4014  H HB3  . GLU A 1 113 ? 122.592 2.123   -7.816  1.00 0.00 ? 113 GLU A HB3  2  
ATOM 4015  H HG2  . GLU A 1 113 ? 124.045 3.877   -8.702  1.00 0.00 ? 113 GLU A HG2  2  
ATOM 4016  H HG3  . GLU A 1 113 ? 125.386 3.235   -7.758  1.00 0.00 ? 113 GLU A HG3  2  
ATOM 4017  N N    . GLN A 1 114 ? 121.439 4.520   -7.431  1.00 0.00 ? 114 GLN A N    2  
ATOM 4018  C CA   . GLN A 1 114 ? 120.849 5.680   -8.077  1.00 0.00 ? 114 GLN A CA   2  
ATOM 4019  C C    . GLN A 1 114 ? 120.313 6.719   -7.100  1.00 0.00 ? 114 GLN A C    2  
ATOM 4020  O O    . GLN A 1 114 ? 120.473 7.926   -7.314  1.00 0.00 ? 114 GLN A O    2  
ATOM 4021  C CB   . GLN A 1 114 ? 119.845 5.294   -9.201  1.00 0.00 ? 114 GLN A CB   2  
ATOM 4022  C CG   . GLN A 1 114 ? 118.741 4.278   -8.851  1.00 0.00 ? 114 GLN A CG   2  
ATOM 4023  C CD   . GLN A 1 114 ? 117.641 4.801   -7.946  1.00 0.00 ? 114 GLN A CD   2  
ATOM 4024  O OE1  . GLN A 1 114 ? 117.317 5.991   -7.953  1.00 0.00 ? 114 GLN A OE1  2  
ATOM 4025  N NE2  . GLN A 1 114 ? 117.036 3.918   -7.202  1.00 0.00 ? 114 GLN A NE2  2  
ATOM 4026  H H    . GLN A 1 114 ? 121.009 3.640   -7.521  1.00 0.00 ? 114 GLN A H    2  
ATOM 4027  H HA   . GLN A 1 114 ? 121.695 6.161   -8.550  1.00 0.00 ? 114 GLN A HA   2  
ATOM 4028  H HB2  . GLN A 1 114 ? 119.351 6.195   -9.534  1.00 0.00 ? 114 GLN A HB2  2  
ATOM 4029  H HB3  . GLN A 1 114 ? 120.412 4.898   -10.032 1.00 0.00 ? 114 GLN A HB3  2  
ATOM 4030  H HG2  . GLN A 1 114 ? 118.281 3.947   -9.771  1.00 0.00 ? 114 GLN A HG2  2  
ATOM 4031  H HG3  . GLN A 1 114 ? 119.209 3.430   -8.374  1.00 0.00 ? 114 GLN A HG3  2  
ATOM 4032  H HE21 . GLN A 1 114 ? 117.333 2.986   -7.277  1.00 0.00 ? 114 GLN A HE21 2  
ATOM 4033  H HE22 . GLN A 1 114 ? 116.309 4.201   -6.607  1.00 0.00 ? 114 GLN A HE22 2  
ATOM 4034  N N    . ASP A 1 115 ? 119.763 6.266   -5.997  1.00 0.00 ? 115 ASP A N    2  
ATOM 4035  C CA   . ASP A 1 115 ? 119.162 7.188   -5.053  1.00 0.00 ? 115 ASP A CA   2  
ATOM 4036  C C    . ASP A 1 115 ? 120.160 7.698   -4.021  1.00 0.00 ? 115 ASP A C    2  
ATOM 4037  O O    . ASP A 1 115 ? 120.273 8.896   -3.799  1.00 0.00 ? 115 ASP A O    2  
ATOM 4038  C CB   . ASP A 1 115 ? 117.976 6.541   -4.349  1.00 0.00 ? 115 ASP A CB   2  
ATOM 4039  C CG   . ASP A 1 115 ? 117.228 7.512   -3.464  1.00 0.00 ? 115 ASP A CG   2  
ATOM 4040  O OD1  . ASP A 1 115 ? 116.382 8.260   -3.981  1.00 0.00 ? 115 ASP A OD1  2  
ATOM 4041  O OD2  . ASP A 1 115 ? 117.459 7.538   -2.239  1.00 0.00 ? 115 ASP A OD2  2  
ATOM 4042  H H    . ASP A 1 115 ? 119.737 5.299   -5.825  1.00 0.00 ? 115 ASP A H    2  
ATOM 4043  H HA   . ASP A 1 115 ? 118.794 8.032   -5.618  1.00 0.00 ? 115 ASP A HA   2  
ATOM 4044  H HB2  . ASP A 1 115 ? 117.290 6.151   -5.087  1.00 0.00 ? 115 ASP A HB2  2  
ATOM 4045  H HB3  . ASP A 1 115 ? 118.342 5.729   -3.736  1.00 0.00 ? 115 ASP A HB3  2  
ATOM 4046  N N    . SER A 1 116 ? 120.899 6.805   -3.423  1.00 0.00 ? 116 SER A N    2  
ATOM 4047  C CA   . SER A 1 116 ? 121.763 7.167   -2.316  1.00 0.00 ? 116 SER A CA   2  
ATOM 4048  C C    . SER A 1 116 ? 123.203 7.530   -2.758  1.00 0.00 ? 116 SER A C    2  
ATOM 4049  O O    . SER A 1 116 ? 123.711 8.557   -2.356  1.00 0.00 ? 116 SER A O    2  
ATOM 4050  C CB   . SER A 1 116 ? 121.755 6.037   -1.271  1.00 0.00 ? 116 SER A CB   2  
ATOM 4051  O OG   . SER A 1 116 ? 122.411 6.390   -0.084  1.00 0.00 ? 116 SER A OG   2  
ATOM 4052  H H    . SER A 1 116 ? 120.873 5.870   -3.714  1.00 0.00 ? 116 SER A H    2  
ATOM 4053  H HA   . SER A 1 116 ? 121.329 8.043   -1.857  1.00 0.00 ? 116 SER A HA   2  
ATOM 4054  H HB2  . SER A 1 116 ? 120.733 5.785   -1.029  1.00 0.00 ? 116 SER A HB2  2  
ATOM 4055  H HB3  . SER A 1 116 ? 122.239 5.168   -1.694  1.00 0.00 ? 116 SER A HB3  2  
ATOM 4056  H HG   . SER A 1 116 ? 121.727 6.698   0.536   1.00 0.00 ? 116 SER A HG   2  
ATOM 4057  N N    . TYR A 1 117 ? 123.813 6.728   -3.643  1.00 0.00 ? 117 TYR A N    2  
ATOM 4058  C CA   . TYR A 1 117 ? 125.231 6.880   -4.058  1.00 0.00 ? 117 TYR A CA   2  
ATOM 4059  C C    . TYR A 1 117 ? 125.531 8.256   -4.616  1.00 0.00 ? 117 TYR A C    2  
ATOM 4060  O O    . TYR A 1 117 ? 126.560 8.847   -4.310  1.00 0.00 ? 117 TYR A O    2  
ATOM 4061  C CB   . TYR A 1 117 ? 125.579 5.754   -5.040  1.00 0.00 ? 117 TYR A CB   2  
ATOM 4062  C CG   . TYR A 1 117 ? 126.823 5.895   -5.893  1.00 0.00 ? 117 TYR A CG   2  
ATOM 4063  C CD1  . TYR A 1 117 ? 128.102 5.808   -5.362  1.00 0.00 ? 117 TYR A CD1  2  
ATOM 4064  C CD2  . TYR A 1 117 ? 126.694 6.053   -7.264  1.00 0.00 ? 117 TYR A CD2  2  
ATOM 4065  C CE1  . TYR A 1 117 ? 129.215 5.880   -6.185  1.00 0.00 ? 117 TYR A CE1  2  
ATOM 4066  C CE2  . TYR A 1 117 ? 127.789 6.134   -8.082  1.00 0.00 ? 117 TYR A CE2  2  
ATOM 4067  C CZ   . TYR A 1 117 ? 129.045 6.046   -7.548  1.00 0.00 ? 117 TYR A CZ   2  
ATOM 4068  O OH   . TYR A 1 117 ? 130.134 6.112   -8.382  1.00 0.00 ? 117 TYR A OH   2  
ATOM 4069  H H    . TYR A 1 117 ? 123.299 5.995   -4.060  1.00 0.00 ? 117 TYR A H    2  
ATOM 4070  H HA   . TYR A 1 117 ? 125.831 6.748   -3.169  1.00 0.00 ? 117 TYR A HA   2  
ATOM 4071  H HB2  . TYR A 1 117 ? 125.707 4.847   -4.468  1.00 0.00 ? 117 TYR A HB2  2  
ATOM 4072  H HB3  . TYR A 1 117 ? 124.732 5.652   -5.709  1.00 0.00 ? 117 TYR A HB3  2  
ATOM 4073  H HD1  . TYR A 1 117 ? 128.225 5.683   -4.296  1.00 0.00 ? 117 TYR A HD1  2  
ATOM 4074  H HD2  . TYR A 1 117 ? 125.703 6.124   -7.689  1.00 0.00 ? 117 TYR A HD2  2  
ATOM 4075  H HE1  . TYR A 1 117 ? 130.205 5.810   -5.761  1.00 0.00 ? 117 TYR A HE1  2  
ATOM 4076  H HE2  . TYR A 1 117 ? 127.660 6.260   -9.147  1.00 0.00 ? 117 TYR A HE2  2  
ATOM 4077  H HH   . TYR A 1 117 ? 129.967 6.822   -9.016  1.00 0.00 ? 117 TYR A HH   2  
ATOM 4078  N N    . THR A 1 118 ? 124.617 8.770   -5.376  1.00 0.00 ? 118 THR A N    2  
ATOM 4079  C CA   . THR A 1 118 ? 124.747 10.091  -5.951  1.00 0.00 ? 118 THR A CA   2  
ATOM 4080  C C    . THR A 1 118 ? 124.792 11.181  -4.839  1.00 0.00 ? 118 THR A C    2  
ATOM 4081  O O    . THR A 1 118 ? 125.660 12.083  -4.834  1.00 0.00 ? 118 THR A O    2  
ATOM 4082  C CB   . THR A 1 118 ? 123.584 10.314  -6.932  1.00 0.00 ? 118 THR A CB   2  
ATOM 4083  O OG1  . THR A 1 118 ? 122.356 9.850   -6.316  1.00 0.00 ? 118 THR A OG1  2  
ATOM 4084  C CG2  . THR A 1 118 ? 123.822 9.528   -8.206  1.00 0.00 ? 118 THR A CG2  2  
ATOM 4085  H H    . THR A 1 118 ? 123.812 8.241   -5.564  1.00 0.00 ? 118 THR A H    2  
ATOM 4086  H HA   . THR A 1 118 ? 125.677 10.121  -6.499  1.00 0.00 ? 118 THR A HA   2  
ATOM 4087  H HB   . THR A 1 118 ? 123.505 11.367  -7.164  1.00 0.00 ? 118 THR A HB   2  
ATOM 4088  H HG1  . THR A 1 118 ? 121.918 9.229   -6.919  1.00 0.00 ? 118 THR A HG1  2  
ATOM 4089  H HG21 . THR A 1 118 ? 123.908 8.479   -7.959  1.00 0.00 ? 118 THR A HG21 2  
ATOM 4090  H HG22 . THR A 1 118 ? 124.738 9.864   -8.671  1.00 0.00 ? 118 THR A HG22 2  
ATOM 4091  H HG23 . THR A 1 118 ? 122.994 9.672   -8.883  1.00 0.00 ? 118 THR A HG23 2  
ATOM 4092  N N    . ARG A 1 119 ? 123.915 11.035  -3.858  1.00 0.00 ? 119 ARG A N    2  
ATOM 4093  C CA   . ARG A 1 119 ? 123.857 11.959  -2.732  1.00 0.00 ? 119 ARG A CA   2  
ATOM 4094  C C    . ARG A 1 119 ? 125.021 11.696  -1.777  1.00 0.00 ? 119 ARG A C    2  
ATOM 4095  O O    . ARG A 1 119 ? 125.481 12.596  -1.082  1.00 0.00 ? 119 ARG A O    2  
ATOM 4096  C CB   . ARG A 1 119 ? 122.504 11.899  -1.987  1.00 0.00 ? 119 ARG A CB   2  
ATOM 4097  C CG   . ARG A 1 119 ? 121.309 12.564  -2.694  1.00 0.00 ? 119 ARG A CG   2  
ATOM 4098  C CD   . ARG A 1 119 ? 120.970 11.915  -4.020  1.00 0.00 ? 119 ARG A CD   2  
ATOM 4099  N NE   . ARG A 1 119 ? 119.787 12.500  -4.663  1.00 0.00 ? 119 ARG A NE   2  
ATOM 4100  C CZ   . ARG A 1 119 ? 119.334 12.141  -5.873  1.00 0.00 ? 119 ARG A CZ   2  
ATOM 4101  N NH1  . ARG A 1 119 ? 120.003 11.243  -6.589  1.00 0.00 ? 119 ARG A NH1  2  
ATOM 4102  N NH2  . ARG A 1 119 ? 118.215 12.659  -6.358  1.00 0.00 ? 119 ARG A NH2  2  
ATOM 4103  H H    . ARG A 1 119 ? 123.310 10.262  -3.896  1.00 0.00 ? 119 ARG A H    2  
ATOM 4104  H HA   . ARG A 1 119 ? 123.992 12.949  -3.143  1.00 0.00 ? 119 ARG A HA   2  
ATOM 4105  H HB2  . ARG A 1 119 ? 122.250 10.862  -1.823  1.00 0.00 ? 119 ARG A HB2  2  
ATOM 4106  H HB3  . ARG A 1 119 ? 122.632 12.372  -1.025  1.00 0.00 ? 119 ARG A HB3  2  
ATOM 4107  H HG2  . ARG A 1 119 ? 120.444 12.494  -2.052  1.00 0.00 ? 119 ARG A HG2  2  
ATOM 4108  H HG3  . ARG A 1 119 ? 121.544 13.604  -2.859  1.00 0.00 ? 119 ARG A HG3  2  
ATOM 4109  H HD2  . ARG A 1 119 ? 121.814 12.028  -4.684  1.00 0.00 ? 119 ARG A HD2  2  
ATOM 4110  H HD3  . ARG A 1 119 ? 120.792 10.863  -3.852  1.00 0.00 ? 119 ARG A HD3  2  
ATOM 4111  H HE   . ARG A 1 119 ? 119.312 13.185  -4.128  1.00 0.00 ? 119 ARG A HE   2  
ATOM 4112  H HH11 . ARG A 1 119 ? 120.846 10.811  -6.248  1.00 0.00 ? 119 ARG A HH11 2  
ATOM 4113  H HH12 . ARG A 1 119 ? 119.734 10.944  -7.513  1.00 0.00 ? 119 ARG A HH12 2  
ATOM 4114  H HH21 . ARG A 1 119 ? 117.641 13.330  -5.866  1.00 0.00 ? 119 ARG A HH21 2  
ATOM 4115  H HH22 . ARG A 1 119 ? 117.877 12.389  -7.269  1.00 0.00 ? 119 ARG A HH22 2  
ATOM 4116  N N    . PHE A 1 120 ? 125.476 10.450  -1.735  1.00 0.00 ? 120 PHE A N    2  
ATOM 4117  C CA   . PHE A 1 120 ? 126.666 10.075  -0.993  1.00 0.00 ? 120 PHE A CA   2  
ATOM 4118  C C    . PHE A 1 120 ? 127.837 10.833  -1.545  1.00 0.00 ? 120 PHE A C    2  
ATOM 4119  O O    . PHE A 1 120 ? 128.557 11.472  -0.801  1.00 0.00 ? 120 PHE A O    2  
ATOM 4120  C CB   . PHE A 1 120 ? 126.918 8.546   -1.052  1.00 0.00 ? 120 PHE A CB   2  
ATOM 4121  C CG   . PHE A 1 120 ? 128.319 8.107   -0.633  1.00 0.00 ? 120 PHE A CG   2  
ATOM 4122  C CD1  . PHE A 1 120 ? 128.674 7.952   0.703   1.00 0.00 ? 120 PHE A CD1  2  
ATOM 4123  C CD2  . PHE A 1 120 ? 129.280 7.851   -1.603  1.00 0.00 ? 120 PHE A CD2  2  
ATOM 4124  C CE1  . PHE A 1 120 ? 129.965 7.551   1.048   1.00 0.00 ? 120 PHE A CE1  2  
ATOM 4125  C CE2  . PHE A 1 120 ? 130.551 7.457   -1.258  1.00 0.00 ? 120 PHE A CE2  2  
ATOM 4126  C CZ   . PHE A 1 120 ? 130.894 7.308   0.064   1.00 0.00 ? 120 PHE A CZ   2  
ATOM 4127  H H    . PHE A 1 120 ? 124.968 9.747   -2.202  1.00 0.00 ? 120 PHE A H    2  
ATOM 4128  H HA   . PHE A 1 120 ? 126.515 10.373  0.035   1.00 0.00 ? 120 PHE A HA   2  
ATOM 4129  H HB2  . PHE A 1 120 ? 126.214 8.051   -0.400  1.00 0.00 ? 120 PHE A HB2  2  
ATOM 4130  H HB3  . PHE A 1 120 ? 126.753 8.208   -2.065  1.00 0.00 ? 120 PHE A HB3  2  
ATOM 4131  H HD1  . PHE A 1 120 ? 127.944 8.144   1.475   1.00 0.00 ? 120 PHE A HD1  2  
ATOM 4132  H HD2  . PHE A 1 120 ? 129.022 7.966   -2.644  1.00 0.00 ? 120 PHE A HD2  2  
ATOM 4133  H HE1  . PHE A 1 120 ? 130.270 7.420   2.079   1.00 0.00 ? 120 PHE A HE1  2  
ATOM 4134  H HE2  . PHE A 1 120 ? 131.282 7.265   -2.030  1.00 0.00 ? 120 PHE A HE2  2  
ATOM 4135  H HZ   . PHE A 1 120 ? 131.893 6.997   0.330   1.00 0.00 ? 120 PHE A HZ   2  
ATOM 4136  N N    . LEU A 1 121 ? 127.980 10.811  -2.858  1.00 0.00 ? 121 LEU A N    2  
ATOM 4137  C CA   . LEU A 1 121 ? 129.060 11.508  -3.529  1.00 0.00 ? 121 LEU A CA   2  
ATOM 4138  C C    . LEU A 1 121 ? 129.016 13.003  -3.271  1.00 0.00 ? 121 LEU A C    2  
ATOM 4139  O O    . LEU A 1 121 ? 130.030 13.660  -3.322  1.00 0.00 ? 121 LEU A O    2  
ATOM 4140  C CB   . LEU A 1 121 ? 129.072 11.214  -5.028  1.00 0.00 ? 121 LEU A CB   2  
ATOM 4141  C CG   . LEU A 1 121 ? 129.339 9.760   -5.414  1.00 0.00 ? 121 LEU A CG   2  
ATOM 4142  C CD1  . LEU A 1 121 ? 129.316 9.602   -6.916  1.00 0.00 ? 121 LEU A CD1  2  
ATOM 4143  C CD2  . LEU A 1 121 ? 130.669 9.286   -4.850  1.00 0.00 ? 121 LEU A CD2  2  
ATOM 4144  H H    . LEU A 1 121 ? 127.346 10.287  -3.399  1.00 0.00 ? 121 LEU A H    2  
ATOM 4145  H HA   . LEU A 1 121 ? 129.978 11.133  -3.102  1.00 0.00 ? 121 LEU A HA   2  
ATOM 4146  H HB2  . LEU A 1 121 ? 128.114 11.504  -5.434  1.00 0.00 ? 121 LEU A HB2  2  
ATOM 4147  H HB3  . LEU A 1 121 ? 129.836 11.828  -5.483  1.00 0.00 ? 121 LEU A HB3  2  
ATOM 4148  H HG   . LEU A 1 121 ? 128.556 9.138   -5.005  1.00 0.00 ? 121 LEU A HG   2  
ATOM 4149  H HD11 . LEU A 1 121 ? 130.087 10.219  -7.354  1.00 0.00 ? 121 LEU A HD11 2  
ATOM 4150  H HD12 . LEU A 1 121 ? 128.353 9.911   -7.295  1.00 0.00 ? 121 LEU A HD12 2  
ATOM 4151  H HD13 . LEU A 1 121 ? 129.491 8.568   -7.174  1.00 0.00 ? 121 LEU A HD13 2  
ATOM 4152  H HD21 . LEU A 1 121 ? 131.463 9.902   -5.249  1.00 0.00 ? 121 LEU A HD21 2  
ATOM 4153  H HD22 . LEU A 1 121 ? 130.839 8.254   -5.116  1.00 0.00 ? 121 LEU A HD22 2  
ATOM 4154  H HD23 . LEU A 1 121 ? 130.660 9.386   -3.774  1.00 0.00 ? 121 LEU A HD23 2  
ATOM 4155  N N    . LYS A 1 122 ? 127.844 13.537  -3.008  1.00 0.00 ? 122 LYS A N    2  
ATOM 4156  C CA   . LYS A 1 122 ? 127.738 14.946  -2.659  1.00 0.00 ? 122 LYS A CA   2  
ATOM 4157  C C    . LYS A 1 122 ? 127.615 15.231  -1.164  1.00 0.00 ? 122 LYS A C    2  
ATOM 4158  O O    . LYS A 1 122 ? 127.536 16.404  -0.768  1.00 0.00 ? 122 LYS A O    2  
ATOM 4159  C CB   . LYS A 1 122 ? 126.640 15.654  -3.441  1.00 0.00 ? 122 LYS A CB   2  
ATOM 4160  C CG   . LYS A 1 122 ? 127.068 16.051  -4.830  1.00 0.00 ? 122 LYS A CG   2  
ATOM 4161  C CD   . LYS A 1 122 ? 128.238 17.018  -4.755  1.00 0.00 ? 122 LYS A CD   2  
ATOM 4162  C CE   . LYS A 1 122 ? 128.699 17.471  -6.119  1.00 0.00 ? 122 LYS A CE   2  
ATOM 4163  N NZ   . LYS A 1 122 ? 127.665 18.258  -6.838  1.00 0.00 ? 122 LYS A NZ   2  
ATOM 4164  H H    . LYS A 1 122 ? 127.038 12.979  -3.097  1.00 0.00 ? 122 LYS A H    2  
ATOM 4165  H HA   . LYS A 1 122 ? 128.678 15.384  -2.963  1.00 0.00 ? 122 LYS A HA   2  
ATOM 4166  H HB2  . LYS A 1 122 ? 125.788 14.996  -3.522  1.00 0.00 ? 122 LYS A HB2  2  
ATOM 4167  H HB3  . LYS A 1 122 ? 126.349 16.547  -2.908  1.00 0.00 ? 122 LYS A HB3  2  
ATOM 4168  H HG2  . LYS A 1 122 ? 127.370 15.169  -5.377  1.00 0.00 ? 122 LYS A HG2  2  
ATOM 4169  H HG3  . LYS A 1 122 ? 126.244 16.533  -5.334  1.00 0.00 ? 122 LYS A HG3  2  
ATOM 4170  H HD2  . LYS A 1 122 ? 127.937 17.887  -4.190  1.00 0.00 ? 122 LYS A HD2  2  
ATOM 4171  H HD3  . LYS A 1 122 ? 129.058 16.529  -4.250  1.00 0.00 ? 122 LYS A HD3  2  
ATOM 4172  H HE2  . LYS A 1 122 ? 129.578 18.080  -5.970  1.00 0.00 ? 122 LYS A HE2  2  
ATOM 4173  H HE3  . LYS A 1 122 ? 128.965 16.598  -6.695  1.00 0.00 ? 122 LYS A HE3  2  
ATOM 4174  H HZ1  . LYS A 1 122 ? 126.786 17.724  -7.004  1.00 0.00 ? 122 LYS A HZ1  2  
ATOM 4175  H HZ2  . LYS A 1 122 ? 128.035 18.578  -7.758  1.00 0.00 ? 122 LYS A HZ2  2  
ATOM 4176  H HZ3  . LYS A 1 122 ? 127.435 19.137  -6.323  1.00 0.00 ? 122 LYS A HZ3  2  
ATOM 4177  N N    . SER A 1 123 ? 127.630 14.217  -0.327  1.00 0.00 ? 123 SER A N    2  
ATOM 4178  C CA   . SER A 1 123 ? 127.512 14.452  1.086   1.00 0.00 ? 123 SER A CA   2  
ATOM 4179  C C    . SER A 1 123 ? 128.850 14.899  1.634   1.00 0.00 ? 123 SER A C    2  
ATOM 4180  O O    . SER A 1 123 ? 129.905 14.608  1.035   1.00 0.00 ? 123 SER A O    2  
ATOM 4181  C CB   . SER A 1 123 ? 127.067 13.176  1.801   1.00 0.00 ? 123 SER A CB   2  
ATOM 4182  O OG   . SER A 1 123 ? 128.040 12.139  1.667   1.00 0.00 ? 123 SER A OG   2  
ATOM 4183  H H    . SER A 1 123 ? 127.716 13.285  -0.632  1.00 0.00 ? 123 SER A H    2  
ATOM 4184  H HA   . SER A 1 123 ? 126.774 15.224  1.250   1.00 0.00 ? 123 SER A HA   2  
ATOM 4185  H HB2  . SER A 1 123 ? 126.925 13.387  2.851   1.00 0.00 ? 123 SER A HB2  2  
ATOM 4186  H HB3  . SER A 1 123 ? 126.135 12.835  1.374   1.00 0.00 ? 123 SER A HB3  2  
ATOM 4187  H HG   . SER A 1 123 ? 128.115 11.895  0.734   1.00 0.00 ? 123 SER A HG   2  
ATOM 4188  N N    . ASP A 1 124 ? 128.840 15.561  2.782   1.00 0.00 ? 124 ASP A N    2  
ATOM 4189  C CA   . ASP A 1 124 ? 130.097 15.947  3.423   1.00 0.00 ? 124 ASP A CA   2  
ATOM 4190  C C    . ASP A 1 124 ? 130.833 14.716  3.903   1.00 0.00 ? 124 ASP A C    2  
ATOM 4191  O O    . ASP A 1 124 ? 131.987 14.790  4.244   1.00 0.00 ? 124 ASP A O    2  
ATOM 4192  C CB   . ASP A 1 124 ? 129.928 16.959  4.570   1.00 0.00 ? 124 ASP A CB   2  
ATOM 4193  C CG   . ASP A 1 124 ? 129.565 18.355  4.104   1.00 0.00 ? 124 ASP A CG   2  
ATOM 4194  O OD1  . ASP A 1 124 ? 130.469 19.139  3.734   1.00 0.00 ? 124 ASP A OD1  2  
ATOM 4195  O OD2  . ASP A 1 124 ? 128.369 18.709  4.117   1.00 0.00 ? 124 ASP A OD2  2  
ATOM 4196  H H    . ASP A 1 124 ? 127.974 15.794  3.192   1.00 0.00 ? 124 ASP A H    2  
ATOM 4197  H HA   . ASP A 1 124 ? 130.697 16.391  2.640   1.00 0.00 ? 124 ASP A HA   2  
ATOM 4198  H HB2  . ASP A 1 124 ? 129.144 16.613  5.228   1.00 0.00 ? 124 ASP A HB2  2  
ATOM 4199  H HB3  . ASP A 1 124 ? 130.853 17.010  5.123   1.00 0.00 ? 124 ASP A HB3  2  
ATOM 4200  N N    . ILE A 1 125 ? 130.125 13.579  3.909   1.00 0.00 ? 125 ILE A N    2  
ATOM 4201  C CA   . ILE A 1 125 ? 130.685 12.262  4.184   1.00 0.00 ? 125 ILE A CA   2  
ATOM 4202  C C    . ILE A 1 125 ? 131.752 11.940  3.119   1.00 0.00 ? 125 ILE A C    2  
ATOM 4203  O O    . ILE A 1 125 ? 132.954 11.833  3.421   1.00 0.00 ? 125 ILE A O    2  
ATOM 4204  C CB   . ILE A 1 125 ? 129.554 11.144  4.174   1.00 0.00 ? 125 ILE A CB   2  
ATOM 4205  C CG1  . ILE A 1 125 ? 128.687 11.126  5.451   1.00 0.00 ? 125 ILE A CG1  2  
ATOM 4206  C CG2  . ILE A 1 125 ? 130.061 9.754   3.817   1.00 0.00 ? 125 ILE A CG2  2  
ATOM 4207  C CD1  . ILE A 1 125 ? 127.742 12.300  5.595   1.00 0.00 ? 125 ILE A CD1  2  
ATOM 4208  H H    . ILE A 1 125 ? 129.170 13.647  3.704   1.00 0.00 ? 125 ILE A H    2  
ATOM 4209  H HA   . ILE A 1 125 ? 131.150 12.289  5.160   1.00 0.00 ? 125 ILE A HA   2  
ATOM 4210  H HB   . ILE A 1 125 ? 128.916 11.416  3.346   1.00 0.00 ? 125 ILE A HB   2  
ATOM 4211  H HG12 . ILE A 1 125 ? 128.090 10.227  5.461   1.00 0.00 ? 125 ILE A HG12 2  
ATOM 4212  H HG13 . ILE A 1 125 ? 129.339 11.118  6.312   1.00 0.00 ? 125 ILE A HG13 2  
ATOM 4213  H HG21 . ILE A 1 125 ? 130.858 9.433   4.472   1.00 0.00 ? 125 ILE A HG21 2  
ATOM 4214  H HG22 . ILE A 1 125 ? 130.411 9.825   2.794   1.00 0.00 ? 125 ILE A HG22 2  
ATOM 4215  H HG23 . ILE A 1 125 ? 129.236 9.059   3.845   1.00 0.00 ? 125 ILE A HG23 2  
ATOM 4216  H HD11 . ILE A 1 125 ? 128.312 13.217  5.612   1.00 0.00 ? 125 ILE A HD11 2  
ATOM 4217  H HD12 . ILE A 1 125 ? 127.184 12.204  6.515   1.00 0.00 ? 125 ILE A HD12 2  
ATOM 4218  H HD13 . ILE A 1 125 ? 127.059 12.317  4.758   1.00 0.00 ? 125 ILE A HD13 2  
ATOM 4219  N N    . TYR A 1 126 ? 131.325 11.845  1.864   1.00 0.00 ? 126 TYR A N    2  
ATOM 4220  C CA   . TYR A 1 126 ? 132.250 11.536  0.795   1.00 0.00 ? 126 TYR A CA   2  
ATOM 4221  C C    . TYR A 1 126 ? 133.241 12.666  0.604   1.00 0.00 ? 126 TYR A C    2  
ATOM 4222  O O    . TYR A 1 126 ? 134.418 12.432  0.358   1.00 0.00 ? 126 TYR A O    2  
ATOM 4223  C CB   . TYR A 1 126 ? 131.528 11.204  -0.503  1.00 0.00 ? 126 TYR A CB   2  
ATOM 4224  C CG   . TYR A 1 126 ? 132.455 10.859  -1.636  1.00 0.00 ? 126 TYR A CG   2  
ATOM 4225  C CD1  . TYR A 1 126 ? 133.251 9.726   -1.579  1.00 0.00 ? 126 TYR A CD1  2  
ATOM 4226  C CD2  . TYR A 1 126 ? 132.555 11.678  -2.745  1.00 0.00 ? 126 TYR A CD2  2  
ATOM 4227  C CE1  . TYR A 1 126 ? 134.114 9.411   -2.595  1.00 0.00 ? 126 TYR A CE1  2  
ATOM 4228  C CE2  . TYR A 1 126 ? 133.413 11.378  -3.770  1.00 0.00 ? 126 TYR A CE2  2  
ATOM 4229  C CZ   . TYR A 1 126 ? 134.190 10.247  -3.699  1.00 0.00 ? 126 TYR A CZ   2  
ATOM 4230  O OH   . TYR A 1 126 ? 135.060 9.964   -4.720  1.00 0.00 ? 126 TYR A OH   2  
ATOM 4231  H H    . TYR A 1 126 ? 130.366 11.964  1.683   1.00 0.00 ? 126 TYR A H    2  
ATOM 4232  H HA   . TYR A 1 126 ? 132.810 10.670  1.117   1.00 0.00 ? 126 TYR A HA   2  
ATOM 4233  H HB2  . TYR A 1 126 ? 130.878 10.358  -0.340  1.00 0.00 ? 126 TYR A HB2  2  
ATOM 4234  H HB3  . TYR A 1 126 ? 130.934 12.054  -0.804  1.00 0.00 ? 126 TYR A HB3  2  
ATOM 4235  H HD1  . TYR A 1 126 ? 133.182 9.082   -0.716  1.00 0.00 ? 126 TYR A HD1  2  
ATOM 4236  H HD2  . TYR A 1 126 ? 131.938 12.562  -2.803  1.00 0.00 ? 126 TYR A HD2  2  
ATOM 4237  H HE1  . TYR A 1 126 ? 134.716 8.515   -2.511  1.00 0.00 ? 126 TYR A HE1  2  
ATOM 4238  H HE2  . TYR A 1 126 ? 133.478 12.031  -4.627  1.00 0.00 ? 126 TYR A HE2  2  
ATOM 4239  H HH   . TYR A 1 126 ? 135.214 9.013   -4.695  1.00 0.00 ? 126 TYR A HH   2  
ATOM 4240  N N    . LEU A 1 127 ? 132.782 13.886  0.771   1.00 0.00 ? 127 LEU A N    2  
ATOM 4241  C CA   . LEU A 1 127 ? 133.662 15.031  0.668   1.00 0.00 ? 127 LEU A CA   2  
ATOM 4242  C C    . LEU A 1 127 ? 134.666 15.099  1.825   1.00 0.00 ? 127 LEU A C    2  
ATOM 4243  O O    . LEU A 1 127 ? 135.687 15.754  1.714   1.00 0.00 ? 127 LEU A O    2  
ATOM 4244  C CB   . LEU A 1 127 ? 132.899 16.357  0.464   1.00 0.00 ? 127 LEU A CB   2  
ATOM 4245  C CG   . LEU A 1 127 ? 132.445 16.689  -0.975  1.00 0.00 ? 127 LEU A CG   2  
ATOM 4246  C CD1  . LEU A 1 127 ? 133.631 16.785  -1.921  1.00 0.00 ? 127 LEU A CD1  2  
ATOM 4247  C CD2  . LEU A 1 127 ? 131.430 15.700  -1.493  1.00 0.00 ? 127 LEU A CD2  2  
ATOM 4248  H H    . LEU A 1 127 ? 131.823 14.018  0.948   1.00 0.00 ? 127 LEU A H    2  
ATOM 4249  H HA   . LEU A 1 127 ? 134.253 14.843  -0.217  1.00 0.00 ? 127 LEU A HA   2  
ATOM 4250  H HB2  . LEU A 1 127 ? 131.995 16.323  1.052   1.00 0.00 ? 127 LEU A HB2  2  
ATOM 4251  H HB3  . LEU A 1 127 ? 133.519 17.169  0.814   1.00 0.00 ? 127 LEU A HB3  2  
ATOM 4252  H HG   . LEU A 1 127 ? 131.982 17.663  -0.947  1.00 0.00 ? 127 LEU A HG   2  
ATOM 4253  H HD11 . LEU A 1 127 ? 134.292 17.573  -1.593  1.00 0.00 ? 127 LEU A HD11 2  
ATOM 4254  H HD12 . LEU A 1 127 ? 133.278 17.001  -2.919  1.00 0.00 ? 127 LEU A HD12 2  
ATOM 4255  H HD13 . LEU A 1 127 ? 134.163 15.846  -1.923  1.00 0.00 ? 127 LEU A HD13 2  
ATOM 4256  H HD21 . LEU A 1 127 ? 131.126 15.968  -2.494  1.00 0.00 ? 127 LEU A HD21 2  
ATOM 4257  H HD22 . LEU A 1 127 ? 130.565 15.702  -0.844  1.00 0.00 ? 127 LEU A HD22 2  
ATOM 4258  H HD23 . LEU A 1 127 ? 131.864 14.711  -1.502  1.00 0.00 ? 127 LEU A HD23 2  
ATOM 4259  N N    . ASP A 1 128 ? 134.395 14.376  2.906   1.00 0.00 ? 128 ASP A N    2  
ATOM 4260  C CA   . ASP A 1 128 ? 135.329 14.279  4.040   1.00 0.00 ? 128 ASP A CA   2  
ATOM 4261  C C    . ASP A 1 128 ? 136.424 13.298  3.670   1.00 0.00 ? 128 ASP A C    2  
ATOM 4262  O O    . ASP A 1 128 ? 137.552 13.405  4.125   1.00 0.00 ? 128 ASP A O    2  
ATOM 4263  C CB   . ASP A 1 128 ? 134.603 13.825  5.325   1.00 0.00 ? 128 ASP A CB   2  
ATOM 4264  C CG   . ASP A 1 128 ? 135.463 13.841  6.577   1.00 0.00 ? 128 ASP A CG   2  
ATOM 4265  O OD1  . ASP A 1 128 ? 135.680 14.931  7.152   1.00 0.00 ? 128 ASP A OD1  2  
ATOM 4266  O OD2  . ASP A 1 128 ? 135.874 12.764  7.049   1.00 0.00 ? 128 ASP A OD2  2  
ATOM 4267  H H    . ASP A 1 128 ? 133.539 13.900  2.971   1.00 0.00 ? 128 ASP A H    2  
ATOM 4268  H HA   . ASP A 1 128 ? 135.773 15.252  4.189   1.00 0.00 ? 128 ASP A HA   2  
ATOM 4269  H HB2  . ASP A 1 128 ? 133.762 14.479  5.498   1.00 0.00 ? 128 ASP A HB2  2  
ATOM 4270  H HB3  . ASP A 1 128 ? 134.235 12.820  5.174   1.00 0.00 ? 128 ASP A HB3  2  
ATOM 4271  N N    . LEU A 1 129 ? 136.082 12.344  2.813   1.00 0.00 ? 129 LEU A N    2  
ATOM 4272  C CA   . LEU A 1 129 ? 137.079 11.402  2.281   1.00 0.00 ? 129 LEU A CA   2  
ATOM 4273  C C    . LEU A 1 129 ? 137.877 12.108  1.185   1.00 0.00 ? 129 LEU A C    2  
ATOM 4274  O O    . LEU A 1 129 ? 139.020 11.760  0.896   1.00 0.00 ? 129 LEU A O    2  
ATOM 4275  C CB   . LEU A 1 129 ? 136.401 10.163  1.679   1.00 0.00 ? 129 LEU A CB   2  
ATOM 4276  C CG   . LEU A 1 129 ? 135.267 9.562   2.507   1.00 0.00 ? 129 LEU A CG   2  
ATOM 4277  C CD1  . LEU A 1 129 ? 134.514 8.550   1.686   1.00 0.00 ? 129 LEU A CD1  2  
ATOM 4278  C CD2  . LEU A 1 129 ? 135.804 8.918   3.777   1.00 0.00 ? 129 LEU A CD2  2  
ATOM 4279  H H    . LEU A 1 129 ? 135.131 12.255  2.575   1.00 0.00 ? 129 LEU A H    2  
ATOM 4280  H HA   . LEU A 1 129 ? 137.740 11.110  3.084   1.00 0.00 ? 129 LEU A HA   2  
ATOM 4281  H HB2  . LEU A 1 129 ? 136.120 10.292  0.643   1.00 0.00 ? 129 LEU A HB2  2  
ATOM 4282  H HB3  . LEU A 1 129 ? 137.178 9.413   1.660   1.00 0.00 ? 129 LEU A HB3  2  
ATOM 4283  H HG   . LEU A 1 129 ? 134.577 10.346  2.787   1.00 0.00 ? 129 LEU A HG   2  
ATOM 4284  H HD11 . LEU A 1 129 ? 135.202 7.795   1.338   1.00 0.00 ? 129 LEU A HD11 2  
ATOM 4285  H HD12 . LEU A 1 129 ? 134.063 9.043   0.838   1.00 0.00 ? 129 LEU A HD12 2  
ATOM 4286  H HD13 . LEU A 1 129 ? 133.747 8.088   2.290   1.00 0.00 ? 129 LEU A HD13 2  
ATOM 4287  H HD21 . LEU A 1 129 ? 136.313 9.664   4.372   1.00 0.00 ? 129 LEU A HD21 2  
ATOM 4288  H HD22 . LEU A 1 129 ? 136.499 8.132   3.516   1.00 0.00 ? 129 LEU A HD22 2  
ATOM 4289  H HD23 . LEU A 1 129 ? 134.985 8.501   4.344   1.00 0.00 ? 129 LEU A HD23 2  
ATOM 4290  N N    . MET A 1 130 ? 137.246 13.109  0.583   1.00 0.00 ? 130 MET A N    2  
ATOM 4291  C CA   . MET A 1 130 ? 137.852 13.891  -0.489  1.00 0.00 ? 130 MET A CA   2  
ATOM 4292  C C    . MET A 1 130 ? 138.776 14.970  0.044   1.00 0.00 ? 130 MET A C    2  
ATOM 4293  O O    . MET A 1 130 ? 140.009 14.860  -0.036  1.00 0.00 ? 130 MET A O    2  
ATOM 4294  C CB   . MET A 1 130 ? 136.781 14.558  -1.379  1.00 0.00 ? 130 MET A CB   2  
ATOM 4295  C CG   . MET A 1 130 ? 135.867 13.639  -2.195  1.00 0.00 ? 130 MET A CG   2  
ATOM 4296  S SD   . MET A 1 130 ? 136.713 12.702  -3.485  1.00 0.00 ? 130 MET A SD   2  
ATOM 4297  C CE   . MET A 1 130 ? 137.583 11.454  -2.543  1.00 0.00 ? 130 MET A CE   2  
ATOM 4298  H H    . MET A 1 130 ? 136.329 13.297  0.873   1.00 0.00 ? 130 MET A H    2  
ATOM 4299  H HA   . MET A 1 130 ? 138.426 13.217  -1.107  1.00 0.00 ? 130 MET A HA   2  
ATOM 4300  H HB2  . MET A 1 130 ? 136.143 15.153  -0.742  1.00 0.00 ? 130 MET A HB2  2  
ATOM 4301  H HB3  . MET A 1 130 ? 137.283 15.225  -2.063  1.00 0.00 ? 130 MET A HB3  2  
ATOM 4302  H HG2  . MET A 1 130 ? 135.385 12.933  -1.535  1.00 0.00 ? 130 MET A HG2  2  
ATOM 4303  H HG3  . MET A 1 130 ? 135.107 14.251  -2.659  1.00 0.00 ? 130 MET A HG3  2  
ATOM 4304  H HE1  . MET A 1 130 ? 138.177 10.844  -3.212  1.00 0.00 ? 130 MET A HE1  2  
ATOM 4305  H HE2  . MET A 1 130 ? 136.863 10.824  -2.038  1.00 0.00 ? 130 MET A HE2  2  
ATOM 4306  H HE3  . MET A 1 130 ? 138.227 11.925  -1.815  1.00 0.00 ? 130 MET A HE3  2  
ATOM 4307  N N    . GLU A 1 131 ? 138.189 15.982  0.644   1.00 0.00 ? 131 GLU A N    2  
ATOM 4308  C CA   . GLU A 1 131 ? 138.921 17.168  1.038   1.00 0.00 ? 131 GLU A CA   2  
ATOM 4309  C C    . GLU A 1 131 ? 138.844 17.361  2.546   1.00 0.00 ? 131 GLU A C    2  
ATOM 4310  O O    . GLU A 1 131 ? 139.307 18.384  3.079   1.00 0.00 ? 131 GLU A O    2  
ATOM 4311  C CB   . GLU A 1 131 ? 138.292 18.374  0.346   1.00 0.00 ? 131 GLU A CB   2  
ATOM 4312  C CG   . GLU A 1 131 ? 138.000 18.147  -1.130  1.00 0.00 ? 131 GLU A CG   2  
ATOM 4313  C CD   . GLU A 1 131 ? 137.399 19.340  -1.803  1.00 0.00 ? 131 GLU A CD   2  
ATOM 4314  O OE1  . GLU A 1 131 ? 136.539 20.009  -1.209  1.00 0.00 ? 131 GLU A OE1  2  
ATOM 4315  O OE2  . GLU A 1 131 ? 137.777 19.630  -2.958  1.00 0.00 ? 131 GLU A OE2  2  
ATOM 4316  H H    . GLU A 1 131 ? 137.227 15.950  0.851   1.00 0.00 ? 131 GLU A H    2  
ATOM 4317  H HA   . GLU A 1 131 ? 139.948 17.082  0.719   1.00 0.00 ? 131 GLU A HA   2  
ATOM 4318  H HB2  . GLU A 1 131 ? 137.364 18.615  0.841   1.00 0.00 ? 131 GLU A HB2  2  
ATOM 4319  H HB3  . GLU A 1 131 ? 138.964 19.215  0.433   1.00 0.00 ? 131 GLU A HB3  2  
ATOM 4320  H HG2  . GLU A 1 131 ? 138.926 17.907  -1.631  1.00 0.00 ? 131 GLU A HG2  2  
ATOM 4321  H HG3  . GLU A 1 131 ? 137.319 17.314  -1.221  1.00 0.00 ? 131 GLU A HG3  2  
ATOM 4322  N N    . GLY A 1 132 ? 138.281 16.380  3.220   1.00 0.00 ? 132 GLY A N    2  
ATOM 4323  C CA   . GLY A 1 132 ? 138.076 16.461  4.645   1.00 0.00 ? 132 GLY A CA   2  
ATOM 4324  C C    . GLY A 1 132 ? 139.318 16.137  5.419   1.00 0.00 ? 132 GLY A C    2  
ATOM 4325  O O    . GLY A 1 132 ? 139.491 16.605  6.551   1.00 0.00 ? 132 GLY A O    2  
ATOM 4326  H H    . GLY A 1 132 ? 138.011 15.571  2.739   1.00 0.00 ? 132 GLY A H    2  
ATOM 4327  H HA2  . GLY A 1 132 ? 137.758 17.462  4.897   1.00 0.00 ? 132 GLY A HA2  2  
ATOM 4328  H HA3  . GLY A 1 132 ? 137.300 15.765  4.925   1.00 0.00 ? 132 GLY A HA3  2  
ATOM 4329  N N    . ARG A 1 133 ? 140.182 15.352  4.826   1.00 0.00 ? 133 ARG A N    2  
ATOM 4330  C CA   . ARG A 1 133 ? 141.434 14.980  5.434   1.00 0.00 ? 133 ARG A CA   2  
ATOM 4331  C C    . ARG A 1 133 ? 142.606 15.475  4.598   1.00 0.00 ? 133 ARG A C    2  
ATOM 4332  O O    . ARG A 1 133 ? 143.082 14.762  3.716   1.00 0.00 ? 133 ARG A O    2  
ATOM 4333  C CB   . ARG A 1 133 ? 141.535 13.450  5.597   1.00 0.00 ? 133 ARG A CB   2  
ATOM 4334  C CG   . ARG A 1 133 ? 140.546 12.839  6.573   1.00 0.00 ? 133 ARG A CG   2  
ATOM 4335  C CD   . ARG A 1 133 ? 140.962 13.009  8.036   1.00 0.00 ? 133 ARG A CD   2  
ATOM 4336  N NE   . ARG A 1 133 ? 141.178 14.403  8.443   1.00 0.00 ? 133 ARG A NE   2  
ATOM 4337  C CZ   . ARG A 1 133 ? 140.405 15.080  9.297   1.00 0.00 ? 133 ARG A CZ   2  
ATOM 4338  N NH1  . ARG A 1 133 ? 139.264 14.543  9.742   1.00 0.00 ? 133 ARG A NH1  2  
ATOM 4339  N NH2  . ARG A 1 133 ? 140.750 16.303  9.679   1.00 0.00 ? 133 ARG A NH2  2  
ATOM 4340  H H    . ARG A 1 133 ? 139.994 14.979  3.931   1.00 0.00 ? 133 ARG A H    2  
ATOM 4341  H HA   . ARG A 1 133 ? 141.480 15.432  6.413   1.00 0.00 ? 133 ARG A HA   2  
ATOM 4342  H HB2  . ARG A 1 133 ? 141.374 12.991  4.634   1.00 0.00 ? 133 ARG A HB2  2  
ATOM 4343  H HB3  . ARG A 1 133 ? 142.533 13.210  5.930   1.00 0.00 ? 133 ARG A HB3  2  
ATOM 4344  H HG2  . ARG A 1 133 ? 139.587 13.315  6.434   1.00 0.00 ? 133 ARG A HG2  2  
ATOM 4345  H HG3  . ARG A 1 133 ? 140.452 11.785  6.354   1.00 0.00 ? 133 ARG A HG3  2  
ATOM 4346  H HD2  . ARG A 1 133 ? 140.188 12.592  8.663   1.00 0.00 ? 133 ARG A HD2  2  
ATOM 4347  H HD3  . ARG A 1 133 ? 141.875 12.453  8.193   1.00 0.00 ? 133 ARG A HD3  2  
ATOM 4348  H HE   . ARG A 1 133 ? 142.002 14.806  8.070   1.00 0.00 ? 133 ARG A HE   2  
ATOM 4349  H HH11 . ARG A 1 133 ? 138.945 13.629  9.449   1.00 0.00 ? 133 ARG A HH11 2  
ATOM 4350  H HH12 . ARG A 1 133 ? 138.664 14.999  10.407  1.00 0.00 ? 133 ARG A HH12 2  
ATOM 4351  H HH21 . ARG A 1 133 ? 141.588 16.767  9.352   1.00 0.00 ? 133 ARG A HH21 2  
ATOM 4352  H HH22 . ARG A 1 133 ? 140.188 16.839  10.323  1.00 0.00 ? 133 ARG A HH22 2  
ATOM 4353  N N    . PRO A 1 134 ? 143.052 16.721  4.800   1.00 0.00 ? 134 PRO A N    2  
ATOM 4354  C CA   . PRO A 1 134 ? 144.240 17.222  4.141   1.00 0.00 ? 134 PRO A CA   2  
ATOM 4355  C C    . PRO A 1 134 ? 145.457 16.712  4.895   1.00 0.00 ? 134 PRO A C    2  
ATOM 4356  O O    . PRO A 1 134 ? 145.536 16.873  6.124   1.00 0.00 ? 134 PRO A O    2  
ATOM 4357  C CB   . PRO A 1 134 ? 144.122 18.760  4.278   1.00 0.00 ? 134 PRO A CB   2  
ATOM 4358  C CG   . PRO A 1 134 ? 142.800 19.010  4.942   1.00 0.00 ? 134 PRO A CG   2  
ATOM 4359  C CD   . PRO A 1 134 ? 142.445 17.743  5.657   1.00 0.00 ? 134 PRO A CD   2  
ATOM 4360  H HA   . PRO A 1 134 ? 144.286 16.926  3.104   1.00 0.00 ? 134 PRO A HA   2  
ATOM 4361  H HB2  . PRO A 1 134 ? 144.938 19.129  4.882   1.00 0.00 ? 134 PRO A HB2  2  
ATOM 4362  H HB3  . PRO A 1 134 ? 144.160 19.213  3.298   1.00 0.00 ? 134 PRO A HB3  2  
ATOM 4363  H HG2  . PRO A 1 134 ? 142.889 19.823  5.646   1.00 0.00 ? 134 PRO A HG2  2  
ATOM 4364  H HG3  . PRO A 1 134 ? 142.053 19.240  4.197   1.00 0.00 ? 134 PRO A HG3  2  
ATOM 4365  H HD2  . PRO A 1 134 ? 142.881 17.730  6.645   1.00 0.00 ? 134 PRO A HD2  2  
ATOM 4366  H HD3  . PRO A 1 134 ? 141.374 17.618  5.709   1.00 0.00 ? 134 PRO A HD3  2  
ATOM 4367  N N    . SER A 1 1   ? 145.739 6.800   7.964   1.00 0.00 ? 1   SER A N    3  
ATOM 4368  C CA   . SER A 1 1   ? 144.536 6.348   8.617   1.00 0.00 ? 1   SER A CA   3  
ATOM 4369  C C    . SER A 1 1   ? 143.359 6.492   7.668   1.00 0.00 ? 1   SER A C    3  
ATOM 4370  O O    . SER A 1 1   ? 143.242 7.513   6.971   1.00 0.00 ? 1   SER A O    3  
ATOM 4371  C CB   . SER A 1 1   ? 144.327 7.165   9.880   1.00 0.00 ? 1   SER A CB   3  
ATOM 4372  O OG   . SER A 1 1   ? 145.463 7.049   10.731  1.00 0.00 ? 1   SER A OG   3  
ATOM 4373  H H1   . SER A 1 1   ? 145.882 6.264   7.080   1.00 0.00 ? 1   SER A H1   3  
ATOM 4374  H H2   . SER A 1 1   ? 146.579 6.679   8.569   1.00 0.00 ? 1   SER A H2   3  
ATOM 4375  H H3   . SER A 1 1   ? 145.643 7.804   7.698   1.00 0.00 ? 1   SER A H3   3  
ATOM 4376  H HA   . SER A 1 1   ? 144.655 5.307   8.879   1.00 0.00 ? 1   SER A HA   3  
ATOM 4377  H HB2  . SER A 1 1   ? 144.183 8.203   9.619   1.00 0.00 ? 1   SER A HB2  3  
ATOM 4378  H HB3  . SER A 1 1   ? 143.458 6.798   10.407  1.00 0.00 ? 1   SER A HB3  3  
ATOM 4379  H HG   . SER A 1 1   ? 146.034 7.826   10.618  1.00 0.00 ? 1   SER A HG   3  
ATOM 4380  N N    . MET A 1 2   ? 142.505 5.452   7.620   1.00 0.00 ? 2   MET A N    3  
ATOM 4381  C CA   . MET A 1 2   ? 141.340 5.381   6.717   1.00 0.00 ? 2   MET A CA   3  
ATOM 4382  C C    . MET A 1 2   ? 141.790 5.346   5.261   1.00 0.00 ? 2   MET A C    3  
ATOM 4383  O O    . MET A 1 2   ? 142.986 5.175   4.958   1.00 0.00 ? 2   MET A O    3  
ATOM 4384  C CB   . MET A 1 2   ? 140.358 6.553   6.922   1.00 0.00 ? 2   MET A CB   3  
ATOM 4385  C CG   . MET A 1 2   ? 139.746 6.653   8.303   1.00 0.00 ? 2   MET A CG   3  
ATOM 4386  S SD   . MET A 1 2   ? 138.651 8.073   8.451   1.00 0.00 ? 2   MET A SD   3  
ATOM 4387  C CE   . MET A 1 2   ? 139.763 9.389   7.974   1.00 0.00 ? 2   MET A CE   3  
ATOM 4388  H H    . MET A 1 2   ? 142.648 4.679   8.206   1.00 0.00 ? 2   MET A H    3  
ATOM 4389  H HA   . MET A 1 2   ? 140.831 4.452   6.928   1.00 0.00 ? 2   MET A HA   3  
ATOM 4390  H HB2  . MET A 1 2   ? 140.883 7.477   6.729   1.00 0.00 ? 2   MET A HB2  3  
ATOM 4391  H HB3  . MET A 1 2   ? 139.556 6.457   6.203   1.00 0.00 ? 2   MET A HB3  3  
ATOM 4392  H HG2  . MET A 1 2   ? 139.181 5.754   8.500   1.00 0.00 ? 2   MET A HG2  3  
ATOM 4393  H HG3  . MET A 1 2   ? 140.539 6.749   9.029   1.00 0.00 ? 2   MET A HG3  3  
ATOM 4394  H HE1  . MET A 1 2   ? 139.240 10.332  8.012   1.00 0.00 ? 2   MET A HE1  3  
ATOM 4395  H HE2  . MET A 1 2   ? 140.119 9.214   6.970   1.00 0.00 ? 2   MET A HE2  3  
ATOM 4396  H HE3  . MET A 1 2   ? 140.602 9.415   8.654   1.00 0.00 ? 2   MET A HE3  3  
ATOM 4397  N N    . VAL A 1 3   ? 140.846 5.477   4.376   1.00 0.00 ? 3   VAL A N    3  
ATOM 4398  C CA   . VAL A 1 3   ? 141.103 5.501   2.958   1.00 0.00 ? 3   VAL A CA   3  
ATOM 4399  C C    . VAL A 1 3   ? 141.662 6.855   2.530   1.00 0.00 ? 3   VAL A C    3  
ATOM 4400  O O    . VAL A 1 3   ? 141.182 7.916   2.962   1.00 0.00 ? 3   VAL A O    3  
ATOM 4401  C CB   . VAL A 1 3   ? 139.823 5.113   2.147   1.00 0.00 ? 3   VAL A CB   3  
ATOM 4402  C CG1  . VAL A 1 3   ? 138.623 5.863   2.656   1.00 0.00 ? 3   VAL A CG1  3  
ATOM 4403  C CG2  . VAL A 1 3   ? 139.975 5.374   0.650   1.00 0.00 ? 3   VAL A CG2  3  
ATOM 4404  H H    . VAL A 1 3   ? 139.920 5.578   4.680   1.00 0.00 ? 3   VAL A H    3  
ATOM 4405  H HA   . VAL A 1 3   ? 141.865 4.759   2.767   1.00 0.00 ? 3   VAL A HA   3  
ATOM 4406  H HB   . VAL A 1 3   ? 139.640 4.058   2.291   1.00 0.00 ? 3   VAL A HB   3  
ATOM 4407  H HG11 . VAL A 1 3   ? 138.476 5.629   3.699   1.00 0.00 ? 3   VAL A HG11 3  
ATOM 4408  H HG12 . VAL A 1 3   ? 137.778 5.508   2.084   1.00 0.00 ? 3   VAL A HG12 3  
ATOM 4409  H HG13 . VAL A 1 3   ? 138.759 6.923   2.512   1.00 0.00 ? 3   VAL A HG13 3  
ATOM 4410  H HG21 . VAL A 1 3   ? 139.960 6.440   0.454   1.00 0.00 ? 3   VAL A HG21 3  
ATOM 4411  H HG22 . VAL A 1 3   ? 139.163 4.906   0.115   1.00 0.00 ? 3   VAL A HG22 3  
ATOM 4412  H HG23 . VAL A 1 3   ? 140.915 4.962   0.310   1.00 0.00 ? 3   VAL A HG23 3  
ATOM 4413  N N    . SER A 1 4   ? 142.703 6.799   1.753   1.00 0.00 ? 4   SER A N    3  
ATOM 4414  C CA   . SER A 1 4   ? 143.339 7.962   1.216   1.00 0.00 ? 4   SER A CA   3  
ATOM 4415  C C    . SER A 1 4   ? 142.471 8.553   0.103   1.00 0.00 ? 4   SER A C    3  
ATOM 4416  O O    . SER A 1 4   ? 141.793 7.805   -0.625  1.00 0.00 ? 4   SER A O    3  
ATOM 4417  C CB   . SER A 1 4   ? 144.728 7.567   0.715   1.00 0.00 ? 4   SER A CB   3  
ATOM 4418  O OG   . SER A 1 4   ? 145.492 6.976   1.776   1.00 0.00 ? 4   SER A OG   3  
ATOM 4419  H H    . SER A 1 4   ? 143.073 5.921   1.504   1.00 0.00 ? 4   SER A H    3  
ATOM 4420  H HA   . SER A 1 4   ? 143.438 8.726   1.968   1.00 0.00 ? 4   SER A HA   3  
ATOM 4421  H HB2  . SER A 1 4   ? 144.633 6.852   -0.090  1.00 0.00 ? 4   SER A HB2  3  
ATOM 4422  H HB3  . SER A 1 4   ? 145.247 8.446   0.362   1.00 0.00 ? 4   SER A HB3  3  
ATOM 4423  H HG   . SER A 1 4   ? 146.276 6.552   1.395   1.00 0.00 ? 4   SER A HG   3  
ATOM 4424  N N    . PRO A 1 5   ? 142.448 9.907   -0.019  1.00 0.00 ? 5   PRO A N    3  
ATOM 4425  C CA   . PRO A 1 5   ? 141.643 10.639  -1.016  1.00 0.00 ? 5   PRO A CA   3  
ATOM 4426  C C    . PRO A 1 5   ? 141.731 10.063  -2.429  1.00 0.00 ? 5   PRO A C    3  
ATOM 4427  O O    . PRO A 1 5   ? 140.765 10.114  -3.179  1.00 0.00 ? 5   PRO A O    3  
ATOM 4428  C CB   . PRO A 1 5   ? 142.250 12.036  -0.997  1.00 0.00 ? 5   PRO A CB   3  
ATOM 4429  C CG   . PRO A 1 5   ? 142.752 12.205  0.385   1.00 0.00 ? 5   PRO A CG   3  
ATOM 4430  C CD   . PRO A 1 5   ? 143.205 10.844  0.845   1.00 0.00 ? 5   PRO A CD   3  
ATOM 4431  H HA   . PRO A 1 5   ? 140.606 10.700  -0.718  1.00 0.00 ? 5   PRO A HA   3  
ATOM 4432  H HB2  . PRO A 1 5   ? 143.051 12.097  -1.720  1.00 0.00 ? 5   PRO A HB2  3  
ATOM 4433  H HB3  . PRO A 1 5   ? 141.489 12.767  -1.229  1.00 0.00 ? 5   PRO A HB3  3  
ATOM 4434  H HG2  . PRO A 1 5   ? 143.582 12.896  0.394   1.00 0.00 ? 5   PRO A HG2  3  
ATOM 4435  H HG3  . PRO A 1 5   ? 141.956 12.566  1.020   1.00 0.00 ? 5   PRO A HG3  3  
ATOM 4436  H HD2  . PRO A 1 5   ? 144.268 10.729  0.695   1.00 0.00 ? 5   PRO A HD2  3  
ATOM 4437  H HD3  . PRO A 1 5   ? 142.952 10.695  1.884   1.00 0.00 ? 5   PRO A HD3  3  
ATOM 4438  N N    . GLU A 1 6   ? 142.871 9.498   -2.772  1.00 0.00 ? 6   GLU A N    3  
ATOM 4439  C CA   . GLU A 1 6   ? 143.074 8.944   -4.103  1.00 0.00 ? 6   GLU A CA   3  
ATOM 4440  C C    . GLU A 1 6   ? 142.191 7.714   -4.323  1.00 0.00 ? 6   GLU A C    3  
ATOM 4441  O O    . GLU A 1 6   ? 141.497 7.601   -5.335  1.00 0.00 ? 6   GLU A O    3  
ATOM 4442  C CB   . GLU A 1 6   ? 144.540 8.603   -4.330  1.00 0.00 ? 6   GLU A CB   3  
ATOM 4443  C CG   . GLU A 1 6   ? 144.870 8.234   -5.760  1.00 0.00 ? 6   GLU A CG   3  
ATOM 4444  C CD   . GLU A 1 6   ? 144.511 9.334   -6.723  1.00 0.00 ? 6   GLU A CD   3  
ATOM 4445  O OE1  . GLU A 1 6   ? 145.092 10.436  -6.635  1.00 0.00 ? 6   GLU A OE1  3  
ATOM 4446  O OE2  . GLU A 1 6   ? 143.643 9.125   -7.578  1.00 0.00 ? 6   GLU A OE2  3  
ATOM 4447  H H    . GLU A 1 6   ? 143.587 9.468   -2.091  1.00 0.00 ? 6   GLU A H    3  
ATOM 4448  H HA   . GLU A 1 6   ? 142.777 9.703   -4.813  1.00 0.00 ? 6   GLU A HA   3  
ATOM 4449  H HB2  . GLU A 1 6   ? 145.144 9.455   -4.053  1.00 0.00 ? 6   GLU A HB2  3  
ATOM 4450  H HB3  . GLU A 1 6   ? 144.803 7.768   -3.697  1.00 0.00 ? 6   GLU A HB3  3  
ATOM 4451  H HG2  . GLU A 1 6   ? 145.930 8.038   -5.835  1.00 0.00 ? 6   GLU A HG2  3  
ATOM 4452  H HG3  . GLU A 1 6   ? 144.316 7.346   -6.027  1.00 0.00 ? 6   GLU A HG3  3  
ATOM 4453  N N    . GLU A 1 7   ? 142.173 6.822   -3.366  1.00 0.00 ? 7   GLU A N    3  
ATOM 4454  C CA   . GLU A 1 7   ? 141.349 5.643   -3.495  1.00 0.00 ? 7   GLU A CA   3  
ATOM 4455  C C    . GLU A 1 7   ? 139.897 6.043   -3.346  1.00 0.00 ? 7   GLU A C    3  
ATOM 4456  O O    . GLU A 1 7   ? 139.013 5.477   -3.975  1.00 0.00 ? 7   GLU A O    3  
ATOM 4457  C CB   . GLU A 1 7   ? 141.710 4.601   -2.447  1.00 0.00 ? 7   GLU A CB   3  
ATOM 4458  C CG   . GLU A 1 7   ? 140.933 3.301   -2.573  1.00 0.00 ? 7   GLU A CG   3  
ATOM 4459  C CD   . GLU A 1 7   ? 141.239 2.535   -3.849  1.00 0.00 ? 7   GLU A CD   3  
ATOM 4460  O OE1  . GLU A 1 7   ? 142.201 2.901   -4.570  1.00 0.00 ? 7   GLU A OE1  3  
ATOM 4461  O OE2  . GLU A 1 7   ? 140.576 1.509   -4.104  1.00 0.00 ? 7   GLU A OE2  3  
ATOM 4462  H H    . GLU A 1 7   ? 142.707 6.959   -2.556  1.00 0.00 ? 7   GLU A H    3  
ATOM 4463  H HA   . GLU A 1 7   ? 141.512 5.237   -4.484  1.00 0.00 ? 7   GLU A HA   3  
ATOM 4464  H HB2  . GLU A 1 7   ? 142.756 4.354   -2.546  1.00 0.00 ? 7   GLU A HB2  3  
ATOM 4465  H HB3  . GLU A 1 7   ? 141.528 5.009   -1.464  1.00 0.00 ? 7   GLU A HB3  3  
ATOM 4466  H HG2  . GLU A 1 7   ? 141.175 2.670   -1.731  1.00 0.00 ? 7   GLU A HG2  3  
ATOM 4467  H HG3  . GLU A 1 7   ? 139.877 3.529   -2.553  1.00 0.00 ? 7   GLU A HG3  3  
ATOM 4468  N N    . ALA A 1 8   ? 139.670 7.045   -2.533  1.00 0.00 ? 8   ALA A N    3  
ATOM 4469  C CA   . ALA A 1 8   ? 138.353 7.546   -2.314  1.00 0.00 ? 8   ALA A CA   3  
ATOM 4470  C C    . ALA A 1 8   ? 137.771 8.155   -3.613  1.00 0.00 ? 8   ALA A C    3  
ATOM 4471  O O    . ALA A 1 8   ? 136.616 7.917   -3.928  1.00 0.00 ? 8   ALA A O    3  
ATOM 4472  C CB   . ALA A 1 8   ? 138.336 8.499   -1.113  1.00 0.00 ? 8   ALA A CB   3  
ATOM 4473  H H    . ALA A 1 8   ? 140.432 7.442   -2.057  1.00 0.00 ? 8   ALA A H    3  
ATOM 4474  H HA   . ALA A 1 8   ? 137.746 6.684   -2.072  1.00 0.00 ? 8   ALA A HA   3  
ATOM 4475  H HB1  . ALA A 1 8   ? 138.809 7.975   -0.292  1.00 0.00 ? 8   ALA A HB1  3  
ATOM 4476  H HB2  . ALA A 1 8   ? 137.329 8.779   -0.827  1.00 0.00 ? 8   ALA A HB2  3  
ATOM 4477  H HB3  . ALA A 1 8   ? 138.909 9.386   -1.338  1.00 0.00 ? 8   ALA A HB3  3  
ATOM 4478  N N    . VAL A 1 9   ? 138.585 8.910   -4.399  1.00 0.00 ? 9   VAL A N    3  
ATOM 4479  C CA   . VAL A 1 9   ? 138.104 9.433   -5.707  1.00 0.00 ? 9   VAL A CA   3  
ATOM 4480  C C    . VAL A 1 9   ? 137.795 8.290   -6.674  1.00 0.00 ? 9   VAL A C    3  
ATOM 4481  O O    . VAL A 1 9   ? 136.917 8.412   -7.532  1.00 0.00 ? 9   VAL A O    3  
ATOM 4482  C CB   . VAL A 1 9   ? 139.047 10.483  -6.414  1.00 0.00 ? 9   VAL A CB   3  
ATOM 4483  C CG1  . VAL A 1 9   ? 139.335 11.671  -5.536  1.00 0.00 ? 9   VAL A CG1  3  
ATOM 4484  C CG2  . VAL A 1 9   ? 140.334 9.879   -6.939  1.00 0.00 ? 9   VAL A CG2  3  
ATOM 4485  H H    . VAL A 1 9   ? 139.476 9.160   -4.067  1.00 0.00 ? 9   VAL A H    3  
ATOM 4486  H HA   . VAL A 1 9   ? 137.155 9.903   -5.489  1.00 0.00 ? 9   VAL A HA   3  
ATOM 4487  H HB   . VAL A 1 9   ? 138.487 10.861  -7.257  1.00 0.00 ? 9   VAL A HB   3  
ATOM 4488  H HG11 . VAL A 1 9   ? 139.986 12.360  -6.053  1.00 0.00 ? 9   VAL A HG11 3  
ATOM 4489  H HG12 . VAL A 1 9   ? 139.809 11.331  -4.627  1.00 0.00 ? 9   VAL A HG12 3  
ATOM 4490  H HG13 . VAL A 1 9   ? 138.409 12.166  -5.285  1.00 0.00 ? 9   VAL A HG13 3  
ATOM 4491  H HG21 . VAL A 1 9   ? 140.887 9.443   -6.121  1.00 0.00 ? 9   VAL A HG21 3  
ATOM 4492  H HG22 . VAL A 1 9   ? 140.930 10.648  -7.409  1.00 0.00 ? 9   VAL A HG22 3  
ATOM 4493  H HG23 . VAL A 1 9   ? 140.100 9.112   -7.663  1.00 0.00 ? 9   VAL A HG23 3  
ATOM 4494  N N    . LYS A 1 10  ? 138.508 7.174   -6.520  1.00 0.00 ? 10  LYS A N    3  
ATOM 4495  C CA   . LYS A 1 10  ? 138.249 5.957   -7.308  1.00 0.00 ? 10  LYS A CA   3  
ATOM 4496  C C    . LYS A 1 10  ? 136.844 5.419   -7.041  1.00 0.00 ? 10  LYS A C    3  
ATOM 4497  O O    . LYS A 1 10  ? 136.232 4.798   -7.894  1.00 0.00 ? 10  LYS A O    3  
ATOM 4498  C CB   . LYS A 1 10  ? 139.292 4.871   -7.010  1.00 0.00 ? 10  LYS A CB   3  
ATOM 4499  C CG   . LYS A 1 10  ? 140.485 4.810   -7.956  1.00 0.00 ? 10  LYS A CG   3  
ATOM 4500  C CD   . LYS A 1 10  ? 141.191 6.136   -8.121  1.00 0.00 ? 10  LYS A CD   3  
ATOM 4501  C CE   . LYS A 1 10  ? 142.449 5.955   -8.932  1.00 0.00 ? 10  LYS A CE   3  
ATOM 4502  N NZ   . LYS A 1 10  ? 143.092 7.231   -9.276  1.00 0.00 ? 10  LYS A NZ   3  
ATOM 4503  H H    . LYS A 1 10  ? 139.240 7.179   -5.862  1.00 0.00 ? 10  LYS A H    3  
ATOM 4504  H HA   . LYS A 1 10  ? 138.316 6.230   -8.351  1.00 0.00 ? 10  LYS A HA   3  
ATOM 4505  H HB2  . LYS A 1 10  ? 139.675 5.030   -6.013  1.00 0.00 ? 10  LYS A HB2  3  
ATOM 4506  H HB3  . LYS A 1 10  ? 138.795 3.912   -7.031  1.00 0.00 ? 10  LYS A HB3  3  
ATOM 4507  H HG2  . LYS A 1 10  ? 141.197 4.094   -7.570  1.00 0.00 ? 10  LYS A HG2  3  
ATOM 4508  H HG3  . LYS A 1 10  ? 140.137 4.474   -8.921  1.00 0.00 ? 10  LYS A HG3  3  
ATOM 4509  H HD2  . LYS A 1 10  ? 140.534 6.827   -8.628  1.00 0.00 ? 10  LYS A HD2  3  
ATOM 4510  H HD3  . LYS A 1 10  ? 141.451 6.524   -7.147  1.00 0.00 ? 10  LYS A HD3  3  
ATOM 4511  H HE2  . LYS A 1 10  ? 143.133 5.376   -8.327  1.00 0.00 ? 10  LYS A HE2  3  
ATOM 4512  H HE3  . LYS A 1 10  ? 142.211 5.410   -9.833  1.00 0.00 ? 10  LYS A HE3  3  
ATOM 4513  H HZ1  . LYS A 1 10  ? 143.995 7.068   -9.771  1.00 0.00 ? 10  LYS A HZ1  3  
ATOM 4514  H HZ2  . LYS A 1 10  ? 143.287 7.826   -8.438  1.00 0.00 ? 10  LYS A HZ2  3  
ATOM 4515  H HZ3  . LYS A 1 10  ? 142.482 7.792   -9.908  1.00 0.00 ? 10  LYS A HZ3  3  
ATOM 4516  N N    . TRP A 1 11  ? 136.323 5.690   -5.867  1.00 0.00 ? 11  TRP A N    3  
ATOM 4517  C CA   . TRP A 1 11  ? 134.977 5.255   -5.512  1.00 0.00 ? 11  TRP A CA   3  
ATOM 4518  C C    . TRP A 1 11  ? 133.945 6.056   -6.276  1.00 0.00 ? 11  TRP A C    3  
ATOM 4519  O O    . TRP A 1 11  ? 132.806 5.631   -6.438  1.00 0.00 ? 11  TRP A O    3  
ATOM 4520  C CB   . TRP A 1 11  ? 134.723 5.426   -4.026  1.00 0.00 ? 11  TRP A CB   3  
ATOM 4521  C CG   . TRP A 1 11  ? 135.612 4.622   -3.144  1.00 0.00 ? 11  TRP A CG   3  
ATOM 4522  C CD1  . TRP A 1 11  ? 136.487 3.643   -3.512  1.00 0.00 ? 11  TRP A CD1  3  
ATOM 4523  C CD2  . TRP A 1 11  ? 135.680 4.710   -1.733  1.00 0.00 ? 11  TRP A CD2  3  
ATOM 4524  N NE1  . TRP A 1 11  ? 137.109 3.138   -2.412  1.00 0.00 ? 11  TRP A NE1  3  
ATOM 4525  C CE2  . TRP A 1 11  ? 136.621 3.768   -1.301  1.00 0.00 ? 11  TRP A CE2  3  
ATOM 4526  C CE3  . TRP A 1 11  ? 135.031 5.506   -0.787  1.00 0.00 ? 11  TRP A CE3  3  
ATOM 4527  C CZ2  . TRP A 1 11  ? 136.928 3.591   0.032   1.00 0.00 ? 11  TRP A CZ2  3  
ATOM 4528  C CZ3  . TRP A 1 11  ? 135.333 5.324   0.542   1.00 0.00 ? 11  TRP A CZ3  3  
ATOM 4529  C CH2  . TRP A 1 11  ? 136.270 4.372   0.936   1.00 0.00 ? 11  TRP A CH2  3  
ATOM 4530  H H    . TRP A 1 11  ? 136.860 6.182   -5.208  1.00 0.00 ? 11  TRP A H    3  
ATOM 4531  H HA   . TRP A 1 11  ? 134.879 4.210   -5.767  1.00 0.00 ? 11  TRP A HA   3  
ATOM 4532  H HB2  . TRP A 1 11  ? 134.867 6.465   -3.770  1.00 0.00 ? 11  TRP A HB2  3  
ATOM 4533  H HB3  . TRP A 1 11  ? 133.699 5.158   -3.813  1.00 0.00 ? 11  TRP A HB3  3  
ATOM 4534  H HD1  . TRP A 1 11  ? 136.665 3.339   -4.532  1.00 0.00 ? 11  TRP A HD1  3  
ATOM 4535  H HE1  . TRP A 1 11  ? 137.790 2.437   -2.440  1.00 0.00 ? 11  TRP A HE1  3  
ATOM 4536  H HE3  . TRP A 1 11  ? 134.310 6.252   -1.097  1.00 0.00 ? 11  TRP A HE3  3  
ATOM 4537  H HZ2  . TRP A 1 11  ? 137.651 2.860   0.364   1.00 0.00 ? 11  TRP A HZ2  3  
ATOM 4538  H HZ3  . TRP A 1 11  ? 134.826 5.906   1.304   1.00 0.00 ? 11  TRP A HZ3  3  
ATOM 4539  H HH2  . TRP A 1 11  ? 136.475 4.264   1.990   1.00 0.00 ? 11  TRP A HH2  3  
ATOM 4540  N N    . GLY A 1 12  ? 134.378 7.193   -6.789  1.00 0.00 ? 12  GLY A N    3  
ATOM 4541  C CA   . GLY A 1 12  ? 133.507 8.092   -7.497  1.00 0.00 ? 12  GLY A CA   3  
ATOM 4542  C C    . GLY A 1 12  ? 133.286 7.690   -8.937  1.00 0.00 ? 12  GLY A C    3  
ATOM 4543  O O    . GLY A 1 12  ? 132.650 8.424   -9.699  1.00 0.00 ? 12  GLY A O    3  
ATOM 4544  H H    . GLY A 1 12  ? 135.329 7.416   -6.700  1.00 0.00 ? 12  GLY A H    3  
ATOM 4545  H HA2  . GLY A 1 12  ? 132.553 8.118   -6.993  1.00 0.00 ? 12  GLY A HA2  3  
ATOM 4546  H HA3  . GLY A 1 12  ? 133.936 9.082   -7.474  1.00 0.00 ? 12  GLY A HA3  3  
ATOM 4547  N N    . GLU A 1 13  ? 133.817 6.548   -9.333  1.00 0.00 ? 13  GLU A N    3  
ATOM 4548  C CA   . GLU A 1 13  ? 133.584 6.066   -10.669 1.00 0.00 ? 13  GLU A CA   3  
ATOM 4549  C C    . GLU A 1 13  ? 132.756 4.772   -10.706 1.00 0.00 ? 13  GLU A C    3  
ATOM 4550  O O    . GLU A 1 13  ? 131.961 4.570   -11.634 1.00 0.00 ? 13  GLU A O    3  
ATOM 4551  C CB   . GLU A 1 13  ? 134.877 6.059   -11.535 1.00 0.00 ? 13  GLU A CB   3  
ATOM 4552  C CG   . GLU A 1 13  ? 136.095 5.328   -10.964 1.00 0.00 ? 13  GLU A CG   3  
ATOM 4553  C CD   . GLU A 1 13  ? 136.063 3.837   -11.159 1.00 0.00 ? 13  GLU A CD   3  
ATOM 4554  O OE1  . GLU A 1 13  ? 136.518 3.368   -12.207 1.00 0.00 ? 13  GLU A OE1  3  
ATOM 4555  O OE2  . GLU A 1 13  ? 135.594 3.104   -10.278 1.00 0.00 ? 13  GLU A OE2  3  
ATOM 4556  H H    . GLU A 1 13  ? 134.385 6.042   -8.715  1.00 0.00 ? 13  GLU A H    3  
ATOM 4557  H HA   . GLU A 1 13  ? 132.917 6.811   -11.082 1.00 0.00 ? 13  GLU A HA   3  
ATOM 4558  H HB2  . GLU A 1 13  ? 134.647 5.600   -12.484 1.00 0.00 ? 13  GLU A HB2  3  
ATOM 4559  H HB3  . GLU A 1 13  ? 135.159 7.086   -11.718 1.00 0.00 ? 13  GLU A HB3  3  
ATOM 4560  H HG2  . GLU A 1 13  ? 136.983 5.710   -11.443 1.00 0.00 ? 13  GLU A HG2  3  
ATOM 4561  H HG3  . GLU A 1 13  ? 136.152 5.538   -9.906  1.00 0.00 ? 13  GLU A HG3  3  
ATOM 4562  N N    . SER A 1 14  ? 132.900 3.919   -9.695  1.00 0.00 ? 14  SER A N    3  
ATOM 4563  C CA   . SER A 1 14  ? 132.108 2.696   -9.617  1.00 0.00 ? 14  SER A CA   3  
ATOM 4564  C C    . SER A 1 14  ? 131.650 2.438   -8.171  1.00 0.00 ? 14  SER A C    3  
ATOM 4565  O O    . SER A 1 14  ? 132.488 2.285   -7.265  1.00 0.00 ? 14  SER A O    3  
ATOM 4566  C CB   . SER A 1 14  ? 132.928 1.490   -10.108 1.00 0.00 ? 14  SER A CB   3  
ATOM 4567  O OG   . SER A 1 14  ? 133.559 1.762   -11.357 1.00 0.00 ? 14  SER A OG   3  
ATOM 4568  H H    . SER A 1 14  ? 133.569 4.087   -8.998  1.00 0.00 ? 14  SER A H    3  
ATOM 4569  H HA   . SER A 1 14  ? 131.242 2.812   -10.251 1.00 0.00 ? 14  SER A HA   3  
ATOM 4570  H HB2  . SER A 1 14  ? 133.691 1.258   -9.379  1.00 0.00 ? 14  SER A HB2  3  
ATOM 4571  H HB3  . SER A 1 14  ? 132.276 0.638   -10.226 1.00 0.00 ? 14  SER A HB3  3  
ATOM 4572  H HG   . SER A 1 14  ? 134.301 2.348   -11.117 1.00 0.00 ? 14  SER A HG   3  
ATOM 4573  N N    . PHE A 1 15  ? 130.337 2.385   -7.967  1.00 0.00 ? 15  PHE A N    3  
ATOM 4574  C CA   . PHE A 1 15  ? 129.732 2.082   -6.660  1.00 0.00 ? 15  PHE A CA   3  
ATOM 4575  C C    . PHE A 1 15  ? 130.203 0.715   -6.170  1.00 0.00 ? 15  PHE A C    3  
ATOM 4576  O O    . PHE A 1 15  ? 130.430 0.521   -4.994  1.00 0.00 ? 15  PHE A O    3  
ATOM 4577  C CB   . PHE A 1 15  ? 128.189 2.142   -6.761  1.00 0.00 ? 15  PHE A CB   3  
ATOM 4578  C CG   . PHE A 1 15  ? 127.415 1.746   -5.513  1.00 0.00 ? 15  PHE A CG   3  
ATOM 4579  C CD1  . PHE A 1 15  ? 127.666 2.342   -4.286  1.00 0.00 ? 15  PHE A CD1  3  
ATOM 4580  C CD2  . PHE A 1 15  ? 126.416 0.790   -5.586  1.00 0.00 ? 15  PHE A CD2  3  
ATOM 4581  C CE1  . PHE A 1 15  ? 126.937 1.986   -3.162  1.00 0.00 ? 15  PHE A CE1  3  
ATOM 4582  C CE2  . PHE A 1 15  ? 125.690 0.436   -4.463  1.00 0.00 ? 15  PHE A CE2  3  
ATOM 4583  C CZ   . PHE A 1 15  ? 125.952 1.035   -3.257  1.00 0.00 ? 15  PHE A CZ   3  
ATOM 4584  H H    . PHE A 1 15  ? 129.743 2.556   -8.737  1.00 0.00 ? 15  PHE A H    3  
ATOM 4585  H HA   . PHE A 1 15  ? 130.073 2.831   -5.960  1.00 0.00 ? 15  PHE A HA   3  
ATOM 4586  H HB2  . PHE A 1 15  ? 127.899 3.154   -7.004  1.00 0.00 ? 15  PHE A HB2  3  
ATOM 4587  H HB3  . PHE A 1 15  ? 127.876 1.493   -7.567  1.00 0.00 ? 15  PHE A HB3  3  
ATOM 4588  H HD1  . PHE A 1 15  ? 128.441 3.090   -4.209  1.00 0.00 ? 15  PHE A HD1  3  
ATOM 4589  H HD2  . PHE A 1 15  ? 126.206 0.316   -6.533  1.00 0.00 ? 15  PHE A HD2  3  
ATOM 4590  H HE1  . PHE A 1 15  ? 127.126 2.439   -2.199  1.00 0.00 ? 15  PHE A HE1  3  
ATOM 4591  H HE2  . PHE A 1 15  ? 124.912 -0.311  -4.521  1.00 0.00 ? 15  PHE A HE2  3  
ATOM 4592  H HZ   . PHE A 1 15  ? 125.384 0.757   -2.381  1.00 0.00 ? 15  PHE A HZ   3  
ATOM 4593  N N    . ASP A 1 16  ? 130.372 -0.206  -7.100  1.00 0.00 ? 16  ASP A N    3  
ATOM 4594  C CA   . ASP A 1 16  ? 130.900 -1.552  -6.820  1.00 0.00 ? 16  ASP A CA   3  
ATOM 4595  C C    . ASP A 1 16  ? 132.265 -1.490  -6.119  1.00 0.00 ? 16  ASP A C    3  
ATOM 4596  O O    . ASP A 1 16  ? 132.500 -2.195  -5.143  1.00 0.00 ? 16  ASP A O    3  
ATOM 4597  C CB   . ASP A 1 16  ? 131.020 -2.337  -8.125  1.00 0.00 ? 16  ASP A CB   3  
ATOM 4598  C CG   . ASP A 1 16  ? 131.705 -3.683  -7.974  1.00 0.00 ? 16  ASP A CG   3  
ATOM 4599  O OD1  . ASP A 1 16  ? 131.043 -4.672  -7.592  1.00 0.00 ? 16  ASP A OD1  3  
ATOM 4600  O OD2  . ASP A 1 16  ? 132.912 -3.778  -8.283  1.00 0.00 ? 16  ASP A OD2  3  
ATOM 4601  H H    . ASP A 1 16  ? 130.086 0.024   -8.016  1.00 0.00 ? 16  ASP A H    3  
ATOM 4602  H HA   . ASP A 1 16  ? 130.197 -2.056  -6.174  1.00 0.00 ? 16  ASP A HA   3  
ATOM 4603  H HB2  . ASP A 1 16  ? 130.030 -2.511  -8.521  1.00 0.00 ? 16  ASP A HB2  3  
ATOM 4604  H HB3  . ASP A 1 16  ? 131.578 -1.746  -8.835  1.00 0.00 ? 16  ASP A HB3  3  
ATOM 4605  N N    . LYS A 1 17  ? 133.129 -0.597  -6.591  1.00 0.00 ? 17  LYS A N    3  
ATOM 4606  C CA   . LYS A 1 17  ? 134.473 -0.426  -6.028  1.00 0.00 ? 17  LYS A CA   3  
ATOM 4607  C C    . LYS A 1 17  ? 134.377 0.086   -4.595  1.00 0.00 ? 17  LYS A C    3  
ATOM 4608  O O    . LYS A 1 17  ? 135.087 -0.368  -3.692  1.00 0.00 ? 17  LYS A O    3  
ATOM 4609  C CB   . LYS A 1 17  ? 135.277 0.556   -6.889  1.00 0.00 ? 17  LYS A CB   3  
ATOM 4610  C CG   . LYS A 1 17  ? 136.611 0.940   -6.291  1.00 0.00 ? 17  LYS A CG   3  
ATOM 4611  C CD   . LYS A 1 17  ? 137.442 1.879   -7.178  1.00 0.00 ? 17  LYS A CD   3  
ATOM 4612  C CE   . LYS A 1 17  ? 137.984 1.239   -8.476  1.00 0.00 ? 17  LYS A CE   3  
ATOM 4613  N NZ   . LYS A 1 17  ? 136.949 0.972   -9.503  1.00 0.00 ? 17  LYS A NZ   3  
ATOM 4614  H H    . LYS A 1 17  ? 132.840 -0.012  -7.322  1.00 0.00 ? 17  LYS A H    3  
ATOM 4615  H HA   . LYS A 1 17  ? 134.966 -1.387  -6.030  1.00 0.00 ? 17  LYS A HA   3  
ATOM 4616  H HB2  . LYS A 1 17  ? 135.458 0.108   -7.855  1.00 0.00 ? 17  LYS A HB2  3  
ATOM 4617  H HB3  . LYS A 1 17  ? 134.693 1.454   -7.024  1.00 0.00 ? 17  LYS A HB3  3  
ATOM 4618  H HG2  . LYS A 1 17  ? 136.379 1.467   -5.375  1.00 0.00 ? 17  LYS A HG2  3  
ATOM 4619  H HG3  . LYS A 1 17  ? 137.173 0.048   -6.063  1.00 0.00 ? 17  LYS A HG3  3  
ATOM 4620  H HD2  . LYS A 1 17  ? 136.825 2.721   -7.455  1.00 0.00 ? 17  LYS A HD2  3  
ATOM 4621  H HD3  . LYS A 1 17  ? 138.276 2.242   -6.594  1.00 0.00 ? 17  LYS A HD3  3  
ATOM 4622  H HE2  . LYS A 1 17  ? 138.717 1.905   -8.904  1.00 0.00 ? 17  LYS A HE2  3  
ATOM 4623  H HE3  . LYS A 1 17  ? 138.468 0.309   -8.215  1.00 0.00 ? 17  LYS A HE3  3  
ATOM 4624  H HZ1  . LYS A 1 17  ? 136.386 1.833   -9.704  1.00 0.00 ? 17  LYS A HZ1  3  
ATOM 4625  H HZ2  . LYS A 1 17  ? 136.320 0.173   -9.270  1.00 0.00 ? 17  LYS A HZ2  3  
ATOM 4626  H HZ3  . LYS A 1 17  ? 137.411 0.715   -10.405 1.00 0.00 ? 17  LYS A HZ3  3  
ATOM 4627  N N    . LEU A 1 18  ? 133.486 1.018   -4.422  1.00 0.00 ? 18  LEU A N    3  
ATOM 4628  C CA   . LEU A 1 18  ? 133.170 1.610   -3.144  1.00 0.00 ? 18  LEU A CA   3  
ATOM 4629  C C    . LEU A 1 18  ? 132.632 0.554   -2.184  1.00 0.00 ? 18  LEU A C    3  
ATOM 4630  O O    . LEU A 1 18  ? 133.071 0.437   -1.048  1.00 0.00 ? 18  LEU A O    3  
ATOM 4631  C CB   . LEU A 1 18  ? 132.096 2.674   -3.400  1.00 0.00 ? 18  LEU A CB   3  
ATOM 4632  C CG   . LEU A 1 18  ? 131.299 3.193   -2.207  1.00 0.00 ? 18  LEU A CG   3  
ATOM 4633  C CD1  . LEU A 1 18  ? 132.170 3.938   -1.247  1.00 0.00 ? 18  LEU A CD1  3  
ATOM 4634  C CD2  . LEU A 1 18  ? 130.195 4.074   -2.692  1.00 0.00 ? 18  LEU A CD2  3  
ATOM 4635  H H    . LEU A 1 18  ? 132.995 1.333   -5.211  1.00 0.00 ? 18  LEU A H    3  
ATOM 4636  H HA   . LEU A 1 18  ? 134.042 2.097   -2.736  1.00 0.00 ? 18  LEU A HA   3  
ATOM 4637  H HB2  . LEU A 1 18  ? 132.581 3.523   -3.857  1.00 0.00 ? 18  LEU A HB2  3  
ATOM 4638  H HB3  . LEU A 1 18  ? 131.399 2.268   -4.118  1.00 0.00 ? 18  LEU A HB3  3  
ATOM 4639  H HG   . LEU A 1 18  ? 130.848 2.358   -1.689  1.00 0.00 ? 18  LEU A HG   3  
ATOM 4640  H HD11 . LEU A 1 18  ? 132.625 4.779   -1.750  1.00 0.00 ? 18  LEU A HD11 3  
ATOM 4641  H HD12 . LEU A 1 18  ? 132.942 3.281   -0.876  1.00 0.00 ? 18  LEU A HD12 3  
ATOM 4642  H HD13 . LEU A 1 18  ? 131.579 4.298   -0.416  1.00 0.00 ? 18  LEU A HD13 3  
ATOM 4643  H HD21 . LEU A 1 18  ? 130.637 4.898   -3.231  1.00 0.00 ? 18  LEU A HD21 3  
ATOM 4644  H HD22 . LEU A 1 18  ? 129.623 4.432   -1.849  1.00 0.00 ? 18  LEU A HD22 3  
ATOM 4645  H HD23 . LEU A 1 18  ? 129.567 3.504   -3.360  1.00 0.00 ? 18  LEU A HD23 3  
ATOM 4646  N N    . LEU A 1 19  ? 131.737 -0.228  -2.689  1.00 0.00 ? 19  LEU A N    3  
ATOM 4647  C CA   . LEU A 1 19  ? 130.977 -1.161  -1.920  1.00 0.00 ? 19  LEU A CA   3  
ATOM 4648  C C    . LEU A 1 19  ? 131.779 -2.414  -1.531  1.00 0.00 ? 19  LEU A C    3  
ATOM 4649  O O    . LEU A 1 19  ? 131.538 -3.014  -0.479  1.00 0.00 ? 19  LEU A O    3  
ATOM 4650  C CB   . LEU A 1 19  ? 129.760 -1.518  -2.732  1.00 0.00 ? 19  LEU A CB   3  
ATOM 4651  C CG   . LEU A 1 19  ? 128.555 -1.982  -1.977  1.00 0.00 ? 19  LEU A CG   3  
ATOM 4652  C CD1  . LEU A 1 19  ? 128.145 -0.904  -0.950  1.00 0.00 ? 19  LEU A CD1  3  
ATOM 4653  C CD2  . LEU A 1 19  ? 127.443 -2.223  -2.982  1.00 0.00 ? 19  LEU A CD2  3  
ATOM 4654  H H    . LEU A 1 19  ? 131.540 -0.151  -3.650  1.00 0.00 ? 19  LEU A H    3  
ATOM 4655  H HA   . LEU A 1 19  ? 130.638 -0.658  -1.029  1.00 0.00 ? 19  LEU A HA   3  
ATOM 4656  H HB2  . LEU A 1 19  ? 129.476 -0.648  -3.304  1.00 0.00 ? 19  LEU A HB2  3  
ATOM 4657  H HB3  . LEU A 1 19  ? 130.043 -2.298  -3.423  1.00 0.00 ? 19  LEU A HB3  3  
ATOM 4658  H HG   . LEU A 1 19  ? 128.762 -2.908  -1.462  1.00 0.00 ? 19  LEU A HG   3  
ATOM 4659  H HD11 . LEU A 1 19  ? 128.995 -0.674  -0.325  1.00 0.00 ? 19  LEU A HD11 3  
ATOM 4660  H HD12 . LEU A 1 19  ? 127.343 -1.243  -0.307  1.00 0.00 ? 19  LEU A HD12 3  
ATOM 4661  H HD13 . LEU A 1 19  ? 127.843 -0.004  -1.466  1.00 0.00 ? 19  LEU A HD13 3  
ATOM 4662  H HD21 . LEU A 1 19  ? 127.731 -3.002  -3.673  1.00 0.00 ? 19  LEU A HD21 3  
ATOM 4663  H HD22 . LEU A 1 19  ? 127.271 -1.312  -3.537  1.00 0.00 ? 19  LEU A HD22 3  
ATOM 4664  H HD23 . LEU A 1 19  ? 126.532 -2.499  -2.471  1.00 0.00 ? 19  LEU A HD23 3  
ATOM 4665  N N    . SER A 1 20  ? 132.713 -2.827  -2.373  1.00 0.00 ? 20  SER A N    3  
ATOM 4666  C CA   . SER A 1 20  ? 133.555 -3.978  -2.049  1.00 0.00 ? 20  SER A CA   3  
ATOM 4667  C C    . SER A 1 20  ? 134.682 -3.561  -1.116  1.00 0.00 ? 20  SER A C    3  
ATOM 4668  O O    . SER A 1 20  ? 135.395 -4.391  -0.558  1.00 0.00 ? 20  SER A O    3  
ATOM 4669  C CB   . SER A 1 20  ? 134.122 -4.590  -3.313  1.00 0.00 ? 20  SER A CB   3  
ATOM 4670  O OG   . SER A 1 20  ? 133.080 -4.937  -4.219  1.00 0.00 ? 20  SER A OG   3  
ATOM 4671  H H    . SER A 1 20  ? 132.825 -2.381  -3.242  1.00 0.00 ? 20  SER A H    3  
ATOM 4672  H HA   . SER A 1 20  ? 132.940 -4.709  -1.545  1.00 0.00 ? 20  SER A HA   3  
ATOM 4673  H HB2  . SER A 1 20  ? 134.778 -3.878  -3.794  1.00 0.00 ? 20  SER A HB2  3  
ATOM 4674  H HB3  . SER A 1 20  ? 134.678 -5.483  -3.064  1.00 0.00 ? 20  SER A HB3  3  
ATOM 4675  H HG   . SER A 1 20  ? 132.240 -4.853  -3.738  1.00 0.00 ? 20  SER A HG   3  
ATOM 4676  N N    . HIS A 1 21  ? 134.811 -2.281  -0.943  1.00 0.00 ? 21  HIS A N    3  
ATOM 4677  C CA   . HIS A 1 21  ? 135.796 -1.713  -0.085  1.00 0.00 ? 21  HIS A CA   3  
ATOM 4678  C C    . HIS A 1 21  ? 135.190 -1.632  1.284   1.00 0.00 ? 21  HIS A C    3  
ATOM 4679  O O    . HIS A 1 21  ? 134.137 -1.040  1.428   1.00 0.00 ? 21  HIS A O    3  
ATOM 4680  C CB   . HIS A 1 21  ? 136.101 -0.301  -0.546  1.00 0.00 ? 21  HIS A CB   3  
ATOM 4681  C CG   . HIS A 1 21  ? 137.489 -0.046  -0.990  1.00 0.00 ? 21  HIS A CG   3  
ATOM 4682  N ND1  . HIS A 1 21  ? 138.455 0.415   -0.142  1.00 0.00 ? 21  HIS A ND1  3  
ATOM 4683  C CD2  . HIS A 1 21  ? 138.049 -0.065  -2.215  1.00 0.00 ? 21  HIS A CD2  3  
ATOM 4684  C CE1  . HIS A 1 21  ? 139.533 0.693   -0.809  1.00 0.00 ? 21  HIS A CE1  3  
ATOM 4685  N NE2  . HIS A 1 21  ? 139.320 0.404   -2.075  1.00 0.00 ? 21  HIS A NE2  3  
ATOM 4686  H H    . HIS A 1 21  ? 134.170 -1.688  -1.387  1.00 0.00 ? 21  HIS A H    3  
ATOM 4687  H HA   . HIS A 1 21  ? 136.701 -2.303  -0.090  1.00 0.00 ? 21  HIS A HA   3  
ATOM 4688  H HB2  . HIS A 1 21  ? 135.454 -0.061  -1.376  1.00 0.00 ? 21  HIS A HB2  3  
ATOM 4689  H HB3  . HIS A 1 21  ? 135.882 0.376   0.267   1.00 0.00 ? 21  HIS A HB3  3  
ATOM 4690  H HD1  . HIS A 1 21  ? 138.393 0.427   0.842   1.00 0.00 ? 21  HIS A HD1  3  
ATOM 4691  H HD2  . HIS A 1 21  ? 137.587 -0.378  -3.140  1.00 0.00 ? 21  HIS A HD2  3  
ATOM 4692  H HE1  . HIS A 1 21  ? 140.406 1.158   -0.373  1.00 0.00 ? 21  HIS A HE1  3  
ATOM 4693  H HE2  . HIS A 1 21  ? 139.862 0.748   -2.834  1.00 0.00 ? 21  HIS A HE2  3  
ATOM 4694  N N    . ARG A 1 22  ? 135.823 -2.214  2.274   1.00 0.00 ? 22  ARG A N    3  
ATOM 4695  C CA   . ARG A 1 22  ? 135.304 -2.167  3.641   1.00 0.00 ? 22  ARG A CA   3  
ATOM 4696  C C    . ARG A 1 22  ? 135.134 -0.716  4.102   1.00 0.00 ? 22  ARG A C    3  
ATOM 4697  O O    . ARG A 1 22  ? 134.118 -0.367  4.675   1.00 0.00 ? 22  ARG A O    3  
ATOM 4698  C CB   . ARG A 1 22  ? 136.208 -2.934  4.616   1.00 0.00 ? 22  ARG A CB   3  
ATOM 4699  C CG   . ARG A 1 22  ? 135.616 -3.060  6.015   1.00 0.00 ? 22  ARG A CG   3  
ATOM 4700  C CD   . ARG A 1 22  ? 134.314 -3.848  5.974   1.00 0.00 ? 22  ARG A CD   3  
ATOM 4701  N NE   . ARG A 1 22  ? 133.642 -3.911  7.275   1.00 0.00 ? 22  ARG A NE   3  
ATOM 4702  C CZ   . ARG A 1 22  ? 132.886 -4.942  7.697   1.00 0.00 ? 22  ARG A CZ   3  
ATOM 4703  N NH1  . ARG A 1 22  ? 132.638 -5.967  6.885   1.00 0.00 ? 22  ARG A NH1  3  
ATOM 4704  N NH2  . ARG A 1 22  ? 132.335 -4.920  8.902   1.00 0.00 ? 22  ARG A NH2  3  
ATOM 4705  H H    . ARG A 1 22  ? 136.646 -2.721  2.071   1.00 0.00 ? 22  ARG A H    3  
ATOM 4706  H HA   . ARG A 1 22  ? 134.323 -2.622  3.635   1.00 0.00 ? 22  ARG A HA   3  
ATOM 4707  H HB2  . ARG A 1 22  ? 136.380 -3.927  4.225   1.00 0.00 ? 22  ARG A HB2  3  
ATOM 4708  H HB3  . ARG A 1 22  ? 137.154 -2.417  4.692   1.00 0.00 ? 22  ARG A HB3  3  
ATOM 4709  H HG2  . ARG A 1 22  ? 136.320 -3.572  6.654   1.00 0.00 ? 22  ARG A HG2  3  
ATOM 4710  H HG3  . ARG A 1 22  ? 135.418 -2.072  6.404   1.00 0.00 ? 22  ARG A HG3  3  
ATOM 4711  H HD2  . ARG A 1 22  ? 133.649 -3.375  5.267   1.00 0.00 ? 22  ARG A HD2  3  
ATOM 4712  H HD3  . ARG A 1 22  ? 134.530 -4.852  5.641   1.00 0.00 ? 22  ARG A HD3  3  
ATOM 4713  H HE   . ARG A 1 22  ? 133.772 -3.115  7.850   1.00 0.00 ? 22  ARG A HE   3  
ATOM 4714  H HH11 . ARG A 1 22  ? 132.995 -6.004  5.944   1.00 0.00 ? 22  ARG A HH11 3  
ATOM 4715  H HH12 . ARG A 1 22  ? 132.086 -6.751  7.183   1.00 0.00 ? 22  ARG A HH12 3  
ATOM 4716  H HH21 . ARG A 1 22  ? 132.431 -4.156  9.552   1.00 0.00 ? 22  ARG A HH21 3  
ATOM 4717  H HH22 . ARG A 1 22  ? 131.787 -5.698  9.244   1.00 0.00 ? 22  ARG A HH22 3  
ATOM 4718  N N    . ASP A 1 23  ? 136.110 0.128   3.776   1.00 0.00 ? 23  ASP A N    3  
ATOM 4719  C CA   . ASP A 1 23  ? 136.060 1.559   4.142   1.00 0.00 ? 23  ASP A CA   3  
ATOM 4720  C C    . ASP A 1 23  ? 134.945 2.263   3.398   1.00 0.00 ? 23  ASP A C    3  
ATOM 4721  O O    . ASP A 1 23  ? 134.377 3.228   3.884   1.00 0.00 ? 23  ASP A O    3  
ATOM 4722  C CB   . ASP A 1 23  ? 137.382 2.300   3.830   1.00 0.00 ? 23  ASP A CB   3  
ATOM 4723  C CG   . ASP A 1 23  ? 138.568 1.850   4.644   1.00 0.00 ? 23  ASP A CG   3  
ATOM 4724  O OD1  . ASP A 1 23  ? 138.738 2.307   5.782   1.00 0.00 ? 23  ASP A OD1  3  
ATOM 4725  O OD2  . ASP A 1 23  ? 139.366 1.022   4.150   1.00 0.00 ? 23  ASP A OD2  3  
ATOM 4726  H H    . ASP A 1 23  ? 136.883 -0.232  3.284   1.00 0.00 ? 23  ASP A H    3  
ATOM 4727  H HA   . ASP A 1 23  ? 135.867 1.621   5.202   1.00 0.00 ? 23  ASP A HA   3  
ATOM 4728  H HB2  . ASP A 1 23  ? 137.628 2.148   2.789   1.00 0.00 ? 23  ASP A HB2  3  
ATOM 4729  H HB3  . ASP A 1 23  ? 137.231 3.356   3.996   1.00 0.00 ? 23  ASP A HB3  3  
ATOM 4730  N N    . GLY A 1 24  ? 134.618 1.759   2.227   1.00 0.00 ? 24  GLY A N    3  
ATOM 4731  C CA   . GLY A 1 24  ? 133.628 2.400   1.402   1.00 0.00 ? 24  GLY A CA   3  
ATOM 4732  C C    . GLY A 1 24  ? 132.261 1.966   1.744   1.00 0.00 ? 24  GLY A C    3  
ATOM 4733  O O    . GLY A 1 24  ? 131.354 2.782   1.827   1.00 0.00 ? 24  GLY A O    3  
ATOM 4734  H H    . GLY A 1 24  ? 135.024 0.914   1.947   1.00 0.00 ? 24  GLY A H    3  
ATOM 4735  H HA2  . GLY A 1 24  ? 133.694 3.468   1.544   1.00 0.00 ? 24  GLY A HA2  3  
ATOM 4736  H HA3  . GLY A 1 24  ? 133.813 2.180   0.367   1.00 0.00 ? 24  GLY A HA3  3  
ATOM 4737  N N    . LEU A 1 25  ? 132.109 0.680   1.940   1.00 0.00 ? 25  LEU A N    3  
ATOM 4738  C CA   . LEU A 1 25  ? 130.885 0.110   2.426   1.00 0.00 ? 25  LEU A CA   3  
ATOM 4739  C C    . LEU A 1 25  ? 130.514 0.773   3.729   1.00 0.00 ? 25  LEU A C    3  
ATOM 4740  O O    . LEU A 1 25  ? 129.361 1.080   3.966   1.00 0.00 ? 25  LEU A O    3  
ATOM 4741  C CB   . LEU A 1 25  ? 131.029 -1.435  2.545   1.00 0.00 ? 25  LEU A CB   3  
ATOM 4742  C CG   . LEU A 1 25  ? 130.318 -2.151  3.712   1.00 0.00 ? 25  LEU A CG   3  
ATOM 4743  C CD1  . LEU A 1 25  ? 130.010 -3.585  3.320   1.00 0.00 ? 25  LEU A CD1  3  
ATOM 4744  C CD2  . LEU A 1 25  ? 131.237 -2.172  4.945   1.00 0.00 ? 25  LEU A CD2  3  
ATOM 4745  H H    . LEU A 1 25  ? 132.857 0.078   1.722   1.00 0.00 ? 25  LEU A H    3  
ATOM 4746  H HA   . LEU A 1 25  ? 130.118 0.335   1.700   1.00 0.00 ? 25  LEU A HA   3  
ATOM 4747  H HB2  . LEU A 1 25  ? 130.658 -1.868  1.628   1.00 0.00 ? 25  LEU A HB2  3  
ATOM 4748  H HB3  . LEU A 1 25  ? 132.084 -1.656  2.611   1.00 0.00 ? 25  LEU A HB3  3  
ATOM 4749  H HG   . LEU A 1 25  ? 129.404 -1.638  3.975   1.00 0.00 ? 25  LEU A HG   3  
ATOM 4750  H HD11 . LEU A 1 25  ? 129.361 -3.589  2.456   1.00 0.00 ? 25  LEU A HD11 3  
ATOM 4751  H HD12 . LEU A 1 25  ? 129.518 -4.086  4.141   1.00 0.00 ? 25  LEU A HD12 3  
ATOM 4752  H HD13 . LEU A 1 25  ? 130.929 -4.099  3.080   1.00 0.00 ? 25  LEU A HD13 3  
ATOM 4753  H HD21 . LEU A 1 25  ? 130.758 -2.700  5.755   1.00 0.00 ? 25  LEU A HD21 3  
ATOM 4754  H HD22 . LEU A 1 25  ? 131.477 -1.163  5.258   1.00 0.00 ? 25  LEU A HD22 3  
ATOM 4755  H HD23 . LEU A 1 25  ? 132.157 -2.674  4.678   1.00 0.00 ? 25  LEU A HD23 3  
ATOM 4756  N N    . GLU A 1 26  ? 131.528 1.047   4.527   1.00 0.00 ? 26  GLU A N    3  
ATOM 4757  C CA   . GLU A 1 26  ? 131.371 1.711   5.778   1.00 0.00 ? 26  GLU A CA   3  
ATOM 4758  C C    . GLU A 1 26  ? 131.028 3.192   5.557   1.00 0.00 ? 26  GLU A C    3  
ATOM 4759  O O    . GLU A 1 26  ? 130.136 3.707   6.203   1.00 0.00 ? 26  GLU A O    3  
ATOM 4760  C CB   . GLU A 1 26  ? 132.633 1.519   6.610   1.00 0.00 ? 26  GLU A CB   3  
ATOM 4761  C CG   . GLU A 1 26  ? 132.603 2.097   8.020   1.00 0.00 ? 26  GLU A CG   3  
ATOM 4762  C CD   . GLU A 1 26  ? 131.530 1.492   8.897   1.00 0.00 ? 26  GLU A CD   3  
ATOM 4763  O OE1  . GLU A 1 26  ? 131.504 0.251   9.054   1.00 0.00 ? 26  GLU A OE1  3  
ATOM 4764  O OE2  . GLU A 1 26  ? 130.733 2.250   9.491   1.00 0.00 ? 26  GLU A OE2  3  
ATOM 4765  H H    . GLU A 1 26  ? 132.430 0.765   4.262   1.00 0.00 ? 26  GLU A H    3  
ATOM 4766  H HA   . GLU A 1 26  ? 130.542 1.244   6.290   1.00 0.00 ? 26  GLU A HA   3  
ATOM 4767  H HB2  . GLU A 1 26  ? 132.769 0.447   6.674   1.00 0.00 ? 26  GLU A HB2  3  
ATOM 4768  H HB3  . GLU A 1 26  ? 133.470 1.938   6.070   1.00 0.00 ? 26  GLU A HB3  3  
ATOM 4769  H HG2  . GLU A 1 26  ? 133.562 1.921   8.486   1.00 0.00 ? 26  GLU A HG2  3  
ATOM 4770  H HG3  . GLU A 1 26  ? 132.433 3.162   7.951   1.00 0.00 ? 26  GLU A HG3  3  
ATOM 4771  N N    . ALA A 1 27  ? 131.675 3.851   4.585   1.00 0.00 ? 27  ALA A N    3  
ATOM 4772  C CA   . ALA A 1 27  ? 131.372 5.267   4.321   1.00 0.00 ? 27  ALA A CA   3  
ATOM 4773  C C    . ALA A 1 27  ? 129.924 5.406   3.843   1.00 0.00 ? 27  ALA A C    3  
ATOM 4774  O O    . ALA A 1 27  ? 129.159 6.261   4.326   1.00 0.00 ? 27  ALA A O    3  
ATOM 4775  C CB   . ALA A 1 27  ? 132.334 5.872   3.280   1.00 0.00 ? 27  ALA A CB   3  
ATOM 4776  H H    . ALA A 1 27  ? 132.354 3.396   4.032   1.00 0.00 ? 27  ALA A H    3  
ATOM 4777  H HA   . ALA A 1 27  ? 131.478 5.802   5.254   1.00 0.00 ? 27  ALA A HA   3  
ATOM 4778  H HB1  . ALA A 1 27  ? 133.352 5.907   3.645   1.00 0.00 ? 27  ALA A HB1  3  
ATOM 4779  H HB2  . ALA A 1 27  ? 132.001 6.874   3.046   1.00 0.00 ? 27  ALA A HB2  3  
ATOM 4780  H HB3  . ALA A 1 27  ? 132.312 5.292   2.367   1.00 0.00 ? 27  ALA A HB3  3  
ATOM 4781  N N    . PHE A 1 28  ? 129.542 4.519   2.950   1.00 0.00 ? 28  PHE A N    3  
ATOM 4782  C CA   . PHE A 1 28  ? 128.230 4.537   2.358   1.00 0.00 ? 28  PHE A CA   3  
ATOM 4783  C C    . PHE A 1 28  ? 127.183 4.147   3.385   1.00 0.00 ? 28  PHE A C    3  
ATOM 4784  O O    . PHE A 1 28  ? 126.144 4.796   3.487   1.00 0.00 ? 28  PHE A O    3  
ATOM 4785  C CB   . PHE A 1 28  ? 128.166 3.611   1.131   1.00 0.00 ? 28  PHE A CB   3  
ATOM 4786  C CG   . PHE A 1 28  ? 126.883 3.722   0.352   1.00 0.00 ? 28  PHE A CG   3  
ATOM 4787  C CD1  . PHE A 1 28  ? 126.718 4.727   -0.582  1.00 0.00 ? 28  PHE A CD1  3  
ATOM 4788  C CD2  . PHE A 1 28  ? 125.844 2.832   0.557   1.00 0.00 ? 28  PHE A CD2  3  
ATOM 4789  C CE1  . PHE A 1 28  ? 125.546 4.842   -1.296  1.00 0.00 ? 28  PHE A CE1  3  
ATOM 4790  C CE2  . PHE A 1 28  ? 124.668 2.943   -0.153  1.00 0.00 ? 28  PHE A CE2  3  
ATOM 4791  C CZ   . PHE A 1 28  ? 124.521 3.951   -1.082  1.00 0.00 ? 28  PHE A CZ   3  
ATOM 4792  H H    . PHE A 1 28  ? 130.188 3.826   2.687   1.00 0.00 ? 28  PHE A H    3  
ATOM 4793  H HA   . PHE A 1 28  ? 128.032 5.549   2.037   1.00 0.00 ? 28  PHE A HA   3  
ATOM 4794  H HB2  . PHE A 1 28  ? 128.977 3.854   0.461   1.00 0.00 ? 28  PHE A HB2  3  
ATOM 4795  H HB3  . PHE A 1 28  ? 128.273 2.588   1.459   1.00 0.00 ? 28  PHE A HB3  3  
ATOM 4796  H HD1  . PHE A 1 28  ? 127.521 5.428   -0.752  1.00 0.00 ? 28  PHE A HD1  3  
ATOM 4797  H HD2  . PHE A 1 28  ? 125.960 2.041   1.284   1.00 0.00 ? 28  PHE A HD2  3  
ATOM 4798  H HE1  . PHE A 1 28  ? 125.434 5.632   -2.024  1.00 0.00 ? 28  PHE A HE1  3  
ATOM 4799  H HE2  . PHE A 1 28  ? 123.865 2.241   0.018   1.00 0.00 ? 28  PHE A HE2  3  
ATOM 4800  H HZ   . PHE A 1 28  ? 123.600 4.041   -1.640  1.00 0.00 ? 28  PHE A HZ   3  
ATOM 4801  N N    . THR A 1 29  ? 127.467 3.113   4.173   1.00 0.00 ? 29  THR A N    3  
ATOM 4802  C CA   . THR A 1 29  ? 126.522 2.681   5.170   1.00 0.00 ? 29  THR A CA   3  
ATOM 4803  C C    . THR A 1 29  ? 126.323 3.776   6.229   1.00 0.00 ? 29  THR A C    3  
ATOM 4804  O O    . THR A 1 29  ? 125.225 4.010   6.633   1.00 0.00 ? 29  THR A O    3  
ATOM 4805  C CB   . THR A 1 29  ? 126.858 1.279   5.820   1.00 0.00 ? 29  THR A CB   3  
ATOM 4806  O OG1  . THR A 1 29  ? 125.739 0.809   6.587   1.00 0.00 ? 29  THR A OG1  3  
ATOM 4807  C CG2  . THR A 1 29  ? 128.058 1.357   6.748   1.00 0.00 ? 29  THR A CG2  3  
ATOM 4808  H H    . THR A 1 29  ? 128.315 2.627   4.061   1.00 0.00 ? 29  THR A H    3  
ATOM 4809  H HA   . THR A 1 29  ? 125.579 2.601   4.646   1.00 0.00 ? 29  THR A HA   3  
ATOM 4810  H HB   . THR A 1 29  ? 127.064 0.573   5.029   1.00 0.00 ? 29  THR A HB   3  
ATOM 4811  H HG1  . THR A 1 29  ? 125.409 -0.038  6.249   1.00 0.00 ? 29  THR A HG1  3  
ATOM 4812  H HG21 . THR A 1 29  ? 128.922 1.688   6.190   1.00 0.00 ? 29  THR A HG21 3  
ATOM 4813  H HG22 . THR A 1 29  ? 128.254 0.381   7.168   1.00 0.00 ? 29  THR A HG22 3  
ATOM 4814  H HG23 . THR A 1 29  ? 127.852 2.058   7.543   1.00 0.00 ? 29  THR A HG23 3  
ATOM 4815  N N    . ARG A 1 30  ? 127.385 4.512   6.599   1.00 0.00 ? 30  ARG A N    3  
ATOM 4816  C CA   . ARG A 1 30  ? 127.251 5.595   7.594   1.00 0.00 ? 30  ARG A CA   3  
ATOM 4817  C C    . ARG A 1 30  ? 126.342 6.700   7.086   1.00 0.00 ? 30  ARG A C    3  
ATOM 4818  O O    . ARG A 1 30  ? 125.617 7.348   7.854   1.00 0.00 ? 30  ARG A O    3  
ATOM 4819  C CB   . ARG A 1 30  ? 128.604 6.165   7.996   1.00 0.00 ? 30  ARG A CB   3  
ATOM 4820  C CG   . ARG A 1 30  ? 129.474 5.160   8.700   1.00 0.00 ? 30  ARG A CG   3  
ATOM 4821  C CD   . ARG A 1 30  ? 130.778 5.756   9.165   1.00 0.00 ? 30  ARG A CD   3  
ATOM 4822  N NE   . ARG A 1 30  ? 131.589 4.765   9.866   1.00 0.00 ? 30  ARG A NE   3  
ATOM 4823  C CZ   . ARG A 1 30  ? 132.698 5.019   10.558  1.00 0.00 ? 30  ARG A CZ   3  
ATOM 4824  N NH1  . ARG A 1 30  ? 133.129 6.274   10.699  1.00 0.00 ? 30  ARG A NH1  3  
ATOM 4825  N NH2  . ARG A 1 30  ? 133.359 4.009   11.129  1.00 0.00 ? 30  ARG A NH2  3  
ATOM 4826  H H    . ARG A 1 30  ? 128.269 4.319   6.211   1.00 0.00 ? 30  ARG A H    3  
ATOM 4827  H HA   . ARG A 1 30  ? 126.782 5.159   8.465   1.00 0.00 ? 30  ARG A HA   3  
ATOM 4828  H HB2  . ARG A 1 30  ? 129.121 6.499   7.108   1.00 0.00 ? 30  ARG A HB2  3  
ATOM 4829  H HB3  . ARG A 1 30  ? 128.450 7.005   8.658   1.00 0.00 ? 30  ARG A HB3  3  
ATOM 4830  H HG2  . ARG A 1 30  ? 128.940 4.760   9.548   1.00 0.00 ? 30  ARG A HG2  3  
ATOM 4831  H HG3  . ARG A 1 30  ? 129.684 4.355   8.012   1.00 0.00 ? 30  ARG A HG3  3  
ATOM 4832  H HD2  . ARG A 1 30  ? 131.324 6.116   8.304   1.00 0.00 ? 30  ARG A HD2  3  
ATOM 4833  H HD3  . ARG A 1 30  ? 130.571 6.577   9.834   1.00 0.00 ? 30  ARG A HD3  3  
ATOM 4834  H HE   . ARG A 1 30  ? 131.256 3.836   9.765   1.00 0.00 ? 30  ARG A HE   3  
ATOM 4835  H HH11 . ARG A 1 30  ? 132.646 7.064   10.298  1.00 0.00 ? 30  ARG A HH11 3  
ATOM 4836  H HH12 . ARG A 1 30  ? 133.962 6.532   11.202  1.00 0.00 ? 30  ARG A HH12 3  
ATOM 4837  H HH21 . ARG A 1 30  ? 133.041 3.059   11.063  1.00 0.00 ? 30  ARG A HH21 3  
ATOM 4838  H HH22 . ARG A 1 30  ? 134.228 4.128   11.629  1.00 0.00 ? 30  ARG A HH22 3  
ATOM 4839  N N    . PHE A 1 31  ? 126.373 6.907   5.799   1.00 0.00 ? 31  PHE A N    3  
ATOM 4840  C CA   . PHE A 1 31  ? 125.514 7.864   5.168   1.00 0.00 ? 31  PHE A CA   3  
ATOM 4841  C C    . PHE A 1 31  ? 124.071 7.327   5.108   1.00 0.00 ? 31  PHE A C    3  
ATOM 4842  O O    . PHE A 1 31  ? 123.099 8.075   5.259   1.00 0.00 ? 31  PHE A O    3  
ATOM 4843  C CB   . PHE A 1 31  ? 126.049 8.173   3.769   1.00 0.00 ? 31  PHE A CB   3  
ATOM 4844  C CG   . PHE A 1 31  ? 125.184 9.089   2.986   1.00 0.00 ? 31  PHE A CG   3  
ATOM 4845  C CD1  . PHE A 1 31  ? 125.008 10.391  3.389   1.00 0.00 ? 31  PHE A CD1  3  
ATOM 4846  C CD2  . PHE A 1 31  ? 124.545 8.645   1.850   1.00 0.00 ? 31  PHE A CD2  3  
ATOM 4847  C CE1  . PHE A 1 31  ? 124.205 11.241  2.674   1.00 0.00 ? 31  PHE A CE1  3  
ATOM 4848  C CE2  . PHE A 1 31  ? 123.744 9.492   1.132   1.00 0.00 ? 31  PHE A CE2  3  
ATOM 4849  C CZ   . PHE A 1 31  ? 123.576 10.793  1.550   1.00 0.00 ? 31  PHE A CZ   3  
ATOM 4850  H H    . PHE A 1 31  ? 127.018 6.407   5.251   1.00 0.00 ? 31  PHE A H    3  
ATOM 4851  H HA   . PHE A 1 31  ? 125.530 8.770   5.756   1.00 0.00 ? 31  PHE A HA   3  
ATOM 4852  H HB2  . PHE A 1 31  ? 127.022 8.632   3.857   1.00 0.00 ? 31  PHE A HB2  3  
ATOM 4853  H HB3  . PHE A 1 31  ? 126.146 7.247   3.219   1.00 0.00 ? 31  PHE A HB3  3  
ATOM 4854  H HD1  . PHE A 1 31  ? 125.507 10.744  4.279   1.00 0.00 ? 31  PHE A HD1  3  
ATOM 4855  H HD2  . PHE A 1 31  ? 124.680 7.624   1.527   1.00 0.00 ? 31  PHE A HD2  3  
ATOM 4856  H HE1  . PHE A 1 31  ? 124.074 12.262  2.999   1.00 0.00 ? 31  PHE A HE1  3  
ATOM 4857  H HE2  . PHE A 1 31  ? 123.244 9.141   0.242   1.00 0.00 ? 31  PHE A HE2  3  
ATOM 4858  H HZ   . PHE A 1 31  ? 122.943 11.463  0.987   1.00 0.00 ? 31  PHE A HZ   3  
ATOM 4859  N N    . LEU A 1 32  ? 123.958 6.042   4.930   1.00 0.00 ? 32  LEU A N    3  
ATOM 4860  C CA   . LEU A 1 32  ? 122.690 5.374   4.774   1.00 0.00 ? 32  LEU A CA   3  
ATOM 4861  C C    . LEU A 1 32  ? 121.993 5.180   6.150   1.00 0.00 ? 32  LEU A C    3  
ATOM 4862  O O    . LEU A 1 32  ? 120.771 5.340   6.270   1.00 0.00 ? 32  LEU A O    3  
ATOM 4863  C CB   . LEU A 1 32  ? 122.952 4.020   4.102   1.00 0.00 ? 32  LEU A CB   3  
ATOM 4864  C CG   . LEU A 1 32  ? 121.855 3.458   3.215   1.00 0.00 ? 32  LEU A CG   3  
ATOM 4865  C CD1  . LEU A 1 32  ? 121.588 4.387   2.039   1.00 0.00 ? 32  LEU A CD1  3  
ATOM 4866  C CD2  . LEU A 1 32  ? 122.254 2.089   2.711   1.00 0.00 ? 32  LEU A CD2  3  
ATOM 4867  H H    . LEU A 1 32  ? 124.783 5.510   4.871   1.00 0.00 ? 32  LEU A H    3  
ATOM 4868  H HA   . LEU A 1 32  ? 122.061 5.965   4.125   1.00 0.00 ? 32  LEU A HA   3  
ATOM 4869  H HB2  . LEU A 1 32  ? 123.851 4.094   3.510   1.00 0.00 ? 32  LEU A HB2  3  
ATOM 4870  H HB3  . LEU A 1 32  ? 123.139 3.304   4.888   1.00 0.00 ? 32  LEU A HB3  3  
ATOM 4871  H HG   . LEU A 1 32  ? 120.944 3.355   3.785   1.00 0.00 ? 32  LEU A HG   3  
ATOM 4872  H HD11 . LEU A 1 32  ? 120.807 3.963   1.425   1.00 0.00 ? 32  LEU A HD11 3  
ATOM 4873  H HD12 . LEU A 1 32  ? 122.489 4.491   1.452   1.00 0.00 ? 32  LEU A HD12 3  
ATOM 4874  H HD13 . LEU A 1 32  ? 121.276 5.355   2.402   1.00 0.00 ? 32  LEU A HD13 3  
ATOM 4875  H HD21 . LEU A 1 32  ? 122.380 1.422   3.550   1.00 0.00 ? 32  LEU A HD21 3  
ATOM 4876  H HD22 . LEU A 1 32  ? 123.190 2.157   2.173   1.00 0.00 ? 32  LEU A HD22 3  
ATOM 4877  H HD23 . LEU A 1 32  ? 121.486 1.704   2.057   1.00 0.00 ? 32  LEU A HD23 3  
ATOM 4878  N N    . LYS A 1 33  ? 122.786 4.860   7.178   1.00 0.00 ? 33  LYS A N    3  
ATOM 4879  C CA   . LYS A 1 33  ? 122.297 4.610   8.547   1.00 0.00 ? 33  LYS A CA   3  
ATOM 4880  C C    . LYS A 1 33  ? 121.631 5.831   9.143   1.00 0.00 ? 33  LYS A C    3  
ATOM 4881  O O    . LYS A 1 33  ? 120.538 5.735   9.699   1.00 0.00 ? 33  LYS A O    3  
ATOM 4882  C CB   . LYS A 1 33  ? 123.428 4.149   9.486   1.00 0.00 ? 33  LYS A CB   3  
ATOM 4883  C CG   . LYS A 1 33  ? 124.105 2.843   9.102   1.00 0.00 ? 33  LYS A CG   3  
ATOM 4884  C CD   . LYS A 1 33  ? 125.209 2.499   10.081  1.00 0.00 ? 33  LYS A CD   3  
ATOM 4885  C CE   . LYS A 1 33  ? 126.032 1.298   9.636   1.00 0.00 ? 33  LYS A CE   3  
ATOM 4886  N NZ   . LYS A 1 33  ? 125.214 0.085   9.407   1.00 0.00 ? 33  LYS A NZ   3  
ATOM 4887  H H    . LYS A 1 33  ? 123.751 4.760   7.003   1.00 0.00 ? 33  LYS A H    3  
ATOM 4888  H HA   . LYS A 1 33  ? 121.563 3.819   8.487   1.00 0.00 ? 33  LYS A HA   3  
ATOM 4889  H HB2  . LYS A 1 33  ? 124.186 4.917   9.512   1.00 0.00 ? 33  LYS A HB2  3  
ATOM 4890  H HB3  . LYS A 1 33  ? 123.021 4.036   10.481  1.00 0.00 ? 33  LYS A HB3  3  
ATOM 4891  H HG2  . LYS A 1 33  ? 123.371 2.050   9.105   1.00 0.00 ? 33  LYS A HG2  3  
ATOM 4892  H HG3  . LYS A 1 33  ? 124.527 2.944   8.113   1.00 0.00 ? 33  LYS A HG3  3  
ATOM 4893  H HD2  . LYS A 1 33  ? 125.867 3.350   10.177  1.00 0.00 ? 33  LYS A HD2  3  
ATOM 4894  H HD3  . LYS A 1 33  ? 124.761 2.283   11.040  1.00 0.00 ? 33  LYS A HD3  3  
ATOM 4895  H HE2  . LYS A 1 33  ? 126.534 1.550   8.713   1.00 0.00 ? 33  LYS A HE2  3  
ATOM 4896  H HE3  . LYS A 1 33  ? 126.771 1.087   10.394  1.00 0.00 ? 33  LYS A HE3  3  
ATOM 4897  H HZ1  . LYS A 1 33  ? 124.551 -0.053  10.198  1.00 0.00 ? 33  LYS A HZ1  3  
ATOM 4898  H HZ2  . LYS A 1 33  ? 125.822 -0.758  9.395   1.00 0.00 ? 33  LYS A HZ2  3  
ATOM 4899  H HZ3  . LYS A 1 33  ? 124.683 0.089   8.508   1.00 0.00 ? 33  LYS A HZ3  3  
ATOM 4900  N N    . THR A 1 34  ? 122.264 6.985   9.003   1.00 0.00 ? 34  THR A N    3  
ATOM 4901  C CA   . THR A 1 34  ? 121.731 8.209   9.576   1.00 0.00 ? 34  THR A CA   3  
ATOM 4902  C C    . THR A 1 34  ? 120.320 8.532   9.046   1.00 0.00 ? 34  THR A C    3  
ATOM 4903  O O    . THR A 1 34  ? 119.491 9.090   9.763   1.00 0.00 ? 34  THR A O    3  
ATOM 4904  C CB   . THR A 1 34  ? 122.703 9.431   9.414   1.00 0.00 ? 34  THR A CB   3  
ATOM 4905  O OG1  . THR A 1 34  ? 122.120 10.618  9.979   1.00 0.00 ? 34  THR A OG1  3  
ATOM 4906  C CG2  . THR A 1 34  ? 123.046 9.688   7.963   1.00 0.00 ? 34  THR A CG2  3  
ATOM 4907  H H    . THR A 1 34  ? 123.120 7.006   8.524   1.00 0.00 ? 34  THR A H    3  
ATOM 4908  H HA   . THR A 1 34  ? 121.620 8.006   10.633  1.00 0.00 ? 34  THR A HA   3  
ATOM 4909  H HB   . THR A 1 34  ? 123.608 9.207   9.959   1.00 0.00 ? 34  THR A HB   3  
ATOM 4910  H HG1  . THR A 1 34  ? 122.703 11.377  9.813   1.00 0.00 ? 34  THR A HG1  3  
ATOM 4911  H HG21 . THR A 1 34  ? 123.530 8.817   7.548   1.00 0.00 ? 34  THR A HG21 3  
ATOM 4912  H HG22 . THR A 1 34  ? 123.709 10.538  7.894   1.00 0.00 ? 34  THR A HG22 3  
ATOM 4913  H HG23 . THR A 1 34  ? 122.140 9.892   7.411   1.00 0.00 ? 34  THR A HG23 3  
ATOM 4914  N N    . GLU A 1 35  ? 120.023 8.122   7.824   1.00 0.00 ? 35  GLU A N    3  
ATOM 4915  C CA   . GLU A 1 35  ? 118.722 8.387   7.272   1.00 0.00 ? 35  GLU A CA   3  
ATOM 4916  C C    . GLU A 1 35  ? 117.880 7.114   7.212   1.00 0.00 ? 35  GLU A C    3  
ATOM 4917  O O    . GLU A 1 35  ? 116.943 7.025   6.431   1.00 0.00 ? 35  GLU A O    3  
ATOM 4918  C CB   . GLU A 1 35  ? 118.822 9.050   5.906   1.00 0.00 ? 35  GLU A CB   3  
ATOM 4919  C CG   . GLU A 1 35  ? 119.466 8.228   4.815   1.00 0.00 ? 35  GLU A CG   3  
ATOM 4920  C CD   . GLU A 1 35  ? 119.380 8.936   3.495   1.00 0.00 ? 35  GLU A CD   3  
ATOM 4921  O OE1  . GLU A 1 35  ? 118.253 9.061   2.941   1.00 0.00 ? 35  GLU A OE1  3  
ATOM 4922  O OE2  . GLU A 1 35  ? 120.414 9.437   3.004   1.00 0.00 ? 35  GLU A OE2  3  
ATOM 4923  H H    . GLU A 1 35  ? 120.682 7.624   7.296   1.00 0.00 ? 35  GLU A H    3  
ATOM 4924  H HA   . GLU A 1 35  ? 118.232 9.068   7.952   1.00 0.00 ? 35  GLU A HA   3  
ATOM 4925  H HB2  . GLU A 1 35  ? 117.825 9.301   5.575   1.00 0.00 ? 35  GLU A HB2  3  
ATOM 4926  H HB3  . GLU A 1 35  ? 119.385 9.965   6.017   1.00 0.00 ? 35  GLU A HB3  3  
ATOM 4927  H HG2  . GLU A 1 35  ? 120.505 8.065   5.062   1.00 0.00 ? 35  GLU A HG2  3  
ATOM 4928  H HG3  . GLU A 1 35  ? 118.954 7.280   4.735   1.00 0.00 ? 35  GLU A HG3  3  
ATOM 4929  N N    . PHE A 1 36  ? 118.234 6.141   8.063   1.00 0.00 ? 36  PHE A N    3  
ATOM 4930  C CA   . PHE A 1 36  ? 117.527 4.840   8.251   1.00 0.00 ? 36  PHE A CA   3  
ATOM 4931  C C    . PHE A 1 36  ? 117.375 3.982   6.989   1.00 0.00 ? 36  PHE A C    3  
ATOM 4932  O O    . PHE A 1 36  ? 116.693 2.965   7.006   1.00 0.00 ? 36  PHE A O    3  
ATOM 4933  C CB   . PHE A 1 36  ? 116.185 4.951   9.065   1.00 0.00 ? 36  PHE A CB   3  
ATOM 4934  C CG   . PHE A 1 36  ? 115.136 5.897   8.526   1.00 0.00 ? 36  PHE A CG   3  
ATOM 4935  C CD1  . PHE A 1 36  ? 114.336 5.538   7.454   1.00 0.00 ? 36  PHE A CD1  3  
ATOM 4936  C CD2  . PHE A 1 36  ? 114.964 7.150   9.092   1.00 0.00 ? 36  PHE A CD2  3  
ATOM 4937  C CE1  . PHE A 1 36  ? 113.387 6.407   6.961   1.00 0.00 ? 36  PHE A CE1  3  
ATOM 4938  C CE2  . PHE A 1 36  ? 114.018 8.024   8.603   1.00 0.00 ? 36  PHE A CE2  3  
ATOM 4939  C CZ   . PHE A 1 36  ? 113.229 7.653   7.536   1.00 0.00 ? 36  PHE A CZ   3  
ATOM 4940  H H    . PHE A 1 36  ? 119.035 6.296   8.611   1.00 0.00 ? 36  PHE A H    3  
ATOM 4941  H HA   . PHE A 1 36  ? 118.221 4.278   8.862   1.00 0.00 ? 36  PHE A HA   3  
ATOM 4942  H HB2  . PHE A 1 36  ? 115.729 3.973   9.108   1.00 0.00 ? 36  PHE A HB2  3  
ATOM 4943  H HB3  . PHE A 1 36  ? 116.426 5.258   10.073  1.00 0.00 ? 36  PHE A HB3  3  
ATOM 4944  H HD1  . PHE A 1 36  ? 114.458 4.565   7.003   1.00 0.00 ? 36  PHE A HD1  3  
ATOM 4945  H HD2  . PHE A 1 36  ? 115.582 7.442   9.929   1.00 0.00 ? 36  PHE A HD2  3  
ATOM 4946  H HE1  . PHE A 1 36  ? 112.770 6.116   6.125   1.00 0.00 ? 36  PHE A HE1  3  
ATOM 4947  H HE2  . PHE A 1 36  ? 113.895 8.997   9.053   1.00 0.00 ? 36  PHE A HE2  3  
ATOM 4948  H HZ   . PHE A 1 36  ? 112.485 8.334   7.150   1.00 0.00 ? 36  PHE A HZ   3  
ATOM 4949  N N    . SER A 1 37  ? 118.095 4.321   5.942   1.00 0.00 ? 37  SER A N    3  
ATOM 4950  C CA   . SER A 1 37  ? 118.022 3.577   4.699   1.00 0.00 ? 37  SER A CA   3  
ATOM 4951  C C    . SER A 1 37  ? 118.998 2.392   4.743   1.00 0.00 ? 37  SER A C    3  
ATOM 4952  O O    . SER A 1 37  ? 119.089 1.597   3.790   1.00 0.00 ? 37  SER A O    3  
ATOM 4953  C CB   . SER A 1 37  ? 118.392 4.492   3.549   1.00 0.00 ? 37  SER A CB   3  
ATOM 4954  O OG   . SER A 1 37  ? 117.687 5.717   3.615   1.00 0.00 ? 37  SER A OG   3  
ATOM 4955  H H    . SER A 1 37  ? 118.697 5.095   5.995   1.00 0.00 ? 37  SER A H    3  
ATOM 4956  H HA   . SER A 1 37  ? 117.012 3.217   4.560   1.00 0.00 ? 37  SER A HA   3  
ATOM 4957  H HB2  . SER A 1 37  ? 119.450 4.699   3.585   1.00 0.00 ? 37  SER A HB2  3  
ATOM 4958  H HB3  . SER A 1 37  ? 118.154 4.004   2.615   1.00 0.00 ? 37  SER A HB3  3  
ATOM 4959  H HG   . SER A 1 37  ? 116.770 5.583   3.899   1.00 0.00 ? 37  SER A HG   3  
ATOM 4960  N N    . GLU A 1 38  ? 119.700 2.280   5.883   1.00 0.00 ? 38  GLU A N    3  
ATOM 4961  C CA   . GLU A 1 38  ? 120.728 1.259   6.167   1.00 0.00 ? 38  GLU A CA   3  
ATOM 4962  C C    . GLU A 1 38  ? 120.217 -0.173  5.948   1.00 0.00 ? 38  GLU A C    3  
ATOM 4963  O O    . GLU A 1 38  ? 120.993 -1.088  5.683   1.00 0.00 ? 38  GLU A O    3  
ATOM 4964  C CB   . GLU A 1 38  ? 121.229 1.433   7.604   1.00 0.00 ? 38  GLU A CB   3  
ATOM 4965  C CG   . GLU A 1 38  ? 120.122 1.420   8.659   1.00 0.00 ? 38  GLU A CG   3  
ATOM 4966  C CD   . GLU A 1 38  ? 120.643 1.594   10.070  1.00 0.00 ? 38  GLU A CD   3  
ATOM 4967  O OE1  . GLU A 1 38  ? 121.154 0.615   10.651  1.00 0.00 ? 38  GLU A OE1  3  
ATOM 4968  O OE2  . GLU A 1 38  ? 120.541 2.683   10.619  1.00 0.00 ? 38  GLU A OE2  3  
ATOM 4969  H H    . GLU A 1 38  ? 119.505 2.947   6.574   1.00 0.00 ? 38  GLU A H    3  
ATOM 4970  H HA   . GLU A 1 38  ? 121.557 1.447   5.497   1.00 0.00 ? 38  GLU A HA   3  
ATOM 4971  H HB2  . GLU A 1 38  ? 121.918 0.632   7.830   1.00 0.00 ? 38  GLU A HB2  3  
ATOM 4972  H HB3  . GLU A 1 38  ? 121.754 2.374   7.677   1.00 0.00 ? 38  GLU A HB3  3  
ATOM 4973  H HG2  . GLU A 1 38  ? 119.433 2.224   8.449   1.00 0.00 ? 38  GLU A HG2  3  
ATOM 4974  H HG3  . GLU A 1 38  ? 119.600 0.478   8.594   1.00 0.00 ? 38  GLU A HG3  3  
ATOM 4975  N N    . GLU A 1 39  ? 118.911 -0.325  6.030   1.00 0.00 ? 39  GLU A N    3  
ATOM 4976  C CA   . GLU A 1 39  ? 118.215 -1.584  5.821   1.00 0.00 ? 39  GLU A CA   3  
ATOM 4977  C C    . GLU A 1 39  ? 118.562 -2.224  4.476   1.00 0.00 ? 39  GLU A C    3  
ATOM 4978  O O    . GLU A 1 39  ? 118.622 -3.421  4.372   1.00 0.00 ? 39  GLU A O    3  
ATOM 4979  C CB   . GLU A 1 39  ? 116.707 -1.339  5.930   1.00 0.00 ? 39  GLU A CB   3  
ATOM 4980  C CG   . GLU A 1 39  ? 116.228 -0.151  5.101   1.00 0.00 ? 39  GLU A CG   3  
ATOM 4981  C CD   . GLU A 1 39  ? 114.774 0.160   5.292   1.00 0.00 ? 39  GLU A CD   3  
ATOM 4982  O OE1  . GLU A 1 39  ? 114.378 0.512   6.424   1.00 0.00 ? 39  GLU A OE1  3  
ATOM 4983  O OE2  . GLU A 1 39  ? 114.018 0.126   4.308   1.00 0.00 ? 39  GLU A OE2  3  
ATOM 4984  H H    . GLU A 1 39  ? 118.375 0.465   6.248   1.00 0.00 ? 39  GLU A H    3  
ATOM 4985  H HA   . GLU A 1 39  ? 118.501 -2.260  6.613   1.00 0.00 ? 39  GLU A HA   3  
ATOM 4986  H HB2  . GLU A 1 39  ? 116.184 -2.222  5.594   1.00 0.00 ? 39  GLU A HB2  3  
ATOM 4987  H HB3  . GLU A 1 39  ? 116.458 -1.154  6.965   1.00 0.00 ? 39  GLU A HB3  3  
ATOM 4988  H HG2  . GLU A 1 39  ? 116.801 0.719   5.385   1.00 0.00 ? 39  GLU A HG2  3  
ATOM 4989  H HG3  . GLU A 1 39  ? 116.405 -0.368  4.058   1.00 0.00 ? 39  GLU A HG3  3  
ATOM 4990  N N    . ASN A 1 40  ? 118.836 -1.400  3.485   1.00 0.00 ? 40  ASN A N    3  
ATOM 4991  C CA   . ASN A 1 40  ? 119.121 -1.870  2.128   1.00 0.00 ? 40  ASN A CA   3  
ATOM 4992  C C    . ASN A 1 40  ? 120.529 -2.479  2.020   1.00 0.00 ? 40  ASN A C    3  
ATOM 4993  O O    . ASN A 1 40  ? 120.724 -3.624  1.509   1.00 0.00 ? 40  ASN A O    3  
ATOM 4994  C CB   . ASN A 1 40  ? 118.972 -0.705  1.119   1.00 0.00 ? 40  ASN A CB   3  
ATOM 4995  C CG   . ASN A 1 40  ? 117.549 -0.167  0.998   1.00 0.00 ? 40  ASN A CG   3  
ATOM 4996  O OD1  . ASN A 1 40  ? 116.747 -0.645  0.185   1.00 0.00 ? 40  ASN A OD1  3  
ATOM 4997  N ND2  . ASN A 1 40  ? 117.241 0.851   1.766   1.00 0.00 ? 40  ASN A ND2  3  
ATOM 4998  H H    . ASN A 1 40  ? 118.847 -0.440  3.688   1.00 0.00 ? 40  ASN A H    3  
ATOM 4999  H HA   . ASN A 1 40  ? 118.394 -2.629  1.881   1.00 0.00 ? 40  ASN A HA   3  
ATOM 5000  H HB2  . ASN A 1 40  ? 119.603 0.108   1.445   1.00 0.00 ? 40  ASN A HB2  3  
ATOM 5001  H HB3  . ASN A 1 40  ? 119.304 -1.027  0.143   1.00 0.00 ? 40  ASN A HB3  3  
ATOM 5002  H HD21 . ASN A 1 40  ? 117.936 1.210   2.360   1.00 0.00 ? 40  ASN A HD21 3  
ATOM 5003  H HD22 . ASN A 1 40  ? 116.323 1.213   1.750   1.00 0.00 ? 40  ASN A HD22 3  
ATOM 5004  N N    . ILE A 1 41  ? 121.503 -1.759  2.531   1.00 0.00 ? 41  ILE A N    3  
ATOM 5005  C CA   . ILE A 1 41  ? 122.877 -2.184  2.405   1.00 0.00 ? 41  ILE A CA   3  
ATOM 5006  C C    . ILE A 1 41  ? 123.125 -3.423  3.267   1.00 0.00 ? 41  ILE A C    3  
ATOM 5007  O O    . ILE A 1 41  ? 123.695 -4.414  2.810   1.00 0.00 ? 41  ILE A O    3  
ATOM 5008  C CB   . ILE A 1 41  ? 123.879 -1.032  2.728   1.00 0.00 ? 41  ILE A CB   3  
ATOM 5009  C CG1  . ILE A 1 41  ? 125.271 -1.353  2.151   1.00 0.00 ? 41  ILE A CG1  3  
ATOM 5010  C CG2  . ILE A 1 41  ? 123.927 -0.687  4.243   1.00 0.00 ? 41  ILE A CG2  3  
ATOM 5011  C CD1  . ILE A 1 41  ? 126.281 -0.242  2.281   1.00 0.00 ? 41  ILE A CD1  3  
ATOM 5012  H H    . ILE A 1 41  ? 121.292 -0.929  3.006   1.00 0.00 ? 41  ILE A H    3  
ATOM 5013  H HA   . ILE A 1 41  ? 123.007 -2.482  1.374   1.00 0.00 ? 41  ILE A HA   3  
ATOM 5014  H HB   . ILE A 1 41  ? 123.500 -0.150  2.232   1.00 0.00 ? 41  ILE A HB   3  
ATOM 5015  H HG12 . ILE A 1 41  ? 125.697 -2.235  2.596   1.00 0.00 ? 41  ILE A HG12 3  
ATOM 5016  H HG13 . ILE A 1 41  ? 125.149 -1.544  1.096   1.00 0.00 ? 41  ILE A HG13 3  
ATOM 5017  H HG21 . ILE A 1 41  ? 124.751 -0.018  4.446   1.00 0.00 ? 41  ILE A HG21 3  
ATOM 5018  H HG22 . ILE A 1 41  ? 123.973 -1.549  4.909   1.00 0.00 ? 41  ILE A HG22 3  
ATOM 5019  H HG23 . ILE A 1 41  ? 123.018 -0.170  4.512   1.00 0.00 ? 41  ILE A HG23 3  
ATOM 5020  H HD11 . ILE A 1 41  ? 125.842 0.667   1.894   1.00 0.00 ? 41  ILE A HD11 3  
ATOM 5021  H HD12 . ILE A 1 41  ? 127.135 -0.496  1.666   1.00 0.00 ? 41  ILE A HD12 3  
ATOM 5022  H HD13 . ILE A 1 41  ? 126.564 -0.110  3.315   1.00 0.00 ? 41  ILE A HD13 3  
ATOM 5023  N N    . GLU A 1 42  ? 122.598 -3.396  4.476   1.00 0.00 ? 42  GLU A N    3  
ATOM 5024  C CA   . GLU A 1 42  ? 122.723 -4.493  5.382   1.00 0.00 ? 42  GLU A CA   3  
ATOM 5025  C C    . GLU A 1 42  ? 121.824 -5.671  4.955   1.00 0.00 ? 42  GLU A C    3  
ATOM 5026  O O    . GLU A 1 42  ? 122.033 -6.818  5.393   1.00 0.00 ? 42  GLU A O    3  
ATOM 5027  C CB   . GLU A 1 42  ? 122.433 -4.056  6.804   1.00 0.00 ? 42  GLU A CB   3  
ATOM 5028  C CG   . GLU A 1 42  ? 123.605 -3.433  7.608   1.00 0.00 ? 42  GLU A CG   3  
ATOM 5029  C CD   . GLU A 1 42  ? 124.282 -2.197  7.118   1.00 0.00 ? 42  GLU A CD   3  
ATOM 5030  O OE1  . GLU A 1 42  ? 123.767 -1.088  7.416   1.00 0.00 ? 42  GLU A OE1  3  
ATOM 5031  O OE2  . GLU A 1 42  ? 125.381 -2.281  6.550   1.00 0.00 ? 42  GLU A OE2  3  
ATOM 5032  H H    . GLU A 1 42  ? 122.117 -2.592  4.774   1.00 0.00 ? 42  GLU A H    3  
ATOM 5033  H HA   . GLU A 1 42  ? 123.750 -4.819  5.323   1.00 0.00 ? 42  GLU A HA   3  
ATOM 5034  H HB2  . GLU A 1 42  ? 121.641 -3.323  6.776   1.00 0.00 ? 42  GLU A HB2  3  
ATOM 5035  H HB3  . GLU A 1 42  ? 122.077 -4.917  7.352   1.00 0.00 ? 42  GLU A HB3  3  
ATOM 5036  H HG2  . GLU A 1 42  ? 123.066 -2.905  8.369   1.00 0.00 ? 42  GLU A HG2  3  
ATOM 5037  H HG3  . GLU A 1 42  ? 124.318 -4.153  7.982   1.00 0.00 ? 42  GLU A HG3  3  
ATOM 5038  N N    . PHE A 1 43  ? 120.826 -5.383  4.104   1.00 0.00 ? 43  PHE A N    3  
ATOM 5039  C CA   . PHE A 1 43  ? 119.974 -6.405  3.493   1.00 0.00 ? 43  PHE A CA   3  
ATOM 5040  C C    . PHE A 1 43  ? 120.822 -7.374  2.723   1.00 0.00 ? 43  PHE A C    3  
ATOM 5041  O O    . PHE A 1 43  ? 120.831 -8.578  3.010   1.00 0.00 ? 43  PHE A O    3  
ATOM 5042  C CB   . PHE A 1 43  ? 118.929 -5.760  2.558   1.00 0.00 ? 43  PHE A CB   3  
ATOM 5043  C CG   . PHE A 1 43  ? 118.276 -6.684  1.565   1.00 0.00 ? 43  PHE A CG   3  
ATOM 5044  C CD1  . PHE A 1 43  ? 117.193 -7.438  1.910   1.00 0.00 ? 43  PHE A CD1  3  
ATOM 5045  C CD2  . PHE A 1 43  ? 118.767 -6.776  0.267   1.00 0.00 ? 43  PHE A CD2  3  
ATOM 5046  C CE1  . PHE A 1 43  ? 116.598 -8.270  0.990   1.00 0.00 ? 43  PHE A CE1  3  
ATOM 5047  C CE2  . PHE A 1 43  ? 118.181 -7.605  -0.652  1.00 0.00 ? 43  PHE A CE2  3  
ATOM 5048  C CZ   . PHE A 1 43  ? 117.095 -8.350  -0.293  1.00 0.00 ? 43  PHE A CZ   3  
ATOM 5049  H H    . PHE A 1 43  ? 120.636 -4.446  3.883   1.00 0.00 ? 43  PHE A H    3  
ATOM 5050  H HA   . PHE A 1 43  ? 119.461 -6.933  4.284   1.00 0.00 ? 43  PHE A HA   3  
ATOM 5051  H HB2  . PHE A 1 43  ? 118.142 -5.331  3.160   1.00 0.00 ? 43  PHE A HB2  3  
ATOM 5052  H HB3  . PHE A 1 43  ? 119.411 -4.965  2.008   1.00 0.00 ? 43  PHE A HB3  3  
ATOM 5053  H HD1  . PHE A 1 43  ? 116.801 -7.379  2.915   1.00 0.00 ? 43  PHE A HD1  3  
ATOM 5054  H HD2  . PHE A 1 43  ? 119.623 -6.183  -0.016  1.00 0.00 ? 43  PHE A HD2  3  
ATOM 5055  H HE1  . PHE A 1 43  ? 115.727 -8.840  1.273   1.00 0.00 ? 43  PHE A HE1  3  
ATOM 5056  H HE2  . PHE A 1 43  ? 118.573 -7.665  -1.657  1.00 0.00 ? 43  PHE A HE2  3  
ATOM 5057  H HZ   . PHE A 1 43  ? 116.630 -9.001  -1.018  1.00 0.00 ? 43  PHE A HZ   3  
ATOM 5058  N N    . TRP A 1 44  ? 121.577 -6.880  1.755   1.00 0.00 ? 44  TRP A N    3  
ATOM 5059  C CA   . TRP A 1 44  ? 122.387 -7.827  1.025   1.00 0.00 ? 44  TRP A CA   3  
ATOM 5060  C C    . TRP A 1 44  ? 123.636 -8.247  1.765   1.00 0.00 ? 44  TRP A C    3  
ATOM 5061  O O    . TRP A 1 44  ? 124.302 -9.195  1.377   1.00 0.00 ? 44  TRP A O    3  
ATOM 5062  C CB   . TRP A 1 44  ? 122.599 -7.537  -0.464  1.00 0.00 ? 44  TRP A CB   3  
ATOM 5063  C CG   . TRP A 1 44  ? 123.099 -6.193  -0.816  1.00 0.00 ? 44  TRP A CG   3  
ATOM 5064  C CD1  . TRP A 1 44  ? 122.465 -5.294  -1.605  1.00 0.00 ? 44  TRP A CD1  3  
ATOM 5065  C CD2  . TRP A 1 44  ? 124.326 -5.586  -0.413  1.00 0.00 ? 44  TRP A CD2  3  
ATOM 5066  N NE1  . TRP A 1 44  ? 123.220 -4.178  -1.738  1.00 0.00 ? 44  TRP A NE1  3  
ATOM 5067  C CE2  . TRP A 1 44  ? 124.365 -4.327  -0.993  1.00 0.00 ? 44  TRP A CE2  3  
ATOM 5068  C CE3  . TRP A 1 44  ? 125.396 -5.989  0.392   1.00 0.00 ? 44  TRP A CE3  3  
ATOM 5069  C CZ2  . TRP A 1 44  ? 125.420 -3.470  -0.798  1.00 0.00 ? 44  TRP A CZ2  3  
ATOM 5070  C CZ3  . TRP A 1 44  ? 126.443 -5.137  0.583   1.00 0.00 ? 44  TRP A CZ3  3  
ATOM 5071  C CH2  . TRP A 1 44  ? 126.451 -3.891  -0.005  1.00 0.00 ? 44  TRP A CH2  3  
ATOM 5072  H H    . TRP A 1 44  ? 121.553 -5.910  1.559   1.00 0.00 ? 44  TRP A H    3  
ATOM 5073  H HA   . TRP A 1 44  ? 121.775 -8.717  1.101   1.00 0.00 ? 44  TRP A HA   3  
ATOM 5074  H HB2  . TRP A 1 44  ? 123.315 -8.246  -0.851  1.00 0.00 ? 44  TRP A HB2  3  
ATOM 5075  H HB3  . TRP A 1 44  ? 121.660 -7.691  -0.975  1.00 0.00 ? 44  TRP A HB3  3  
ATOM 5076  H HD1  . TRP A 1 44  ? 121.508 -5.467  -2.075  1.00 0.00 ? 44  TRP A HD1  3  
ATOM 5077  H HE1  . TRP A 1 44  ? 122.965 -3.397  -2.274  1.00 0.00 ? 44  TRP A HE1  3  
ATOM 5078  H HE3  . TRP A 1 44  ? 125.403 -6.963  0.858   1.00 0.00 ? 44  TRP A HE3  3  
ATOM 5079  H HZ2  . TRP A 1 44  ? 125.447 -2.488  -1.248  1.00 0.00 ? 44  TRP A HZ2  3  
ATOM 5080  H HZ3  . TRP A 1 44  ? 127.276 -5.431  1.204   1.00 0.00 ? 44  TRP A HZ3  3  
ATOM 5081  H HH2  . TRP A 1 44  ? 127.298 -3.245  0.170   1.00 0.00 ? 44  TRP A HH2  3  
ATOM 5082  N N    . ILE A 1 45  ? 123.951 -7.546  2.841   1.00 0.00 ? 45  ILE A N    3  
ATOM 5083  C CA   . ILE A 1 45  ? 124.997 -7.988  3.737   1.00 0.00 ? 45  ILE A CA   3  
ATOM 5084  C C    . ILE A 1 45  ? 124.544 -9.275  4.415   1.00 0.00 ? 45  ILE A C    3  
ATOM 5085  O O    . ILE A 1 45  ? 125.340 -10.186 4.643   1.00 0.00 ? 45  ILE A O    3  
ATOM 5086  C CB   . ILE A 1 45  ? 125.396 -6.894  4.768   1.00 0.00 ? 45  ILE A CB   3  
ATOM 5087  C CG1  . ILE A 1 45  ? 126.244 -5.820  4.071   1.00 0.00 ? 45  ILE A CG1  3  
ATOM 5088  C CG2  . ILE A 1 45  ? 126.115 -7.477  5.983   1.00 0.00 ? 45  ILE A CG2  3  
ATOM 5089  C CD1  . ILE A 1 45  ? 126.698 -4.693  4.964   1.00 0.00 ? 45  ILE A CD1  3  
ATOM 5090  H H    . ILE A 1 45  ? 123.487 -6.698  3.010   1.00 0.00 ? 45  ILE A H    3  
ATOM 5091  H HA   . ILE A 1 45  ? 125.850 -8.230  3.118   1.00 0.00 ? 45  ILE A HA   3  
ATOM 5092  H HB   . ILE A 1 45  ? 124.487 -6.429  5.120   1.00 0.00 ? 45  ILE A HB   3  
ATOM 5093  H HG12 . ILE A 1 45  ? 127.127 -6.283  3.659   1.00 0.00 ? 45  ILE A HG12 3  
ATOM 5094  H HG13 . ILE A 1 45  ? 125.667 -5.396  3.262   1.00 0.00 ? 45  ILE A HG13 3  
ATOM 5095  H HG21 . ILE A 1 45  ? 126.339 -6.688  6.686   1.00 0.00 ? 45  ILE A HG21 3  
ATOM 5096  H HG22 . ILE A 1 45  ? 127.033 -7.949  5.663   1.00 0.00 ? 45  ILE A HG22 3  
ATOM 5097  H HG23 . ILE A 1 45  ? 125.476 -8.213  6.451   1.00 0.00 ? 45  ILE A HG23 3  
ATOM 5098  H HD11 . ILE A 1 45  ? 125.835 -4.183  5.367   1.00 0.00 ? 45  ILE A HD11 3  
ATOM 5099  H HD12 . ILE A 1 45  ? 127.292 -3.996  4.390   1.00 0.00 ? 45  ILE A HD12 3  
ATOM 5100  H HD13 . ILE A 1 45  ? 127.289 -5.092  5.774   1.00 0.00 ? 45  ILE A HD13 3  
ATOM 5101  N N    . ALA A 1 46  ? 123.247 -9.364  4.675   1.00 0.00 ? 46  ALA A N    3  
ATOM 5102  C CA   . ALA A 1 46  ? 122.662 -10.569 5.211   1.00 0.00 ? 46  ALA A CA   3  
ATOM 5103  C C    . ALA A 1 46  ? 122.717 -11.660 4.150   1.00 0.00 ? 46  ALA A C    3  
ATOM 5104  O O    . ALA A 1 46  ? 122.934 -12.820 4.469   1.00 0.00 ? 46  ALA A O    3  
ATOM 5105  C CB   . ALA A 1 46  ? 121.222 -10.337 5.650   1.00 0.00 ? 46  ALA A CB   3  
ATOM 5106  H H    . ALA A 1 46  ? 122.674 -8.582  4.514   1.00 0.00 ? 46  ALA A H    3  
ATOM 5107  H HA   . ALA A 1 46  ? 123.254 -10.857 6.068   1.00 0.00 ? 46  ALA A HA   3  
ATOM 5108  H HB1  . ALA A 1 46  ? 120.663 -9.923  4.824   1.00 0.00 ? 46  ALA A HB1  3  
ATOM 5109  H HB2  . ALA A 1 46  ? 121.186 -9.666  6.495   1.00 0.00 ? 46  ALA A HB2  3  
ATOM 5110  H HB3  . ALA A 1 46  ? 120.782 -11.289 5.914   1.00 0.00 ? 46  ALA A HB3  3  
ATOM 5111  N N    . CYS A 1 47  ? 122.535 -11.267 2.890   1.00 0.00 ? 47  CYS A N    3  
ATOM 5112  C CA   . CYS A 1 47  ? 122.603 -12.196 1.757   1.00 0.00 ? 47  CYS A CA   3  
ATOM 5113  C C    . CYS A 1 47  ? 124.030 -12.714 1.555   1.00 0.00 ? 47  CYS A C    3  
ATOM 5114  O O    . CYS A 1 47  ? 124.241 -13.901 1.316   1.00 0.00 ? 47  CYS A O    3  
ATOM 5115  C CB   . CYS A 1 47  ? 122.091 -11.540 0.465   1.00 0.00 ? 47  CYS A CB   3  
ATOM 5116  S SG   . CYS A 1 47  ? 122.135 -12.616 -0.994  1.00 0.00 ? 47  CYS A SG   3  
ATOM 5117  H H    . CYS A 1 47  ? 122.320 -10.323 2.732   1.00 0.00 ? 47  CYS A H    3  
ATOM 5118  H HA   . CYS A 1 47  ? 121.971 -13.039 1.995   1.00 0.00 ? 47  CYS A HA   3  
ATOM 5119  H HB2  . CYS A 1 47  ? 121.065 -11.234 0.610   1.00 0.00 ? 47  CYS A HB2  3  
ATOM 5120  H HB3  . CYS A 1 47  ? 122.693 -10.668 0.254   1.00 0.00 ? 47  CYS A HB3  3  
ATOM 5121  H HG   . CYS A 1 47  ? 123.398 -12.826 -1.358  1.00 0.00 ? 47  CYS A HG   3  
ATOM 5122  N N    . GLU A 1 48  ? 125.012 -11.841 1.664   1.00 0.00 ? 48  GLU A N    3  
ATOM 5123  C CA   . GLU A 1 48  ? 126.377 -12.278 1.518   1.00 0.00 ? 48  GLU A CA   3  
ATOM 5124  C C    . GLU A 1 48  ? 126.814 -13.084 2.748   1.00 0.00 ? 48  GLU A C    3  
ATOM 5125  O O    . GLU A 1 48  ? 127.585 -14.026 2.642   1.00 0.00 ? 48  GLU A O    3  
ATOM 5126  C CB   . GLU A 1 48  ? 127.327 -11.117 1.116   1.00 0.00 ? 48  GLU A CB   3  
ATOM 5127  C CG   . GLU A 1 48  ? 127.449 -9.964  2.102   1.00 0.00 ? 48  GLU A CG   3  
ATOM 5128  C CD   . GLU A 1 48  ? 128.717 -10.024 2.922   1.00 0.00 ? 48  GLU A CD   3  
ATOM 5129  O OE1  . GLU A 1 48  ? 128.943 -11.023 3.637   1.00 0.00 ? 48  GLU A OE1  3  
ATOM 5130  O OE2  . GLU A 1 48  ? 129.513 -9.076  2.873   1.00 0.00 ? 48  GLU A OE2  3  
ATOM 5131  H H    . GLU A 1 48  ? 124.812 -10.889 1.810   1.00 0.00 ? 48  GLU A H    3  
ATOM 5132  H HA   . GLU A 1 48  ? 126.338 -12.995 0.710   1.00 0.00 ? 48  GLU A HA   3  
ATOM 5133  H HB2  . GLU A 1 48  ? 128.316 -11.532 0.986   1.00 0.00 ? 48  GLU A HB2  3  
ATOM 5134  H HB3  . GLU A 1 48  ? 126.997 -10.734 0.161   1.00 0.00 ? 48  GLU A HB3  3  
ATOM 5135  H HG2  . GLU A 1 48  ? 127.443 -9.036  1.550   1.00 0.00 ? 48  GLU A HG2  3  
ATOM 5136  H HG3  . GLU A 1 48  ? 126.601 -9.990  2.770   1.00 0.00 ? 48  GLU A HG3  3  
ATOM 5137  N N    . ASP A 1 49  ? 126.257 -12.749 3.900   1.00 0.00 ? 49  ASP A N    3  
ATOM 5138  C CA   . ASP A 1 49  ? 126.454 -13.532 5.133   1.00 0.00 ? 49  ASP A CA   3  
ATOM 5139  C C    . ASP A 1 49  ? 125.850 -14.915 4.940   1.00 0.00 ? 49  ASP A C    3  
ATOM 5140  O O    . ASP A 1 49  ? 126.321 -15.921 5.476   1.00 0.00 ? 49  ASP A O    3  
ATOM 5141  C CB   . ASP A 1 49  ? 125.747 -12.836 6.299   1.00 0.00 ? 49  ASP A CB   3  
ATOM 5142  C CG   . ASP A 1 49  ? 125.790 -13.612 7.594   1.00 0.00 ? 49  ASP A CG   3  
ATOM 5143  O OD1  . ASP A 1 49  ? 124.918 -14.484 7.812   1.00 0.00 ? 49  ASP A OD1  3  
ATOM 5144  O OD2  . ASP A 1 49  ? 126.660 -13.333 8.445   1.00 0.00 ? 49  ASP A OD2  3  
ATOM 5145  H H    . ASP A 1 49  ? 125.718 -11.928 3.934   1.00 0.00 ? 49  ASP A H    3  
ATOM 5146  H HA   . ASP A 1 49  ? 127.510 -13.611 5.340   1.00 0.00 ? 49  ASP A HA   3  
ATOM 5147  H HB2  . ASP A 1 49  ? 126.211 -11.876 6.470   1.00 0.00 ? 49  ASP A HB2  3  
ATOM 5148  H HB3  . ASP A 1 49  ? 124.713 -12.679 6.029   1.00 0.00 ? 49  ASP A HB3  3  
ATOM 5149  N N    . PHE A 1 50  ? 124.822 -14.936 4.152   1.00 0.00 ? 50  PHE A N    3  
ATOM 5150  C CA   . PHE A 1 50  ? 124.081 -16.113 3.829   1.00 0.00 ? 50  PHE A CA   3  
ATOM 5151  C C    . PHE A 1 50  ? 124.874 -17.017 2.881   1.00 0.00 ? 50  PHE A C    3  
ATOM 5152  O O    . PHE A 1 50  ? 124.933 -18.220 3.095   1.00 0.00 ? 50  PHE A O    3  
ATOM 5153  C CB   . PHE A 1 50  ? 122.722 -15.689 3.267   1.00 0.00 ? 50  PHE A CB   3  
ATOM 5154  C CG   . PHE A 1 50  ? 121.821 -16.771 2.832   1.00 0.00 ? 50  PHE A CG   3  
ATOM 5155  C CD1  . PHE A 1 50  ? 121.004 -17.398 3.735   1.00 0.00 ? 50  PHE A CD1  3  
ATOM 5156  C CD2  . PHE A 1 50  ? 121.773 -17.146 1.506   1.00 0.00 ? 50  PHE A CD2  3  
ATOM 5157  C CE1  . PHE A 1 50  ? 120.158 -18.390 3.327   1.00 0.00 ? 50  PHE A CE1  3  
ATOM 5158  C CE2  . PHE A 1 50  ? 120.928 -18.130 1.094   1.00 0.00 ? 50  PHE A CE2  3  
ATOM 5159  C CZ   . PHE A 1 50  ? 120.119 -18.754 2.002   1.00 0.00 ? 50  PHE A CZ   3  
ATOM 5160  H H    . PHE A 1 50  ? 124.529 -14.086 3.760   1.00 0.00 ? 50  PHE A H    3  
ATOM 5161  H HA   . PHE A 1 50  ? 123.933 -16.645 4.752   1.00 0.00 ? 50  PHE A HA   3  
ATOM 5162  H HB2  . PHE A 1 50  ? 122.196 -15.127 4.024   1.00 0.00 ? 50  PHE A HB2  3  
ATOM 5163  H HB3  . PHE A 1 50  ? 122.896 -15.037 2.423   1.00 0.00 ? 50  PHE A HB3  3  
ATOM 5164  H HD1  . PHE A 1 50  ? 121.036 -17.100 4.773   1.00 0.00 ? 50  PHE A HD1  3  
ATOM 5165  H HD2  . PHE A 1 50  ? 122.417 -16.653 0.793   1.00 0.00 ? 50  PHE A HD2  3  
ATOM 5166  H HE1  . PHE A 1 50  ? 119.518 -18.884 4.043   1.00 0.00 ? 50  PHE A HE1  3  
ATOM 5167  H HE2  . PHE A 1 50  ? 120.896 -18.416 0.052   1.00 0.00 ? 50  PHE A HE2  3  
ATOM 5168  H HZ   . PHE A 1 50  ? 119.448 -19.534 1.677   1.00 0.00 ? 50  PHE A HZ   3  
ATOM 5169  N N    . LYS A 1 51  ? 125.522 -16.431 1.864   1.00 0.00 ? 51  LYS A N    3  
ATOM 5170  C CA   . LYS A 1 51  ? 126.369 -17.222 0.953   1.00 0.00 ? 51  LYS A CA   3  
ATOM 5171  C C    . LYS A 1 51  ? 127.617 -17.735 1.692   1.00 0.00 ? 51  LYS A C    3  
ATOM 5172  O O    . LYS A 1 51  ? 128.327 -18.615 1.204   1.00 0.00 ? 51  LYS A O    3  
ATOM 5173  C CB   . LYS A 1 51  ? 126.777 -16.442 -0.331  1.00 0.00 ? 51  LYS A CB   3  
ATOM 5174  C CG   . LYS A 1 51  ? 127.639 -15.214 -0.077  1.00 0.00 ? 51  LYS A CG   3  
ATOM 5175  C CD   . LYS A 1 51  ? 128.133 -14.529 -1.350  1.00 0.00 ? 51  LYS A CD   3  
ATOM 5176  C CE   . LYS A 1 51  ? 129.072 -15.425 -2.147  1.00 0.00 ? 51  LYS A CE   3  
ATOM 5177  N NZ   . LYS A 1 51  ? 129.710 -14.707 -3.274  1.00 0.00 ? 51  LYS A NZ   3  
ATOM 5178  H H    . LYS A 1 51  ? 125.388 -15.470 1.707   1.00 0.00 ? 51  LYS A H    3  
ATOM 5179  H HA   . LYS A 1 51  ? 125.785 -18.089 0.674   1.00 0.00 ? 51  LYS A HA   3  
ATOM 5180  H HB2  . LYS A 1 51  ? 127.329 -17.106 -0.979  1.00 0.00 ? 51  LYS A HB2  3  
ATOM 5181  H HB3  . LYS A 1 51  ? 125.880 -16.127 -0.843  1.00 0.00 ? 51  LYS A HB3  3  
ATOM 5182  H HG2  . LYS A 1 51  ? 127.061 -14.498 0.489   1.00 0.00 ? 51  LYS A HG2  3  
ATOM 5183  H HG3  . LYS A 1 51  ? 128.493 -15.516 0.513   1.00 0.00 ? 51  LYS A HG3  3  
ATOM 5184  H HD2  . LYS A 1 51  ? 127.283 -14.281 -1.967  1.00 0.00 ? 51  LYS A HD2  3  
ATOM 5185  H HD3  . LYS A 1 51  ? 128.655 -13.623 -1.077  1.00 0.00 ? 51  LYS A HD3  3  
ATOM 5186  H HE2  . LYS A 1 51  ? 129.843 -15.793 -1.487  1.00 0.00 ? 51  LYS A HE2  3  
ATOM 5187  H HE3  . LYS A 1 51  ? 128.505 -16.258 -2.535  1.00 0.00 ? 51  LYS A HE3  3  
ATOM 5188  H HZ1  . LYS A 1 51  ? 130.273 -15.377 -3.845  1.00 0.00 ? 51  LYS A HZ1  3  
ATOM 5189  H HZ2  . LYS A 1 51  ? 130.380 -14.002 -2.895  1.00 0.00 ? 51  LYS A HZ2  3  
ATOM 5190  H HZ3  . LYS A 1 51  ? 129.018 -14.232 -3.896  1.00 0.00 ? 51  LYS A HZ3  3  
ATOM 5191  N N    . LYS A 1 52  ? 127.896 -17.145 2.857   1.00 0.00 ? 52  LYS A N    3  
ATOM 5192  C CA   . LYS A 1 52  ? 128.987 -17.593 3.731   1.00 0.00 ? 52  LYS A CA   3  
ATOM 5193  C C    . LYS A 1 52  ? 128.606 -18.853 4.508   1.00 0.00 ? 52  LYS A C    3  
ATOM 5194  O O    . LYS A 1 52  ? 129.467 -19.520 5.084   1.00 0.00 ? 52  LYS A O    3  
ATOM 5195  C CB   . LYS A 1 52  ? 129.401 -16.480 4.693   1.00 0.00 ? 52  LYS A CB   3  
ATOM 5196  C CG   . LYS A 1 52  ? 129.918 -15.276 3.964   1.00 0.00 ? 52  LYS A CG   3  
ATOM 5197  C CD   . LYS A 1 52  ? 130.187 -14.081 4.863   1.00 0.00 ? 52  LYS A CD   3  
ATOM 5198  C CE   . LYS A 1 52  ? 131.307 -14.304 5.849   1.00 0.00 ? 52  LYS A CE   3  
ATOM 5199  N NZ   . LYS A 1 52  ? 131.602 -13.053 6.572   1.00 0.00 ? 52  LYS A NZ   3  
ATOM 5200  H H    . LYS A 1 52  ? 127.370 -16.351 3.106   1.00 0.00 ? 52  LYS A H    3  
ATOM 5201  H HA   . LYS A 1 52  ? 129.827 -17.832 3.096   1.00 0.00 ? 52  LYS A HA   3  
ATOM 5202  H HB2  . LYS A 1 52  ? 128.540 -16.183 5.276   1.00 0.00 ? 52  LYS A HB2  3  
ATOM 5203  H HB3  . LYS A 1 52  ? 130.184 -16.848 5.342   1.00 0.00 ? 52  LYS A HB3  3  
ATOM 5204  H HG2  . LYS A 1 52  ? 130.816 -15.557 3.444   1.00 0.00 ? 52  LYS A HG2  3  
ATOM 5205  H HG3  . LYS A 1 52  ? 129.175 -14.998 3.229   1.00 0.00 ? 52  LYS A HG3  3  
ATOM 5206  H HD2  . LYS A 1 52  ? 130.446 -13.235 4.245   1.00 0.00 ? 52  LYS A HD2  3  
ATOM 5207  H HD3  . LYS A 1 52  ? 129.282 -13.852 5.407   1.00 0.00 ? 52  LYS A HD3  3  
ATOM 5208  H HE2  . LYS A 1 52  ? 131.000 -15.063 6.553   1.00 0.00 ? 52  LYS A HE2  3  
ATOM 5209  H HE3  . LYS A 1 52  ? 132.189 -14.626 5.316   1.00 0.00 ? 52  LYS A HE3  3  
ATOM 5210  H HZ1  . LYS A 1 52  ? 130.747 -12.700 7.057   1.00 0.00 ? 52  LYS A HZ1  3  
ATOM 5211  H HZ2  . LYS A 1 52  ? 131.908 -12.300 5.921   1.00 0.00 ? 52  LYS A HZ2  3  
ATOM 5212  H HZ3  . LYS A 1 52  ? 132.344 -13.174 7.295   1.00 0.00 ? 52  LYS A HZ3  3  
ATOM 5213  N N    . SER A 1 53  ? 127.333 -19.157 4.542   1.00 0.00 ? 53  SER A N    3  
ATOM 5214  C CA   . SER A 1 53  ? 126.861 -20.350 5.159   1.00 0.00 ? 53  SER A CA   3  
ATOM 5215  C C    . SER A 1 53  ? 126.853 -21.456 4.120   1.00 0.00 ? 53  SER A C    3  
ATOM 5216  O O    . SER A 1 53  ? 126.265 -21.315 3.061   1.00 0.00 ? 53  SER A O    3  
ATOM 5217  C CB   . SER A 1 53  ? 125.455 -20.118 5.711   1.00 0.00 ? 53  SER A CB   3  
ATOM 5218  O OG   . SER A 1 53  ? 125.461 -19.056 6.656   1.00 0.00 ? 53  SER A OG   3  
ATOM 5219  H H    . SER A 1 53  ? 126.652 -18.584 4.127   1.00 0.00 ? 53  SER A H    3  
ATOM 5220  H HA   . SER A 1 53  ? 127.525 -20.613 5.971   1.00 0.00 ? 53  SER A HA   3  
ATOM 5221  H HB2  . SER A 1 53  ? 124.788 -19.862 4.901   1.00 0.00 ? 53  SER A HB2  3  
ATOM 5222  H HB3  . SER A 1 53  ? 125.106 -21.017 6.197   1.00 0.00 ? 53  SER A HB3  3  
ATOM 5223  H HG   . SER A 1 53  ? 126.022 -19.388 7.377   1.00 0.00 ? 53  SER A HG   3  
ATOM 5224  N N    . LYS A 1 54  ? 127.532 -22.524 4.392   1.00 0.00 ? 54  LYS A N    3  
ATOM 5225  C CA   . LYS A 1 54  ? 127.565 -23.631 3.466   1.00 0.00 ? 54  LYS A CA   3  
ATOM 5226  C C    . LYS A 1 54  ? 126.744 -24.795 3.981   1.00 0.00 ? 54  LYS A C    3  
ATOM 5227  O O    . LYS A 1 54  ? 126.832 -25.916 3.482   1.00 0.00 ? 54  LYS A O    3  
ATOM 5228  C CB   . LYS A 1 54  ? 129.021 -24.011 3.086   1.00 0.00 ? 54  LYS A CB   3  
ATOM 5229  C CG   . LYS A 1 54  ? 130.012 -24.243 4.233   1.00 0.00 ? 54  LYS A CG   3  
ATOM 5230  C CD   . LYS A 1 54  ? 129.722 -25.504 5.028   1.00 0.00 ? 54  LYS A CD   3  
ATOM 5231  C CE   . LYS A 1 54  ? 130.795 -25.753 6.063   1.00 0.00 ? 54  LYS A CE   3  
ATOM 5232  N NZ   . LYS A 1 54  ? 132.127 -25.882 5.438   1.00 0.00 ? 54  LYS A NZ   3  
ATOM 5233  H H    . LYS A 1 54  ? 128.038 -22.585 5.236   1.00 0.00 ? 54  LYS A H    3  
ATOM 5234  H HA   . LYS A 1 54  ? 127.062 -23.277 2.578   1.00 0.00 ? 54  LYS A HA   3  
ATOM 5235  H HB2  . LYS A 1 54  ? 128.990 -24.922 2.507   1.00 0.00 ? 54  LYS A HB2  3  
ATOM 5236  H HB3  . LYS A 1 54  ? 129.415 -23.227 2.455   1.00 0.00 ? 54  LYS A HB3  3  
ATOM 5237  H HG2  . LYS A 1 54  ? 131.006 -24.323 3.820   1.00 0.00 ? 54  LYS A HG2  3  
ATOM 5238  H HG3  . LYS A 1 54  ? 129.971 -23.391 4.895   1.00 0.00 ? 54  LYS A HG3  3  
ATOM 5239  H HD2  . LYS A 1 54  ? 128.770 -25.395 5.526   1.00 0.00 ? 54  LYS A HD2  3  
ATOM 5240  H HD3  . LYS A 1 54  ? 129.683 -26.344 4.351   1.00 0.00 ? 54  LYS A HD3  3  
ATOM 5241  H HE2  . LYS A 1 54  ? 130.809 -24.927 6.757   1.00 0.00 ? 54  LYS A HE2  3  
ATOM 5242  H HE3  . LYS A 1 54  ? 130.561 -26.666 6.591   1.00 0.00 ? 54  LYS A HE3  3  
ATOM 5243  H HZ1  . LYS A 1 54  ? 132.850 -26.142 6.143   1.00 0.00 ? 54  LYS A HZ1  3  
ATOM 5244  H HZ2  . LYS A 1 54  ? 132.431 -24.973 5.025   1.00 0.00 ? 54  LYS A HZ2  3  
ATOM 5245  H HZ3  . LYS A 1 54  ? 132.142 -26.575 4.659   1.00 0.00 ? 54  LYS A HZ3  3  
ATOM 5246  N N    . GLY A 1 55  ? 125.913 -24.502 4.948   1.00 0.00 ? 55  GLY A N    3  
ATOM 5247  C CA   . GLY A 1 55  ? 125.070 -25.496 5.525   1.00 0.00 ? 55  GLY A CA   3  
ATOM 5248  C C    . GLY A 1 55  ? 123.674 -25.355 4.989   1.00 0.00 ? 55  GLY A C    3  
ATOM 5249  O O    . GLY A 1 55  ? 123.004 -24.363 5.286   1.00 0.00 ? 55  GLY A O    3  
ATOM 5250  H H    . GLY A 1 55  ? 125.830 -23.571 5.245   1.00 0.00 ? 55  GLY A H    3  
ATOM 5251  H HA2  . GLY A 1 55  ? 125.458 -26.475 5.284   1.00 0.00 ? 55  GLY A HA2  3  
ATOM 5252  H HA3  . GLY A 1 55  ? 125.046 -25.368 6.598   1.00 0.00 ? 55  GLY A HA3  3  
ATOM 5253  N N    . PRO A 1 56  ? 123.203 -26.324 4.192   1.00 0.00 ? 56  PRO A N    3  
ATOM 5254  C CA   . PRO A 1 56  ? 121.895 -26.258 3.539   1.00 0.00 ? 56  PRO A CA   3  
ATOM 5255  C C    . PRO A 1 56  ? 120.706 -26.204 4.512   1.00 0.00 ? 56  PRO A C    3  
ATOM 5256  O O    . PRO A 1 56  ? 119.659 -25.654 4.172   1.00 0.00 ? 56  PRO A O    3  
ATOM 5257  C CB   . PRO A 1 56  ? 121.846 -27.497 2.641   1.00 0.00 ? 56  PRO A CB   3  
ATOM 5258  C CG   . PRO A 1 56  ? 123.264 -27.959 2.549   1.00 0.00 ? 56  PRO A CG   3  
ATOM 5259  C CD   . PRO A 1 56  ? 123.914 -27.562 3.839   1.00 0.00 ? 56  PRO A CD   3  
ATOM 5260  H HA   . PRO A 1 56  ? 121.853 -25.373 2.920   1.00 0.00 ? 56  PRO A HA   3  
ATOM 5261  H HB2  . PRO A 1 56  ? 121.199 -28.246 3.072   1.00 0.00 ? 56  PRO A HB2  3  
ATOM 5262  H HB3  . PRO A 1 56  ? 121.476 -27.194 1.672   1.00 0.00 ? 56  PRO A HB3  3  
ATOM 5263  H HG2  . PRO A 1 56  ? 123.293 -29.033 2.430   1.00 0.00 ? 56  PRO A HG2  3  
ATOM 5264  H HG3  . PRO A 1 56  ? 123.756 -27.476 1.717   1.00 0.00 ? 56  PRO A HG3  3  
ATOM 5265  H HD2  . PRO A 1 56  ? 123.758 -28.321 4.591   1.00 0.00 ? 56  PRO A HD2  3  
ATOM 5266  H HD3  . PRO A 1 56  ? 124.967 -27.374 3.695   1.00 0.00 ? 56  PRO A HD3  3  
ATOM 5267  N N    . GLN A 1 57  ? 120.872 -26.725 5.728   1.00 0.00 ? 57  GLN A N    3  
ATOM 5268  C CA   . GLN A 1 57  ? 119.801 -26.645 6.727   1.00 0.00 ? 57  GLN A CA   3  
ATOM 5269  C C    . GLN A 1 57  ? 119.635 -25.205 7.160   1.00 0.00 ? 57  GLN A C    3  
ATOM 5270  O O    . GLN A 1 57  ? 118.511 -24.692 7.255   1.00 0.00 ? 57  GLN A O    3  
ATOM 5271  C CB   . GLN A 1 57  ? 120.061 -27.527 7.953   1.00 0.00 ? 57  GLN A CB   3  
ATOM 5272  C CG   . GLN A 1 57  ? 120.169 -29.013 7.664   1.00 0.00 ? 57  GLN A CG   3  
ATOM 5273  C CD   . GLN A 1 57  ? 118.950 -29.573 6.952   1.00 0.00 ? 57  GLN A CD   3  
ATOM 5274  O OE1  . GLN A 1 57  ? 117.979 -29.993 7.587   1.00 0.00 ? 57  GLN A OE1  3  
ATOM 5275  N NE2  . GLN A 1 57  ? 119.013 -29.647 5.652   1.00 0.00 ? 57  GLN A NE2  3  
ATOM 5276  H H    . GLN A 1 57  ? 121.730 -27.149 5.948   1.00 0.00 ? 57  GLN A H    3  
ATOM 5277  H HA   . GLN A 1 57  ? 118.886 -26.958 6.241   1.00 0.00 ? 57  GLN A HA   3  
ATOM 5278  H HB2  . GLN A 1 57  ? 120.985 -27.211 8.414   1.00 0.00 ? 57  GLN A HB2  3  
ATOM 5279  H HB3  . GLN A 1 57  ? 119.257 -27.374 8.657   1.00 0.00 ? 57  GLN A HB3  3  
ATOM 5280  H HG2  . GLN A 1 57  ? 121.036 -29.182 7.041   1.00 0.00 ? 57  GLN A HG2  3  
ATOM 5281  H HG3  . GLN A 1 57  ? 120.295 -29.537 8.601   1.00 0.00 ? 57  GLN A HG3  3  
ATOM 5282  H HE21 . GLN A 1 57  ? 119.852 -29.343 5.230   1.00 0.00 ? 57  GLN A HE21 3  
ATOM 5283  H HE22 . GLN A 1 57  ? 118.259 -30.003 5.130   1.00 0.00 ? 57  GLN A HE22 3  
ATOM 5284  N N    . GLN A 1 58  ? 120.773 -24.535 7.370   1.00 0.00 ? 58  GLN A N    3  
ATOM 5285  C CA   . GLN A 1 58  ? 120.783 -23.120 7.722   1.00 0.00 ? 58  GLN A CA   3  
ATOM 5286  C C    . GLN A 1 58  ? 120.162 -22.308 6.646   1.00 0.00 ? 58  GLN A C    3  
ATOM 5287  O O    . GLN A 1 58  ? 119.510 -21.333 6.926   1.00 0.00 ? 58  GLN A O    3  
ATOM 5288  C CB   . GLN A 1 58  ? 122.186 -22.581 7.956   1.00 0.00 ? 58  GLN A CB   3  
ATOM 5289  C CG   . GLN A 1 58  ? 122.834 -23.032 9.222   1.00 0.00 ? 58  GLN A CG   3  
ATOM 5290  C CD   . GLN A 1 58  ? 122.038 -22.654 10.457  1.00 0.00 ? 58  GLN A CD   3  
ATOM 5291  O OE1  . GLN A 1 58  ? 121.351 -21.632 10.482  1.00 0.00 ? 58  GLN A OE1  3  
ATOM 5292  N NE2  . GLN A 1 58  ? 122.109 -23.468 11.471  1.00 0.00 ? 58  GLN A NE2  3  
ATOM 5293  H H    . GLN A 1 58  ? 121.622 -25.023 7.281   1.00 0.00 ? 58  GLN A H    3  
ATOM 5294  H HA   . GLN A 1 58  ? 120.212 -22.997 8.630   1.00 0.00 ? 58  GLN A HA   3  
ATOM 5295  H HB2  . GLN A 1 58  ? 122.815 -22.894 7.136   1.00 0.00 ? 58  GLN A HB2  3  
ATOM 5296  H HB3  . GLN A 1 58  ? 122.141 -21.502 7.962   1.00 0.00 ? 58  GLN A HB3  3  
ATOM 5297  H HG2  . GLN A 1 58  ? 123.029 -24.093 9.207   1.00 0.00 ? 58  GLN A HG2  3  
ATOM 5298  H HG3  . GLN A 1 58  ? 123.754 -22.466 9.243   1.00 0.00 ? 58  GLN A HG3  3  
ATOM 5299  H HE21 . GLN A 1 58  ? 122.661 -24.281 11.388  1.00 0.00 ? 58  GLN A HE21 3  
ATOM 5300  H HE22 . GLN A 1 58  ? 121.607 -23.240 12.286  1.00 0.00 ? 58  GLN A HE22 3  
ATOM 5301  N N    . ILE A 1 59  ? 120.370 -22.726 5.412   1.00 0.00 ? 59  ILE A N    3  
ATOM 5302  C CA   . ILE A 1 59  ? 119.845 -22.030 4.258   1.00 0.00 ? 59  ILE A CA   3  
ATOM 5303  C C    . ILE A 1 59  ? 118.342 -21.840 4.389   1.00 0.00 ? 59  ILE A C    3  
ATOM 5304  O O    . ILE A 1 59  ? 117.854 -20.749 4.202   1.00 0.00 ? 59  ILE A O    3  
ATOM 5305  C CB   . ILE A 1 59  ? 120.174 -22.758 2.931   1.00 0.00 ? 59  ILE A CB   3  
ATOM 5306  C CG1  . ILE A 1 59  ? 121.692 -22.981 2.783   1.00 0.00 ? 59  ILE A CG1  3  
ATOM 5307  C CG2  . ILE A 1 59  ? 119.612 -22.003 1.746   1.00 0.00 ? 59  ILE A CG2  3  
ATOM 5308  C CD1  . ILE A 1 59  ? 122.554 -21.750 2.919   1.00 0.00 ? 59  ILE A CD1  3  
ATOM 5309  H H    . ILE A 1 59  ? 120.916 -23.531 5.285   1.00 0.00 ? 59  ILE A H    3  
ATOM 5310  H HA   . ILE A 1 59  ? 120.307 -21.053 4.239   1.00 0.00 ? 59  ILE A HA   3  
ATOM 5311  H HB   . ILE A 1 59  ? 119.688 -23.722 2.961   1.00 0.00 ? 59  ILE A HB   3  
ATOM 5312  H HG12 . ILE A 1 59  ? 122.014 -23.657 3.562   1.00 0.00 ? 59  ILE A HG12 3  
ATOM 5313  H HG13 . ILE A 1 59  ? 121.890 -23.426 1.819   1.00 0.00 ? 59  ILE A HG13 3  
ATOM 5314  H HG21 . ILE A 1 59  ? 120.052 -21.017 1.713   1.00 0.00 ? 59  ILE A HG21 3  
ATOM 5315  H HG22 . ILE A 1 59  ? 118.547 -21.886 1.894   1.00 0.00 ? 59  ILE A HG22 3  
ATOM 5316  H HG23 . ILE A 1 59  ? 119.811 -22.529 0.824   1.00 0.00 ? 59  ILE A HG23 3  
ATOM 5317  H HD11 . ILE A 1 59  ? 122.330 -21.262 3.856   1.00 0.00 ? 59  ILE A HD11 3  
ATOM 5318  H HD12 . ILE A 1 59  ? 122.397 -21.078 2.088   1.00 0.00 ? 59  ILE A HD12 3  
ATOM 5319  H HD13 . ILE A 1 59  ? 123.583 -22.084 2.941   1.00 0.00 ? 59  ILE A HD13 3  
ATOM 5320  N N    . HIS A 1 60  ? 117.633 -22.902 4.774   1.00 0.00 ? 60  HIS A N    3  
ATOM 5321  C CA   . HIS A 1 60  ? 116.167 -22.827 4.983   1.00 0.00 ? 60  HIS A CA   3  
ATOM 5322  C C    . HIS A 1 60  ? 115.840 -21.750 6.006   1.00 0.00 ? 60  HIS A C    3  
ATOM 5323  O O    . HIS A 1 60  ? 115.093 -20.824 5.730   1.00 0.00 ? 60  HIS A O    3  
ATOM 5324  C CB   . HIS A 1 60  ? 115.577 -24.152 5.508   1.00 0.00 ? 60  HIS A CB   3  
ATOM 5325  C CG   . HIS A 1 60  ? 115.675 -25.335 4.601   1.00 0.00 ? 60  HIS A CG   3  
ATOM 5326  N ND1  . HIS A 1 60  ? 114.594 -25.875 3.949   1.00 0.00 ? 60  HIS A ND1  3  
ATOM 5327  C CD2  . HIS A 1 60  ? 116.716 -26.125 4.298   1.00 0.00 ? 60  HIS A CD2  3  
ATOM 5328  C CE1  . HIS A 1 60  ? 114.975 -26.942 3.288   1.00 0.00 ? 60  HIS A CE1  3  
ATOM 5329  N NE2  . HIS A 1 60  ? 116.258 -27.113 3.487   1.00 0.00 ? 60  HIS A NE2  3  
ATOM 5330  H H    . HIS A 1 60  ? 118.131 -23.733 4.921   1.00 0.00 ? 60  HIS A H    3  
ATOM 5331  H HA   . HIS A 1 60  ? 115.697 -22.574 4.044   1.00 0.00 ? 60  HIS A HA   3  
ATOM 5332  H HB2  . HIS A 1 60  ? 116.086 -24.418 6.423   1.00 0.00 ? 60  HIS A HB2  3  
ATOM 5333  H HB3  . HIS A 1 60  ? 114.534 -23.992 5.736   1.00 0.00 ? 60  HIS A HB3  3  
ATOM 5334  H HD1  . HIS A 1 60  ? 113.663 -25.551 3.992   1.00 0.00 ? 60  HIS A HD1  3  
ATOM 5335  H HD2  . HIS A 1 60  ? 117.733 -25.999 4.642   1.00 0.00 ? 60  HIS A HD2  3  
ATOM 5336  H HE1  . HIS A 1 60  ? 114.339 -27.571 2.683   1.00 0.00 ? 60  HIS A HE1  3  
ATOM 5337  H HE2  . HIS A 1 60  ? 116.863 -27.646 2.910   1.00 0.00 ? 60  HIS A HE2  3  
ATOM 5338  N N    . LEU A 1 61  ? 116.471 -21.875 7.155   1.00 0.00 ? 61  LEU A N    3  
ATOM 5339  C CA   . LEU A 1 61  ? 116.249 -21.019 8.312   1.00 0.00 ? 61  LEU A CA   3  
ATOM 5340  C C    . LEU A 1 61  ? 116.610 -19.580 8.013   1.00 0.00 ? 61  LEU A C    3  
ATOM 5341  O O    . LEU A 1 61  ? 115.766 -18.680 8.088   1.00 0.00 ? 61  LEU A O    3  
ATOM 5342  C CB   . LEU A 1 61  ? 117.152 -21.489 9.426   1.00 0.00 ? 61  LEU A CB   3  
ATOM 5343  C CG   . LEU A 1 61  ? 117.094 -22.957 9.754   1.00 0.00 ? 61  LEU A CG   3  
ATOM 5344  C CD1  . LEU A 1 61  ? 118.223 -23.284 10.682  1.00 0.00 ? 61  LEU A CD1  3  
ATOM 5345  C CD2  . LEU A 1 61  ? 115.760 -23.308 10.377  1.00 0.00 ? 61  LEU A CD2  3  
ATOM 5346  H H    . LEU A 1 61  ? 117.141 -22.588 7.227   1.00 0.00 ? 61  LEU A H    3  
ATOM 5347  H HA   . LEU A 1 61  ? 115.227 -21.101 8.647   1.00 0.00 ? 61  LEU A HA   3  
ATOM 5348  H HB2  . LEU A 1 61  ? 118.169 -21.248 9.156   1.00 0.00 ? 61  LEU A HB2  3  
ATOM 5349  H HB3  . LEU A 1 61  ? 116.896 -20.936 10.318  1.00 0.00 ? 61  LEU A HB3  3  
ATOM 5350  H HG   . LEU A 1 61  ? 117.218 -23.534 8.848   1.00 0.00 ? 61  LEU A HG   3  
ATOM 5351  H HD11 . LEU A 1 61  ? 118.262 -24.346 10.875  1.00 0.00 ? 61  LEU A HD11 3  
ATOM 5352  H HD12 . LEU A 1 61  ? 118.090 -22.737 11.603  1.00 0.00 ? 61  LEU A HD12 3  
ATOM 5353  H HD13 . LEU A 1 61  ? 119.130 -22.959 10.192  1.00 0.00 ? 61  LEU A HD13 3  
ATOM 5354  H HD21 . LEU A 1 61  ? 114.973 -23.055 9.684   1.00 0.00 ? 61  LEU A HD21 3  
ATOM 5355  H HD22 . LEU A 1 61  ? 115.633 -22.745 11.289  1.00 0.00 ? 61  LEU A HD22 3  
ATOM 5356  H HD23 . LEU A 1 61  ? 115.725 -24.366 10.593  1.00 0.00 ? 61  LEU A HD23 3  
ATOM 5357  N N    . LYS A 1 62  ? 117.869 -19.386 7.689   1.00 0.00 ? 62  LYS A N    3  
ATOM 5358  C CA   . LYS A 1 62  ? 118.435 -18.079 7.420   1.00 0.00 ? 62  LYS A CA   3  
ATOM 5359  C C    . LYS A 1 62  ? 117.711 -17.357 6.281   1.00 0.00 ? 62  LYS A C    3  
ATOM 5360  O O    . LYS A 1 62  ? 117.398 -16.176 6.408   1.00 0.00 ? 62  LYS A O    3  
ATOM 5361  C CB   . LYS A 1 62  ? 119.958 -18.166 7.159   1.00 0.00 ? 62  LYS A CB   3  
ATOM 5362  C CG   . LYS A 1 62  ? 120.772 -18.733 8.339   1.00 0.00 ? 62  LYS A CG   3  
ATOM 5363  C CD   . LYS A 1 62  ? 122.279 -18.620 8.123   1.00 0.00 ? 62  LYS A CD   3  
ATOM 5364  C CE   . LYS A 1 62  ? 122.739 -17.170 8.031   1.00 0.00 ? 62  LYS A CE   3  
ATOM 5365  N NZ   . LYS A 1 62  ? 124.216 -17.068 7.985   1.00 0.00 ? 62  LYS A NZ   3  
ATOM 5366  H H    . LYS A 1 62  ? 118.436 -20.193 7.646   1.00 0.00 ? 62  LYS A H    3  
ATOM 5367  H HA   . LYS A 1 62  ? 118.282 -17.495 8.316   1.00 0.00 ? 62  LYS A HA   3  
ATOM 5368  H HB2  . LYS A 1 62  ? 120.113 -18.815 6.310   1.00 0.00 ? 62  LYS A HB2  3  
ATOM 5369  H HB3  . LYS A 1 62  ? 120.339 -17.186 6.914   1.00 0.00 ? 62  LYS A HB3  3  
ATOM 5370  H HG2  . LYS A 1 62  ? 120.524 -18.208 9.249   1.00 0.00 ? 62  LYS A HG2  3  
ATOM 5371  H HG3  . LYS A 1 62  ? 120.545 -19.783 8.468   1.00 0.00 ? 62  LYS A HG3  3  
ATOM 5372  H HD2  . LYS A 1 62  ? 122.786 -19.094 8.949   1.00 0.00 ? 62  LYS A HD2  3  
ATOM 5373  H HD3  . LYS A 1 62  ? 122.535 -19.129 7.205   1.00 0.00 ? 62  LYS A HD3  3  
ATOM 5374  H HE2  . LYS A 1 62  ? 122.328 -16.729 7.135   1.00 0.00 ? 62  LYS A HE2  3  
ATOM 5375  H HE3  . LYS A 1 62  ? 122.374 -16.635 8.896   1.00 0.00 ? 62  LYS A HE3  3  
ATOM 5376  H HZ1  . LYS A 1 62  ? 124.613 -17.628 7.200   1.00 0.00 ? 62  LYS A HZ1  3  
ATOM 5377  H HZ2  . LYS A 1 62  ? 124.616 -17.463 8.864   1.00 0.00 ? 62  LYS A HZ2  3  
ATOM 5378  H HZ3  . LYS A 1 62  ? 124.535 -16.076 7.889   1.00 0.00 ? 62  LYS A HZ3  3  
ATOM 5379  N N    . ALA A 1 63  ? 117.407 -18.067 5.193   1.00 0.00 ? 63  ALA A N    3  
ATOM 5380  C CA   . ALA A 1 63  ? 116.712 -17.450 4.065   1.00 0.00 ? 63  ALA A CA   3  
ATOM 5381  C C    . ALA A 1 63  ? 115.319 -17.039 4.467   1.00 0.00 ? 63  ALA A C    3  
ATOM 5382  O O    . ALA A 1 63  ? 114.906 -15.919 4.213   1.00 0.00 ? 63  ALA A O    3  
ATOM 5383  C CB   . ALA A 1 63  ? 116.650 -18.372 2.855   1.00 0.00 ? 63  ALA A CB   3  
ATOM 5384  H H    . ALA A 1 63  ? 117.649 -19.019 5.136   1.00 0.00 ? 63  ALA A H    3  
ATOM 5385  H HA   . ALA A 1 63  ? 117.265 -16.562 3.793   1.00 0.00 ? 63  ALA A HA   3  
ATOM 5386  H HB1  . ALA A 1 63  ? 117.635 -18.734 2.590   1.00 0.00 ? 63  ALA A HB1  3  
ATOM 5387  H HB2  . ALA A 1 63  ? 116.230 -17.852 2.003   1.00 0.00 ? 63  ALA A HB2  3  
ATOM 5388  H HB3  . ALA A 1 63  ? 116.021 -19.212 3.112   1.00 0.00 ? 63  ALA A HB3  3  
ATOM 5389  N N    . LYS A 1 64  ? 114.617 -17.946 5.129   1.00 0.00 ? 64  LYS A N    3  
ATOM 5390  C CA   . LYS A 1 64  ? 113.241 -17.714 5.586   1.00 0.00 ? 64  LYS A CA   3  
ATOM 5391  C C    . LYS A 1 64  ? 113.198 -16.483 6.509   1.00 0.00 ? 64  LYS A C    3  
ATOM 5392  O O    . LYS A 1 64  ? 112.276 -15.666 6.435   1.00 0.00 ? 64  LYS A O    3  
ATOM 5393  C CB   . LYS A 1 64  ? 112.749 -18.952 6.343   1.00 0.00 ? 64  LYS A CB   3  
ATOM 5394  C CG   . LYS A 1 64  ? 111.241 -19.153 6.413   1.00 0.00 ? 64  LYS A CG   3  
ATOM 5395  C CD   . LYS A 1 64  ? 110.651 -19.349 5.020   1.00 0.00 ? 64  LYS A CD   3  
ATOM 5396  C CE   . LYS A 1 64  ? 109.301 -20.065 5.058   1.00 0.00 ? 64  LYS A CE   3  
ATOM 5397  N NZ   . LYS A 1 64  ? 108.280 -19.369 5.864   1.00 0.00 ? 64  LYS A NZ   3  
ATOM 5398  H H    . LYS A 1 64  ? 115.037 -18.819 5.295   1.00 0.00 ? 64  LYS A H    3  
ATOM 5399  H HA   . LYS A 1 64  ? 112.612 -17.546 4.725   1.00 0.00 ? 64  LYS A HA   3  
ATOM 5400  H HB2  . LYS A 1 64  ? 113.170 -19.829 5.872   1.00 0.00 ? 64  LYS A HB2  3  
ATOM 5401  H HB3  . LYS A 1 64  ? 113.126 -18.898 7.354   1.00 0.00 ? 64  LYS A HB3  3  
ATOM 5402  H HG2  . LYS A 1 64  ? 111.027 -20.025 7.012   1.00 0.00 ? 64  LYS A HG2  3  
ATOM 5403  H HG3  . LYS A 1 64  ? 110.791 -18.281 6.867   1.00 0.00 ? 64  LYS A HG3  3  
ATOM 5404  H HD2  . LYS A 1 64  ? 110.514 -18.381 4.561   1.00 0.00 ? 64  LYS A HD2  3  
ATOM 5405  H HD3  . LYS A 1 64  ? 111.342 -19.933 4.431   1.00 0.00 ? 64  LYS A HD3  3  
ATOM 5406  H HE2  . LYS A 1 64  ? 108.937 -20.148 4.044   1.00 0.00 ? 64  LYS A HE2  3  
ATOM 5407  H HE3  . LYS A 1 64  ? 109.456 -21.056 5.458   1.00 0.00 ? 64  LYS A HE3  3  
ATOM 5408  H HZ1  . LYS A 1 64  ? 108.558 -19.223 6.859   1.00 0.00 ? 64  LYS A HZ1  3  
ATOM 5409  H HZ2  . LYS A 1 64  ? 107.413 -19.949 5.888   1.00 0.00 ? 64  LYS A HZ2  3  
ATOM 5410  H HZ3  . LYS A 1 64  ? 107.998 -18.452 5.453   1.00 0.00 ? 64  LYS A HZ3  3  
ATOM 5411  N N    . ALA A 1 65  ? 114.230 -16.347 7.333   1.00 0.00 ? 65  ALA A N    3  
ATOM 5412  C CA   . ALA A 1 65  ? 114.354 -15.241 8.265   1.00 0.00 ? 65  ALA A CA   3  
ATOM 5413  C C    . ALA A 1 65  ? 114.544 -13.916 7.528   1.00 0.00 ? 65  ALA A C    3  
ATOM 5414  O O    . ALA A 1 65  ? 113.859 -12.930 7.819   1.00 0.00 ? 65  ALA A O    3  
ATOM 5415  C CB   . ALA A 1 65  ? 115.510 -15.485 9.217   1.00 0.00 ? 65  ALA A CB   3  
ATOM 5416  H H    . ALA A 1 65  ? 114.932 -17.033 7.302   1.00 0.00 ? 65  ALA A H    3  
ATOM 5417  H HA   . ALA A 1 65  ? 113.442 -15.192 8.842   1.00 0.00 ? 65  ALA A HA   3  
ATOM 5418  H HB1  . ALA A 1 65  ? 115.371 -16.429 9.723   1.00 0.00 ? 65  ALA A HB1  3  
ATOM 5419  H HB2  . ALA A 1 65  ? 115.552 -14.688 9.944   1.00 0.00 ? 65  ALA A HB2  3  
ATOM 5420  H HB3  . ALA A 1 65  ? 116.429 -15.509 8.651   1.00 0.00 ? 65  ALA A HB3  3  
ATOM 5421  N N    . ILE A 1 66  ? 115.473 -13.895 6.581   1.00 0.00 ? 66  ILE A N    3  
ATOM 5422  C CA   . ILE A 1 66  ? 115.738 -12.697 5.775   1.00 0.00 ? 66  ILE A CA   3  
ATOM 5423  C C    . ILE A 1 66  ? 114.502 -12.359 4.929   1.00 0.00 ? 66  ILE A C    3  
ATOM 5424  O O    . ILE A 1 66  ? 114.124 -11.197 4.778   1.00 0.00 ? 66  ILE A O    3  
ATOM 5425  C CB   . ILE A 1 66  ? 116.992 -12.895 4.868   1.00 0.00 ? 66  ILE A CB   3  
ATOM 5426  C CG1  . ILE A 1 66  ? 118.234 -13.154 5.745   1.00 0.00 ? 66  ILE A CG1  3  
ATOM 5427  C CG2  . ILE A 1 66  ? 117.208 -11.686 3.948   1.00 0.00 ? 66  ILE A CG2  3  
ATOM 5428  C CD1  . ILE A 1 66  ? 119.509 -13.447 4.975   1.00 0.00 ? 66  ILE A CD1  3  
ATOM 5429  H H    . ILE A 1 66  ? 116.006 -14.708 6.424   1.00 0.00 ? 66  ILE A H    3  
ATOM 5430  H HA   . ILE A 1 66  ? 115.917 -11.879 6.459   1.00 0.00 ? 66  ILE A HA   3  
ATOM 5431  H HB   . ILE A 1 66  ? 116.820 -13.760 4.245   1.00 0.00 ? 66  ILE A HB   3  
ATOM 5432  H HG12 . ILE A 1 66  ? 118.420 -12.284 6.356   1.00 0.00 ? 66  ILE A HG12 3  
ATOM 5433  H HG13 . ILE A 1 66  ? 118.032 -13.997 6.390   1.00 0.00 ? 66  ILE A HG13 3  
ATOM 5434  H HG21 . ILE A 1 66  ? 117.286 -10.787 4.541   1.00 0.00 ? 66  ILE A HG21 3  
ATOM 5435  H HG22 . ILE A 1 66  ? 116.372 -11.613 3.266   1.00 0.00 ? 66  ILE A HG22 3  
ATOM 5436  H HG23 . ILE A 1 66  ? 118.116 -11.832 3.382   1.00 0.00 ? 66  ILE A HG23 3  
ATOM 5437  H HD11 . ILE A 1 66  ? 120.305 -13.648 5.676   1.00 0.00 ? 66  ILE A HD11 3  
ATOM 5438  H HD12 . ILE A 1 66  ? 119.782 -12.571 4.404   1.00 0.00 ? 66  ILE A HD12 3  
ATOM 5439  H HD13 . ILE A 1 66  ? 119.372 -14.299 4.324   1.00 0.00 ? 66  ILE A HD13 3  
ATOM 5440  N N    . TYR A 1 67  ? 113.871 -13.396 4.428   1.00 0.00 ? 67  TYR A N    3  
ATOM 5441  C CA   . TYR A 1 67  ? 112.644 -13.306 3.672   1.00 0.00 ? 67  TYR A CA   3  
ATOM 5442  C C    . TYR A 1 67  ? 111.574 -12.570 4.470   1.00 0.00 ? 67  TYR A C    3  
ATOM 5443  O O    . TYR A 1 67  ? 111.140 -11.513 4.074   1.00 0.00 ? 67  TYR A O    3  
ATOM 5444  C CB   . TYR A 1 67  ? 112.175 -14.721 3.339   1.00 0.00 ? 67  TYR A CB   3  
ATOM 5445  C CG   . TYR A 1 67  ? 110.845 -14.817 2.657   1.00 0.00 ? 67  TYR A CG   3  
ATOM 5446  C CD1  . TYR A 1 67  ? 110.692 -14.419 1.352   1.00 0.00 ? 67  TYR A CD1  3  
ATOM 5447  C CD2  . TYR A 1 67  ? 109.745 -15.325 3.328   1.00 0.00 ? 67  TYR A CD2  3  
ATOM 5448  C CE1  . TYR A 1 67  ? 109.484 -14.520 0.718   1.00 0.00 ? 67  TYR A CE1  3  
ATOM 5449  C CE2  . TYR A 1 67  ? 108.526 -15.430 2.711   1.00 0.00 ? 67  TYR A CE2  3  
ATOM 5450  C CZ   . TYR A 1 67  ? 108.391 -15.032 1.410   1.00 0.00 ? 67  TYR A CZ   3  
ATOM 5451  O OH   . TYR A 1 67  ? 107.171 -15.171 0.784   1.00 0.00 ? 67  TYR A OH   3  
ATOM 5452  H H    . TYR A 1 67  ? 114.267 -14.288 4.567   1.00 0.00 ? 67  TYR A H    3  
ATOM 5453  H HA   . TYR A 1 67  ? 112.809 -12.777 2.742   1.00 0.00 ? 67  TYR A HA   3  
ATOM 5454  H HB2  . TYR A 1 67  ? 112.903 -15.183 2.688   1.00 0.00 ? 67  TYR A HB2  3  
ATOM 5455  H HB3  . TYR A 1 67  ? 112.126 -15.291 4.255   1.00 0.00 ? 67  TYR A HB3  3  
ATOM 5456  H HD1  . TYR A 1 67  ? 111.548 -14.032 0.816   1.00 0.00 ? 67  TYR A HD1  3  
ATOM 5457  H HD2  . TYR A 1 67  ? 109.856 -15.637 4.356   1.00 0.00 ? 67  TYR A HD2  3  
ATOM 5458  H HE1  . TYR A 1 67  ? 109.425 -14.174 -0.306  1.00 0.00 ? 67  TYR A HE1  3  
ATOM 5459  H HE2  . TYR A 1 67  ? 107.680 -15.828 3.250   1.00 0.00 ? 67  TYR A HE2  3  
ATOM 5460  H HH   . TYR A 1 67  ? 106.453 -14.928 1.391   1.00 0.00 ? 67  TYR A HH   3  
ATOM 5461  N N    . GLU A 1 68  ? 111.221 -13.086 5.626   1.00 0.00 ? 68  GLU A N    3  
ATOM 5462  C CA   . GLU A 1 68  ? 110.136 -12.510 6.414   1.00 0.00 ? 68  GLU A CA   3  
ATOM 5463  C C    . GLU A 1 68  ? 110.474 -11.134 6.993   1.00 0.00 ? 68  GLU A C    3  
ATOM 5464  O O    . GLU A 1 68  ? 109.585 -10.362 7.311   1.00 0.00 ? 68  GLU A O    3  
ATOM 5465  C CB   . GLU A 1 68  ? 109.697 -13.461 7.506   1.00 0.00 ? 68  GLU A CB   3  
ATOM 5466  C CG   . GLU A 1 68  ? 109.171 -14.781 6.981   1.00 0.00 ? 68  GLU A CG   3  
ATOM 5467  C CD   . GLU A 1 68  ? 108.718 -15.685 8.081   1.00 0.00 ? 68  GLU A CD   3  
ATOM 5468  O OE1  . GLU A 1 68  ? 109.560 -16.351 8.705   1.00 0.00 ? 68  GLU A OE1  3  
ATOM 5469  O OE2  . GLU A 1 68  ? 107.507 -15.746 8.354   1.00 0.00 ? 68  GLU A OE2  3  
ATOM 5470  H H    . GLU A 1 68  ? 111.690 -13.880 5.969   1.00 0.00 ? 68  GLU A H    3  
ATOM 5471  H HA   . GLU A 1 68  ? 109.305 -12.376 5.737   1.00 0.00 ? 68  GLU A HA   3  
ATOM 5472  H HB2  . GLU A 1 68  ? 110.540 -13.659 8.154   1.00 0.00 ? 68  GLU A HB2  3  
ATOM 5473  H HB3  . GLU A 1 68  ? 108.917 -12.988 8.083   1.00 0.00 ? 68  GLU A HB3  3  
ATOM 5474  H HG2  . GLU A 1 68  ? 108.333 -14.588 6.328   1.00 0.00 ? 68  GLU A HG2  3  
ATOM 5475  H HG3  . GLU A 1 68  ? 109.953 -15.276 6.423   1.00 0.00 ? 68  GLU A HG3  3  
ATOM 5476  N N    . LYS A 1 69  ? 111.745 -10.829 7.100   1.00 0.00 ? 69  LYS A N    3  
ATOM 5477  C CA   . LYS A 1 69  ? 112.170 -9.549  7.635   1.00 0.00 ? 69  LYS A CA   3  
ATOM 5478  C C    . LYS A 1 69  ? 112.235 -8.479  6.533   1.00 0.00 ? 69  LYS A C    3  
ATOM 5479  O O    . LYS A 1 69  ? 112.073 -7.272  6.800   1.00 0.00 ? 69  LYS A O    3  
ATOM 5480  C CB   . LYS A 1 69  ? 113.547 -9.699  8.318   1.00 0.00 ? 69  LYS A CB   3  
ATOM 5481  C CG   . LYS A 1 69  ? 114.108 -8.416  8.919   1.00 0.00 ? 69  LYS A CG   3  
ATOM 5482  C CD   . LYS A 1 69  ? 115.477 -8.640  9.547   1.00 0.00 ? 69  LYS A CD   3  
ATOM 5483  C CE   . LYS A 1 69  ? 116.043 -7.341  10.102  1.00 0.00 ? 69  LYS A CE   3  
ATOM 5484  N NZ   . LYS A 1 69  ? 117.378 -7.518  10.706  1.00 0.00 ? 69  LYS A NZ   3  
ATOM 5485  H H    . LYS A 1 69  ? 112.415 -11.491 6.825   1.00 0.00 ? 69  LYS A H    3  
ATOM 5486  H HA   . LYS A 1 69  ? 111.450 -9.243  8.380   1.00 0.00 ? 69  LYS A HA   3  
ATOM 5487  H HB2  . LYS A 1 69  ? 113.461 -10.426 9.113   1.00 0.00 ? 69  LYS A HB2  3  
ATOM 5488  H HB3  . LYS A 1 69  ? 114.254 -10.069 7.589   1.00 0.00 ? 69  LYS A HB3  3  
ATOM 5489  H HG2  . LYS A 1 69  ? 114.207 -7.686  8.129   1.00 0.00 ? 69  LYS A HG2  3  
ATOM 5490  H HG3  . LYS A 1 69  ? 113.425 -8.050  9.671   1.00 0.00 ? 69  LYS A HG3  3  
ATOM 5491  H HD2  . LYS A 1 69  ? 115.382 -9.353  10.352  1.00 0.00 ? 69  LYS A HD2  3  
ATOM 5492  H HD3  . LYS A 1 69  ? 116.152 -9.025  8.797   1.00 0.00 ? 69  LYS A HD3  3  
ATOM 5493  H HE2  . LYS A 1 69  ? 116.121 -6.625  9.297   1.00 0.00 ? 69  LYS A HE2  3  
ATOM 5494  H HE3  . LYS A 1 69  ? 115.364 -6.960  10.851  1.00 0.00 ? 69  LYS A HE3  3  
ATOM 5495  H HZ1  . LYS A 1 69  ? 117.736 -6.608  11.066  1.00 0.00 ? 69  LYS A HZ1  3  
ATOM 5496  H HZ2  . LYS A 1 69  ? 118.064 -7.910  10.021  1.00 0.00 ? 69  LYS A HZ2  3  
ATOM 5497  H HZ3  . LYS A 1 69  ? 117.320 -8.175  11.513  1.00 0.00 ? 69  LYS A HZ3  3  
ATOM 5498  N N    . PHE A 1 70  ? 112.389 -8.913  5.298   1.00 0.00 ? 70  PHE A N    3  
ATOM 5499  C CA   . PHE A 1 70  ? 112.674 -7.994  4.220   1.00 0.00 ? 70  PHE A CA   3  
ATOM 5500  C C    . PHE A 1 70  ? 111.860 -8.282  2.960   1.00 0.00 ? 70  PHE A C    3  
ATOM 5501  O O    . PHE A 1 70  ? 111.112 -7.445  2.494   1.00 0.00 ? 70  PHE A O    3  
ATOM 5502  C CB   . PHE A 1 70  ? 114.171 -8.039  3.872   1.00 0.00 ? 70  PHE A CB   3  
ATOM 5503  C CG   . PHE A 1 70  ? 115.109 -7.409  4.866   1.00 0.00 ? 70  PHE A CG   3  
ATOM 5504  C CD1  . PHE A 1 70  ? 115.070 -6.044  5.104   1.00 0.00 ? 70  PHE A CD1  3  
ATOM 5505  C CD2  . PHE A 1 70  ? 116.048 -8.174  5.535   1.00 0.00 ? 70  PHE A CD2  3  
ATOM 5506  C CE1  . PHE A 1 70  ? 115.944 -5.455  5.994   1.00 0.00 ? 70  PHE A CE1  3  
ATOM 5507  C CE2  . PHE A 1 70  ? 116.930 -7.589  6.421   1.00 0.00 ? 70  PHE A CE2  3  
ATOM 5508  C CZ   . PHE A 1 70  ? 116.877 -6.228  6.652   1.00 0.00 ? 70  PHE A CZ   3  
ATOM 5509  H H    . PHE A 1 70  ? 112.263 -9.863  5.082   1.00 0.00 ? 70  PHE A H    3  
ATOM 5510  H HA   . PHE A 1 70  ? 112.450 -6.996  4.563   1.00 0.00 ? 70  PHE A HA   3  
ATOM 5511  H HB2  . PHE A 1 70  ? 114.469 -9.071  3.771   1.00 0.00 ? 70  PHE A HB2  3  
ATOM 5512  H HB3  . PHE A 1 70  ? 114.316 -7.548  2.922   1.00 0.00 ? 70  PHE A HB3  3  
ATOM 5513  H HD1  . PHE A 1 70  ? 114.339 -5.439  4.589   1.00 0.00 ? 70  PHE A HD1  3  
ATOM 5514  H HD2  . PHE A 1 70  ? 116.090 -9.239  5.356   1.00 0.00 ? 70  PHE A HD2  3  
ATOM 5515  H HE1  . PHE A 1 70  ? 115.901 -4.392  6.173   1.00 0.00 ? 70  PHE A HE1  3  
ATOM 5516  H HE2  . PHE A 1 70  ? 117.658 -8.197  6.938   1.00 0.00 ? 70  PHE A HE2  3  
ATOM 5517  H HZ   . PHE A 1 70  ? 117.566 -5.768  7.346   1.00 0.00 ? 70  PHE A HZ   3  
ATOM 5518  N N    . ILE A 1 71  ? 112.023 -9.468  2.427   1.00 0.00 ? 71  ILE A N    3  
ATOM 5519  C CA   . ILE A 1 71  ? 111.406 -9.869  1.152   1.00 0.00 ? 71  ILE A CA   3  
ATOM 5520  C C    . ILE A 1 71  ? 109.878 -9.982  1.270   1.00 0.00 ? 71  ILE A C    3  
ATOM 5521  O O    . ILE A 1 71  ? 109.142 -9.863  0.281   1.00 0.00 ? 71  ILE A O    3  
ATOM 5522  C CB   . ILE A 1 71  ? 112.042 -11.204 0.656   1.00 0.00 ? 71  ILE A CB   3  
ATOM 5523  C CG1  . ILE A 1 71  ? 113.554 -11.039 0.492   1.00 0.00 ? 71  ILE A CG1  3  
ATOM 5524  C CG2  . ILE A 1 71  ? 111.414 -11.720 -0.637  1.00 0.00 ? 71  ILE A CG2  3  
ATOM 5525  C CD1  . ILE A 1 71  ? 113.954 -9.960  -0.489  1.00 0.00 ? 71  ILE A CD1  3  
ATOM 5526  H H    . ILE A 1 71  ? 112.574 -10.122 2.906   1.00 0.00 ? 71  ILE A H    3  
ATOM 5527  H HA   . ILE A 1 71  ? 111.631 -9.095  0.432   1.00 0.00 ? 71  ILE A HA   3  
ATOM 5528  H HB   . ILE A 1 71  ? 111.870 -11.950 1.417   1.00 0.00 ? 71  ILE A HB   3  
ATOM 5529  H HG12 . ILE A 1 71  ? 113.986 -10.787 1.449   1.00 0.00 ? 71  ILE A HG12 3  
ATOM 5530  H HG13 . ILE A 1 71  ? 113.975 -11.974 0.151   1.00 0.00 ? 71  ILE A HG13 3  
ATOM 5531  H HG21 . ILE A 1 71  ? 111.250 -10.901 -1.324  1.00 0.00 ? 71  ILE A HG21 3  
ATOM 5532  H HG22 . ILE A 1 71  ? 110.516 -12.290 -0.430  1.00 0.00 ? 71  ILE A HG22 3  
ATOM 5533  H HG23 . ILE A 1 71  ? 112.143 -12.387 -1.079  1.00 0.00 ? 71  ILE A HG23 3  
ATOM 5534  H HD11 . ILE A 1 71  ? 113.554 -9.012  -0.160  1.00 0.00 ? 71  ILE A HD11 3  
ATOM 5535  H HD12 . ILE A 1 71  ? 113.563 -10.195 -1.467  1.00 0.00 ? 71  ILE A HD12 3  
ATOM 5536  H HD13 . ILE A 1 71  ? 115.031 -9.895  -0.535  1.00 0.00 ? 71  ILE A HD13 3  
ATOM 5537  N N    . GLN A 1 72  ? 109.420 -10.186 2.478   1.00 0.00 ? 72  GLN A N    3  
ATOM 5538  C CA   . GLN A 1 72  ? 108.011 -10.278 2.757   1.00 0.00 ? 72  GLN A CA   3  
ATOM 5539  C C    . GLN A 1 72  ? 107.376 -8.886  2.599   1.00 0.00 ? 72  GLN A C    3  
ATOM 5540  O O    . GLN A 1 72  ? 108.033 -7.866  2.813   1.00 0.00 ? 72  GLN A O    3  
ATOM 5541  C CB   . GLN A 1 72  ? 107.802 -10.828 4.180   1.00 0.00 ? 72  GLN A CB   3  
ATOM 5542  C CG   . GLN A 1 72  ? 106.354 -11.087 4.552   1.00 0.00 ? 72  GLN A CG   3  
ATOM 5543  C CD   . GLN A 1 72  ? 105.692 -12.077 3.622   1.00 0.00 ? 72  GLN A CD   3  
ATOM 5544  O OE1  . GLN A 1 72  ? 105.118 -11.697 2.602   1.00 0.00 ? 72  GLN A OE1  3  
ATOM 5545  N NE2  . GLN A 1 72  ? 105.745 -13.334 3.960   1.00 0.00 ? 72  GLN A NE2  3  
ATOM 5546  H H    . GLN A 1 72  ? 110.080 -10.266 3.205   1.00 0.00 ? 72  GLN A H    3  
ATOM 5547  H HA   . GLN A 1 72  ? 107.566 -10.955 2.042   1.00 0.00 ? 72  GLN A HA   3  
ATOM 5548  H HB2  . GLN A 1 72  ? 108.337 -11.764 4.268   1.00 0.00 ? 72  GLN A HB2  3  
ATOM 5549  H HB3  . GLN A 1 72  ? 108.209 -10.112 4.883   1.00 0.00 ? 72  GLN A HB3  3  
ATOM 5550  H HG2  . GLN A 1 72  ? 106.313 -11.472 5.559   1.00 0.00 ? 72  GLN A HG2  3  
ATOM 5551  H HG3  . GLN A 1 72  ? 105.821 -10.149 4.503   1.00 0.00 ? 72  GLN A HG3  3  
ATOM 5552  H HE21 . GLN A 1 72  ? 106.193 -13.589 4.794   1.00 0.00 ? 72  GLN A HE21 3  
ATOM 5553  H HE22 . GLN A 1 72  ? 105.338 -14.000 3.361   1.00 0.00 ? 72  GLN A HE22 3  
ATOM 5554  N N    . THR A 1 73  ? 106.139 -8.835  2.217   1.00 0.00 ? 73  THR A N    3  
ATOM 5555  C CA   . THR A 1 73  ? 105.489 -7.568  2.035   1.00 0.00 ? 73  THR A CA   3  
ATOM 5556  C C    . THR A 1 73  ? 104.934 -7.039  3.372   1.00 0.00 ? 73  THR A C    3  
ATOM 5557  O O    . THR A 1 73  ? 104.997 -5.854  3.673   1.00 0.00 ? 73  THR A O    3  
ATOM 5558  C CB   . THR A 1 73  ? 104.413 -7.669  0.963   1.00 0.00 ? 73  THR A CB   3  
ATOM 5559  O OG1  . THR A 1 73  ? 105.012 -8.213  -0.235  1.00 0.00 ? 73  THR A OG1  3  
ATOM 5560  C CG2  . THR A 1 73  ? 103.883 -6.301  0.683   1.00 0.00 ? 73  THR A CG2  3  
ATOM 5561  H H    . THR A 1 73  ? 105.645 -9.662  2.033   1.00 0.00 ? 73  THR A H    3  
ATOM 5562  H HA   . THR A 1 73  ? 106.250 -6.877  1.702   1.00 0.00 ? 73  THR A HA   3  
ATOM 5563  H HB   . THR A 1 73  ? 103.616 -8.310  1.307   1.00 0.00 ? 73  THR A HB   3  
ATOM 5564  H HG1  . THR A 1 73  ? 104.336 -8.465  -0.885  1.00 0.00 ? 73  THR A HG1  3  
ATOM 5565  H HG21 . THR A 1 73  ? 104.704 -5.672  0.368   1.00 0.00 ? 73  THR A HG21 3  
ATOM 5566  H HG22 . THR A 1 73  ? 103.497 -5.955  1.632   1.00 0.00 ? 73  THR A HG22 3  
ATOM 5567  H HG23 . THR A 1 73  ? 103.102 -6.340  -0.061  1.00 0.00 ? 73  THR A HG23 3  
ATOM 5568  N N    . ASP A 1 74  ? 104.423 -7.929  4.165   1.00 0.00 ? 74  ASP A N    3  
ATOM 5569  C CA   . ASP A 1 74  ? 104.004 -7.606  5.544   1.00 0.00 ? 74  ASP A CA   3  
ATOM 5570  C C    . ASP A 1 74  ? 105.199 -7.674  6.503   1.00 0.00 ? 74  ASP A C    3  
ATOM 5571  O O    . ASP A 1 74  ? 105.031 -7.786  7.713   1.00 0.00 ? 74  ASP A O    3  
ATOM 5572  C CB   . ASP A 1 74  ? 102.867 -8.530  6.047   1.00 0.00 ? 74  ASP A CB   3  
ATOM 5573  C CG   . ASP A 1 74  ? 103.210 -10.011 6.080   1.00 0.00 ? 74  ASP A CG   3  
ATOM 5574  O OD1  . ASP A 1 74  ? 103.738 -10.516 7.092   1.00 0.00 ? 74  ASP A OD1  3  
ATOM 5575  O OD2  . ASP A 1 74  ? 102.909 -10.708 5.085   1.00 0.00 ? 74  ASP A OD2  3  
ATOM 5576  H H    . ASP A 1 74  ? 104.264 -8.811  3.769   1.00 0.00 ? 74  ASP A H    3  
ATOM 5577  H HA   . ASP A 1 74  ? 103.650 -6.585  5.529   1.00 0.00 ? 74  ASP A HA   3  
ATOM 5578  H HB2  . ASP A 1 74  ? 102.603 -8.237  7.053   1.00 0.00 ? 74  ASP A HB2  3  
ATOM 5579  H HB3  . ASP A 1 74  ? 102.005 -8.393  5.412   1.00 0.00 ? 74  ASP A HB3  3  
ATOM 5580  N N    . ALA A 1 75  ? 106.394 -7.544  5.950   1.00 0.00 ? 75  ALA A N    3  
ATOM 5581  C CA   . ALA A 1 75  ? 107.624 -7.587  6.710   1.00 0.00 ? 75  ALA A CA   3  
ATOM 5582  C C    . ALA A 1 75  ? 107.721 -6.396  7.647   1.00 0.00 ? 75  ALA A C    3  
ATOM 5583  O O    . ALA A 1 75  ? 107.092 -5.349  7.406   1.00 0.00 ? 75  ALA A O    3  
ATOM 5584  C CB   . ALA A 1 75  ? 108.822 -7.585  5.774   1.00 0.00 ? 75  ALA A CB   3  
ATOM 5585  H H    . ALA A 1 75  ? 106.438 -7.383  4.985   1.00 0.00 ? 75  ALA A H    3  
ATOM 5586  H HA   . ALA A 1 75  ? 107.645 -8.503  7.282   1.00 0.00 ? 75  ALA A HA   3  
ATOM 5587  H HB1  . ALA A 1 75  ? 108.814 -6.702  5.150   1.00 0.00 ? 75  ALA A HB1  3  
ATOM 5588  H HB2  . ALA A 1 75  ? 108.808 -8.470  5.157   1.00 0.00 ? 75  ALA A HB2  3  
ATOM 5589  H HB3  . ALA A 1 75  ? 109.716 -7.574  6.383   1.00 0.00 ? 75  ALA A HB3  3  
ATOM 5590  N N    . PRO A 1 76  ? 108.500 -6.524  8.725   1.00 0.00 ? 76  PRO A N    3  
ATOM 5591  C CA   . PRO A 1 76  ? 108.719 -5.437  9.667   1.00 0.00 ? 76  PRO A CA   3  
ATOM 5592  C C    . PRO A 1 76  ? 109.511 -4.290  9.043   1.00 0.00 ? 76  PRO A C    3  
ATOM 5593  O O    . PRO A 1 76  ? 109.442 -3.155  9.504   1.00 0.00 ? 76  PRO A O    3  
ATOM 5594  C CB   . PRO A 1 76  ? 109.543 -6.091  10.786  1.00 0.00 ? 76  PRO A CB   3  
ATOM 5595  C CG   . PRO A 1 76  ? 110.181 -7.271  10.150  1.00 0.00 ? 76  PRO A CG   3  
ATOM 5596  C CD   . PRO A 1 76  ? 109.197 -7.761  9.145   1.00 0.00 ? 76  PRO A CD   3  
ATOM 5597  H HA   . PRO A 1 76  ? 107.790 -5.063  10.071  1.00 0.00 ? 76  PRO A HA   3  
ATOM 5598  H HB2  . PRO A 1 76  ? 110.281 -5.390  11.148  1.00 0.00 ? 76  PRO A HB2  3  
ATOM 5599  H HB3  . PRO A 1 76  ? 108.891 -6.385  11.595  1.00 0.00 ? 76  PRO A HB3  3  
ATOM 5600  H HG2  . PRO A 1 76  ? 111.095 -6.978  9.655   1.00 0.00 ? 76  PRO A HG2  3  
ATOM 5601  H HG3  . PRO A 1 76  ? 110.375 -8.034  10.890  1.00 0.00 ? 76  PRO A HG3  3  
ATOM 5602  H HD2  . PRO A 1 76  ? 109.707 -8.219  8.311   1.00 0.00 ? 76  PRO A HD2  3  
ATOM 5603  H HD3  . PRO A 1 76  ? 108.504 -8.459  9.592   1.00 0.00 ? 76  PRO A HD3  3  
ATOM 5604  N N    . LYS A 1 77  ? 110.257 -4.586  7.986   1.00 0.00 ? 77  LYS A N    3  
ATOM 5605  C CA   . LYS A 1 77  ? 111.100 -3.576  7.373   1.00 0.00 ? 77  LYS A CA   3  
ATOM 5606  C C    . LYS A 1 77  ? 110.847 -3.468  5.878   1.00 0.00 ? 77  LYS A C    3  
ATOM 5607  O O    . LYS A 1 77  ? 110.695 -2.363  5.349   1.00 0.00 ? 77  LYS A O    3  
ATOM 5608  C CB   . LYS A 1 77  ? 112.579 -3.879  7.629   1.00 0.00 ? 77  LYS A CB   3  
ATOM 5609  C CG   . LYS A 1 77  ? 112.938 -4.062  9.102   1.00 0.00 ? 77  LYS A CG   3  
ATOM 5610  C CD   . LYS A 1 77  ? 114.434 -4.186  9.296   1.00 0.00 ? 77  LYS A CD   3  
ATOM 5611  C CE   . LYS A 1 77  ? 115.137 -2.882  8.962   1.00 0.00 ? 77  LYS A CE   3  
ATOM 5612  N NZ   . LYS A 1 77  ? 114.791 -1.805  9.916   1.00 0.00 ? 77  LYS A NZ   3  
ATOM 5613  H H    . LYS A 1 77  ? 110.212 -5.496  7.622   1.00 0.00 ? 77  LYS A H    3  
ATOM 5614  H HA   . LYS A 1 77  ? 110.864 -2.629  7.835   1.00 0.00 ? 77  LYS A HA   3  
ATOM 5615  H HB2  . LYS A 1 77  ? 112.841 -4.787  7.104   1.00 0.00 ? 77  LYS A HB2  3  
ATOM 5616  H HB3  . LYS A 1 77  ? 113.169 -3.066  7.234   1.00 0.00 ? 77  LYS A HB3  3  
ATOM 5617  H HG2  . LYS A 1 77  ? 112.584 -3.207  9.657   1.00 0.00 ? 77  LYS A HG2  3  
ATOM 5618  H HG3  . LYS A 1 77  ? 112.458 -4.956  9.470   1.00 0.00 ? 77  LYS A HG3  3  
ATOM 5619  H HD2  . LYS A 1 77  ? 114.637 -4.442  10.325  1.00 0.00 ? 77  LYS A HD2  3  
ATOM 5620  H HD3  . LYS A 1 77  ? 114.810 -4.964  8.648   1.00 0.00 ? 77  LYS A HD3  3  
ATOM 5621  H HE2  . LYS A 1 77  ? 116.205 -3.045  8.994   1.00 0.00 ? 77  LYS A HE2  3  
ATOM 5622  H HE3  . LYS A 1 77  ? 114.850 -2.579  7.967   1.00 0.00 ? 77  LYS A HE3  3  
ATOM 5623  H HZ1  . LYS A 1 77  ? 113.762 -1.672  10.031  1.00 0.00 ? 77  LYS A HZ1  3  
ATOM 5624  H HZ2  . LYS A 1 77  ? 115.180 -0.897  9.582   1.00 0.00 ? 77  LYS A HZ2  3  
ATOM 5625  H HZ3  . LYS A 1 77  ? 115.204 -2.003  10.854  1.00 0.00 ? 77  LYS A HZ3  3  
ATOM 5626  N N    . GLU A 1 78  ? 110.811 -4.631  5.213   1.00 0.00 ? 78  GLU A N    3  
ATOM 5627  C CA   . GLU A 1 78  ? 110.616 -4.756  3.751   1.00 0.00 ? 78  GLU A CA   3  
ATOM 5628  C C    . GLU A 1 78  ? 111.850 -4.305  2.970   1.00 0.00 ? 78  GLU A C    3  
ATOM 5629  O O    . GLU A 1 78  ? 112.853 -3.864  3.549   1.00 0.00 ? 78  GLU A O    3  
ATOM 5630  C CB   . GLU A 1 78  ? 109.407 -3.997  3.216   1.00 0.00 ? 78  GLU A CB   3  
ATOM 5631  C CG   . GLU A 1 78  ? 108.055 -4.462  3.667   1.00 0.00 ? 78  GLU A CG   3  
ATOM 5632  C CD   . GLU A 1 78  ? 106.992 -3.658  2.975   1.00 0.00 ? 78  GLU A CD   3  
ATOM 5633  O OE1  . GLU A 1 78  ? 106.913 -3.716  1.733   1.00 0.00 ? 78  GLU A OE1  3  
ATOM 5634  O OE2  . GLU A 1 78  ? 106.260 -2.907  3.645   1.00 0.00 ? 78  GLU A OE2  3  
ATOM 5635  H H    . GLU A 1 78  ? 110.965 -5.458  5.714   1.00 0.00 ? 78  GLU A H    3  
ATOM 5636  H HA   . GLU A 1 78  ? 110.470 -5.812  3.576   1.00 0.00 ? 78  GLU A HA   3  
ATOM 5637  H HB2  . GLU A 1 78  ? 109.502 -2.963  3.509   1.00 0.00 ? 78  GLU A HB2  3  
ATOM 5638  H HB3  . GLU A 1 78  ? 109.437 -4.044  2.137   1.00 0.00 ? 78  GLU A HB3  3  
ATOM 5639  H HG2  . GLU A 1 78  ? 107.936 -5.507  3.419   1.00 0.00 ? 78  GLU A HG2  3  
ATOM 5640  H HG3  . GLU A 1 78  ? 107.961 -4.320  4.734   1.00 0.00 ? 78  GLU A HG3  3  
ATOM 5641  N N    . VAL A 1 79  ? 111.774 -4.411  1.653   1.00 0.00 ? 79  VAL A N    3  
ATOM 5642  C CA   . VAL A 1 79  ? 112.870 -4.004  0.778   1.00 0.00 ? 79  VAL A CA   3  
ATOM 5643  C C    . VAL A 1 79  ? 112.292 -3.207  -0.367  1.00 0.00 ? 79  VAL A C    3  
ATOM 5644  O O    . VAL A 1 79  ? 111.172 -3.463  -0.775  1.00 0.00 ? 79  VAL A O    3  
ATOM 5645  C CB   . VAL A 1 79  ? 113.634 -5.232  0.164   1.00 0.00 ? 79  VAL A CB   3  
ATOM 5646  C CG1  . VAL A 1 79  ? 114.858 -4.804  -0.625  1.00 0.00 ? 79  VAL A CG1  3  
ATOM 5647  C CG2  . VAL A 1 79  ? 114.044 -6.192  1.217   1.00 0.00 ? 79  VAL A CG2  3  
ATOM 5648  H H    . VAL A 1 79  ? 110.943 -4.759  1.252   1.00 0.00 ? 79  VAL A H    3  
ATOM 5649  H HA   . VAL A 1 79  ? 113.564 -3.395  1.339   1.00 0.00 ? 79  VAL A HA   3  
ATOM 5650  H HB   . VAL A 1 79  ? 112.964 -5.736  -0.517  1.00 0.00 ? 79  VAL A HB   3  
ATOM 5651  H HG11 . VAL A 1 79  ? 114.556 -4.159  -1.437  1.00 0.00 ? 79  VAL A HG11 3  
ATOM 5652  H HG12 . VAL A 1 79  ? 115.353 -5.681  -1.017  1.00 0.00 ? 79  VAL A HG12 3  
ATOM 5653  H HG13 . VAL A 1 79  ? 115.536 -4.273  0.026   1.00 0.00 ? 79  VAL A HG13 3  
ATOM 5654  H HG21 . VAL A 1 79  ? 114.687 -5.688  1.924   1.00 0.00 ? 79  VAL A HG21 3  
ATOM 5655  H HG22 . VAL A 1 79  ? 114.581 -7.038  0.802   1.00 0.00 ? 79  VAL A HG22 3  
ATOM 5656  H HG23 . VAL A 1 79  ? 113.171 -6.548  1.744   1.00 0.00 ? 79  VAL A HG23 3  
ATOM 5657  N N    . ASN A 1 80  ? 113.055 -2.270  -0.908  1.00 0.00 ? 80  ASN A N    3  
ATOM 5658  C CA   . ASN A 1 80  ? 112.660 -1.496  -2.115  1.00 0.00 ? 80  ASN A CA   3  
ATOM 5659  C C    . ASN A 1 80  ? 112.833 -2.376  -3.377  1.00 0.00 ? 80  ASN A C    3  
ATOM 5660  O O    . ASN A 1 80  ? 113.163 -1.892  -4.463  1.00 0.00 ? 80  ASN A O    3  
ATOM 5661  C CB   . ASN A 1 80  ? 113.541 -0.232  -2.260  1.00 0.00 ? 80  ASN A CB   3  
ATOM 5662  C CG   . ASN A 1 80  ? 113.388 0.762   -1.127  1.00 0.00 ? 80  ASN A CG   3  
ATOM 5663  O OD1  . ASN A 1 80  ? 112.516 1.627   -1.163  1.00 0.00 ? 80  ASN A OD1  3  
ATOM 5664  N ND2  . ASN A 1 80  ? 114.247 0.682   -0.141  1.00 0.00 ? 80  ASN A ND2  3  
ATOM 5665  H H    . ASN A 1 80  ? 113.911 -2.076  -0.470  1.00 0.00 ? 80  ASN A H    3  
ATOM 5666  H HA   . ASN A 1 80  ? 111.624 -1.210  -2.016  1.00 0.00 ? 80  ASN A HA   3  
ATOM 5667  H HB2  . ASN A 1 80  ? 114.579 -0.529  -2.302  1.00 0.00 ? 80  ASN A HB2  3  
ATOM 5668  H HB3  . ASN A 1 80  ? 113.286 0.263   -3.186  1.00 0.00 ? 80  ASN A HB3  3  
ATOM 5669  H HD21 . ASN A 1 80  ? 114.965 0.008   -0.145  1.00 0.00 ? 80  ASN A HD21 3  
ATOM 5670  H HD22 . ASN A 1 80  ? 114.169 1.304   0.621   1.00 0.00 ? 80  ASN A HD22 3  
ATOM 5671  N N    . LEU A 1 81  ? 112.552 -3.643  -3.223  1.00 0.00 ? 81  LEU A N    3  
ATOM 5672  C CA   . LEU A 1 81  ? 112.746 -4.643  -4.234  1.00 0.00 ? 81  LEU A CA   3  
ATOM 5673  C C    . LEU A 1 81  ? 111.537 -4.701  -5.156  1.00 0.00 ? 81  LEU A C    3  
ATOM 5674  O O    . LEU A 1 81  ? 110.402 -4.399  -4.738  1.00 0.00 ? 81  LEU A O    3  
ATOM 5675  C CB   . LEU A 1 81  ? 112.952 -5.990  -3.541  1.00 0.00 ? 81  LEU A CB   3  
ATOM 5676  C CG   . LEU A 1 81  ? 113.254 -7.190  -4.413  1.00 0.00 ? 81  LEU A CG   3  
ATOM 5677  C CD1  . LEU A 1 81  ? 114.648 -7.089  -4.946  1.00 0.00 ? 81  LEU A CD1  3  
ATOM 5678  C CD2  . LEU A 1 81  ? 113.069 -8.473  -3.632  1.00 0.00 ? 81  LEU A CD2  3  
ATOM 5679  H H    . LEU A 1 81  ? 112.139 -3.914  -2.375  1.00 0.00 ? 81  LEU A H    3  
ATOM 5680  H HA   . LEU A 1 81  ? 113.634 -4.409  -4.802  1.00 0.00 ? 81  LEU A HA   3  
ATOM 5681  H HB2  . LEU A 1 81  ? 113.840 -5.852  -2.939  1.00 0.00 ? 81  LEU A HB2  3  
ATOM 5682  H HB3  . LEU A 1 81  ? 112.105 -6.208  -2.908  1.00 0.00 ? 81  LEU A HB3  3  
ATOM 5683  H HG   . LEU A 1 81  ? 112.594 -7.209  -5.267  1.00 0.00 ? 81  LEU A HG   3  
ATOM 5684  H HD11 . LEU A 1 81  ? 114.816 -7.887  -5.655  1.00 0.00 ? 81  LEU A HD11 3  
ATOM 5685  H HD12 . LEU A 1 81  ? 115.345 -7.221  -4.128  1.00 0.00 ? 81  LEU A HD12 3  
ATOM 5686  H HD13 . LEU A 1 81  ? 114.803 -6.133  -5.425  1.00 0.00 ? 81  LEU A HD13 3  
ATOM 5687  H HD21 . LEU A 1 81  ? 113.732 -8.482  -2.780  1.00 0.00 ? 81  LEU A HD21 3  
ATOM 5688  H HD22 . LEU A 1 81  ? 113.295 -9.316  -4.267  1.00 0.00 ? 81  LEU A HD22 3  
ATOM 5689  H HD23 . LEU A 1 81  ? 112.047 -8.553  -3.290  1.00 0.00 ? 81  LEU A HD23 3  
ATOM 5690  N N    . ASP A 1 82  ? 111.779 -5.087  -6.381  1.00 0.00 ? 82  ASP A N    3  
ATOM 5691  C CA   . ASP A 1 82  ? 110.755 -5.187  -7.398  1.00 0.00 ? 82  ASP A CA   3  
ATOM 5692  C C    . ASP A 1 82  ? 109.930 -6.451  -7.194  1.00 0.00 ? 82  ASP A C    3  
ATOM 5693  O O    . ASP A 1 82  ? 110.358 -7.396  -6.493  1.00 0.00 ? 82  ASP A O    3  
ATOM 5694  C CB   . ASP A 1 82  ? 111.388 -5.234  -8.791  1.00 0.00 ? 82  ASP A CB   3  
ATOM 5695  C CG   . ASP A 1 82  ? 112.117 -6.529  -9.044  1.00 0.00 ? 82  ASP A CG   3  
ATOM 5696  O OD1  . ASP A 1 82  ? 113.182 -6.740  -8.472  1.00 0.00 ? 82  ASP A OD1  3  
ATOM 5697  O OD2  . ASP A 1 82  ? 111.604 -7.376  -9.804  1.00 0.00 ? 82  ASP A OD2  3  
ATOM 5698  H H    . ASP A 1 82  ? 112.690 -5.343  -6.641  1.00 0.00 ? 82  ASP A H    3  
ATOM 5699  H HA   . ASP A 1 82  ? 110.115 -4.319  -7.336  1.00 0.00 ? 82  ASP A HA   3  
ATOM 5700  H HB2  . ASP A 1 82  ? 110.616 -5.128  -9.538  1.00 0.00 ? 82  ASP A HB2  3  
ATOM 5701  H HB3  . ASP A 1 82  ? 112.093 -4.422  -8.896  1.00 0.00 ? 82  ASP A HB3  3  
ATOM 5702  N N    . PHE A 1 83  ? 108.781 -6.479  -7.830  1.00 0.00 ? 83  PHE A N    3  
ATOM 5703  C CA   . PHE A 1 83  ? 107.848 -7.584  -7.739  1.00 0.00 ? 83  PHE A CA   3  
ATOM 5704  C C    . PHE A 1 83  ? 108.369 -8.865  -8.319  1.00 0.00 ? 83  PHE A C    3  
ATOM 5705  O O    . PHE A 1 83  ? 108.073 -9.935  -7.797  1.00 0.00 ? 83  PHE A O    3  
ATOM 5706  C CB   . PHE A 1 83  ? 106.523 -7.245  -8.394  1.00 0.00 ? 83  PHE A CB   3  
ATOM 5707  C CG   . PHE A 1 83  ? 105.639 -6.410  -7.553  1.00 0.00 ? 83  PHE A CG   3  
ATOM 5708  C CD1  . PHE A 1 83  ? 105.746 -5.040  -7.547  1.00 0.00 ? 83  PHE A CD1  3  
ATOM 5709  C CD2  . PHE A 1 83  ? 104.693 -7.013  -6.766  1.00 0.00 ? 83  PHE A CD2  3  
ATOM 5710  C CE1  . PHE A 1 83  ? 104.913 -4.271  -6.760  1.00 0.00 ? 83  PHE A CE1  3  
ATOM 5711  C CE2  . PHE A 1 83  ? 103.851 -6.265  -5.972  1.00 0.00 ? 83  PHE A CE2  3  
ATOM 5712  C CZ   . PHE A 1 83  ? 103.960 -4.886  -5.968  1.00 0.00 ? 83  PHE A CZ   3  
ATOM 5713  H H    . PHE A 1 83  ? 108.544 -5.707  -8.396  1.00 0.00 ? 83  PHE A H    3  
ATOM 5714  H HA   . PHE A 1 83  ? 107.653 -7.747  -6.690  1.00 0.00 ? 83  PHE A HA   3  
ATOM 5715  H HB2  . PHE A 1 83  ? 106.712 -6.705  -9.310  1.00 0.00 ? 83  PHE A HB2  3  
ATOM 5716  H HB3  . PHE A 1 83  ? 106.001 -8.163  -8.627  1.00 0.00 ? 83  PHE A HB3  3  
ATOM 5717  H HD1  . PHE A 1 83  ? 106.500 -4.591  -8.177  1.00 0.00 ? 83  PHE A HD1  3  
ATOM 5718  H HD2  . PHE A 1 83  ? 104.644 -8.093  -6.801  1.00 0.00 ? 83  PHE A HD2  3  
ATOM 5719  H HE1  . PHE A 1 83  ? 105.005 -3.195  -6.762  1.00 0.00 ? 83  PHE A HE1  3  
ATOM 5720  H HE2  . PHE A 1 83  ? 103.109 -6.752  -5.356  1.00 0.00 ? 83  PHE A HE2  3  
ATOM 5721  H HZ   . PHE A 1 83  ? 103.306 -4.291  -5.348  1.00 0.00 ? 83  PHE A HZ   3  
ATOM 5722  N N    . HIS A 1 84  ? 109.153 -8.781  -9.355  1.00 0.00 ? 84  HIS A N    3  
ATOM 5723  C CA   . HIS A 1 84  ? 109.589 -9.977  -10.030 1.00 0.00 ? 84  HIS A CA   3  
ATOM 5724  C C    . HIS A 1 84  ? 110.621 -10.737 -9.203  1.00 0.00 ? 84  HIS A C    3  
ATOM 5725  O O    . HIS A 1 84  ? 110.528 -11.961 -9.071  1.00 0.00 ? 84  HIS A O    3  
ATOM 5726  C CB   . HIS A 1 84  ? 110.080 -9.682  -11.463 1.00 0.00 ? 84  HIS A CB   3  
ATOM 5727  C CG   . HIS A 1 84  ? 110.685 -10.865 -12.194 1.00 0.00 ? 84  HIS A CG   3  
ATOM 5728  N ND1  . HIS A 1 84  ? 109.968 -11.980 -12.559 1.00 0.00 ? 84  HIS A ND1  3  
ATOM 5729  C CD2  . HIS A 1 84  ? 111.956 -11.098 -12.601 1.00 0.00 ? 84  HIS A CD2  3  
ATOM 5730  C CE1  . HIS A 1 84  ? 110.764 -12.840 -13.155 1.00 0.00 ? 84  HIS A CE1  3  
ATOM 5731  N NE2  . HIS A 1 84  ? 111.976 -12.334 -13.194 1.00 0.00 ? 84  HIS A NE2  3  
ATOM 5732  H H    . HIS A 1 84  ? 109.489 -7.907  -9.654  1.00 0.00 ? 84  HIS A H    3  
ATOM 5733  H HA   . HIS A 1 84  ? 108.683 -10.563 -10.085 1.00 0.00 ? 84  HIS A HA   3  
ATOM 5734  H HB2  . HIS A 1 84  ? 109.238 -9.328  -12.040 1.00 0.00 ? 84  HIS A HB2  3  
ATOM 5735  H HB3  . HIS A 1 84  ? 110.819 -8.896  -11.415 1.00 0.00 ? 84  HIS A HB3  3  
ATOM 5736  H HD1  . HIS A 1 84  ? 109.004 -12.137 -12.394 1.00 0.00 ? 84  HIS A HD1  3  
ATOM 5737  H HD2  . HIS A 1 84  ? 112.794 -10.425 -12.473 1.00 0.00 ? 84  HIS A HD2  3  
ATOM 5738  H HE1  . HIS A 1 84  ? 110.470 -13.801 -13.550 1.00 0.00 ? 84  HIS A HE1  3  
ATOM 5739  H HE2  . HIS A 1 84  ? 112.776 -12.917 -13.204 1.00 0.00 ? 84  HIS A HE2  3  
ATOM 5740  N N    . THR A 1 85  ? 111.574 -10.022 -8.634  1.00 0.00 ? 85  THR A N    3  
ATOM 5741  C CA   . THR A 1 85  ? 112.583 -10.658 -7.812  1.00 0.00 ? 85  THR A CA   3  
ATOM 5742  C C    . THR A 1 85  ? 111.946 -11.289 -6.575  1.00 0.00 ? 85  THR A C    3  
ATOM 5743  O O    . THR A 1 85  ? 112.137 -12.484 -6.315  1.00 0.00 ? 85  THR A O    3  
ATOM 5744  C CB   . THR A 1 85  ? 113.684 -9.675  -7.366  1.00 0.00 ? 85  THR A CB   3  
ATOM 5745  O OG1  . THR A 1 85  ? 114.300 -9.071  -8.512  1.00 0.00 ? 85  THR A OG1  3  
ATOM 5746  C CG2  . THR A 1 85  ? 114.735 -10.404 -6.548  1.00 0.00 ? 85  THR A CG2  3  
ATOM 5747  H H    . THR A 1 85  ? 111.610 -9.049  -8.789  1.00 0.00 ? 85  THR A H    3  
ATOM 5748  H HA   . THR A 1 85  ? 113.036 -11.443 -8.402  1.00 0.00 ? 85  THR A HA   3  
ATOM 5749  H HB   . THR A 1 85  ? 113.238 -8.905  -6.755  1.00 0.00 ? 85  THR A HB   3  
ATOM 5750  H HG1  . THR A 1 85  ? 113.960 -8.154  -8.526  1.00 0.00 ? 85  THR A HG1  3  
ATOM 5751  H HG21 . THR A 1 85  ? 114.256 -10.876 -5.703  1.00 0.00 ? 85  THR A HG21 3  
ATOM 5752  H HG22 . THR A 1 85  ? 115.471 -9.709  -6.166  1.00 0.00 ? 85  THR A HG22 3  
ATOM 5753  H HG23 . THR A 1 85  ? 115.217 -11.159 -7.151  1.00 0.00 ? 85  THR A HG23 3  
ATOM 5754  N N    . LYS A 1 86  ? 111.140 -10.501 -5.853  1.00 0.00 ? 86  LYS A N    3  
ATOM 5755  C CA   . LYS A 1 86  ? 110.525 -10.975 -4.620  1.00 0.00 ? 86  LYS A CA   3  
ATOM 5756  C C    . LYS A 1 86  ? 109.618 -12.159 -4.889  1.00 0.00 ? 86  LYS A C    3  
ATOM 5757  O O    . LYS A 1 86  ? 109.553 -13.075 -4.092  1.00 0.00 ? 86  LYS A O    3  
ATOM 5758  C CB   . LYS A 1 86  ? 109.780 -9.848  -3.876  1.00 0.00 ? 86  LYS A CB   3  
ATOM 5759  C CG   . LYS A 1 86  ? 108.551 -9.293  -4.583  1.00 0.00 ? 86  LYS A CG   3  
ATOM 5760  C CD   . LYS A 1 86  ? 108.002 -8.064  -3.876  1.00 0.00 ? 86  LYS A CD   3  
ATOM 5761  C CE   . LYS A 1 86  ? 107.633 -8.345  -2.427  1.00 0.00 ? 86  LYS A CE   3  
ATOM 5762  N NZ   . LYS A 1 86  ? 107.157 -7.131  -1.755  1.00 0.00 ? 86  LYS A NZ   3  
ATOM 5763  H H    . LYS A 1 86  ? 110.970 -9.584  -6.164  1.00 0.00 ? 86  LYS A H    3  
ATOM 5764  H HA   . LYS A 1 86  ? 111.332 -11.328 -3.995  1.00 0.00 ? 86  LYS A HA   3  
ATOM 5765  H HB2  . LYS A 1 86  ? 109.461 -10.224 -2.914  1.00 0.00 ? 86  LYS A HB2  3  
ATOM 5766  H HB3  . LYS A 1 86  ? 110.470 -9.033  -3.714  1.00 0.00 ? 86  LYS A HB3  3  
ATOM 5767  H HG2  . LYS A 1 86  ? 108.822 -9.023  -5.593  1.00 0.00 ? 86  LYS A HG2  3  
ATOM 5768  H HG3  . LYS A 1 86  ? 107.788 -10.058 -4.606  1.00 0.00 ? 86  LYS A HG3  3  
ATOM 5769  H HD2  . LYS A 1 86  ? 108.750 -7.285  -3.895  1.00 0.00 ? 86  LYS A HD2  3  
ATOM 5770  H HD3  . LYS A 1 86  ? 107.122 -7.726  -4.404  1.00 0.00 ? 86  LYS A HD3  3  
ATOM 5771  H HE2  . LYS A 1 86  ? 106.851 -9.090  -2.404  1.00 0.00 ? 86  LYS A HE2  3  
ATOM 5772  H HE3  . LYS A 1 86  ? 108.505 -8.719  -1.911  1.00 0.00 ? 86  LYS A HE3  3  
ATOM 5773  H HZ1  . LYS A 1 86  ? 106.980 -7.290  -0.742  1.00 0.00 ? 86  LYS A HZ1  3  
ATOM 5774  H HZ2  . LYS A 1 86  ? 106.259 -6.805  -2.174  1.00 0.00 ? 86  LYS A HZ2  3  
ATOM 5775  H HZ3  . LYS A 1 86  ? 107.840 -6.348  -1.845  1.00 0.00 ? 86  LYS A HZ3  3  
ATOM 5776  N N    . GLU A 1 87  ? 108.971 -12.153 -6.050  1.00 0.00 ? 87  GLU A N    3  
ATOM 5777  C CA   . GLU A 1 87  ? 108.101 -13.234 -6.463  1.00 0.00 ? 87  GLU A CA   3  
ATOM 5778  C C    . GLU A 1 87  ? 108.864 -14.545 -6.484  1.00 0.00 ? 87  GLU A C    3  
ATOM 5779  O O    . GLU A 1 87  ? 108.484 -15.496 -5.824  1.00 0.00 ? 87  GLU A O    3  
ATOM 5780  C CB   . GLU A 1 87  ? 107.544 -12.956 -7.851  1.00 0.00 ? 87  GLU A CB   3  
ATOM 5781  C CG   . GLU A 1 87  ? 106.595 -14.009 -8.362  1.00 0.00 ? 87  GLU A CG   3  
ATOM 5782  C CD   . GLU A 1 87  ? 105.359 -14.148 -7.509  1.00 0.00 ? 87  GLU A CD   3  
ATOM 5783  O OE1  . GLU A 1 87  ? 104.691 -13.125 -7.234  1.00 0.00 ? 87  GLU A OE1  3  
ATOM 5784  O OE2  . GLU A 1 87  ? 105.030 -15.280 -7.092  1.00 0.00 ? 87  GLU A OE2  3  
ATOM 5785  H H    . GLU A 1 87  ? 109.081 -11.379 -6.645  1.00 0.00 ? 87  GLU A H    3  
ATOM 5786  H HA   . GLU A 1 87  ? 107.280 -13.306 -5.766  1.00 0.00 ? 87  GLU A HA   3  
ATOM 5787  H HB2  . GLU A 1 87  ? 107.017 -12.014 -7.832  1.00 0.00 ? 87  GLU A HB2  3  
ATOM 5788  H HB3  . GLU A 1 87  ? 108.370 -12.878 -8.545  1.00 0.00 ? 87  GLU A HB3  3  
ATOM 5789  H HG2  . GLU A 1 87  ? 106.310 -13.769 -9.374  1.00 0.00 ? 87  GLU A HG2  3  
ATOM 5790  H HG3  . GLU A 1 87  ? 107.137 -14.945 -8.346  1.00 0.00 ? 87  GLU A HG3  3  
ATOM 5791  N N    . VAL A 1 88  ? 109.976 -14.561 -7.183  1.00 0.00 ? 88  VAL A N    3  
ATOM 5792  C CA   . VAL A 1 88  ? 110.767 -15.771 -7.324  1.00 0.00 ? 88  VAL A CA   3  
ATOM 5793  C C    . VAL A 1 88  ? 111.275 -16.253 -5.957  1.00 0.00 ? 88  VAL A C    3  
ATOM 5794  O O    . VAL A 1 88  ? 111.330 -17.477 -5.689  1.00 0.00 ? 88  VAL A O    3  
ATOM 5795  C CB   . VAL A 1 88  ? 111.946 -15.569 -8.303  1.00 0.00 ? 88  VAL A CB   3  
ATOM 5796  C CG1  . VAL A 1 88  ? 112.674 -16.878 -8.528  1.00 0.00 ? 88  VAL A CG1  3  
ATOM 5797  C CG2  . VAL A 1 88  ? 111.440 -15.010 -9.622  1.00 0.00 ? 88  VAL A CG2  3  
ATOM 5798  H H    . VAL A 1 88  ? 110.274 -13.730 -7.616  1.00 0.00 ? 88  VAL A H    3  
ATOM 5799  H HA   . VAL A 1 88  ? 110.111 -16.532 -7.722  1.00 0.00 ? 88  VAL A HA   3  
ATOM 5800  H HB   . VAL A 1 88  ? 112.637 -14.860 -7.873  1.00 0.00 ? 88  VAL A HB   3  
ATOM 5801  H HG11 . VAL A 1 88  ? 111.961 -17.592 -8.915  1.00 0.00 ? 88  VAL A HG11 3  
ATOM 5802  H HG12 . VAL A 1 88  ? 113.058 -17.236 -7.584  1.00 0.00 ? 88  VAL A HG12 3  
ATOM 5803  H HG13 . VAL A 1 88  ? 113.477 -16.741 -9.236  1.00 0.00 ? 88  VAL A HG13 3  
ATOM 5804  H HG21 . VAL A 1 88  ? 110.744 -15.710 -10.058 1.00 0.00 ? 88  VAL A HG21 3  
ATOM 5805  H HG22 . VAL A 1 88  ? 112.265 -14.845 -10.298 1.00 0.00 ? 88  VAL A HG22 3  
ATOM 5806  H HG23 . VAL A 1 88  ? 110.926 -14.077 -9.437  1.00 0.00 ? 88  VAL A HG23 3  
ATOM 5807  N N    . ILE A 1 89  ? 111.582 -15.301 -5.083  1.00 0.00 ? 89  ILE A N    3  
ATOM 5808  C CA   . ILE A 1 89  ? 112.031 -15.611 -3.738  1.00 0.00 ? 89  ILE A CA   3  
ATOM 5809  C C    . ILE A 1 89  ? 110.891 -16.249 -2.952  1.00 0.00 ? 89  ILE A C    3  
ATOM 5810  O O    . ILE A 1 89  ? 111.080 -17.276 -2.330  1.00 0.00 ? 89  ILE A O    3  
ATOM 5811  C CB   . ILE A 1 89  ? 112.540 -14.358 -2.972  1.00 0.00 ? 89  ILE A CB   3  
ATOM 5812  C CG1  . ILE A 1 89  ? 113.638 -13.641 -3.769  1.00 0.00 ? 89  ILE A CG1  3  
ATOM 5813  C CG2  . ILE A 1 89  ? 113.058 -14.751 -1.578  1.00 0.00 ? 89  ILE A CG2  3  
ATOM 5814  C CD1  . ILE A 1 89  ? 114.164 -12.390 -3.097  1.00 0.00 ? 89  ILE A CD1  3  
ATOM 5815  H H    . ILE A 1 89  ? 111.506 -14.362 -5.365  1.00 0.00 ? 89  ILE A H    3  
ATOM 5816  H HA   . ILE A 1 89  ? 112.837 -16.327 -3.820  1.00 0.00 ? 89  ILE A HA   3  
ATOM 5817  H HB   . ILE A 1 89  ? 111.705 -13.686 -2.839  1.00 0.00 ? 89  ILE A HB   3  
ATOM 5818  H HG12 . ILE A 1 89  ? 114.470 -14.314 -3.910  1.00 0.00 ? 89  ILE A HG12 3  
ATOM 5819  H HG13 . ILE A 1 89  ? 113.243 -13.360 -4.734  1.00 0.00 ? 89  ILE A HG13 3  
ATOM 5820  H HG21 . ILE A 1 89  ? 113.828 -15.503 -1.676  1.00 0.00 ? 89  ILE A HG21 3  
ATOM 5821  H HG22 . ILE A 1 89  ? 112.246 -15.124 -0.972  1.00 0.00 ? 89  ILE A HG22 3  
ATOM 5822  H HG23 . ILE A 1 89  ? 113.473 -13.877 -1.099  1.00 0.00 ? 89  ILE A HG23 3  
ATOM 5823  H HD11 . ILE A 1 89  ? 114.809 -11.832 -3.760  1.00 0.00 ? 89  ILE A HD11 3  
ATOM 5824  H HD12 . ILE A 1 89  ? 114.731 -12.690 -2.228  1.00 0.00 ? 89  ILE A HD12 3  
ATOM 5825  H HD13 . ILE A 1 89  ? 113.334 -11.780 -2.768  1.00 0.00 ? 89  ILE A HD13 3  
ATOM 5826  N N    . THR A 1 90  ? 109.690 -15.659 -3.035  1.00 0.00 ? 90  THR A N    3  
ATOM 5827  C CA   . THR A 1 90  ? 108.527 -16.181 -2.316  1.00 0.00 ? 90  THR A CA   3  
ATOM 5828  C C    . THR A 1 90  ? 108.225 -17.630 -2.742  1.00 0.00 ? 90  THR A C    3  
ATOM 5829  O O    . THR A 1 90  ? 107.796 -18.452 -1.940  1.00 0.00 ? 90  THR A O    3  
ATOM 5830  C CB   . THR A 1 90  ? 107.231 -15.297 -2.505  1.00 0.00 ? 90  THR A CB   3  
ATOM 5831  O OG1  . THR A 1 90  ? 106.795 -15.289 -3.865  1.00 0.00 ? 90  THR A OG1  3  
ATOM 5832  C CG2  . THR A 1 90  ? 107.447 -13.860 -2.076  1.00 0.00 ? 90  THR A CG2  3  
ATOM 5833  H H    . THR A 1 90  ? 109.595 -14.838 -3.570  1.00 0.00 ? 90  THR A H    3  
ATOM 5834  H HA   . THR A 1 90  ? 108.786 -16.191 -1.267  1.00 0.00 ? 90  THR A HA   3  
ATOM 5835  H HB   . THR A 1 90  ? 106.446 -15.723 -1.899  1.00 0.00 ? 90  THR A HB   3  
ATOM 5836  H HG1  . THR A 1 90  ? 107.551 -15.348 -4.467  1.00 0.00 ? 90  THR A HG1  3  
ATOM 5837  H HG21 . THR A 1 90  ? 106.527 -13.311 -2.206  1.00 0.00 ? 90  THR A HG21 3  
ATOM 5838  H HG22 . THR A 1 90  ? 108.207 -13.427 -2.709  1.00 0.00 ? 90  THR A HG22 3  
ATOM 5839  H HG23 . THR A 1 90  ? 107.760 -13.824 -1.043  1.00 0.00 ? 90  THR A HG23 3  
ATOM 5840  N N    . ASN A 1 91  ? 108.514 -17.940 -4.001  1.00 0.00 ? 91  ASN A N    3  
ATOM 5841  C CA   . ASN A 1 91  ? 108.229 -19.259 -4.541  1.00 0.00 ? 91  ASN A CA   3  
ATOM 5842  C C    . ASN A 1 91  ? 109.251 -20.271 -4.041  1.00 0.00 ? 91  ASN A C    3  
ATOM 5843  O O    . ASN A 1 91  ? 108.899 -21.374 -3.625  1.00 0.00 ? 91  ASN A O    3  
ATOM 5844  C CB   . ASN A 1 91  ? 108.254 -19.275 -6.089  1.00 0.00 ? 91  ASN A CB   3  
ATOM 5845  C CG   . ASN A 1 91  ? 107.425 -18.192 -6.782  1.00 0.00 ? 91  ASN A CG   3  
ATOM 5846  O OD1  . ASN A 1 91  ? 107.757 -17.780 -7.893  1.00 0.00 ? 91  ASN A OD1  3  
ATOM 5847  N ND2  . ASN A 1 91  ? 106.378 -17.713 -6.167  1.00 0.00 ? 91  ASN A ND2  3  
ATOM 5848  H H    . ASN A 1 91  ? 108.910 -17.248 -4.574  1.00 0.00 ? 91  ASN A H    3  
ATOM 5849  H HA   . ASN A 1 91  ? 107.246 -19.554 -4.208  1.00 0.00 ? 91  ASN A HA   3  
ATOM 5850  H HB2  . ASN A 1 91  ? 109.276 -19.155 -6.415  1.00 0.00 ? 91  ASN A HB2  3  
ATOM 5851  H HB3  . ASN A 1 91  ? 107.902 -20.240 -6.423  1.00 0.00 ? 91  ASN A HB3  3  
ATOM 5852  H HD21 . ASN A 1 91  ? 106.117 -18.049 -5.280  1.00 0.00 ? 91  ASN A HD21 3  
ATOM 5853  H HD22 . ASN A 1 91  ? 105.907 -16.979 -6.620  1.00 0.00 ? 91  ASN A HD22 3  
ATOM 5854  N N    . SER A 1 92  ? 110.507 -19.881 -4.034  1.00 0.00 ? 92  SER A N    3  
ATOM 5855  C CA   . SER A 1 92  ? 111.578 -20.801 -3.726  1.00 0.00 ? 92  SER A CA   3  
ATOM 5856  C C    . SER A 1 92  ? 112.101 -20.625 -2.301  1.00 0.00 ? 92  SER A C    3  
ATOM 5857  O O    . SER A 1 92  ? 113.107 -21.194 -1.959  1.00 0.00 ? 92  SER A O    3  
ATOM 5858  C CB   . SER A 1 92  ? 112.725 -20.623 -4.754  1.00 0.00 ? 92  SER A CB   3  
ATOM 5859  O OG   . SER A 1 92  ? 113.766 -21.598 -4.601  1.00 0.00 ? 92  SER A OG   3  
ATOM 5860  H H    . SER A 1 92  ? 110.726 -18.946 -4.237  1.00 0.00 ? 92  SER A H    3  
ATOM 5861  H HA   . SER A 1 92  ? 111.193 -21.804 -3.834  1.00 0.00 ? 92  SER A HA   3  
ATOM 5862  H HB2  . SER A 1 92  ? 112.320 -20.714 -5.751  1.00 0.00 ? 92  SER A HB2  3  
ATOM 5863  H HB3  . SER A 1 92  ? 113.151 -19.637 -4.638  1.00 0.00 ? 92  SER A HB3  3  
ATOM 5864  H HG   . SER A 1 92  ? 113.807 -21.845 -3.665  1.00 0.00 ? 92  SER A HG   3  
ATOM 5865  N N    . ILE A 1 93  ? 111.406 -19.889 -1.459  1.00 0.00 ? 93  ILE A N    3  
ATOM 5866  C CA   . ILE A 1 93  ? 111.915 -19.664 -0.101  1.00 0.00 ? 93  ILE A CA   3  
ATOM 5867  C C    . ILE A 1 93  ? 111.620 -20.891 0.774   1.00 0.00 ? 93  ILE A C    3  
ATOM 5868  O O    . ILE A 1 93  ? 112.253 -21.126 1.803   1.00 0.00 ? 93  ILE A O    3  
ATOM 5869  C CB   . ILE A 1 93  ? 111.328 -18.374 0.540   1.00 0.00 ? 93  ILE A CB   3  
ATOM 5870  C CG1  . ILE A 1 93  ? 112.191 -17.930 1.717   1.00 0.00 ? 93  ILE A CG1  3  
ATOM 5871  C CG2  . ILE A 1 93  ? 109.892 -18.579 0.979   1.00 0.00 ? 93  ILE A CG2  3  
ATOM 5872  C CD1  . ILE A 1 93  ? 113.561 -17.432 1.296   1.00 0.00 ? 93  ILE A CD1  3  
ATOM 5873  H H    . ILE A 1 93  ? 110.572 -19.461 -1.748  1.00 0.00 ? 93  ILE A H    3  
ATOM 5874  H HA   . ILE A 1 93  ? 112.990 -19.568 -0.180  1.00 0.00 ? 93  ILE A HA   3  
ATOM 5875  H HB   . ILE A 1 93  ? 111.341 -17.595 -0.207  1.00 0.00 ? 93  ILE A HB   3  
ATOM 5876  H HG12 . ILE A 1 93  ? 111.691 -17.128 2.241   1.00 0.00 ? 93  ILE A HG12 3  
ATOM 5877  H HG13 . ILE A 1 93  ? 112.331 -18.763 2.390   1.00 0.00 ? 93  ILE A HG13 3  
ATOM 5878  H HG21 . ILE A 1 93  ? 109.322 -18.925 0.127   1.00 0.00 ? 93  ILE A HG21 3  
ATOM 5879  H HG22 . ILE A 1 93  ? 109.479 -17.654 1.352   1.00 0.00 ? 93  ILE A HG22 3  
ATOM 5880  H HG23 . ILE A 1 93  ? 109.864 -19.336 1.750   1.00 0.00 ? 93  ILE A HG23 3  
ATOM 5881  H HD11 . ILE A 1 93  ? 114.053 -18.178 0.690   1.00 0.00 ? 93  ILE A HD11 3  
ATOM 5882  H HD12 . ILE A 1 93  ? 114.164 -17.251 2.175   1.00 0.00 ? 93  ILE A HD12 3  
ATOM 5883  H HD13 . ILE A 1 93  ? 113.459 -16.510 0.740   1.00 0.00 ? 93  ILE A HD13 3  
ATOM 5884  N N    . THR A 1 94  ? 110.636 -21.653 0.342   1.00 0.00 ? 94  THR A N    3  
ATOM 5885  C CA   . THR A 1 94  ? 110.265 -22.911 0.960   1.00 0.00 ? 94  THR A CA   3  
ATOM 5886  C C    . THR A 1 94  ? 111.369 -23.978 0.711   1.00 0.00 ? 94  THR A C    3  
ATOM 5887  O O    . THR A 1 94  ? 111.451 -24.992 1.403   1.00 0.00 ? 94  THR A O    3  
ATOM 5888  C CB   . THR A 1 94  ? 108.883 -23.384 0.402   1.00 0.00 ? 94  THR A CB   3  
ATOM 5889  O OG1  . THR A 1 94  ? 108.426 -24.584 1.046   1.00 0.00 ? 94  THR A OG1  3  
ATOM 5890  C CG2  . THR A 1 94  ? 108.943 -23.592 -1.110  1.00 0.00 ? 94  THR A CG2  3  
ATOM 5891  H H    . THR A 1 94  ? 110.098 -21.303 -0.399  1.00 0.00 ? 94  THR A H    3  
ATOM 5892  H HA   . THR A 1 94  ? 110.175 -22.745 2.024   1.00 0.00 ? 94  THR A HA   3  
ATOM 5893  H HB   . THR A 1 94  ? 108.166 -22.603 0.607   1.00 0.00 ? 94  THR A HB   3  
ATOM 5894  H HG1  . THR A 1 94  ? 108.805 -25.357 0.591   1.00 0.00 ? 94  THR A HG1  3  
ATOM 5895  H HG21 . THR A 1 94  ? 109.673 -24.354 -1.342  1.00 0.00 ? 94  THR A HG21 3  
ATOM 5896  H HG22 . THR A 1 94  ? 109.238 -22.661 -1.574  1.00 0.00 ? 94  THR A HG22 3  
ATOM 5897  H HG23 . THR A 1 94  ? 107.971 -23.890 -1.476  1.00 0.00 ? 94  THR A HG23 3  
ATOM 5898  N N    . GLN A 1 95  ? 112.217 -23.717 -0.264  1.00 0.00 ? 95  GLN A N    3  
ATOM 5899  C CA   . GLN A 1 95  ? 113.337 -24.571 -0.596  1.00 0.00 ? 95  GLN A CA   3  
ATOM 5900  C C    . GLN A 1 95  ? 114.458 -23.704 -1.163  1.00 0.00 ? 95  GLN A C    3  
ATOM 5901  O O    . GLN A 1 95  ? 114.729 -23.694 -2.373  1.00 0.00 ? 95  GLN A O    3  
ATOM 5902  C CB   . GLN A 1 95  ? 112.930 -25.706 -1.554  1.00 0.00 ? 95  GLN A CB   3  
ATOM 5903  C CG   . GLN A 1 95  ? 112.235 -25.261 -2.840  1.00 0.00 ? 95  GLN A CG   3  
ATOM 5904  C CD   . GLN A 1 95  ? 111.881 -26.430 -3.721  1.00 0.00 ? 95  GLN A CD   3  
ATOM 5905  O OE1  . GLN A 1 95  ? 112.562 -27.461 -3.706  1.00 0.00 ? 95  GLN A OE1  3  
ATOM 5906  N NE2  . GLN A 1 95  ? 110.847 -26.289 -4.491  1.00 0.00 ? 95  GLN A NE2  3  
ATOM 5907  H H    . GLN A 1 95  ? 112.125 -22.882 -0.769  1.00 0.00 ? 95  GLN A H    3  
ATOM 5908  H HA   . GLN A 1 95  ? 113.690 -24.988 0.337   1.00 0.00 ? 95  GLN A HA   3  
ATOM 5909  H HB2  . GLN A 1 95  ? 113.816 -26.255 -1.834  1.00 0.00 ? 95  GLN A HB2  3  
ATOM 5910  H HB3  . GLN A 1 95  ? 112.265 -26.374 -1.026  1.00 0.00 ? 95  GLN A HB3  3  
ATOM 5911  H HG2  . GLN A 1 95  ? 111.329 -24.733 -2.582  1.00 0.00 ? 95  GLN A HG2  3  
ATOM 5912  H HG3  . GLN A 1 95  ? 112.896 -24.600 -3.382  1.00 0.00 ? 95  GLN A HG3  3  
ATOM 5913  H HE21 . GLN A 1 95  ? 110.354 -25.434 -4.466  1.00 0.00 ? 95  GLN A HE21 3  
ATOM 5914  H HE22 . GLN A 1 95  ? 110.567 -27.033 -5.074  1.00 0.00 ? 95  GLN A HE22 3  
ATOM 5915  N N    . PRO A 1 96  ? 115.081 -22.908 -0.302  1.00 0.00 ? 96  PRO A N    3  
ATOM 5916  C CA   . PRO A 1 96  ? 116.033 -21.915 -0.727  1.00 0.00 ? 96  PRO A CA   3  
ATOM 5917  C C    . PRO A 1 96  ? 117.383 -22.484 -1.100  1.00 0.00 ? 96  PRO A C    3  
ATOM 5918  O O    . PRO A 1 96  ? 117.733 -23.637 -0.756  1.00 0.00 ? 96  PRO A O    3  
ATOM 5919  C CB   . PRO A 1 96  ? 116.140 -20.984 0.471   1.00 0.00 ? 96  PRO A CB   3  
ATOM 5920  C CG   . PRO A 1 96  ? 115.831 -21.837 1.648   1.00 0.00 ? 96  PRO A CG   3  
ATOM 5921  C CD   . PRO A 1 96  ? 114.923 -22.927 1.167   1.00 0.00 ? 96  PRO A CD   3  
ATOM 5922  H HA   . PRO A 1 96  ? 115.652 -21.355 -1.568  1.00 0.00 ? 96  PRO A HA   3  
ATOM 5923  H HB2  . PRO A 1 96  ? 117.140 -20.583 0.526   1.00 0.00 ? 96  PRO A HB2  3  
ATOM 5924  H HB3  . PRO A 1 96  ? 115.427 -20.179 0.373   1.00 0.00 ? 96  PRO A HB3  3  
ATOM 5925  H HG2  . PRO A 1 96  ? 116.745 -22.259 2.041   1.00 0.00 ? 96  PRO A HG2  3  
ATOM 5926  H HG3  . PRO A 1 96  ? 115.336 -21.247 2.405   1.00 0.00 ? 96  PRO A HG3  3  
ATOM 5927  H HD2  . PRO A 1 96  ? 115.226 -23.883 1.570   1.00 0.00 ? 96  PRO A HD2  3  
ATOM 5928  H HD3  . PRO A 1 96  ? 113.901 -22.713 1.442   1.00 0.00 ? 96  PRO A HD3  3  
ATOM 5929  N N    . THR A 1 97  ? 118.123 -21.684 -1.782  1.00 0.00 ? 97  THR A N    3  
ATOM 5930  C CA   . THR A 1 97  ? 119.426 -21.995 -2.236  1.00 0.00 ? 97  THR A CA   3  
ATOM 5931  C C    . THR A 1 97  ? 120.338 -20.902 -1.798  1.00 0.00 ? 97  THR A C    3  
ATOM 5932  O O    . THR A 1 97  ? 119.880 -19.896 -1.244  1.00 0.00 ? 97  THR A O    3  
ATOM 5933  C CB   . THR A 1 97  ? 119.466 -22.154 -3.771  1.00 0.00 ? 97  THR A CB   3  
ATOM 5934  O OG1  . THR A 1 97  ? 118.820 -21.037 -4.422  1.00 0.00 ? 97  THR A OG1  3  
ATOM 5935  C CG2  . THR A 1 97  ? 118.831 -23.452 -4.206  1.00 0.00 ? 97  THR A CG2  3  
ATOM 5936  H H    . THR A 1 97  ? 117.803 -20.769 -1.966  1.00 0.00 ? 97  THR A H    3  
ATOM 5937  H HA   . THR A 1 97  ? 119.809 -22.894 -1.772  1.00 0.00 ? 97  THR A HA   3  
ATOM 5938  H HB   . THR A 1 97  ? 120.505 -22.155 -4.070  1.00 0.00 ? 97  THR A HB   3  
ATOM 5939  H HG1  . THR A 1 97  ? 117.867 -21.037 -4.254  1.00 0.00 ? 97  THR A HG1  3  
ATOM 5940  H HG21 . THR A 1 97  ? 118.865 -23.529 -5.283  1.00 0.00 ? 97  THR A HG21 3  
ATOM 5941  H HG22 . THR A 1 97  ? 117.809 -23.491 -3.861  1.00 0.00 ? 97  THR A HG22 3  
ATOM 5942  H HG23 . THR A 1 97  ? 119.398 -24.260 -3.769  1.00 0.00 ? 97  THR A HG23 3  
ATOM 5943  N N    . LEU A 1 98  ? 121.596 -21.065 -2.068  1.00 0.00 ? 98  LEU A N    3  
ATOM 5944  C CA   . LEU A 1 98  ? 122.606 -20.151 -1.608  1.00 0.00 ? 98  LEU A CA   3  
ATOM 5945  C C    . LEU A 1 98  ? 122.439 -18.758 -2.216  1.00 0.00 ? 98  LEU A C    3  
ATOM 5946  O O    . LEU A 1 98  ? 122.904 -17.761 -1.665  1.00 0.00 ? 98  LEU A O    3  
ATOM 5947  C CB   . LEU A 1 98  ? 123.977 -20.703 -1.941  1.00 0.00 ? 98  LEU A CB   3  
ATOM 5948  C CG   . LEU A 1 98  ? 125.076 -20.236 -1.029  1.00 0.00 ? 98  LEU A CG   3  
ATOM 5949  C CD1  . LEU A 1 98  ? 124.753 -20.708 0.367   1.00 0.00 ? 98  LEU A CD1  3  
ATOM 5950  C CD2  . LEU A 1 98  ? 126.412 -20.781 -1.484  1.00 0.00 ? 98  LEU A CD2  3  
ATOM 5951  H H    . LEU A 1 98  ? 121.868 -21.860 -2.586  1.00 0.00 ? 98  LEU A H    3  
ATOM 5952  H HA   . LEU A 1 98  ? 122.527 -20.074 -0.534  1.00 0.00 ? 98  LEU A HA   3  
ATOM 5953  H HB2  . LEU A 1 98  ? 123.929 -21.781 -1.899  1.00 0.00 ? 98  LEU A HB2  3  
ATOM 5954  H HB3  . LEU A 1 98  ? 124.227 -20.408 -2.950  1.00 0.00 ? 98  LEU A HB3  3  
ATOM 5955  H HG   . LEU A 1 98  ? 125.115 -19.156 -1.027  1.00 0.00 ? 98  LEU A HG   3  
ATOM 5956  H HD11 . LEU A 1 98  ? 125.503 -20.387 1.073   1.00 0.00 ? 98  LEU A HD11 3  
ATOM 5957  H HD12 . LEU A 1 98  ? 124.680 -21.788 0.353   1.00 0.00 ? 98  LEU A HD12 3  
ATOM 5958  H HD13 . LEU A 1 98  ? 123.782 -20.326 0.650   1.00 0.00 ? 98  LEU A HD13 3  
ATOM 5959  H HD21 . LEU A 1 98  ? 126.620 -20.430 -2.483  1.00 0.00 ? 98  LEU A HD21 3  
ATOM 5960  H HD22 . LEU A 1 98  ? 126.367 -21.861 -1.486  1.00 0.00 ? 98  LEU A HD22 3  
ATOM 5961  H HD23 . LEU A 1 98  ? 127.190 -20.451 -0.812  1.00 0.00 ? 98  LEU A HD23 3  
ATOM 5962  N N    . HIS A 1 99  ? 121.791 -18.685 -3.351  1.00 0.00 ? 99  HIS A N    3  
ATOM 5963  C CA   . HIS A 1 99  ? 121.581 -17.425 -4.014  1.00 0.00 ? 99  HIS A CA   3  
ATOM 5964  C C    . HIS A 1 99  ? 120.100 -17.131 -4.220  1.00 0.00 ? 99  HIS A C    3  
ATOM 5965  O O    . HIS A 1 99  ? 119.687 -16.637 -5.273  1.00 0.00 ? 99  HIS A O    3  
ATOM 5966  C CB   . HIS A 1 99  ? 122.389 -17.337 -5.328  1.00 0.00 ? 99  HIS A CB   3  
ATOM 5967  C CG   . HIS A 1 99  ? 123.865 -17.135 -5.108  1.00 0.00 ? 99  HIS A CG   3  
ATOM 5968  N ND1  . HIS A 1 99  ? 124.525 -15.979 -5.439  1.00 0.00 ? 99  HIS A ND1  3  
ATOM 5969  C CD2  . HIS A 1 99  ? 124.799 -17.933 -4.543  1.00 0.00 ? 99  HIS A CD2  3  
ATOM 5970  C CE1  . HIS A 1 99  ? 125.779 -16.070 -5.077  1.00 0.00 ? 99  HIS A CE1  3  
ATOM 5971  N NE2  . HIS A 1 99  ? 125.970 -17.242 -4.536  1.00 0.00 ? 99  HIS A NE2  3  
ATOM 5972  H H    . HIS A 1 99  ? 121.435 -19.506 -3.759  1.00 0.00 ? 99  HIS A H    3  
ATOM 5973  H HA   . HIS A 1 99  ? 121.959 -16.671 -3.338  1.00 0.00 ? 99  HIS A HA   3  
ATOM 5974  H HB2  . HIS A 1 99  ? 122.261 -18.255 -5.885  1.00 0.00 ? 99  HIS A HB2  3  
ATOM 5975  H HB3  . HIS A 1 99  ? 122.020 -16.510 -5.916  1.00 0.00 ? 99  HIS A HB3  3  
ATOM 5976  H HD1  . HIS A 1 99  ? 124.158 -15.199 -5.928  1.00 0.00 ? 99  HIS A HD1  3  
ATOM 5977  H HD2  . HIS A 1 99  ? 124.642 -18.934 -4.166  1.00 0.00 ? 99  HIS A HD2  3  
ATOM 5978  H HE1  . HIS A 1 99  ? 126.524 -15.292 -5.179  1.00 0.00 ? 99  HIS A HE1  3  
ATOM 5979  H HE2  . HIS A 1 99  ? 126.861 -17.641 -4.365  1.00 0.00 ? 99  HIS A HE2  3  
ATOM 5980  N N    . SER A 1 100 ? 119.298 -17.400 -3.197  1.00 0.00 ? 100 SER A N    3  
ATOM 5981  C CA   . SER A 1 100 ? 117.881 -17.065 -3.232  1.00 0.00 ? 100 SER A CA   3  
ATOM 5982  C C    . SER A 1 100 ? 117.658 -15.539 -3.224  1.00 0.00 ? 100 SER A C    3  
ATOM 5983  O O    . SER A 1 100 ? 116.645 -15.051 -3.715  1.00 0.00 ? 100 SER A O    3  
ATOM 5984  C CB   . SER A 1 100 ? 117.116 -17.751 -2.080  1.00 0.00 ? 100 SER A CB   3  
ATOM 5985  O OG   . SER A 1 100 ? 117.146 -19.162 -2.245  1.00 0.00 ? 100 SER A OG   3  
ATOM 5986  H H    . SER A 1 100 ? 119.655 -17.846 -2.397  1.00 0.00 ? 100 SER A H    3  
ATOM 5987  H HA   . SER A 1 100 ? 117.501 -17.443 -4.170  1.00 0.00 ? 100 SER A HA   3  
ATOM 5988  H HB2  . SER A 1 100 ? 117.550 -17.511 -1.117  1.00 0.00 ? 100 SER A HB2  3  
ATOM 5989  H HB3  . SER A 1 100 ? 116.084 -17.433 -2.086  1.00 0.00 ? 100 SER A HB3  3  
ATOM 5990  H HG   . SER A 1 100 ? 116.773 -19.357 -3.120  1.00 0.00 ? 100 SER A HG   3  
ATOM 5991  N N    . PHE A 1 101 ? 118.623 -14.791 -2.714  1.00 0.00 ? 101 PHE A N    3  
ATOM 5992  C CA   . PHE A 1 101 ? 118.503 -13.339 -2.666  1.00 0.00 ? 101 PHE A CA   3  
ATOM 5993  C C    . PHE A 1 101 ? 119.507 -12.699 -3.623  1.00 0.00 ? 101 PHE A C    3  
ATOM 5994  O O    . PHE A 1 101 ? 119.761 -11.506 -3.557  1.00 0.00 ? 101 PHE A O    3  
ATOM 5995  C CB   . PHE A 1 101 ? 118.751 -12.820 -1.245  1.00 0.00 ? 101 PHE A CB   3  
ATOM 5996  C CG   . PHE A 1 101 ? 117.923 -13.485 -0.189  1.00 0.00 ? 101 PHE A CG   3  
ATOM 5997  C CD1  . PHE A 1 101 ? 116.597 -13.142 -0.004  1.00 0.00 ? 101 PHE A CD1  3  
ATOM 5998  C CD2  . PHE A 1 101 ? 118.480 -14.455 0.625   1.00 0.00 ? 101 PHE A CD2  3  
ATOM 5999  C CE1  . PHE A 1 101 ? 115.843 -13.758 0.973   1.00 0.00 ? 101 PHE A CE1  3  
ATOM 6000  C CE2  . PHE A 1 101 ? 117.732 -15.068 1.597   1.00 0.00 ? 101 PHE A CE2  3  
ATOM 6001  C CZ   . PHE A 1 101 ? 116.412 -14.719 1.769   1.00 0.00 ? 101 PHE A CZ   3  
ATOM 6002  H H    . PHE A 1 101 ? 119.440 -15.208 -2.351  1.00 0.00 ? 101 PHE A H    3  
ATOM 6003  H HA   . PHE A 1 101 ? 117.503 -13.073 -2.971  1.00 0.00 ? 101 PHE A HA   3  
ATOM 6004  H HB2  . PHE A 1 101 ? 119.789 -12.975 -0.993  1.00 0.00 ? 101 PHE A HB2  3  
ATOM 6005  H HB3  . PHE A 1 101 ? 118.540 -11.761 -1.221  1.00 0.00 ? 101 PHE A HB3  3  
ATOM 6006  H HD1  . PHE A 1 101 ? 116.149 -12.387 -0.634  1.00 0.00 ? 101 PHE A HD1  3  
ATOM 6007  H HD2  . PHE A 1 101 ? 119.516 -14.729 0.489   1.00 0.00 ? 101 PHE A HD2  3  
ATOM 6008  H HE1  . PHE A 1 101 ? 114.808 -13.493 1.123   1.00 0.00 ? 101 PHE A HE1  3  
ATOM 6009  H HE2  . PHE A 1 101 ? 118.173 -15.825 2.228   1.00 0.00 ? 101 PHE A HE2  3  
ATOM 6010  H HZ   . PHE A 1 101 ? 115.824 -15.203 2.534   1.00 0.00 ? 101 PHE A HZ   3  
ATOM 6011  N N    . ASP A 1 102 ? 120.023 -13.499 -4.552  1.00 0.00 ? 102 ASP A N    3  
ATOM 6012  C CA   . ASP A 1 102 ? 121.070 -13.055 -5.501  1.00 0.00 ? 102 ASP A CA   3  
ATOM 6013  C C    . ASP A 1 102 ? 120.609 -11.898 -6.377  1.00 0.00 ? 102 ASP A C    3  
ATOM 6014  O O    . ASP A 1 102 ? 121.332 -10.911 -6.566  1.00 0.00 ? 102 ASP A O    3  
ATOM 6015  C CB   . ASP A 1 102 ? 121.503 -14.208 -6.390  1.00 0.00 ? 102 ASP A CB   3  
ATOM 6016  C CG   . ASP A 1 102 ? 122.611 -13.836 -7.343  1.00 0.00 ? 102 ASP A CG   3  
ATOM 6017  O OD1  . ASP A 1 102 ? 123.791 -13.938 -6.954  1.00 0.00 ? 102 ASP A OD1  3  
ATOM 6018  O OD2  . ASP A 1 102 ? 122.321 -13.465 -8.496  1.00 0.00 ? 102 ASP A OD2  3  
ATOM 6019  H H    . ASP A 1 102 ? 119.678 -14.416 -4.607  1.00 0.00 ? 102 ASP A H    3  
ATOM 6020  H HA   . ASP A 1 102 ? 121.922 -12.732 -4.922  1.00 0.00 ? 102 ASP A HA   3  
ATOM 6021  H HB2  . ASP A 1 102 ? 121.850 -15.022 -5.770  1.00 0.00 ? 102 ASP A HB2  3  
ATOM 6022  H HB3  . ASP A 1 102 ? 120.652 -14.542 -6.966  1.00 0.00 ? 102 ASP A HB3  3  
ATOM 6023  N N    . ALA A 1 103 ? 119.405 -12.003 -6.887  1.00 0.00 ? 103 ALA A N    3  
ATOM 6024  C CA   . ALA A 1 103 ? 118.878 -10.981 -7.762  1.00 0.00 ? 103 ALA A CA   3  
ATOM 6025  C C    . ALA A 1 103 ? 118.477 -9.784  -6.950  1.00 0.00 ? 103 ALA A C    3  
ATOM 6026  O O    . ALA A 1 103 ? 118.664 -8.643  -7.369  1.00 0.00 ? 103 ALA A O    3  
ATOM 6027  C CB   . ALA A 1 103 ? 117.700 -11.496 -8.561  1.00 0.00 ? 103 ALA A CB   3  
ATOM 6028  H H    . ALA A 1 103 ? 118.843 -12.769 -6.642  1.00 0.00 ? 103 ALA A H    3  
ATOM 6029  H HA   . ALA A 1 103 ? 119.663 -10.693 -8.445  1.00 0.00 ? 103 ALA A HA   3  
ATOM 6030  H HB1  . ALA A 1 103 ? 116.907 -11.780 -7.885  1.00 0.00 ? 103 ALA A HB1  3  
ATOM 6031  H HB2  . ALA A 1 103 ? 118.006 -12.355 -9.141  1.00 0.00 ? 103 ALA A HB2  3  
ATOM 6032  H HB3  . ALA A 1 103 ? 117.348 -10.719 -9.224  1.00 0.00 ? 103 ALA A HB3  3  
ATOM 6033  N N    . ALA A 1 104 ? 117.963 -10.049 -5.766  1.00 0.00 ? 104 ALA A N    3  
ATOM 6034  C CA   . ALA A 1 104 ? 117.541 -9.003  -4.864  1.00 0.00 ? 104 ALA A CA   3  
ATOM 6035  C C    . ALA A 1 104 ? 118.729 -8.166  -4.419  1.00 0.00 ? 104 ALA A C    3  
ATOM 6036  O O    . ALA A 1 104 ? 118.628 -6.945  -4.296  1.00 0.00 ? 104 ALA A O    3  
ATOM 6037  C CB   . ALA A 1 104 ? 116.774 -9.582  -3.693  1.00 0.00 ? 104 ALA A CB   3  
ATOM 6038  H H    . ALA A 1 104 ? 117.855 -10.992 -5.508  1.00 0.00 ? 104 ALA A H    3  
ATOM 6039  H HA   . ALA A 1 104 ? 116.877 -8.360  -5.424  1.00 0.00 ? 104 ALA A HA   3  
ATOM 6040  H HB1  . ALA A 1 104 ? 117.424 -10.170 -3.061  1.00 0.00 ? 104 ALA A HB1  3  
ATOM 6041  H HB2  . ALA A 1 104 ? 115.987 -10.206 -4.100  1.00 0.00 ? 104 ALA A HB2  3  
ATOM 6042  H HB3  . ALA A 1 104 ? 116.330 -8.769  -3.138  1.00 0.00 ? 104 ALA A HB3  3  
ATOM 6043  N N    . GLN A 1 105 ? 119.856 -8.839  -4.227  1.00 0.00 ? 105 GLN A N    3  
ATOM 6044  C CA   . GLN A 1 105 ? 121.132 -8.216  -3.917  1.00 0.00 ? 105 GLN A CA   3  
ATOM 6045  C C    . GLN A 1 105 ? 121.455 -7.204  -5.008  1.00 0.00 ? 105 GLN A C    3  
ATOM 6046  O O    . GLN A 1 105 ? 121.709 -6.028  -4.732  1.00 0.00 ? 105 GLN A O    3  
ATOM 6047  C CB   . GLN A 1 105 ? 122.222 -9.334  -3.831  1.00 0.00 ? 105 GLN A CB   3  
ATOM 6048  C CG   . GLN A 1 105 ? 123.659 -8.905  -3.472  1.00 0.00 ? 105 GLN A CG   3  
ATOM 6049  C CD   . GLN A 1 105 ? 124.420 -8.190  -4.585  1.00 0.00 ? 105 GLN A CD   3  
ATOM 6050  O OE1  . GLN A 1 105 ? 124.203 -8.435  -5.786  1.00 0.00 ? 105 GLN A OE1  3  
ATOM 6051  N NE2  . GLN A 1 105 ? 125.313 -7.324  -4.206  1.00 0.00 ? 105 GLN A NE2  3  
ATOM 6052  H H    . GLN A 1 105 ? 119.821 -9.822  -4.269  1.00 0.00 ? 105 GLN A H    3  
ATOM 6053  H HA   . GLN A 1 105 ? 121.056 -7.717  -2.962  1.00 0.00 ? 105 GLN A HA   3  
ATOM 6054  H HB2  . GLN A 1 105 ? 121.910 -10.052 -3.087  1.00 0.00 ? 105 GLN A HB2  3  
ATOM 6055  H HB3  . GLN A 1 105 ? 122.250 -9.837  -4.787  1.00 0.00 ? 105 GLN A HB3  3  
ATOM 6056  H HG2  . GLN A 1 105 ? 123.613 -8.237  -2.625  1.00 0.00 ? 105 GLN A HG2  3  
ATOM 6057  H HG3  . GLN A 1 105 ? 124.212 -9.788  -3.187  1.00 0.00 ? 105 GLN A HG3  3  
ATOM 6058  H HE21 . GLN A 1 105 ? 125.431 -7.189  -3.243  1.00 0.00 ? 105 GLN A HE21 3  
ATOM 6059  H HE22 . GLN A 1 105 ? 125.841 -6.854  -4.893  1.00 0.00 ? 105 GLN A HE22 3  
ATOM 6060  N N    . SER A 1 106 ? 121.378 -7.657  -6.246  1.00 0.00 ? 106 SER A N    3  
ATOM 6061  C CA   . SER A 1 106 ? 121.685 -6.832  -7.381  1.00 0.00 ? 106 SER A CA   3  
ATOM 6062  C C    . SER A 1 106 ? 120.686 -5.679  -7.534  1.00 0.00 ? 106 SER A C    3  
ATOM 6063  O O    . SER A 1 106 ? 121.069 -4.581  -7.927  1.00 0.00 ? 106 SER A O    3  
ATOM 6064  C CB   . SER A 1 106 ? 121.769 -7.695  -8.629  1.00 0.00 ? 106 SER A CB   3  
ATOM 6065  O OG   . SER A 1 106 ? 122.752 -8.717  -8.434  1.00 0.00 ? 106 SER A OG   3  
ATOM 6066  H H    . SER A 1 106 ? 121.103 -8.590  -6.391  1.00 0.00 ? 106 SER A H    3  
ATOM 6067  H HA   . SER A 1 106 ? 122.659 -6.400  -7.200  1.00 0.00 ? 106 SER A HA   3  
ATOM 6068  H HB2  . SER A 1 106 ? 120.810 -8.154  -8.819  1.00 0.00 ? 106 SER A HB2  3  
ATOM 6069  H HB3  . SER A 1 106 ? 122.062 -7.090  -9.475  1.00 0.00 ? 106 SER A HB3  3  
ATOM 6070  H HG   . SER A 1 106 ? 123.074 -8.628  -7.525  1.00 0.00 ? 106 SER A HG   3  
ATOM 6071  N N    . ARG A 1 107 ? 119.419 -5.927  -7.189  1.00 0.00 ? 107 ARG A N    3  
ATOM 6072  C CA   . ARG A 1 107 ? 118.395 -4.889  -7.220  1.00 0.00 ? 107 ARG A CA   3  
ATOM 6073  C C    . ARG A 1 107 ? 118.743 -3.772  -6.267  1.00 0.00 ? 107 ARG A C    3  
ATOM 6074  O O    . ARG A 1 107 ? 118.838 -2.631  -6.661  1.00 0.00 ? 107 ARG A O    3  
ATOM 6075  C CB   . ARG A 1 107 ? 117.012 -5.438  -6.866  1.00 0.00 ? 107 ARG A CB   3  
ATOM 6076  C CG   . ARG A 1 107 ? 116.451 -6.447  -7.849  1.00 0.00 ? 107 ARG A CG   3  
ATOM 6077  C CD   . ARG A 1 107 ? 116.303 -5.865  -9.242  1.00 0.00 ? 107 ARG A CD   3  
ATOM 6078  N NE   . ARG A 1 107 ? 115.359 -4.739  -9.300  1.00 0.00 ? 107 ARG A NE   3  
ATOM 6079  C CZ   . ARG A 1 107 ? 114.944 -4.169  -10.440 1.00 0.00 ? 107 ARG A CZ   3  
ATOM 6080  N NH1  . ARG A 1 107 ? 115.468 -4.559  -11.608 1.00 0.00 ? 107 ARG A NH1  3  
ATOM 6081  N NH2  . ARG A 1 107 ? 114.020 -3.209  -10.418 1.00 0.00 ? 107 ARG A NH2  3  
ATOM 6082  H H    . ARG A 1 107 ? 119.180 -6.840  -6.913  1.00 0.00 ? 107 ARG A H    3  
ATOM 6083  H HA   . ARG A 1 107 ? 118.353 -4.476  -8.214  1.00 0.00 ? 107 ARG A HA   3  
ATOM 6084  H HB2  . ARG A 1 107 ? 117.067 -5.914  -5.899  1.00 0.00 ? 107 ARG A HB2  3  
ATOM 6085  H HB3  . ARG A 1 107 ? 116.322 -4.609  -6.802  1.00 0.00 ? 107 ARG A HB3  3  
ATOM 6086  H HG2  . ARG A 1 107 ? 117.111 -7.301  -7.894  1.00 0.00 ? 107 ARG A HG2  3  
ATOM 6087  H HG3  . ARG A 1 107 ? 115.480 -6.761  -7.490  1.00 0.00 ? 107 ARG A HG3  3  
ATOM 6088  H HD2  . ARG A 1 107 ? 117.270 -5.520  -9.576  1.00 0.00 ? 107 ARG A HD2  3  
ATOM 6089  H HD3  . ARG A 1 107 ? 115.957 -6.645  -9.903  1.00 0.00 ? 107 ARG A HD3  3  
ATOM 6090  H HE   . ARG A 1 107 ? 115.003 -4.431  -8.429  1.00 0.00 ? 107 ARG A HE   3  
ATOM 6091  H HH11 . ARG A 1 107 ? 116.183 -5.266  -11.675 1.00 0.00 ? 107 ARG A HH11 3  
ATOM 6092  H HH12 . ARG A 1 107 ? 115.158 -4.183  -12.493 1.00 0.00 ? 107 ARG A HH12 3  
ATOM 6093  H HH21 . ARG A 1 107 ? 113.589 -2.871  -9.573  1.00 0.00 ? 107 ARG A HH21 3  
ATOM 6094  H HH22 . ARG A 1 107 ? 113.718 -2.752  -11.261 1.00 0.00 ? 107 ARG A HH22 3  
ATOM 6095  N N    . VAL A 1 108 ? 118.992 -4.121  -5.031  1.00 0.00 ? 108 VAL A N    3  
ATOM 6096  C CA   . VAL A 1 108 ? 119.279 -3.142  -3.997  1.00 0.00 ? 108 VAL A CA   3  
ATOM 6097  C C    . VAL A 1 108 ? 120.582 -2.398  -4.270  1.00 0.00 ? 108 VAL A C    3  
ATOM 6098  O O    . VAL A 1 108 ? 120.689 -1.190  -4.028  1.00 0.00 ? 108 VAL A O    3  
ATOM 6099  C CB   . VAL A 1 108 ? 119.282 -3.791  -2.614  1.00 0.00 ? 108 VAL A CB   3  
ATOM 6100  C CG1  . VAL A 1 108 ? 119.540 -2.765  -1.549  1.00 0.00 ? 108 VAL A CG1  3  
ATOM 6101  C CG2  . VAL A 1 108 ? 117.951 -4.457  -2.381  1.00 0.00 ? 108 VAL A CG2  3  
ATOM 6102  H H    . VAL A 1 108 ? 118.977 -5.079  -4.799  1.00 0.00 ? 108 VAL A H    3  
ATOM 6103  H HA   . VAL A 1 108 ? 118.480 -2.415  -4.030  1.00 0.00 ? 108 VAL A HA   3  
ATOM 6104  H HB   . VAL A 1 108 ? 120.049 -4.550  -2.574  1.00 0.00 ? 108 VAL A HB   3  
ATOM 6105  H HG11 . VAL A 1 108 ? 118.775 -2.005  -1.632  1.00 0.00 ? 108 VAL A HG11 3  
ATOM 6106  H HG12 . VAL A 1 108 ? 120.520 -2.327  -1.688  1.00 0.00 ? 108 VAL A HG12 3  
ATOM 6107  H HG13 . VAL A 1 108 ? 119.478 -3.236  -0.578  1.00 0.00 ? 108 VAL A HG13 3  
ATOM 6108  H HG21 . VAL A 1 108 ? 117.174 -3.709  -2.426  1.00 0.00 ? 108 VAL A HG21 3  
ATOM 6109  H HG22 . VAL A 1 108 ? 117.942 -4.948  -1.420  1.00 0.00 ? 108 VAL A HG22 3  
ATOM 6110  H HG23 . VAL A 1 108 ? 117.790 -5.179  -3.168  1.00 0.00 ? 108 VAL A HG23 3  
ATOM 6111  N N    . TYR A 1 109 ? 121.547 -3.118  -4.792  1.00 0.00 ? 109 TYR A N    3  
ATOM 6112  C CA   . TYR A 1 109 ? 122.808 -2.549  -5.219  1.00 0.00 ? 109 TYR A CA   3  
ATOM 6113  C C    . TYR A 1 109 ? 122.581 -1.402  -6.232  1.00 0.00 ? 109 TYR A C    3  
ATOM 6114  O O    . TYR A 1 109 ? 123.067 -0.294  -6.030  1.00 0.00 ? 109 TYR A O    3  
ATOM 6115  C CB   . TYR A 1 109 ? 123.693 -3.686  -5.770  1.00 0.00 ? 109 TYR A CB   3  
ATOM 6116  C CG   . TYR A 1 109 ? 124.787 -3.298  -6.747  1.00 0.00 ? 109 TYR A CG   3  
ATOM 6117  C CD1  . TYR A 1 109 ? 124.528 -3.263  -8.112  1.00 0.00 ? 109 TYR A CD1  3  
ATOM 6118  C CD2  . TYR A 1 109 ? 126.069 -2.992  -6.318  1.00 0.00 ? 109 TYR A CD2  3  
ATOM 6119  C CE1  . TYR A 1 109 ? 125.498 -2.935  -9.017  1.00 0.00 ? 109 TYR A CE1  3  
ATOM 6120  C CE2  . TYR A 1 109 ? 127.060 -2.664  -7.225  1.00 0.00 ? 109 TYR A CE2  3  
ATOM 6121  C CZ   . TYR A 1 109 ? 126.765 -2.638  -8.578  1.00 0.00 ? 109 TYR A CZ   3  
ATOM 6122  O OH   . TYR A 1 109 ? 127.748 -2.314  -9.499  1.00 0.00 ? 109 TYR A OH   3  
ATOM 6123  H H    . TYR A 1 109 ? 121.407 -4.087  -4.890  1.00 0.00 ? 109 TYR A H    3  
ATOM 6124  H HA   . TYR A 1 109 ? 123.282 -2.135  -4.339  1.00 0.00 ? 109 TYR A HA   3  
ATOM 6125  H HB2  . TYR A 1 109 ? 124.186 -4.143  -4.925  1.00 0.00 ? 109 TYR A HB2  3  
ATOM 6126  H HB3  . TYR A 1 109 ? 123.053 -4.426  -6.218  1.00 0.00 ? 109 TYR A HB3  3  
ATOM 6127  H HD1  . TYR A 1 109 ? 123.530 -3.497  -8.457  1.00 0.00 ? 109 TYR A HD1  3  
ATOM 6128  H HD2  . TYR A 1 109 ? 126.291 -3.013  -5.262  1.00 0.00 ? 109 TYR A HD2  3  
ATOM 6129  H HE1  . TYR A 1 109 ? 125.255 -2.916  -10.069 1.00 0.00 ? 109 TYR A HE1  3  
ATOM 6130  H HE2  . TYR A 1 109 ? 128.050 -2.430  -6.864  1.00 0.00 ? 109 TYR A HE2  3  
ATOM 6131  H HH   . TYR A 1 109 ? 128.414 -3.016  -9.420  1.00 0.00 ? 109 TYR A HH   3  
ATOM 6132  N N    . GLN A 1 110 ? 121.792 -1.653  -7.273  1.00 0.00 ? 110 GLN A N    3  
ATOM 6133  C CA   . GLN A 1 110 ? 121.514 -0.615  -8.266  1.00 0.00 ? 110 GLN A CA   3  
ATOM 6134  C C    . GLN A 1 110 ? 120.601 0.480   -7.715  1.00 0.00 ? 110 GLN A C    3  
ATOM 6135  O O    . GLN A 1 110 ? 120.772 1.652   -8.060  1.00 0.00 ? 110 GLN A O    3  
ATOM 6136  C CB   . GLN A 1 110 ? 120.986 -1.181  -9.590  1.00 0.00 ? 110 GLN A CB   3  
ATOM 6137  C CG   . GLN A 1 110 ? 119.861 -2.177  -9.451  1.00 0.00 ? 110 GLN A CG   3  
ATOM 6138  C CD   . GLN A 1 110 ? 119.208 -2.526  -10.761 1.00 0.00 ? 110 GLN A CD   3  
ATOM 6139  O OE1  . GLN A 1 110 ? 119.111 -1.700  -11.670 1.00 0.00 ? 110 GLN A OE1  3  
ATOM 6140  N NE2  . GLN A 1 110 ? 118.795 -3.756  -10.890 1.00 0.00 ? 110 GLN A NE2  3  
ATOM 6141  H H    . GLN A 1 110 ? 121.391 -2.544  -7.376  1.00 0.00 ? 110 GLN A H    3  
ATOM 6142  H HA   . GLN A 1 110 ? 122.468 -0.143  -8.452  1.00 0.00 ? 110 GLN A HA   3  
ATOM 6143  H HB2  . GLN A 1 110 ? 120.630 -0.364  -10.200 1.00 0.00 ? 110 GLN A HB2  3  
ATOM 6144  H HB3  . GLN A 1 110 ? 121.804 -1.666  -10.103 1.00 0.00 ? 110 GLN A HB3  3  
ATOM 6145  H HG2  . GLN A 1 110 ? 120.285 -3.082  -9.042  1.00 0.00 ? 110 GLN A HG2  3  
ATOM 6146  H HG3  . GLN A 1 110 ? 119.121 -1.805  -8.756  1.00 0.00 ? 110 GLN A HG3  3  
ATOM 6147  H HE21 . GLN A 1 110 ? 118.929 -4.369  -10.140 1.00 0.00 ? 110 GLN A HE21 3  
ATOM 6148  H HE22 . GLN A 1 110 ? 118.382 -4.032  -11.739 1.00 0.00 ? 110 GLN A HE22 3  
ATOM 6149  N N    . LEU A 1 111 ? 119.655 0.095   -6.836  1.00 0.00 ? 111 LEU A N    3  
ATOM 6150  C CA   . LEU A 1 111 ? 118.759 1.056   -6.165  1.00 0.00 ? 111 LEU A CA   3  
ATOM 6151  C C    . LEU A 1 111 ? 119.590 2.102   -5.467  1.00 0.00 ? 111 LEU A C    3  
ATOM 6152  O O    . LEU A 1 111 ? 119.474 3.299   -5.736  1.00 0.00 ? 111 LEU A O    3  
ATOM 6153  C CB   . LEU A 1 111 ? 117.909 0.372   -5.087  1.00 0.00 ? 111 LEU A CB   3  
ATOM 6154  C CG   . LEU A 1 111 ? 116.944 -0.714  -5.511  1.00 0.00 ? 111 LEU A CG   3  
ATOM 6155  C CD1  . LEU A 1 111 ? 116.323 -1.339  -4.277  1.00 0.00 ? 111 LEU A CD1  3  
ATOM 6156  C CD2  . LEU A 1 111 ? 115.868 -0.158  -6.426  1.00 0.00 ? 111 LEU A CD2  3  
ATOM 6157  H H    . LEU A 1 111 ? 119.547 -0.864  -6.652  1.00 0.00 ? 111 LEU A H    3  
ATOM 6158  H HA   . LEU A 1 111 ? 118.112 1.517   -6.895  1.00 0.00 ? 111 LEU A HA   3  
ATOM 6159  H HB2  . LEU A 1 111 ? 118.586 -0.064  -4.367  1.00 0.00 ? 111 LEU A HB2  3  
ATOM 6160  H HB3  . LEU A 1 111 ? 117.347 1.145   -4.584  1.00 0.00 ? 111 LEU A HB3  3  
ATOM 6161  H HG   . LEU A 1 111 ? 117.485 -1.486  -6.039  1.00 0.00 ? 111 LEU A HG   3  
ATOM 6162  H HD11 . LEU A 1 111 ? 117.104 -1.725  -3.635  1.00 0.00 ? 111 LEU A HD11 3  
ATOM 6163  H HD12 . LEU A 1 111 ? 115.669 -2.147  -4.572  1.00 0.00 ? 111 LEU A HD12 3  
ATOM 6164  H HD13 . LEU A 1 111 ? 115.755 -0.593  -3.741  1.00 0.00 ? 111 LEU A HD13 3  
ATOM 6165  H HD21 . LEU A 1 111 ? 115.197 -0.952  -6.718  1.00 0.00 ? 111 LEU A HD21 3  
ATOM 6166  H HD22 . LEU A 1 111 ? 116.329 0.268   -7.305  1.00 0.00 ? 111 LEU A HD22 3  
ATOM 6167  H HD23 . LEU A 1 111 ? 115.313 0.609   -5.904  1.00 0.00 ? 111 LEU A HD23 3  
ATOM 6168  N N    . MET A 1 112 ? 120.477 1.630   -4.607  1.00 0.00 ? 112 MET A N    3  
ATOM 6169  C CA   . MET A 1 112 ? 121.328 2.498   -3.839  1.00 0.00 ? 112 MET A CA   3  
ATOM 6170  C C    . MET A 1 112 ? 122.259 3.278   -4.724  1.00 0.00 ? 112 MET A C    3  
ATOM 6171  O O    . MET A 1 112 ? 122.575 4.394   -4.414  1.00 0.00 ? 112 MET A O    3  
ATOM 6172  C CB   . MET A 1 112 ? 122.120 1.740   -2.783  1.00 0.00 ? 112 MET A CB   3  
ATOM 6173  C CG   . MET A 1 112 ? 121.272 1.121   -1.687  1.00 0.00 ? 112 MET A CG   3  
ATOM 6174  S SD   . MET A 1 112 ? 122.272 0.266   -0.459  1.00 0.00 ? 112 MET A SD   3  
ATOM 6175  C CE   . MET A 1 112 ? 123.106 -0.919  -1.503  1.00 0.00 ? 112 MET A CE   3  
ATOM 6176  H H    . MET A 1 112 ? 120.548 0.654   -4.501  1.00 0.00 ? 112 MET A H    3  
ATOM 6177  H HA   . MET A 1 112 ? 120.684 3.203   -3.335  1.00 0.00 ? 112 MET A HA   3  
ATOM 6178  H HB2  . MET A 1 112 ? 122.669 0.946   -3.267  1.00 0.00 ? 112 MET A HB2  3  
ATOM 6179  H HB3  . MET A 1 112 ? 122.824 2.418   -2.325  1.00 0.00 ? 112 MET A HB3  3  
ATOM 6180  H HG2  . MET A 1 112 ? 120.716 1.904   -1.192  1.00 0.00 ? 112 MET A HG2  3  
ATOM 6181  H HG3  . MET A 1 112 ? 120.589 0.414   -2.132  1.00 0.00 ? 112 MET A HG3  3  
ATOM 6182  H HE1  . MET A 1 112 ? 123.802 -1.509  -0.923  1.00 0.00 ? 112 MET A HE1  3  
ATOM 6183  H HE2  . MET A 1 112 ? 123.644 -0.411  -2.290  1.00 0.00 ? 112 MET A HE2  3  
ATOM 6184  H HE3  . MET A 1 112 ? 122.364 -1.576  -1.937  1.00 0.00 ? 112 MET A HE3  3  
ATOM 6185  N N    . GLU A 1 113 ? 122.672 2.698   -5.833  1.00 0.00 ? 113 GLU A N    3  
ATOM 6186  C CA   . GLU A 1 113 ? 123.552 3.380   -6.761  1.00 0.00 ? 113 GLU A CA   3  
ATOM 6187  C C    . GLU A 1 113 ? 122.867 4.628   -7.367  1.00 0.00 ? 113 GLU A C    3  
ATOM 6188  O O    . GLU A 1 113 ? 123.285 5.769   -7.105  1.00 0.00 ? 113 GLU A O    3  
ATOM 6189  C CB   . GLU A 1 113 ? 124.028 2.430   -7.865  1.00 0.00 ? 113 GLU A CB   3  
ATOM 6190  C CG   . GLU A 1 113 ? 125.079 3.041   -8.782  1.00 0.00 ? 113 GLU A CG   3  
ATOM 6191  C CD   . GLU A 1 113 ? 125.549 2.098   -9.858  1.00 0.00 ? 113 GLU A CD   3  
ATOM 6192  O OE1  . GLU A 1 113 ? 124.855 1.957   -10.876 1.00 0.00 ? 113 GLU A OE1  3  
ATOM 6193  O OE2  . GLU A 1 113 ? 126.647 1.515   -9.732  1.00 0.00 ? 113 GLU A OE2  3  
ATOM 6194  H H    . GLU A 1 113 ? 122.391 1.777   -6.026  1.00 0.00 ? 113 GLU A H    3  
ATOM 6195  H HA   . GLU A 1 113 ? 124.408 3.713   -6.193  1.00 0.00 ? 113 GLU A HA   3  
ATOM 6196  H HB2  . GLU A 1 113 ? 124.437 1.539   -7.413  1.00 0.00 ? 113 GLU A HB2  3  
ATOM 6197  H HB3  . GLU A 1 113 ? 123.169 2.164   -8.464  1.00 0.00 ? 113 GLU A HB3  3  
ATOM 6198  H HG2  . GLU A 1 113 ? 124.656 3.913   -9.258  1.00 0.00 ? 113 GLU A HG2  3  
ATOM 6199  H HG3  . GLU A 1 113 ? 125.928 3.340   -8.185  1.00 0.00 ? 113 GLU A HG3  3  
ATOM 6200  N N    . GLN A 1 114 ? 121.784 4.422   -8.091  1.00 0.00 ? 114 GLN A N    3  
ATOM 6201  C CA   . GLN A 1 114 ? 121.104 5.522   -8.784  1.00 0.00 ? 114 GLN A CA   3  
ATOM 6202  C C    . GLN A 1 114 ? 120.431 6.507   -7.826  1.00 0.00 ? 114 GLN A C    3  
ATOM 6203  O O    . GLN A 1 114 ? 120.171 7.667   -8.185  1.00 0.00 ? 114 GLN A O    3  
ATOM 6204  C CB   . GLN A 1 114 ? 120.106 5.001   -9.819  1.00 0.00 ? 114 GLN A CB   3  
ATOM 6205  C CG   . GLN A 1 114 ? 119.068 4.047   -9.272  1.00 0.00 ? 114 GLN A CG   3  
ATOM 6206  C CD   . GLN A 1 114 ? 118.070 3.619   -10.323 1.00 0.00 ? 114 GLN A CD   3  
ATOM 6207  O OE1  . GLN A 1 114 ? 117.029 4.252   -10.506 1.00 0.00 ? 114 GLN A OE1  3  
ATOM 6208  N NE2  . GLN A 1 114 ? 118.384 2.586   -11.050 1.00 0.00 ? 114 GLN A NE2  3  
ATOM 6209  H H    . GLN A 1 114 ? 121.426 3.507   -8.164  1.00 0.00 ? 114 GLN A H    3  
ATOM 6210  H HA   . GLN A 1 114 ? 121.877 6.067   -9.308  1.00 0.00 ? 114 GLN A HA   3  
ATOM 6211  H HB2  . GLN A 1 114 ? 119.586 5.843   -10.252 1.00 0.00 ? 114 GLN A HB2  3  
ATOM 6212  H HB3  . GLN A 1 114 ? 120.653 4.495   -10.601 1.00 0.00 ? 114 GLN A HB3  3  
ATOM 6213  H HG2  . GLN A 1 114 ? 119.583 3.170   -8.903  1.00 0.00 ? 114 GLN A HG2  3  
ATOM 6214  H HG3  . GLN A 1 114 ? 118.544 4.526   -8.458  1.00 0.00 ? 114 GLN A HG3  3  
ATOM 6215  H HE21 . GLN A 1 114 ? 119.249 2.130   -10.903 1.00 0.00 ? 114 GLN A HE21 3  
ATOM 6216  H HE22 . GLN A 1 114 ? 117.747 2.270   -11.723 1.00 0.00 ? 114 GLN A HE22 3  
ATOM 6217  N N    . ASP A 1 115 ? 120.156 6.065   -6.629  1.00 0.00 ? 115 ASP A N    3  
ATOM 6218  C CA   . ASP A 1 115 ? 119.515 6.922   -5.650  1.00 0.00 ? 115 ASP A CA   3  
ATOM 6219  C C    . ASP A 1 115 ? 120.516 7.539   -4.678  1.00 0.00 ? 115 ASP A C    3  
ATOM 6220  O O    . ASP A 1 115 ? 120.708 8.759   -4.652  1.00 0.00 ? 115 ASP A O    3  
ATOM 6221  C CB   . ASP A 1 115 ? 118.442 6.151   -4.875  1.00 0.00 ? 115 ASP A CB   3  
ATOM 6222  C CG   . ASP A 1 115 ? 117.751 6.987   -3.823  1.00 0.00 ? 115 ASP A CG   3  
ATOM 6223  O OD1  . ASP A 1 115 ? 116.782 7.695   -4.151  1.00 0.00 ? 115 ASP A OD1  3  
ATOM 6224  O OD2  . ASP A 1 115 ? 118.142 6.932   -2.642  1.00 0.00 ? 115 ASP A OD2  3  
ATOM 6225  H H    . ASP A 1 115 ? 120.359 5.130   -6.410  1.00 0.00 ? 115 ASP A H    3  
ATOM 6226  H HA   . ASP A 1 115 ? 119.027 7.722   -6.187  1.00 0.00 ? 115 ASP A HA   3  
ATOM 6227  H HB2  . ASP A 1 115 ? 117.694 5.797   -5.568  1.00 0.00 ? 115 ASP A HB2  3  
ATOM 6228  H HB3  . ASP A 1 115 ? 118.905 5.303   -4.392  1.00 0.00 ? 115 ASP A HB3  3  
ATOM 6229  N N    . SER A 1 116 ? 121.199 6.705   -3.935  1.00 0.00 ? 116 SER A N    3  
ATOM 6230  C CA   . SER A 1 116 ? 122.004 7.169   -2.830  1.00 0.00 ? 116 SER A CA   3  
ATOM 6231  C C    . SER A 1 116 ? 123.512 7.262   -3.143  1.00 0.00 ? 116 SER A C    3  
ATOM 6232  O O    . SER A 1 116 ? 124.234 7.870   -2.391  1.00 0.00 ? 116 SER A O    3  
ATOM 6233  C CB   . SER A 1 116 ? 121.751 6.278   -1.597  1.00 0.00 ? 116 SER A CB   3  
ATOM 6234  O OG   . SER A 1 116 ? 122.408 6.778   -0.433  1.00 0.00 ? 116 SER A OG   3  
ATOM 6235  H H    . SER A 1 116 ? 121.181 5.743   -4.130  1.00 0.00 ? 116 SER A H    3  
ATOM 6236  H HA   . SER A 1 116 ? 121.656 8.161   -2.581  1.00 0.00 ? 116 SER A HA   3  
ATOM 6237  H HB2  . SER A 1 116 ? 120.691 6.237   -1.397  1.00 0.00 ? 116 SER A HB2  3  
ATOM 6238  H HB3  . SER A 1 116 ? 122.117 5.282   -1.800  1.00 0.00 ? 116 SER A HB3  3  
ATOM 6239  H HG   . SER A 1 116 ? 123.349 6.860   -0.626  1.00 0.00 ? 116 SER A HG   3  
ATOM 6240  N N    . TYR A 1 117 ? 123.985 6.673   -4.222  1.00 0.00 ? 117 TYR A N    3  
ATOM 6241  C CA   . TYR A 1 117 ? 125.419 6.717   -4.542  1.00 0.00 ? 117 TYR A CA   3  
ATOM 6242  C C    . TYR A 1 117 ? 125.829 8.087   -5.045  1.00 0.00 ? 117 TYR A C    3  
ATOM 6243  O O    . TYR A 1 117 ? 126.819 8.648   -4.596  1.00 0.00 ? 117 TYR A O    3  
ATOM 6244  C CB   . TYR A 1 117 ? 125.791 5.596   -5.509  1.00 0.00 ? 117 TYR A CB   3  
ATOM 6245  C CG   . TYR A 1 117 ? 127.134 5.721   -6.174  1.00 0.00 ? 117 TYR A CG   3  
ATOM 6246  C CD1  . TYR A 1 117 ? 128.311 5.768   -5.445  1.00 0.00 ? 117 TYR A CD1  3  
ATOM 6247  C CD2  . TYR A 1 117 ? 127.210 5.801   -7.552  1.00 0.00 ? 117 TYR A CD2  3  
ATOM 6248  C CE1  . TYR A 1 117 ? 129.523 5.891   -6.080  1.00 0.00 ? 117 TYR A CE1  3  
ATOM 6249  C CE2  . TYR A 1 117 ? 128.410 5.922   -8.187  1.00 0.00 ? 117 TYR A CE2  3  
ATOM 6250  C CZ   . TYR A 1 117 ? 129.561 5.965   -7.454  1.00 0.00 ? 117 TYR A CZ   3  
ATOM 6251  O OH   . TYR A 1 117 ? 130.756 6.102   -8.096  1.00 0.00 ? 117 TYR A OH   3  
ATOM 6252  H H    . TYR A 1 117 ? 123.381 6.167   -4.813  1.00 0.00 ? 117 TYR A H    3  
ATOM 6253  H HA   . TYR A 1 117 ? 125.937 6.557   -3.607  1.00 0.00 ? 117 TYR A HA   3  
ATOM 6254  H HB2  . TYR A 1 117 ? 125.790 4.665   -4.961  1.00 0.00 ? 117 TYR A HB2  3  
ATOM 6255  H HB3  . TYR A 1 117 ? 125.036 5.576   -6.288  1.00 0.00 ? 117 TYR A HB3  3  
ATOM 6256  H HD1  . TYR A 1 117 ? 128.267 5.708   -4.368  1.00 0.00 ? 117 TYR A HD1  3  
ATOM 6257  H HD2  . TYR A 1 117 ? 126.298 5.765   -8.129  1.00 0.00 ? 117 TYR A HD2  3  
ATOM 6258  H HE1  . TYR A 1 117 ? 130.437 5.928   -5.508  1.00 0.00 ? 117 TYR A HE1  3  
ATOM 6259  H HE2  . TYR A 1 117 ? 128.453 5.985   -9.264  1.00 0.00 ? 117 TYR A HE2  3  
ATOM 6260  H HH   . TYR A 1 117 ? 131.424 5.657   -7.554  1.00 0.00 ? 117 TYR A HH   3  
ATOM 6261  N N    . THR A 1 118 ? 125.059 8.622   -5.948  1.00 0.00 ? 118 THR A N    3  
ATOM 6262  C CA   . THR A 1 118 ? 125.259 9.983   -6.419  1.00 0.00 ? 118 THR A CA   3  
ATOM 6263  C C    . THR A 1 118 ? 125.114 10.970  -5.221  1.00 0.00 ? 118 THR A C    3  
ATOM 6264  O O    . THR A 1 118 ? 125.919 11.914  -5.037  1.00 0.00 ? 118 THR A O    3  
ATOM 6265  C CB   . THR A 1 118 ? 124.254 10.291  -7.571  1.00 0.00 ? 118 THR A CB   3  
ATOM 6266  O OG1  . THR A 1 118 ? 124.192 11.693  -7.870  1.00 0.00 ? 118 THR A OG1  3  
ATOM 6267  C CG2  . THR A 1 118 ? 122.869 9.745   -7.251  1.00 0.00 ? 118 THR A CG2  3  
ATOM 6268  H H    . THR A 1 118 ? 124.339 8.079   -6.336  1.00 0.00 ? 118 THR A H    3  
ATOM 6269  H HA   . THR A 1 118 ? 126.270 10.050  -6.794  1.00 0.00 ? 118 THR A HA   3  
ATOM 6270  H HB   . THR A 1 118 ? 124.621 9.787   -8.453  1.00 0.00 ? 118 THR A HB   3  
ATOM 6271  H HG1  . THR A 1 118 ? 124.962 11.910  -8.421  1.00 0.00 ? 118 THR A HG1  3  
ATOM 6272  H HG21 . THR A 1 118 ? 122.194 9.951   -8.069  1.00 0.00 ? 118 THR A HG21 3  
ATOM 6273  H HG22 . THR A 1 118 ? 122.501 10.207  -6.347  1.00 0.00 ? 118 THR A HG22 3  
ATOM 6274  H HG23 . THR A 1 118 ? 122.943 8.676   -7.100  1.00 0.00 ? 118 THR A HG23 3  
ATOM 6275  N N    . ARG A 1 119 ? 124.150 10.674  -4.367  1.00 0.00 ? 119 ARG A N    3  
ATOM 6276  C CA   . ARG A 1 119 ? 123.907 11.429  -3.155  1.00 0.00 ? 119 ARG A CA   3  
ATOM 6277  C C    . ARG A 1 119 ? 125.143 11.313  -2.236  1.00 0.00 ? 119 ARG A C    3  
ATOM 6278  O O    . ARG A 1 119 ? 125.610 12.291  -1.676  1.00 0.00 ? 119 ARG A O    3  
ATOM 6279  C CB   . ARG A 1 119 ? 122.651 10.862  -2.488  1.00 0.00 ? 119 ARG A CB   3  
ATOM 6280  C CG   . ARG A 1 119 ? 122.173 11.571  -1.240  1.00 0.00 ? 119 ARG A CG   3  
ATOM 6281  C CD   . ARG A 1 119 ? 121.808 13.011  -1.491  1.00 0.00 ? 119 ARG A CD   3  
ATOM 6282  N NE   . ARG A 1 119 ? 121.223 13.631  -0.296  1.00 0.00 ? 119 ARG A NE   3  
ATOM 6283  C CZ   . ARG A 1 119 ? 120.726 14.872  -0.254  1.00 0.00 ? 119 ARG A CZ   3  
ATOM 6284  N NH1  . ARG A 1 119 ? 120.859 15.683  -1.297  1.00 0.00 ? 119 ARG A NH1  3  
ATOM 6285  N NH2  . ARG A 1 119 ? 120.151 15.313  0.848   1.00 0.00 ? 119 ARG A NH2  3  
ATOM 6286  H H    . ARG A 1 119 ? 123.570 9.915   -4.577  1.00 0.00 ? 119 ARG A H    3  
ATOM 6287  H HA   . ARG A 1 119 ? 123.744 12.464  -3.418  1.00 0.00 ? 119 ARG A HA   3  
ATOM 6288  H HB2  . ARG A 1 119 ? 121.843 10.891  -3.203  1.00 0.00 ? 119 ARG A HB2  3  
ATOM 6289  H HB3  . ARG A 1 119 ? 122.843 9.829   -2.236  1.00 0.00 ? 119 ARG A HB3  3  
ATOM 6290  H HG2  . ARG A 1 119 ? 121.304 11.058  -0.858  1.00 0.00 ? 119 ARG A HG2  3  
ATOM 6291  H HG3  . ARG A 1 119 ? 122.963 11.533  -0.504  1.00 0.00 ? 119 ARG A HG3  3  
ATOM 6292  H HD2  . ARG A 1 119 ? 122.699 13.553  -1.770  1.00 0.00 ? 119 ARG A HD2  3  
ATOM 6293  H HD3  . ARG A 1 119 ? 121.090 13.057  -2.296  1.00 0.00 ? 119 ARG A HD3  3  
ATOM 6294  H HE   . ARG A 1 119 ? 121.176 13.049  0.501   1.00 0.00 ? 119 ARG A HE   3  
ATOM 6295  H HH11 . ARG A 1 119 ? 121.343 15.386  -2.123  1.00 0.00 ? 119 ARG A HH11 3  
ATOM 6296  H HH12 . ARG A 1 119 ? 120.477 16.618  -1.313  1.00 0.00 ? 119 ARG A HH12 3  
ATOM 6297  H HH21 . ARG A 1 119 ? 120.074 14.757  1.687   1.00 0.00 ? 119 ARG A HH21 3  
ATOM 6298  H HH22 . ARG A 1 119 ? 119.734 16.228  0.916   1.00 0.00 ? 119 ARG A HH22 3  
ATOM 6299  N N    . PHE A 1 120 ? 125.685 10.112  -2.155  1.00 0.00 ? 120 PHE A N    3  
ATOM 6300  C CA   . PHE A 1 120 ? 126.893 9.826   -1.403  1.00 0.00 ? 120 PHE A CA   3  
ATOM 6301  C C    . PHE A 1 120 ? 128.079 10.595  -1.969  1.00 0.00 ? 120 PHE A C    3  
ATOM 6302  O O    . PHE A 1 120 ? 128.898 11.082  -1.233  1.00 0.00 ? 120 PHE A O    3  
ATOM 6303  C CB   . PHE A 1 120 ? 127.172 8.310   -1.378  1.00 0.00 ? 120 PHE A CB   3  
ATOM 6304  C CG   . PHE A 1 120 ? 128.509 7.915   -0.810  1.00 0.00 ? 120 PHE A CG   3  
ATOM 6305  C CD1  . PHE A 1 120 ? 128.729 7.881   0.557   1.00 0.00 ? 120 PHE A CD1  3  
ATOM 6306  C CD2  . PHE A 1 120 ? 129.547 7.575   -1.657  1.00 0.00 ? 120 PHE A CD2  3  
ATOM 6307  C CE1  . PHE A 1 120 ? 129.965 7.517   1.059   1.00 0.00 ? 120 PHE A CE1  3  
ATOM 6308  C CE2  . PHE A 1 120 ? 130.772 7.212   -1.160  1.00 0.00 ? 120 PHE A CE2  3  
ATOM 6309  C CZ   . PHE A 1 120 ? 130.983 7.182   0.198   1.00 0.00 ? 120 PHE A CZ   3  
ATOM 6310  H H    . PHE A 1 120 ? 125.240 9.360   -2.603  1.00 0.00 ? 120 PHE A H    3  
ATOM 6311  H HA   . PHE A 1 120 ? 126.722 10.160  -0.389  1.00 0.00 ? 120 PHE A HA   3  
ATOM 6312  H HB2  . PHE A 1 120 ? 126.412 7.826   -0.782  1.00 0.00 ? 120 PHE A HB2  3  
ATOM 6313  H HB3  . PHE A 1 120 ? 127.112 7.935   -2.390  1.00 0.00 ? 120 PHE A HB3  3  
ATOM 6314  H HD1  . PHE A 1 120 ? 127.928 8.144   1.233   1.00 0.00 ? 120 PHE A HD1  3  
ATOM 6315  H HD2  . PHE A 1 120 ? 129.386 7.599   -2.725  1.00 0.00 ? 120 PHE A HD2  3  
ATOM 6316  H HE1  . PHE A 1 120 ? 130.150 7.486   2.123   1.00 0.00 ? 120 PHE A HE1  3  
ATOM 6317  H HE2  . PHE A 1 120 ? 131.572 6.948   -1.836  1.00 0.00 ? 120 PHE A HE2  3  
ATOM 6318  H HZ   . PHE A 1 120 ? 131.948 6.896   0.588   1.00 0.00 ? 120 PHE A HZ   3  
ATOM 6319  N N    . LEU A 1 121 ? 128.143 10.743  -3.262  1.00 0.00 ? 121 LEU A N    3  
ATOM 6320  C CA   . LEU A 1 121 ? 129.226 11.502  -3.865  1.00 0.00 ? 121 LEU A CA   3  
ATOM 6321  C C    . LEU A 1 121 ? 129.175 12.977  -3.453  1.00 0.00 ? 121 LEU A C    3  
ATOM 6322  O O    . LEU A 1 121 ? 130.191 13.670  -3.472  1.00 0.00 ? 121 LEU A O    3  
ATOM 6323  C CB   . LEU A 1 121 ? 129.263 11.312  -5.380  1.00 0.00 ? 121 LEU A CB   3  
ATOM 6324  C CG   . LEU A 1 121 ? 129.531 9.875   -5.831  1.00 0.00 ? 121 LEU A CG   3  
ATOM 6325  C CD1  . LEU A 1 121 ? 129.518 9.768   -7.347  1.00 0.00 ? 121 LEU A CD1  3  
ATOM 6326  C CD2  . LEU A 1 121 ? 130.860 9.395   -5.265  1.00 0.00 ? 121 LEU A CD2  3  
ATOM 6327  H H    . LEU A 1 121 ? 127.467 10.307  -3.825  1.00 0.00 ? 121 LEU A H    3  
ATOM 6328  H HA   . LEU A 1 121 ? 130.135 11.098  -3.443  1.00 0.00 ? 121 LEU A HA   3  
ATOM 6329  H HB2  . LEU A 1 121 ? 128.313 11.629  -5.785  1.00 0.00 ? 121 LEU A HB2  3  
ATOM 6330  H HB3  . LEU A 1 121 ? 130.041 11.942  -5.786  1.00 0.00 ? 121 LEU A HB3  3  
ATOM 6331  H HG   . LEU A 1 121 ? 128.752 9.236   -5.445  1.00 0.00 ? 121 LEU A HG   3  
ATOM 6332  H HD11 . LEU A 1 121 ? 129.687 8.738   -7.630  1.00 0.00 ? 121 LEU A HD11 3  
ATOM 6333  H HD12 . LEU A 1 121 ? 130.298 10.390  -7.761  1.00 0.00 ? 121 LEU A HD12 3  
ATOM 6334  H HD13 . LEU A 1 121 ? 128.558 10.091  -7.721  1.00 0.00 ? 121 LEU A HD13 3  
ATOM 6335  H HD21 . LEU A 1 121 ? 130.864 9.543   -4.193  1.00 0.00 ? 121 LEU A HD21 3  
ATOM 6336  H HD22 . LEU A 1 121 ? 131.663 9.977   -5.693  1.00 0.00 ? 121 LEU A HD22 3  
ATOM 6337  H HD23 . LEU A 1 121 ? 131.002 8.348   -5.489  1.00 0.00 ? 121 LEU A HD23 3  
ATOM 6338  N N    . LYS A 1 122 ? 127.989 13.446  -3.086  1.00 0.00 ? 122 LYS A N    3  
ATOM 6339  C CA   . LYS A 1 122 ? 127.835 14.793  -2.521  1.00 0.00 ? 122 LYS A CA   3  
ATOM 6340  C C    . LYS A 1 122 ? 127.646 14.741  -0.979  1.00 0.00 ? 122 LYS A C    3  
ATOM 6341  O O    . LYS A 1 122 ? 127.379 15.773  -0.346  1.00 0.00 ? 122 LYS A O    3  
ATOM 6342  C CB   . LYS A 1 122 ? 126.629 15.517  -3.139  1.00 0.00 ? 122 LYS A CB   3  
ATOM 6343  C CG   . LYS A 1 122 ? 126.678 15.827  -4.644  1.00 0.00 ? 122 LYS A CG   3  
ATOM 6344  C CD   . LYS A 1 122 ? 127.771 16.837  -5.027  1.00 0.00 ? 122 LYS A CD   3  
ATOM 6345  C CE   . LYS A 1 122 ? 129.133 16.191  -5.227  1.00 0.00 ? 122 LYS A CE   3  
ATOM 6346  N NZ   . LYS A 1 122 ? 129.153 15.278  -6.394  1.00 0.00 ? 122 LYS A NZ   3  
ATOM 6347  H H    . LYS A 1 122 ? 127.192 12.885  -3.234  1.00 0.00 ? 122 LYS A H    3  
ATOM 6348  H HA   . LYS A 1 122 ? 128.733 15.356  -2.737  1.00 0.00 ? 122 LYS A HA   3  
ATOM 6349  H HB2  . LYS A 1 122 ? 125.750 14.913  -2.968  1.00 0.00 ? 122 LYS A HB2  3  
ATOM 6350  H HB3  . LYS A 1 122 ? 126.500 16.450  -2.609  1.00 0.00 ? 122 LYS A HB3  3  
ATOM 6351  H HG2  . LYS A 1 122 ? 126.868 14.908  -5.177  1.00 0.00 ? 122 LYS A HG2  3  
ATOM 6352  H HG3  . LYS A 1 122 ? 125.716 16.217  -4.946  1.00 0.00 ? 122 LYS A HG3  3  
ATOM 6353  H HD2  . LYS A 1 122 ? 127.488 17.331  -5.943  1.00 0.00 ? 122 LYS A HD2  3  
ATOM 6354  H HD3  . LYS A 1 122 ? 127.847 17.569  -4.235  1.00 0.00 ? 122 LYS A HD3  3  
ATOM 6355  H HE2  . LYS A 1 122 ? 129.869 16.967  -5.378  1.00 0.00 ? 122 LYS A HE2  3  
ATOM 6356  H HE3  . LYS A 1 122 ? 129.384 15.630  -4.338  1.00 0.00 ? 122 LYS A HE3  3  
ATOM 6357  H HZ1  . LYS A 1 122 ? 130.070 14.791  -6.479  1.00 0.00 ? 122 LYS A HZ1  3  
ATOM 6358  H HZ2  . LYS A 1 122 ? 129.013 15.787  -7.295  1.00 0.00 ? 122 LYS A HZ2  3  
ATOM 6359  H HZ3  . LYS A 1 122 ? 128.404 14.552  -6.358  1.00 0.00 ? 122 LYS A HZ3  3  
ATOM 6360  N N    . SER A 1 123 ? 127.733 13.554  -0.391  1.00 0.00 ? 123 SER A N    3  
ATOM 6361  C CA   . SER A 1 123 ? 127.558 13.404  1.056   1.00 0.00 ? 123 SER A CA   3  
ATOM 6362  C C    . SER A 1 123 ? 128.754 13.937  1.819   1.00 0.00 ? 123 SER A C    3  
ATOM 6363  O O    . SER A 1 123 ? 129.889 13.915  1.320   1.00 0.00 ? 123 SER A O    3  
ATOM 6364  C CB   . SER A 1 123 ? 127.335 11.942  1.457   1.00 0.00 ? 123 SER A CB   3  
ATOM 6365  O OG   . SER A 1 123 ? 128.516 11.160  1.311   1.00 0.00 ? 123 SER A OG   3  
ATOM 6366  H H    . SER A 1 123 ? 127.858 12.758  -0.951  1.00 0.00 ? 123 SER A H    3  
ATOM 6367  H HA   . SER A 1 123 ? 126.687 13.974  1.340   1.00 0.00 ? 123 SER A HA   3  
ATOM 6368  H HB2  . SER A 1 123 ? 127.024 11.901  2.490   1.00 0.00 ? 123 SER A HB2  3  
ATOM 6369  H HB3  . SER A 1 123 ? 126.559 11.520  0.834   1.00 0.00 ? 123 SER A HB3  3  
ATOM 6370  H HG   . SER A 1 123 ? 128.783 11.185  0.381   1.00 0.00 ? 123 SER A HG   3  
ATOM 6371  N N    . ASP A 1 124 ? 128.501 14.346  3.044   1.00 0.00 ? 124 ASP A N    3  
ATOM 6372  C CA   . ASP A 1 124 ? 129.512 14.893  3.934   1.00 0.00 ? 124 ASP A CA   3  
ATOM 6373  C C    . ASP A 1 124 ? 130.617 13.885  4.194   1.00 0.00 ? 124 ASP A C    3  
ATOM 6374  O O    . ASP A 1 124 ? 131.781 14.238  4.162   1.00 0.00 ? 124 ASP A O    3  
ATOM 6375  C CB   . ASP A 1 124 ? 128.862 15.334  5.254   1.00 0.00 ? 124 ASP A CB   3  
ATOM 6376  C CG   . ASP A 1 124 ? 129.850 15.851  6.278   1.00 0.00 ? 124 ASP A CG   3  
ATOM 6377  O OD1  . ASP A 1 124 ? 130.247 17.034  6.192   1.00 0.00 ? 124 ASP A OD1  3  
ATOM 6378  O OD2  . ASP A 1 124 ? 130.216 15.099  7.204   1.00 0.00 ? 124 ASP A OD2  3  
ATOM 6379  H H    . ASP A 1 124 ? 127.581 14.261  3.380   1.00 0.00 ? 124 ASP A H    3  
ATOM 6380  H HA   . ASP A 1 124 ? 129.956 15.758  3.458   1.00 0.00 ? 124 ASP A HA   3  
ATOM 6381  H HB2  . ASP A 1 124 ? 128.152 16.121  5.050   1.00 0.00 ? 124 ASP A HB2  3  
ATOM 6382  H HB3  . ASP A 1 124 ? 128.337 14.492  5.678   1.00 0.00 ? 124 ASP A HB3  3  
ATOM 6383  N N    . ILE A 1 125 ? 130.248 12.619  4.404   1.00 0.00 ? 125 ILE A N    3  
ATOM 6384  C CA   . ILE A 1 125 ? 131.240 11.577  4.656   1.00 0.00 ? 125 ILE A CA   3  
ATOM 6385  C C    . ILE A 1 125 ? 132.175 11.385  3.449   1.00 0.00 ? 125 ILE A C    3  
ATOM 6386  O O    . ILE A 1 125 ? 133.388 11.323  3.610   1.00 0.00 ? 125 ILE A O    3  
ATOM 6387  C CB   . ILE A 1 125 ? 130.605 10.205  5.119   1.00 0.00 ? 125 ILE A CB   3  
ATOM 6388  C CG1  . ILE A 1 125 ? 131.693 9.170   5.460   1.00 0.00 ? 125 ILE A CG1  3  
ATOM 6389  C CG2  . ILE A 1 125 ? 129.652 9.628   4.082   1.00 0.00 ? 125 ILE A CG2  3  
ATOM 6390  C CD1  . ILE A 1 125 ? 132.605 9.574   6.598   1.00 0.00 ? 125 ILE A CD1  3  
ATOM 6391  H H    . ILE A 1 125 ? 129.293 12.393  4.417   1.00 0.00 ? 125 ILE A H    3  
ATOM 6392  H HA   . ILE A 1 125 ? 131.856 11.957  5.460   1.00 0.00 ? 125 ILE A HA   3  
ATOM 6393  H HB   . ILE A 1 125 ? 130.030 10.397  6.014   1.00 0.00 ? 125 ILE A HB   3  
ATOM 6394  H HG12 . ILE A 1 125 ? 131.219 8.241   5.739   1.00 0.00 ? 125 ILE A HG12 3  
ATOM 6395  H HG13 . ILE A 1 125 ? 132.303 9.003   4.585   1.00 0.00 ? 125 ILE A HG13 3  
ATOM 6396  H HG21 . ILE A 1 125 ? 129.198 8.729   4.473   1.00 0.00 ? 125 ILE A HG21 3  
ATOM 6397  H HG22 . ILE A 1 125 ? 130.221 9.364   3.201   1.00 0.00 ? 125 ILE A HG22 3  
ATOM 6398  H HG23 . ILE A 1 125 ? 128.890 10.349  3.829   1.00 0.00 ? 125 ILE A HG23 3  
ATOM 6399  H HD11 . ILE A 1 125 ? 133.110 10.494  6.344   1.00 0.00 ? 125 ILE A HD11 3  
ATOM 6400  H HD12 . ILE A 1 125 ? 133.332 8.796   6.772   1.00 0.00 ? 125 ILE A HD12 3  
ATOM 6401  H HD13 . ILE A 1 125 ? 132.018 9.722   7.493   1.00 0.00 ? 125 ILE A HD13 3  
ATOM 6402  N N    . TYR A 1 126 ? 131.627 11.365  2.237   1.00 0.00 ? 126 TYR A N    3  
ATOM 6403  C CA   . TYR A 1 126 ? 132.466 11.172  1.068   1.00 0.00 ? 126 TYR A CA   3  
ATOM 6404  C C    . TYR A 1 126 ? 133.294 12.415  0.788   1.00 0.00 ? 126 TYR A C    3  
ATOM 6405  O O    . TYR A 1 126 ? 134.465 12.321  0.420   1.00 0.00 ? 126 TYR A O    3  
ATOM 6406  C CB   . TYR A 1 126 ? 131.660 10.758  -0.156  1.00 0.00 ? 126 TYR A CB   3  
ATOM 6407  C CG   . TYR A 1 126 ? 132.511 10.498  -1.378  1.00 0.00 ? 126 TYR A CG   3  
ATOM 6408  C CD1  . TYR A 1 126 ? 133.366 9.412   -1.426  1.00 0.00 ? 126 TYR A CD1  3  
ATOM 6409  C CD2  . TYR A 1 126 ? 132.491 11.359  -2.459  1.00 0.00 ? 126 TYR A CD2  3  
ATOM 6410  C CE1  . TYR A 1 126 ? 134.162 9.183   -2.514  1.00 0.00 ? 126 TYR A CE1  3  
ATOM 6411  C CE2  . TYR A 1 126 ? 133.289 11.148  -3.549  1.00 0.00 ? 126 TYR A CE2  3  
ATOM 6412  C CZ   . TYR A 1 126 ? 134.118 10.062  -3.584  1.00 0.00 ? 126 TYR A CZ   3  
ATOM 6413  O OH   . TYR A 1 126 ? 134.926 9.865   -4.680  1.00 0.00 ? 126 TYR A OH   3  
ATOM 6414  H H    . TYR A 1 126 ? 130.655 11.480  2.139   1.00 0.00 ? 126 TYR A H    3  
ATOM 6415  H HA   . TYR A 1 126 ? 133.154 10.378  1.319   1.00 0.00 ? 126 TYR A HA   3  
ATOM 6416  H HB2  . TYR A 1 126 ? 131.114 9.854   0.069   1.00 0.00 ? 126 TYR A HB2  3  
ATOM 6417  H HB3  . TYR A 1 126 ? 130.960 11.543  -0.399  1.00 0.00 ? 126 TYR A HB3  3  
ATOM 6418  H HD1  . TYR A 1 126 ? 133.392 8.729   -0.589  1.00 0.00 ? 126 TYR A HD1  3  
ATOM 6419  H HD2  . TYR A 1 126 ? 131.824 12.206  -2.457  1.00 0.00 ? 126 TYR A HD2  3  
ATOM 6420  H HE1  . TYR A 1 126 ? 134.804 8.311   -2.515  1.00 0.00 ? 126 TYR A HE1  3  
ATOM 6421  H HE2  . TYR A 1 126 ? 133.260 11.844  -4.374  1.00 0.00 ? 126 TYR A HE2  3  
ATOM 6422  H HH   . TYR A 1 126 ? 135.115 8.919   -4.707  1.00 0.00 ? 126 TYR A HH   3  
ATOM 6423  N N    . LEU A 1 127 ? 132.705 13.571  1.007   1.00 0.00 ? 127 LEU A N    3  
ATOM 6424  C CA   . LEU A 1 127 ? 133.408 14.832  0.833   1.00 0.00 ? 127 LEU A CA   3  
ATOM 6425  C C    . LEU A 1 127 ? 134.555 14.940  1.854   1.00 0.00 ? 127 LEU A C    3  
ATOM 6426  O O    . LEU A 1 127 ? 135.583 15.576  1.602   1.00 0.00 ? 127 LEU A O    3  
ATOM 6427  C CB   . LEU A 1 127 ? 132.427 16.014  0.953   1.00 0.00 ? 127 LEU A CB   3  
ATOM 6428  C CG   . LEU A 1 127 ? 131.330 16.101  -0.130  1.00 0.00 ? 127 LEU A CG   3  
ATOM 6429  C CD1  . LEU A 1 127 ? 130.466 17.330  0.063   1.00 0.00 ? 127 LEU A CD1  3  
ATOM 6430  C CD2  . LEU A 1 127 ? 131.920 16.080  -1.532  1.00 0.00 ? 127 LEU A CD2  3  
ATOM 6431  H H    . LEU A 1 127 ? 131.763 13.588  1.287   1.00 0.00 ? 127 LEU A H    3  
ATOM 6432  H HA   . LEU A 1 127 ? 133.837 14.824  -0.159  1.00 0.00 ? 127 LEU A HA   3  
ATOM 6433  H HB2  . LEU A 1 127 ? 131.927 15.899  1.905   1.00 0.00 ? 127 LEU A HB2  3  
ATOM 6434  H HB3  . LEU A 1 127 ? 132.958 16.952  0.985   1.00 0.00 ? 127 LEU A HB3  3  
ATOM 6435  H HG   . LEU A 1 127 ? 130.684 15.241  -0.022  1.00 0.00 ? 127 LEU A HG   3  
ATOM 6436  H HD11 . LEU A 1 127 ? 131.079 18.217  0.005   1.00 0.00 ? 127 LEU A HD11 3  
ATOM 6437  H HD12 . LEU A 1 127 ? 129.982 17.284  1.027   1.00 0.00 ? 127 LEU A HD12 3  
ATOM 6438  H HD13 . LEU A 1 127 ? 129.716 17.359  -0.715  1.00 0.00 ? 127 LEU A HD13 3  
ATOM 6439  H HD21 . LEU A 1 127 ? 132.567 16.933  -1.668  1.00 0.00 ? 127 LEU A HD21 3  
ATOM 6440  H HD22 . LEU A 1 127 ? 131.112 16.111  -2.252  1.00 0.00 ? 127 LEU A HD22 3  
ATOM 6441  H HD23 . LEU A 1 127 ? 132.484 15.169  -1.671  1.00 0.00 ? 127 LEU A HD23 3  
ATOM 6442  N N    . ASP A 1 128 ? 134.377 14.282  2.975   1.00 0.00 ? 128 ASP A N    3  
ATOM 6443  C CA   . ASP A 1 128 ? 135.367 14.220  4.047   1.00 0.00 ? 128 ASP A CA   3  
ATOM 6444  C C    . ASP A 1 128 ? 136.499 13.238  3.682   1.00 0.00 ? 128 ASP A C    3  
ATOM 6445  O O    . ASP A 1 128 ? 137.650 13.388  4.109   1.00 0.00 ? 128 ASP A O    3  
ATOM 6446  C CB   . ASP A 1 128 ? 134.661 13.810  5.340   1.00 0.00 ? 128 ASP A CB   3  
ATOM 6447  C CG   . ASP A 1 128 ? 135.539 13.776  6.550   1.00 0.00 ? 128 ASP A CG   3  
ATOM 6448  O OD1  . ASP A 1 128 ? 135.961 14.851  7.032   1.00 0.00 ? 128 ASP A OD1  3  
ATOM 6449  O OD2  . ASP A 1 128 ? 135.772 12.693  7.078   1.00 0.00 ? 128 ASP A OD2  3  
ATOM 6450  H H    . ASP A 1 128 ? 133.513 13.836  3.119   1.00 0.00 ? 128 ASP A H    3  
ATOM 6451  H HA   . ASP A 1 128 ? 135.785 15.208  4.171   1.00 0.00 ? 128 ASP A HA   3  
ATOM 6452  H HB2  . ASP A 1 128 ? 133.859 14.507  5.536   1.00 0.00 ? 128 ASP A HB2  3  
ATOM 6453  H HB3  . ASP A 1 128 ? 134.234 12.828  5.198   1.00 0.00 ? 128 ASP A HB3  3  
ATOM 6454  N N    . LEU A 1 129 ? 136.173 12.250  2.852   1.00 0.00 ? 129 LEU A N    3  
ATOM 6455  C CA   . LEU A 1 129 ? 137.176 11.300  2.351   1.00 0.00 ? 129 LEU A CA   3  
ATOM 6456  C C    . LEU A 1 129 ? 137.975 11.986  1.256   1.00 0.00 ? 129 LEU A C    3  
ATOM 6457  O O    . LEU A 1 129 ? 139.143 11.692  1.039   1.00 0.00 ? 129 LEU A O    3  
ATOM 6458  C CB   . LEU A 1 129 ? 136.512 10.046  1.756   1.00 0.00 ? 129 LEU A CB   3  
ATOM 6459  C CG   . LEU A 1 129 ? 135.460 9.350   2.619   1.00 0.00 ? 129 LEU A CG   3  
ATOM 6460  C CD1  . LEU A 1 129 ? 134.723 8.326   1.806   1.00 0.00 ? 129 LEU A CD1  3  
ATOM 6461  C CD2  . LEU A 1 129 ? 136.091 8.690   3.835   1.00 0.00 ? 129 LEU A CD2  3  
ATOM 6462  H H    . LEU A 1 129 ? 135.231 12.153  2.593   1.00 0.00 ? 129 LEU A H    3  
ATOM 6463  H HA   . LEU A 1 129 ? 137.830 11.021  3.163   1.00 0.00 ? 129 LEU A HA   3  
ATOM 6464  H HB2  . LEU A 1 129 ? 136.126 10.238  0.766   1.00 0.00 ? 129 LEU A HB2  3  
ATOM 6465  H HB3  . LEU A 1 129 ? 137.316 9.336   1.620   1.00 0.00 ? 129 LEU A HB3  3  
ATOM 6466  H HG   . LEU A 1 129 ? 134.744 10.082  2.963   1.00 0.00 ? 129 LEU A HG   3  
ATOM 6467  H HD11 . LEU A 1 129 ? 134.217 8.815   0.987   1.00 0.00 ? 129 LEU A HD11 3  
ATOM 6468  H HD12 . LEU A 1 129 ? 134.004 7.814   2.427   1.00 0.00 ? 129 LEU A HD12 3  
ATOM 6469  H HD13 . LEU A 1 129 ? 135.432 7.614   1.408   1.00 0.00 ? 129 LEU A HD13 3  
ATOM 6470  H HD21 . LEU A 1 129 ? 136.845 7.988   3.512   1.00 0.00 ? 129 LEU A HD21 3  
ATOM 6471  H HD22 . LEU A 1 129 ? 135.321 8.152   4.372   1.00 0.00 ? 129 LEU A HD22 3  
ATOM 6472  H HD23 . LEU A 1 129 ? 136.533 9.439   4.475   1.00 0.00 ? 129 LEU A HD23 3  
ATOM 6473  N N    . MET A 1 130 ? 137.311 12.911  0.572   1.00 0.00 ? 130 MET A N    3  
ATOM 6474  C CA   . MET A 1 130 ? 137.912 13.695  -0.498  1.00 0.00 ? 130 MET A CA   3  
ATOM 6475  C C    . MET A 1 130 ? 139.013 14.576  0.011   1.00 0.00 ? 130 MET A C    3  
ATOM 6476  O O    . MET A 1 130 ? 140.090 14.630  -0.572  1.00 0.00 ? 130 MET A O    3  
ATOM 6477  C CB   . MET A 1 130 ? 136.878 14.543  -1.209  1.00 0.00 ? 130 MET A CB   3  
ATOM 6478  C CG   . MET A 1 130 ? 135.854 13.797  -2.094  1.00 0.00 ? 130 MET A CG   3  
ATOM 6479  S SD   . MET A 1 130 ? 136.588 12.922  -3.506  1.00 0.00 ? 130 MET A SD   3  
ATOM 6480  C CE   . MET A 1 130 ? 137.390 11.525  -2.715  1.00 0.00 ? 130 MET A CE   3  
ATOM 6481  H H    . MET A 1 130 ? 136.365 13.043  0.800   1.00 0.00 ? 130 MET A H    3  
ATOM 6482  H HA   . MET A 1 130 ? 138.333 13.003  -1.214  1.00 0.00 ? 130 MET A HA   3  
ATOM 6483  H HB2  . MET A 1 130 ? 136.348 15.055  -0.419  1.00 0.00 ? 130 MET A HB2  3  
ATOM 6484  H HB3  . MET A 1 130 ? 137.403 15.276  -1.802  1.00 0.00 ? 130 MET A HB3  3  
ATOM 6485  H HG2  . MET A 1 130 ? 135.302 13.071  -1.516  1.00 0.00 ? 130 MET A HG2  3  
ATOM 6486  H HG3  . MET A 1 130 ? 135.158 14.527  -2.479  1.00 0.00 ? 130 MET A HG3  3  
ATOM 6487  H HE1  . MET A 1 130 ? 136.650 10.909  -2.228  1.00 0.00 ? 130 MET A HE1  3  
ATOM 6488  H HE2  . MET A 1 130 ? 138.089 11.890  -1.977  1.00 0.00 ? 130 MET A HE2  3  
ATOM 6489  H HE3  . MET A 1 130 ? 137.931 10.937  -3.448  1.00 0.00 ? 130 MET A HE3  3  
ATOM 6490  N N    . GLU A 1 131 ? 138.747 15.268  1.102   1.00 0.00 ? 131 GLU A N    3  
ATOM 6491  C CA   . GLU A 1 131 ? 139.754 16.114  1.714   1.00 0.00 ? 131 GLU A CA   3  
ATOM 6492  C C    . GLU A 1 131 ? 140.779 15.255  2.444   1.00 0.00 ? 131 GLU A C    3  
ATOM 6493  O O    . GLU A 1 131 ? 141.883 15.700  2.748   1.00 0.00 ? 131 GLU A O    3  
ATOM 6494  C CB   . GLU A 1 131 ? 139.117 17.131  2.670   1.00 0.00 ? 131 GLU A CB   3  
ATOM 6495  C CG   . GLU A 1 131 ? 138.328 16.516  3.810   1.00 0.00 ? 131 GLU A CG   3  
ATOM 6496  C CD   . GLU A 1 131 ? 137.791 17.545  4.759   1.00 0.00 ? 131 GLU A CD   3  
ATOM 6497  O OE1  . GLU A 1 131 ? 138.500 17.914  5.714   1.00 0.00 ? 131 GLU A OE1  3  
ATOM 6498  O OE2  . GLU A 1 131 ? 136.657 18.009  4.573   1.00 0.00 ? 131 GLU A OE2  3  
ATOM 6499  H H    . GLU A 1 131 ? 137.846 15.230  1.490   1.00 0.00 ? 131 GLU A H    3  
ATOM 6500  H HA   . GLU A 1 131 ? 140.258 16.642  0.919   1.00 0.00 ? 131 GLU A HA   3  
ATOM 6501  H HB2  . GLU A 1 131 ? 139.900 17.740  3.098   1.00 0.00 ? 131 GLU A HB2  3  
ATOM 6502  H HB3  . GLU A 1 131 ? 138.454 17.769  2.104   1.00 0.00 ? 131 GLU A HB3  3  
ATOM 6503  H HG2  . GLU A 1 131 ? 137.498 15.961  3.398   1.00 0.00 ? 131 GLU A HG2  3  
ATOM 6504  H HG3  . GLU A 1 131 ? 138.976 15.843  4.353   1.00 0.00 ? 131 GLU A HG3  3  
ATOM 6505  N N    . GLY A 1 132 ? 140.411 14.014  2.686   1.00 0.00 ? 132 GLY A N    3  
ATOM 6506  C CA   . GLY A 1 132 ? 141.275 13.095  3.387   1.00 0.00 ? 132 GLY A CA   3  
ATOM 6507  C C    . GLY A 1 132 ? 141.409 13.469  4.831   1.00 0.00 ? 132 GLY A C    3  
ATOM 6508  O O    . GLY A 1 132 ? 142.480 13.904  5.262   1.00 0.00 ? 132 GLY A O    3  
ATOM 6509  H H    . GLY A 1 132 ? 139.527 13.743  2.353   1.00 0.00 ? 132 GLY A H    3  
ATOM 6510  H HA2  . GLY A 1 132 ? 140.863 12.099  3.313   1.00 0.00 ? 132 GLY A HA2  3  
ATOM 6511  H HA3  . GLY A 1 132 ? 142.253 13.111  2.928   1.00 0.00 ? 132 GLY A HA3  3  
ATOM 6512  N N    . ARG A 1 133 ? 140.294 13.327  5.546   1.00 0.00 ? 133 ARG A N    3  
ATOM 6513  C CA   . ARG A 1 133 ? 140.147 13.630  6.982   1.00 0.00 ? 133 ARG A CA   3  
ATOM 6514  C C    . ARG A 1 133 ? 141.369 13.235  7.803   1.00 0.00 ? 133 ARG A C    3  
ATOM 6515  O O    . ARG A 1 133 ? 141.656 12.042  7.971   1.00 0.00 ? 133 ARG A O    3  
ATOM 6516  C CB   . ARG A 1 133 ? 138.957 12.861  7.518   1.00 0.00 ? 133 ARG A CB   3  
ATOM 6517  C CG   . ARG A 1 133 ? 138.618 13.096  8.987   1.00 0.00 ? 133 ARG A CG   3  
ATOM 6518  C CD   . ARG A 1 133 ? 137.551 12.117  9.400   1.00 0.00 ? 133 ARG A CD   3  
ATOM 6519  N NE   . ARG A 1 133 ? 136.913 12.422  10.673  1.00 0.00 ? 133 ARG A NE   3  
ATOM 6520  C CZ   . ARG A 1 133 ? 135.599 12.655  10.781  1.00 0.00 ? 133 ARG A CZ   3  
ATOM 6521  N NH1  . ARG A 1 133 ? 134.859 12.802  9.674   1.00 0.00 ? 133 ARG A NH1  3  
ATOM 6522  N NH2  . ARG A 1 133 ? 135.022 12.755  11.973  1.00 0.00 ? 133 ARG A NH2  3  
ATOM 6523  H H    . ARG A 1 133 ? 139.493 13.020  5.069   1.00 0.00 ? 133 ARG A H    3  
ATOM 6524  H HA   . ARG A 1 133 ? 139.942 14.683  7.101   1.00 0.00 ? 133 ARG A HA   3  
ATOM 6525  H HB2  . ARG A 1 133 ? 138.088 13.130  6.937   1.00 0.00 ? 133 ARG A HB2  3  
ATOM 6526  H HB3  . ARG A 1 133 ? 139.146 11.806  7.385   1.00 0.00 ? 133 ARG A HB3  3  
ATOM 6527  H HG2  . ARG A 1 133 ? 139.504 12.941  9.587   1.00 0.00 ? 133 ARG A HG2  3  
ATOM 6528  H HG3  . ARG A 1 133 ? 138.249 14.104  9.116   1.00 0.00 ? 133 ARG A HG3  3  
ATOM 6529  H HD2  . ARG A 1 133 ? 136.788 12.104  8.637   1.00 0.00 ? 133 ARG A HD2  3  
ATOM 6530  H HD3  . ARG A 1 133 ? 138.001 11.136  9.459   1.00 0.00 ? 133 ARG A HD3  3  
ATOM 6531  H HE   . ARG A 1 133 ? 137.501 12.375  11.469  1.00 0.00 ? 133 ARG A HE   3  
ATOM 6532  H HH11 . ARG A 1 133 ? 135.265 12.740  8.747   1.00 0.00 ? 133 ARG A HH11 3  
ATOM 6533  H HH12 . ARG A 1 133 ? 133.873 12.987  9.693   1.00 0.00 ? 133 ARG A HH12 3  
ATOM 6534  H HH21 . ARG A 1 133 ? 135.517 12.666  12.847  1.00 0.00 ? 133 ARG A HH21 3  
ATOM 6535  H HH22 . ARG A 1 133 ? 134.028 12.911  12.038  1.00 0.00 ? 133 ARG A HH22 3  
ATOM 6536  N N    . PRO A 1 134 ? 142.124 14.213  8.278   1.00 0.00 ? 134 PRO A N    3  
ATOM 6537  C CA   . PRO A 1 134 ? 143.239 13.967  9.157   1.00 0.00 ? 134 PRO A CA   3  
ATOM 6538  C C    . PRO A 1 134 ? 142.731 13.648  10.564  1.00 0.00 ? 134 PRO A C    3  
ATOM 6539  O O    . PRO A 1 134 ? 142.056 14.468  11.199  1.00 0.00 ? 134 PRO A O    3  
ATOM 6540  C CB   . PRO A 1 134 ? 144.022 15.294  9.148   1.00 0.00 ? 134 PRO A CB   3  
ATOM 6541  C CG   . PRO A 1 134 ? 143.385 16.128  8.086   1.00 0.00 ? 134 PRO A CG   3  
ATOM 6542  C CD   . PRO A 1 134 ? 141.981 15.638  7.970   1.00 0.00 ? 134 PRO A CD   3  
ATOM 6543  H HA   . PRO A 1 134 ? 143.859 13.158  8.801   1.00 0.00 ? 134 PRO A HA   3  
ATOM 6544  H HB2  . PRO A 1 134 ? 143.945 15.764  10.118  1.00 0.00 ? 134 PRO A HB2  3  
ATOM 6545  H HB3  . PRO A 1 134 ? 145.059 15.096  8.923   1.00 0.00 ? 134 PRO A HB3  3  
ATOM 6546  H HG2  . PRO A 1 134 ? 143.396 17.168  8.376   1.00 0.00 ? 134 PRO A HG2  3  
ATOM 6547  H HG3  . PRO A 1 134 ? 143.907 15.992  7.151   1.00 0.00 ? 134 PRO A HG3  3  
ATOM 6548  H HD2  . PRO A 1 134 ? 141.344 16.132  8.689   1.00 0.00 ? 134 PRO A HD2  3  
ATOM 6549  H HD3  . PRO A 1 134 ? 141.608 15.779  6.967   1.00 0.00 ? 134 PRO A HD3  3  
ATOM 6550  N N    . SER A 1 1   ? 138.010 2.931   8.768   1.00 0.00 ? 1   SER A N    4  
ATOM 6551  C CA   . SER A 1 1   ? 138.936 2.243   7.902   1.00 0.00 ? 1   SER A CA   4  
ATOM 6552  C C    . SER A 1 1   ? 139.621 3.285   7.010   1.00 0.00 ? 1   SER A C    4  
ATOM 6553  O O    . SER A 1 1   ? 139.014 4.305   6.671   1.00 0.00 ? 1   SER A O    4  
ATOM 6554  C CB   . SER A 1 1   ? 138.164 1.198   7.078   1.00 0.00 ? 1   SER A CB   4  
ATOM 6555  O OG   . SER A 1 1   ? 139.034 0.316   6.388   1.00 0.00 ? 1   SER A OG   4  
ATOM 6556  H H1   . SER A 1 1   ? 138.500 3.697   9.278   1.00 0.00 ? 1   SER A H1   4  
ATOM 6557  H H2   . SER A 1 1   ? 137.621 2.259   9.462   1.00 0.00 ? 1   SER A H2   4  
ATOM 6558  H H3   . SER A 1 1   ? 137.216 3.323   8.215   1.00 0.00 ? 1   SER A H3   4  
ATOM 6559  H HA   . SER A 1 1   ? 139.683 1.755   8.511   1.00 0.00 ? 1   SER A HA   4  
ATOM 6560  H HB2  . SER A 1 1   ? 137.541 0.614   7.739   1.00 0.00 ? 1   SER A HB2  4  
ATOM 6561  H HB3  . SER A 1 1   ? 137.538 1.706   6.358   1.00 0.00 ? 1   SER A HB3  4  
ATOM 6562  H HG   . SER A 1 1   ? 139.196 0.708   5.508   1.00 0.00 ? 1   SER A HG   4  
ATOM 6563  N N    . MET A 1 2   ? 140.881 3.042   6.665   1.00 0.00 ? 2   MET A N    4  
ATOM 6564  C CA   . MET A 1 2   ? 141.691 3.990   5.907   1.00 0.00 ? 2   MET A CA   4  
ATOM 6565  C C    . MET A 1 2   ? 141.665 3.727   4.412   1.00 0.00 ? 2   MET A C    4  
ATOM 6566  O O    . MET A 1 2   ? 142.009 2.633   3.947   1.00 0.00 ? 2   MET A O    4  
ATOM 6567  C CB   . MET A 1 2   ? 143.145 3.965   6.398   1.00 0.00 ? 2   MET A CB   4  
ATOM 6568  C CG   . MET A 1 2   ? 144.108 4.824   5.572   1.00 0.00 ? 2   MET A CG   4  
ATOM 6569  S SD   . MET A 1 2   ? 143.643 6.567   5.520   1.00 0.00 ? 2   MET A SD   4  
ATOM 6570  C CE   . MET A 1 2   ? 144.930 7.230   4.458   1.00 0.00 ? 2   MET A CE   4  
ATOM 6571  H H    . MET A 1 2   ? 141.294 2.180   6.905   1.00 0.00 ? 2   MET A H    4  
ATOM 6572  H HA   . MET A 1 2   ? 141.300 4.978   6.092   1.00 0.00 ? 2   MET A HA   4  
ATOM 6573  H HB2  . MET A 1 2   ? 143.173 4.320   7.417   1.00 0.00 ? 2   MET A HB2  4  
ATOM 6574  H HB3  . MET A 1 2   ? 143.499 2.945   6.375   1.00 0.00 ? 2   MET A HB3  4  
ATOM 6575  H HG2  . MET A 1 2   ? 145.096 4.748   6.002   1.00 0.00 ? 2   MET A HG2  4  
ATOM 6576  H HG3  . MET A 1 2   ? 144.131 4.440   4.562   1.00 0.00 ? 2   MET A HG3  4  
ATOM 6577  H HE1  . MET A 1 2   ? 145.896 7.050   4.908   1.00 0.00 ? 2   MET A HE1  4  
ATOM 6578  H HE2  . MET A 1 2   ? 144.782 8.294   4.339   1.00 0.00 ? 2   MET A HE2  4  
ATOM 6579  H HE3  . MET A 1 2   ? 144.885 6.748   3.493   1.00 0.00 ? 2   MET A HE3  4  
ATOM 6580  N N    . VAL A 1 3   ? 141.288 4.735   3.674   1.00 0.00 ? 3   VAL A N    4  
ATOM 6581  C CA   . VAL A 1 3   ? 141.300 4.703   2.239   1.00 0.00 ? 3   VAL A CA   4  
ATOM 6582  C C    . VAL A 1 3   ? 142.113 5.869   1.705   1.00 0.00 ? 3   VAL A C    4  
ATOM 6583  O O    . VAL A 1 3   ? 141.958 7.008   2.164   1.00 0.00 ? 3   VAL A O    4  
ATOM 6584  C CB   . VAL A 1 3   ? 139.848 4.676   1.630   1.00 0.00 ? 3   VAL A CB   4  
ATOM 6585  C CG1  . VAL A 1 3   ? 138.960 5.689   2.305   1.00 0.00 ? 3   VAL A CG1  4  
ATOM 6586  C CG2  . VAL A 1 3   ? 139.845 4.942   0.119   1.00 0.00 ? 3   VAL A CG2  4  
ATOM 6587  H H    . VAL A 1 3   ? 140.988 5.564   4.106   1.00 0.00 ? 3   VAL A H    4  
ATOM 6588  H HA   . VAL A 1 3   ? 141.810 3.794   1.956   1.00 0.00 ? 3   VAL A HA   4  
ATOM 6589  H HB   . VAL A 1 3   ? 139.428 3.696   1.803   1.00 0.00 ? 3   VAL A HB   4  
ATOM 6590  H HG11 . VAL A 1 3   ? 139.376 6.677   2.180   1.00 0.00 ? 3   VAL A HG11 4  
ATOM 6591  H HG12 . VAL A 1 3   ? 138.879 5.435   3.352   1.00 0.00 ? 3   VAL A HG12 4  
ATOM 6592  H HG13 . VAL A 1 3   ? 137.992 5.629   1.833   1.00 0.00 ? 3   VAL A HG13 4  
ATOM 6593  H HG21 . VAL A 1 3   ? 138.883 4.647   -0.275  1.00 0.00 ? 3   VAL A HG21 4  
ATOM 6594  H HG22 . VAL A 1 3   ? 140.635 4.400   -0.378  1.00 0.00 ? 3   VAL A HG22 4  
ATOM 6595  H HG23 . VAL A 1 3   ? 139.954 6.006   -0.062  1.00 0.00 ? 3   VAL A HG23 4  
ATOM 6596  N N    . SER A 1 4   ? 143.016 5.571   0.798   1.00 0.00 ? 4   SER A N    4  
ATOM 6597  C CA   . SER A 1 4   ? 143.792 6.575   0.143   1.00 0.00 ? 4   SER A CA   4  
ATOM 6598  C C    . SER A 1 4   ? 142.833 7.399   -0.722  1.00 0.00 ? 4   SER A C    4  
ATOM 6599  O O    . SER A 1 4   ? 142.026 6.821   -1.460  1.00 0.00 ? 4   SER A O    4  
ATOM 6600  C CB   . SER A 1 4   ? 144.865 5.895   -0.718  1.00 0.00 ? 4   SER A CB   4  
ATOM 6601  O OG   . SER A 1 4   ? 145.645 4.987   0.071   1.00 0.00 ? 4   SER A OG   4  
ATOM 6602  H H    . SER A 1 4   ? 143.153 4.632   0.535   1.00 0.00 ? 4   SER A H    4  
ATOM 6603  H HA   . SER A 1 4   ? 144.258 7.212   0.880   1.00 0.00 ? 4   SER A HA   4  
ATOM 6604  H HB2  . SER A 1 4   ? 144.388 5.345   -1.516  1.00 0.00 ? 4   SER A HB2  4  
ATOM 6605  H HB3  . SER A 1 4   ? 145.520 6.646   -1.135  1.00 0.00 ? 4   SER A HB3  4  
ATOM 6606  H HG   . SER A 1 4   ? 146.217 5.516   0.653   1.00 0.00 ? 4   SER A HG   4  
ATOM 6607  N N    . PRO A 1 5   ? 142.878 8.739   -0.619  1.00 0.00 ? 5   PRO A N    4  
ATOM 6608  C CA   . PRO A 1 5   ? 141.955 9.646   -1.332  1.00 0.00 ? 5   PRO A CA   4  
ATOM 6609  C C    . PRO A 1 5   ? 141.868 9.380   -2.837  1.00 0.00 ? 5   PRO A C    4  
ATOM 6610  O O    . PRO A 1 5   ? 140.841 9.647   -3.461  1.00 0.00 ? 5   PRO A O    4  
ATOM 6611  C CB   . PRO A 1 5   ? 142.518 11.036  -1.062  1.00 0.00 ? 5   PRO A CB   4  
ATOM 6612  C CG   . PRO A 1 5   ? 143.860 10.823  -0.441  1.00 0.00 ? 5   PRO A CG   4  
ATOM 6613  C CD   . PRO A 1 5   ? 143.810 9.491   0.226   1.00 0.00 ? 5   PRO A CD   4  
ATOM 6614  H HA   . PRO A 1 5   ? 140.960 9.575   -0.916  1.00 0.00 ? 5   PRO A HA   4  
ATOM 6615  H HB2  . PRO A 1 5   ? 142.600 11.575  -1.994  1.00 0.00 ? 5   PRO A HB2  4  
ATOM 6616  H HB3  . PRO A 1 5   ? 141.858 11.567  -0.393  1.00 0.00 ? 5   PRO A HB3  4  
ATOM 6617  H HG2  . PRO A 1 5   ? 144.622 10.828  -1.207  1.00 0.00 ? 5   PRO A HG2  4  
ATOM 6618  H HG3  . PRO A 1 5   ? 144.055 11.600  0.283   1.00 0.00 ? 5   PRO A HG3  4  
ATOM 6619  H HD2  . PRO A 1 5   ? 144.788 9.031   0.231   1.00 0.00 ? 5   PRO A HD2  4  
ATOM 6620  H HD3  . PRO A 1 5   ? 143.426 9.585   1.231   1.00 0.00 ? 5   PRO A HD3  4  
ATOM 6621  N N    . GLU A 1 6   ? 142.940 8.836   -3.397  1.00 0.00 ? 6   GLU A N    4  
ATOM 6622  C CA   . GLU A 1 6   ? 142.981 8.455   -4.803  1.00 0.00 ? 6   GLU A CA   4  
ATOM 6623  C C    . GLU A 1 6   ? 141.907 7.389   -5.075  1.00 0.00 ? 6   GLU A C    4  
ATOM 6624  O O    . GLU A 1 6   ? 141.090 7.530   -5.965  1.00 0.00 ? 6   GLU A O    4  
ATOM 6625  C CB   . GLU A 1 6   ? 144.355 7.893   -5.145  1.00 0.00 ? 6   GLU A CB   4  
ATOM 6626  C CG   . GLU A 1 6   ? 145.506 8.801   -4.759  1.00 0.00 ? 6   GLU A CG   4  
ATOM 6627  C CD   . GLU A 1 6   ? 146.840 8.211   -5.113  1.00 0.00 ? 6   GLU A CD   4  
ATOM 6628  O OE1  . GLU A 1 6   ? 147.185 7.125   -4.591  1.00 0.00 ? 6   GLU A OE1  4  
ATOM 6629  O OE2  . GLU A 1 6   ? 147.564 8.805   -5.937  1.00 0.00 ? 6   GLU A OE2  4  
ATOM 6630  H H    . GLU A 1 6   ? 143.728 8.698   -2.831  1.00 0.00 ? 6   GLU A H    4  
ATOM 6631  H HA   . GLU A 1 6   ? 142.786 9.328   -5.407  1.00 0.00 ? 6   GLU A HA   4  
ATOM 6632  H HB2  . GLU A 1 6   ? 144.481 6.952   -4.632  1.00 0.00 ? 6   GLU A HB2  4  
ATOM 6633  H HB3  . GLU A 1 6   ? 144.403 7.718   -6.209  1.00 0.00 ? 6   GLU A HB3  4  
ATOM 6634  H HG2  . GLU A 1 6   ? 145.397 9.744   -5.274  1.00 0.00 ? 6   GLU A HG2  4  
ATOM 6635  H HG3  . GLU A 1 6   ? 145.473 8.970   -3.691  1.00 0.00 ? 6   GLU A HG3  4  
ATOM 6636  N N    . GLU A 1 7   ? 141.885 6.364   -4.244  1.00 0.00 ? 7   GLU A N    4  
ATOM 6637  C CA   . GLU A 1 7   ? 140.918 5.283   -4.369  1.00 0.00 ? 7   GLU A CA   4  
ATOM 6638  C C    . GLU A 1 7   ? 139.529 5.798   -4.010  1.00 0.00 ? 7   GLU A C    4  
ATOM 6639  O O    . GLU A 1 7   ? 138.527 5.319   -4.517  1.00 0.00 ? 7   GLU A O    4  
ATOM 6640  C CB   . GLU A 1 7   ? 141.283 4.127   -3.437  1.00 0.00 ? 7   GLU A CB   4  
ATOM 6641  C CG   . GLU A 1 7   ? 140.352 2.928   -3.537  1.00 0.00 ? 7   GLU A CG   4  
ATOM 6642  C CD   . GLU A 1 7   ? 140.563 2.062   -4.768  1.00 0.00 ? 7   GLU A CD   4  
ATOM 6643  O OE1  . GLU A 1 7   ? 140.656 2.573   -5.906  1.00 0.00 ? 7   GLU A OE1  4  
ATOM 6644  O OE2  . GLU A 1 7   ? 140.612 0.822   -4.605  1.00 0.00 ? 7   GLU A OE2  4  
ATOM 6645  H H    . GLU A 1 7   ? 142.524 6.341   -3.503  1.00 0.00 ? 7   GLU A H    4  
ATOM 6646  H HA   . GLU A 1 7   ? 140.920 4.932   -5.392  1.00 0.00 ? 7   GLU A HA   4  
ATOM 6647  H HB2  . GLU A 1 7   ? 142.283 3.795   -3.671  1.00 0.00 ? 7   GLU A HB2  4  
ATOM 6648  H HB3  . GLU A 1 7   ? 141.262 4.486   -2.418  1.00 0.00 ? 7   GLU A HB3  4  
ATOM 6649  H HG2  . GLU A 1 7   ? 140.495 2.307   -2.664  1.00 0.00 ? 7   GLU A HG2  4  
ATOM 6650  H HG3  . GLU A 1 7   ? 139.335 3.293   -3.543  1.00 0.00 ? 7   GLU A HG3  4  
ATOM 6651  N N    . ALA A 1 8   ? 139.482 6.779   -3.137  1.00 0.00 ? 8   ALA A N    4  
ATOM 6652  C CA   . ALA A 1 8   ? 138.224 7.353   -2.748  1.00 0.00 ? 8   ALA A CA   4  
ATOM 6653  C C    . ALA A 1 8   ? 137.581 8.095   -3.923  1.00 0.00 ? 8   ALA A C    4  
ATOM 6654  O O    . ALA A 1 8   ? 136.398 7.980   -4.123  1.00 0.00 ? 8   ALA A O    4  
ATOM 6655  C CB   . ALA A 1 8   ? 138.356 8.221   -1.495  1.00 0.00 ? 8   ALA A CB   4  
ATOM 6656  H H    . ALA A 1 8   ? 140.324 7.105   -2.755  1.00 0.00 ? 8   ALA A H    4  
ATOM 6657  H HA   . ALA A 1 8   ? 137.578 6.517   -2.518  1.00 0.00 ? 8   ALA A HA   4  
ATOM 6658  H HB1  . ALA A 1 8   ? 137.384 8.587   -1.180  1.00 0.00 ? 8   ALA A HB1  4  
ATOM 6659  H HB2  . ALA A 1 8   ? 139.003 9.059   -1.707  1.00 0.00 ? 8   ALA A HB2  4  
ATOM 6660  H HB3  . ALA A 1 8   ? 138.792 7.603   -0.717  1.00 0.00 ? 8   ALA A HB3  4  
ATOM 6661  N N    . VAL A 1 9   ? 138.372 8.849   -4.719  1.00 0.00 ? 9   VAL A N    4  
ATOM 6662  C CA   . VAL A 1 9   ? 137.811 9.512   -5.921  1.00 0.00 ? 9   VAL A CA   4  
ATOM 6663  C C    . VAL A 1 9   ? 137.375 8.470   -6.948  1.00 0.00 ? 9   VAL A C    4  
ATOM 6664  O O    . VAL A 1 9   ? 136.475 8.708   -7.763  1.00 0.00 ? 9   VAL A O    4  
ATOM 6665  C CB   . VAL A 1 9   ? 138.764 10.563  -6.604  1.00 0.00 ? 9   VAL A CB   4  
ATOM 6666  C CG1  . VAL A 1 9   ? 139.269 11.589  -5.626  1.00 0.00 ? 9   VAL A CG1  4  
ATOM 6667  C CG2  . VAL A 1 9   ? 139.916 9.931   -7.346  1.00 0.00 ? 9   VAL A CG2  4  
ATOM 6668  H H    . VAL A 1 9   ? 139.307 9.001   -4.461  1.00 0.00 ? 9   VAL A H    4  
ATOM 6669  H HA   . VAL A 1 9   ? 136.914 10.013  -5.585  1.00 0.00 ? 9   VAL A HA   4  
ATOM 6670  H HB   . VAL A 1 9   ? 138.152 11.089  -7.320  1.00 0.00 ? 9   VAL A HB   4  
ATOM 6671  H HG11 . VAL A 1 9   ? 139.879 11.100  -4.881  1.00 0.00 ? 9   VAL A HG11 4  
ATOM 6672  H HG12 . VAL A 1 9   ? 138.424 12.044  -5.129  1.00 0.00 ? 9   VAL A HG12 4  
ATOM 6673  H HG13 . VAL A 1 9   ? 139.850 12.339  -6.141  1.00 0.00 ? 9   VAL A HG13 4  
ATOM 6674  H HG21 . VAL A 1 9   ? 139.531 9.288   -8.124  1.00 0.00 ? 9   VAL A HG21 4  
ATOM 6675  H HG22 . VAL A 1 9   ? 140.511 9.348   -6.658  1.00 0.00 ? 9   VAL A HG22 4  
ATOM 6676  H HG23 . VAL A 1 9   ? 140.527 10.703  -7.787  1.00 0.00 ? 9   VAL A HG23 4  
ATOM 6677  N N    . LYS A 1 10  ? 138.018 7.318   -6.896  1.00 0.00 ? 10  LYS A N    4  
ATOM 6678  C CA   . LYS A 1 10  ? 137.683 6.181   -7.745  1.00 0.00 ? 10  LYS A CA   4  
ATOM 6679  C C    . LYS A 1 10  ? 136.267 5.682   -7.436  1.00 0.00 ? 10  LYS A C    4  
ATOM 6680  O O    . LYS A 1 10  ? 135.578 5.160   -8.302  1.00 0.00 ? 10  LYS A O    4  
ATOM 6681  C CB   . LYS A 1 10  ? 138.709 5.062   -7.544  1.00 0.00 ? 10  LYS A CB   4  
ATOM 6682  C CG   . LYS A 1 10  ? 140.126 5.454   -7.946  1.00 0.00 ? 10  LYS A CG   4  
ATOM 6683  C CD   . LYS A 1 10  ? 140.283 5.483   -9.440  1.00 0.00 ? 10  LYS A CD   4  
ATOM 6684  C CE   . LYS A 1 10  ? 140.318 4.071   -9.963  1.00 0.00 ? 10  LYS A CE   4  
ATOM 6685  N NZ   . LYS A 1 10  ? 140.198 4.005   -11.420 1.00 0.00 ? 10  LYS A NZ   4  
ATOM 6686  H H    . LYS A 1 10  ? 138.771 7.250   -6.266  1.00 0.00 ? 10  LYS A H    4  
ATOM 6687  H HA   . LYS A 1 10  ? 137.720 6.511   -8.773  1.00 0.00 ? 10  LYS A HA   4  
ATOM 6688  H HB2  . LYS A 1 10  ? 138.717 4.782   -6.502  1.00 0.00 ? 10  LYS A HB2  4  
ATOM 6689  H HB3  . LYS A 1 10  ? 138.413 4.209   -8.136  1.00 0.00 ? 10  LYS A HB3  4  
ATOM 6690  H HG2  . LYS A 1 10  ? 140.342 6.437   -7.554  1.00 0.00 ? 10  LYS A HG2  4  
ATOM 6691  H HG3  . LYS A 1 10  ? 140.819 4.739   -7.528  1.00 0.00 ? 10  LYS A HG3  4  
ATOM 6692  H HD2  . LYS A 1 10  ? 139.445 6.008   -9.873  1.00 0.00 ? 10  LYS A HD2  4  
ATOM 6693  H HD3  . LYS A 1 10  ? 141.206 5.980   -9.695  1.00 0.00 ? 10  LYS A HD3  4  
ATOM 6694  H HE2  . LYS A 1 10  ? 141.255 3.624   -9.666  1.00 0.00 ? 10  LYS A HE2  4  
ATOM 6695  H HE3  . LYS A 1 10  ? 139.507 3.521   -9.510  1.00 0.00 ? 10  LYS A HE3  4  
ATOM 6696  H HZ1  . LYS A 1 10  ? 140.306 3.015   -11.723 1.00 0.00 ? 10  LYS A HZ1  4  
ATOM 6697  H HZ2  . LYS A 1 10  ? 140.898 4.596   -11.920 1.00 0.00 ? 10  LYS A HZ2  4  
ATOM 6698  H HZ3  . LYS A 1 10  ? 139.237 4.308   -11.690 1.00 0.00 ? 10  LYS A HZ3  4  
ATOM 6699  N N    . TRP A 1 11  ? 135.816 5.895   -6.210  1.00 0.00 ? 11  TRP A N    4  
ATOM 6700  C CA   . TRP A 1 11  ? 134.464 5.502   -5.797  1.00 0.00 ? 11  TRP A CA   4  
ATOM 6701  C C    . TRP A 1 11  ? 133.426 6.311   -6.557  1.00 0.00 ? 11  TRP A C    4  
ATOM 6702  O O    . TRP A 1 11  ? 132.296 5.862   -6.775  1.00 0.00 ? 11  TRP A O    4  
ATOM 6703  C CB   . TRP A 1 11  ? 134.275 5.686   -4.292  1.00 0.00 ? 11  TRP A CB   4  
ATOM 6704  C CG   . TRP A 1 11  ? 135.155 4.807   -3.457  1.00 0.00 ? 11  TRP A CG   4  
ATOM 6705  C CD1  . TRP A 1 11  ? 135.884 3.732   -3.877  1.00 0.00 ? 11  TRP A CD1  4  
ATOM 6706  C CD2  . TRP A 1 11  ? 135.370 4.910   -2.051  1.00 0.00 ? 11  TRP A CD2  4  
ATOM 6707  N NE1  . TRP A 1 11  ? 136.556 3.182   -2.823  1.00 0.00 ? 11  TRP A NE1  4  
ATOM 6708  C CE2  . TRP A 1 11  ? 136.252 3.880   -1.690  1.00 0.00 ? 11  TRP A CE2  4  
ATOM 6709  C CE3  . TRP A 1 11  ? 134.904 5.780   -1.060  1.00 0.00 ? 11  TRP A CE3  4  
ATOM 6710  C CZ2  . TRP A 1 11  ? 136.676 3.696   -0.390  1.00 0.00 ? 11  TRP A CZ2  4  
ATOM 6711  C CZ3  . TRP A 1 11  ? 135.324 5.588   0.236   1.00 0.00 ? 11  TRP A CZ3  4  
ATOM 6712  C CH2  . TRP A 1 11  ? 136.200 4.558   0.557   1.00 0.00 ? 11  TRP A CH2  4  
ATOM 6713  H H    . TRP A 1 11  ? 136.401 6.329   -5.552  1.00 0.00 ? 11  TRP A H    4  
ATOM 6714  H HA   . TRP A 1 11  ? 134.338 4.459   -6.046  1.00 0.00 ? 11  TRP A HA   4  
ATOM 6715  H HB2  . TRP A 1 11  ? 134.519 6.708   -4.043  1.00 0.00 ? 11  TRP A HB2  4  
ATOM 6716  H HB3  . TRP A 1 11  ? 133.248 5.503   -4.016  1.00 0.00 ? 11  TRP A HB3  4  
ATOM 6717  H HD1  . TRP A 1 11  ? 135.927 3.389   -4.899  1.00 0.00 ? 11  TRP A HD1  4  
ATOM 6718  H HE1  . TRP A 1 11  ? 137.152 2.411   -2.893  1.00 0.00 ? 11  TRP A HE1  4  
ATOM 6719  H HE3  . TRP A 1 11  ? 134.223 6.584   -1.300  1.00 0.00 ? 11  TRP A HE3  4  
ATOM 6720  H HZ2  . TRP A 1 11  ? 137.356 2.903   -0.117  1.00 0.00 ? 11  TRP A HZ2  4  
ATOM 6721  H HZ3  . TRP A 1 11  ? 134.964 6.236   1.026   1.00 0.00 ? 11  TRP A HZ3  4  
ATOM 6722  H HH2  . TRP A 1 11  ? 136.503 4.444   1.588   1.00 0.00 ? 11  TRP A HH2  4  
ATOM 6723  N N    . GLY A 1 12  ? 133.842 7.481   -7.007  1.00 0.00 ? 12  GLY A N    4  
ATOM 6724  C CA   . GLY A 1 12  ? 132.993 8.346   -7.780  1.00 0.00 ? 12  GLY A CA   4  
ATOM 6725  C C    . GLY A 1 12  ? 132.838 7.875   -9.211  1.00 0.00 ? 12  GLY A C    4  
ATOM 6726  O O    . GLY A 1 12  ? 132.101 8.478   -9.993  1.00 0.00 ? 12  GLY A O    4  
ATOM 6727  H H    . GLY A 1 12  ? 134.757 7.766   -6.796  1.00 0.00 ? 12  GLY A H    4  
ATOM 6728  H HA2  . GLY A 1 12  ? 132.017 8.382   -7.318  1.00 0.00 ? 12  GLY A HA2  4  
ATOM 6729  H HA3  . GLY A 1 12  ? 133.414 9.340   -7.785  1.00 0.00 ? 12  GLY A HA3  4  
ATOM 6730  N N    . GLU A 1 13  ? 133.552 6.819   -9.572  1.00 0.00 ? 13  GLU A N    4  
ATOM 6731  C CA   . GLU A 1 13  ? 133.408 6.229   -10.881 1.00 0.00 ? 13  GLU A CA   4  
ATOM 6732  C C    . GLU A 1 13  ? 132.264 5.249   -10.848 1.00 0.00 ? 13  GLU A C    4  
ATOM 6733  O O    . GLU A 1 13  ? 131.358 5.300   -11.677 1.00 0.00 ? 13  GLU A O    4  
ATOM 6734  C CB   . GLU A 1 13  ? 134.652 5.455   -11.294 1.00 0.00 ? 13  GLU A CB   4  
ATOM 6735  C CG   . GLU A 1 13  ? 135.943 6.228   -11.293 1.00 0.00 ? 13  GLU A CG   4  
ATOM 6736  C CD   . GLU A 1 13  ? 137.076 5.354   -11.742 1.00 0.00 ? 13  GLU A CD   4  
ATOM 6737  O OE1  . GLU A 1 13  ? 137.497 4.468   -10.987 1.00 0.00 ? 13  GLU A OE1  4  
ATOM 6738  O OE2  . GLU A 1 13  ? 137.540 5.504   -12.881 1.00 0.00 ? 13  GLU A OE2  4  
ATOM 6739  H H    . GLU A 1 13  ? 134.195 6.433   -8.937  1.00 0.00 ? 13  GLU A H    4  
ATOM 6740  H HA   . GLU A 1 13  ? 133.211 7.007   -11.604 1.00 0.00 ? 13  GLU A HA   4  
ATOM 6741  H HB2  . GLU A 1 13  ? 134.774 4.621   -10.620 1.00 0.00 ? 13  GLU A HB2  4  
ATOM 6742  H HB3  . GLU A 1 13  ? 134.493 5.066   -12.289 1.00 0.00 ? 13  GLU A HB3  4  
ATOM 6743  H HG2  . GLU A 1 13  ? 135.855 7.068   -11.966 1.00 0.00 ? 13  GLU A HG2  4  
ATOM 6744  H HG3  . GLU A 1 13  ? 136.146 6.577   -10.290 1.00 0.00 ? 13  GLU A HG3  4  
ATOM 6745  N N    . SER A 1 14  ? 132.288 4.375   -9.862  1.00 0.00 ? 14  SER A N    4  
ATOM 6746  C CA   . SER A 1 14  ? 131.330 3.310   -9.779  1.00 0.00 ? 14  SER A CA   4  
ATOM 6747  C C    . SER A 1 14  ? 130.994 2.973   -8.322  1.00 0.00 ? 14  SER A C    4  
ATOM 6748  O O    . SER A 1 14  ? 131.897 2.689   -7.498  1.00 0.00 ? 14  SER A O    4  
ATOM 6749  C CB   . SER A 1 14  ? 131.903 2.069   -10.477 1.00 0.00 ? 14  SER A CB   4  
ATOM 6750  O OG   . SER A 1 14  ? 132.227 2.336   -11.845 1.00 0.00 ? 14  SER A OG   4  
ATOM 6751  H H    . SER A 1 14  ? 132.958 4.453   -9.151  1.00 0.00 ? 14  SER A H    4  
ATOM 6752  H HA   . SER A 1 14  ? 130.435 3.606   -10.303 1.00 0.00 ? 14  SER A HA   4  
ATOM 6753  H HB2  . SER A 1 14  ? 132.801 1.757   -9.964  1.00 0.00 ? 14  SER A HB2  4  
ATOM 6754  H HB3  . SER A 1 14  ? 131.175 1.273   -10.439 1.00 0.00 ? 14  SER A HB3  4  
ATOM 6755  H HG   . SER A 1 14  ? 131.398 2.676   -12.228 1.00 0.00 ? 14  SER A HG   4  
ATOM 6756  N N    . PHE A 1 15  ? 129.708 2.992   -8.014  1.00 0.00 ? 15  PHE A N    4  
ATOM 6757  C CA   . PHE A 1 15  ? 129.189 2.610   -6.705  1.00 0.00 ? 15  PHE A CA   4  
ATOM 6758  C C    . PHE A 1 15  ? 129.626 1.187   -6.338  1.00 0.00 ? 15  PHE A C    4  
ATOM 6759  O O    . PHE A 1 15  ? 129.824 0.875   -5.171  1.00 0.00 ? 15  PHE A O    4  
ATOM 6760  C CB   . PHE A 1 15  ? 127.645 2.734   -6.699  1.00 0.00 ? 15  PHE A CB   4  
ATOM 6761  C CG   . PHE A 1 15  ? 126.957 2.255   -5.442  1.00 0.00 ? 15  PHE A CG   4  
ATOM 6762  C CD1  . PHE A 1 15  ? 127.264 2.793   -4.212  1.00 0.00 ? 15  PHE A CD1  4  
ATOM 6763  C CD2  . PHE A 1 15  ? 126.008 1.256   -5.503  1.00 0.00 ? 15  PHE A CD2  4  
ATOM 6764  C CE1  . PHE A 1 15  ? 126.639 2.344   -3.070  1.00 0.00 ? 15  PHE A CE1  4  
ATOM 6765  C CE2  . PHE A 1 15  ? 125.379 0.807   -4.360  1.00 0.00 ? 15  PHE A CE2  4  
ATOM 6766  C CZ   . PHE A 1 15  ? 125.696 1.352   -3.148  1.00 0.00 ? 15  PHE A CZ   4  
ATOM 6767  H H    . PHE A 1 15  ? 129.062 3.297   -8.696  1.00 0.00 ? 15  PHE A H    4  
ATOM 6768  H HA   . PHE A 1 15  ? 129.594 3.298   -5.977  1.00 0.00 ? 15  PHE A HA   4  
ATOM 6769  H HB2  . PHE A 1 15  ? 127.379 3.772   -6.831  1.00 0.00 ? 15  PHE A HB2  4  
ATOM 6770  H HB3  . PHE A 1 15  ? 127.252 2.170   -7.531  1.00 0.00 ? 15  PHE A HB3  4  
ATOM 6771  H HD1  . PHE A 1 15  ? 128.007 3.575   -4.145  1.00 0.00 ? 15  PHE A HD1  4  
ATOM 6772  H HD2  . PHE A 1 15  ? 125.755 0.822   -6.459  1.00 0.00 ? 15  PHE A HD2  4  
ATOM 6773  H HE1  . PHE A 1 15  ? 126.882 2.763   -2.104  1.00 0.00 ? 15  PHE A HE1  4  
ATOM 6774  H HE2  . PHE A 1 15  ? 124.636 0.024   -4.411  1.00 0.00 ? 15  PHE A HE2  4  
ATOM 6775  H HZ   . PHE A 1 15  ? 125.206 1.002   -2.252  1.00 0.00 ? 15  PHE A HZ   4  
ATOM 6776  N N    . ASP A 1 16  ? 129.815 0.346   -7.347  1.00 0.00 ? 16  ASP A N    4  
ATOM 6777  C CA   . ASP A 1 16  ? 130.227 -1.037  -7.123  1.00 0.00 ? 16  ASP A CA   4  
ATOM 6778  C C    . ASP A 1 16  ? 131.606 -1.108  -6.452  1.00 0.00 ? 16  ASP A C    4  
ATOM 6779  O O    . ASP A 1 16  ? 131.799 -1.889  -5.538  1.00 0.00 ? 16  ASP A O    4  
ATOM 6780  C CB   . ASP A 1 16  ? 130.231 -1.878  -8.431  1.00 0.00 ? 16  ASP A CB   4  
ATOM 6781  C CG   . ASP A 1 16  ? 131.574 -1.924  -9.157  1.00 0.00 ? 16  ASP A CG   4  
ATOM 6782  O OD1  . ASP A 1 16  ? 131.879 -1.026  -9.943  1.00 0.00 ? 16  ASP A OD1  4  
ATOM 6783  O OD2  . ASP A 1 16  ? 132.336 -2.891  -8.949  1.00 0.00 ? 16  ASP A OD2  4  
ATOM 6784  H H    . ASP A 1 16  ? 129.634 0.663   -8.262  1.00 0.00 ? 16  ASP A H    4  
ATOM 6785  H HA   . ASP A 1 16  ? 129.508 -1.466  -6.438  1.00 0.00 ? 16  ASP A HA   4  
ATOM 6786  H HB2  . ASP A 1 16  ? 129.945 -2.893  -8.198  1.00 0.00 ? 16  ASP A HB2  4  
ATOM 6787  H HB3  . ASP A 1 16  ? 129.498 -1.456  -9.102  1.00 0.00 ? 16  ASP A HB3  4  
ATOM 6788  N N    . LYS A 1 17  ? 132.549 -0.258  -6.863  1.00 0.00 ? 17  LYS A N    4  
ATOM 6789  C CA   . LYS A 1 17  ? 133.890 -0.332  -6.293  1.00 0.00 ? 17  LYS A CA   4  
ATOM 6790  C C    . LYS A 1 17  ? 133.933 0.333   -4.936  1.00 0.00 ? 17  LYS A C    4  
ATOM 6791  O O    . LYS A 1 17  ? 134.787 0.009   -4.103  1.00 0.00 ? 17  LYS A O    4  
ATOM 6792  C CB   . LYS A 1 17  ? 134.976 0.218   -7.221  1.00 0.00 ? 17  LYS A CB   4  
ATOM 6793  C CG   . LYS A 1 17  ? 134.856 1.687   -7.560  1.00 0.00 ? 17  LYS A CG   4  
ATOM 6794  C CD   . LYS A 1 17  ? 136.088 2.180   -8.289  1.00 0.00 ? 17  LYS A CD   4  
ATOM 6795  C CE   . LYS A 1 17  ? 136.311 1.469   -9.602  1.00 0.00 ? 17  LYS A CE   4  
ATOM 6796  N NZ   . LYS A 1 17  ? 137.546 1.922   -10.256 1.00 0.00 ? 17  LYS A NZ   4  
ATOM 6797  H H    . LYS A 1 17  ? 132.320 0.412   -7.543  1.00 0.00 ? 17  LYS A H    4  
ATOM 6798  H HA   . LYS A 1 17  ? 134.073 -1.384  -6.125  1.00 0.00 ? 17  LYS A HA   4  
ATOM 6799  H HB2  . LYS A 1 17  ? 135.936 0.063   -6.752  1.00 0.00 ? 17  LYS A HB2  4  
ATOM 6800  H HB3  . LYS A 1 17  ? 134.951 -0.345  -8.143  1.00 0.00 ? 17  LYS A HB3  4  
ATOM 6801  H HG2  . LYS A 1 17  ? 133.992 1.834   -8.191  1.00 0.00 ? 17  LYS A HG2  4  
ATOM 6802  H HG3  . LYS A 1 17  ? 134.736 2.250   -6.647  1.00 0.00 ? 17  LYS A HG3  4  
ATOM 6803  H HD2  . LYS A 1 17  ? 135.978 3.236   -8.483  1.00 0.00 ? 17  LYS A HD2  4  
ATOM 6804  H HD3  . LYS A 1 17  ? 136.949 2.026   -7.654  1.00 0.00 ? 17  LYS A HD3  4  
ATOM 6805  H HE2  . LYS A 1 17  ? 136.381 0.407   -9.417  1.00 0.00 ? 17  LYS A HE2  4  
ATOM 6806  H HE3  . LYS A 1 17  ? 135.472 1.667   -10.253 1.00 0.00 ? 17  LYS A HE3  4  
ATOM 6807  H HZ1  . LYS A 1 17  ? 137.489 2.939   -10.498 1.00 0.00 ? 17  LYS A HZ1  4  
ATOM 6808  H HZ2  . LYS A 1 17  ? 137.691 1.384   -11.138 1.00 0.00 ? 17  LYS A HZ2  4  
ATOM 6809  H HZ3  . LYS A 1 17  ? 138.363 1.766   -9.624  1.00 0.00 ? 17  LYS A HZ3  4  
ATOM 6810  N N    . LEU A 1 18  ? 133.018 1.267   -4.738  1.00 0.00 ? 18  LEU A N    4  
ATOM 6811  C CA   . LEU A 1 18  ? 132.796 1.888   -3.440  1.00 0.00 ? 18  LEU A CA   4  
ATOM 6812  C C    . LEU A 1 18  ? 132.341 0.819   -2.461  1.00 0.00 ? 18  LEU A C    4  
ATOM 6813  O O    . LEU A 1 18  ? 132.906 0.642   -1.382  1.00 0.00 ? 18  LEU A O    4  
ATOM 6814  C CB   . LEU A 1 18  ? 131.686 2.961   -3.588  1.00 0.00 ? 18  LEU A CB   4  
ATOM 6815  C CG   . LEU A 1 18  ? 130.994 3.470   -2.303  1.00 0.00 ? 18  LEU A CG   4  
ATOM 6816  C CD1  . LEU A 1 18  ? 131.959 4.179   -1.388  1.00 0.00 ? 18  LEU A CD1  4  
ATOM 6817  C CD2  . LEU A 1 18  ? 129.850 4.388   -2.659  1.00 0.00 ? 18  LEU A CD2  4  
ATOM 6818  H H    . LEU A 1 18  ? 132.474 1.560   -5.503  1.00 0.00 ? 18  LEU A H    4  
ATOM 6819  H HA   . LEU A 1 18  ? 133.705 2.359   -3.097  1.00 0.00 ? 18  LEU A HA   4  
ATOM 6820  H HB2  . LEU A 1 18  ? 132.122 3.816   -4.081  1.00 0.00 ? 18  LEU A HB2  4  
ATOM 6821  H HB3  . LEU A 1 18  ? 130.926 2.554   -4.237  1.00 0.00 ? 18  LEU A HB3  4  
ATOM 6822  H HG   . LEU A 1 18  ? 130.581 2.620   -1.773  1.00 0.00 ? 18  LEU A HG   4  
ATOM 6823  H HD11 . LEU A 1 18  ? 132.380 5.033   -1.899  1.00 0.00 ? 18  LEU A HD11 4  
ATOM 6824  H HD12 . LEU A 1 18  ? 132.757 3.504   -1.114  1.00 0.00 ? 18  LEU A HD12 4  
ATOM 6825  H HD13 . LEU A 1 18  ? 131.460 4.512   -0.488  1.00 0.00 ? 18  LEU A HD13 4  
ATOM 6826  H HD21 . LEU A 1 18  ? 129.374 4.737   -1.754  1.00 0.00 ? 18  LEU A HD21 4  
ATOM 6827  H HD22 . LEU A 1 18  ? 129.131 3.849   -3.259  1.00 0.00 ? 18  LEU A HD22 4  
ATOM 6828  H HD23 . LEU A 1 18  ? 130.225 5.232   -3.218  1.00 0.00 ? 18  LEU A HD23 4  
ATOM 6829  N N    . LEU A 1 19  ? 131.373 0.080   -2.905  1.00 0.00 ? 19  LEU A N    4  
ATOM 6830  C CA   . LEU A 1 19  ? 130.689 -0.899  -2.120  1.00 0.00 ? 19  LEU A CA   4  
ATOM 6831  C C    . LEU A 1 19  ? 131.557 -2.139  -1.851  1.00 0.00 ? 19  LEU A C    4  
ATOM 6832  O O    . LEU A 1 19  ? 131.489 -2.733  -0.771  1.00 0.00 ? 19  LEU A O    4  
ATOM 6833  C CB   . LEU A 1 19  ? 129.434 -1.268  -2.866  1.00 0.00 ? 19  LEU A CB   4  
ATOM 6834  C CG   . LEU A 1 19  ? 128.294 -1.762  -2.042  1.00 0.00 ? 19  LEU A CG   4  
ATOM 6835  C CD1  . LEU A 1 19  ? 127.895 -0.682  -1.023  1.00 0.00 ? 19  LEU A CD1  4  
ATOM 6836  C CD2  . LEU A 1 19  ? 127.139 -2.094  -2.968  1.00 0.00 ? 19  LEU A CD2  4  
ATOM 6837  H H    . LEU A 1 19  ? 131.067 0.221   -3.828  1.00 0.00 ? 19  LEU A H    4  
ATOM 6838  H HA   . LEU A 1 19  ? 130.398 -0.447  -1.183  1.00 0.00 ? 19  LEU A HA   4  
ATOM 6839  H HB2  . LEU A 1 19  ? 129.098 -0.394  -3.408  1.00 0.00 ? 19  LEU A HB2  4  
ATOM 6840  H HB3  . LEU A 1 19  ? 129.685 -2.033  -3.584  1.00 0.00 ? 19  LEU A HB3  4  
ATOM 6841  H HG   . LEU A 1 19  ? 128.579 -2.659  -1.511  1.00 0.00 ? 19  LEU A HG   4  
ATOM 6842  H HD11 . LEU A 1 19  ? 128.766 -0.400  -0.450  1.00 0.00 ? 19  LEU A HD11 4  
ATOM 6843  H HD12 . LEU A 1 19  ? 127.144 -1.051  -0.337  1.00 0.00 ? 19  LEU A HD12 4  
ATOM 6844  H HD13 . LEU A 1 19  ? 127.525 0.188   -1.545  1.00 0.00 ? 19  LEU A HD13 4  
ATOM 6845  H HD21 . LEU A 1 19  ? 127.451 -2.858  -3.666  1.00 0.00 ? 19  LEU A HD21 4  
ATOM 6846  H HD22 . LEU A 1 19  ? 126.874 -1.214  -3.536  1.00 0.00 ? 19  LEU A HD22 4  
ATOM 6847  H HD23 . LEU A 1 19  ? 126.288 -2.443  -2.401  1.00 0.00 ? 19  LEU A HD23 4  
ATOM 6848  N N    . SER A 1 20  ? 132.384 -2.512  -2.816  1.00 0.00 ? 20  SER A N    4  
ATOM 6849  C CA   . SER A 1 20  ? 133.273 -3.658  -2.660  1.00 0.00 ? 20  SER A CA   4  
ATOM 6850  C C    . SER A 1 20  ? 134.508 -3.300  -1.834  1.00 0.00 ? 20  SER A C    4  
ATOM 6851  O O    . SER A 1 20  ? 135.382 -4.131  -1.593  1.00 0.00 ? 20  SER A O    4  
ATOM 6852  C CB   . SER A 1 20  ? 133.688 -4.190  -4.020  1.00 0.00 ? 20  SER A CB   4  
ATOM 6853  O OG   . SER A 1 20  ? 132.549 -4.530  -4.795  1.00 0.00 ? 20  SER A OG   4  
ATOM 6854  H H    . SER A 1 20  ? 132.379 -2.031  -3.672  1.00 0.00 ? 20  SER A H    4  
ATOM 6855  H HA   . SER A 1 20  ? 132.723 -4.429  -2.140  1.00 0.00 ? 20  SER A HA   4  
ATOM 6856  H HB2  . SER A 1 20  ? 134.255 -3.434  -4.543  1.00 0.00 ? 20  SER A HB2  4  
ATOM 6857  H HB3  . SER A 1 20  ? 134.299 -5.072  -3.890  1.00 0.00 ? 20  SER A HB3  4  
ATOM 6858  H HG   . SER A 1 20  ? 131.825 -4.735  -4.184  1.00 0.00 ? 20  SER A HG   4  
ATOM 6859  N N    . HIS A 1 21  ? 134.573 -2.080  -1.406  1.00 0.00 ? 21  HIS A N    4  
ATOM 6860  C CA   . HIS A 1 21  ? 135.659 -1.633  -0.607  1.00 0.00 ? 21  HIS A CA   4  
ATOM 6861  C C    . HIS A 1 21  ? 135.126 -1.553  0.784   1.00 0.00 ? 21  HIS A C    4  
ATOM 6862  O O    . HIS A 1 21  ? 134.088 -0.948  0.983   1.00 0.00 ? 21  HIS A O    4  
ATOM 6863  C CB   . HIS A 1 21  ? 136.104 -0.245  -1.064  1.00 0.00 ? 21  HIS A CB   4  
ATOM 6864  C CG   . HIS A 1 21  ? 137.566 -0.119  -1.367  1.00 0.00 ? 21  HIS A CG   4  
ATOM 6865  N ND1  . HIS A 1 21  ? 138.472 0.457   -0.508  1.00 0.00 ? 21  HIS A ND1  4  
ATOM 6866  C CD2  . HIS A 1 21  ? 138.260 -0.424  -2.482  1.00 0.00 ? 21  HIS A CD2  4  
ATOM 6867  C CE1  . HIS A 1 21  ? 139.643 0.522   -1.081  1.00 0.00 ? 21  HIS A CE1  4  
ATOM 6868  N NE2  . HIS A 1 21  ? 139.547 -0.014  -2.282  1.00 0.00 ? 21  HIS A NE2  4  
ATOM 6869  H H    . HIS A 1 21  ? 133.827 -1.465  -1.576  1.00 0.00 ? 21  HIS A H    4  
ATOM 6870  H HA   . HIS A 1 21  ? 136.481 -2.330  -0.670  1.00 0.00 ? 21  HIS A HA   4  
ATOM 6871  H HB2  . HIS A 1 21  ? 135.566 0.012   -1.964  1.00 0.00 ? 21  HIS A HB2  4  
ATOM 6872  H HB3  . HIS A 1 21  ? 135.858 0.471   -0.294  1.00 0.00 ? 21  HIS A HB3  4  
ATOM 6873  H HD1  . HIS A 1 21  ? 138.365 0.698   0.445   1.00 0.00 ? 21  HIS A HD1  4  
ATOM 6874  H HD2  . HIS A 1 21  ? 137.868 -0.904  -3.368  1.00 0.00 ? 21  HIS A HD2  4  
ATOM 6875  H HE1  . HIS A 1 21  ? 140.501 0.998   -0.628  1.00 0.00 ? 21  HIS A HE1  4  
ATOM 6876  H HE2  . HIS A 1 21  ? 140.153 0.198   -3.037  1.00 0.00 ? 21  HIS A HE2  4  
ATOM 6877  N N    . ARG A 1 22  ? 135.796 -2.138  1.748   1.00 0.00 ? 22  ARG A N    4  
ATOM 6878  C CA   . ARG A 1 22  ? 135.273 -2.114  3.120   1.00 0.00 ? 22  ARG A CA   4  
ATOM 6879  C C    . ARG A 1 22  ? 135.240 -0.690  3.647   1.00 0.00 ? 22  ARG A C    4  
ATOM 6880  O O    . ARG A 1 22  ? 134.357 -0.315  4.388   1.00 0.00 ? 22  ARG A O    4  
ATOM 6881  C CB   . ARG A 1 22  ? 136.036 -3.032  4.101   1.00 0.00 ? 22  ARG A CB   4  
ATOM 6882  C CG   . ARG A 1 22  ? 135.930 -4.545  3.846   1.00 0.00 ? 22  ARG A CG   4  
ATOM 6883  C CD   . ARG A 1 22  ? 136.758 -5.010  2.656   1.00 0.00 ? 22  ARG A CD   4  
ATOM 6884  N NE   . ARG A 1 22  ? 138.191 -4.739  2.846   1.00 0.00 ? 22  ARG A NE   4  
ATOM 6885  C CZ   . ARG A 1 22  ? 139.189 -5.236  2.093   1.00 0.00 ? 22  ARG A CZ   4  
ATOM 6886  N NH1  . ARG A 1 22  ? 138.939 -6.121  1.128   1.00 0.00 ? 22  ARG A NH1  4  
ATOM 6887  N NH2  . ARG A 1 22  ? 140.440 -4.852  2.323   1.00 0.00 ? 22  ARG A NH2  4  
ATOM 6888  H H    . ARG A 1 22  ? 136.654 -2.570  1.529   1.00 0.00 ? 22  ARG A H    4  
ATOM 6889  H HA   . ARG A 1 22  ? 134.245 -2.442  3.054   1.00 0.00 ? 22  ARG A HA   4  
ATOM 6890  H HB2  . ARG A 1 22  ? 137.084 -2.772  4.061   1.00 0.00 ? 22  ARG A HB2  4  
ATOM 6891  H HB3  . ARG A 1 22  ? 135.675 -2.833  5.101   1.00 0.00 ? 22  ARG A HB3  4  
ATOM 6892  H HG2  . ARG A 1 22  ? 136.274 -5.070  4.723   1.00 0.00 ? 22  ARG A HG2  4  
ATOM 6893  H HG3  . ARG A 1 22  ? 134.893 -4.791  3.671   1.00 0.00 ? 22  ARG A HG3  4  
ATOM 6894  H HD2  . ARG A 1 22  ? 136.615 -6.073  2.524   1.00 0.00 ? 22  ARG A HD2  4  
ATOM 6895  H HD3  . ARG A 1 22  ? 136.417 -4.486  1.774   1.00 0.00 ? 22  ARG A HD3  4  
ATOM 6896  H HE   . ARG A 1 22  ? 138.403 -4.111  3.576   1.00 0.00 ? 22  ARG A HE   4  
ATOM 6897  H HH11 . ARG A 1 22  ? 138.011 -6.464  0.920   1.00 0.00 ? 22  ARG A HH11 4  
ATOM 6898  H HH12 . ARG A 1 22  ? 139.673 -6.479  0.538   1.00 0.00 ? 22  ARG A HH12 4  
ATOM 6899  H HH21 . ARG A 1 22  ? 140.680 -4.187  3.048   1.00 0.00 ? 22  ARG A HH21 4  
ATOM 6900  H HH22 . ARG A 1 22  ? 141.232 -5.195  1.800   1.00 0.00 ? 22  ARG A HH22 4  
ATOM 6901  N N    . ASP A 1 23  ? 136.184 0.111   3.191   1.00 0.00 ? 23  ASP A N    4  
ATOM 6902  C CA   . ASP A 1 23  ? 136.270 1.529   3.570   1.00 0.00 ? 23  ASP A CA   4  
ATOM 6903  C C    . ASP A 1 23  ? 135.100 2.277   2.974   1.00 0.00 ? 23  ASP A C    4  
ATOM 6904  O O    . ASP A 1 23  ? 134.595 3.237   3.552   1.00 0.00 ? 23  ASP A O    4  
ATOM 6905  C CB   . ASP A 1 23  ? 137.526 2.178   2.999   1.00 0.00 ? 23  ASP A CB   4  
ATOM 6906  C CG   . ASP A 1 23  ? 138.721 1.308   3.053   1.00 0.00 ? 23  ASP A CG   4  
ATOM 6907  O OD1  . ASP A 1 23  ? 139.422 1.283   4.049   1.00 0.00 ? 23  ASP A OD1  4  
ATOM 6908  O OD2  . ASP A 1 23  ? 138.964 0.598   2.066   1.00 0.00 ? 23  ASP A OD2  4  
ATOM 6909  H H    . ASP A 1 23  ? 136.868 -0.286  2.609   1.00 0.00 ? 23  ASP A H    4  
ATOM 6910  H HA   . ASP A 1 23  ? 136.276 1.622   4.646   1.00 0.00 ? 23  ASP A HA   4  
ATOM 6911  H HB2  . ASP A 1 23  ? 137.350 2.435   1.965   1.00 0.00 ? 23  ASP A HB2  4  
ATOM 6912  H HB3  . ASP A 1 23  ? 137.733 3.083   3.551   1.00 0.00 ? 23  ASP A HB3  4  
ATOM 6913  N N    . GLY A 1 24  ? 134.675 1.832   1.809   1.00 0.00 ? 24  GLY A N    4  
ATOM 6914  C CA   . GLY A 1 24  ? 133.622 2.499   1.100   1.00 0.00 ? 24  GLY A CA   4  
ATOM 6915  C C    . GLY A 1 24  ? 132.303 2.071   1.579   1.00 0.00 ? 24  GLY A C    4  
ATOM 6916  O O    . GLY A 1 24  ? 131.417 2.885   1.735   1.00 0.00 ? 24  GLY A O    4  
ATOM 6917  H H    . GLY A 1 24  ? 135.059 1.007   1.452   1.00 0.00 ? 24  GLY A H    4  
ATOM 6918  H HA2  . GLY A 1 24  ? 133.718 3.562   1.259   1.00 0.00 ? 24  GLY A HA2  4  
ATOM 6919  H HA3  . GLY A 1 24  ? 133.690 2.306   0.046   1.00 0.00 ? 24  GLY A HA3  4  
ATOM 6920  N N    . LEU A 1 25  ? 132.178 0.787   1.825   1.00 0.00 ? 25  LEU A N    4  
ATOM 6921  C CA   . LEU A 1 25  ? 131.018 0.222   2.454   1.00 0.00 ? 25  LEU A CA   4  
ATOM 6922  C C    . LEU A 1 25  ? 130.768 0.939   3.764   1.00 0.00 ? 25  LEU A C    4  
ATOM 6923  O O    . LEU A 1 25  ? 129.648 1.236   4.107   1.00 0.00 ? 25  LEU A O    4  
ATOM 6924  C CB   . LEU A 1 25  ? 131.214 -1.314  2.619   1.00 0.00 ? 25  LEU A CB   4  
ATOM 6925  C CG   . LEU A 1 25  ? 130.627 -2.007  3.866   1.00 0.00 ? 25  LEU A CG   4  
ATOM 6926  C CD1  . LEU A 1 25  ? 130.360 -3.469  3.551   1.00 0.00 ? 25  LEU A CD1  4  
ATOM 6927  C CD2  . LEU A 1 25  ? 131.637 -1.942  5.023   1.00 0.00 ? 25  LEU A CD2  4  
ATOM 6928  H H    . LEU A 1 25  ? 132.899 0.179   1.545   1.00 0.00 ? 25  LEU A H    4  
ATOM 6929  H HA   . LEU A 1 25  ? 130.176 0.400   1.800   1.00 0.00 ? 25  LEU A HA   4  
ATOM 6930  H HB2  . LEU A 1 25  ? 130.779 -1.790  1.753   1.00 0.00 ? 25  LEU A HB2  4  
ATOM 6931  H HB3  . LEU A 1 25  ? 132.277 -1.505  2.600   1.00 0.00 ? 25  LEU A HB3  4  
ATOM 6932  H HG   . LEU A 1 25  ? 129.712 -1.527  4.180   1.00 0.00 ? 25  LEU A HG   4  
ATOM 6933  H HD11 . LEU A 1 25  ? 131.284 -3.952  3.270   1.00 0.00 ? 25  LEU A HD11 4  
ATOM 6934  H HD12 . LEU A 1 25  ? 129.655 -3.540  2.735   1.00 0.00 ? 25  LEU A HD12 4  
ATOM 6935  H HD13 . LEU A 1 25  ? 129.950 -3.957  4.423   1.00 0.00 ? 25  LEU A HD13 4  
ATOM 6936  H HD21 . LEU A 1 25  ? 131.227 -2.421  5.899   1.00 0.00 ? 25  LEU A HD21 4  
ATOM 6937  H HD22 . LEU A 1 25  ? 131.907 -0.917  5.259   1.00 0.00 ? 25  LEU A HD22 4  
ATOM 6938  H HD23 . LEU A 1 25  ? 132.533 -2.466  4.720   1.00 0.00 ? 25  LEU A HD23 4  
ATOM 6939  N N    . GLU A 1 26  ? 131.850 1.263   4.433   1.00 0.00 ? 26  GLU A N    4  
ATOM 6940  C CA   . GLU A 1 26  ? 131.834 1.993   5.661   1.00 0.00 ? 26  GLU A CA   4  
ATOM 6941  C C    . GLU A 1 26  ? 131.439 3.467   5.436   1.00 0.00 ? 26  GLU A C    4  
ATOM 6942  O O    . GLU A 1 26  ? 130.592 3.994   6.164   1.00 0.00 ? 26  GLU A O    4  
ATOM 6943  C CB   . GLU A 1 26  ? 133.195 1.873   6.298   1.00 0.00 ? 26  GLU A CB   4  
ATOM 6944  C CG   . GLU A 1 26  ? 133.374 2.654   7.583   1.00 0.00 ? 26  GLU A CG   4  
ATOM 6945  C CD   . GLU A 1 26  ? 134.783 2.593   8.087   1.00 0.00 ? 26  GLU A CD   4  
ATOM 6946  O OE1  . GLU A 1 26  ? 135.620 3.456   7.694   1.00 0.00 ? 26  GLU A OE1  4  
ATOM 6947  O OE2  . GLU A 1 26  ? 135.096 1.688   8.881   1.00 0.00 ? 26  GLU A OE2  4  
ATOM 6948  H H    . GLU A 1 26  ? 132.716 0.959   4.086   1.00 0.00 ? 26  GLU A H    4  
ATOM 6949  H HA   . GLU A 1 26  ? 131.109 1.533   6.315   1.00 0.00 ? 26  GLU A HA   4  
ATOM 6950  H HB2  . GLU A 1 26  ? 133.314 0.812   6.485   1.00 0.00 ? 26  GLU A HB2  4  
ATOM 6951  H HB3  . GLU A 1 26  ? 133.941 2.179   5.580   1.00 0.00 ? 26  GLU A HB3  4  
ATOM 6952  H HG2  . GLU A 1 26  ? 133.114 3.688   7.405   1.00 0.00 ? 26  GLU A HG2  4  
ATOM 6953  H HG3  . GLU A 1 26  ? 132.717 2.242   8.335   1.00 0.00 ? 26  GLU A HG3  4  
ATOM 6954  N N    . ALA A 1 27  ? 132.009 4.125   4.406   1.00 0.00 ? 27  ALA A N    4  
ATOM 6955  C CA   . ALA A 1 27  ? 131.668 5.536   4.162   1.00 0.00 ? 27  ALA A CA   4  
ATOM 6956  C C    . ALA A 1 27  ? 130.214 5.637   3.742   1.00 0.00 ? 27  ALA A C    4  
ATOM 6957  O O    . ALA A 1 27  ? 129.469 6.519   4.191   1.00 0.00 ? 27  ALA A O    4  
ATOM 6958  C CB   . ALA A 1 27  ? 132.573 6.189   3.094   1.00 0.00 ? 27  ALA A CB   4  
ATOM 6959  H H    . ALA A 1 27  ? 132.636 3.661   3.800   1.00 0.00 ? 27  ALA A H    4  
ATOM 6960  H HA   . ALA A 1 27  ? 131.788 6.062   5.097   1.00 0.00 ? 27  ALA A HA   4  
ATOM 6961  H HB1  . ALA A 1 27  ? 132.527 5.651   2.156   1.00 0.00 ? 27  ALA A HB1  4  
ATOM 6962  H HB2  . ALA A 1 27  ? 133.603 6.270   3.417   1.00 0.00 ? 27  ALA A HB2  4  
ATOM 6963  H HB3  . ALA A 1 27  ? 132.180 7.188   2.929   1.00 0.00 ? 27  ALA A HB3  4  
ATOM 6964  N N    . PHE A 1 28  ? 129.803 4.696   2.933   1.00 0.00 ? 28  PHE A N    4  
ATOM 6965  C CA   . PHE A 1 28  ? 128.478 4.674   2.404   1.00 0.00 ? 28  PHE A CA   4  
ATOM 6966  C C    . PHE A 1 28  ? 127.479 4.275   3.468   1.00 0.00 ? 28  PHE A C    4  
ATOM 6967  O O    . PHE A 1 28  ? 126.420 4.872   3.558   1.00 0.00 ? 28  PHE A O    4  
ATOM 6968  C CB   . PHE A 1 28  ? 128.381 3.747   1.189   1.00 0.00 ? 28  PHE A CB   4  
ATOM 6969  C CG   . PHE A 1 28  ? 127.057 3.822   0.496   1.00 0.00 ? 28  PHE A CG   4  
ATOM 6970  C CD1  . PHE A 1 28  ? 126.746 4.919   -0.287  1.00 0.00 ? 28  PHE A CD1  4  
ATOM 6971  C CD2  . PHE A 1 28  ? 126.121 2.807   0.628   1.00 0.00 ? 28  PHE A CD2  4  
ATOM 6972  C CE1  . PHE A 1 28  ? 125.535 5.008   -0.925  1.00 0.00 ? 28  PHE A CE1  4  
ATOM 6973  C CE2  . PHE A 1 28  ? 124.907 2.894   -0.010  1.00 0.00 ? 28  PHE A CE2  4  
ATOM 6974  C CZ   . PHE A 1 28  ? 124.614 3.996   -0.786  1.00 0.00 ? 28  PHE A CZ   4  
ATOM 6975  H H    . PHE A 1 28  ? 130.434 3.983   2.682   1.00 0.00 ? 28  PHE A H    4  
ATOM 6976  H HA   . PHE A 1 28  ? 128.245 5.679   2.083   1.00 0.00 ? 28  PHE A HA   4  
ATOM 6977  H HB2  . PHE A 1 28  ? 129.148 4.014   0.477   1.00 0.00 ? 28  PHE A HB2  4  
ATOM 6978  H HB3  . PHE A 1 28  ? 128.536 2.728   1.508   1.00 0.00 ? 28  PHE A HB3  4  
ATOM 6979  H HD1  . PHE A 1 28  ? 127.469 5.713   -0.395  1.00 0.00 ? 28  PHE A HD1  4  
ATOM 6980  H HD2  . PHE A 1 28  ? 126.342 1.938   1.229   1.00 0.00 ? 28  PHE A HD2  4  
ATOM 6981  H HE1  . PHE A 1 28  ? 125.307 5.870   -1.535  1.00 0.00 ? 28  PHE A HE1  4  
ATOM 6982  H HE2  . PHE A 1 28  ? 124.183 2.101   0.098   1.00 0.00 ? 28  PHE A HE2  4  
ATOM 6983  H HZ   . PHE A 1 28  ? 123.663 4.063   -1.291  1.00 0.00 ? 28  PHE A HZ   4  
ATOM 6984  N N    . THR A 1 29  ? 127.826 3.292   4.300   1.00 0.00 ? 29  THR A N    4  
ATOM 6985  C CA   . THR A 1 29  ? 126.916 2.836   5.328   1.00 0.00 ? 29  THR A CA   4  
ATOM 6986  C C    . THR A 1 29  ? 126.669 3.942   6.356   1.00 0.00 ? 29  THR A C    4  
ATOM 6987  O O    . THR A 1 29  ? 125.604 4.014   6.916   1.00 0.00 ? 29  THR A O    4  
ATOM 6988  C CB   . THR A 1 29  ? 127.355 1.487   6.020   1.00 0.00 ? 29  THR A CB   4  
ATOM 6989  O OG1  . THR A 1 29  ? 126.246 0.908   6.710   1.00 0.00 ? 29  THR A OG1  4  
ATOM 6990  C CG2  . THR A 1 29  ? 128.482 1.694   7.031   1.00 0.00 ? 29  THR A CG2  4  
ATOM 6991  H H    . THR A 1 29  ? 128.694 2.837   4.209   1.00 0.00 ? 29  THR A H    4  
ATOM 6992  H HA   . THR A 1 29  ? 125.974 2.675   4.823   1.00 0.00 ? 29  THR A HA   4  
ATOM 6993  H HB   . THR A 1 29  ? 127.686 0.800   5.256   1.00 0.00 ? 29  THR A HB   4  
ATOM 6994  H HG1  . THR A 1 29  ? 126.117 0.020   6.354   1.00 0.00 ? 29  THR A HG1  4  
ATOM 6995  H HG21 . THR A 1 29  ? 129.341 2.110   6.525   1.00 0.00 ? 29  THR A HG21 4  
ATOM 6996  H HG22 . THR A 1 29  ? 128.746 0.746   7.474   1.00 0.00 ? 29  THR A HG22 4  
ATOM 6997  H HG23 . THR A 1 29  ? 128.153 2.375   7.803   1.00 0.00 ? 29  THR A HG23 4  
ATOM 6998  N N    . ARG A 1 30  ? 127.647 4.839   6.558   1.00 0.00 ? 30  ARG A N    4  
ATOM 6999  C CA   . ARG A 1 30  ? 127.437 5.959   7.462   1.00 0.00 ? 30  ARG A CA   4  
ATOM 7000  C C    . ARG A 1 30  ? 126.500 6.982   6.850   1.00 0.00 ? 30  ARG A C    4  
ATOM 7001  O O    . ARG A 1 30  ? 125.652 7.547   7.538   1.00 0.00 ? 30  ARG A O    4  
ATOM 7002  C CB   . ARG A 1 30  ? 128.736 6.600   7.933   1.00 0.00 ? 30  ARG A CB   4  
ATOM 7003  C CG   . ARG A 1 30  ? 129.556 5.678   8.804   1.00 0.00 ? 30  ARG A CG   4  
ATOM 7004  C CD   . ARG A 1 30  ? 130.553 6.448   9.637   1.00 0.00 ? 30  ARG A CD   4  
ATOM 7005  N NE   . ARG A 1 30  ? 131.650 7.025   8.872   1.00 0.00 ? 30  ARG A NE   4  
ATOM 7006  C CZ   . ARG A 1 30  ? 132.310 8.130   9.233   1.00 0.00 ? 30  ARG A CZ   4  
ATOM 7007  N NH1  . ARG A 1 30  ? 131.832 8.912   10.191  1.00 0.00 ? 30  ARG A NH1  4  
ATOM 7008  N NH2  . ARG A 1 30  ? 133.418 8.464   8.594   1.00 0.00 ? 30  ARG A NH2  4  
ATOM 7009  H H    . ARG A 1 30  ? 128.513 4.723   6.109   1.00 0.00 ? 30  ARG A H    4  
ATOM 7010  H HA   . ARG A 1 30  ? 126.919 5.552   8.321   1.00 0.00 ? 30  ARG A HA   4  
ATOM 7011  H HB2  . ARG A 1 30  ? 129.326 6.875   7.071   1.00 0.00 ? 30  ARG A HB2  4  
ATOM 7012  H HB3  . ARG A 1 30  ? 128.503 7.488   8.503   1.00 0.00 ? 30  ARG A HB3  4  
ATOM 7013  H HG2  . ARG A 1 30  ? 128.897 5.116   9.446   1.00 0.00 ? 30  ARG A HG2  4  
ATOM 7014  H HG3  . ARG A 1 30  ? 130.091 4.993   8.163   1.00 0.00 ? 30  ARG A HG3  4  
ATOM 7015  H HD2  . ARG A 1 30  ? 130.019 7.278   10.074  1.00 0.00 ? 30  ARG A HD2  4  
ATOM 7016  H HD3  . ARG A 1 30  ? 130.949 5.807   10.410  1.00 0.00 ? 30  ARG A HD3  4  
ATOM 7017  H HE   . ARG A 1 30  ? 131.947 6.503   8.089   1.00 0.00 ? 30  ARG A HE   4  
ATOM 7018  H HH11 . ARG A 1 30  ? 130.969 8.717   10.673  1.00 0.00 ? 30  ARG A HH11 4  
ATOM 7019  H HH12 . ARG A 1 30  ? 132.308 9.754   10.479  1.00 0.00 ? 30  ARG A HH12 4  
ATOM 7020  H HH21 . ARG A 1 30  ? 133.747 7.879   7.846   1.00 0.00 ? 30  ARG A HH21 4  
ATOM 7021  H HH22 . ARG A 1 30  ? 133.973 9.283   8.801   1.00 0.00 ? 30  ARG A HH22 4  
ATOM 7022  N N    . PHE A 1 31  ? 126.610 7.187   5.553   1.00 0.00 ? 31  PHE A N    4  
ATOM 7023  C CA   . PHE A 1 31  ? 125.674 8.061   4.867   1.00 0.00 ? 31  PHE A CA   4  
ATOM 7024  C C    . PHE A 1 31  ? 124.284 7.414   4.869   1.00 0.00 ? 31  PHE A C    4  
ATOM 7025  O O    . PHE A 1 31  ? 123.265 8.056   5.097   1.00 0.00 ? 31  PHE A O    4  
ATOM 7026  C CB   . PHE A 1 31  ? 126.127 8.345   3.430   1.00 0.00 ? 31  PHE A CB   4  
ATOM 7027  C CG   . PHE A 1 31  ? 125.154 9.203   2.684   1.00 0.00 ? 31  PHE A CG   4  
ATOM 7028  C CD1  . PHE A 1 31  ? 125.138 10.565  2.875   1.00 0.00 ? 31  PHE A CD1  4  
ATOM 7029  C CD2  . PHE A 1 31  ? 124.237 8.640   1.812   1.00 0.00 ? 31  PHE A CD2  4  
ATOM 7030  C CE1  . PHE A 1 31  ? 124.230 11.356  2.218   1.00 0.00 ? 31  PHE A CE1  4  
ATOM 7031  C CE2  . PHE A 1 31  ? 123.329 9.429   1.150   1.00 0.00 ? 31  PHE A CE2  4  
ATOM 7032  C CZ   . PHE A 1 31  ? 123.326 10.788  1.357   1.00 0.00 ? 31  PHE A CZ   4  
ATOM 7033  H H    . PHE A 1 31  ? 127.337 6.751   5.056   1.00 0.00 ? 31  PHE A H    4  
ATOM 7034  H HA   . PHE A 1 31  ? 125.624 8.988   5.422   1.00 0.00 ? 31  PHE A HA   4  
ATOM 7035  H HB2  . PHE A 1 31  ? 127.079 8.856   3.448   1.00 0.00 ? 31  PHE A HB2  4  
ATOM 7036  H HB3  . PHE A 1 31  ? 126.229 7.412   2.897   1.00 0.00 ? 31  PHE A HB3  4  
ATOM 7037  H HD1  . PHE A 1 31  ? 125.851 11.013  3.552   1.00 0.00 ? 31  PHE A HD1  4  
ATOM 7038  H HD2  . PHE A 1 31  ? 124.241 7.573   1.653   1.00 0.00 ? 31  PHE A HD2  4  
ATOM 7039  H HE1  . PHE A 1 31  ? 124.234 12.424  2.375   1.00 0.00 ? 31  PHE A HE1  4  
ATOM 7040  H HE2  . PHE A 1 31  ? 122.618 8.982   0.472   1.00 0.00 ? 31  PHE A HE2  4  
ATOM 7041  H HZ   . PHE A 1 31  ? 122.610 11.410  0.840   1.00 0.00 ? 31  PHE A HZ   4  
ATOM 7042  N N    . LEU A 1 32  ? 124.269 6.141   4.658   1.00 0.00 ? 32  LEU A N    4  
ATOM 7043  C CA   . LEU A 1 32  ? 123.056 5.374   4.637   1.00 0.00 ? 32  LEU A CA   4  
ATOM 7044  C C    . LEU A 1 32  ? 122.451 5.332   6.057   1.00 0.00 ? 32  LEU A C    4  
ATOM 7045  O O    . LEU A 1 32  ? 121.251 5.194   6.240   1.00 0.00 ? 32  LEU A O    4  
ATOM 7046  C CB   . LEU A 1 32  ? 123.401 3.987   4.143   1.00 0.00 ? 32  LEU A CB   4  
ATOM 7047  C CG   . LEU A 1 32  ? 122.268 3.106   3.695   1.00 0.00 ? 32  LEU A CG   4  
ATOM 7048  C CD1  . LEU A 1 32  ? 121.520 3.744   2.534   1.00 0.00 ? 32  LEU A CD1  4  
ATOM 7049  C CD2  . LEU A 1 32  ? 122.825 1.777   3.287   1.00 0.00 ? 32  LEU A CD2  4  
ATOM 7050  H H    . LEU A 1 32  ? 125.120 5.683   4.467   1.00 0.00 ? 32  LEU A H    4  
ATOM 7051  H HA   . LEU A 1 32  ? 122.358 5.836   3.955   1.00 0.00 ? 32  LEU A HA   4  
ATOM 7052  H HB2  . LEU A 1 32  ? 124.088 4.083   3.316   1.00 0.00 ? 32  LEU A HB2  4  
ATOM 7053  H HB3  . LEU A 1 32  ? 123.919 3.484   4.946   1.00 0.00 ? 32  LEU A HB3  4  
ATOM 7054  H HG   . LEU A 1 32  ? 121.578 2.947   4.512   1.00 0.00 ? 32  LEU A HG   4  
ATOM 7055  H HD11 . LEU A 1 32  ? 120.710 3.097   2.233   1.00 0.00 ? 32  LEU A HD11 4  
ATOM 7056  H HD12 . LEU A 1 32  ? 122.196 3.887   1.704   1.00 0.00 ? 32  LEU A HD12 4  
ATOM 7057  H HD13 . LEU A 1 32  ? 121.119 4.698   2.843   1.00 0.00 ? 32  LEU A HD13 4  
ATOM 7058  H HD21 . LEU A 1 32  ? 123.529 1.911   2.479   1.00 0.00 ? 32  LEU A HD21 4  
ATOM 7059  H HD22 . LEU A 1 32  ? 122.020 1.133   2.962   1.00 0.00 ? 32  LEU A HD22 4  
ATOM 7060  H HD23 . LEU A 1 32  ? 123.328 1.324   4.128   1.00 0.00 ? 32  LEU A HD23 4  
ATOM 7061  N N    . LYS A 1 33  ? 123.309 5.486   7.039   1.00 0.00 ? 33  LYS A N    4  
ATOM 7062  C CA   . LYS A 1 33  ? 122.949 5.533   8.440   1.00 0.00 ? 33  LYS A CA   4  
ATOM 7063  C C    . LYS A 1 33  ? 122.380 6.896   8.810   1.00 0.00 ? 33  LYS A C    4  
ATOM 7064  O O    . LYS A 1 33  ? 121.458 6.980   9.612   1.00 0.00 ? 33  LYS A O    4  
ATOM 7065  C CB   . LYS A 1 33  ? 124.180 5.207   9.290   1.00 0.00 ? 33  LYS A CB   4  
ATOM 7066  C CG   . LYS A 1 33  ? 124.007 5.319   10.788  1.00 0.00 ? 33  LYS A CG   4  
ATOM 7067  C CD   . LYS A 1 33  ? 125.264 4.853   11.499  1.00 0.00 ? 33  LYS A CD   4  
ATOM 7068  C CE   . LYS A 1 33  ? 125.494 3.357   11.310  1.00 0.00 ? 33  LYS A CE   4  
ATOM 7069  N NZ   . LYS A 1 33  ? 124.407 2.549   11.910  1.00 0.00 ? 33  LYS A NZ   4  
ATOM 7070  H H    . LYS A 1 33  ? 124.260 5.538   6.803   1.00 0.00 ? 33  LYS A H    4  
ATOM 7071  H HA   . LYS A 1 33  ? 122.198 4.778   8.618   1.00 0.00 ? 33  LYS A HA   4  
ATOM 7072  H HB2  . LYS A 1 33  ? 124.484 4.193   9.073   1.00 0.00 ? 33  LYS A HB2  4  
ATOM 7073  H HB3  . LYS A 1 33  ? 124.979 5.869   8.990   1.00 0.00 ? 33  LYS A HB3  4  
ATOM 7074  H HG2  . LYS A 1 33  ? 123.814 6.350   11.047  1.00 0.00 ? 33  LYS A HG2  4  
ATOM 7075  H HG3  . LYS A 1 33  ? 123.177 4.700   11.096  1.00 0.00 ? 33  LYS A HG3  4  
ATOM 7076  H HD2  . LYS A 1 33  ? 126.104 5.378   11.065  1.00 0.00 ? 33  LYS A HD2  4  
ATOM 7077  H HD3  . LYS A 1 33  ? 125.188 5.076   12.553  1.00 0.00 ? 33  LYS A HD3  4  
ATOM 7078  H HE2  . LYS A 1 33  ? 125.546 3.143   10.254  1.00 0.00 ? 33  LYS A HE2  4  
ATOM 7079  H HE3  . LYS A 1 33  ? 126.431 3.089   11.777  1.00 0.00 ? 33  LYS A HE3  4  
ATOM 7080  H HZ1  . LYS A 1 33  ? 124.303 2.770   12.925  1.00 0.00 ? 33  LYS A HZ1  4  
ATOM 7081  H HZ2  . LYS A 1 33  ? 124.618 1.532   11.823  1.00 0.00 ? 33  LYS A HZ2  4  
ATOM 7082  H HZ3  . LYS A 1 33  ? 123.488 2.712   11.437  1.00 0.00 ? 33  LYS A HZ3  4  
ATOM 7083  N N    . THR A 1 34  ? 122.907 7.961   8.221   1.00 0.00 ? 34  THR A N    4  
ATOM 7084  C CA   . THR A 1 34  ? 122.392 9.287   8.503   1.00 0.00 ? 34  THR A CA   4  
ATOM 7085  C C    . THR A 1 34  ? 120.993 9.459   7.870   1.00 0.00 ? 34  THR A C    4  
ATOM 7086  O O    . THR A 1 34  ? 120.162 10.214  8.372   1.00 0.00 ? 34  THR A O    4  
ATOM 7087  C CB   . THR A 1 34  ? 123.392 10.450  8.108   1.00 0.00 ? 34  THR A CB   4  
ATOM 7088  O OG1  . THR A 1 34  ? 122.936 11.711  8.625   1.00 0.00 ? 34  THR A OG1  4  
ATOM 7089  C CG2  . THR A 1 34  ? 123.568 10.582  6.611   1.00 0.00 ? 34  THR A CG2  4  
ATOM 7090  H H    . THR A 1 34  ? 123.676 7.853   7.617   1.00 0.00 ? 34  THR A H    4  
ATOM 7091  H HA   . THR A 1 34  ? 122.238 9.305   9.574   1.00 0.00 ? 34  THR A HA   4  
ATOM 7092  H HB   . THR A 1 34  ? 124.348 10.228  8.560   1.00 0.00 ? 34  THR A HB   4  
ATOM 7093  H HG1  . THR A 1 34  ? 122.705 12.281  7.876   1.00 0.00 ? 34  THR A HG1  4  
ATOM 7094  H HG21 . THR A 1 34  ? 122.614 10.799  6.154   1.00 0.00 ? 34  THR A HG21 4  
ATOM 7095  H HG22 . THR A 1 34  ? 123.950 9.652   6.213   1.00 0.00 ? 34  THR A HG22 4  
ATOM 7096  H HG23 . THR A 1 34  ? 124.263 11.381  6.396   1.00 0.00 ? 34  THR A HG23 4  
ATOM 7097  N N    . GLU A 1 35  ? 120.723 8.718   6.789   1.00 0.00 ? 35  GLU A N    4  
ATOM 7098  C CA   . GLU A 1 35  ? 119.383 8.714   6.215   1.00 0.00 ? 35  GLU A CA   4  
ATOM 7099  C C    . GLU A 1 35  ? 118.551 7.569   6.822   1.00 0.00 ? 35  GLU A C    4  
ATOM 7100  O O    . GLU A 1 35  ? 117.365 7.430   6.536   1.00 0.00 ? 35  GLU A O    4  
ATOM 7101  C CB   . GLU A 1 35  ? 119.396 8.617   4.686   1.00 0.00 ? 35  GLU A CB   4  
ATOM 7102  C CG   . GLU A 1 35  ? 120.005 7.351   4.128   1.00 0.00 ? 35  GLU A CG   4  
ATOM 7103  C CD   . GLU A 1 35  ? 119.662 7.160   2.678   1.00 0.00 ? 35  GLU A CD   4  
ATOM 7104  O OE1  . GLU A 1 35  ? 118.556 6.646   2.394   1.00 0.00 ? 35  GLU A OE1  4  
ATOM 7105  O OE2  . GLU A 1 35  ? 120.450 7.522   1.808   1.00 0.00 ? 35  GLU A OE2  4  
ATOM 7106  H H    . GLU A 1 35  ? 121.441 8.206   6.356   1.00 0.00 ? 35  GLU A H    4  
ATOM 7107  H HA   . GLU A 1 35  ? 118.920 9.644   6.513   1.00 0.00 ? 35  GLU A HA   4  
ATOM 7108  H HB2  . GLU A 1 35  ? 118.380 8.684   4.326   1.00 0.00 ? 35  GLU A HB2  4  
ATOM 7109  H HB3  . GLU A 1 35  ? 119.957 9.458   4.304   1.00 0.00 ? 35  GLU A HB3  4  
ATOM 7110  H HG2  . GLU A 1 35  ? 121.079 7.408   4.226   1.00 0.00 ? 35  GLU A HG2  4  
ATOM 7111  H HG3  . GLU A 1 35  ? 119.634 6.506   4.689   1.00 0.00 ? 35  GLU A HG3  4  
ATOM 7112  N N    . PHE A 1 36  ? 119.213 6.750   7.649   1.00 0.00 ? 36  PHE A N    4  
ATOM 7113  C CA   . PHE A 1 36  ? 118.603 5.629   8.395   1.00 0.00 ? 36  PHE A CA   4  
ATOM 7114  C C    . PHE A 1 36  ? 118.125 4.460   7.516   1.00 0.00 ? 36  PHE A C    4  
ATOM 7115  O O    . PHE A 1 36  ? 117.390 3.584   7.987   1.00 0.00 ? 36  PHE A O    4  
ATOM 7116  C CB   . PHE A 1 36  ? 117.486 6.115   9.335   1.00 0.00 ? 36  PHE A CB   4  
ATOM 7117  C CG   . PHE A 1 36  ? 117.980 6.919   10.502  1.00 0.00 ? 36  PHE A CG   4  
ATOM 7118  C CD1  . PHE A 1 36  ? 118.197 8.279   10.390  1.00 0.00 ? 36  PHE A CD1  4  
ATOM 7119  C CD2  . PHE A 1 36  ? 118.228 6.308   11.712  1.00 0.00 ? 36  PHE A CD2  4  
ATOM 7120  C CE1  . PHE A 1 36  ? 118.653 9.008   11.465  1.00 0.00 ? 36  PHE A CE1  4  
ATOM 7121  C CE2  . PHE A 1 36  ? 118.684 7.030   12.793  1.00 0.00 ? 36  PHE A CE2  4  
ATOM 7122  C CZ   . PHE A 1 36  ? 118.897 8.383   12.669  1.00 0.00 ? 36  PHE A CZ   4  
ATOM 7123  H H    . PHE A 1 36  ? 120.168 6.925   7.782   1.00 0.00 ? 36  PHE A H    4  
ATOM 7124  H HA   . PHE A 1 36  ? 119.397 5.234   9.013   1.00 0.00 ? 36  PHE A HA   4  
ATOM 7125  H HB2  . PHE A 1 36  ? 116.802 6.734   8.774   1.00 0.00 ? 36  PHE A HB2  4  
ATOM 7126  H HB3  . PHE A 1 36  ? 116.951 5.258   9.720   1.00 0.00 ? 36  PHE A HB3  4  
ATOM 7127  H HD1  . PHE A 1 36  ? 118.007 8.772   9.449   1.00 0.00 ? 36  PHE A HD1  4  
ATOM 7128  H HD2  . PHE A 1 36  ? 118.061 5.245   11.811  1.00 0.00 ? 36  PHE A HD2  4  
ATOM 7129  H HE1  . PHE A 1 36  ? 118.818 10.071  11.366  1.00 0.00 ? 36  PHE A HE1  4  
ATOM 7130  H HE2  . PHE A 1 36  ? 118.874 6.535   13.733  1.00 0.00 ? 36  PHE A HE2  4  
ATOM 7131  H HZ   . PHE A 1 36  ? 119.256 8.954   13.512  1.00 0.00 ? 36  PHE A HZ   4  
ATOM 7132  N N    . SER A 1 37  ? 118.614 4.389   6.296   1.00 0.00 ? 37  SER A N    4  
ATOM 7133  C CA   . SER A 1 37  ? 118.223 3.331   5.364   1.00 0.00 ? 37  SER A CA   4  
ATOM 7134  C C    . SER A 1 37  ? 119.248 2.195   5.359   1.00 0.00 ? 37  SER A C    4  
ATOM 7135  O O    . SER A 1 37  ? 119.153 1.282   4.558   1.00 0.00 ? 37  SER A O    4  
ATOM 7136  C CB   . SER A 1 37  ? 118.107 3.892   3.951   1.00 0.00 ? 37  SER A CB   4  
ATOM 7137  O OG   . SER A 1 37  ? 117.211 4.987   3.900   1.00 0.00 ? 37  SER A OG   4  
ATOM 7138  H H    . SER A 1 37  ? 119.273 5.056   6.005   1.00 0.00 ? 37  SER A H    4  
ATOM 7139  H HA   . SER A 1 37  ? 117.260 2.947   5.665   1.00 0.00 ? 37  SER A HA   4  
ATOM 7140  H HB2  . SER A 1 37  ? 119.079 4.227   3.620   1.00 0.00 ? 37  SER A HB2  4  
ATOM 7141  H HB3  . SER A 1 37  ? 117.749 3.118   3.289   1.00 0.00 ? 37  SER A HB3  4  
ATOM 7142  H HG   . SER A 1 37  ? 117.674 5.668   3.376   1.00 0.00 ? 37  SER A HG   4  
ATOM 7143  N N    . GLU A 1 38  ? 120.189 2.253   6.303   1.00 0.00 ? 38  GLU A N    4  
ATOM 7144  C CA   . GLU A 1 38  ? 121.332 1.306   6.434   1.00 0.00 ? 38  GLU A CA   4  
ATOM 7145  C C    . GLU A 1 38  ? 120.954 -0.187  6.310   1.00 0.00 ? 38  GLU A C    4  
ATOM 7146  O O    . GLU A 1 38  ? 121.758 -1.007  5.880   1.00 0.00 ? 38  GLU A O    4  
ATOM 7147  C CB   . GLU A 1 38  ? 122.041 1.555   7.759   1.00 0.00 ? 38  GLU A CB   4  
ATOM 7148  C CG   . GLU A 1 38  ? 121.106 1.513   8.954   1.00 0.00 ? 38  GLU A CG   4  
ATOM 7149  C CD   . GLU A 1 38  ? 121.822 1.690   10.253  1.00 0.00 ? 38  GLU A CD   4  
ATOM 7150  O OE1  . GLU A 1 38  ? 122.081 2.829   10.646  1.00 0.00 ? 38  GLU A OE1  4  
ATOM 7151  O OE2  . GLU A 1 38  ? 122.131 0.684   10.917  1.00 0.00 ? 38  GLU A OE2  4  
ATOM 7152  H H    . GLU A 1 38  ? 120.126 2.991   6.945   1.00 0.00 ? 38  GLU A H    4  
ATOM 7153  H HA   . GLU A 1 38  ? 122.029 1.545   5.643   1.00 0.00 ? 38  GLU A HA   4  
ATOM 7154  H HB2  . GLU A 1 38  ? 122.801 0.798   7.894   1.00 0.00 ? 38  GLU A HB2  4  
ATOM 7155  H HB3  . GLU A 1 38  ? 122.510 2.527   7.727   1.00 0.00 ? 38  GLU A HB3  4  
ATOM 7156  H HG2  . GLU A 1 38  ? 120.379 2.304   8.852   1.00 0.00 ? 38  GLU A HG2  4  
ATOM 7157  H HG3  . GLU A 1 38  ? 120.597 0.560   8.962   1.00 0.00 ? 38  GLU A HG3  4  
ATOM 7158  N N    . GLU A 1 39  ? 119.724 -0.503  6.633   1.00 0.00 ? 39  GLU A N    4  
ATOM 7159  C CA   . GLU A 1 39  ? 119.225 -1.863  6.637   1.00 0.00 ? 39  GLU A CA   4  
ATOM 7160  C C    . GLU A 1 39  ? 119.268 -2.523  5.247   1.00 0.00 ? 39  GLU A C    4  
ATOM 7161  O O    . GLU A 1 39  ? 119.241 -3.738  5.143   1.00 0.00 ? 39  GLU A O    4  
ATOM 7162  C CB   . GLU A 1 39  ? 117.818 -1.869  7.171   1.00 0.00 ? 39  GLU A CB   4  
ATOM 7163  C CG   . GLU A 1 39  ? 117.696 -1.174  8.505   1.00 0.00 ? 39  GLU A CG   4  
ATOM 7164  C CD   . GLU A 1 39  ? 116.319 -1.234  9.048   1.00 0.00 ? 39  GLU A CD   4  
ATOM 7165  O OE1  . GLU A 1 39  ? 115.439 -0.523  8.539   1.00 0.00 ? 39  GLU A OE1  4  
ATOM 7166  O OE2  . GLU A 1 39  ? 116.075 -2.009  9.975   1.00 0.00 ? 39  GLU A OE2  4  
ATOM 7167  H H    . GLU A 1 39  ? 119.120 0.226   6.882   1.00 0.00 ? 39  GLU A H    4  
ATOM 7168  H HA   . GLU A 1 39  ? 119.840 -2.438  7.313   1.00 0.00 ? 39  GLU A HA   4  
ATOM 7169  H HB2  . GLU A 1 39  ? 117.173 -1.370  6.462   1.00 0.00 ? 39  GLU A HB2  4  
ATOM 7170  H HB3  . GLU A 1 39  ? 117.490 -2.892  7.288   1.00 0.00 ? 39  GLU A HB3  4  
ATOM 7171  H HG2  . GLU A 1 39  ? 118.365 -1.648  9.208   1.00 0.00 ? 39  GLU A HG2  4  
ATOM 7172  H HG3  . GLU A 1 39  ? 117.978 -0.139  8.384   1.00 0.00 ? 39  GLU A HG3  4  
ATOM 7173  N N    . ASN A 1 40  ? 119.347 -1.731  4.197   1.00 0.00 ? 40  ASN A N    4  
ATOM 7174  C CA   . ASN A 1 40  ? 119.397 -2.288  2.846   1.00 0.00 ? 40  ASN A CA   4  
ATOM 7175  C C    . ASN A 1 40  ? 120.822 -2.744  2.455   1.00 0.00 ? 40  ASN A C    4  
ATOM 7176  O O    . ASN A 1 40  ? 121.021 -3.797  1.773   1.00 0.00 ? 40  ASN A O    4  
ATOM 7177  C CB   . ASN A 1 40  ? 118.749 -1.345  1.807   1.00 0.00 ? 40  ASN A CB   4  
ATOM 7178  C CG   . ASN A 1 40  ? 119.319 0.059   1.740   1.00 0.00 ? 40  ASN A CG   4  
ATOM 7179  O OD1  . ASN A 1 40  ? 120.460 0.282   2.023   1.00 0.00 ? 40  ASN A OD1  4  
ATOM 7180  N ND2  . ASN A 1 40  ? 118.493 1.013   1.383   1.00 0.00 ? 40  ASN A ND2  4  
ATOM 7181  H H    . ASN A 1 40  ? 119.381 -0.757  4.330   1.00 0.00 ? 40  ASN A H    4  
ATOM 7182  H HA   . ASN A 1 40  ? 118.809 -3.194  2.902   1.00 0.00 ? 40  ASN A HA   4  
ATOM 7183  H HB2  . ASN A 1 40  ? 118.823 -1.780  0.822   1.00 0.00 ? 40  ASN A HB2  4  
ATOM 7184  H HB3  . ASN A 1 40  ? 117.710 -1.267  2.074   1.00 0.00 ? 40  ASN A HB3  4  
ATOM 7185  H HD21 . ASN A 1 40  ? 117.560 0.766   1.196   1.00 0.00 ? 40  ASN A HD21 4  
ATOM 7186  H HD22 . ASN A 1 40  ? 118.846 1.927   1.304   1.00 0.00 ? 40  ASN A HD22 4  
ATOM 7187  N N    . ILE A 1 41  ? 121.811 -2.020  2.926   1.00 0.00 ? 41  ILE A N    4  
ATOM 7188  C CA   . ILE A 1 41  ? 123.195 -2.415  2.703   1.00 0.00 ? 41  ILE A CA   4  
ATOM 7189  C C    . ILE A 1 41  ? 123.437 -3.695  3.502   1.00 0.00 ? 41  ILE A C    4  
ATOM 7190  O O    . ILE A 1 41  ? 124.081 -4.643  3.046   1.00 0.00 ? 41  ILE A O    4  
ATOM 7191  C CB   . ILE A 1 41  ? 124.224 -1.287  3.098   1.00 0.00 ? 41  ILE A CB   4  
ATOM 7192  C CG1  . ILE A 1 41  ? 125.482 -1.421  2.214   1.00 0.00 ? 41  ILE A CG1  4  
ATOM 7193  C CG2  . ILE A 1 41  ? 124.608 -1.325  4.605   1.00 0.00 ? 41  ILE A CG2  4  
ATOM 7194  C CD1  . ILE A 1 41  ? 126.546 -0.367  2.447   1.00 0.00 ? 41  ILE A CD1  4  
ATOM 7195  H H    . ILE A 1 41  ? 121.573 -1.185  3.385   1.00 0.00 ? 41  ILE A H    4  
ATOM 7196  H HA   . ILE A 1 41  ? 123.297 -2.663  1.656   1.00 0.00 ? 41  ILE A HA   4  
ATOM 7197  H HB   . ILE A 1 41  ? 123.767 -0.331  2.894   1.00 0.00 ? 41  ILE A HB   4  
ATOM 7198  H HG12 . ILE A 1 41  ? 125.943 -2.387  2.340   1.00 0.00 ? 41  ILE A HG12 4  
ATOM 7199  H HG13 . ILE A 1 41  ? 125.168 -1.334  1.184   1.00 0.00 ? 41  ILE A HG13 4  
ATOM 7200  H HG21 . ILE A 1 41  ? 123.750 -1.369  5.273   1.00 0.00 ? 41  ILE A HG21 4  
ATOM 7201  H HG22 . ILE A 1 41  ? 125.195 -0.462  4.876   1.00 0.00 ? 41  ILE A HG22 4  
ATOM 7202  H HG23 . ILE A 1 41  ? 125.200 -2.209  4.803   1.00 0.00 ? 41  ILE A HG23 4  
ATOM 7203  H HD11 . ILE A 1 41  ? 126.113 0.615   2.324   1.00 0.00 ? 41  ILE A HD11 4  
ATOM 7204  H HD12 . ILE A 1 41  ? 127.318 -0.502  1.702   1.00 0.00 ? 41  ILE A HD12 4  
ATOM 7205  H HD13 . ILE A 1 41  ? 126.958 -0.470  3.440   1.00 0.00 ? 41  ILE A HD13 4  
ATOM 7206  N N    . GLU A 1 42  ? 122.808 -3.728  4.659   1.00 0.00 ? 42  GLU A N    4  
ATOM 7207  C CA   . GLU A 1 42  ? 122.839 -4.836  5.544   1.00 0.00 ? 42  GLU A CA   4  
ATOM 7208  C C    . GLU A 1 42  ? 121.948 -5.974  5.030   1.00 0.00 ? 42  GLU A C    4  
ATOM 7209  O O    . GLU A 1 42  ? 122.065 -7.110  5.483   1.00 0.00 ? 42  GLU A O    4  
ATOM 7210  C CB   . GLU A 1 42  ? 122.403 -4.387  6.916   1.00 0.00 ? 42  GLU A CB   4  
ATOM 7211  C CG   . GLU A 1 42  ? 123.514 -3.956  7.879   1.00 0.00 ? 42  GLU A CG   4  
ATOM 7212  C CD   . GLU A 1 42  ? 124.481 -2.898  7.480   1.00 0.00 ? 42  GLU A CD   4  
ATOM 7213  O OE1  . GLU A 1 42  ? 124.199 -1.711  7.741   1.00 0.00 ? 42  GLU A OE1  4  
ATOM 7214  O OE2  . GLU A 1 42  ? 125.601 -3.229  7.052   1.00 0.00 ? 42  GLU A OE2  4  
ATOM 7215  H H    . GLU A 1 42  ? 122.312 -2.924  4.929   1.00 0.00 ? 42  GLU A H    4  
ATOM 7216  H HA   . GLU A 1 42  ? 123.858 -5.186  5.606   1.00 0.00 ? 42  GLU A HA   4  
ATOM 7217  H HB2  . GLU A 1 42  ? 121.734 -3.548  6.798   1.00 0.00 ? 42  GLU A HB2  4  
ATOM 7218  H HB3  . GLU A 1 42  ? 121.857 -5.198  7.376   1.00 0.00 ? 42  GLU A HB3  4  
ATOM 7219  H HG2  . GLU A 1 42  ? 122.985 -3.317  8.563   1.00 0.00 ? 42  GLU A HG2  4  
ATOM 7220  H HG3  . GLU A 1 42  ? 124.031 -4.800  8.314   1.00 0.00 ? 42  GLU A HG3  4  
ATOM 7221  N N    . PHE A 1 43  ? 121.047 -5.657  4.105   1.00 0.00 ? 43  PHE A N    4  
ATOM 7222  C CA   . PHE A 1 43  ? 120.221 -6.649  3.445   1.00 0.00 ? 43  PHE A CA   4  
ATOM 7223  C C    . PHE A 1 43  ? 121.094 -7.581  2.647   1.00 0.00 ? 43  PHE A C    4  
ATOM 7224  O O    . PHE A 1 43  ? 121.048 -8.801  2.842   1.00 0.00 ? 43  PHE A O    4  
ATOM 7225  C CB   . PHE A 1 43  ? 119.169 -5.984  2.532   1.00 0.00 ? 43  PHE A CB   4  
ATOM 7226  C CG   . PHE A 1 43  ? 118.423 -6.928  1.625   1.00 0.00 ? 43  PHE A CG   4  
ATOM 7227  C CD1  . PHE A 1 43  ? 118.919 -7.248  0.362   1.00 0.00 ? 43  PHE A CD1  4  
ATOM 7228  C CD2  . PHE A 1 43  ? 117.239 -7.488  2.025   1.00 0.00 ? 43  PHE A CD2  4  
ATOM 7229  C CE1  . PHE A 1 43  ? 118.243 -8.107  -0.465  1.00 0.00 ? 43  PHE A CE1  4  
ATOM 7230  C CE2  . PHE A 1 43  ? 116.555 -8.346  1.196   1.00 0.00 ? 43  PHE A CE2  4  
ATOM 7231  C CZ   . PHE A 1 43  ? 117.059 -8.655  -0.051  1.00 0.00 ? 43  PHE A CZ   4  
ATOM 7232  H H    . PHE A 1 43  ? 120.907 -4.715  3.870   1.00 0.00 ? 43  PHE A H    4  
ATOM 7233  H HA   . PHE A 1 43  ? 119.712 -7.217  4.211   1.00 0.00 ? 43  PHE A HA   4  
ATOM 7234  H HB2  . PHE A 1 43  ? 118.438 -5.481  3.147   1.00 0.00 ? 43  PHE A HB2  4  
ATOM 7235  H HB3  . PHE A 1 43  ? 119.666 -5.250  1.912   1.00 0.00 ? 43  PHE A HB3  4  
ATOM 7236  H HD1  . PHE A 1 43  ? 119.852 -6.812  0.034   1.00 0.00 ? 43  PHE A HD1  4  
ATOM 7237  H HD2  . PHE A 1 43  ? 116.841 -7.250  3.000   1.00 0.00 ? 43  PHE A HD2  4  
ATOM 7238  H HE1  . PHE A 1 43  ? 118.639 -8.345  -1.442  1.00 0.00 ? 43  PHE A HE1  4  
ATOM 7239  H HE2  . PHE A 1 43  ? 115.616 -8.762  1.528   1.00 0.00 ? 43  PHE A HE2  4  
ATOM 7240  H HZ   . PHE A 1 43  ? 116.520 -9.331  -0.698  1.00 0.00 ? 43  PHE A HZ   4  
ATOM 7241  N N    . TRP A 1 44  ? 121.913 -7.042  1.740   1.00 0.00 ? 44  TRP A N    4  
ATOM 7242  C CA   . TRP A 1 44  ? 122.770 -7.969  0.995   1.00 0.00 ? 44  TRP A CA   4  
ATOM 7243  C C    . TRP A 1 44  ? 123.893 -8.533  1.842   1.00 0.00 ? 44  TRP A C    4  
ATOM 7244  O O    . TRP A 1 44  ? 124.442 -9.594  1.542   1.00 0.00 ? 44  TRP A O    4  
ATOM 7245  C CB   . TRP A 1 44  ? 123.214 -7.529  -0.416  1.00 0.00 ? 44  TRP A CB   4  
ATOM 7246  C CG   . TRP A 1 44  ? 123.903 -6.217  -0.546  1.00 0.00 ? 44  TRP A CG   4  
ATOM 7247  C CD1  . TRP A 1 44  ? 123.415 -5.125  -1.182  1.00 0.00 ? 44  TRP A CD1  4  
ATOM 7248  C CD2  . TRP A 1 44  ? 125.208 -5.853  -0.061  1.00 0.00 ? 44  TRP A CD2  4  
ATOM 7249  N NE1  . TRP A 1 44  ? 124.323 -4.117  -1.145  1.00 0.00 ? 44  TRP A NE1  4  
ATOM 7250  C CE2  . TRP A 1 44  ? 125.426 -4.529  -0.442  1.00 0.00 ? 44  TRP A CE2  4  
ATOM 7251  C CE3  . TRP A 1 44  ? 126.208 -6.515  0.665   1.00 0.00 ? 44  TRP A CE3  4  
ATOM 7252  C CZ2  . TRP A 1 44  ? 126.592 -3.854  -0.131  1.00 0.00 ? 44  TRP A CZ2  4  
ATOM 7253  C CZ3  . TRP A 1 44  ? 127.367 -5.834  0.974   1.00 0.00 ? 44  TRP A CZ3  4  
ATOM 7254  C CH2  . TRP A 1 44  ? 127.546 -4.514  0.579   1.00 0.00 ? 44  TRP A CH2  4  
ATOM 7255  H H    . TRP A 1 44  ? 121.903 -6.062  1.595   1.00 0.00 ? 44  TRP A H    4  
ATOM 7256  H HA   . TRP A 1 44  ? 122.113 -8.823  0.892   1.00 0.00 ? 44  TRP A HA   4  
ATOM 7257  H HB2  . TRP A 1 44  ? 123.896 -8.270  -0.804  1.00 0.00 ? 44  TRP A HB2  4  
ATOM 7258  H HB3  . TRP A 1 44  ? 122.340 -7.512  -1.052  1.00 0.00 ? 44  TRP A HB3  4  
ATOM 7259  H HD1  . TRP A 1 44  ? 122.451 -5.085  -1.667  1.00 0.00 ? 44  TRP A HD1  4  
ATOM 7260  H HE1  . TRP A 1 44  ? 124.186 -3.237  -1.554  1.00 0.00 ? 44  TRP A HE1  4  
ATOM 7261  H HE3  . TRP A 1 44  ? 126.084 -7.540  0.980   1.00 0.00 ? 44  TRP A HE3  4  
ATOM 7262  H HZ2  . TRP A 1 44  ? 126.751 -2.829  -0.428  1.00 0.00 ? 44  TRP A HZ2  4  
ATOM 7263  H HZ3  . TRP A 1 44  ? 128.148 -6.322  1.540   1.00 0.00 ? 44  TRP A HZ3  4  
ATOM 7264  H HH2  . TRP A 1 44  ? 128.465 -4.007  0.838   1.00 0.00 ? 44  TRP A HH2  4  
ATOM 7265  N N    . ILE A 1 45  ? 124.217 -7.837  2.918   1.00 0.00 ? 45  ILE A N    4  
ATOM 7266  C CA   . ILE A 1 45  ? 125.141 -8.362  3.898   1.00 0.00 ? 45  ILE A CA   4  
ATOM 7267  C C    . ILE A 1 45  ? 124.536 -9.596  4.552   1.00 0.00 ? 45  ILE A C    4  
ATOM 7268  O O    . ILE A 1 45  ? 125.216 -10.594 4.730   1.00 0.00 ? 45  ILE A O    4  
ATOM 7269  C CB   . ILE A 1 45  ? 125.564 -7.290  4.945   1.00 0.00 ? 45  ILE A CB   4  
ATOM 7270  C CG1  . ILE A 1 45  ? 126.532 -6.311  4.279   1.00 0.00 ? 45  ILE A CG1  4  
ATOM 7271  C CG2  . ILE A 1 45  ? 126.168 -7.906  6.210   1.00 0.00 ? 45  ILE A CG2  4  
ATOM 7272  C CD1  . ILE A 1 45  ? 127.063 -5.231  5.173   1.00 0.00 ? 45  ILE A CD1  4  
ATOM 7273  H H    . ILE A 1 45  ? 123.846 -6.935  3.027   1.00 0.00 ? 45  ILE A H    4  
ATOM 7274  H HA   . ILE A 1 45  ? 126.015 -8.686  3.350   1.00 0.00 ? 45  ILE A HA   4  
ATOM 7275  H HB   . ILE A 1 45  ? 124.681 -6.740  5.234   1.00 0.00 ? 45  ILE A HB   4  
ATOM 7276  H HG12 . ILE A 1 45  ? 127.381 -6.862  3.902   1.00 0.00 ? 45  ILE A HG12 4  
ATOM 7277  H HG13 . ILE A 1 45  ? 126.027 -5.841  3.449   1.00 0.00 ? 45  ILE A HG13 4  
ATOM 7278  H HG21 . ILE A 1 45  ? 125.466 -8.612  6.629   1.00 0.00 ? 45  ILE A HG21 4  
ATOM 7279  H HG22 . ILE A 1 45  ? 126.334 -7.116  6.929   1.00 0.00 ? 45  ILE A HG22 4  
ATOM 7280  H HG23 . ILE A 1 45  ? 127.099 -8.400  5.978   1.00 0.00 ? 45  ILE A HG23 4  
ATOM 7281  H HD11 . ILE A 1 45  ? 127.715 -4.590  4.599   1.00 0.00 ? 45  ILE A HD11 4  
ATOM 7282  H HD12 . ILE A 1 45  ? 127.615 -5.678  5.986   1.00 0.00 ? 45  ILE A HD12 4  
ATOM 7283  H HD13 . ILE A 1 45  ? 126.242 -4.652  5.571   1.00 0.00 ? 45  ILE A HD13 4  
ATOM 7284  N N    . ALA A 1 46  ? 123.236 -9.540  4.832   1.00 0.00 ? 46  ALA A N    4  
ATOM 7285  C CA   . ALA A 1 46  ? 122.504 -10.680 5.370   1.00 0.00 ? 46  ALA A CA   4  
ATOM 7286  C C    . ALA A 1 46  ? 122.545 -11.827 4.383   1.00 0.00 ? 46  ALA A C    4  
ATOM 7287  O O    . ALA A 1 46  ? 122.580 -12.963 4.784   1.00 0.00 ? 46  ALA A O    4  
ATOM 7288  C CB   . ALA A 1 46  ? 121.048 -10.324 5.662   1.00 0.00 ? 46  ALA A CB   4  
ATOM 7289  H H    . ALA A 1 46  ? 122.754 -8.694  4.700   1.00 0.00 ? 46  ALA A H    4  
ATOM 7290  H HA   . ALA A 1 46  ? 122.981 -10.980 6.291   1.00 0.00 ? 46  ALA A HA   4  
ATOM 7291  H HB1  . ALA A 1 46  ? 120.995 -9.600  6.462   1.00 0.00 ? 46  ALA A HB1  4  
ATOM 7292  H HB2  . ALA A 1 46  ? 120.494 -11.221 5.907   1.00 0.00 ? 46  ALA A HB2  4  
ATOM 7293  H HB3  . ALA A 1 46  ? 120.609 -9.900  4.771   1.00 0.00 ? 46  ALA A HB3  4  
ATOM 7294  N N    . CYS A 1 47  ? 122.568 -11.501 3.097   1.00 0.00 ? 47  CYS A N    4  
ATOM 7295  C CA   . CYS A 1 47  ? 122.591 -12.495 2.026   1.00 0.00 ? 47  CYS A CA   4  
ATOM 7296  C C    . CYS A 1 47  ? 123.978 -13.166 1.901   1.00 0.00 ? 47  CYS A C    4  
ATOM 7297  O O    . CYS A 1 47  ? 124.086 -14.377 1.680   1.00 0.00 ? 47  CYS A O    4  
ATOM 7298  C CB   . CYS A 1 47  ? 122.195 -11.838 0.703   1.00 0.00 ? 47  CYS A CB   4  
ATOM 7299  S SG   . CYS A 1 47  ? 120.613 -10.962 0.765   1.00 0.00 ? 47  CYS A SG   4  
ATOM 7300  H H    . CYS A 1 47  ? 122.561 -10.549 2.861   1.00 0.00 ? 47  CYS A H    4  
ATOM 7301  H HA   . CYS A 1 47  ? 121.860 -13.253 2.268   1.00 0.00 ? 47  CYS A HA   4  
ATOM 7302  H HB2  . CYS A 1 47  ? 122.956 -11.123 0.426   1.00 0.00 ? 47  CYS A HB2  4  
ATOM 7303  H HB3  . CYS A 1 47  ? 122.125 -12.597 -0.061  1.00 0.00 ? 47  CYS A HB3  4  
ATOM 7304  H HG   . CYS A 1 47  ? 120.657 -10.082 1.758   1.00 0.00 ? 47  CYS A HG   4  
ATOM 7305  N N    . GLU A 1 48  ? 125.033 -12.393 2.054   1.00 0.00 ? 48  GLU A N    4  
ATOM 7306  C CA   . GLU A 1 48  ? 126.374 -12.951 1.990   1.00 0.00 ? 48  GLU A CA   4  
ATOM 7307  C C    . GLU A 1 48  ? 126.629 -13.711 3.307   1.00 0.00 ? 48  GLU A C    4  
ATOM 7308  O O    . GLU A 1 48  ? 127.189 -14.798 3.324   1.00 0.00 ? 48  GLU A O    4  
ATOM 7309  C CB   . GLU A 1 48  ? 127.390 -11.817 1.705   1.00 0.00 ? 48  GLU A CB   4  
ATOM 7310  C CG   . GLU A 1 48  ? 128.792 -12.231 1.217   1.00 0.00 ? 48  GLU A CG   4  
ATOM 7311  C CD   . GLU A 1 48  ? 129.726 -12.783 2.280   1.00 0.00 ? 48  GLU A CD   4  
ATOM 7312  O OE1  . GLU A 1 48  ? 130.409 -11.977 2.959   1.00 0.00 ? 48  GLU A OE1  4  
ATOM 7313  O OE2  . GLU A 1 48  ? 129.851 -14.017 2.407   1.00 0.00 ? 48  GLU A OE2  4  
ATOM 7314  H H    . GLU A 1 48  ? 124.907 -11.428 2.189   1.00 0.00 ? 48  GLU A H    4  
ATOM 7315  H HA   . GLU A 1 48  ? 126.380 -13.671 1.182   1.00 0.00 ? 48  GLU A HA   4  
ATOM 7316  H HB2  . GLU A 1 48  ? 126.968 -11.170 0.950   1.00 0.00 ? 48  GLU A HB2  4  
ATOM 7317  H HB3  . GLU A 1 48  ? 127.505 -11.240 2.606   1.00 0.00 ? 48  GLU A HB3  4  
ATOM 7318  H HG2  . GLU A 1 48  ? 128.676 -12.991 0.461   1.00 0.00 ? 48  GLU A HG2  4  
ATOM 7319  H HG3  . GLU A 1 48  ? 129.255 -11.365 0.766   1.00 0.00 ? 48  GLU A HG3  4  
ATOM 7320  N N    . ASP A 1 49  ? 126.115 -13.162 4.397   1.00 0.00 ? 49  ASP A N    4  
ATOM 7321  C CA   . ASP A 1 49  ? 126.170 -13.824 5.708   1.00 0.00 ? 49  ASP A CA   4  
ATOM 7322  C C    . ASP A 1 49  ? 125.347 -15.108 5.680   1.00 0.00 ? 49  ASP A C    4  
ATOM 7323  O O    . ASP A 1 49  ? 125.626 -16.074 6.387   1.00 0.00 ? 49  ASP A O    4  
ATOM 7324  C CB   . ASP A 1 49  ? 125.663 -12.889 6.808   1.00 0.00 ? 49  ASP A CB   4  
ATOM 7325  C CG   . ASP A 1 49  ? 125.610 -13.539 8.169   1.00 0.00 ? 49  ASP A CG   4  
ATOM 7326  O OD1  . ASP A 1 49  ? 126.671 -13.772 8.781   1.00 0.00 ? 49  ASP A OD1  4  
ATOM 7327  O OD2  . ASP A 1 49  ? 124.492 -13.816 8.667   1.00 0.00 ? 49  ASP A OD2  4  
ATOM 7328  H H    . ASP A 1 49  ? 125.694 -12.274 4.330   1.00 0.00 ? 49  ASP A H    4  
ATOM 7329  H HA   . ASP A 1 49  ? 127.201 -14.080 5.903   1.00 0.00 ? 49  ASP A HA   4  
ATOM 7330  H HB2  . ASP A 1 49  ? 126.319 -12.034 6.872   1.00 0.00 ? 49  ASP A HB2  4  
ATOM 7331  H HB3  . ASP A 1 49  ? 124.670 -12.553 6.549   1.00 0.00 ? 49  ASP A HB3  4  
ATOM 7332  N N    . PHE A 1 50  ? 124.343 -15.099 4.852   1.00 0.00 ? 50  PHE A N    4  
ATOM 7333  C CA   . PHE A 1 50  ? 123.477 -16.229 4.615   1.00 0.00 ? 50  PHE A CA   4  
ATOM 7334  C C    . PHE A 1 50  ? 124.257 -17.391 4.004   1.00 0.00 ? 50  PHE A C    4  
ATOM 7335  O O    . PHE A 1 50  ? 124.114 -18.530 4.442   1.00 0.00 ? 50  PHE A O    4  
ATOM 7336  C CB   . PHE A 1 50  ? 122.307 -15.768 3.734   1.00 0.00 ? 50  PHE A CB   4  
ATOM 7337  C CG   . PHE A 1 50  ? 121.451 -16.820 3.158   1.00 0.00 ? 50  PHE A CG   4  
ATOM 7338  C CD1  . PHE A 1 50  ? 120.643 -17.582 3.953   1.00 0.00 ? 50  PHE A CD1  4  
ATOM 7339  C CD2  . PHE A 1 50  ? 121.454 -17.037 1.798   1.00 0.00 ? 50  PHE A CD2  4  
ATOM 7340  C CE1  . PHE A 1 50  ? 119.848 -18.552 3.406   1.00 0.00 ? 50  PHE A CE1  4  
ATOM 7341  C CE2  . PHE A 1 50  ? 120.663 -17.998 1.245   1.00 0.00 ? 50  PHE A CE2  4  
ATOM 7342  C CZ   . PHE A 1 50  ? 119.856 -18.761 2.049   1.00 0.00 ? 50  PHE A CZ   4  
ATOM 7343  H H    . PHE A 1 50  ? 124.144 -14.266 4.374   1.00 0.00 ? 50  PHE A H    4  
ATOM 7344  H HA   . PHE A 1 50  ? 123.090 -16.543 5.571   1.00 0.00 ? 50  PHE A HA   4  
ATOM 7345  H HB2  . PHE A 1 50  ? 121.663 -15.134 4.326   1.00 0.00 ? 50  PHE A HB2  4  
ATOM 7346  H HB3  . PHE A 1 50  ? 122.708 -15.178 2.922   1.00 0.00 ? 50  PHE A HB3  4  
ATOM 7347  H HD1  . PHE A 1 50  ? 120.637 -17.406 5.020   1.00 0.00 ? 50  PHE A HD1  4  
ATOM 7348  H HD2  . PHE A 1 50  ? 122.092 -16.436 1.169   1.00 0.00 ? 50  PHE A HD2  4  
ATOM 7349  H HE1  . PHE A 1 50  ? 119.214 -19.154 4.041   1.00 0.00 ? 50  PHE A HE1  4  
ATOM 7350  H HE2  . PHE A 1 50  ? 120.672 -18.162 0.178   1.00 0.00 ? 50  PHE A HE2  4  
ATOM 7351  H HZ   . PHE A 1 50  ? 119.226 -19.523 1.615   1.00 0.00 ? 50  PHE A HZ   4  
ATOM 7352  N N    . LYS A 1 51  ? 125.122 -17.091 3.042   1.00 0.00 ? 51  LYS A N    4  
ATOM 7353  C CA   . LYS A 1 51  ? 125.934 -18.138 2.426   1.00 0.00 ? 51  LYS A CA   4  
ATOM 7354  C C    . LYS A 1 51  ? 127.125 -18.528 3.316   1.00 0.00 ? 51  LYS A C    4  
ATOM 7355  O O    . LYS A 1 51  ? 127.820 -19.522 3.042   1.00 0.00 ? 51  LYS A O    4  
ATOM 7356  C CB   . LYS A 1 51  ? 126.412 -17.768 1.010   1.00 0.00 ? 51  LYS A CB   4  
ATOM 7357  C CG   . LYS A 1 51  ? 127.387 -16.606 0.929   1.00 0.00 ? 51  LYS A CG   4  
ATOM 7358  C CD   . LYS A 1 51  ? 127.862 -16.412 -0.490  1.00 0.00 ? 51  LYS A CD   4  
ATOM 7359  C CE   . LYS A 1 51  ? 128.868 -15.280 -0.635  1.00 0.00 ? 51  LYS A CE   4  
ATOM 7360  N NZ   . LYS A 1 51  ? 130.067 -15.478 0.207   1.00 0.00 ? 51  LYS A NZ   4  
ATOM 7361  H H    . LYS A 1 51  ? 125.183 -16.160 2.738   1.00 0.00 ? 51  LYS A H    4  
ATOM 7362  H HA   . LYS A 1 51  ? 125.295 -19.008 2.360   1.00 0.00 ? 51  LYS A HA   4  
ATOM 7363  H HB2  . LYS A 1 51  ? 126.897 -18.631 0.578   1.00 0.00 ? 51  LYS A HB2  4  
ATOM 7364  H HB3  . LYS A 1 51  ? 125.546 -17.525 0.412   1.00 0.00 ? 51  LYS A HB3  4  
ATOM 7365  H HG2  . LYS A 1 51  ? 126.893 -15.705 1.263   1.00 0.00 ? 51  LYS A HG2  4  
ATOM 7366  H HG3  . LYS A 1 51  ? 128.237 -16.812 1.562   1.00 0.00 ? 51  LYS A HG3  4  
ATOM 7367  H HD2  . LYS A 1 51  ? 128.329 -17.327 -0.825  1.00 0.00 ? 51  LYS A HD2  4  
ATOM 7368  H HD3  . LYS A 1 51  ? 127.005 -16.204 -1.114  1.00 0.00 ? 51  LYS A HD3  4  
ATOM 7369  H HE2  . LYS A 1 51  ? 129.176 -15.221 -1.668  1.00 0.00 ? 51  LYS A HE2  4  
ATOM 7370  H HE3  . LYS A 1 51  ? 128.387 -14.356 -0.351  1.00 0.00 ? 51  LYS A HE3  4  
ATOM 7371  H HZ1  . LYS A 1 51  ? 129.836 -15.309 1.212   1.00 0.00 ? 51  LYS A HZ1  4  
ATOM 7372  H HZ2  . LYS A 1 51  ? 130.802 -14.777 -0.032  1.00 0.00 ? 51  LYS A HZ2  4  
ATOM 7373  H HZ3  . LYS A 1 51  ? 130.457 -16.441 0.114   1.00 0.00 ? 51  LYS A HZ3  4  
ATOM 7374  N N    . LYS A 1 52  ? 127.395 -17.718 4.347   1.00 0.00 ? 52  LYS A N    4  
ATOM 7375  C CA   . LYS A 1 52  ? 128.432 -18.051 5.326   1.00 0.00 ? 52  LYS A CA   4  
ATOM 7376  C C    . LYS A 1 52  ? 128.030 -19.317 6.083   1.00 0.00 ? 52  LYS A C    4  
ATOM 7377  O O    . LYS A 1 52  ? 128.868 -20.183 6.367   1.00 0.00 ? 52  LYS A O    4  
ATOM 7378  C CB   . LYS A 1 52  ? 128.705 -16.888 6.294   1.00 0.00 ? 52  LYS A CB   4  
ATOM 7379  C CG   . LYS A 1 52  ? 129.179 -15.623 5.605   1.00 0.00 ? 52  LYS A CG   4  
ATOM 7380  C CD   . LYS A 1 52  ? 129.496 -14.502 6.590   1.00 0.00 ? 52  LYS A CD   4  
ATOM 7381  C CE   . LYS A 1 52  ? 129.818 -13.218 5.839   1.00 0.00 ? 52  LYS A CE   4  
ATOM 7382  N NZ   . LYS A 1 52  ? 130.156 -12.089 6.727   1.00 0.00 ? 52  LYS A NZ   4  
ATOM 7383  H H    . LYS A 1 52  ? 126.900 -16.871 4.413   1.00 0.00 ? 52  LYS A H    4  
ATOM 7384  H HA   . LYS A 1 52  ? 129.328 -18.272 4.763   1.00 0.00 ? 52  LYS A HA   4  
ATOM 7385  H HB2  . LYS A 1 52  ? 127.789 -16.654 6.819   1.00 0.00 ? 52  LYS A HB2  4  
ATOM 7386  H HB3  . LYS A 1 52  ? 129.467 -17.197 6.997   1.00 0.00 ? 52  LYS A HB3  4  
ATOM 7387  H HG2  . LYS A 1 52  ? 130.062 -15.849 5.028   1.00 0.00 ? 52  LYS A HG2  4  
ATOM 7388  H HG3  . LYS A 1 52  ? 128.400 -15.289 4.935   1.00 0.00 ? 52  LYS A HG3  4  
ATOM 7389  H HD2  . LYS A 1 52  ? 128.637 -14.336 7.225   1.00 0.00 ? 52  LYS A HD2  4  
ATOM 7390  H HD3  . LYS A 1 52  ? 130.348 -14.784 7.190   1.00 0.00 ? 52  LYS A HD3  4  
ATOM 7391  H HE2  . LYS A 1 52  ? 130.659 -13.404 5.188   1.00 0.00 ? 52  LYS A HE2  4  
ATOM 7392  H HE3  . LYS A 1 52  ? 128.961 -12.951 5.239   1.00 0.00 ? 52  LYS A HE3  4  
ATOM 7393  H HZ1  . LYS A 1 52  ? 129.419 -11.925 7.445   1.00 0.00 ? 52  LYS A HZ1  4  
ATOM 7394  H HZ2  . LYS A 1 52  ? 130.213 -11.203 6.175   1.00 0.00 ? 52  LYS A HZ2  4  
ATOM 7395  H HZ3  . LYS A 1 52  ? 131.076 -12.190 7.209   1.00 0.00 ? 52  LYS A HZ3  4  
ATOM 7396  N N    . SER A 1 53  ? 126.755 -19.427 6.406   1.00 0.00 ? 53  SER A N    4  
ATOM 7397  C CA   . SER A 1 53  ? 126.235 -20.648 6.948   1.00 0.00 ? 53  SER A CA   4  
ATOM 7398  C C    . SER A 1 53  ? 126.049 -21.626 5.800   1.00 0.00 ? 53  SER A C    4  
ATOM 7399  O O    . SER A 1 53  ? 125.310 -21.359 4.878   1.00 0.00 ? 53  SER A O    4  
ATOM 7400  C CB   . SER A 1 53  ? 124.940 -20.397 7.732   1.00 0.00 ? 53  SER A CB   4  
ATOM 7401  O OG   . SER A 1 53  ? 124.101 -19.434 7.092   1.00 0.00 ? 53  SER A OG   4  
ATOM 7402  H H    . SER A 1 53  ? 126.143 -18.677 6.253   1.00 0.00 ? 53  SER A H    4  
ATOM 7403  H HA   . SER A 1 53  ? 126.993 -21.049 7.608   1.00 0.00 ? 53  SER A HA   4  
ATOM 7404  H HB2  . SER A 1 53  ? 124.387 -21.324 7.782   1.00 0.00 ? 53  SER A HB2  4  
ATOM 7405  H HB3  . SER A 1 53  ? 125.176 -20.055 8.728   1.00 0.00 ? 53  SER A HB3  4  
ATOM 7406  H HG   . SER A 1 53  ? 124.145 -19.562 6.129   1.00 0.00 ? 53  SER A HG   4  
ATOM 7407  N N    . LYS A 1 54  ? 126.751 -22.721 5.851   1.00 0.00 ? 54  LYS A N    4  
ATOM 7408  C CA   . LYS A 1 54  ? 126.792 -23.649 4.739   1.00 0.00 ? 54  LYS A CA   4  
ATOM 7409  C C    . LYS A 1 54  ? 125.994 -24.919 4.981   1.00 0.00 ? 54  LYS A C    4  
ATOM 7410  O O    . LYS A 1 54  ? 126.020 -25.843 4.160   1.00 0.00 ? 54  LYS A O    4  
ATOM 7411  C CB   . LYS A 1 54  ? 128.260 -23.923 4.339   1.00 0.00 ? 54  LYS A CB   4  
ATOM 7412  C CG   . LYS A 1 54  ? 129.215 -24.273 5.500   1.00 0.00 ? 54  LYS A CG   4  
ATOM 7413  C CD   . LYS A 1 54  ? 129.049 -25.695 6.033   1.00 0.00 ? 54  LYS A CD   4  
ATOM 7414  C CE   . LYS A 1 54  ? 129.474 -26.730 5.001   1.00 0.00 ? 54  LYS A CE   4  
ATOM 7415  N NZ   . LYS A 1 54  ? 130.886 -26.546 4.590   1.00 0.00 ? 54  LYS A NZ   4  
ATOM 7416  H H    . LYS A 1 54  ? 127.260 -22.909 6.674   1.00 0.00 ? 54  LYS A H    4  
ATOM 7417  H HA   . LYS A 1 54  ? 126.325 -23.138 3.910   1.00 0.00 ? 54  LYS A HA   4  
ATOM 7418  H HB2  . LYS A 1 54  ? 128.278 -24.749 3.644   1.00 0.00 ? 54  LYS A HB2  4  
ATOM 7419  H HB3  . LYS A 1 54  ? 128.646 -23.047 3.840   1.00 0.00 ? 54  LYS A HB3  4  
ATOM 7420  H HG2  . LYS A 1 54  ? 130.231 -24.162 5.154   1.00 0.00 ? 54  LYS A HG2  4  
ATOM 7421  H HG3  . LYS A 1 54  ? 129.040 -23.574 6.305   1.00 0.00 ? 54  LYS A HG3  4  
ATOM 7422  H HD2  . LYS A 1 54  ? 129.659 -25.812 6.917   1.00 0.00 ? 54  LYS A HD2  4  
ATOM 7423  H HD3  . LYS A 1 54  ? 128.011 -25.854 6.286   1.00 0.00 ? 54  LYS A HD3  4  
ATOM 7424  H HE2  . LYS A 1 54  ? 129.360 -27.715 5.430   1.00 0.00 ? 54  LYS A HE2  4  
ATOM 7425  H HE3  . LYS A 1 54  ? 128.836 -26.639 4.134   1.00 0.00 ? 54  LYS A HE3  4  
ATOM 7426  H HZ1  . LYS A 1 54  ? 131.523 -26.634 5.412   1.00 0.00 ? 54  LYS A HZ1  4  
ATOM 7427  H HZ2  . LYS A 1 54  ? 131.045 -25.611 4.159   1.00 0.00 ? 54  LYS A HZ2  4  
ATOM 7428  H HZ3  . LYS A 1 54  ? 131.176 -27.272 3.899   1.00 0.00 ? 54  LYS A HZ3  4  
ATOM 7429  N N    . GLY A 1 55  ? 125.281 -24.959 6.076   1.00 0.00 ? 55  GLY A N    4  
ATOM 7430  C CA   . GLY A 1 55  ? 124.467 -26.107 6.382   1.00 0.00 ? 55  GLY A CA   4  
ATOM 7431  C C    . GLY A 1 55  ? 123.126 -25.955 5.729   1.00 0.00 ? 55  GLY A C    4  
ATOM 7432  O O    . GLY A 1 55  ? 122.428 -25.002 6.029   1.00 0.00 ? 55  GLY A O    4  
ATOM 7433  H H    . GLY A 1 55  ? 125.271 -24.180 6.670   1.00 0.00 ? 55  GLY A H    4  
ATOM 7434  H HA2  . GLY A 1 55  ? 124.954 -26.998 6.013   1.00 0.00 ? 55  GLY A HA2  4  
ATOM 7435  H HA3  . GLY A 1 55  ? 124.333 -26.181 7.451   1.00 0.00 ? 55  GLY A HA3  4  
ATOM 7436  N N    . PRO A 1 56  ? 122.728 -26.874 4.836   1.00 0.00 ? 56  PRO A N    4  
ATOM 7437  C CA   . PRO A 1 56  ? 121.493 -26.747 4.059   1.00 0.00 ? 56  PRO A CA   4  
ATOM 7438  C C    . PRO A 1 56  ? 120.236 -26.589 4.919   1.00 0.00 ? 56  PRO A C    4  
ATOM 7439  O O    . PRO A 1 56  ? 119.341 -25.822 4.566   1.00 0.00 ? 56  PRO A O    4  
ATOM 7440  C CB   . PRO A 1 56  ? 121.444 -28.008 3.204   1.00 0.00 ? 56  PRO A CB   4  
ATOM 7441  C CG   . PRO A 1 56  ? 122.845 -28.513 3.199   1.00 0.00 ? 56  PRO A CG   4  
ATOM 7442  C CD   . PRO A 1 56  ? 123.438 -28.116 4.513   1.00 0.00 ? 56  PRO A CD   4  
ATOM 7443  H HA   . PRO A 1 56  ? 121.571 -25.878 3.420   1.00 0.00 ? 56  PRO A HA   4  
ATOM 7444  H HB2  . PRO A 1 56  ? 120.753 -28.723 3.625   1.00 0.00 ? 56  PRO A HB2  4  
ATOM 7445  H HB3  . PRO A 1 56  ? 121.138 -27.723 2.208   1.00 0.00 ? 56  PRO A HB3  4  
ATOM 7446  H HG2  . PRO A 1 56  ? 122.847 -29.588 3.096   1.00 0.00 ? 56  PRO A HG2  4  
ATOM 7447  H HG3  . PRO A 1 56  ? 123.394 -28.058 2.388   1.00 0.00 ? 56  PRO A HG3  4  
ATOM 7448  H HD2  . PRO A 1 56  ? 123.244 -28.874 5.258   1.00 0.00 ? 56  PRO A HD2  4  
ATOM 7449  H HD3  . PRO A 1 56  ? 124.497 -27.938 4.425   1.00 0.00 ? 56  PRO A HD3  4  
ATOM 7450  N N    . GLN A 1 57  ? 120.179 -27.267 6.067   1.00 0.00 ? 57  GLN A N    4  
ATOM 7451  C CA   . GLN A 1 57  ? 119.032 -27.102 6.972   1.00 0.00 ? 57  GLN A CA   4  
ATOM 7452  C C    . GLN A 1 57  ? 118.970 -25.662 7.470   1.00 0.00 ? 57  GLN A C    4  
ATOM 7453  O O    . GLN A 1 57  ? 117.902 -25.048 7.507   1.00 0.00 ? 57  GLN A O    4  
ATOM 7454  C CB   . GLN A 1 57  ? 119.086 -28.069 8.169   1.00 0.00 ? 57  GLN A CB   4  
ATOM 7455  C CG   . GLN A 1 57  ? 120.304 -27.899 9.059   1.00 0.00 ? 57  GLN A CG   4  
ATOM 7456  C CD   . GLN A 1 57  ? 120.326 -28.836 10.234  1.00 0.00 ? 57  GLN A CD   4  
ATOM 7457  O OE1  . GLN A 1 57  ? 119.286 -29.240 10.754  1.00 0.00 ? 57  GLN A OE1  4  
ATOM 7458  N NE2  . GLN A 1 57  ? 121.500 -29.181 10.661  1.00 0.00 ? 57  GLN A NE2  4  
ATOM 7459  H H    . GLN A 1 57  ? 120.908 -27.897 6.282   1.00 0.00 ? 57  GLN A H    4  
ATOM 7460  H HA   . GLN A 1 57  ? 118.140 -27.293 6.393   1.00 0.00 ? 57  GLN A HA   4  
ATOM 7461  H HB2  . GLN A 1 57  ? 118.215 -27.879 8.782   1.00 0.00 ? 57  GLN A HB2  4  
ATOM 7462  H HB3  . GLN A 1 57  ? 119.056 -29.087 7.809   1.00 0.00 ? 57  GLN A HB3  4  
ATOM 7463  H HG2  . GLN A 1 57  ? 121.190 -28.079 8.467   1.00 0.00 ? 57  GLN A HG2  4  
ATOM 7464  H HG3  . GLN A 1 57  ? 120.322 -26.883 9.424   1.00 0.00 ? 57  GLN A HG3  4  
ATOM 7465  H HE21 . GLN A 1 57  ? 122.274 -28.802 10.181  1.00 0.00 ? 57  GLN A HE21 4  
ATOM 7466  H HE22 . GLN A 1 57  ? 121.599 -29.784 11.429  1.00 0.00 ? 57  GLN A HE22 4  
ATOM 7467  N N    . GLN A 1 58  ? 120.146 -25.113 7.757   1.00 0.00 ? 58  GLN A N    4  
ATOM 7468  C CA   . GLN A 1 58  ? 120.303 -23.770 8.264   1.00 0.00 ? 58  GLN A CA   4  
ATOM 7469  C C    . GLN A 1 58  ? 119.881 -22.781 7.200   1.00 0.00 ? 58  GLN A C    4  
ATOM 7470  O O    . GLN A 1 58  ? 119.336 -21.727 7.504   1.00 0.00 ? 58  GLN A O    4  
ATOM 7471  C CB   . GLN A 1 58  ? 121.772 -23.535 8.662   1.00 0.00 ? 58  GLN A CB   4  
ATOM 7472  C CG   . GLN A 1 58  ? 122.049 -22.192 9.311   1.00 0.00 ? 58  GLN A CG   4  
ATOM 7473  C CD   . GLN A 1 58  ? 121.323 -22.008 10.632  1.00 0.00 ? 58  GLN A CD   4  
ATOM 7474  O OE1  . GLN A 1 58  ? 120.952 -20.902 10.992  1.00 0.00 ? 58  GLN A OE1  4  
ATOM 7475  N NE2  . GLN A 1 58  ? 121.150 -23.070 11.377  1.00 0.00 ? 58  GLN A NE2  4  
ATOM 7476  H H    . GLN A 1 58  ? 120.955 -25.645 7.600   1.00 0.00 ? 58  GLN A H    4  
ATOM 7477  H HA   . GLN A 1 58  ? 119.679 -23.653 9.137   1.00 0.00 ? 58  GLN A HA   4  
ATOM 7478  H HB2  . GLN A 1 58  ? 122.065 -24.306 9.359   1.00 0.00 ? 58  GLN A HB2  4  
ATOM 7479  H HB3  . GLN A 1 58  ? 122.386 -23.619 7.777   1.00 0.00 ? 58  GLN A HB3  4  
ATOM 7480  H HG2  . GLN A 1 58  ? 123.111 -22.123 9.496   1.00 0.00 ? 58  GLN A HG2  4  
ATOM 7481  H HG3  . GLN A 1 58  ? 121.760 -21.405 8.630   1.00 0.00 ? 58  GLN A HG3  4  
ATOM 7482  H HE21 . GLN A 1 58  ? 121.489 -23.946 11.069  1.00 0.00 ? 58  GLN A HE21 4  
ATOM 7483  H HE22 . GLN A 1 58  ? 120.687 -22.958 12.235  1.00 0.00 ? 58  GLN A HE22 4  
ATOM 7484  N N    . ILE A 1 59  ? 120.109 -23.160 5.955   1.00 0.00 ? 59  ILE A N    4  
ATOM 7485  C CA   . ILE A 1 59  ? 119.764 -22.351 4.801   1.00 0.00 ? 59  ILE A CA   4  
ATOM 7486  C C    . ILE A 1 59  ? 118.276 -22.055 4.784   1.00 0.00 ? 59  ILE A C    4  
ATOM 7487  O O    . ILE A 1 59  ? 117.879 -20.926 4.616   1.00 0.00 ? 59  ILE A O    4  
ATOM 7488  C CB   . ILE A 1 59  ? 120.148 -23.053 3.471   1.00 0.00 ? 59  ILE A CB   4  
ATOM 7489  C CG1  . ILE A 1 59  ? 121.630 -23.426 3.452   1.00 0.00 ? 59  ILE A CG1  4  
ATOM 7490  C CG2  . ILE A 1 59  ? 119.772 -22.220 2.262   1.00 0.00 ? 59  ILE A CG2  4  
ATOM 7491  C CD1  . ILE A 1 59  ? 122.574 -22.313 3.795   1.00 0.00 ? 59  ILE A CD1  4  
ATOM 7492  H H    . ILE A 1 59  ? 120.555 -24.024 5.815   1.00 0.00 ? 59  ILE A H    4  
ATOM 7493  H HA   . ILE A 1 59  ? 120.309 -21.421 4.867   1.00 0.00 ? 59  ILE A HA   4  
ATOM 7494  H HB   . ILE A 1 59  ? 119.569 -23.963 3.417   1.00 0.00 ? 59  ILE A HB   4  
ATOM 7495  H HG12 . ILE A 1 59  ? 121.799 -24.207 4.177   1.00 0.00 ? 59  ILE A HG12 4  
ATOM 7496  H HG13 . ILE A 1 59  ? 121.886 -23.792 2.469   1.00 0.00 ? 59  ILE A HG13 4  
ATOM 7497  H HG21 . ILE A 1 59  ? 120.289 -21.272 2.296   1.00 0.00 ? 59  ILE A HG21 4  
ATOM 7498  H HG22 . ILE A 1 59  ? 118.706 -22.048 2.282   1.00 0.00 ? 59  ILE A HG22 4  
ATOM 7499  H HG23 . ILE A 1 59  ? 120.037 -22.750 1.359   1.00 0.00 ? 59  ILE A HG23 4  
ATOM 7500  H HD11 . ILE A 1 59  ? 122.491 -21.513 3.075   1.00 0.00 ? 59  ILE A HD11 4  
ATOM 7501  H HD12 . ILE A 1 59  ? 123.572 -22.728 3.801   1.00 0.00 ? 59  ILE A HD12 4  
ATOM 7502  H HD13 . ILE A 1 59  ? 122.355 -21.952 4.788   1.00 0.00 ? 59  ILE A HD13 4  
ATOM 7503  N N    . HIS A 1 60  ? 117.465 -23.082 5.003   1.00 0.00 ? 60  HIS A N    4  
ATOM 7504  C CA   . HIS A 1 60  ? 116.000 -22.921 4.989   1.00 0.00 ? 60  HIS A CA   4  
ATOM 7505  C C    . HIS A 1 60  ? 115.559 -21.958 6.070   1.00 0.00 ? 60  HIS A C    4  
ATOM 7506  O O    . HIS A 1 60  ? 114.706 -21.117 5.845   1.00 0.00 ? 60  HIS A O    4  
ATOM 7507  C CB   . HIS A 1 60  ? 115.258 -24.258 5.168   1.00 0.00 ? 60  HIS A CB   4  
ATOM 7508  C CG   . HIS A 1 60  ? 115.452 -25.255 4.064   1.00 0.00 ? 60  HIS A CG   4  
ATOM 7509  N ND1  . HIS A 1 60  ? 114.459 -25.639 3.189   1.00 0.00 ? 60  HIS A ND1  4  
ATOM 7510  C CD2  . HIS A 1 60  ? 116.526 -25.973 3.727   1.00 0.00 ? 60  HIS A CD2  4  
ATOM 7511  C CE1  . HIS A 1 60  ? 114.934 -26.550 2.365   1.00 0.00 ? 60  HIS A CE1  4  
ATOM 7512  N NE2  . HIS A 1 60  ? 116.186 -26.766 2.672   1.00 0.00 ? 60  HIS A NE2  4  
ATOM 7513  H H    . HIS A 1 60  ? 117.895 -23.945 5.189   1.00 0.00 ? 60  HIS A H    4  
ATOM 7514  H HA   . HIS A 1 60  ? 115.736 -22.498 4.031   1.00 0.00 ? 60  HIS A HA   4  
ATOM 7515  H HB2  . HIS A 1 60  ? 115.594 -24.724 6.083   1.00 0.00 ? 60  HIS A HB2  4  
ATOM 7516  H HB3  . HIS A 1 60  ? 114.199 -24.056 5.252   1.00 0.00 ? 60  HIS A HB3  4  
ATOM 7517  H HD1  . HIS A 1 60  ? 113.521 -25.315 3.166   1.00 0.00 ? 60  HIS A HD1  4  
ATOM 7518  H HD2  . HIS A 1 60  ? 117.481 -25.929 4.232   1.00 0.00 ? 60  HIS A HD2  4  
ATOM 7519  H HE1  . HIS A 1 60  ? 114.384 -27.036 1.572   1.00 0.00 ? 60  HIS A HE1  4  
ATOM 7520  H HE2  . HIS A 1 60  ? 116.655 -27.626 2.527   1.00 0.00 ? 60  HIS A HE2  4  
ATOM 7521  N N    . LEU A 1 61  ? 116.185 -22.076 7.222   1.00 0.00 ? 61  LEU A N    4  
ATOM 7522  C CA   . LEU A 1 61  ? 115.878 -21.254 8.387   1.00 0.00 ? 61  LEU A CA   4  
ATOM 7523  C C    . LEU A 1 61  ? 116.244 -19.808 8.085   1.00 0.00 ? 61  LEU A C    4  
ATOM 7524  O O    . LEU A 1 61  ? 115.397 -18.910 8.103   1.00 0.00 ? 61  LEU A O    4  
ATOM 7525  C CB   . LEU A 1 61  ? 116.730 -21.725 9.557   1.00 0.00 ? 61  LEU A CB   4  
ATOM 7526  C CG   . LEU A 1 61  ? 116.824 -23.228 9.761   1.00 0.00 ? 61  LEU A CG   4  
ATOM 7527  C CD1  . LEU A 1 61  ? 117.813 -23.531 10.843  1.00 0.00 ? 61  LEU A CD1  4  
ATOM 7528  C CD2  . LEU A 1 61  ? 115.476 -23.837 10.076  1.00 0.00 ? 61  LEU A CD2  4  
ATOM 7529  H H    . LEU A 1 61  ? 116.896 -22.747 7.297   1.00 0.00 ? 61  LEU A H    4  
ATOM 7530  H HA   . LEU A 1 61  ? 114.833 -21.347 8.643   1.00 0.00 ? 61  LEU A HA   4  
ATOM 7531  H HB2  . LEU A 1 61  ? 117.731 -21.345 9.414   1.00 0.00 ? 61  LEU A HB2  4  
ATOM 7532  H HB3  . LEU A 1 61  ? 116.328 -21.287 10.459  1.00 0.00 ? 61  LEU A HB3  4  
ATOM 7533  H HG   . LEU A 1 61  ? 117.196 -23.674 8.849   1.00 0.00 ? 61  LEU A HG   4  
ATOM 7534  H HD11 . LEU A 1 61  ? 117.944 -24.599 10.934  1.00 0.00 ? 61  LEU A HD11 4  
ATOM 7535  H HD12 . LEU A 1 61  ? 117.470 -23.104 11.774  1.00 0.00 ? 61  LEU A HD12 4  
ATOM 7536  H HD13 . LEU A 1 61  ? 118.741 -23.067 10.539  1.00 0.00 ? 61  LEU A HD13 4  
ATOM 7537  H HD21 . LEU A 1 61  ? 114.809 -23.627 9.253   1.00 0.00 ? 61  LEU A HD21 4  
ATOM 7538  H HD22 . LEU A 1 61  ? 115.083 -23.413 10.989  1.00 0.00 ? 61  LEU A HD22 4  
ATOM 7539  H HD23 . LEU A 1 61  ? 115.591 -24.907 10.175  1.00 0.00 ? 61  LEU A HD23 4  
ATOM 7540  N N    . LYS A 1 62  ? 117.524 -19.617 7.791   1.00 0.00 ? 62  LYS A N    4  
ATOM 7541  C CA   . LYS A 1 62  ? 118.090 -18.307 7.442   1.00 0.00 ? 62  LYS A CA   4  
ATOM 7542  C C    . LYS A 1 62  ? 117.324 -17.627 6.303   1.00 0.00 ? 62  LYS A C    4  
ATOM 7543  O O    . LYS A 1 62  ? 116.953 -16.458 6.411   1.00 0.00 ? 62  LYS A O    4  
ATOM 7544  C CB   . LYS A 1 62  ? 119.559 -18.441 7.029   1.00 0.00 ? 62  LYS A CB   4  
ATOM 7545  C CG   . LYS A 1 62  ? 120.529 -18.806 8.131   1.00 0.00 ? 62  LYS A CG   4  
ATOM 7546  C CD   . LYS A 1 62  ? 120.627 -17.708 9.167   1.00 0.00 ? 62  LYS A CD   4  
ATOM 7547  C CE   . LYS A 1 62  ? 121.718 -18.005 10.181  1.00 0.00 ? 62  LYS A CE   4  
ATOM 7548  N NZ   . LYS A 1 62  ? 123.051 -18.102 9.543   1.00 0.00 ? 62  LYS A NZ   4  
ATOM 7549  H H    . LYS A 1 62  ? 118.107 -20.414 7.836   1.00 0.00 ? 62  LYS A H    4  
ATOM 7550  H HA   . LYS A 1 62  ? 118.041 -17.678 8.319   1.00 0.00 ? 62  LYS A HA   4  
ATOM 7551  H HB2  . LYS A 1 62  ? 119.629 -19.204 6.269   1.00 0.00 ? 62  LYS A HB2  4  
ATOM 7552  H HB3  . LYS A 1 62  ? 119.874 -17.502 6.597   1.00 0.00 ? 62  LYS A HB3  4  
ATOM 7553  H HG2  . LYS A 1 62  ? 120.189 -19.711 8.612   1.00 0.00 ? 62  LYS A HG2  4  
ATOM 7554  H HG3  . LYS A 1 62  ? 121.505 -18.971 7.698   1.00 0.00 ? 62  LYS A HG3  4  
ATOM 7555  H HD2  . LYS A 1 62  ? 120.857 -16.780 8.665   1.00 0.00 ? 62  LYS A HD2  4  
ATOM 7556  H HD3  . LYS A 1 62  ? 119.679 -17.623 9.676   1.00 0.00 ? 62  LYS A HD3  4  
ATOM 7557  H HE2  . LYS A 1 62  ? 121.740 -17.210 10.912  1.00 0.00 ? 62  LYS A HE2  4  
ATOM 7558  H HE3  . LYS A 1 62  ? 121.492 -18.940 10.671  1.00 0.00 ? 62  LYS A HE3  4  
ATOM 7559  H HZ1  . LYS A 1 62  ? 123.778 -18.358 10.249  1.00 0.00 ? 62  LYS A HZ1  4  
ATOM 7560  H HZ2  . LYS A 1 62  ? 123.305 -17.177 9.134   1.00 0.00 ? 62  LYS A HZ2  4  
ATOM 7561  H HZ3  . LYS A 1 62  ? 123.081 -18.787 8.762   1.00 0.00 ? 62  LYS A HZ3  4  
ATOM 7562  N N    . ALA A 1 63  ? 117.086 -18.367 5.229   1.00 0.00 ? 63  ALA A N    4  
ATOM 7563  C CA   . ALA A 1 63  ? 116.418 -17.832 4.054   1.00 0.00 ? 63  ALA A CA   4  
ATOM 7564  C C    . ALA A 1 63  ? 115.028 -17.398 4.376   1.00 0.00 ? 63  ALA A C    4  
ATOM 7565  O O    . ALA A 1 63  ? 114.614 -16.318 4.000   1.00 0.00 ? 63  ALA A O    4  
ATOM 7566  C CB   . ALA A 1 63  ? 116.371 -18.854 2.936   1.00 0.00 ? 63  ALA A CB   4  
ATOM 7567  H H    . ALA A 1 63  ? 117.374 -19.309 5.218   1.00 0.00 ? 63  ALA A H    4  
ATOM 7568  H HA   . ALA A 1 63  ? 116.985 -16.981 3.705   1.00 0.00 ? 63  ALA A HA   4  
ATOM 7569  H HB1  . ALA A 1 63  ? 117.364 -19.217 2.712   1.00 0.00 ? 63  ALA A HB1  4  
ATOM 7570  H HB2  . ALA A 1 63  ? 115.944 -18.405 2.050   1.00 0.00 ? 63  ALA A HB2  4  
ATOM 7571  H HB3  . ALA A 1 63  ? 115.751 -19.673 3.270   1.00 0.00 ? 63  ALA A HB3  4  
ATOM 7572  N N    . LYS A 1 64  ? 114.316 -18.231 5.092   1.00 0.00 ? 64  LYS A N    4  
ATOM 7573  C CA   . LYS A 1 64  ? 112.944 -17.948 5.422   1.00 0.00 ? 64  LYS A CA   4  
ATOM 7574  C C    . LYS A 1 64  ? 112.859 -16.728 6.343   1.00 0.00 ? 64  LYS A C    4  
ATOM 7575  O O    . LYS A 1 64  ? 111.949 -15.917 6.219   1.00 0.00 ? 64  LYS A O    4  
ATOM 7576  C CB   . LYS A 1 64  ? 112.286 -19.168 6.049   1.00 0.00 ? 64  LYS A CB   4  
ATOM 7577  C CG   . LYS A 1 64  ? 110.779 -19.144 6.005   1.00 0.00 ? 64  LYS A CG   4  
ATOM 7578  C CD   . LYS A 1 64  ? 110.285 -19.028 4.567   1.00 0.00 ? 64  LYS A CD   4  
ATOM 7579  C CE   . LYS A 1 64  ? 108.785 -19.178 4.478   1.00 0.00 ? 64  LYS A CE   4  
ATOM 7580  N NZ   . LYS A 1 64  ? 108.342 -20.542 4.839   1.00 0.00 ? 64  LYS A NZ   4  
ATOM 7581  H H    . LYS A 1 64  ? 114.732 -19.070 5.391   1.00 0.00 ? 64  LYS A H    4  
ATOM 7582  H HA   . LYS A 1 64  ? 112.436 -17.710 4.499   1.00 0.00 ? 64  LYS A HA   4  
ATOM 7583  H HB2  . LYS A 1 64  ? 112.622 -20.052 5.525   1.00 0.00 ? 64  LYS A HB2  4  
ATOM 7584  H HB3  . LYS A 1 64  ? 112.593 -19.235 7.082   1.00 0.00 ? 64  LYS A HB3  4  
ATOM 7585  H HG2  . LYS A 1 64  ? 110.397 -20.056 6.439   1.00 0.00 ? 64  LYS A HG2  4  
ATOM 7586  H HG3  . LYS A 1 64  ? 110.424 -18.293 6.568   1.00 0.00 ? 64  LYS A HG3  4  
ATOM 7587  H HD2  . LYS A 1 64  ? 110.561 -18.058 4.180   1.00 0.00 ? 64  LYS A HD2  4  
ATOM 7588  H HD3  . LYS A 1 64  ? 110.754 -19.799 3.972   1.00 0.00 ? 64  LYS A HD3  4  
ATOM 7589  H HE2  . LYS A 1 64  ? 108.325 -18.470 5.151   1.00 0.00 ? 64  LYS A HE2  4  
ATOM 7590  H HE3  . LYS A 1 64  ? 108.477 -18.963 3.465   1.00 0.00 ? 64  LYS A HE3  4  
ATOM 7591  H HZ1  . LYS A 1 64  ? 108.650 -21.240 4.128   1.00 0.00 ? 64  LYS A HZ1  4  
ATOM 7592  H HZ2  . LYS A 1 64  ? 107.302 -20.590 4.915   1.00 0.00 ? 64  LYS A HZ2  4  
ATOM 7593  H HZ3  . LYS A 1 64  ? 108.719 -20.837 5.764   1.00 0.00 ? 64  LYS A HZ3  4  
ATOM 7594  N N    . ALA A 1 65  ? 113.840 -16.586 7.222   1.00 0.00 ? 65  ALA A N    4  
ATOM 7595  C CA   . ALA A 1 65  ? 113.923 -15.442 8.114   1.00 0.00 ? 65  ALA A CA   4  
ATOM 7596  C C    . ALA A 1 65  ? 114.120 -14.158 7.315   1.00 0.00 ? 65  ALA A C    4  
ATOM 7597  O O    . ALA A 1 65  ? 113.370 -13.194 7.478   1.00 0.00 ? 65  ALA A O    4  
ATOM 7598  C CB   . ALA A 1 65  ? 115.061 -15.625 9.108   1.00 0.00 ? 65  ALA A CB   4  
ATOM 7599  H H    . ALA A 1 65  ? 114.523 -17.291 7.280   1.00 0.00 ? 65  ALA A H    4  
ATOM 7600  H HA   . ALA A 1 65  ? 112.994 -15.378 8.662   1.00 0.00 ? 65  ALA A HA   4  
ATOM 7601  H HB1  . ALA A 1 65  ? 115.997 -15.686 8.574   1.00 0.00 ? 65  ALA A HB1  4  
ATOM 7602  H HB2  . ALA A 1 65  ? 114.905 -16.535 9.670   1.00 0.00 ? 65  ALA A HB2  4  
ATOM 7603  H HB3  . ALA A 1 65  ? 115.086 -14.784 9.785   1.00 0.00 ? 65  ALA A HB3  4  
ATOM 7604  N N    . ILE A 1 66  ? 115.110 -14.164 6.431   1.00 0.00 ? 66  ILE A N    4  
ATOM 7605  C CA   . ILE A 1 66  ? 115.414 -13.004 5.599   1.00 0.00 ? 66  ILE A CA   4  
ATOM 7606  C C    . ILE A 1 66  ? 114.248 -12.731 4.630   1.00 0.00 ? 66  ILE A C    4  
ATOM 7607  O O    . ILE A 1 66  ? 113.909 -11.588 4.349   1.00 0.00 ? 66  ILE A O    4  
ATOM 7608  C CB   . ILE A 1 66  ? 116.768 -13.184 4.836   1.00 0.00 ? 66  ILE A CB   4  
ATOM 7609  C CG1  . ILE A 1 66  ? 117.902 -13.436 5.852   1.00 0.00 ? 66  ILE A CG1  4  
ATOM 7610  C CG2  . ILE A 1 66  ? 117.081 -11.958 3.970   1.00 0.00 ? 66  ILE A CG2  4  
ATOM 7611  C CD1  . ILE A 1 66  ? 119.271 -13.670 5.238   1.00 0.00 ? 66  ILE A CD1  4  
ATOM 7612  H H    . ILE A 1 66  ? 115.654 -14.979 6.343   1.00 0.00 ? 66  ILE A H    4  
ATOM 7613  H HA   . ILE A 1 66  ? 115.492 -12.157 6.266   1.00 0.00 ? 66  ILE A HA   4  
ATOM 7614  H HB   . ILE A 1 66  ? 116.686 -14.044 4.188   1.00 0.00 ? 66  ILE A HB   4  
ATOM 7615  H HG12 . ILE A 1 66  ? 117.985 -12.581 6.506   1.00 0.00 ? 66  ILE A HG12 4  
ATOM 7616  H HG13 . ILE A 1 66  ? 117.647 -14.304 6.444   1.00 0.00 ? 66  ILE A HG13 4  
ATOM 7617  H HG21 . ILE A 1 66  ? 118.051 -12.081 3.512   1.00 0.00 ? 66  ILE A HG21 4  
ATOM 7618  H HG22 . ILE A 1 66  ? 117.076 -11.070 4.586   1.00 0.00 ? 66  ILE A HG22 4  
ATOM 7619  H HG23 . ILE A 1 66  ? 116.326 -11.876 3.200   1.00 0.00 ? 66  ILE A HG23 4  
ATOM 7620  H HD11 . ILE A 1 66  ? 119.222 -14.462 4.505   1.00 0.00 ? 66  ILE A HD11 4  
ATOM 7621  H HD12 . ILE A 1 66  ? 119.951 -13.966 6.024   1.00 0.00 ? 66  ILE A HD12 4  
ATOM 7622  H HD13 . ILE A 1 66  ? 119.635 -12.756 4.790   1.00 0.00 ? 66  ILE A HD13 4  
ATOM 7623  N N    . TYR A 1 67  ? 113.627 -13.788 4.157   1.00 0.00 ? 67  TYR A N    4  
ATOM 7624  C CA   . TYR A 1 67  ? 112.438 -13.681 3.341   1.00 0.00 ? 67  TYR A CA   4  
ATOM 7625  C C    . TYR A 1 67  ? 111.332 -12.963 4.123   1.00 0.00 ? 67  TYR A C    4  
ATOM 7626  O O    . TYR A 1 67  ? 110.934 -11.872 3.761   1.00 0.00 ? 67  TYR A O    4  
ATOM 7627  C CB   . TYR A 1 67  ? 111.958 -15.080 2.905   1.00 0.00 ? 67  TYR A CB   4  
ATOM 7628  C CG   . TYR A 1 67  ? 110.664 -15.059 2.136   1.00 0.00 ? 67  TYR A CG   4  
ATOM 7629  C CD1  . TYR A 1 67  ? 110.638 -14.734 0.794   1.00 0.00 ? 67  TYR A CD1  4  
ATOM 7630  C CD2  . TYR A 1 67  ? 109.460 -15.327 2.773   1.00 0.00 ? 67  TYR A CD2  4  
ATOM 7631  C CE1  . TYR A 1 67  ? 109.453 -14.672 0.105   1.00 0.00 ? 67  TYR A CE1  4  
ATOM 7632  C CE2  . TYR A 1 67  ? 108.272 -15.279 2.098   1.00 0.00 ? 67  TYR A CE2  4  
ATOM 7633  C CZ   . TYR A 1 67  ? 108.260 -14.954 0.769   1.00 0.00 ? 67  TYR A CZ   4  
ATOM 7634  O OH   . TYR A 1 67  ? 107.050 -14.881 0.112   1.00 0.00 ? 67  TYR A OH   4  
ATOM 7635  H H    . TYR A 1 67  ? 113.995 -14.681 4.352   1.00 0.00 ? 67  TYR A H    4  
ATOM 7636  H HA   . TYR A 1 67  ? 112.651 -13.097 2.450   1.00 0.00 ? 67  TYR A HA   4  
ATOM 7637  H HB2  . TYR A 1 67  ? 112.709 -15.531 2.274   1.00 0.00 ? 67  TYR A HB2  4  
ATOM 7638  H HB3  . TYR A 1 67  ? 111.818 -15.692 3.783   1.00 0.00 ? 67  TYR A HB3  4  
ATOM 7639  H HD1  . TYR A 1 67  ? 111.566 -14.531 0.272   1.00 0.00 ? 67  TYR A HD1  4  
ATOM 7640  H HD2  . TYR A 1 67  ? 109.467 -15.583 3.822   1.00 0.00 ? 67  TYR A HD2  4  
ATOM 7641  H HE1  . TYR A 1 67  ? 109.499 -14.395 -0.939  1.00 0.00 ? 67  TYR A HE1  4  
ATOM 7642  H HE2  . TYR A 1 67  ? 107.349 -15.499 2.613   1.00 0.00 ? 67  TYR A HE2  4  
ATOM 7643  H HH   . TYR A 1 67  ? 106.988 -15.541 -0.594  1.00 0.00 ? 67  TYR A HH   4  
ATOM 7644  N N    . GLU A 1 68  ? 110.907 -13.542 5.232   1.00 0.00 ? 68  GLU A N    4  
ATOM 7645  C CA   . GLU A 1 68  ? 109.776 -13.018 5.995   1.00 0.00 ? 68  GLU A CA   4  
ATOM 7646  C C    . GLU A 1 68  ? 110.036 -11.639 6.624   1.00 0.00 ? 68  GLU A C    4  
ATOM 7647  O O    . GLU A 1 68  ? 109.095 -10.892 6.896   1.00 0.00 ? 68  GLU A O    4  
ATOM 7648  C CB   . GLU A 1 68  ? 109.290 -14.021 7.042   1.00 0.00 ? 68  GLU A CB   4  
ATOM 7649  C CG   . GLU A 1 68  ? 108.734 -15.314 6.454   1.00 0.00 ? 68  GLU A CG   4  
ATOM 7650  C CD   . GLU A 1 68  ? 108.132 -16.221 7.501   1.00 0.00 ? 68  GLU A CD   4  
ATOM 7651  O OE1  . GLU A 1 68  ? 108.866 -17.005 8.127   1.00 0.00 ? 68  GLU A OE1  4  
ATOM 7652  O OE2  . GLU A 1 68  ? 106.903 -16.165 7.729   1.00 0.00 ? 68  GLU A OE2  4  
ATOM 7653  H H    . GLU A 1 68  ? 111.362 -14.350 5.566   1.00 0.00 ? 68  GLU A H    4  
ATOM 7654  H HA   . GLU A 1 68  ? 108.981 -12.884 5.275   1.00 0.00 ? 68  GLU A HA   4  
ATOM 7655  H HB2  . GLU A 1 68  ? 110.115 -14.272 7.692   1.00 0.00 ? 68  GLU A HB2  4  
ATOM 7656  H HB3  . GLU A 1 68  ? 108.512 -13.556 7.631   1.00 0.00 ? 68  GLU A HB3  4  
ATOM 7657  H HG2  . GLU A 1 68  ? 107.966 -15.064 5.738   1.00 0.00 ? 68  GLU A HG2  4  
ATOM 7658  H HG3  . GLU A 1 68  ? 109.531 -15.843 5.950   1.00 0.00 ? 68  GLU A HG3  4  
ATOM 7659  N N    . LYS A 1 69  ? 111.279 -11.302 6.851   1.00 0.00 ? 69  LYS A N    4  
ATOM 7660  C CA   . LYS A 1 69  ? 111.608 -10.006 7.412   1.00 0.00 ? 69  LYS A CA   4  
ATOM 7661  C C    . LYS A 1 69  ? 111.813 -8.937  6.326   1.00 0.00 ? 69  LYS A C    4  
ATOM 7662  O O    . LYS A 1 69  ? 111.584 -7.735  6.564   1.00 0.00 ? 69  LYS A O    4  
ATOM 7663  C CB   . LYS A 1 69  ? 112.854 -10.112 8.315   1.00 0.00 ? 69  LYS A CB   4  
ATOM 7664  C CG   . LYS A 1 69  ? 113.362 -8.775  8.848   1.00 0.00 ? 69  LYS A CG   4  
ATOM 7665  C CD   . LYS A 1 69  ? 114.566 -8.930  9.759   1.00 0.00 ? 69  LYS A CD   4  
ATOM 7666  C CE   . LYS A 1 69  ? 114.216 -9.637  11.052  1.00 0.00 ? 69  LYS A CE   4  
ATOM 7667  N NZ   . LYS A 1 69  ? 115.401 -9.796  11.912  1.00 0.00 ? 69  LYS A NZ   4  
ATOM 7668  H H    . LYS A 1 69  ? 111.998 -11.949 6.672   1.00 0.00 ? 69  LYS A H    4  
ATOM 7669  H HA   . LYS A 1 69  ? 110.772 -9.704  8.028   1.00 0.00 ? 69  LYS A HA   4  
ATOM 7670  H HB2  . LYS A 1 69  ? 112.616 -10.737 9.162   1.00 0.00 ? 69  LYS A HB2  4  
ATOM 7671  H HB3  . LYS A 1 69  ? 113.650 -10.575 7.751   1.00 0.00 ? 69  LYS A HB3  4  
ATOM 7672  H HG2  . LYS A 1 69  ? 113.662 -8.177  7.999   1.00 0.00 ? 69  LYS A HG2  4  
ATOM 7673  H HG3  . LYS A 1 69  ? 112.565 -8.278  9.381   1.00 0.00 ? 69  LYS A HG3  4  
ATOM 7674  H HD2  . LYS A 1 69  ? 115.322 -9.504  9.245   1.00 0.00 ? 69  LYS A HD2  4  
ATOM 7675  H HD3  . LYS A 1 69  ? 114.956 -7.949  9.989   1.00 0.00 ? 69  LYS A HD3  4  
ATOM 7676  H HE2  . LYS A 1 69  ? 113.473 -9.056  11.578  1.00 0.00 ? 69  LYS A HE2  4  
ATOM 7677  H HE3  . LYS A 1 69  ? 113.813 -10.613 10.820  1.00 0.00 ? 69  LYS A HE3  4  
ATOM 7678  H HZ1  . LYS A 1 69  ? 115.842 -8.877  12.136  1.00 0.00 ? 69  LYS A HZ1  4  
ATOM 7679  H HZ2  . LYS A 1 69  ? 116.113 -10.364 11.401  1.00 0.00 ? 69  LYS A HZ2  4  
ATOM 7680  H HZ3  . LYS A 1 69  ? 115.171 -10.290 12.800  1.00 0.00 ? 69  LYS A HZ3  4  
ATOM 7681  N N    . PHE A 1 70  ? 112.155 -9.360  5.131   1.00 0.00 ? 70  PHE A N    4  
ATOM 7682  C CA   . PHE A 1 70  ? 112.573 -8.421  4.112   1.00 0.00 ? 70  PHE A CA   4  
ATOM 7683  C C    . PHE A 1 70  ? 111.819 -8.618  2.806   1.00 0.00 ? 70  PHE A C    4  
ATOM 7684  O O    . PHE A 1 70  ? 111.130 -7.732  2.334   1.00 0.00 ? 70  PHE A O    4  
ATOM 7685  C CB   . PHE A 1 70  ? 114.086 -8.562  3.841   1.00 0.00 ? 70  PHE A CB   4  
ATOM 7686  C CG   . PHE A 1 70  ? 115.016 -8.189  4.972   1.00 0.00 ? 70  PHE A CG   4  
ATOM 7687  C CD1  . PHE A 1 70  ? 115.295 -6.862  5.248   1.00 0.00 ? 70  PHE A CD1  4  
ATOM 7688  C CD2  . PHE A 1 70  ? 115.633 -9.167  5.735   1.00 0.00 ? 70  PHE A CD2  4  
ATOM 7689  C CE1  . PHE A 1 70  ? 116.166 -6.520  6.265   1.00 0.00 ? 70  PHE A CE1  4  
ATOM 7690  C CE2  . PHE A 1 70  ? 116.508 -8.833  6.747   1.00 0.00 ? 70  PHE A CE2  4  
ATOM 7691  C CZ   . PHE A 1 70  ? 116.774 -7.505  7.013   1.00 0.00 ? 70  PHE A CZ   4  
ATOM 7692  H H    . PHE A 1 70  ? 112.071 -10.310 4.892   1.00 0.00 ? 70  PHE A H    4  
ATOM 7693  H HA   . PHE A 1 70  ? 112.396 -7.421  4.478   1.00 0.00 ? 70  PHE A HA   4  
ATOM 7694  H HB2  . PHE A 1 70  ? 114.294 -9.592  3.596   1.00 0.00 ? 70  PHE A HB2  4  
ATOM 7695  H HB3  . PHE A 1 70  ? 114.339 -7.951  2.987   1.00 0.00 ? 70  PHE A HB3  4  
ATOM 7696  H HD1  . PHE A 1 70  ? 114.821 -6.089  4.663   1.00 0.00 ? 70  PHE A HD1  4  
ATOM 7697  H HD2  . PHE A 1 70  ? 115.423 -10.206 5.529   1.00 0.00 ? 70  PHE A HD2  4  
ATOM 7698  H HE1  . PHE A 1 70  ? 116.372 -5.480  6.472   1.00 0.00 ? 70  PHE A HE1  4  
ATOM 7699  H HE2  . PHE A 1 70  ? 116.980 -9.608  7.333   1.00 0.00 ? 70  PHE A HE2  4  
ATOM 7700  H HZ   . PHE A 1 70  ? 117.459 -7.239  7.805   1.00 0.00 ? 70  PHE A HZ   4  
ATOM 7701  N N    . ILE A 1 71  ? 111.959 -9.784  2.241   1.00 0.00 ? 71  ILE A N    4  
ATOM 7702  C CA   . ILE A 1 71  ? 111.392 -10.116 0.929   1.00 0.00 ? 71  ILE A CA   4  
ATOM 7703  C C    . ILE A 1 71  ? 109.850 -10.170 0.975   1.00 0.00 ? 71  ILE A C    4  
ATOM 7704  O O    . ILE A 1 71  ? 109.164 -10.023 -0.048  1.00 0.00 ? 71  ILE A O    4  
ATOM 7705  C CB   . ILE A 1 71  ? 111.993 -11.463 0.412   1.00 0.00 ? 71  ILE A CB   4  
ATOM 7706  C CG1  . ILE A 1 71  ? 113.521 -11.390 0.405   1.00 0.00 ? 71  ILE A CG1  4  
ATOM 7707  C CG2  . ILE A 1 71  ? 111.469 -11.871 -0.971  1.00 0.00 ? 71  ILE A CG2  4  
ATOM 7708  C CD1  . ILE A 1 71  ? 114.076 -10.266 -0.434  1.00 0.00 ? 71  ILE A CD1  4  
ATOM 7709  H H    . ILE A 1 71  ? 112.471 -10.468 2.721   1.00 0.00 ? 71  ILE A H    4  
ATOM 7710  H HA   . ILE A 1 71  ? 111.717 -9.318  0.275   1.00 0.00 ? 71  ILE A HA   4  
ATOM 7711  H HB   . ILE A 1 71  ? 111.702 -12.237 1.107   1.00 0.00 ? 71  ILE A HB   4  
ATOM 7712  H HG12 . ILE A 1 71  ? 113.870 -11.246 1.418   1.00 0.00 ? 71  ILE A HG12 4  
ATOM 7713  H HG13 . ILE A 1 71  ? 113.918 -12.320 0.026   1.00 0.00 ? 71  ILE A HG13 4  
ATOM 7714  H HG21 . ILE A 1 71  ? 112.215 -12.531 -1.395  1.00 0.00 ? 71  ILE A HG21 4  
ATOM 7715  H HG22 . ILE A 1 71  ? 111.343 -11.015 -1.618  1.00 0.00 ? 71  ILE A HG22 4  
ATOM 7716  H HG23 . ILE A 1 71  ? 110.552 -12.446 -0.862  1.00 0.00 ? 71  ILE A HG23 4  
ATOM 7717  H HD11 . ILE A 1 71  ? 113.709 -9.322  -0.057  1.00 0.00 ? 71  ILE A HD11 4  
ATOM 7718  H HD12 . ILE A 1 71  ? 113.760 -10.391 -1.460  1.00 0.00 ? 71  ILE A HD12 4  
ATOM 7719  H HD13 . ILE A 1 71  ? 115.155 -10.278 -0.385  1.00 0.00 ? 71  ILE A HD13 4  
ATOM 7720  N N    . GLN A 1 72  ? 109.326 -10.375 2.159   1.00 0.00 ? 72  GLN A N    4  
ATOM 7721  C CA   . GLN A 1 72  ? 107.893 -10.385 2.383   1.00 0.00 ? 72  GLN A CA   4  
ATOM 7722  C C    . GLN A 1 72  ? 107.384 -8.941  2.285   1.00 0.00 ? 72  GLN A C    4  
ATOM 7723  O O    . GLN A 1 72  ? 108.122 -8.015  2.564   1.00 0.00 ? 72  GLN A O    4  
ATOM 7724  C CB   . GLN A 1 72  ? 107.608 -10.929 3.791   1.00 0.00 ? 72  GLN A CB   4  
ATOM 7725  C CG   . GLN A 1 72  ? 106.135 -11.102 4.123   1.00 0.00 ? 72  GLN A CG   4  
ATOM 7726  C CD   . GLN A 1 72  ? 105.510 -12.255 3.388   1.00 0.00 ? 72  GLN A CD   4  
ATOM 7727  O OE1  . GLN A 1 72  ? 105.008 -12.106 2.283   1.00 0.00 ? 72  GLN A OE1  4  
ATOM 7728  N NE2  . GLN A 1 72  ? 105.503 -13.391 4.005   1.00 0.00 ? 72  GLN A NE2  4  
ATOM 7729  H H    . GLN A 1 72  ? 109.950 -10.515 2.910   1.00 0.00 ? 72  GLN A H    4  
ATOM 7730  H HA   . GLN A 1 72  ? 107.412 -11.010 1.645   1.00 0.00 ? 72  GLN A HA   4  
ATOM 7731  H HB2  . GLN A 1 72  ? 108.078 -11.898 3.887   1.00 0.00 ? 72  GLN A HB2  4  
ATOM 7732  H HB3  . GLN A 1 72  ? 108.037 -10.245 4.510   1.00 0.00 ? 72  GLN A HB3  4  
ATOM 7733  H HG2  . GLN A 1 72  ? 106.031 -11.268 5.184   1.00 0.00 ? 72  GLN A HG2  4  
ATOM 7734  H HG3  . GLN A 1 72  ? 105.614 -10.195 3.853   1.00 0.00 ? 72  GLN A HG3  4  
ATOM 7735  H HE21 . GLN A 1 72  ? 105.895 -13.425 4.912   1.00 0.00 ? 72  GLN A HE21 4  
ATOM 7736  H HE22 . GLN A 1 72  ? 105.118 -14.178 3.551   1.00 0.00 ? 72  GLN A HE22 4  
ATOM 7737  N N    . THR A 1 73  ? 106.163 -8.746  1.874   1.00 0.00 ? 73  THR A N    4  
ATOM 7738  C CA   . THR A 1 73  ? 105.613 -7.409  1.822   1.00 0.00 ? 73  THR A CA   4  
ATOM 7739  C C    . THR A 1 73  ? 104.941 -7.088  3.152   1.00 0.00 ? 73  THR A C    4  
ATOM 7740  O O    . THR A 1 73  ? 105.119 -6.016  3.734   1.00 0.00 ? 73  THR A O    4  
ATOM 7741  C CB   . THR A 1 73  ? 104.651 -7.284  0.642   1.00 0.00 ? 73  THR A CB   4  
ATOM 7742  O OG1  . THR A 1 73  ? 105.388 -7.571  -0.552  1.00 0.00 ? 73  THR A OG1  4  
ATOM 7743  C CG2  . THR A 1 73  ? 104.063 -5.896  0.557   1.00 0.00 ? 73  THR A CG2  4  
ATOM 7744  H H    . THR A 1 73  ? 105.601 -9.500  1.594   1.00 0.00 ? 73  THR A H    4  
ATOM 7745  H HA   . THR A 1 73  ? 106.440 -6.727  1.685   1.00 0.00 ? 73  THR A HA   4  
ATOM 7746  H HB   . THR A 1 73  ? 103.862 -8.014  0.758   1.00 0.00 ? 73  THR A HB   4  
ATOM 7747  H HG1  . THR A 1 73  ? 106.262 -7.174  -0.416  1.00 0.00 ? 73  THR A HG1  4  
ATOM 7748  H HG21 . THR A 1 73  ? 103.386 -5.834  -0.283  1.00 0.00 ? 73  THR A HG21 4  
ATOM 7749  H HG22 . THR A 1 73  ? 104.856 -5.170  0.458   1.00 0.00 ? 73  THR A HG22 4  
ATOM 7750  H HG23 . THR A 1 73  ? 103.519 -5.726  1.474   1.00 0.00 ? 73  THR A HG23 4  
ATOM 7751  N N    . ASP A 1 74  ? 104.254 -8.071  3.674   1.00 0.00 ? 74  ASP A N    4  
ATOM 7752  C CA   . ASP A 1 74  ? 103.623 -8.005  5.000   1.00 0.00 ? 74  ASP A CA   4  
ATOM 7753  C C    . ASP A 1 74  ? 104.702 -8.261  6.096   1.00 0.00 ? 74  ASP A C    4  
ATOM 7754  O O    . ASP A 1 74  ? 104.424 -8.728  7.188   1.00 0.00 ? 74  ASP A O    4  
ATOM 7755  C CB   . ASP A 1 74  ? 102.505 -9.068  5.055   1.00 0.00 ? 74  ASP A CB   4  
ATOM 7756  C CG   . ASP A 1 74  ? 101.594 -8.963  6.266   1.00 0.00 ? 74  ASP A CG   4  
ATOM 7757  O OD1  . ASP A 1 74  ? 100.751 -8.044  6.307   1.00 0.00 ? 74  ASP A OD1  4  
ATOM 7758  O OD2  . ASP A 1 74  ? 101.681 -9.814  7.181   1.00 0.00 ? 74  ASP A OD2  4  
ATOM 7759  H H    . ASP A 1 74  ? 104.124 -8.867  3.112   1.00 0.00 ? 74  ASP A H    4  
ATOM 7760  H HA   . ASP A 1 74  ? 103.199 -7.020  5.132   1.00 0.00 ? 74  ASP A HA   4  
ATOM 7761  H HB2  . ASP A 1 74  ? 101.892 -8.973  4.173   1.00 0.00 ? 74  ASP A HB2  4  
ATOM 7762  H HB3  . ASP A 1 74  ? 102.961 -10.048 5.055   1.00 0.00 ? 74  ASP A HB3  4  
ATOM 7763  N N    . ALA A 1 75  ? 105.927 -7.885  5.777   1.00 0.00 ? 75  ALA A N    4  
ATOM 7764  C CA   . ALA A 1 75  ? 107.089 -8.062  6.623   1.00 0.00 ? 75  ALA A CA   4  
ATOM 7765  C C    . ALA A 1 75  ? 107.125 -6.992  7.704   1.00 0.00 ? 75  ALA A C    4  
ATOM 7766  O O    . ALA A 1 75  ? 106.402 -5.994  7.610   1.00 0.00 ? 75  ALA A O    4  
ATOM 7767  C CB   . ALA A 1 75  ? 108.342 -7.946  5.771   1.00 0.00 ? 75  ALA A CB   4  
ATOM 7768  H H    . ALA A 1 75  ? 106.040 -7.422  4.921   1.00 0.00 ? 75  ALA A H    4  
ATOM 7769  H HA   . ALA A 1 75  ? 107.070 -9.046  7.067   1.00 0.00 ? 75  ALA A HA   4  
ATOM 7770  H HB1  . ALA A 1 75  ? 108.360 -8.729  5.028   1.00 0.00 ? 75  ALA A HB1  4  
ATOM 7771  H HB2  . ALA A 1 75  ? 109.210 -8.015  6.411   1.00 0.00 ? 75  ALA A HB2  4  
ATOM 7772  H HB3  . ALA A 1 75  ? 108.362 -6.983  5.281   1.00 0.00 ? 75  ALA A HB3  4  
ATOM 7773  N N    . PRO A 1 76  ? 107.953 -7.180  8.760   1.00 0.00 ? 76  PRO A N    4  
ATOM 7774  C CA   . PRO A 1 76  ? 108.134 -6.175  9.817   1.00 0.00 ? 76  PRO A CA   4  
ATOM 7775  C C    . PRO A 1 76  ? 108.755 -4.867  9.293   1.00 0.00 ? 76  PRO A C    4  
ATOM 7776  O O    . PRO A 1 76  ? 108.657 -3.821  9.945   1.00 0.00 ? 76  PRO A O    4  
ATOM 7777  C CB   . PRO A 1 76  ? 109.088 -6.852  10.812  1.00 0.00 ? 76  PRO A CB   4  
ATOM 7778  C CG   . PRO A 1 76  ? 109.736 -7.948  10.047  1.00 0.00 ? 76  PRO A CG   4  
ATOM 7779  C CD   . PRO A 1 76  ? 108.715 -8.415  9.064   1.00 0.00 ? 76  PRO A CD   4  
ATOM 7780  H HA   . PRO A 1 76  ? 107.198 -5.950  10.304  1.00 0.00 ? 76  PRO A HA   4  
ATOM 7781  H HB2  . PRO A 1 76  ? 109.815 -6.133  11.159  1.00 0.00 ? 76  PRO A HB2  4  
ATOM 7782  H HB3  . PRO A 1 76  ? 108.525 -7.235  11.651  1.00 0.00 ? 76  PRO A HB3  4  
ATOM 7783  H HG2  . PRO A 1 76  ? 110.608 -7.571  9.533   1.00 0.00 ? 76  PRO A HG2  4  
ATOM 7784  H HG3  . PRO A 1 76  ? 110.009 -8.752  10.715  1.00 0.00 ? 76  PRO A HG3  4  
ATOM 7785  H HD2  . PRO A 1 76  ? 109.195 -8.803  8.178   1.00 0.00 ? 76  PRO A HD2  4  
ATOM 7786  H HD3  . PRO A 1 76  ? 108.073 -9.162  9.507   1.00 0.00 ? 76  PRO A HD3  4  
ATOM 7787  N N    . LYS A 1 77  ? 109.389 -4.928  8.124   1.00 0.00 ? 77  LYS A N    4  
ATOM 7788  C CA   . LYS A 1 77  ? 109.979 -3.736  7.519   1.00 0.00 ? 77  LYS A CA   4  
ATOM 7789  C C    . LYS A 1 77  ? 109.947 -3.800  5.998   1.00 0.00 ? 77  LYS A C    4  
ATOM 7790  O O    . LYS A 1 77  ? 109.780 -2.782  5.355   1.00 0.00 ? 77  LYS A O    4  
ATOM 7791  C CB   . LYS A 1 77  ? 111.420 -3.478  8.000   1.00 0.00 ? 77  LYS A CB   4  
ATOM 7792  C CG   . LYS A 1 77  ? 112.390 -4.618  7.742   1.00 0.00 ? 77  LYS A CG   4  
ATOM 7793  C CD   . LYS A 1 77  ? 113.854 -4.213  7.928   1.00 0.00 ? 77  LYS A CD   4  
ATOM 7794  C CE   . LYS A 1 77  ? 114.388 -3.315  6.785   1.00 0.00 ? 77  LYS A CE   4  
ATOM 7795  N NZ   . LYS A 1 77  ? 113.891 -1.912  6.809   1.00 0.00 ? 77  LYS A NZ   4  
ATOM 7796  H H    . LYS A 1 77  ? 109.423 -5.795  7.665   1.00 0.00 ? 77  LYS A H    4  
ATOM 7797  H HA   . LYS A 1 77  ? 109.364 -2.902  7.823   1.00 0.00 ? 77  LYS A HA   4  
ATOM 7798  H HB2  . LYS A 1 77  ? 111.800 -2.599  7.499   1.00 0.00 ? 77  LYS A HB2  4  
ATOM 7799  H HB3  . LYS A 1 77  ? 111.397 -3.289  9.063   1.00 0.00 ? 77  LYS A HB3  4  
ATOM 7800  H HG2  . LYS A 1 77  ? 112.166 -5.424  8.425   1.00 0.00 ? 77  LYS A HG2  4  
ATOM 7801  H HG3  . LYS A 1 77  ? 112.247 -4.962  6.728   1.00 0.00 ? 77  LYS A HG3  4  
ATOM 7802  H HD2  . LYS A 1 77  ? 113.948 -3.674  8.859   1.00 0.00 ? 77  LYS A HD2  4  
ATOM 7803  H HD3  . LYS A 1 77  ? 114.454 -5.109  7.977   1.00 0.00 ? 77  LYS A HD3  4  
ATOM 7804  H HE2  . LYS A 1 77  ? 115.464 -3.288  6.852   1.00 0.00 ? 77  LYS A HE2  4  
ATOM 7805  H HE3  . LYS A 1 77  ? 114.111 -3.770  5.846   1.00 0.00 ? 77  LYS A HE3  4  
ATOM 7806  H HZ1  . LYS A 1 77  ? 114.264 -1.407  5.975   1.00 0.00 ? 77  LYS A HZ1  4  
ATOM 7807  H HZ2  . LYS A 1 77  ? 114.268 -1.399  7.637   1.00 0.00 ? 77  LYS A HZ2  4  
ATOM 7808  H HZ3  . LYS A 1 77  ? 112.854 -1.807  6.797   1.00 0.00 ? 77  LYS A HZ3  4  
ATOM 7809  N N    . GLU A 1 78  ? 110.167 -5.005  5.457   1.00 0.00 ? 78  GLU A N    4  
ATOM 7810  C CA   . GLU A 1 78  ? 110.169 -5.321  4.010   1.00 0.00 ? 78  GLU A CA   4  
ATOM 7811  C C    . GLU A 1 78  ? 111.295 -4.600  3.243   1.00 0.00 ? 78  GLU A C    4  
ATOM 7812  O O    . GLU A 1 78  ? 112.097 -3.851  3.830   1.00 0.00 ? 78  GLU A O    4  
ATOM 7813  C CB   . GLU A 1 78  ? 108.789 -5.115  3.311   1.00 0.00 ? 78  GLU A CB   4  
ATOM 7814  C CG   . GLU A 1 78  ? 108.442 -3.700  2.877   1.00 0.00 ? 78  GLU A CG   4  
ATOM 7815  C CD   . GLU A 1 78  ? 107.110 -3.630  2.197   1.00 0.00 ? 78  GLU A CD   4  
ATOM 7816  O OE1  . GLU A 1 78  ? 106.953 -4.227  1.118   1.00 0.00 ? 78  GLU A OE1  4  
ATOM 7817  O OE2  . GLU A 1 78  ? 106.176 -2.980  2.745   1.00 0.00 ? 78  GLU A OE2  4  
ATOM 7818  H H    . GLU A 1 78  ? 110.394 -5.748  6.052   1.00 0.00 ? 78  GLU A H    4  
ATOM 7819  H HA   . GLU A 1 78  ? 110.409 -6.376  3.980   1.00 0.00 ? 78  GLU A HA   4  
ATOM 7820  H HB2  . GLU A 1 78  ? 108.760 -5.736  2.428   1.00 0.00 ? 78  GLU A HB2  4  
ATOM 7821  H HB3  . GLU A 1 78  ? 108.019 -5.461  3.986   1.00 0.00 ? 78  GLU A HB3  4  
ATOM 7822  H HG2  . GLU A 1 78  ? 108.420 -3.061  3.748   1.00 0.00 ? 78  GLU A HG2  4  
ATOM 7823  H HG3  . GLU A 1 78  ? 109.202 -3.350  2.195   1.00 0.00 ? 78  GLU A HG3  4  
ATOM 7824  N N    . VAL A 1 79  ? 111.378 -4.872  1.957   1.00 0.00 ? 79  VAL A N    4  
ATOM 7825  C CA   . VAL A 1 79  ? 112.345 -4.265  1.064   1.00 0.00 ? 79  VAL A CA   4  
ATOM 7826  C C    . VAL A 1 79  ? 111.591 -3.746  -0.151  1.00 0.00 ? 79  VAL A C    4  
ATOM 7827  O O    . VAL A 1 79  ? 110.674 -4.413  -0.640  1.00 0.00 ? 79  VAL A O    4  
ATOM 7828  C CB   . VAL A 1 79  ? 113.397 -5.318  0.563   1.00 0.00 ? 79  VAL A CB   4  
ATOM 7829  C CG1  . VAL A 1 79  ? 114.479 -4.686  -0.281  1.00 0.00 ? 79  VAL A CG1  4  
ATOM 7830  C CG2  . VAL A 1 79  ? 114.026 -6.062  1.701   1.00 0.00 ? 79  VAL A CG2  4  
ATOM 7831  H H    . VAL A 1 79  ? 110.751 -5.523  1.578   1.00 0.00 ? 79  VAL A H    4  
ATOM 7832  H HA   . VAL A 1 79  ? 112.853 -3.459  1.572   1.00 0.00 ? 79  VAL A HA   4  
ATOM 7833  H HB   . VAL A 1 79  ? 112.876 -6.031  -0.057  1.00 0.00 ? 79  VAL A HB   4  
ATOM 7834  H HG11 . VAL A 1 79  ? 114.032 -4.222  -1.148  1.00 0.00 ? 79  VAL A HG11 4  
ATOM 7835  H HG12 . VAL A 1 79  ? 115.155 -5.471  -0.591  1.00 0.00 ? 79  VAL A HG12 4  
ATOM 7836  H HG13 . VAL A 1 79  ? 115.014 -3.954  0.304   1.00 0.00 ? 79  VAL A HG13 4  
ATOM 7837  H HG21 . VAL A 1 79  ? 114.553 -5.386  2.358   1.00 0.00 ? 79  VAL A HG21 4  
ATOM 7838  H HG22 . VAL A 1 79  ? 114.709 -6.814  1.322   1.00 0.00 ? 79  VAL A HG22 4  
ATOM 7839  H HG23 . VAL A 1 79  ? 113.248 -6.569  2.252   1.00 0.00 ? 79  VAL A HG23 4  
ATOM 7840  N N    . ASN A 1 80  ? 112.001 -2.601  -0.670  1.00 0.00 ? 80  ASN A N    4  
ATOM 7841  C CA   . ASN A 1 80  ? 111.390 -1.997  -1.881  1.00 0.00 ? 80  ASN A CA   4  
ATOM 7842  C C    . ASN A 1 80  ? 112.026 -2.606  -3.128  1.00 0.00 ? 80  ASN A C    4  
ATOM 7843  O O    . ASN A 1 80  ? 112.215 -1.943  -4.163  1.00 0.00 ? 80  ASN A O    4  
ATOM 7844  C CB   . ASN A 1 80  ? 111.592 -0.478  -1.884  1.00 0.00 ? 80  ASN A CB   4  
ATOM 7845  C CG   . ASN A 1 80  ? 110.864 0.223   -0.761  1.00 0.00 ? 80  ASN A CG   4  
ATOM 7846  O OD1  . ASN A 1 80  ? 109.707 0.614   -0.906  1.00 0.00 ? 80  ASN A OD1  4  
ATOM 7847  N ND2  . ASN A 1 80  ? 111.518 0.388   0.359   1.00 0.00 ? 80  ASN A ND2  4  
ATOM 7848  H H    . ASN A 1 80  ? 112.749 -2.124  -0.241  1.00 0.00 ? 80  ASN A H    4  
ATOM 7849  H HA   . ASN A 1 80  ? 110.334 -2.226  -1.872  1.00 0.00 ? 80  ASN A HA   4  
ATOM 7850  H HB2  . ASN A 1 80  ? 112.645 -0.263  -1.786  1.00 0.00 ? 80  ASN A HB2  4  
ATOM 7851  H HB3  . ASN A 1 80  ? 111.239 -0.078  -2.824  1.00 0.00 ? 80  ASN A HB3  4  
ATOM 7852  H HD21 . ASN A 1 80  ? 112.440 0.048   0.417   1.00 0.00 ? 80  ASN A HD21 4  
ATOM 7853  H HD22 . ASN A 1 80  ? 111.075 0.837   1.110   1.00 0.00 ? 80  ASN A HD22 4  
ATOM 7854  N N    . LEU A 1 81  ? 112.272 -3.883  -3.020  1.00 0.00 ? 81  LEU A N    4  
ATOM 7855  C CA   . LEU A 1 81  ? 112.938 -4.700  -3.996  1.00 0.00 ? 81  LEU A CA   4  
ATOM 7856  C C    . LEU A 1 81  ? 112.109 -4.829  -5.257  1.00 0.00 ? 81  LEU A C    4  
ATOM 7857  O O    . LEU A 1 81  ? 110.870 -4.802  -5.202  1.00 0.00 ? 81  LEU A O    4  
ATOM 7858  C CB   . LEU A 1 81  ? 113.139 -6.085  -3.371  1.00 0.00 ? 81  LEU A CB   4  
ATOM 7859  C CG   . LEU A 1 81  ? 113.851 -7.155  -4.175  1.00 0.00 ? 81  LEU A CG   4  
ATOM 7860  C CD1  . LEU A 1 81  ? 115.324 -6.861  -4.202  1.00 0.00 ? 81  LEU A CD1  4  
ATOM 7861  C CD2  . LEU A 1 81  ? 113.581 -8.531  -3.580  1.00 0.00 ? 81  LEU A CD2  4  
ATOM 7862  H H    . LEU A 1 81  ? 111.929 -4.300  -2.201  1.00 0.00 ? 81  LEU A H    4  
ATOM 7863  H HA   . LEU A 1 81  ? 113.911 -4.290  -4.217  1.00 0.00 ? 81  LEU A HA   4  
ATOM 7864  H HB2  . LEU A 1 81  ? 113.810 -5.899  -2.546  1.00 0.00 ? 81  LEU A HB2  4  
ATOM 7865  H HB3  . LEU A 1 81  ? 112.199 -6.470  -3.008  1.00 0.00 ? 81  LEU A HB3  4  
ATOM 7866  H HG   . LEU A 1 81  ? 113.514 -7.151  -5.202  1.00 0.00 ? 81  LEU A HG   4  
ATOM 7867  H HD11 . LEU A 1 81  ? 115.501 -5.921  -4.704  1.00 0.00 ? 81  LEU A HD11 4  
ATOM 7868  H HD12 . LEU A 1 81  ? 115.841 -7.661  -4.714  1.00 0.00 ? 81  LEU A HD12 4  
ATOM 7869  H HD13 . LEU A 1 81  ? 115.693 -6.801  -3.189  1.00 0.00 ? 81  LEU A HD13 4  
ATOM 7870  H HD21 . LEU A 1 81  ? 113.960 -8.570  -2.569  1.00 0.00 ? 81  LEU A HD21 4  
ATOM 7871  H HD22 . LEU A 1 81  ? 114.075 -9.287  -4.171  1.00 0.00 ? 81  LEU A HD22 4  
ATOM 7872  H HD23 . LEU A 1 81  ? 112.520 -8.741  -3.562  1.00 0.00 ? 81  LEU A HD23 4  
ATOM 7873  N N    . ASP A 1 82  ? 112.804 -4.916  -6.377  1.00 0.00 ? 82  ASP A N    4  
ATOM 7874  C CA   . ASP A 1 82  ? 112.218 -5.179  -7.697  1.00 0.00 ? 82  ASP A CA   4  
ATOM 7875  C C    . ASP A 1 82  ? 111.178 -6.290  -7.617  1.00 0.00 ? 82  ASP A C    4  
ATOM 7876  O O    . ASP A 1 82  ? 111.460 -7.385  -7.089  1.00 0.00 ? 82  ASP A O    4  
ATOM 7877  C CB   . ASP A 1 82  ? 113.327 -5.572  -8.673  1.00 0.00 ? 82  ASP A CB   4  
ATOM 7878  C CG   . ASP A 1 82  ? 112.811 -6.099  -9.986  1.00 0.00 ? 82  ASP A CG   4  
ATOM 7879  O OD1  . ASP A 1 82  ? 112.434 -5.300  -10.857 1.00 0.00 ? 82  ASP A OD1  4  
ATOM 7880  O OD2  . ASP A 1 82  ? 112.791 -7.333  -10.165 1.00 0.00 ? 82  ASP A OD2  4  
ATOM 7881  H H    . ASP A 1 82  ? 113.772 -4.750  -6.315  1.00 0.00 ? 82  ASP A H    4  
ATOM 7882  H HA   . ASP A 1 82  ? 111.748 -4.274  -8.049  1.00 0.00 ? 82  ASP A HA   4  
ATOM 7883  H HB2  . ASP A 1 82  ? 113.938 -4.704  -8.879  1.00 0.00 ? 82  ASP A HB2  4  
ATOM 7884  H HB3  . ASP A 1 82  ? 113.944 -6.332  -8.216  1.00 0.00 ? 82  ASP A HB3  4  
ATOM 7885  N N    . PHE A 1 83  ? 109.987 -6.003  -8.133  1.00 0.00 ? 83  PHE A N    4  
ATOM 7886  C CA   . PHE A 1 83  ? 108.845 -6.905  -8.031  1.00 0.00 ? 83  PHE A CA   4  
ATOM 7887  C C    . PHE A 1 83  ? 109.115 -8.271  -8.661  1.00 0.00 ? 83  PHE A C    4  
ATOM 7888  O O    . PHE A 1 83  ? 108.629 -9.285  -8.172  1.00 0.00 ? 83  PHE A O    4  
ATOM 7889  C CB   . PHE A 1 83  ? 107.553 -6.270  -8.605  1.00 0.00 ? 83  PHE A CB   4  
ATOM 7890  C CG   . PHE A 1 83  ? 107.515 -6.087  -10.106 1.00 0.00 ? 83  PHE A CG   4  
ATOM 7891  C CD1  . PHE A 1 83  ? 108.050 -4.961  -10.704 1.00 0.00 ? 83  PHE A CD1  4  
ATOM 7892  C CD2  . PHE A 1 83  ? 106.920 -7.048  -10.916 1.00 0.00 ? 83  PHE A CD2  4  
ATOM 7893  C CE1  . PHE A 1 83  ? 107.997 -4.797  -12.076 1.00 0.00 ? 83  PHE A CE1  4  
ATOM 7894  C CE2  . PHE A 1 83  ? 106.866 -6.890  -12.285 1.00 0.00 ? 83  PHE A CE2  4  
ATOM 7895  C CZ   . PHE A 1 83  ? 107.407 -5.762  -12.867 1.00 0.00 ? 83  PHE A CZ   4  
ATOM 7896  H H    . PHE A 1 83  ? 109.868 -5.140  -8.583  1.00 0.00 ? 83  PHE A H    4  
ATOM 7897  H HA   . PHE A 1 83  ? 108.693 -7.071  -6.974  1.00 0.00 ? 83  PHE A HA   4  
ATOM 7898  H HB2  . PHE A 1 83  ? 106.712 -6.892  -8.338  1.00 0.00 ? 83  PHE A HB2  4  
ATOM 7899  H HB3  . PHE A 1 83  ? 107.418 -5.300  -8.148  1.00 0.00 ? 83  PHE A HB3  4  
ATOM 7900  H HD1  . PHE A 1 83  ? 108.517 -4.206  -10.088 1.00 0.00 ? 83  PHE A HD1  4  
ATOM 7901  H HD2  . PHE A 1 83  ? 106.496 -7.933  -10.463 1.00 0.00 ? 83  PHE A HD2  4  
ATOM 7902  H HE1  . PHE A 1 83  ? 108.420 -3.913  -12.529 1.00 0.00 ? 83  PHE A HE1  4  
ATOM 7903  H HE2  . PHE A 1 83  ? 106.404 -7.647  -12.900 1.00 0.00 ? 83  PHE A HE2  4  
ATOM 7904  H HZ   . PHE A 1 83  ? 107.366 -5.634  -13.938 1.00 0.00 ? 83  PHE A HZ   4  
ATOM 7905  N N    . HIS A 1 84  ? 109.920 -8.307  -9.707  1.00 0.00 ? 84  HIS A N    4  
ATOM 7906  C CA   . HIS A 1 84  ? 110.210 -9.562  -10.365 1.00 0.00 ? 84  HIS A CA   4  
ATOM 7907  C C    . HIS A 1 84  ? 111.186 -10.367 -9.527  1.00 0.00 ? 84  HIS A C    4  
ATOM 7908  O O    . HIS A 1 84  ? 111.068 -11.577 -9.427  1.00 0.00 ? 84  HIS A O    4  
ATOM 7909  C CB   . HIS A 1 84  ? 110.747 -9.354  -11.796 1.00 0.00 ? 84  HIS A CB   4  
ATOM 7910  C CG   . HIS A 1 84  ? 111.054 -10.645 -12.514 1.00 0.00 ? 84  HIS A CG   4  
ATOM 7911  N ND1  . HIS A 1 84  ? 110.091 -11.417 -13.104 1.00 0.00 ? 84  HIS A ND1  4  
ATOM 7912  C CD2  . HIS A 1 84  ? 112.217 -11.316 -12.679 1.00 0.00 ? 84  HIS A CD2  4  
ATOM 7913  C CE1  . HIS A 1 84  ? 110.636 -12.506 -13.591 1.00 0.00 ? 84  HIS A CE1  4  
ATOM 7914  N NE2  . HIS A 1 84  ? 111.923 -12.470 -13.351 1.00 0.00 ? 84  HIS A NE2  4  
ATOM 7915  H H    . HIS A 1 84  ? 110.347 -7.481  -10.024 1.00 0.00 ? 84  HIS A H    4  
ATOM 7916  H HA   . HIS A 1 84  ? 109.282 -10.114 -10.413 1.00 0.00 ? 84  HIS A HA   4  
ATOM 7917  H HB2  . HIS A 1 84  ? 110.012 -8.816  -12.377 1.00 0.00 ? 84  HIS A HB2  4  
ATOM 7918  H HB3  . HIS A 1 84  ? 111.657 -8.773  -11.751 1.00 0.00 ? 84  HIS A HB3  4  
ATOM 7919  H HD1  . HIS A 1 84  ? 109.130 -11.180 -13.157 1.00 0.00 ? 84  HIS A HD1  4  
ATOM 7920  H HD2  . HIS A 1 84  ? 113.195 -10.998 -12.344 1.00 0.00 ? 84  HIS A HD2  4  
ATOM 7921  H HE1  . HIS A 1 84  ? 110.116 -13.312 -14.084 1.00 0.00 ? 84  HIS A HE1  4  
ATOM 7922  H HE2  . HIS A 1 84  ? 112.507 -13.269 -13.338 1.00 0.00 ? 84  HIS A HE2  4  
ATOM 7923  N N    . THR A 1 85  ? 112.130 -9.686  -8.938  1.00 0.00 ? 85  THR A N    4  
ATOM 7924  C CA   . THR A 1 85  ? 113.111 -10.305 -8.095  1.00 0.00 ? 85  THR A CA   4  
ATOM 7925  C C    . THR A 1 85  ? 112.448 -10.951 -6.884  1.00 0.00 ? 85  THR A C    4  
ATOM 7926  O O    . THR A 1 85  ? 112.661 -12.134 -6.627  1.00 0.00 ? 85  THR A O    4  
ATOM 7927  C CB   . THR A 1 85  ? 114.161 -9.278  -7.663  1.00 0.00 ? 85  THR A CB   4  
ATOM 7928  O OG1  . THR A 1 85  ? 114.740 -8.698  -8.849  1.00 0.00 ? 85  THR A OG1  4  
ATOM 7929  C CG2  . THR A 1 85  ? 115.254 -9.928  -6.817  1.00 0.00 ? 85  THR A CG2  4  
ATOM 7930  H H    . THR A 1 85  ? 112.178 -8.716  -9.095  1.00 0.00 ? 85  THR A H    4  
ATOM 7931  H HA   . THR A 1 85  ? 113.601 -11.077 -8.672  1.00 0.00 ? 85  THR A HA   4  
ATOM 7932  H HB   . THR A 1 85  ? 113.670 -8.503  -7.093  1.00 0.00 ? 85  THR A HB   4  
ATOM 7933  H HG1  . THR A 1 85  ? 114.041 -8.217  -9.325  1.00 0.00 ? 85  THR A HG1  4  
ATOM 7934  H HG21 . THR A 1 85  ? 116.012 -9.192  -6.590  1.00 0.00 ? 85  THR A HG21 4  
ATOM 7935  H HG22 . THR A 1 85  ? 115.707 -10.752 -7.347  1.00 0.00 ? 85  THR A HG22 4  
ATOM 7936  H HG23 . THR A 1 85  ? 114.849 -10.286 -5.880  1.00 0.00 ? 85  THR A HG23 4  
ATOM 7937  N N    . LYS A 1 86  ? 111.598 -10.190 -6.178  1.00 0.00 ? 86  LYS A N    4  
ATOM 7938  C CA   . LYS A 1 86  ? 110.898 -10.739 -5.018  1.00 0.00 ? 86  LYS A CA   4  
ATOM 7939  C C    . LYS A 1 86  ? 109.998 -11.898 -5.449  1.00 0.00 ? 86  LYS A C    4  
ATOM 7940  O O    . LYS A 1 86  ? 109.916 -12.900 -4.760  1.00 0.00 ? 86  LYS A O    4  
ATOM 7941  C CB   . LYS A 1 86  ? 110.109 -9.668  -4.208  1.00 0.00 ? 86  LYS A CB   4  
ATOM 7942  C CG   . LYS A 1 86  ? 108.932 -9.021  -4.930  1.00 0.00 ? 86  LYS A CG   4  
ATOM 7943  C CD   . LYS A 1 86  ? 108.136 -8.075  -4.021  1.00 0.00 ? 86  LYS A CD   4  
ATOM 7944  C CE   . LYS A 1 86  ? 108.925 -6.830  -3.619  1.00 0.00 ? 86  LYS A CE   4  
ATOM 7945  N NZ   . LYS A 1 86  ? 108.125 -5.911  -2.768  1.00 0.00 ? 86  LYS A NZ   4  
ATOM 7946  H H    . LYS A 1 86  ? 111.465 -9.254  -6.448  1.00 0.00 ? 86  LYS A H    4  
ATOM 7947  H HA   . LYS A 1 86  ? 111.667 -11.165 -4.390  1.00 0.00 ? 86  LYS A HA   4  
ATOM 7948  H HB2  . LYS A 1 86  ? 109.726 -10.128 -3.310  1.00 0.00 ? 86  LYS A HB2  4  
ATOM 7949  H HB3  . LYS A 1 86  ? 110.801 -8.888  -3.925  1.00 0.00 ? 86  LYS A HB3  4  
ATOM 7950  H HG2  . LYS A 1 86  ? 109.308 -8.457  -5.772  1.00 0.00 ? 86  LYS A HG2  4  
ATOM 7951  H HG3  . LYS A 1 86  ? 108.276 -9.801  -5.288  1.00 0.00 ? 86  LYS A HG3  4  
ATOM 7952  H HD2  . LYS A 1 86  ? 107.246 -7.760  -4.544  1.00 0.00 ? 86  LYS A HD2  4  
ATOM 7953  H HD3  . LYS A 1 86  ? 107.851 -8.614  -3.129  1.00 0.00 ? 86  LYS A HD3  4  
ATOM 7954  H HE2  . LYS A 1 86  ? 109.802 -7.139  -3.071  1.00 0.00 ? 86  LYS A HE2  4  
ATOM 7955  H HE3  . LYS A 1 86  ? 109.229 -6.309  -4.515  1.00 0.00 ? 86  LYS A HE3  4  
ATOM 7956  H HZ1  . LYS A 1 86  ? 108.550 -4.958  -2.735  1.00 0.00 ? 86  LYS A HZ1  4  
ATOM 7957  H HZ2  . LYS A 1 86  ? 108.065 -6.239  -1.779  1.00 0.00 ? 86  LYS A HZ2  4  
ATOM 7958  H HZ3  . LYS A 1 86  ? 107.147 -5.814  -3.122  1.00 0.00 ? 86  LYS A HZ3  4  
ATOM 7959  N N    . GLU A 1 87  ? 109.387 -11.764 -6.630  1.00 0.00 ? 87  GLU A N    4  
ATOM 7960  C CA   . GLU A 1 87  ? 108.551 -12.808 -7.222  1.00 0.00 ? 87  GLU A CA   4  
ATOM 7961  C C    . GLU A 1 87  ? 109.356 -14.105 -7.374  1.00 0.00 ? 87  GLU A C    4  
ATOM 7962  O O    . GLU A 1 87  ? 108.962 -15.154 -6.863  1.00 0.00 ? 87  GLU A O    4  
ATOM 7963  C CB   . GLU A 1 87  ? 108.039 -12.346 -8.591  1.00 0.00 ? 87  GLU A CB   4  
ATOM 7964  C CG   . GLU A 1 87  ? 107.235 -13.379 -9.345  1.00 0.00 ? 87  GLU A CG   4  
ATOM 7965  C CD   . GLU A 1 87  ? 105.915 -13.703 -8.702  1.00 0.00 ? 87  GLU A CD   4  
ATOM 7966  O OE1  . GLU A 1 87  ? 105.853 -14.601 -7.861  1.00 0.00 ? 87  GLU A OE1  4  
ATOM 7967  O OE2  . GLU A 1 87  ? 104.895 -13.082 -9.052  1.00 0.00 ? 87  GLU A OE2  4  
ATOM 7968  H H    . GLU A 1 87  ? 109.497 -10.922 -7.123  1.00 0.00 ? 87  GLU A H    4  
ATOM 7969  H HA   . GLU A 1 87  ? 107.710 -12.981 -6.567  1.00 0.00 ? 87  GLU A HA   4  
ATOM 7970  H HB2  . GLU A 1 87  ? 107.415 -11.476 -8.451  1.00 0.00 ? 87  GLU A HB2  4  
ATOM 7971  H HB3  . GLU A 1 87  ? 108.889 -12.069 -9.197  1.00 0.00 ? 87  GLU A HB3  4  
ATOM 7972  H HG2  . GLU A 1 87  ? 107.068 -13.047 -10.357 1.00 0.00 ? 87  GLU A HG2  4  
ATOM 7973  H HG3  . GLU A 1 87  ? 107.837 -14.278 -9.344  1.00 0.00 ? 87  GLU A HG3  4  
ATOM 7974  N N    . VAL A 1 88  ? 110.504 -14.010 -8.023  1.00 0.00 ? 88  VAL A N    4  
ATOM 7975  C CA   . VAL A 1 88  ? 111.371 -15.160 -8.223  1.00 0.00 ? 88  VAL A CA   4  
ATOM 7976  C C    . VAL A 1 88  ? 111.778 -15.765 -6.880  1.00 0.00 ? 88  VAL A C    4  
ATOM 7977  O O    . VAL A 1 88  ? 111.768 -16.990 -6.715  1.00 0.00 ? 88  VAL A O    4  
ATOM 7978  C CB   . VAL A 1 88  ? 112.614 -14.809 -9.091  1.00 0.00 ? 88  VAL A CB   4  
ATOM 7979  C CG1  . VAL A 1 88  ? 113.567 -15.998 -9.215  1.00 0.00 ? 88  VAL A CG1  4  
ATOM 7980  C CG2  . VAL A 1 88  ? 112.159 -14.372 -10.472 1.00 0.00 ? 88  VAL A CG2  4  
ATOM 7981  H H    . VAL A 1 88  ? 110.773 -13.134 -8.381  1.00 0.00 ? 88  VAL A H    4  
ATOM 7982  H HA   . VAL A 1 88  ? 110.781 -15.901 -8.744  1.00 0.00 ? 88  VAL A HA   4  
ATOM 7983  H HB   . VAL A 1 88  ? 113.141 -13.985 -8.634  1.00 0.00 ? 88  VAL A HB   4  
ATOM 7984  H HG11 . VAL A 1 88  ? 113.902 -16.294 -8.231  1.00 0.00 ? 88  VAL A HG11 4  
ATOM 7985  H HG12 . VAL A 1 88  ? 114.420 -15.714 -9.813  1.00 0.00 ? 88  VAL A HG12 4  
ATOM 7986  H HG13 . VAL A 1 88  ? 113.053 -16.823 -9.686  1.00 0.00 ? 88  VAL A HG13 4  
ATOM 7987  H HG21 . VAL A 1 88  ? 113.015 -14.112 -11.078 1.00 0.00 ? 88  VAL A HG21 4  
ATOM 7988  H HG22 . VAL A 1 88  ? 111.508 -13.514 -10.386 1.00 0.00 ? 88  VAL A HG22 4  
ATOM 7989  H HG23 . VAL A 1 88  ? 111.614 -15.174 -10.949 1.00 0.00 ? 88  VAL A HG23 4  
ATOM 7990  N N    . ILE A 1 89  ? 112.063 -14.910 -5.900  1.00 0.00 ? 89  ILE A N    4  
ATOM 7991  C CA   . ILE A 1 89  ? 112.393 -15.373 -4.557  1.00 0.00 ? 89  ILE A CA   4  
ATOM 7992  C C    . ILE A 1 89  ? 111.219 -16.133 -3.966  1.00 0.00 ? 89  ILE A C    4  
ATOM 7993  O O    . ILE A 1 89  ? 111.399 -17.213 -3.471  1.00 0.00 ? 89  ILE A O    4  
ATOM 7994  C CB   . ILE A 1 89  ? 112.793 -14.226 -3.594  1.00 0.00 ? 89  ILE A CB   4  
ATOM 7995  C CG1  . ILE A 1 89  ? 113.973 -13.443 -4.161  1.00 0.00 ? 89  ILE A CG1  4  
ATOM 7996  C CG2  . ILE A 1 89  ? 113.136 -14.777 -2.192  1.00 0.00 ? 89  ILE A CG2  4  
ATOM 7997  C CD1  . ILE A 1 89  ? 114.359 -12.256 -3.326  1.00 0.00 ? 89  ILE A CD1  4  
ATOM 7998  H H    . ILE A 1 89  ? 112.061 -13.948 -6.103  1.00 0.00 ? 89  ILE A H    4  
ATOM 7999  H HA   . ILE A 1 89  ? 113.222 -16.059 -4.652  1.00 0.00 ? 89  ILE A HA   4  
ATOM 8000  H HB   . ILE A 1 89  ? 111.947 -13.563 -3.495  1.00 0.00 ? 89  ILE A HB   4  
ATOM 8001  H HG12 . ILE A 1 89  ? 114.831 -14.096 -4.227  1.00 0.00 ? 89  ILE A HG12 4  
ATOM 8002  H HG13 . ILE A 1 89  ? 113.720 -13.092 -5.151  1.00 0.00 ? 89  ILE A HG13 4  
ATOM 8003  H HG21 . ILE A 1 89  ? 112.259 -15.208 -1.732  1.00 0.00 ? 89  ILE A HG21 4  
ATOM 8004  H HG22 . ILE A 1 89  ? 113.493 -13.973 -1.565  1.00 0.00 ? 89  ILE A HG22 4  
ATOM 8005  H HG23 . ILE A 1 89  ? 113.905 -15.530 -2.281  1.00 0.00 ? 89  ILE A HG23 4  
ATOM 8006  H HD11 . ILE A 1 89  ? 114.839 -12.590 -2.419  1.00 0.00 ? 89  ILE A HD11 4  
ATOM 8007  H HD12 . ILE A 1 89  ? 113.447 -11.750 -3.036  1.00 0.00 ? 89  ILE A HD12 4  
ATOM 8008  H HD13 . ILE A 1 89  ? 115.004 -11.589 -3.879  1.00 0.00 ? 89  ILE A HD13 4  
ATOM 8009  N N    . THR A 1 90  ? 110.006 -15.602 -4.093  1.00 0.00 ? 90  THR A N    4  
ATOM 8010  C CA   . THR A 1 90  ? 108.829 -16.266 -3.532  1.00 0.00 ? 90  THR A CA   4  
ATOM 8011  C C    . THR A 1 90  ? 108.608 -17.656 -4.167  1.00 0.00 ? 90  THR A C    4  
ATOM 8012  O O    . THR A 1 90  ? 108.056 -18.559 -3.546  1.00 0.00 ? 90  THR A O    4  
ATOM 8013  C CB   . THR A 1 90  ? 107.525 -15.398 -3.635  1.00 0.00 ? 90  THR A CB   4  
ATOM 8014  O OG1  . THR A 1 90  ? 107.137 -15.182 -4.998  1.00 0.00 ? 90  THR A OG1  4  
ATOM 8015  C CG2  . THR A 1 90  ? 107.719 -14.045 -2.987  1.00 0.00 ? 90  THR A CG2  4  
ATOM 8016  H H    . THR A 1 90  ? 109.904 -14.734 -4.548  1.00 0.00 ? 90  THR A H    4  
ATOM 8017  H HA   . THR A 1 90  ? 109.048 -16.435 -2.489  1.00 0.00 ? 90  THR A HA   4  
ATOM 8018  H HB   . THR A 1 90  ? 106.727 -15.912 -3.120  1.00 0.00 ? 90  THR A HB   4  
ATOM 8019  H HG1  . THR A 1 90  ? 107.887 -15.249 -5.609  1.00 0.00 ? 90  THR A HG1  4  
ATOM 8020  H HG21 . THR A 1 90  ? 108.002 -14.152 -1.951  1.00 0.00 ? 90  THR A HG21 4  
ATOM 8021  H HG22 . THR A 1 90  ? 106.801 -13.482 -3.067  1.00 0.00 ? 90  THR A HG22 4  
ATOM 8022  H HG23 . THR A 1 90  ? 108.498 -13.521 -3.526  1.00 0.00 ? 90  THR A HG23 4  
ATOM 8023  N N    . ASN A 1 91  ? 109.109 -17.828 -5.377  1.00 0.00 ? 91  ASN A N    4  
ATOM 8024  C CA   . ASN A 1 91  ? 108.959 -19.076 -6.112  1.00 0.00 ? 91  ASN A CA   4  
ATOM 8025  C C    . ASN A 1 91  ? 110.131 -20.027 -5.843  1.00 0.00 ? 91  ASN A C    4  
ATOM 8026  O O    . ASN A 1 91  ? 110.029 -21.231 -6.095  1.00 0.00 ? 91  ASN A O    4  
ATOM 8027  C CB   . ASN A 1 91  ? 108.850 -18.801 -7.625  1.00 0.00 ? 91  ASN A CB   4  
ATOM 8028  C CG   . ASN A 1 91  ? 107.650 -17.940 -7.996  1.00 0.00 ? 91  ASN A CG   4  
ATOM 8029  O OD1  . ASN A 1 91  ? 106.593 -18.005 -7.360  1.00 0.00 ? 91  ASN A OD1  4  
ATOM 8030  N ND2  . ASN A 1 91  ? 107.799 -17.127 -9.007  1.00 0.00 ? 91  ASN A ND2  4  
ATOM 8031  H H    . ASN A 1 91  ? 109.585 -17.082 -5.803  1.00 0.00 ? 91  ASN A H    4  
ATOM 8032  H HA   . ASN A 1 91  ? 108.045 -19.545 -5.783  1.00 0.00 ? 91  ASN A HA   4  
ATOM 8033  H HB2  . ASN A 1 91  ? 109.742 -18.289 -7.955  1.00 0.00 ? 91  ASN A HB2  4  
ATOM 8034  H HB3  . ASN A 1 91  ? 108.771 -19.743 -8.146  1.00 0.00 ? 91  ASN A HB3  4  
ATOM 8035  H HD21 . ASN A 1 91  ? 108.663 -17.117 -9.482  1.00 0.00 ? 91  ASN A HD21 4  
ATOM 8036  H HD22 . ASN A 1 91  ? 107.063 -16.524 -9.241  1.00 0.00 ? 91  ASN A HD22 4  
ATOM 8037  N N    . SER A 1 92  ? 111.231 -19.500 -5.312  1.00 0.00 ? 92  SER A N    4  
ATOM 8038  C CA   . SER A 1 92  ? 112.429 -20.307 -5.078  1.00 0.00 ? 92  SER A CA   4  
ATOM 8039  C C    . SER A 1 92  ? 112.834 -20.366 -3.591  1.00 0.00 ? 92  SER A C    4  
ATOM 8040  O O    . SER A 1 92  ? 113.802 -21.030 -3.227  1.00 0.00 ? 92  SER A O    4  
ATOM 8041  C CB   . SER A 1 92  ? 113.585 -19.783 -5.945  1.00 0.00 ? 92  SER A CB   4  
ATOM 8042  O OG   . SER A 1 92  ? 113.777 -18.385 -5.755  1.00 0.00 ? 92  SER A OG   4  
ATOM 8043  H H    . SER A 1 92  ? 111.250 -18.545 -5.087  1.00 0.00 ? 92  SER A H    4  
ATOM 8044  H HA   . SER A 1 92  ? 112.198 -21.311 -5.400  1.00 0.00 ? 92  SER A HA   4  
ATOM 8045  H HB2  . SER A 1 92  ? 114.495 -20.298 -5.678  1.00 0.00 ? 92  SER A HB2  4  
ATOM 8046  H HB3  . SER A 1 92  ? 113.361 -19.967 -6.986  1.00 0.00 ? 92  SER A HB3  4  
ATOM 8047  H HG   . SER A 1 92  ? 113.054 -17.934 -6.219  1.00 0.00 ? 92  SER A HG   4  
ATOM 8048  N N    . ILE A 1 93  ? 112.075 -19.691 -2.743  1.00 0.00 ? 93  ILE A N    4  
ATOM 8049  C CA   . ILE A 1 93  ? 112.363 -19.621 -1.302  1.00 0.00 ? 93  ILE A CA   4  
ATOM 8050  C C    . ILE A 1 93  ? 111.899 -20.909 -0.624  1.00 0.00 ? 93  ILE A C    4  
ATOM 8051  O O    . ILE A 1 93  ? 112.350 -21.270 0.467   1.00 0.00 ? 93  ILE A O    4  
ATOM 8052  C CB   . ILE A 1 93  ? 111.666 -18.373 -0.651  1.00 0.00 ? 93  ILE A CB   4  
ATOM 8053  C CG1  . ILE A 1 93  ? 112.160 -18.140 0.781   1.00 0.00 ? 93  ILE A CG1  4  
ATOM 8054  C CG2  . ILE A 1 93  ? 110.142 -18.488 -0.684  1.00 0.00 ? 93  ILE A CG2  4  
ATOM 8055  C CD1  . ILE A 1 93  ? 113.615 -17.730 0.855   1.00 0.00 ? 93  ILE A CD1  4  
ATOM 8056  H H    . ILE A 1 93  ? 111.318 -19.176 -3.095  1.00 0.00 ? 93  ILE A H    4  
ATOM 8057  H HA   . ILE A 1 93  ? 113.432 -19.533 -1.183  1.00 0.00 ? 93  ILE A HA   4  
ATOM 8058  H HB   . ILE A 1 93  ? 111.931 -17.513 -1.250  1.00 0.00 ? 93  ILE A HB   4  
ATOM 8059  H HG12 . ILE A 1 93  ? 111.571 -17.355 1.234   1.00 0.00 ? 93  ILE A HG12 4  
ATOM 8060  H HG13 . ILE A 1 93  ? 112.036 -19.049 1.352   1.00 0.00 ? 93  ILE A HG13 4  
ATOM 8061  H HG21 . ILE A 1 93  ? 109.697 -17.549 -0.386  1.00 0.00 ? 93  ILE A HG21 4  
ATOM 8062  H HG22 . ILE A 1 93  ? 109.839 -19.273 -0.007  1.00 0.00 ? 93  ILE A HG22 4  
ATOM 8063  H HG23 . ILE A 1 93  ? 109.833 -18.754 -1.684  1.00 0.00 ? 93  ILE A HG23 4  
ATOM 8064  H HD11 . ILE A 1 93  ? 114.233 -18.472 0.371   1.00 0.00 ? 93  ILE A HD11 4  
ATOM 8065  H HD12 . ILE A 1 93  ? 113.912 -17.643 1.890   1.00 0.00 ? 93  ILE A HD12 4  
ATOM 8066  H HD13 . ILE A 1 93  ? 113.741 -16.774 0.368   1.00 0.00 ? 93  ILE A HD13 4  
ATOM 8067  N N    . THR A 1 94  ? 110.988 -21.583 -1.297  1.00 0.00 ? 94  THR A N    4  
ATOM 8068  C CA   . THR A 1 94  ? 110.474 -22.868 -0.876  1.00 0.00 ? 94  THR A CA   4  
ATOM 8069  C C    . THR A 1 94  ? 111.611 -23.921 -0.827  1.00 0.00 ? 94  THR A C    4  
ATOM 8070  O O    . THR A 1 94  ? 111.607 -24.824 0.018   1.00 0.00 ? 94  THR A O    4  
ATOM 8071  C CB   . THR A 1 94  ? 109.319 -23.331 -1.823  1.00 0.00 ? 94  THR A CB   4  
ATOM 8072  O OG1  . THR A 1 94  ? 108.813 -24.624 -1.445  1.00 0.00 ? 94  THR A OG1  4  
ATOM 8073  C CG2  . THR A 1 94  ? 109.778 -23.355 -3.279  1.00 0.00 ? 94  THR A CG2  4  
ATOM 8074  H H    . THR A 1 94  ? 110.631 -21.150 -2.099  1.00 0.00 ? 94  THR A H    4  
ATOM 8075  H HA   . THR A 1 94  ? 110.077 -22.748 0.123   1.00 0.00 ? 94  THR A HA   4  
ATOM 8076  H HB   . THR A 1 94  ? 108.514 -22.616 -1.729  1.00 0.00 ? 94  THR A HB   4  
ATOM 8077  H HG1  . THR A 1 94  ? 108.265 -24.934 -2.186  1.00 0.00 ? 94  THR A HG1  4  
ATOM 8078  H HG21 . THR A 1 94  ? 108.964 -23.680 -3.910  1.00 0.00 ? 94  THR A HG21 4  
ATOM 8079  H HG22 . THR A 1 94  ? 110.611 -24.035 -3.382  1.00 0.00 ? 94  THR A HG22 4  
ATOM 8080  H HG23 . THR A 1 94  ? 110.088 -22.362 -3.571  1.00 0.00 ? 94  THR A HG23 4  
ATOM 8081  N N    . GLN A 1 95  ? 112.595 -23.760 -1.700  1.00 0.00 ? 95  GLN A N    4  
ATOM 8082  C CA   . GLN A 1 95  ? 113.747 -24.635 -1.774  1.00 0.00 ? 95  GLN A CA   4  
ATOM 8083  C C    . GLN A 1 95  ? 114.991 -23.766 -1.911  1.00 0.00 ? 95  GLN A C    4  
ATOM 8084  O O    . GLN A 1 95  ? 115.521 -23.596 -3.011  1.00 0.00 ? 95  GLN A O    4  
ATOM 8085  C CB   . GLN A 1 95  ? 113.652 -25.581 -2.973  1.00 0.00 ? 95  GLN A CB   4  
ATOM 8086  C CG   . GLN A 1 95  ? 112.495 -26.559 -2.946  1.00 0.00 ? 95  GLN A CG   4  
ATOM 8087  C CD   . GLN A 1 95  ? 112.405 -27.353 -4.228  1.00 0.00 ? 95  GLN A CD   4  
ATOM 8088  O OE1  . GLN A 1 95  ? 112.770 -26.870 -5.296  1.00 0.00 ? 95  GLN A OE1  4  
ATOM 8089  N NE2  . GLN A 1 95  ? 111.910 -28.558 -4.149  1.00 0.00 ? 95  GLN A NE2  4  
ATOM 8090  H H    . GLN A 1 95  ? 112.588 -22.992 -2.308  1.00 0.00 ? 95  GLN A H    4  
ATOM 8091  H HA   . GLN A 1 95  ? 113.805 -25.205 -0.857  1.00 0.00 ? 95  GLN A HA   4  
ATOM 8092  H HB2  . GLN A 1 95  ? 113.558 -24.987 -3.870  1.00 0.00 ? 95  GLN A HB2  4  
ATOM 8093  H HB3  . GLN A 1 95  ? 114.571 -26.145 -3.034  1.00 0.00 ? 95  GLN A HB3  4  
ATOM 8094  H HG2  . GLN A 1 95  ? 112.633 -27.241 -2.120  1.00 0.00 ? 95  GLN A HG2  4  
ATOM 8095  H HG3  . GLN A 1 95  ? 111.575 -26.009 -2.811  1.00 0.00 ? 95  GLN A HG3  4  
ATOM 8096  H HE21 . GLN A 1 95  ? 111.612 -28.912 -3.279  1.00 0.00 ? 95  GLN A HE21 4  
ATOM 8097  H HE22 . GLN A 1 95  ? 111.869 -29.084 -4.981  1.00 0.00 ? 95  GLN A HE22 4  
ATOM 8098  N N    . PRO A 1 96  ? 115.428 -23.148 -0.817  1.00 0.00 ? 96  PRO A N    4  
ATOM 8099  C CA   . PRO A 1 96  ? 116.547 -22.217 -0.836  1.00 0.00 ? 96  PRO A CA   4  
ATOM 8100  C C    . PRO A 1 96  ? 117.905 -22.894 -0.998  1.00 0.00 ? 96  PRO A C    4  
ATOM 8101  O O    . PRO A 1 96  ? 118.063 -24.101 -0.772  1.00 0.00 ? 96  PRO A O    4  
ATOM 8102  C CB   . PRO A 1 96  ? 116.455 -21.533 0.525   1.00 0.00 ? 96  PRO A CB   4  
ATOM 8103  C CG   . PRO A 1 96  ? 115.843 -22.556 1.402   1.00 0.00 ? 96  PRO A CG   4  
ATOM 8104  C CD   . PRO A 1 96  ? 114.866 -23.292 0.536   1.00 0.00 ? 96  PRO A CD   4  
ATOM 8105  H HA   . PRO A 1 96  ? 116.424 -21.474 -1.610  1.00 0.00 ? 96  PRO A HA   4  
ATOM 8106  H HB2  . PRO A 1 96  ? 117.444 -21.257 0.860   1.00 0.00 ? 96  PRO A HB2  4  
ATOM 8107  H HB3  . PRO A 1 96  ? 115.834 -20.653 0.452   1.00 0.00 ? 96  PRO A HB3  4  
ATOM 8108  H HG2  . PRO A 1 96  ? 116.607 -23.224 1.772   1.00 0.00 ? 96  PRO A HG2  4  
ATOM 8109  H HG3  . PRO A 1 96  ? 115.330 -22.077 2.224   1.00 0.00 ? 96  PRO A HG3  4  
ATOM 8110  H HD2  . PRO A 1 96  ? 114.787 -24.334 0.806   1.00 0.00 ? 96  PRO A HD2  4  
ATOM 8111  H HD3  . PRO A 1 96  ? 113.894 -22.822 0.588   1.00 0.00 ? 96  PRO A HD3  4  
ATOM 8112  N N    . THR A 1 97  ? 118.852 -22.108 -1.386  1.00 0.00 ? 97  THR A N    4  
ATOM 8113  C CA   . THR A 1 97  ? 120.225 -22.480 -1.560  1.00 0.00 ? 97  THR A CA   4  
ATOM 8114  C C    . THR A 1 97  ? 121.063 -21.301 -1.089  1.00 0.00 ? 97  THR A C    4  
ATOM 8115  O O    . THR A 1 97  ? 120.494 -20.320 -0.631  1.00 0.00 ? 97  THR A O    4  
ATOM 8116  C CB   . THR A 1 97  ? 120.532 -22.820 -3.037  1.00 0.00 ? 97  THR A CB   4  
ATOM 8117  O OG1  . THR A 1 97  ? 119.850 -21.899 -3.913  1.00 0.00 ? 97  THR A OG1  4  
ATOM 8118  C CG2  . THR A 1 97  ? 120.154 -24.256 -3.372  1.00 0.00 ? 97  THR A CG2  4  
ATOM 8119  H H    . THR A 1 97  ? 118.646 -21.158 -1.554  1.00 0.00 ? 97  THR A H    4  
ATOM 8120  H HA   . THR A 1 97  ? 120.427 -23.335 -0.931  1.00 0.00 ? 97  THR A HA   4  
ATOM 8121  H HB   . THR A 1 97  ? 121.595 -22.691 -3.185  1.00 0.00 ? 97  THR A HB   4  
ATOM 8122  H HG1  . THR A 1 97  ? 119.013 -22.309 -4.185  1.00 0.00 ? 97  THR A HG1  4  
ATOM 8123  H HG21 . THR A 1 97  ? 120.371 -24.454 -4.411  1.00 0.00 ? 97  THR A HG21 4  
ATOM 8124  H HG22 . THR A 1 97  ? 119.100 -24.402 -3.186  1.00 0.00 ? 97  THR A HG22 4  
ATOM 8125  H HG23 . THR A 1 97  ? 120.727 -24.927 -2.749  1.00 0.00 ? 97  THR A HG23 4  
ATOM 8126  N N    . LEU A 1 98  ? 122.374 -21.358 -1.245  1.00 0.00 ? 98  LEU A N    4  
ATOM 8127  C CA   . LEU A 1 98  ? 123.278 -20.306 -0.726  1.00 0.00 ? 98  LEU A CA   4  
ATOM 8128  C C    . LEU A 1 98  ? 123.035 -18.921 -1.357  1.00 0.00 ? 98  LEU A C    4  
ATOM 8129  O O    . LEU A 1 98  ? 123.492 -17.909 -0.840  1.00 0.00 ? 98  LEU A O    4  
ATOM 8130  C CB   . LEU A 1 98  ? 124.776 -20.683 -0.895  1.00 0.00 ? 98  LEU A CB   4  
ATOM 8131  C CG   . LEU A 1 98  ? 125.333 -21.879 -0.085  1.00 0.00 ? 98  LEU A CG   4  
ATOM 8132  C CD1  . LEU A 1 98  ? 125.081 -21.722 1.397   1.00 0.00 ? 98  LEU A CD1  4  
ATOM 8133  C CD2  . LEU A 1 98  ? 124.808 -23.206 -0.588  1.00 0.00 ? 98  LEU A CD2  4  
ATOM 8134  H H    . LEU A 1 98  ? 122.764 -22.118 -1.726  1.00 0.00 ? 98  LEU A H    4  
ATOM 8135  H HA   . LEU A 1 98  ? 123.075 -20.219 0.331   1.00 0.00 ? 98  LEU A HA   4  
ATOM 8136  H HB2  . LEU A 1 98  ? 124.942 -20.898 -1.939  1.00 0.00 ? 98  LEU A HB2  4  
ATOM 8137  H HB3  . LEU A 1 98  ? 125.359 -19.810 -0.642  1.00 0.00 ? 98  LEU A HB3  4  
ATOM 8138  H HG   . LEU A 1 98  ? 126.407 -21.875 -0.208  1.00 0.00 ? 98  LEU A HG   4  
ATOM 8139  H HD11 . LEU A 1 98  ? 124.017 -21.652 1.571   1.00 0.00 ? 98  LEU A HD11 4  
ATOM 8140  H HD12 . LEU A 1 98  ? 125.568 -20.832 1.765   1.00 0.00 ? 98  LEU A HD12 4  
ATOM 8141  H HD13 . LEU A 1 98  ? 125.464 -22.587 1.918   1.00 0.00 ? 98  LEU A HD13 4  
ATOM 8142  H HD21 . LEU A 1 98  ? 125.103 -23.344 -1.618  1.00 0.00 ? 98  LEU A HD21 4  
ATOM 8143  H HD22 . LEU A 1 98  ? 123.730 -23.216 -0.518  1.00 0.00 ? 98  LEU A HD22 4  
ATOM 8144  H HD23 . LEU A 1 98  ? 125.213 -24.007 0.013   1.00 0.00 ? 98  LEU A HD23 4  
ATOM 8145  N N    . HIS A 1 99  ? 122.349 -18.871 -2.478  1.00 0.00 ? 99  HIS A N    4  
ATOM 8146  C CA   . HIS A 1 99  ? 122.095 -17.601 -3.146  1.00 0.00 ? 99  HIS A CA   4  
ATOM 8147  C C    . HIS A 1 99  ? 120.630 -17.410 -3.530  1.00 0.00 ? 99  HIS A C    4  
ATOM 8148  O O    . HIS A 1 99  ? 120.323 -16.956 -4.625  1.00 0.00 ? 99  HIS A O    4  
ATOM 8149  C CB   . HIS A 1 99  ? 123.028 -17.391 -4.361  1.00 0.00 ? 99  HIS A CB   4  
ATOM 8150  C CG   . HIS A 1 99  ? 124.424 -16.978 -3.989  1.00 0.00 ? 99  HIS A CG   4  
ATOM 8151  N ND1  . HIS A 1 99  ? 124.878 -15.680 -4.087  1.00 0.00 ? 99  HIS A ND1  4  
ATOM 8152  C CD2  . HIS A 1 99  ? 125.447 -17.681 -3.482  1.00 0.00 ? 99  HIS A CD2  4  
ATOM 8153  C CE1  . HIS A 1 99  ? 126.103 -15.610 -3.637  1.00 0.00 ? 99  HIS A CE1  4  
ATOM 8154  N NE2  . HIS A 1 99  ? 126.474 -16.809 -3.272  1.00 0.00 ? 99  HIS A NE2  4  
ATOM 8155  H H    . HIS A 1 99  ? 122.012 -19.711 -2.859  1.00 0.00 ? 99  HIS A H    4  
ATOM 8156  H HA   . HIS A 1 99  ? 122.326 -16.837 -2.418  1.00 0.00 ? 99  HIS A HA   4  
ATOM 8157  H HB2  . HIS A 1 99  ? 123.095 -18.314 -4.919  1.00 0.00 ? 99  HIS A HB2  4  
ATOM 8158  H HB3  . HIS A 1 99  ? 122.610 -16.624 -4.996  1.00 0.00 ? 99  HIS A HB3  4  
ATOM 8159  H HD1  . HIS A 1 99  ? 124.420 -14.942 -4.556  1.00 0.00 ? 99  HIS A HD1  4  
ATOM 8160  H HD2  . HIS A 1 99  ? 125.455 -18.742 -3.276  1.00 0.00 ? 99  HIS A HD2  4  
ATOM 8161  H HE1  . HIS A 1 99  ? 126.691 -14.709 -3.518  1.00 0.00 ? 99  HIS A HE1  4  
ATOM 8162  H HE2  . HIS A 1 99  ? 127.421 -17.097 -3.345  1.00 0.00 ? 99  HIS A HE2  4  
ATOM 8163  N N    . SER A 1 100 ? 119.732 -17.685 -2.607  1.00 0.00 ? 100 SER A N    4  
ATOM 8164  C CA   . SER A 1 100 ? 118.298 -17.481 -2.842  1.00 0.00 ? 100 SER A CA   4  
ATOM 8165  C C    . SER A 1 100 ? 117.902 -15.989 -2.873  1.00 0.00 ? 100 SER A C    4  
ATOM 8166  O O    . SER A 1 100 ? 116.757 -15.644 -3.162  1.00 0.00 ? 100 SER A O    4  
ATOM 8167  C CB   . SER A 1 100 ? 117.493 -18.239 -1.800  1.00 0.00 ? 100 SER A CB   4  
ATOM 8168  O OG   . SER A 1 100 ? 117.786 -19.612 -1.902  1.00 0.00 ? 100 SER A OG   4  
ATOM 8169  H H    . SER A 1 100 ? 120.006 -18.079 -1.751  1.00 0.00 ? 100 SER A H    4  
ATOM 8170  H HA   . SER A 1 100 ? 118.080 -17.902 -3.813  1.00 0.00 ? 100 SER A HA   4  
ATOM 8171  H HB2  . SER A 1 100 ? 117.740 -17.898 -0.805  1.00 0.00 ? 100 SER A HB2  4  
ATOM 8172  H HB3  . SER A 1 100 ? 116.439 -18.098 -1.979  1.00 0.00 ? 100 SER A HB3  4  
ATOM 8173  H HG   . SER A 1 100 ? 117.416 -19.891 -2.756  1.00 0.00 ? 100 SER A HG   4  
ATOM 8174  N N    . PHE A 1 101 ? 118.849 -15.124 -2.582  1.00 0.00 ? 101 PHE A N    4  
ATOM 8175  C CA   . PHE A 1 101 ? 118.621 -13.686 -2.595  1.00 0.00 ? 101 PHE A CA   4  
ATOM 8176  C C    . PHE A 1 101 ? 119.654 -13.044 -3.508  1.00 0.00 ? 101 PHE A C    4  
ATOM 8177  O O    . PHE A 1 101 ? 119.906 -11.846 -3.441  1.00 0.00 ? 101 PHE A O    4  
ATOM 8178  C CB   . PHE A 1 101 ? 118.783 -13.115 -1.182  1.00 0.00 ? 101 PHE A CB   4  
ATOM 8179  C CG   . PHE A 1 101 ? 117.936 -13.777 -0.136  1.00 0.00 ? 101 PHE A CG   4  
ATOM 8180  C CD1  . PHE A 1 101 ? 116.604 -13.441 0.017   1.00 0.00 ? 101 PHE A CD1  4  
ATOM 8181  C CD2  . PHE A 1 101 ? 118.479 -14.744 0.693   1.00 0.00 ? 101 PHE A CD2  4  
ATOM 8182  C CE1  . PHE A 1 101 ? 115.832 -14.056 0.979   1.00 0.00 ? 101 PHE A CE1  4  
ATOM 8183  C CE2  . PHE A 1 101 ? 117.711 -15.358 1.651   1.00 0.00 ? 101 PHE A CE2  4  
ATOM 8184  C CZ   . PHE A 1 101 ? 116.387 -15.014 1.793   1.00 0.00 ? 101 PHE A CZ   4  
ATOM 8185  H H    . PHE A 1 101 ? 119.735 -15.468 -2.350  1.00 0.00 ? 101 PHE A H    4  
ATOM 8186  H HA   . PHE A 1 101 ? 117.624 -13.486 -2.958  1.00 0.00 ? 101 PHE A HA   4  
ATOM 8187  H HB2  . PHE A 1 101 ? 119.813 -13.218 -0.876  1.00 0.00 ? 101 PHE A HB2  4  
ATOM 8188  H HB3  . PHE A 1 101 ? 118.529 -12.064 -1.202  1.00 0.00 ? 101 PHE A HB3  4  
ATOM 8189  H HD1  . PHE A 1 101 ? 116.168 -12.688 -0.623  1.00 0.00 ? 101 PHE A HD1  4  
ATOM 8190  H HD2  . PHE A 1 101 ? 119.518 -15.014 0.583   1.00 0.00 ? 101 PHE A HD2  4  
ATOM 8191  H HE1  . PHE A 1 101 ? 114.793 -13.787 1.098   1.00 0.00 ? 101 PHE A HE1  4  
ATOM 8192  H HE2  . PHE A 1 101 ? 118.143 -16.111 2.294   1.00 0.00 ? 101 PHE A HE2  4  
ATOM 8193  H HZ   . PHE A 1 101 ? 115.782 -15.497 2.546   1.00 0.00 ? 101 PHE A HZ   4  
ATOM 8194  N N    . ASP A 1 102 ? 120.197 -13.846 -4.410  1.00 0.00 ? 102 ASP A N    4  
ATOM 8195  C CA   . ASP A 1 102 ? 121.316 -13.432 -5.261  1.00 0.00 ? 102 ASP A CA   4  
ATOM 8196  C C    . ASP A 1 102 ? 120.960 -12.269 -6.156  1.00 0.00 ? 102 ASP A C    4  
ATOM 8197  O O    . ASP A 1 102 ? 121.732 -11.307 -6.277  1.00 0.00 ? 102 ASP A O    4  
ATOM 8198  C CB   . ASP A 1 102 ? 121.817 -14.579 -6.116  1.00 0.00 ? 102 ASP A CB   4  
ATOM 8199  C CG   . ASP A 1 102 ? 123.072 -14.212 -6.854  1.00 0.00 ? 102 ASP A CG   4  
ATOM 8200  O OD1  . ASP A 1 102 ? 124.147 -14.307 -6.257  1.00 0.00 ? 102 ASP A OD1  4  
ATOM 8201  O OD2  . ASP A 1 102 ? 123.008 -13.818 -8.032  1.00 0.00 ? 102 ASP A OD2  4  
ATOM 8202  H H    . ASP A 1 102 ? 119.795 -14.734 -4.540  1.00 0.00 ? 102 ASP A H    4  
ATOM 8203  H HA   . ASP A 1 102 ? 122.119 -13.123 -4.608  1.00 0.00 ? 102 ASP A HA   4  
ATOM 8204  H HB2  . ASP A 1 102 ? 122.027 -15.429 -5.485  1.00 0.00 ? 102 ASP A HB2  4  
ATOM 8205  H HB3  . ASP A 1 102 ? 121.058 -14.844 -6.837  1.00 0.00 ? 102 ASP A HB3  4  
ATOM 8206  N N    . ALA A 1 103 ? 119.795 -12.339 -6.760  1.00 0.00 ? 103 ALA A N    4  
ATOM 8207  C CA   . ALA A 1 103 ? 119.341 -11.292 -7.660  1.00 0.00 ? 103 ALA A CA   4  
ATOM 8208  C C    . ALA A 1 103 ? 118.977 -10.054 -6.872  1.00 0.00 ? 103 ALA A C    4  
ATOM 8209  O O    . ALA A 1 103 ? 119.163 -8.919  -7.325  1.00 0.00 ? 103 ALA A O    4  
ATOM 8210  C CB   . ALA A 1 103 ? 118.142 -11.766 -8.466  1.00 0.00 ? 103 ALA A CB   4  
ATOM 8211  H H    . ALA A 1 103 ? 119.227 -13.126 -6.594  1.00 0.00 ? 103 ALA A H    4  
ATOM 8212  H HA   . ALA A 1 103 ? 120.145 -11.056 -8.342  1.00 0.00 ? 103 ALA A HA   4  
ATOM 8213  H HB1  . ALA A 1 103 ? 117.868 -11.005 -9.182  1.00 0.00 ? 103 ALA A HB1  4  
ATOM 8214  H HB2  . ALA A 1 103 ? 117.308 -11.936 -7.799  1.00 0.00 ? 103 ALA A HB2  4  
ATOM 8215  H HB3  . ALA A 1 103 ? 118.388 -12.680 -8.984  1.00 0.00 ? 103 ALA A HB3  4  
ATOM 8216  N N    . ALA A 1 104 ? 118.530 -10.276 -5.662  1.00 0.00 ? 104 ALA A N    4  
ATOM 8217  C CA   . ALA A 1 104 ? 118.052 -9.218  -4.822  1.00 0.00 ? 104 ALA A CA   4  
ATOM 8218  C C    . ALA A 1 104 ? 119.186 -8.361  -4.280  1.00 0.00 ? 104 ALA A C    4  
ATOM 8219  O O    . ALA A 1 104 ? 118.990 -7.171  -4.037  1.00 0.00 ? 104 ALA A O    4  
ATOM 8220  C CB   . ALA A 1 104 ? 117.160 -9.768  -3.737  1.00 0.00 ? 104 ALA A CB   4  
ATOM 8221  H H    . ALA A 1 104 ? 118.541 -11.195 -5.319  1.00 0.00 ? 104 ALA A H    4  
ATOM 8222  H HA   . ALA A 1 104 ? 117.449 -8.582  -5.454  1.00 0.00 ? 104 ALA A HA   4  
ATOM 8223  H HB1  . ALA A 1 104 ? 116.786 -8.948  -3.140  1.00 0.00 ? 104 ALA A HB1  4  
ATOM 8224  H HB2  . ALA A 1 104 ? 117.684 -10.489 -3.127  1.00 0.00 ? 104 ALA A HB2  4  
ATOM 8225  H HB3  . ALA A 1 104 ? 116.321 -10.228 -4.249  1.00 0.00 ? 104 ALA A HB3  4  
ATOM 8226  N N    . GLN A 1 105 ? 120.379 -8.949  -4.149  1.00 0.00 ? 105 GLN A N    4  
ATOM 8227  C CA   . GLN A 1 105 ? 121.573 -8.203  -3.711  1.00 0.00 ? 105 GLN A CA   4  
ATOM 8228  C C    . GLN A 1 105 ? 121.799 -7.031  -4.660  1.00 0.00 ? 105 GLN A C    4  
ATOM 8229  O O    . GLN A 1 105 ? 122.026 -5.893  -4.242  1.00 0.00 ? 105 GLN A O    4  
ATOM 8230  C CB   . GLN A 1 105 ? 122.832 -9.066  -3.780  1.00 0.00 ? 105 GLN A CB   4  
ATOM 8231  C CG   . GLN A 1 105 ? 122.782 -10.396 -3.070  1.00 0.00 ? 105 GLN A CG   4  
ATOM 8232  C CD   . GLN A 1 105 ? 124.083 -11.148 -3.253  1.00 0.00 ? 105 GLN A CD   4  
ATOM 8233  O OE1  . GLN A 1 105 ? 124.998 -11.063 -2.434  1.00 0.00 ? 105 GLN A OE1  4  
ATOM 8234  N NE2  . GLN A 1 105 ? 124.207 -11.820 -4.367  1.00 0.00 ? 105 GLN A NE2  4  
ATOM 8235  H H    . GLN A 1 105 ? 120.441 -9.912  -4.330  1.00 0.00 ? 105 GLN A H    4  
ATOM 8236  H HA   . GLN A 1 105 ? 121.425 -7.849  -2.701  1.00 0.00 ? 105 GLN A HA   4  
ATOM 8237  H HB2  . GLN A 1 105 ? 123.044 -9.262  -4.819  1.00 0.00 ? 105 GLN A HB2  4  
ATOM 8238  H HB3  . GLN A 1 105 ? 123.653 -8.493  -3.371  1.00 0.00 ? 105 GLN A HB3  4  
ATOM 8239  H HG2  . GLN A 1 105 ? 122.615 -10.226 -2.016  1.00 0.00 ? 105 GLN A HG2  4  
ATOM 8240  H HG3  . GLN A 1 105 ? 121.976 -10.988 -3.480  1.00 0.00 ? 105 GLN A HG3  4  
ATOM 8241  H HE21 . GLN A 1 105 ? 123.461 -11.800 -5.004  1.00 0.00 ? 105 GLN A HE21 4  
ATOM 8242  H HE22 . GLN A 1 105 ? 125.055 -12.280 -4.557  1.00 0.00 ? 105 GLN A HE22 4  
ATOM 8243  N N    . SER A 1 106 ? 121.718 -7.332  -5.943  1.00 0.00 ? 106 SER A N    4  
ATOM 8244  C CA   . SER A 1 106 ? 121.938 -6.373  -6.997  1.00 0.00 ? 106 SER A CA   4  
ATOM 8245  C C    . SER A 1 106 ? 120.793 -5.351  -7.041  1.00 0.00 ? 106 SER A C    4  
ATOM 8246  O O    . SER A 1 106 ? 121.010 -4.160  -7.260  1.00 0.00 ? 106 SER A O    4  
ATOM 8247  C CB   . SER A 1 106 ? 122.026 -7.138  -8.311  1.00 0.00 ? 106 SER A CB   4  
ATOM 8248  O OG   . SER A 1 106 ? 122.902 -8.257  -8.163  1.00 0.00 ? 106 SER A OG   4  
ATOM 8249  H H    . SER A 1 106 ? 121.511 -8.253  -6.210  1.00 0.00 ? 106 SER A H    4  
ATOM 8250  H HA   . SER A 1 106 ? 122.876 -5.868  -6.825  1.00 0.00 ? 106 SER A HA   4  
ATOM 8251  H HB2  . SER A 1 106 ? 121.044 -7.493  -8.587  1.00 0.00 ? 106 SER A HB2  4  
ATOM 8252  H HB3  . SER A 1 106 ? 122.413 -6.491  -9.084  1.00 0.00 ? 106 SER A HB3  4  
ATOM 8253  H HG   . SER A 1 106 ? 123.585 -8.002  -7.521  1.00 0.00 ? 106 SER A HG   4  
ATOM 8254  N N    . ARG A 1 107 ? 119.586 -5.821  -6.774  1.00 0.00 ? 107 ARG A N    4  
ATOM 8255  C CA   . ARG A 1 107 ? 118.404 -4.976  -6.807  1.00 0.00 ? 107 ARG A CA   4  
ATOM 8256  C C    . ARG A 1 107 ? 118.412 -3.944  -5.698  1.00 0.00 ? 107 ARG A C    4  
ATOM 8257  O O    . ARG A 1 107 ? 117.999 -2.809  -5.894  1.00 0.00 ? 107 ARG A O    4  
ATOM 8258  C CB   . ARG A 1 107 ? 117.138 -5.813  -6.783  1.00 0.00 ? 107 ARG A CB   4  
ATOM 8259  C CG   . ARG A 1 107 ? 116.984 -6.705  -7.989  1.00 0.00 ? 107 ARG A CG   4  
ATOM 8260  C CD   . ARG A 1 107 ? 116.954 -5.890  -9.267  1.00 0.00 ? 107 ARG A CD   4  
ATOM 8261  N NE   . ARG A 1 107 ? 117.062 -6.713  -10.478 1.00 0.00 ? 107 ARG A NE   4  
ATOM 8262  C CZ   . ARG A 1 107 ? 117.380 -6.218  -11.687 1.00 0.00 ? 107 ARG A CZ   4  
ATOM 8263  N NH1  . ARG A 1 107 ? 117.474 -4.903  -11.860 1.00 0.00 ? 107 ARG A NH1  4  
ATOM 8264  N NH2  . ARG A 1 107 ? 117.590 -7.033  -12.712 1.00 0.00 ? 107 ARG A NH2  4  
ATOM 8265  H H    . ARG A 1 107 ? 119.498 -6.772  -6.547  1.00 0.00 ? 107 ARG A H    4  
ATOM 8266  H HA   . ARG A 1 107 ? 118.416 -4.418  -7.730  1.00 0.00 ? 107 ARG A HA   4  
ATOM 8267  H HB2  . ARG A 1 107 ? 117.147 -6.436  -5.901  1.00 0.00 ? 107 ARG A HB2  4  
ATOM 8268  H HB3  . ARG A 1 107 ? 116.284 -5.153  -6.739  1.00 0.00 ? 107 ARG A HB3  4  
ATOM 8269  H HG2  . ARG A 1 107 ? 117.804 -7.409  -8.023  1.00 0.00 ? 107 ARG A HG2  4  
ATOM 8270  H HG3  . ARG A 1 107 ? 116.046 -7.234  -7.881  1.00 0.00 ? 107 ARG A HG3  4  
ATOM 8271  H HD2  . ARG A 1 107 ? 116.025 -5.342  -9.304  1.00 0.00 ? 107 ARG A HD2  4  
ATOM 8272  H HD3  . ARG A 1 107 ? 117.775 -5.189  -9.244  1.00 0.00 ? 107 ARG A HD3  4  
ATOM 8273  H HE   . ARG A 1 107 ? 116.930 -7.680  -10.350 1.00 0.00 ? 107 ARG A HE   4  
ATOM 8274  H HH11 . ARG A 1 107 ? 117.307 -4.250  -11.114 1.00 0.00 ? 107 ARG A HH11 4  
ATOM 8275  H HH12 . ARG A 1 107 ? 117.741 -4.473  -12.732 1.00 0.00 ? 107 ARG A HH12 4  
ATOM 8276  H HH21 . ARG A 1 107 ? 117.519 -8.038  -12.619 1.00 0.00 ? 107 ARG A HH21 4  
ATOM 8277  H HH22 . ARG A 1 107 ? 117.840 -6.686  -13.621 1.00 0.00 ? 107 ARG A HH22 4  
ATOM 8278  N N    . VAL A 1 108 ? 118.895 -4.319  -4.556  1.00 0.00 ? 108 VAL A N    4  
ATOM 8279  C CA   . VAL A 1 108 ? 118.995 -3.394  -3.453  1.00 0.00 ? 108 VAL A CA   4  
ATOM 8280  C C    . VAL A 1 108 ? 120.187 -2.457  -3.653  1.00 0.00 ? 108 VAL A C    4  
ATOM 8281  O O    . VAL A 1 108 ? 120.130 -1.263  -3.333  1.00 0.00 ? 108 VAL A O    4  
ATOM 8282  C CB   . VAL A 1 108 ? 119.069 -4.145  -2.123  1.00 0.00 ? 108 VAL A CB   4  
ATOM 8283  C CG1  . VAL A 1 108 ? 119.262 -3.194  -0.975  1.00 0.00 ? 108 VAL A CG1  4  
ATOM 8284  C CG2  . VAL A 1 108 ? 117.787 -4.920  -1.938  1.00 0.00 ? 108 VAL A CG2  4  
ATOM 8285  H H    . VAL A 1 108 ? 119.173 -5.254  -4.432  1.00 0.00 ? 108 VAL A H    4  
ATOM 8286  H HA   . VAL A 1 108 ? 118.097 -2.792  -3.468  1.00 0.00 ? 108 VAL A HA   4  
ATOM 8287  H HB   . VAL A 1 108 ? 119.882 -4.854  -2.149  1.00 0.00 ? 108 VAL A HB   4  
ATOM 8288  H HG11 . VAL A 1 108 ? 118.430 -2.504  -0.954  1.00 0.00 ? 108 VAL A HG11 4  
ATOM 8289  H HG12 . VAL A 1 108 ? 120.188 -2.651  -1.108  1.00 0.00 ? 108 VAL A HG12 4  
ATOM 8290  H HG13 . VAL A 1 108 ? 119.293 -3.754  -0.052  1.00 0.00 ? 108 VAL A HG13 4  
ATOM 8291  H HG21 . VAL A 1 108 ? 117.811 -5.463  -1.004  1.00 0.00 ? 108 VAL A HG21 4  
ATOM 8292  H HG22 . VAL A 1 108 ? 117.676 -5.608  -2.764  1.00 0.00 ? 108 VAL A HG22 4  
ATOM 8293  H HG23 . VAL A 1 108 ? 116.957 -4.228  -1.940  1.00 0.00 ? 108 VAL A HG23 4  
ATOM 8294  N N    . TYR A 1 109 ? 121.238 -2.997  -4.229  1.00 0.00 ? 109 TYR A N    4  
ATOM 8295  C CA   . TYR A 1 109 ? 122.415 -2.232  -4.586  1.00 0.00 ? 109 TYR A CA   4  
ATOM 8296  C C    . TYR A 1 109 ? 122.052 -1.086  -5.551  1.00 0.00 ? 109 TYR A C    4  
ATOM 8297  O O    . TYR A 1 109 ? 122.487 0.050   -5.367  1.00 0.00 ? 109 TYR A O    4  
ATOM 8298  C CB   . TYR A 1 109 ? 123.507 -3.198  -5.124  1.00 0.00 ? 109 TYR A CB   4  
ATOM 8299  C CG   . TYR A 1 109 ? 124.380 -2.708  -6.266  1.00 0.00 ? 109 TYR A CG   4  
ATOM 8300  C CD1  . TYR A 1 109 ? 123.936 -2.776  -7.584  1.00 0.00 ? 109 TYR A CD1  4  
ATOM 8301  C CD2  . TYR A 1 109 ? 125.642 -2.207  -6.033  1.00 0.00 ? 109 TYR A CD2  4  
ATOM 8302  C CE1  . TYR A 1 109 ? 124.723 -2.351  -8.622  1.00 0.00 ? 109 TYR A CE1  4  
ATOM 8303  C CE2  . TYR A 1 109 ? 126.442 -1.776  -7.066  1.00 0.00 ? 109 TYR A CE2  4  
ATOM 8304  C CZ   . TYR A 1 109 ? 125.976 -1.850  -8.363  1.00 0.00 ? 109 TYR A CZ   4  
ATOM 8305  O OH   . TYR A 1 109 ? 126.767 -1.427  -9.414  1.00 0.00 ? 109 TYR A OH   4  
ATOM 8306  H H    . TYR A 1 109 ? 121.227 -3.960  -4.421  1.00 0.00 ? 109 TYR A H    4  
ATOM 8307  H HA   . TYR A 1 109 ? 122.771 -1.781  -3.672  1.00 0.00 ? 109 TYR A HA   4  
ATOM 8308  H HB2  . TYR A 1 109 ? 124.180 -3.379  -4.299  1.00 0.00 ? 109 TYR A HB2  4  
ATOM 8309  H HB3  . TYR A 1 109 ? 123.061 -4.145  -5.381  1.00 0.00 ? 109 TYR A HB3  4  
ATOM 8310  H HD1  . TYR A 1 109 ? 122.949 -3.164  -7.783  1.00 0.00 ? 109 TYR A HD1  4  
ATOM 8311  H HD2  . TYR A 1 109 ? 126.002 -2.152  -5.016  1.00 0.00 ? 109 TYR A HD2  4  
ATOM 8312  H HE1  . TYR A 1 109 ? 124.356 -2.413  -9.636  1.00 0.00 ? 109 TYR A HE1  4  
ATOM 8313  H HE2  . TYR A 1 109 ? 127.423 -1.386  -6.834  1.00 0.00 ? 109 TYR A HE2  4  
ATOM 8314  H HH   . TYR A 1 109 ? 126.178 -0.913  -9.995  1.00 0.00 ? 109 TYR A HH   4  
ATOM 8315  N N    . GLN A 1 110 ? 121.208 -1.369  -6.536  1.00 0.00 ? 110 GLN A N    4  
ATOM 8316  C CA   . GLN A 1 110 ? 120.778 -0.331  -7.456  1.00 0.00 ? 110 GLN A CA   4  
ATOM 8317  C C    . GLN A 1 110 ? 119.835 0.673   -6.795  1.00 0.00 ? 110 GLN A C    4  
ATOM 8318  O O    . GLN A 1 110 ? 119.839 1.845   -7.164  1.00 0.00 ? 110 GLN A O    4  
ATOM 8319  C CB   . GLN A 1 110 ? 120.205 -0.882  -8.769  1.00 0.00 ? 110 GLN A CB   4  
ATOM 8320  C CG   . GLN A 1 110 ? 119.081 -1.888  -8.622  1.00 0.00 ? 110 GLN A CG   4  
ATOM 8321  C CD   . GLN A 1 110 ? 118.512 -2.351  -9.955  1.00 0.00 ? 110 GLN A CD   4  
ATOM 8322  O OE1  . GLN A 1 110 ? 117.337 -2.700  -10.060 1.00 0.00 ? 110 GLN A OE1  4  
ATOM 8323  N NE2  . GLN A 1 110 ? 119.325 -2.366  -10.980 1.00 0.00 ? 110 GLN A NE2  4  
ATOM 8324  H H    . GLN A 1 110 ? 120.906 -2.296  -6.660  1.00 0.00 ? 110 GLN A H    4  
ATOM 8325  H HA   . GLN A 1 110 ? 121.682 0.217   -7.685  1.00 0.00 ? 110 GLN A HA   4  
ATOM 8326  H HB2  . GLN A 1 110 ? 119.827 -0.055  -9.351  1.00 0.00 ? 110 GLN A HB2  4  
ATOM 8327  H HB3  . GLN A 1 110 ? 121.007 -1.350  -9.320  1.00 0.00 ? 110 GLN A HB3  4  
ATOM 8328  H HG2  . GLN A 1 110 ? 119.484 -2.753  -8.115  1.00 0.00 ? 110 GLN A HG2  4  
ATOM 8329  H HG3  . GLN A 1 110 ? 118.288 -1.474  -8.016  1.00 0.00 ? 110 GLN A HG3  4  
ATOM 8330  H HE21 . GLN A 1 110 ? 120.265 -2.081  -10.858 1.00 0.00 ? 110 GLN A HE21 4  
ATOM 8331  H HE22 . GLN A 1 110 ? 119.004 -2.653  -11.865 1.00 0.00 ? 110 GLN A HE22 4  
ATOM 8332  N N    . LEU A 1 111 ? 119.039 0.213   -5.810  1.00 0.00 ? 111 LEU A N    4  
ATOM 8333  C CA   . LEU A 1 111 ? 118.161 1.113   -5.034  1.00 0.00 ? 111 LEU A CA   4  
ATOM 8334  C C    . LEU A 1 111 ? 119.004 2.166   -4.335  1.00 0.00 ? 111 LEU A C    4  
ATOM 8335  O O    . LEU A 1 111 ? 118.675 3.357   -4.331  1.00 0.00 ? 111 LEU A O    4  
ATOM 8336  C CB   . LEU A 1 111 ? 117.366 0.342   -3.962  1.00 0.00 ? 111 LEU A CB   4  
ATOM 8337  C CG   . LEU A 1 111 ? 116.371 -0.712  -4.441  1.00 0.00 ? 111 LEU A CG   4  
ATOM 8338  C CD1  . LEU A 1 111 ? 115.780 -1.450  -3.249  1.00 0.00 ? 111 LEU A CD1  4  
ATOM 8339  C CD2  . LEU A 1 111 ? 115.267 -0.072  -5.271  1.00 0.00 ? 111 LEU A CD2  4  
ATOM 8340  H H    . LEU A 1 111 ? 119.024 -0.749  -5.613  1.00 0.00 ? 111 LEU A H    4  
ATOM 8341  H HA   . LEU A 1 111 ? 117.474 1.594   -5.716  1.00 0.00 ? 111 LEU A HA   4  
ATOM 8342  H HB2  . LEU A 1 111 ? 118.076 -0.153  -3.317  1.00 0.00 ? 111 LEU A HB2  4  
ATOM 8343  H HB3  . LEU A 1 111 ? 116.826 1.066   -3.370  1.00 0.00 ? 111 LEU A HB3  4  
ATOM 8344  H HG   . LEU A 1 111 ? 116.889 -1.434  -5.055  1.00 0.00 ? 111 LEU A HG   4  
ATOM 8345  H HD11 . LEU A 1 111 ? 116.577 -1.915  -2.684  1.00 0.00 ? 111 LEU A HD11 4  
ATOM 8346  H HD12 . LEU A 1 111 ? 115.095 -2.209  -3.596  1.00 0.00 ? 111 LEU A HD12 4  
ATOM 8347  H HD13 . LEU A 1 111 ? 115.253 -0.751  -2.616  1.00 0.00 ? 111 LEU A HD13 4  
ATOM 8348  H HD21 . LEU A 1 111 ? 114.580 -0.837  -5.605  1.00 0.00 ? 111 LEU A HD21 4  
ATOM 8349  H HD22 . LEU A 1 111 ? 115.700 0.423   -6.127  1.00 0.00 ? 111 LEU A HD22 4  
ATOM 8350  H HD23 . LEU A 1 111 ? 114.735 0.649   -4.667  1.00 0.00 ? 111 LEU A HD23 4  
ATOM 8351  N N    . MET A 1 112 ? 120.103 1.714   -3.758  1.00 0.00 ? 112 MET A N    4  
ATOM 8352  C CA   . MET A 1 112 ? 121.025 2.590   -3.056  1.00 0.00 ? 112 MET A CA   4  
ATOM 8353  C C    . MET A 1 112 ? 121.745 3.530   -3.991  1.00 0.00 ? 112 MET A C    4  
ATOM 8354  O O    . MET A 1 112 ? 121.908 4.697   -3.679  1.00 0.00 ? 112 MET A O    4  
ATOM 8355  C CB   . MET A 1 112 ? 122.035 1.799   -2.236  1.00 0.00 ? 112 MET A CB   4  
ATOM 8356  C CG   . MET A 1 112 ? 121.479 1.205   -0.964  1.00 0.00 ? 112 MET A CG   4  
ATOM 8357  S SD   . MET A 1 112 ? 122.700 0.226   -0.075  1.00 0.00 ? 112 MET A SD   4  
ATOM 8358  C CE   . MET A 1 112 ? 122.869 -1.153  -1.170  1.00 0.00 ? 112 MET A CE   4  
ATOM 8359  H H    . MET A 1 112 ? 120.283 0.749   -3.803  1.00 0.00 ? 112 MET A H    4  
ATOM 8360  H HA   . MET A 1 112 ? 120.436 3.186   -2.375  1.00 0.00 ? 112 MET A HA   4  
ATOM 8361  H HB2  . MET A 1 112 ? 122.415 0.990   -2.842  1.00 0.00 ? 112 MET A HB2  4  
ATOM 8362  H HB3  . MET A 1 112 ? 122.855 2.451   -1.975  1.00 0.00 ? 112 MET A HB3  4  
ATOM 8363  H HG2  . MET A 1 112 ? 121.146 2.008   -0.324  1.00 0.00 ? 112 MET A HG2  4  
ATOM 8364  H HG3  . MET A 1 112 ? 120.642 0.571   -1.215  1.00 0.00 ? 112 MET A HG3  4  
ATOM 8365  H HE1  . MET A 1 112 ? 121.916 -1.658  -1.248  1.00 0.00 ? 112 MET A HE1  4  
ATOM 8366  H HE2  . MET A 1 112 ? 123.614 -1.828  -0.775  1.00 0.00 ? 112 MET A HE2  4  
ATOM 8367  H HE3  . MET A 1 112 ? 123.176 -0.804  -2.145  1.00 0.00 ? 112 MET A HE3  4  
ATOM 8368  N N    . GLU A 1 113 ? 122.159 3.030   -5.145  1.00 0.00 ? 113 GLU A N    4  
ATOM 8369  C CA   . GLU A 1 113 ? 122.901 3.837   -6.107  1.00 0.00 ? 113 GLU A CA   4  
ATOM 8370  C C    . GLU A 1 113 ? 122.103 5.083   -6.524  1.00 0.00 ? 113 GLU A C    4  
ATOM 8371  O O    . GLU A 1 113 ? 122.521 6.218   -6.267  1.00 0.00 ? 113 GLU A O    4  
ATOM 8372  C CB   . GLU A 1 113 ? 123.271 3.013   -7.346  1.00 0.00 ? 113 GLU A CB   4  
ATOM 8373  C CG   . GLU A 1 113 ? 124.147 3.774   -8.342  1.00 0.00 ? 113 GLU A CG   4  
ATOM 8374  C CD   . GLU A 1 113 ? 124.476 2.981   -9.579  1.00 0.00 ? 113 GLU A CD   4  
ATOM 8375  O OE1  . GLU A 1 113 ? 123.636 2.916   -10.495 1.00 0.00 ? 113 GLU A OE1  4  
ATOM 8376  O OE2  . GLU A 1 113 ? 125.587 2.426   -9.683  1.00 0.00 ? 113 GLU A OE2  4  
ATOM 8377  H H    . GLU A 1 113 ? 121.975 2.085   -5.345  1.00 0.00 ? 113 GLU A H    4  
ATOM 8378  H HA   . GLU A 1 113 ? 123.809 4.161   -5.621  1.00 0.00 ? 113 GLU A HA   4  
ATOM 8379  H HB2  . GLU A 1 113 ? 123.788 2.118   -7.037  1.00 0.00 ? 113 GLU A HB2  4  
ATOM 8380  H HB3  . GLU A 1 113 ? 122.350 2.743   -7.843  1.00 0.00 ? 113 GLU A HB3  4  
ATOM 8381  H HG2  . GLU A 1 113 ? 123.626 4.670   -8.643  1.00 0.00 ? 113 GLU A HG2  4  
ATOM 8382  H HG3  . GLU A 1 113 ? 125.068 4.049   -7.849  1.00 0.00 ? 113 GLU A HG3  4  
ATOM 8383  N N    . GLN A 1 114 ? 120.934 4.855   -7.079  1.00 0.00 ? 114 GLN A N    4  
ATOM 8384  C CA   . GLN A 1 114 ? 120.099 5.919   -7.644  1.00 0.00 ? 114 GLN A CA   4  
ATOM 8385  C C    . GLN A 1 114 ? 119.576 6.939   -6.618  1.00 0.00 ? 114 GLN A C    4  
ATOM 8386  O O    . GLN A 1 114 ? 119.102 8.004   -7.007  1.00 0.00 ? 114 GLN A O    4  
ATOM 8387  C CB   . GLN A 1 114 ? 118.955 5.314   -8.456  1.00 0.00 ? 114 GLN A CB   4  
ATOM 8388  C CG   . GLN A 1 114 ? 118.097 4.340   -7.673  1.00 0.00 ? 114 GLN A CG   4  
ATOM 8389  C CD   . GLN A 1 114 ? 117.129 3.581   -8.550  1.00 0.00 ? 114 GLN A CD   4  
ATOM 8390  O OE1  . GLN A 1 114 ? 115.995 4.004   -8.771  1.00 0.00 ? 114 GLN A OE1  4  
ATOM 8391  N NE2  . GLN A 1 114 ? 117.569 2.460   -9.050  1.00 0.00 ? 114 GLN A NE2  4  
ATOM 8392  H H    . GLN A 1 114 ? 120.613 3.926   -7.128  1.00 0.00 ? 114 GLN A H    4  
ATOM 8393  H HA   . GLN A 1 114 ? 120.729 6.466   -8.329  1.00 0.00 ? 114 GLN A HA   4  
ATOM 8394  H HB2  . GLN A 1 114 ? 118.321 6.112   -8.811  1.00 0.00 ? 114 GLN A HB2  4  
ATOM 8395  H HB3  . GLN A 1 114 ? 119.370 4.792   -9.307  1.00 0.00 ? 114 GLN A HB3  4  
ATOM 8396  H HG2  . GLN A 1 114 ? 118.765 3.630   -7.203  1.00 0.00 ? 114 GLN A HG2  4  
ATOM 8397  H HG3  . GLN A 1 114 ? 117.548 4.879   -6.915  1.00 0.00 ? 114 GLN A HG3  4  
ATOM 8398  H HE21 . GLN A 1 114 ? 118.484 2.196   -8.817  1.00 0.00 ? 114 GLN A HE21 4  
ATOM 8399  H HE22 . GLN A 1 114 ? 116.990 1.925   -9.645  1.00 0.00 ? 114 GLN A HE22 4  
ATOM 8400  N N    . ASP A 1 115 ? 119.657 6.634   -5.335  1.00 0.00 ? 115 ASP A N    4  
ATOM 8401  C CA   . ASP A 1 115 ? 119.183 7.587   -4.315  1.00 0.00 ? 115 ASP A CA   4  
ATOM 8402  C C    . ASP A 1 115 ? 120.311 8.041   -3.413  1.00 0.00 ? 115 ASP A C    4  
ATOM 8403  O O    . ASP A 1 115 ? 120.666 9.215   -3.383  1.00 0.00 ? 115 ASP A O    4  
ATOM 8404  C CB   . ASP A 1 115 ? 118.033 7.004   -3.465  1.00 0.00 ? 115 ASP A CB   4  
ATOM 8405  C CG   . ASP A 1 115 ? 117.512 7.985   -2.402  1.00 0.00 ? 115 ASP A CG   4  
ATOM 8406  O OD1  . ASP A 1 115 ? 116.834 8.970   -2.768  1.00 0.00 ? 115 ASP A OD1  4  
ATOM 8407  O OD2  . ASP A 1 115 ? 117.770 7.782   -1.190  1.00 0.00 ? 115 ASP A OD2  4  
ATOM 8408  H H    . ASP A 1 115 ? 120.054 5.777   -5.074  1.00 0.00 ? 115 ASP A H    4  
ATOM 8409  H HA   . ASP A 1 115 ? 118.814 8.454   -4.844  1.00 0.00 ? 115 ASP A HA   4  
ATOM 8410  H HB2  . ASP A 1 115 ? 117.212 6.744   -4.117  1.00 0.00 ? 115 ASP A HB2  4  
ATOM 8411  H HB3  . ASP A 1 115 ? 118.383 6.113   -2.965  1.00 0.00 ? 115 ASP A HB3  4  
ATOM 8412  N N    . SER A 1 116 ? 120.905 7.103   -2.738  1.00 0.00 ? 116 SER A N    4  
ATOM 8413  C CA   . SER A 1 116 ? 121.906 7.385   -1.753  1.00 0.00 ? 116 SER A CA   4  
ATOM 8414  C C    . SER A 1 116 ? 123.295 7.666   -2.362  1.00 0.00 ? 116 SER A C    4  
ATOM 8415  O O    . SER A 1 116 ? 124.017 8.490   -1.847  1.00 0.00 ? 116 SER A O    4  
ATOM 8416  C CB   . SER A 1 116 ? 121.985 6.213   -0.784  1.00 0.00 ? 116 SER A CB   4  
ATOM 8417  O OG   . SER A 1 116 ? 120.703 5.889   -0.273  1.00 0.00 ? 116 SER A OG   4  
ATOM 8418  H H    . SER A 1 116 ? 120.674 6.162   -2.877  1.00 0.00 ? 116 SER A H    4  
ATOM 8419  H HA   . SER A 1 116 ? 121.590 8.251   -1.191  1.00 0.00 ? 116 SER A HA   4  
ATOM 8420  H HB2  . SER A 1 116 ? 122.370 5.352   -1.308  1.00 0.00 ? 116 SER A HB2  4  
ATOM 8421  H HB3  . SER A 1 116 ? 122.639 6.464   0.038   1.00 0.00 ? 116 SER A HB3  4  
ATOM 8422  H HG   . SER A 1 116 ? 120.557 6.497   0.476   1.00 0.00 ? 116 SER A HG   4  
ATOM 8423  N N    . TYR A 1 117 ? 123.655 7.017   -3.475  1.00 0.00 ? 117 TYR A N    4  
ATOM 8424  C CA   . TYR A 1 117 ? 125.019 7.158   -4.021  1.00 0.00 ? 117 TYR A CA   4  
ATOM 8425  C C    . TYR A 1 117 ? 125.303 8.566   -4.527  1.00 0.00 ? 117 TYR A C    4  
ATOM 8426  O O    . TYR A 1 117 ? 126.367 9.118   -4.266  1.00 0.00 ? 117 TYR A O    4  
ATOM 8427  C CB   . TYR A 1 117 ? 125.299 6.100   -5.091  1.00 0.00 ? 117 TYR A CB   4  
ATOM 8428  C CG   . TYR A 1 117 ? 126.587 6.277   -5.876  1.00 0.00 ? 117 TYR A CG   4  
ATOM 8429  C CD1  . TYR A 1 117 ? 127.835 6.225   -5.262  1.00 0.00 ? 117 TYR A CD1  4  
ATOM 8430  C CD2  . TYR A 1 117 ? 126.542 6.477   -7.245  1.00 0.00 ? 117 TYR A CD2  4  
ATOM 8431  C CE1  . TYR A 1 117 ? 128.995 6.375   -6.002  1.00 0.00 ? 117 TYR A CE1  4  
ATOM 8432  C CE2  . TYR A 1 117 ? 127.691 6.626   -7.985  1.00 0.00 ? 117 TYR A CE2  4  
ATOM 8433  C CZ   . TYR A 1 117 ? 128.912 6.577   -7.366  1.00 0.00 ? 117 TYR A CZ   4  
ATOM 8434  O OH   . TYR A 1 117 ? 130.057 6.726   -8.114  1.00 0.00 ? 117 TYR A OH   4  
ATOM 8435  H H    . TYR A 1 117 ? 123.000 6.456   -3.951  1.00 0.00 ? 117 TYR A H    4  
ATOM 8436  H HA   . TYR A 1 117 ? 125.680 6.978   -3.186  1.00 0.00 ? 117 TYR A HA   4  
ATOM 8437  H HB2  . TYR A 1 117 ? 125.352 5.137   -4.603  1.00 0.00 ? 117 TYR A HB2  4  
ATOM 8438  H HB3  . TYR A 1 117 ? 124.475 6.123   -5.796  1.00 0.00 ? 117 TYR A HB3  4  
ATOM 8439  H HD1  . TYR A 1 117 ? 127.891 6.068   -4.195  1.00 0.00 ? 117 TYR A HD1  4  
ATOM 8440  H HD2  . TYR A 1 117 ? 125.581 6.517   -7.737  1.00 0.00 ? 117 TYR A HD2  4  
ATOM 8441  H HE1  . TYR A 1 117 ? 129.958 6.331   -5.515  1.00 0.00 ? 117 TYR A HE1  4  
ATOM 8442  H HE2  . TYR A 1 117 ? 127.634 6.779   -9.052  1.00 0.00 ? 117 TYR A HE2  4  
ATOM 8443  H HH   . TYR A 1 117 ? 130.760 6.228   -7.670  1.00 0.00 ? 117 TYR A HH   4  
ATOM 8444  N N    . THR A 1 118 ? 124.352 9.144   -5.200  1.00 0.00 ? 118 THR A N    4  
ATOM 8445  C CA   . THR A 1 118 ? 124.485 10.490  -5.727  1.00 0.00 ? 118 THR A CA   4  
ATOM 8446  C C    . THR A 1 118 ? 124.657 11.508  -4.573  1.00 0.00 ? 118 THR A C    4  
ATOM 8447  O O    . THR A 1 118 ? 125.596 12.354  -4.555  1.00 0.00 ? 118 THR A O    4  
ATOM 8448  C CB   . THR A 1 118 ? 123.236 10.821  -6.560  1.00 0.00 ? 118 THR A CB   4  
ATOM 8449  O OG1  . THR A 1 118 ? 122.079 10.459  -5.802  1.00 0.00 ? 118 THR A OG1  4  
ATOM 8450  C CG2  . THR A 1 118 ? 123.229 10.037  -7.859  1.00 0.00 ? 118 THR A CG2  4  
ATOM 8451  H H    . THR A 1 118 ? 123.508 8.664   -5.347  1.00 0.00 ? 118 THR A H    4  
ATOM 8452  H HA   . THR A 1 118 ? 125.353 10.522  -6.369  1.00 0.00 ? 118 THR A HA   4  
ATOM 8453  H HB   . THR A 1 118 ? 123.218 11.879  -6.776  1.00 0.00 ? 118 THR A HB   4  
ATOM 8454  H HG1  . THR A 1 118 ? 121.415 11.157  -5.900  1.00 0.00 ? 118 THR A HG1  4  
ATOM 8455  H HG21 . THR A 1 118 ? 123.222 8.978   -7.640  1.00 0.00 ? 118 THR A HG21 4  
ATOM 8456  H HG22 . THR A 1 118 ? 124.110 10.279  -8.435  1.00 0.00 ? 118 THR A HG22 4  
ATOM 8457  H HG23 . THR A 1 118 ? 122.347 10.289  -8.428  1.00 0.00 ? 118 THR A HG23 4  
ATOM 8458  N N    . ARG A 1 119 ? 123.797 11.379  -3.589  1.00 0.00 ? 119 ARG A N    4  
ATOM 8459  C CA   . ARG A 1 119 ? 123.834 12.231  -2.428  1.00 0.00 ? 119 ARG A CA   4  
ATOM 8460  C C    . ARG A 1 119 ? 125.086 11.950  -1.605  1.00 0.00 ? 119 ARG A C    4  
ATOM 8461  O O    . ARG A 1 119 ? 125.631 12.843  -0.975  1.00 0.00 ? 119 ARG A O    4  
ATOM 8462  C CB   . ARG A 1 119 ? 122.591 12.054  -1.586  1.00 0.00 ? 119 ARG A CB   4  
ATOM 8463  C CG   . ARG A 1 119 ? 121.296 12.394  -2.287  1.00 0.00 ? 119 ARG A CG   4  
ATOM 8464  C CD   . ARG A 1 119 ? 120.135 12.241  -1.336  1.00 0.00 ? 119 ARG A CD   4  
ATOM 8465  N NE   . ARG A 1 119 ? 120.256 13.143  -0.178  1.00 0.00 ? 119 ARG A NE   4  
ATOM 8466  C CZ   . ARG A 1 119 ? 119.840 12.856  1.063   1.00 0.00 ? 119 ARG A CZ   4  
ATOM 8467  N NH1  . ARG A 1 119 ? 119.449 11.632  1.369   1.00 0.00 ? 119 ARG A NH1  4  
ATOM 8468  N NH2  . ARG A 1 119 ? 119.889 13.784  2.014   1.00 0.00 ? 119 ARG A NH2  4  
ATOM 8469  H H    . ARG A 1 119 ? 123.109 10.683  -3.674  1.00 0.00 ? 119 ARG A H    4  
ATOM 8470  H HA   . ARG A 1 119 ? 123.881 13.252  -2.777  1.00 0.00 ? 119 ARG A HA   4  
ATOM 8471  H HB2  . ARG A 1 119 ? 122.534 11.025  -1.264  1.00 0.00 ? 119 ARG A HB2  4  
ATOM 8472  H HB3  . ARG A 1 119 ? 122.678 12.684  -0.714  1.00 0.00 ? 119 ARG A HB3  4  
ATOM 8473  H HG2  . ARG A 1 119 ? 121.338 13.416  -2.634  1.00 0.00 ? 119 ARG A HG2  4  
ATOM 8474  H HG3  . ARG A 1 119 ? 121.160 11.727  -3.125  1.00 0.00 ? 119 ARG A HG3  4  
ATOM 8475  H HD2  . ARG A 1 119 ? 119.221 12.466  -1.864  1.00 0.00 ? 119 ARG A HD2  4  
ATOM 8476  H HD3  . ARG A 1 119 ? 120.106 11.220  -0.983  1.00 0.00 ? 119 ARG A HD3  4  
ATOM 8477  H HE   . ARG A 1 119 ? 120.643 14.030  -0.387  1.00 0.00 ? 119 ARG A HE   4  
ATOM 8478  H HH11 . ARG A 1 119 ? 119.454 10.863  0.710   1.00 0.00 ? 119 ARG A HH11 4  
ATOM 8479  H HH12 . ARG A 1 119 ? 119.104 11.403  2.289   1.00 0.00 ? 119 ARG A HH12 4  
ATOM 8480  H HH21 . ARG A 1 119 ? 120.241 14.710  1.836   1.00 0.00 ? 119 ARG A HH21 4  
ATOM 8481  H HH22 . ARG A 1 119 ? 119.572 13.608  2.955   1.00 0.00 ? 119 ARG A HH22 4  
ATOM 8482  N N    . PHE A 1 120 ? 125.531 10.706  -1.614  1.00 0.00 ? 120 PHE A N    4  
ATOM 8483  C CA   . PHE A 1 120 ? 126.771 10.325  -0.969  1.00 0.00 ? 120 PHE A CA   4  
ATOM 8484  C C    . PHE A 1 120 ? 127.938 11.032  -1.636  1.00 0.00 ? 120 PHE A C    4  
ATOM 8485  O O    . PHE A 1 120 ? 128.837 11.492  -0.970  1.00 0.00 ? 120 PHE A O    4  
ATOM 8486  C CB   . PHE A 1 120 ? 126.970 8.796   -0.988  1.00 0.00 ? 120 PHE A CB   4  
ATOM 8487  C CG   . PHE A 1 120 ? 128.341 8.336   -0.561  1.00 0.00 ? 120 PHE A CG   4  
ATOM 8488  C CD1  . PHE A 1 120 ? 128.711 8.316   0.775   1.00 0.00 ? 120 PHE A CD1  4  
ATOM 8489  C CD2  . PHE A 1 120 ? 129.260 7.921   -1.511  1.00 0.00 ? 120 PHE A CD2  4  
ATOM 8490  C CE1  . PHE A 1 120 ? 129.975 7.893   1.146   1.00 0.00 ? 120 PHE A CE1  4  
ATOM 8491  C CE2  . PHE A 1 120 ? 130.514 7.501   -1.142  1.00 0.00 ? 120 PHE A CE2  4  
ATOM 8492  C CZ   . PHE A 1 120 ? 130.872 7.485   0.186   1.00 0.00 ? 120 PHE A CZ   4  
ATOM 8493  H H    . PHE A 1 120 ? 124.988 10.004  -2.039  1.00 0.00 ? 120 PHE A H    4  
ATOM 8494  H HA   . PHE A 1 120 ? 126.692 10.660  0.056   1.00 0.00 ? 120 PHE A HA   4  
ATOM 8495  H HB2  . PHE A 1 120 ? 126.252 8.343   -0.320  1.00 0.00 ? 120 PHE A HB2  4  
ATOM 8496  H HB3  . PHE A 1 120 ? 126.791 8.434   -1.989  1.00 0.00 ? 120 PHE A HB3  4  
ATOM 8497  H HD1  . PHE A 1 120 ? 128.006 8.637   1.527   1.00 0.00 ? 120 PHE A HD1  4  
ATOM 8498  H HD2  . PHE A 1 120 ? 128.983 7.933   -2.554  1.00 0.00 ? 120 PHE A HD2  4  
ATOM 8499  H HE1  . PHE A 1 120 ? 130.277 7.873   2.185   1.00 0.00 ? 120 PHE A HE1  4  
ATOM 8500  H HE2  . PHE A 1 120 ? 131.220 7.181   -1.895  1.00 0.00 ? 120 PHE A HE2  4  
ATOM 8501  H HZ   . PHE A 1 120 ? 131.859 7.156   0.476   1.00 0.00 ? 120 PHE A HZ   4  
ATOM 8502  N N    . LEU A 1 121 ? 127.891 11.157  -2.942  1.00 0.00 ? 121 LEU A N    4  
ATOM 8503  C CA   . LEU A 1 121 ? 128.937 11.850  -3.677  1.00 0.00 ? 121 LEU A CA   4  
ATOM 8504  C C    . LEU A 1 121 ? 129.032 13.305  -3.272  1.00 0.00 ? 121 LEU A C    4  
ATOM 8505  O O    . LEU A 1 121 ? 130.094 13.917  -3.376  1.00 0.00 ? 121 LEU A O    4  
ATOM 8506  C CB   . LEU A 1 121 ? 128.757 11.695  -5.178  1.00 0.00 ? 121 LEU A CB   4  
ATOM 8507  C CG   . LEU A 1 121 ? 128.942 10.277  -5.690  1.00 0.00 ? 121 LEU A CG   4  
ATOM 8508  C CD1  . LEU A 1 121 ? 128.666 10.211  -7.171  1.00 0.00 ? 121 LEU A CD1  4  
ATOM 8509  C CD2  . LEU A 1 121 ? 130.352 9.796   -5.382  1.00 0.00 ? 121 LEU A CD2  4  
ATOM 8510  H H    . LEU A 1 121 ? 127.142 10.751  -3.435  1.00 0.00 ? 121 LEU A H    4  
ATOM 8511  H HA   . LEU A 1 121 ? 129.867 11.380  -3.393  1.00 0.00 ? 121 LEU A HA   4  
ATOM 8512  H HB2  . LEU A 1 121 ? 127.763 12.029  -5.437  1.00 0.00 ? 121 LEU A HB2  4  
ATOM 8513  H HB3  . LEU A 1 121 ? 129.479 12.327  -5.674  1.00 0.00 ? 121 LEU A HB3  4  
ATOM 8514  H HG   . LEU A 1 121 ? 128.246 9.621   -5.187  1.00 0.00 ? 121 LEU A HG   4  
ATOM 8515  H HD11 . LEU A 1 121 ? 128.801 9.198   -7.516  1.00 0.00 ? 121 LEU A HD11 4  
ATOM 8516  H HD12 . LEU A 1 121 ? 129.349 10.864  -7.695  1.00 0.00 ? 121 LEU A HD12 4  
ATOM 8517  H HD13 . LEU A 1 121 ? 127.650 10.522  -7.363  1.00 0.00 ? 121 LEU A HD13 4  
ATOM 8518  H HD21 . LEU A 1 121 ? 130.554 9.935   -4.328  1.00 0.00 ? 121 LEU A HD21 4  
ATOM 8519  H HD22 . LEU A 1 121 ? 131.063 10.377  -5.951  1.00 0.00 ? 121 LEU A HD22 4  
ATOM 8520  H HD23 . LEU A 1 121 ? 130.448 8.750   -5.633  1.00 0.00 ? 121 LEU A HD23 4  
ATOM 8521  N N    . LYS A 1 122 ? 127.927 13.863  -2.827  1.00 0.00 ? 122 LYS A N    4  
ATOM 8522  C CA   . LYS A 1 122 ? 127.958 15.205  -2.276  1.00 0.00 ? 122 LYS A CA   4  
ATOM 8523  C C    . LYS A 1 122 ? 127.876 15.258  -0.753  1.00 0.00 ? 122 LYS A C    4  
ATOM 8524  O O    . LYS A 1 122 ? 127.796 16.341  -0.177  1.00 0.00 ? 122 LYS A O    4  
ATOM 8525  C CB   . LYS A 1 122 ? 126.952 16.128  -2.933  1.00 0.00 ? 122 LYS A CB   4  
ATOM 8526  C CG   . LYS A 1 122 ? 127.434 16.664  -4.258  1.00 0.00 ? 122 LYS A CG   4  
ATOM 8527  C CD   . LYS A 1 122 ? 128.731 17.434  -4.053  1.00 0.00 ? 122 LYS A CD   4  
ATOM 8528  C CE   . LYS A 1 122 ? 129.232 18.042  -5.330  1.00 0.00 ? 122 LYS A CE   4  
ATOM 8529  N NZ   . LYS A 1 122 ? 130.486 18.791  -5.131  1.00 0.00 ? 122 LYS A NZ   4  
ATOM 8530  H H    . LYS A 1 122 ? 127.080 13.369  -2.919  1.00 0.00 ? 122 LYS A H    4  
ATOM 8531  H HA   . LYS A 1 122 ? 128.944 15.573  -2.523  1.00 0.00 ? 122 LYS A HA   4  
ATOM 8532  H HB2  . LYS A 1 122 ? 126.032 15.585  -3.097  1.00 0.00 ? 122 LYS A HB2  4  
ATOM 8533  H HB3  . LYS A 1 122 ? 126.760 16.965  -2.278  1.00 0.00 ? 122 LYS A HB3  4  
ATOM 8534  H HG2  . LYS A 1 122 ? 127.608 15.841  -4.934  1.00 0.00 ? 122 LYS A HG2  4  
ATOM 8535  H HG3  . LYS A 1 122 ? 126.691 17.331  -4.668  1.00 0.00 ? 122 LYS A HG3  4  
ATOM 8536  H HD2  . LYS A 1 122 ? 128.561 18.225  -3.338  1.00 0.00 ? 122 LYS A HD2  4  
ATOM 8537  H HD3  . LYS A 1 122 ? 129.476 16.756  -3.666  1.00 0.00 ? 122 LYS A HD3  4  
ATOM 8538  H HE2  . LYS A 1 122 ? 129.433 17.231  -6.012  1.00 0.00 ? 122 LYS A HE2  4  
ATOM 8539  H HE3  . LYS A 1 122 ? 128.473 18.699  -5.727  1.00 0.00 ? 122 LYS A HE3  4  
ATOM 8540  H HZ1  . LYS A 1 122 ? 131.283 18.136  -4.973  1.00 0.00 ? 122 LYS A HZ1  4  
ATOM 8541  H HZ2  . LYS A 1 122 ? 130.414 19.416  -4.298  1.00 0.00 ? 122 LYS A HZ2  4  
ATOM 8542  H HZ3  . LYS A 1 122 ? 130.713 19.387  -5.956  1.00 0.00 ? 122 LYS A HZ3  4  
ATOM 8543  N N    . SER A 1 123 ? 127.921 14.113  -0.101  1.00 0.00 ? 123 SER A N    4  
ATOM 8544  C CA   . SER A 1 123 ? 127.919 14.093  1.344   1.00 0.00 ? 123 SER A CA   4  
ATOM 8545  C C    . SER A 1 123 ? 129.252 14.596  1.839   1.00 0.00 ? 123 SER A C    4  
ATOM 8546  O O    . SER A 1 123 ? 130.301 14.332  1.213   1.00 0.00 ? 123 SER A O    4  
ATOM 8547  C CB   . SER A 1 123 ? 127.660 12.687  1.900   1.00 0.00 ? 123 SER A CB   4  
ATOM 8548  O OG   . SER A 1 123 ? 128.733 11.795  1.604   1.00 0.00 ? 123 SER A OG   4  
ATOM 8549  H H    . SER A 1 123 ? 127.929 13.277  -0.610  1.00 0.00 ? 123 SER A H    4  
ATOM 8550  H HA   . SER A 1 123 ? 127.143 14.763  1.684   1.00 0.00 ? 123 SER A HA   4  
ATOM 8551  H HB2  . SER A 1 123 ? 127.545 12.744  2.972   1.00 0.00 ? 123 SER A HB2  4  
ATOM 8552  H HB3  . SER A 1 123 ? 126.752 12.295  1.464   1.00 0.00 ? 123 SER A HB3  4  
ATOM 8553  H HG   . SER A 1 123 ? 128.835 11.738  0.643   1.00 0.00 ? 123 SER A HG   4  
ATOM 8554  N N    . ASP A 1 124 ? 129.240 15.295  2.939   1.00 0.00 ? 124 ASP A N    4  
ATOM 8555  C CA   . ASP A 1 124 ? 130.457 15.838  3.492   1.00 0.00 ? 124 ASP A CA   4  
ATOM 8556  C C    . ASP A 1 124 ? 131.402 14.719  3.946   1.00 0.00 ? 124 ASP A C    4  
ATOM 8557  O O    . ASP A 1 124 ? 132.600 14.941  4.041   1.00 0.00 ? 124 ASP A O    4  
ATOM 8558  C CB   . ASP A 1 124 ? 130.194 16.823  4.643   1.00 0.00 ? 124 ASP A CB   4  
ATOM 8559  C CG   . ASP A 1 124 ? 129.882 16.154  5.958   1.00 0.00 ? 124 ASP A CG   4  
ATOM 8560  O OD1  . ASP A 1 124 ? 128.721 15.762  6.186   1.00 0.00 ? 124 ASP A OD1  4  
ATOM 8561  O OD2  . ASP A 1 124 ? 130.805 16.017  6.790   1.00 0.00 ? 124 ASP A OD2  4  
ATOM 8562  H H    . ASP A 1 124 ? 128.370 15.478  3.366   1.00 0.00 ? 124 ASP A H    4  
ATOM 8563  H HA   . ASP A 1 124 ? 130.949 16.367  2.689   1.00 0.00 ? 124 ASP A HA   4  
ATOM 8564  H HB2  . ASP A 1 124 ? 131.072 17.437  4.784   1.00 0.00 ? 124 ASP A HB2  4  
ATOM 8565  H HB3  . ASP A 1 124 ? 129.362 17.457  4.375   1.00 0.00 ? 124 ASP A HB3  4  
ATOM 8566  N N    . ILE A 1 125 ? 130.868 13.507  4.206   1.00 0.00 ? 125 ILE A N    4  
ATOM 8567  C CA   . ILE A 1 125 ? 131.727 12.388  4.594   1.00 0.00 ? 125 ILE A CA   4  
ATOM 8568  C C    . ILE A 1 125 ? 132.565 11.954  3.373   1.00 0.00 ? 125 ILE A C    4  
ATOM 8569  O O    . ILE A 1 125 ? 133.792 11.770  3.478   1.00 0.00 ? 125 ILE A O    4  
ATOM 8570  C CB   . ILE A 1 125 ? 130.921 11.176  5.285   1.00 0.00 ? 125 ILE A CB   4  
ATOM 8571  C CG1  . ILE A 1 125 ? 131.846 10.247  6.122   1.00 0.00 ? 125 ILE A CG1  4  
ATOM 8572  C CG2  . ILE A 1 125 ? 130.129 10.317  4.290   1.00 0.00 ? 125 ILE A CG2  4  
ATOM 8573  C CD1  . ILE A 1 125 ? 132.770 9.330   5.330   1.00 0.00 ? 125 ILE A CD1  4  
ATOM 8574  H H    . ILE A 1 125 ? 129.895 13.392  4.149   1.00 0.00 ? 125 ILE A H    4  
ATOM 8575  H HA   . ILE A 1 125 ? 132.427 12.805  5.305   1.00 0.00 ? 125 ILE A HA   4  
ATOM 8576  H HB   . ILE A 1 125 ? 130.201 11.621  5.955   1.00 0.00 ? 125 ILE A HB   4  
ATOM 8577  H HG12 . ILE A 1 125 ? 132.472 10.861  6.753   1.00 0.00 ? 125 ILE A HG12 4  
ATOM 8578  H HG13 . ILE A 1 125 ? 131.225 9.628   6.754   1.00 0.00 ? 125 ILE A HG13 4  
ATOM 8579  H HG21 . ILE A 1 125 ? 130.814 9.794   3.633   1.00 0.00 ? 125 ILE A HG21 4  
ATOM 8580  H HG22 . ILE A 1 125 ? 129.455 10.930  3.711   1.00 0.00 ? 125 ILE A HG22 4  
ATOM 8581  H HG23 . ILE A 1 125 ? 129.570 9.586   4.859   1.00 0.00 ? 125 ILE A HG23 4  
ATOM 8582  H HD11 . ILE A 1 125 ? 133.422 9.928   4.710   1.00 0.00 ? 125 ILE A HD11 4  
ATOM 8583  H HD12 . ILE A 1 125 ? 132.180 8.674   4.707   1.00 0.00 ? 125 ILE A HD12 4  
ATOM 8584  H HD13 . ILE A 1 125 ? 133.362 8.740   6.014   1.00 0.00 ? 125 ILE A HD13 4  
ATOM 8585  N N    . TYR A 1 126 ? 131.933 11.886  2.198   1.00 0.00 ? 126 TYR A N    4  
ATOM 8586  C CA   . TYR A 1 126 ? 132.655 11.527  0.990   1.00 0.00 ? 126 TYR A CA   4  
ATOM 8587  C C    . TYR A 1 126 ? 133.511 12.690  0.512   1.00 0.00 ? 126 TYR A C    4  
ATOM 8588  O O    . TYR A 1 126 ? 134.633 12.493  0.058   1.00 0.00 ? 126 TYR A O    4  
ATOM 8589  C CB   . TYR A 1 126 ? 131.726 11.021  -0.124  1.00 0.00 ? 126 TYR A CB   4  
ATOM 8590  C CG   . TYR A 1 126 ? 132.448 10.720  -1.429  1.00 0.00 ? 126 TYR A CG   4  
ATOM 8591  C CD1  . TYR A 1 126 ? 133.327 9.648   -1.536  1.00 0.00 ? 126 TYR A CD1  4  
ATOM 8592  C CD2  . TYR A 1 126 ? 132.290 11.541  -2.531  1.00 0.00 ? 126 TYR A CD2  4  
ATOM 8593  C CE1  . TYR A 1 126 ? 134.014 9.404   -2.706  1.00 0.00 ? 126 TYR A CE1  4  
ATOM 8594  C CE2  . TYR A 1 126 ? 132.974 11.316  -3.692  1.00 0.00 ? 126 TYR A CE2  4  
ATOM 8595  C CZ   . TYR A 1 126 ? 133.832 10.255  -3.785  1.00 0.00 ? 126 TYR A CZ   4  
ATOM 8596  O OH   . TYR A 1 126 ? 134.521 10.055  -4.962  1.00 0.00 ? 126 TYR A OH   4  
ATOM 8597  H H    . TYR A 1 126 ? 130.969 12.077  2.151   1.00 0.00 ? 126 TYR A H    4  
ATOM 8598  H HA   . TYR A 1 126 ? 133.331 10.731  1.269   1.00 0.00 ? 126 TYR A HA   4  
ATOM 8599  H HB2  . TYR A 1 126 ? 131.241 10.112  0.205   1.00 0.00 ? 126 TYR A HB2  4  
ATOM 8600  H HB3  . TYR A 1 126 ? 130.975 11.771  -0.323  1.00 0.00 ? 126 TYR A HB3  4  
ATOM 8601  H HD1  . TYR A 1 126 ? 133.459 8.992   -0.688  1.00 0.00 ? 126 TYR A HD1  4  
ATOM 8602  H HD2  . TYR A 1 126 ? 131.604 12.373  -2.483  1.00 0.00 ? 126 TYR A HD2  4  
ATOM 8603  H HE1  . TYR A 1 126 ? 134.694 8.563   -2.758  1.00 0.00 ? 126 TYR A HE1  4  
ATOM 8604  H HE2  . TYR A 1 126 ? 132.833 11.978  -4.535  1.00 0.00 ? 126 TYR A HE2  4  
ATOM 8605  H HH   . TYR A 1 126 ? 135.058 10.847  -5.088  1.00 0.00 ? 126 TYR A HH   4  
ATOM 8606  N N    . LEU A 1 127 ? 133.004 13.902  0.647   1.00 0.00 ? 127 LEU A N    4  
ATOM 8607  C CA   . LEU A 1 127 ? 133.769 15.079  0.270   1.00 0.00 ? 127 LEU A CA   4  
ATOM 8608  C C    . LEU A 1 127 ? 134.984 15.260  1.183   1.00 0.00 ? 127 LEU A C    4  
ATOM 8609  O O    . LEU A 1 127 ? 135.988 15.862  0.790   1.00 0.00 ? 127 LEU A O    4  
ATOM 8610  C CB   . LEU A 1 127 ? 132.891 16.342  0.202   1.00 0.00 ? 127 LEU A CB   4  
ATOM 8611  C CG   . LEU A 1 127 ? 131.815 16.341  -0.878  1.00 0.00 ? 127 LEU A CG   4  
ATOM 8612  C CD1  . LEU A 1 127 ? 131.029 17.636  -0.843  1.00 0.00 ? 127 LEU A CD1  4  
ATOM 8613  C CD2  . LEU A 1 127 ? 132.433 16.131  -2.245  1.00 0.00 ? 127 LEU A CD2  4  
ATOM 8614  H H    . LEU A 1 127 ? 132.085 14.008  0.983   1.00 0.00 ? 127 LEU A H    4  
ATOM 8615  H HA   . LEU A 1 127 ? 134.156 14.870  -0.718  1.00 0.00 ? 127 LEU A HA   4  
ATOM 8616  H HB2  . LEU A 1 127 ? 132.368 16.468  1.136   1.00 0.00 ? 127 LEU A HB2  4  
ATOM 8617  H HB3  . LEU A 1 127 ? 133.527 17.198  0.035   1.00 0.00 ? 127 LEU A HB3  4  
ATOM 8618  H HG   . LEU A 1 127 ? 131.128 15.531  -0.687  1.00 0.00 ? 127 LEU A HG   4  
ATOM 8619  H HD11 . LEU A 1 127 ? 130.559 17.747  0.123   1.00 0.00 ? 127 LEU A HD11 4  
ATOM 8620  H HD12 . LEU A 1 127 ? 130.269 17.612  -1.610  1.00 0.00 ? 127 LEU A HD12 4  
ATOM 8621  H HD13 . LEU A 1 127 ? 131.694 18.468  -1.019  1.00 0.00 ? 127 LEU A HD13 4  
ATOM 8622  H HD21 . LEU A 1 127 ? 132.953 15.184  -2.263  1.00 0.00 ? 127 LEU A HD21 4  
ATOM 8623  H HD22 . LEU A 1 127 ? 133.130 16.929  -2.452  1.00 0.00 ? 127 LEU A HD22 4  
ATOM 8624  H HD23 . LEU A 1 127 ? 131.656 16.129  -2.994  1.00 0.00 ? 127 LEU A HD23 4  
ATOM 8625  N N    . ASP A 1 128 ? 134.901 14.704  2.385   1.00 0.00 ? 128 ASP A N    4  
ATOM 8626  C CA   . ASP A 1 128 ? 136.037 14.684  3.302   1.00 0.00 ? 128 ASP A CA   4  
ATOM 8627  C C    . ASP A 1 128 ? 137.077 13.687  2.821   1.00 0.00 ? 128 ASP A C    4  
ATOM 8628  O O    . ASP A 1 128 ? 138.266 13.932  2.939   1.00 0.00 ? 128 ASP A O    4  
ATOM 8629  C CB   . ASP A 1 128 ? 135.609 14.354  4.735   1.00 0.00 ? 128 ASP A CB   4  
ATOM 8630  C CG   . ASP A 1 128 ? 136.784 14.214  5.685   1.00 0.00 ? 128 ASP A CG   4  
ATOM 8631  O OD1  . ASP A 1 128 ? 137.401 15.242  6.068   1.00 0.00 ? 128 ASP A OD1  4  
ATOM 8632  O OD2  . ASP A 1 128 ? 137.122 13.077  6.056   1.00 0.00 ? 128 ASP A OD2  4  
ATOM 8633  H H    . ASP A 1 128 ? 134.045 14.323  2.676   1.00 0.00 ? 128 ASP A H    4  
ATOM 8634  H HA   . ASP A 1 128 ? 136.481 15.668  3.281   1.00 0.00 ? 128 ASP A HA   4  
ATOM 8635  H HB2  . ASP A 1 128 ? 134.969 15.141  5.104   1.00 0.00 ? 128 ASP A HB2  4  
ATOM 8636  H HB3  . ASP A 1 128 ? 135.058 13.424  4.732   1.00 0.00 ? 128 ASP A HB3  4  
ATOM 8637  N N    . LEU A 1 129 ? 136.617 12.563  2.249   1.00 0.00 ? 129 LEU A N    4  
ATOM 8638  C CA   . LEU A 1 129 ? 137.539 11.564  1.667   1.00 0.00 ? 129 LEU A CA   4  
ATOM 8639  C C    . LEU A 1 129 ? 138.219 12.197  0.455   1.00 0.00 ? 129 LEU A C    4  
ATOM 8640  O O    . LEU A 1 129 ? 139.352 11.871  0.111   1.00 0.00 ? 129 LEU A O    4  
ATOM 8641  C CB   . LEU A 1 129 ? 136.787 10.294  1.197   1.00 0.00 ? 129 LEU A CB   4  
ATOM 8642  C CG   . LEU A 1 129 ? 135.777 9.676   2.174   1.00 0.00 ? 129 LEU A CG   4  
ATOM 8643  C CD1  . LEU A 1 129 ? 134.895 8.691   1.456   1.00 0.00 ? 129 LEU A CD1  4  
ATOM 8644  C CD2  . LEU A 1 129 ? 136.479 8.971   3.317   1.00 0.00 ? 129 LEU A CD2  4  
ATOM 8645  H H    . LEU A 1 129 ? 135.650 12.400  2.232   1.00 0.00 ? 129 LEU A H    4  
ATOM 8646  H HA   . LEU A 1 129 ? 138.281 11.306  2.408   1.00 0.00 ? 129 LEU A HA   4  
ATOM 8647  H HB2  . LEU A 1 129 ? 136.363 10.397  0.208   1.00 0.00 ? 129 LEU A HB2  4  
ATOM 8648  H HB3  . LEU A 1 129 ? 137.567 9.556   1.075   1.00 0.00 ? 129 LEU A HB3  4  
ATOM 8649  H HG   . LEU A 1 129 ? 135.153 10.455  2.586   1.00 0.00 ? 129 LEU A HG   4  
ATOM 8650  H HD11 . LEU A 1 129 ? 134.358 9.198   0.668   1.00 0.00 ? 129 LEU A HD11 4  
ATOM 8651  H HD12 . LEU A 1 129 ? 134.190 8.263   2.155   1.00 0.00 ? 129 LEU A HD12 4  
ATOM 8652  H HD13 . LEU A 1 129 ? 135.501 7.906   1.030   1.00 0.00 ? 129 LEU A HD13 4  
ATOM 8653  H HD21 . LEU A 1 129 ? 137.174 8.246   2.919   1.00 0.00 ? 129 LEU A HD21 4  
ATOM 8654  H HD22 . LEU A 1 129 ? 135.728 8.444   3.891   1.00 0.00 ? 129 LEU A HD22 4  
ATOM 8655  H HD23 . LEU A 1 129 ? 136.996 9.686   3.940   1.00 0.00 ? 129 LEU A HD23 4  
ATOM 8656  N N    . MET A 1 130 ? 137.495 13.107  -0.189  1.00 0.00 ? 130 MET A N    4  
ATOM 8657  C CA   . MET A 1 130 ? 137.995 13.817  -1.346  1.00 0.00 ? 130 MET A CA   4  
ATOM 8658  C C    . MET A 1 130 ? 139.098 14.766  -0.971  1.00 0.00 ? 130 MET A C    4  
ATOM 8659  O O    . MET A 1 130 ? 140.242 14.602  -1.435  1.00 0.00 ? 130 MET A O    4  
ATOM 8660  C CB   . MET A 1 130 ? 136.877 14.583  -2.092  1.00 0.00 ? 130 MET A CB   4  
ATOM 8661  C CG   . MET A 1 130 ? 135.766 13.736  -2.738  1.00 0.00 ? 130 MET A CG   4  
ATOM 8662  S SD   . MET A 1 130 ? 136.347 12.581  -4.012  1.00 0.00 ? 130 MET A SD   4  
ATOM 8663  C CE   . MET A 1 130 ? 137.152 11.320  -3.018  1.00 0.00 ? 130 MET A CE   4  
ATOM 8664  H H    . MET A 1 130 ? 136.586 13.279  0.139   1.00 0.00 ? 130 MET A H    4  
ATOM 8665  H HA   . MET A 1 130 ? 138.405 13.081  -2.021  1.00 0.00 ? 130 MET A HA   4  
ATOM 8666  H HB2  . MET A 1 130 ? 136.403 15.254  -1.391  1.00 0.00 ? 130 MET A HB2  4  
ATOM 8667  H HB3  . MET A 1 130 ? 137.339 15.177  -2.866  1.00 0.00 ? 130 MET A HB3  4  
ATOM 8668  H HG2  . MET A 1 130 ? 135.261 13.161  -1.976  1.00 0.00 ? 130 MET A HG2  4  
ATOM 8669  H HG3  . MET A 1 130 ? 135.054 14.411  -3.190  1.00 0.00 ? 130 MET A HG3  4  
ATOM 8670  H HE1  . MET A 1 130 ? 137.882 11.786  -2.374  1.00 0.00 ? 130 MET A HE1  4  
ATOM 8671  H HE2  . MET A 1 130 ? 137.674 10.633  -3.674  1.00 0.00 ? 130 MET A HE2  4  
ATOM 8672  H HE3  . MET A 1 130 ? 136.424 10.788  -2.424  1.00 0.00 ? 130 MET A HE3  4  
ATOM 8673  N N    . GLU A 1 131 ? 138.760 15.741  -0.106  1.00 0.00 ? 131 GLU A N    4  
ATOM 8674  C CA   . GLU A 1 131 ? 139.655 16.832  0.314   1.00 0.00 ? 131 GLU A CA   4  
ATOM 8675  C C    . GLU A 1 131 ? 139.965 17.745  -0.885  1.00 0.00 ? 131 GLU A C    4  
ATOM 8676  O O    . GLU A 1 131 ? 139.507 18.889  -0.954  1.00 0.00 ? 131 GLU A O    4  
ATOM 8677  C CB   . GLU A 1 131 ? 140.948 16.291  0.959   1.00 0.00 ? 131 GLU A CB   4  
ATOM 8678  C CG   . GLU A 1 131 ? 141.942 17.361  1.383   1.00 0.00 ? 131 GLU A CG   4  
ATOM 8679  C CD   . GLU A 1 131 ? 143.223 16.767  1.891   1.00 0.00 ? 131 GLU A CD   4  
ATOM 8680  O OE1  . GLU A 1 131 ? 144.021 16.261  1.073   1.00 0.00 ? 131 GLU A OE1  4  
ATOM 8681  O OE2  . GLU A 1 131 ? 143.473 16.790  3.111   1.00 0.00 ? 131 GLU A OE2  4  
ATOM 8682  H H    . GLU A 1 131 ? 137.856 15.729  0.279   1.00 0.00 ? 131 GLU A H    4  
ATOM 8683  H HA   . GLU A 1 131 ? 139.107 17.419  1.038   1.00 0.00 ? 131 GLU A HA   4  
ATOM 8684  H HB2  . GLU A 1 131 ? 140.680 15.717  1.834   1.00 0.00 ? 131 GLU A HB2  4  
ATOM 8685  H HB3  . GLU A 1 131 ? 141.433 15.635  0.251   1.00 0.00 ? 131 GLU A HB3  4  
ATOM 8686  H HG2  . GLU A 1 131 ? 142.165 17.989  0.533   1.00 0.00 ? 131 GLU A HG2  4  
ATOM 8687  H HG3  . GLU A 1 131 ? 141.499 17.958  2.166   1.00 0.00 ? 131 GLU A HG3  4  
ATOM 8688  N N    . GLY A 1 132 ? 140.678 17.195  -1.830  1.00 0.00 ? 132 GLY A N    4  
ATOM 8689  C CA   . GLY A 1 132 ? 141.065 17.873  -3.027  1.00 0.00 ? 132 GLY A CA   4  
ATOM 8690  C C    . GLY A 1 132 ? 142.164 17.103  -3.715  1.00 0.00 ? 132 GLY A C    4  
ATOM 8691  O O    . GLY A 1 132 ? 143.061 17.683  -4.315  1.00 0.00 ? 132 GLY A O    4  
ATOM 8692  H H    . GLY A 1 132 ? 140.937 16.256  -1.694  1.00 0.00 ? 132 GLY A H    4  
ATOM 8693  H HA2  . GLY A 1 132 ? 140.211 17.953  -3.683  1.00 0.00 ? 132 GLY A HA2  4  
ATOM 8694  H HA3  . GLY A 1 132 ? 141.429 18.860  -2.781  1.00 0.00 ? 132 GLY A HA3  4  
ATOM 8695  N N    . ARG A 1 133 ? 142.081 15.791  -3.642  1.00 0.00 ? 133 ARG A N    4  
ATOM 8696  C CA   . ARG A 1 133 ? 143.115 14.907  -4.172  1.00 0.00 ? 133 ARG A CA   4  
ATOM 8697  C C    . ARG A 1 133 ? 142.677 14.336  -5.529  1.00 0.00 ? 133 ARG A C    4  
ATOM 8698  O O    . ARG A 1 133 ? 141.574 13.813  -5.645  1.00 0.00 ? 133 ARG A O    4  
ATOM 8699  C CB   . ARG A 1 133 ? 143.330 13.745  -3.203  1.00 0.00 ? 133 ARG A CB   4  
ATOM 8700  C CG   . ARG A 1 133 ? 143.785 14.127  -1.796  1.00 0.00 ? 133 ARG A CG   4  
ATOM 8701  C CD   . ARG A 1 133 ? 145.258 14.485  -1.726  1.00 0.00 ? 133 ARG A CD   4  
ATOM 8702  N NE   . ARG A 1 133 ? 145.679 14.717  -0.329  1.00 0.00 ? 133 ARG A NE   4  
ATOM 8703  C CZ   . ARG A 1 133 ? 146.779 14.201  0.259   1.00 0.00 ? 133 ARG A CZ   4  
ATOM 8704  N NH1  . ARG A 1 133 ? 147.554 13.340  -0.391  1.00 0.00 ? 133 ARG A NH1  4  
ATOM 8705  N NH2  . ARG A 1 133 ? 147.073 14.526  1.518   1.00 0.00 ? 133 ARG A NH2  4  
ATOM 8706  H H    . ARG A 1 133 ? 141.269 15.381  -3.267  1.00 0.00 ? 133 ARG A H    4  
ATOM 8707  H HA   . ARG A 1 133 ? 144.038 15.458  -4.275  1.00 0.00 ? 133 ARG A HA   4  
ATOM 8708  H HB2  . ARG A 1 133 ? 142.402 13.201  -3.111  1.00 0.00 ? 133 ARG A HB2  4  
ATOM 8709  H HB3  . ARG A 1 133 ? 144.072 13.085  -3.628  1.00 0.00 ? 133 ARG A HB3  4  
ATOM 8710  H HG2  . ARG A 1 133 ? 143.214 14.983  -1.469  1.00 0.00 ? 133 ARG A HG2  4  
ATOM 8711  H HG3  . ARG A 1 133 ? 143.592 13.297  -1.133  1.00 0.00 ? 133 ARG A HG3  4  
ATOM 8712  H HD2  . ARG A 1 133 ? 145.835 13.673  -2.142  1.00 0.00 ? 133 ARG A HD2  4  
ATOM 8713  H HD3  . ARG A 1 133 ? 145.429 15.386  -2.298  1.00 0.00 ? 133 ARG A HD3  4  
ATOM 8714  H HE   . ARG A 1 133 ? 145.067 15.312  0.180   1.00 0.00 ? 133 ARG A HE   4  
ATOM 8715  H HH11 . ARG A 1 133 ? 147.352 13.035  -1.332  1.00 0.00 ? 133 ARG A HH11 4  
ATOM 8716  H HH12 . ARG A 1 133 ? 148.384 12.945  0.027   1.00 0.00 ? 133 ARG A HH12 4  
ATOM 8717  H HH21 . ARG A 1 133 ? 146.518 15.154  2.083   1.00 0.00 ? 133 ARG A HH21 4  
ATOM 8718  H HH22 . ARG A 1 133 ? 147.863 14.124  1.998   1.00 0.00 ? 133 ARG A HH22 4  
ATOM 8719  N N    . PRO A 1 134 ? 143.507 14.470  -6.570  1.00 0.00 ? 134 PRO A N    4  
ATOM 8720  C CA   . PRO A 1 134 ? 143.231 13.897  -7.890  1.00 0.00 ? 134 PRO A CA   4  
ATOM 8721  C C    . PRO A 1 134 ? 143.754 12.439  -8.026  1.00 0.00 ? 134 PRO A C    4  
ATOM 8722  O O    . PRO A 1 134 ? 144.671 12.014  -7.286  1.00 0.00 ? 134 PRO A O    4  
ATOM 8723  C CB   . PRO A 1 134 ? 144.007 14.828  -8.843  1.00 0.00 ? 134 PRO A CB   4  
ATOM 8724  C CG   . PRO A 1 134 ? 144.725 15.821  -7.966  1.00 0.00 ? 134 PRO A CG   4  
ATOM 8725  C CD   . PRO A 1 134 ? 144.740 15.239  -6.585  1.00 0.00 ? 134 PRO A CD   4  
ATOM 8726  H HA   . PRO A 1 134 ? 142.178 13.929  -8.125  1.00 0.00 ? 134 PRO A HA   4  
ATOM 8727  H HB2  . PRO A 1 134 ? 144.707 14.244  -9.423  1.00 0.00 ? 134 PRO A HB2  4  
ATOM 8728  H HB3  . PRO A 1 134 ? 143.312 15.323  -9.506  1.00 0.00 ? 134 PRO A HB3  4  
ATOM 8729  H HG2  . PRO A 1 134 ? 145.736 15.960  -8.321  1.00 0.00 ? 134 PRO A HG2  4  
ATOM 8730  H HG3  . PRO A 1 134 ? 144.195 16.762  -7.973  1.00 0.00 ? 134 PRO A HG3  4  
ATOM 8731  H HD2  . PRO A 1 134 ? 145.601 14.602  -6.448  1.00 0.00 ? 134 PRO A HD2  4  
ATOM 8732  H HD3  . PRO A 1 134 ? 144.717 16.021  -5.840  1.00 0.00 ? 134 PRO A HD3  4  
ATOM 8733  N N    . SER A 1 1   ? 146.666 6.323   6.714   1.00 0.00 ? 1   SER A N    5  
ATOM 8734  C CA   . SER A 1 1   ? 145.544 5.925   7.538   1.00 0.00 ? 1   SER A CA   5  
ATOM 8735  C C    . SER A 1 1   ? 144.247 6.048   6.742   1.00 0.00 ? 1   SER A C    5  
ATOM 8736  O O    . SER A 1 1   ? 144.002 7.080   6.104   1.00 0.00 ? 1   SER A O    5  
ATOM 8737  C CB   . SER A 1 1   ? 145.514 6.792   8.792   1.00 0.00 ? 1   SER A CB   5  
ATOM 8738  O OG   . SER A 1 1   ? 146.750 6.688   9.499   1.00 0.00 ? 1   SER A OG   5  
ATOM 8739  H H1   . SER A 1 1   ? 147.562 6.245   7.237   1.00 0.00 ? 1   SER A H1   5  
ATOM 8740  H H2   . SER A 1 1   ? 146.553 7.315   6.413   1.00 0.00 ? 1   SER A H2   5  
ATOM 8741  H H3   . SER A 1 1   ? 146.715 5.730   5.859   1.00 0.00 ? 1   SER A H3   5  
ATOM 8742  H HA   . SER A 1 1   ? 145.682 4.892   7.821   1.00 0.00 ? 1   SER A HA   5  
ATOM 8743  H HB2  . SER A 1 1   ? 145.354 7.824   8.512   1.00 0.00 ? 1   SER A HB2  5  
ATOM 8744  H HB3  . SER A 1 1   ? 144.713 6.463   9.437   1.00 0.00 ? 1   SER A HB3  5  
ATOM 8745  H HG   . SER A 1 1   ? 146.811 5.790   9.866   1.00 0.00 ? 1   SER A HG   5  
ATOM 8746  N N    . MET A 1 2   ? 143.448 4.967   6.753   1.00 0.00 ? 2   MET A N    5  
ATOM 8747  C CA   . MET A 1 2   ? 142.173 4.869   6.025   1.00 0.00 ? 2   MET A CA   5  
ATOM 8748  C C    . MET A 1 2   ? 142.368 4.884   4.521   1.00 0.00 ? 2   MET A C    5  
ATOM 8749  O O    . MET A 1 2   ? 143.504 4.804   4.018   1.00 0.00 ? 2   MET A O    5  
ATOM 8750  C CB   . MET A 1 2   ? 141.147 5.947   6.444   1.00 0.00 ? 2   MET A CB   5  
ATOM 8751  C CG   . MET A 1 2   ? 140.503 5.709   7.792   1.00 0.00 ? 2   MET A CG   5  
ATOM 8752  S SD   . MET A 1 2   ? 139.232 6.934   8.196   1.00 0.00 ? 2   MET A SD   5  
ATOM 8753  C CE   . MET A 1 2   ? 138.104 6.725   6.807   1.00 0.00 ? 2   MET A CE   5  
ATOM 8754  H H    . MET A 1 2   ? 143.749 4.179   7.264   1.00 0.00 ? 2   MET A H    5  
ATOM 8755  H HA   . MET A 1 2   ? 141.767 3.900   6.277   1.00 0.00 ? 2   MET A HA   5  
ATOM 8756  H HB2  . MET A 1 2   ? 141.649 6.902   6.479   1.00 0.00 ? 2   MET A HB2  5  
ATOM 8757  H HB3  . MET A 1 2   ? 140.369 5.990   5.697   1.00 0.00 ? 2   MET A HB3  5  
ATOM 8758  H HG2  . MET A 1 2   ? 140.046 4.730   7.787   1.00 0.00 ? 2   MET A HG2  5  
ATOM 8759  H HG3  . MET A 1 2   ? 141.270 5.742   8.553   1.00 0.00 ? 2   MET A HG3  5  
ATOM 8760  H HE1  . MET A 1 2   ? 137.733 5.710   6.794   1.00 0.00 ? 2   MET A HE1  5  
ATOM 8761  H HE2  . MET A 1 2   ? 138.629 6.929   5.885   1.00 0.00 ? 2   MET A HE2  5  
ATOM 8762  H HE3  . MET A 1 2   ? 137.278 7.412   6.909   1.00 0.00 ? 2   MET A HE3  5  
ATOM 8763  N N    . VAL A 1 3   ? 141.269 4.895   3.810   1.00 0.00 ? 3   VAL A N    5  
ATOM 8764  C CA   . VAL A 1 3   ? 141.269 4.988   2.375   1.00 0.00 ? 3   VAL A CA   5  
ATOM 8765  C C    . VAL A 1 3   ? 141.913 6.295   1.907   1.00 0.00 ? 3   VAL A C    5  
ATOM 8766  O O    . VAL A 1 3   ? 141.615 7.384   2.437   1.00 0.00 ? 3   VAL A O    5  
ATOM 8767  C CB   . VAL A 1 3   ? 139.820 4.832   1.776   1.00 0.00 ? 3   VAL A CB   5  
ATOM 8768  C CG1  . VAL A 1 3   ? 138.834 5.755   2.482   1.00 0.00 ? 3   VAL A CG1  5  
ATOM 8769  C CG2  . VAL A 1 3   ? 139.806 5.137   0.283   1.00 0.00 ? 3   VAL A CG2  5  
ATOM 8770  H H    . VAL A 1 3   ? 140.406 4.812   4.280   1.00 0.00 ? 3   VAL A H    5  
ATOM 8771  H HA   . VAL A 1 3   ? 141.874 4.171   2.007   1.00 0.00 ? 3   VAL A HA   5  
ATOM 8772  H HB   . VAL A 1 3   ? 139.482 3.812   1.911   1.00 0.00 ? 3   VAL A HB   5  
ATOM 8773  H HG11 . VAL A 1 3   ? 139.156 6.780   2.367   1.00 0.00 ? 3   VAL A HG11 5  
ATOM 8774  H HG12 . VAL A 1 3   ? 138.796 5.503   3.531   1.00 0.00 ? 3   VAL A HG12 5  
ATOM 8775  H HG13 . VAL A 1 3   ? 137.855 5.633   2.043   1.00 0.00 ? 3   VAL A HG13 5  
ATOM 8776  H HG21 . VAL A 1 3   ? 138.847 4.850   -0.122  1.00 0.00 ? 3   VAL A HG21 5  
ATOM 8777  H HG22 . VAL A 1 3   ? 140.600 4.611   -0.225  1.00 0.00 ? 3   VAL A HG22 5  
ATOM 8778  H HG23 . VAL A 1 3   ? 139.923 6.205   0.135   1.00 0.00 ? 3   VAL A HG23 5  
ATOM 8779  N N    . SER A 1 4   ? 142.832 6.158   0.976   1.00 0.00 ? 4   SER A N    5  
ATOM 8780  C CA   . SER A 1 4   ? 143.464 7.261   0.305   1.00 0.00 ? 4   SER A CA   5  
ATOM 8781  C C    . SER A 1 4   ? 142.380 8.134   -0.326  1.00 0.00 ? 4   SER A C    5  
ATOM 8782  O O    . SER A 1 4   ? 141.416 7.609   -0.872  1.00 0.00 ? 4   SER A O    5  
ATOM 8783  C CB   . SER A 1 4   ? 144.396 6.692   -0.789  1.00 0.00 ? 4   SER A CB   5  
ATOM 8784  O OG   . SER A 1 4   ? 144.903 7.699   -1.655  1.00 0.00 ? 4   SER A OG   5  
ATOM 8785  H H    . SER A 1 4   ? 143.102 5.244   0.724   1.00 0.00 ? 4   SER A H    5  
ATOM 8786  H HA   . SER A 1 4   ? 144.050 7.831   1.011   1.00 0.00 ? 4   SER A HA   5  
ATOM 8787  H HB2  . SER A 1 4   ? 145.234 6.199   -0.321  1.00 0.00 ? 4   SER A HB2  5  
ATOM 8788  H HB3  . SER A 1 4   ? 143.846 5.972   -1.378  1.00 0.00 ? 4   SER A HB3  5  
ATOM 8789  H HG   . SER A 1 4   ? 145.844 7.812   -1.444  1.00 0.00 ? 4   SER A HG   5  
ATOM 8790  N N    . PRO A 1 5   ? 142.506 9.460   -0.265  1.00 0.00 ? 5   PRO A N    5  
ATOM 8791  C CA   . PRO A 1 5   ? 141.519 10.369  -0.857  1.00 0.00 ? 5   PRO A CA   5  
ATOM 8792  C C    . PRO A 1 5   ? 141.364 10.108  -2.352  1.00 0.00 ? 5   PRO A C    5  
ATOM 8793  O O    . PRO A 1 5   ? 140.271 10.181  -2.897  1.00 0.00 ? 5   PRO A O    5  
ATOM 8794  C CB   . PRO A 1 5   ? 142.105 11.755  -0.614  1.00 0.00 ? 5   PRO A CB   5  
ATOM 8795  C CG   . PRO A 1 5   ? 143.069 11.578  0.507   1.00 0.00 ? 5   PRO A CG   5  
ATOM 8796  C CD   . PRO A 1 5   ? 143.604 10.188  0.389   1.00 0.00 ? 5   PRO A CD   5  
ATOM 8797  H HA   . PRO A 1 5   ? 140.550 10.275  -0.387  1.00 0.00 ? 5   PRO A HA   5  
ATOM 8798  H HB2  . PRO A 1 5   ? 142.601 12.100  -1.509  1.00 0.00 ? 5   PRO A HB2  5  
ATOM 8799  H HB3  . PRO A 1 5   ? 141.314 12.441  -0.347  1.00 0.00 ? 5   PRO A HB3  5  
ATOM 8800  H HG2  . PRO A 1 5   ? 143.872 12.295  0.415   1.00 0.00 ? 5   PRO A HG2  5  
ATOM 8801  H HG3  . PRO A 1 5   ? 142.560 11.705  1.451   1.00 0.00 ? 5   PRO A HG3  5  
ATOM 8802  H HD2  . PRO A 1 5   ? 144.495 10.174  -0.221  1.00 0.00 ? 5   PRO A HD2  5  
ATOM 8803  H HD3  . PRO A 1 5   ? 143.808 9.778   1.367   1.00 0.00 ? 5   PRO A HD3  5  
ATOM 8804  N N    . GLU A 1 6   ? 142.462 9.732   -2.989  1.00 0.00 ? 6   GLU A N    5  
ATOM 8805  C CA   . GLU A 1 6   ? 142.455 9.409   -4.395  1.00 0.00 ? 6   GLU A CA   5  
ATOM 8806  C C    . GLU A 1 6   ? 141.748 8.074   -4.615  1.00 0.00 ? 6   GLU A C    5  
ATOM 8807  O O    . GLU A 1 6   ? 140.992 7.907   -5.559  1.00 0.00 ? 6   GLU A O    5  
ATOM 8808  C CB   . GLU A 1 6   ? 143.871 9.352   -4.935  1.00 0.00 ? 6   GLU A CB   5  
ATOM 8809  C CG   . GLU A 1 6   ? 143.945 8.992   -6.401  1.00 0.00 ? 6   GLU A CG   5  
ATOM 8810  C CD   . GLU A 1 6   ? 145.344 8.902   -6.888  1.00 0.00 ? 6   GLU A CD   5  
ATOM 8811  O OE1  . GLU A 1 6   ? 145.981 7.842   -6.721  1.00 0.00 ? 6   GLU A OE1  5  
ATOM 8812  O OE2  . GLU A 1 6   ? 145.832 9.876   -7.457  1.00 0.00 ? 6   GLU A OE2  5  
ATOM 8813  H H    . GLU A 1 6   ? 143.296 9.676   -2.473  1.00 0.00 ? 6   GLU A H    5  
ATOM 8814  H HA   . GLU A 1 6   ? 141.907 10.185  -4.912  1.00 0.00 ? 6   GLU A HA   5  
ATOM 8815  H HB2  . GLU A 1 6   ? 144.335 10.318  -4.798  1.00 0.00 ? 6   GLU A HB2  5  
ATOM 8816  H HB3  . GLU A 1 6   ? 144.427 8.613   -4.376  1.00 0.00 ? 6   GLU A HB3  5  
ATOM 8817  H HG2  . GLU A 1 6   ? 143.466 8.036   -6.549  1.00 0.00 ? 6   GLU A HG2  5  
ATOM 8818  H HG3  . GLU A 1 6   ? 143.423 9.747   -6.970  1.00 0.00 ? 6   GLU A HG3  5  
ATOM 8819  N N    . GLU A 1 7   ? 141.970 7.143   -3.712  1.00 0.00 ? 7   GLU A N    5  
ATOM 8820  C CA   . GLU A 1 7   ? 141.333 5.838   -3.792  1.00 0.00 ? 7   GLU A CA   5  
ATOM 8821  C C    . GLU A 1 7   ? 139.825 6.024   -3.584  1.00 0.00 ? 7   GLU A C    5  
ATOM 8822  O O    . GLU A 1 7   ? 139.000 5.321   -4.170  1.00 0.00 ? 7   GLU A O    5  
ATOM 8823  C CB   . GLU A 1 7   ? 141.903 4.906   -2.716  1.00 0.00 ? 7   GLU A CB   5  
ATOM 8824  C CG   . GLU A 1 7   ? 141.474 3.459   -2.845  1.00 0.00 ? 7   GLU A CG   5  
ATOM 8825  C CD   . GLU A 1 7   ? 142.082 2.785   -4.051  1.00 0.00 ? 7   GLU A CD   5  
ATOM 8826  O OE1  . GLU A 1 7   ? 141.651 3.051   -5.183  1.00 0.00 ? 7   GLU A OE1  5  
ATOM 8827  O OE2  . GLU A 1 7   ? 142.987 1.965   -3.880  1.00 0.00 ? 7   GLU A OE2  5  
ATOM 8828  H H    . GLU A 1 7   ? 142.565 7.346   -2.960  1.00 0.00 ? 7   GLU A H    5  
ATOM 8829  H HA   . GLU A 1 7   ? 141.515 5.425   -4.774  1.00 0.00 ? 7   GLU A HA   5  
ATOM 8830  H HB2  . GLU A 1 7   ? 142.980 4.929   -2.772  1.00 0.00 ? 7   GLU A HB2  5  
ATOM 8831  H HB3  . GLU A 1 7   ? 141.593 5.265   -1.746  1.00 0.00 ? 7   GLU A HB3  5  
ATOM 8832  H HG2  . GLU A 1 7   ? 141.783 2.925   -1.959  1.00 0.00 ? 7   GLU A HG2  5  
ATOM 8833  H HG3  . GLU A 1 7   ? 140.398 3.421   -2.931  1.00 0.00 ? 7   GLU A HG3  5  
ATOM 8834  N N    . ALA A 1 8   ? 139.494 7.002   -2.761  1.00 0.00 ? 8   ALA A N    5  
ATOM 8835  C CA   . ALA A 1 8   ? 138.134 7.359   -2.474  1.00 0.00 ? 8   ALA A CA   5  
ATOM 8836  C C    . ALA A 1 8   ? 137.479 8.049   -3.679  1.00 0.00 ? 8   ALA A C    5  
ATOM 8837  O O    . ALA A 1 8   ? 136.331 7.771   -3.982  1.00 0.00 ? 8   ALA A O    5  
ATOM 8838  C CB   . ALA A 1 8   ? 138.060 8.210   -1.197  1.00 0.00 ? 8   ALA A CB   5  
ATOM 8839  H H    . ALA A 1 8   ? 140.217 7.488   -2.307  1.00 0.00 ? 8   ALA A H    5  
ATOM 8840  H HA   . ALA A 1 8   ? 137.600 6.437   -2.295  1.00 0.00 ? 8   ALA A HA   5  
ATOM 8841  H HB1  . ALA A 1 8   ? 137.040 8.468   -0.934  1.00 0.00 ? 8   ALA A HB1  5  
ATOM 8842  H HB2  . ALA A 1 8   ? 138.636 9.116   -1.326  1.00 0.00 ? 8   ALA A HB2  5  
ATOM 8843  H HB3  . ALA A 1 8   ? 138.503 7.627   -0.399  1.00 0.00 ? 8   ALA A HB3  5  
ATOM 8844  N N    . VAL A 1 9   ? 138.218 8.936   -4.396  1.00 0.00 ? 9   VAL A N    5  
ATOM 8845  C CA   . VAL A 1 9   ? 137.649 9.598   -5.600  1.00 0.00 ? 9   VAL A CA   5  
ATOM 8846  C C    . VAL A 1 9   ? 137.286 8.569   -6.658  1.00 0.00 ? 9   VAL A C    5  
ATOM 8847  O O    . VAL A 1 9   ? 136.343 8.759   -7.424  1.00 0.00 ? 9   VAL A O    5  
ATOM 8848  C CB   . VAL A 1 9   ? 138.543 10.729  -6.251  1.00 0.00 ? 9   VAL A CB   5  
ATOM 8849  C CG1  . VAL A 1 9   ? 138.966 11.781  -5.257  1.00 0.00 ? 9   VAL A CG1  5  
ATOM 8850  C CG2  . VAL A 1 9   ? 139.743 10.196  -7.019  1.00 0.00 ? 9   VAL A CG2  5  
ATOM 8851  H H    . VAL A 1 9   ? 139.113 9.183   -4.078  1.00 0.00 ? 9   VAL A H    5  
ATOM 8852  H HA   . VAL A 1 9   ? 136.716 10.036  -5.271  1.00 0.00 ? 9   VAL A HA   5  
ATOM 8853  H HB   . VAL A 1 9   ? 137.893 11.226  -6.955  1.00 0.00 ? 9   VAL A HB   5  
ATOM 8854  H HG11 . VAL A 1 9   ? 139.608 11.333  -4.511  1.00 0.00 ? 9   VAL A HG11 5  
ATOM 8855  H HG12 . VAL A 1 9   ? 138.084 12.160  -4.759  1.00 0.00 ? 9   VAL A HG12 5  
ATOM 8856  H HG13 . VAL A 1 9   ? 139.486 12.582  -5.759  1.00 0.00 ? 9   VAL A HG13 5  
ATOM 8857  H HG21 . VAL A 1 9   ? 139.402 9.550   -7.815  1.00 0.00 ? 9   VAL A HG21 5  
ATOM 8858  H HG22 . VAL A 1 9   ? 140.378 9.637   -6.348  1.00 0.00 ? 9   VAL A HG22 5  
ATOM 8859  H HG23 . VAL A 1 9   ? 140.299 11.022  -7.438  1.00 0.00 ? 9   VAL A HG23 5  
ATOM 8860  N N    . LYS A 1 10  ? 138.015 7.456   -6.660  1.00 0.00 ? 10  LYS A N    5  
ATOM 8861  C CA   . LYS A 1 10  ? 137.777 6.351   -7.596  1.00 0.00 ? 10  LYS A CA   5  
ATOM 8862  C C    . LYS A 1 10  ? 136.362 5.774   -7.408  1.00 0.00 ? 10  LYS A C    5  
ATOM 8863  O O    . LYS A 1 10  ? 135.799 5.199   -8.310  1.00 0.00 ? 10  LYS A O    5  
ATOM 8864  C CB   . LYS A 1 10  ? 138.795 5.218   -7.382  1.00 0.00 ? 10  LYS A CB   5  
ATOM 8865  C CG   . LYS A 1 10  ? 140.263 5.620   -7.426  1.00 0.00 ? 10  LYS A CG   5  
ATOM 8866  C CD   . LYS A 1 10  ? 140.662 6.227   -8.749  1.00 0.00 ? 10  LYS A CD   5  
ATOM 8867  C CE   . LYS A 1 10  ? 142.131 6.621   -8.751  1.00 0.00 ? 10  LYS A CE   5  
ATOM 8868  N NZ   . LYS A 1 10  ? 142.559 7.160   -10.058 1.00 0.00 ? 10  LYS A NZ   5  
ATOM 8869  H H    . LYS A 1 10  ? 138.759 7.401   -6.018  1.00 0.00 ? 10  LYS A H    5  
ATOM 8870  H HA   . LYS A 1 10  ? 137.876 6.730   -8.601  1.00 0.00 ? 10  LYS A HA   5  
ATOM 8871  H HB2  . LYS A 1 10  ? 138.611 4.771   -6.416  1.00 0.00 ? 10  LYS A HB2  5  
ATOM 8872  H HB3  . LYS A 1 10  ? 138.628 4.469   -8.143  1.00 0.00 ? 10  LYS A HB3  5  
ATOM 8873  H HG2  . LYS A 1 10  ? 140.447 6.345   -6.648  1.00 0.00 ? 10  LYS A HG2  5  
ATOM 8874  H HG3  . LYS A 1 10  ? 140.865 4.742   -7.243  1.00 0.00 ? 10  LYS A HG3  5  
ATOM 8875  H HD2  . LYS A 1 10  ? 140.489 5.507   -9.535  1.00 0.00 ? 10  LYS A HD2  5  
ATOM 8876  H HD3  . LYS A 1 10  ? 140.060 7.108   -8.925  1.00 0.00 ? 10  LYS A HD3  5  
ATOM 8877  H HE2  . LYS A 1 10  ? 142.289 7.375   -7.994  1.00 0.00 ? 10  LYS A HE2  5  
ATOM 8878  H HE3  . LYS A 1 10  ? 142.724 5.749   -8.516  1.00 0.00 ? 10  LYS A HE3  5  
ATOM 8879  H HZ1  . LYS A 1 10  ? 143.576 7.397   -10.074 1.00 0.00 ? 10  LYS A HZ1  5  
ATOM 8880  H HZ2  . LYS A 1 10  ? 142.041 8.039   -10.283 1.00 0.00 ? 10  LYS A HZ2  5  
ATOM 8881  H HZ3  . LYS A 1 10  ? 142.372 6.466   -10.813 1.00 0.00 ? 10  LYS A HZ3  5  
ATOM 8882  N N    . TRP A 1 11  ? 135.800 5.963   -6.229  1.00 0.00 ? 11  TRP A N    5  
ATOM 8883  C CA   . TRP A 1 11  ? 134.481 5.425   -5.892  1.00 0.00 ? 11  TRP A CA   5  
ATOM 8884  C C    . TRP A 1 11  ? 133.362 6.203   -6.564  1.00 0.00 ? 11  TRP A C    5  
ATOM 8885  O O    . TRP A 1 11  ? 132.259 5.708   -6.708  1.00 0.00 ? 11  TRP A O    5  
ATOM 8886  C CB   . TRP A 1 11  ? 134.269 5.452   -4.382  1.00 0.00 ? 11  TRP A CB   5  
ATOM 8887  C CG   . TRP A 1 11  ? 135.253 4.630   -3.611  1.00 0.00 ? 11  TRP A CG   5  
ATOM 8888  C CD1  . TRP A 1 11  ? 136.076 3.663   -4.101  1.00 0.00 ? 11  TRP A CD1  5  
ATOM 8889  C CD2  . TRP A 1 11  ? 135.497 4.686   -2.204  1.00 0.00 ? 11  TRP A CD2  5  
ATOM 8890  N NE1  . TRP A 1 11  ? 136.842 3.145   -3.098  1.00 0.00 ? 11  TRP A NE1  5  
ATOM 8891  C CE2  . TRP A 1 11  ? 136.496 3.746   -1.919  1.00 0.00 ? 11  TRP A CE2  5  
ATOM 8892  C CE3  . TRP A 1 11  ? 134.969 5.453   -1.154  1.00 0.00 ? 11  TRP A CE3  5  
ATOM 8893  C CZ2  . TRP A 1 11  ? 136.978 3.548   -0.641  1.00 0.00 ? 11  TRP A CZ2  5  
ATOM 8894  C CZ3  . TRP A 1 11  ? 135.445 5.247   0.120   1.00 0.00 ? 11  TRP A CZ3  5  
ATOM 8895  C CH2  . TRP A 1 11  ? 136.438 4.305   0.364   1.00 0.00 ? 11  TRP A CH2  5  
ATOM 8896  H H    . TRP A 1 11  ? 136.287 6.480   -5.552  1.00 0.00 ? 11  TRP A H    5  
ATOM 8897  H HA   . TRP A 1 11  ? 134.446 4.398   -6.220  1.00 0.00 ? 11  TRP A HA   5  
ATOM 8898  H HB2  . TRP A 1 11  ? 134.386 6.475   -4.054  1.00 0.00 ? 11  TRP A HB2  5  
ATOM 8899  H HB3  . TRP A 1 11  ? 133.269 5.131   -4.143  1.00 0.00 ? 11  TRP A HB3  5  
ATOM 8900  H HD1  . TRP A 1 11  ? 136.126 3.379   -5.142  1.00 0.00 ? 11  TRP A HD1  5  
ATOM 8901  H HE1  . TRP A 1 11  ? 137.520 2.452   -3.243  1.00 0.00 ? 11  TRP A HE1  5  
ATOM 8902  H HE3  . TRP A 1 11  ? 134.197 6.187   -1.330  1.00 0.00 ? 11  TRP A HE3  5  
ATOM 8903  H HZ2  . TRP A 1 11  ? 137.748 2.822   -0.426  1.00 0.00 ? 11  TRP A HZ2  5  
ATOM 8904  H HZ3  . TRP A 1 11  ? 135.043 5.810   0.954   1.00 0.00 ? 11  TRP A HZ3  5  
ATOM 8905  H HH2  . TRP A 1 11  ? 136.784 4.174   1.379   1.00 0.00 ? 11  TRP A HH2  5  
ATOM 8906  N N    . GLY A 1 12  ? 133.680 7.390   -7.031  1.00 0.00 ? 12  GLY A N    5  
ATOM 8907  C CA   . GLY A 1 12  ? 132.687 8.271   -7.618  1.00 0.00 ? 12  GLY A CA   5  
ATOM 8908  C C    . GLY A 1 12  ? 132.407 7.974   -9.081  1.00 0.00 ? 12  GLY A C    5  
ATOM 8909  O O    . GLY A 1 12  ? 131.941 8.845   -9.828  1.00 0.00 ? 12  GLY A O    5  
ATOM 8910  H H    . GLY A 1 12  ? 134.621 7.660   -6.994  1.00 0.00 ? 12  GLY A H    5  
ATOM 8911  H HA2  . GLY A 1 12  ? 131.765 8.171   -7.064  1.00 0.00 ? 12  GLY A HA2  5  
ATOM 8912  H HA3  . GLY A 1 12  ? 133.033 9.291   -7.531  1.00 0.00 ? 12  GLY A HA3  5  
ATOM 8913  N N    . GLU A 1 13  ? 132.700 6.772   -9.500  1.00 0.00 ? 13  GLU A N    5  
ATOM 8914  C CA   . GLU A 1 13  ? 132.428 6.355   -10.864 1.00 0.00 ? 13  GLU A CA   5  
ATOM 8915  C C    . GLU A 1 13  ? 131.791 4.966   -10.910 1.00 0.00 ? 13  GLU A C    5  
ATOM 8916  O O    . GLU A 1 13  ? 131.550 4.430   -12.001 1.00 0.00 ? 13  GLU A O    5  
ATOM 8917  C CB   . GLU A 1 13  ? 133.704 6.403   -11.717 1.00 0.00 ? 13  GLU A CB   5  
ATOM 8918  C CG   . GLU A 1 13  ? 134.850 5.590   -11.153 1.00 0.00 ? 13  GLU A CG   5  
ATOM 8919  C CD   . GLU A 1 13  ? 136.099 5.672   -11.980 1.00 0.00 ? 13  GLU A CD   5  
ATOM 8920  O OE1  . GLU A 1 13  ? 136.693 6.764   -12.087 1.00 0.00 ? 13  GLU A OE1  5  
ATOM 8921  O OE2  . GLU A 1 13  ? 136.523 4.640   -12.545 1.00 0.00 ? 13  GLU A OE2  5  
ATOM 8922  H H    . GLU A 1 13  ? 133.122 6.157   -8.862  1.00 0.00 ? 13  GLU A H    5  
ATOM 8923  H HA   . GLU A 1 13  ? 131.719 7.062   -11.272 1.00 0.00 ? 13  GLU A HA   5  
ATOM 8924  H HB2  . GLU A 1 13  ? 133.477 6.024   -12.702 1.00 0.00 ? 13  GLU A HB2  5  
ATOM 8925  H HB3  . GLU A 1 13  ? 134.028 7.429   -11.803 1.00 0.00 ? 13  GLU A HB3  5  
ATOM 8926  H HG2  . GLU A 1 13  ? 135.075 5.951   -10.161 1.00 0.00 ? 13  GLU A HG2  5  
ATOM 8927  H HG3  . GLU A 1 13  ? 134.539 4.558   -11.093 1.00 0.00 ? 13  GLU A HG3  5  
ATOM 8928  N N    . SER A 1 14  ? 131.483 4.404   -9.742  1.00 0.00 ? 14  SER A N    5  
ATOM 8929  C CA   . SER A 1 14  ? 130.916 3.070   -9.660  1.00 0.00 ? 14  SER A CA   5  
ATOM 8930  C C    . SER A 1 14  ? 130.514 2.746   -8.224  1.00 0.00 ? 14  SER A C    5  
ATOM 8931  O O    . SER A 1 14  ? 131.377 2.569   -7.346  1.00 0.00 ? 14  SER A O    5  
ATOM 8932  C CB   . SER A 1 14  ? 131.920 2.011   -10.179 1.00 0.00 ? 14  SER A CB   5  
ATOM 8933  O OG   . SER A 1 14  ? 131.367 0.690   -10.169 1.00 0.00 ? 14  SER A OG   5  
ATOM 8934  H H    . SER A 1 14  ? 131.584 4.906   -8.903  1.00 0.00 ? 14  SER A H    5  
ATOM 8935  H HA   . SER A 1 14  ? 130.034 3.046   -10.283 1.00 0.00 ? 14  SER A HA   5  
ATOM 8936  H HB2  . SER A 1 14  ? 132.204 2.257   -11.191 1.00 0.00 ? 14  SER A HB2  5  
ATOM 8937  H HB3  . SER A 1 14  ? 132.800 2.023   -9.553  1.00 0.00 ? 14  SER A HB3  5  
ATOM 8938  H HG   . SER A 1 14  ? 131.289 0.442   -11.106 1.00 0.00 ? 14  SER A HG   5  
ATOM 8939  N N    . PHE A 1 15  ? 129.215 2.658   -7.989  1.00 0.00 ? 15  PHE A N    5  
ATOM 8940  C CA   . PHE A 1 15  ? 128.677 2.292   -6.683  1.00 0.00 ? 15  PHE A CA   5  
ATOM 8941  C C    . PHE A 1 15  ? 129.115 0.868   -6.323  1.00 0.00 ? 15  PHE A C    5  
ATOM 8942  O O    . PHE A 1 15  ? 129.348 0.540   -5.156  1.00 0.00 ? 15  PHE A O    5  
ATOM 8943  C CB   . PHE A 1 15  ? 127.142 2.415   -6.699  1.00 0.00 ? 15  PHE A CB   5  
ATOM 8944  C CG   . PHE A 1 15  ? 126.458 2.111   -5.391  1.00 0.00 ? 15  PHE A CG   5  
ATOM 8945  C CD1  . PHE A 1 15  ? 126.874 2.708   -4.221  1.00 0.00 ? 15  PHE A CD1  5  
ATOM 8946  C CD2  . PHE A 1 15  ? 125.387 1.247   -5.343  1.00 0.00 ? 15  PHE A CD2  5  
ATOM 8947  C CE1  . PHE A 1 15  ? 126.239 2.447   -3.032  1.00 0.00 ? 15  PHE A CE1  5  
ATOM 8948  C CE2  . PHE A 1 15  ? 124.749 0.980   -4.153  1.00 0.00 ? 15  PHE A CE2  5  
ATOM 8949  C CZ   . PHE A 1 15  ? 125.176 1.581   -2.998  1.00 0.00 ? 15  PHE A CZ   5  
ATOM 8950  H H    . PHE A 1 15  ? 128.595 2.871   -8.727  1.00 0.00 ? 15  PHE A H    5  
ATOM 8951  H HA   . PHE A 1 15  ? 129.083 2.976   -5.952  1.00 0.00 ? 15  PHE A HA   5  
ATOM 8952  H HB2  . PHE A 1 15  ? 126.878 3.427   -6.971  1.00 0.00 ? 15  PHE A HB2  5  
ATOM 8953  H HB3  . PHE A 1 15  ? 126.751 1.741   -7.447  1.00 0.00 ? 15  PHE A HB3  5  
ATOM 8954  H HD1  . PHE A 1 15  ? 127.711 3.389   -4.243  1.00 0.00 ? 15  PHE A HD1  5  
ATOM 8955  H HD2  . PHE A 1 15  ? 125.050 0.771   -6.252  1.00 0.00 ? 15  PHE A HD2  5  
ATOM 8956  H HE1  . PHE A 1 15  ? 126.575 2.918   -2.120  1.00 0.00 ? 15  PHE A HE1  5  
ATOM 8957  H HE2  . PHE A 1 15  ? 123.912 0.298   -4.123  1.00 0.00 ? 15  PHE A HE2  5  
ATOM 8958  H HZ   . PHE A 1 15  ? 124.677 1.377   -2.062  1.00 0.00 ? 15  PHE A HZ   5  
ATOM 8959  N N    . ASP A 1 16  ? 129.264 0.043   -7.342  1.00 0.00 ? 16  ASP A N    5  
ATOM 8960  C CA   . ASP A 1 16  ? 129.721 -1.325  -7.164  1.00 0.00 ? 16  ASP A CA   5  
ATOM 8961  C C    . ASP A 1 16  ? 131.174 -1.351  -6.731  1.00 0.00 ? 16  ASP A C    5  
ATOM 8962  O O    . ASP A 1 16  ? 131.571 -2.187  -5.939  1.00 0.00 ? 16  ASP A O    5  
ATOM 8963  C CB   . ASP A 1 16  ? 129.531 -2.140  -8.446  1.00 0.00 ? 16  ASP A CB   5  
ATOM 8964  C CG   . ASP A 1 16  ? 130.012 -3.567  -8.312  1.00 0.00 ? 16  ASP A CG   5  
ATOM 8965  O OD1  . ASP A 1 16  ? 129.293 -4.410  -7.713  1.00 0.00 ? 16  ASP A OD1  5  
ATOM 8966  O OD2  . ASP A 1 16  ? 131.097 -3.881  -8.823  1.00 0.00 ? 16  ASP A OD2  5  
ATOM 8967  H H    . ASP A 1 16  ? 129.033 0.364   -8.240  1.00 0.00 ? 16  ASP A H    5  
ATOM 8968  H HA   . ASP A 1 16  ? 129.123 -1.766  -6.381  1.00 0.00 ? 16  ASP A HA   5  
ATOM 8969  H HB2  . ASP A 1 16  ? 128.481 -2.158  -8.699  1.00 0.00 ? 16  ASP A HB2  5  
ATOM 8970  H HB3  . ASP A 1 16  ? 130.080 -1.666  -9.247  1.00 0.00 ? 16  ASP A HB3  5  
ATOM 8971  N N    . LYS A 1 17  ? 131.950 -0.394  -7.218  1.00 0.00 ? 17  LYS A N    5  
ATOM 8972  C CA   . LYS A 1 17  ? 133.371 -0.293  -6.875  1.00 0.00 ? 17  LYS A CA   5  
ATOM 8973  C C    . LYS A 1 17  ? 133.503 0.051   -5.413  1.00 0.00 ? 17  LYS A C    5  
ATOM 8974  O O    . LYS A 1 17  ? 134.290 -0.551  -4.670  1.00 0.00 ? 17  LYS A O    5  
ATOM 8975  C CB   . LYS A 1 17  ? 134.024 0.800   -7.700  1.00 0.00 ? 17  LYS A CB   5  
ATOM 8976  C CG   . LYS A 1 17  ? 135.479 0.998   -7.408  1.00 0.00 ? 17  LYS A CG   5  
ATOM 8977  C CD   . LYS A 1 17  ? 136.041 2.137   -8.220  1.00 0.00 ? 17  LYS A CD   5  
ATOM 8978  C CE   . LYS A 1 17  ? 137.553 2.086   -8.305  1.00 0.00 ? 17  LYS A CE   5  
ATOM 8979  N NZ   . LYS A 1 17  ? 138.006 1.034   -9.233  1.00 0.00 ? 17  LYS A NZ   5  
ATOM 8980  H H    . LYS A 1 17  ? 131.554 0.283   -7.811  1.00 0.00 ? 17  LYS A H    5  
ATOM 8981  H HA   . LYS A 1 17  ? 133.852 -1.236  -7.080  1.00 0.00 ? 17  LYS A HA   5  
ATOM 8982  H HB2  . LYS A 1 17  ? 133.917 0.566   -8.749  1.00 0.00 ? 17  LYS A HB2  5  
ATOM 8983  H HB3  . LYS A 1 17  ? 133.514 1.729   -7.493  1.00 0.00 ? 17  LYS A HB3  5  
ATOM 8984  H HG2  . LYS A 1 17  ? 135.497 1.284   -6.362  1.00 0.00 ? 17  LYS A HG2  5  
ATOM 8985  H HG3  . LYS A 1 17  ? 136.030 0.086   -7.574  1.00 0.00 ? 17  LYS A HG3  5  
ATOM 8986  H HD2  . LYS A 1 17  ? 135.635 2.092   -9.220  1.00 0.00 ? 17  LYS A HD2  5  
ATOM 8987  H HD3  . LYS A 1 17  ? 135.750 3.068   -7.756  1.00 0.00 ? 17  LYS A HD3  5  
ATOM 8988  H HE2  . LYS A 1 17  ? 137.916 3.041   -8.655  1.00 0.00 ? 17  LYS A HE2  5  
ATOM 8989  H HE3  . LYS A 1 17  ? 137.953 1.887   -7.322  1.00 0.00 ? 17  LYS A HE3  5  
ATOM 8990  H HZ1  . LYS A 1 17  ? 139.048 1.004   -9.280  1.00 0.00 ? 17  LYS A HZ1  5  
ATOM 8991  H HZ2  . LYS A 1 17  ? 137.675 1.281   -10.191 1.00 0.00 ? 17  LYS A HZ2  5  
ATOM 8992  H HZ3  . LYS A 1 17  ? 137.651 0.082   -8.992  1.00 0.00 ? 17  LYS A HZ3  5  
ATOM 8993  N N    . LEU A 1 18  ? 132.709 1.013   -5.033  1.00 0.00 ? 18  LEU A N    5  
ATOM 8994  C CA   . LEU A 1 18  ? 132.595 1.497   -3.687  1.00 0.00 ? 18  LEU A CA   5  
ATOM 8995  C C    . LEU A 1 18  ? 132.313 0.336   -2.737  1.00 0.00 ? 18  LEU A C    5  
ATOM 8996  O O    . LEU A 1 18  ? 133.040 0.116   -1.781  1.00 0.00 ? 18  LEU A O    5  
ATOM 8997  C CB   . LEU A 1 18  ? 131.442 2.484   -3.685  1.00 0.00 ? 18  LEU A CB   5  
ATOM 8998  C CG   . LEU A 1 18  ? 130.978 3.051   -2.366  1.00 0.00 ? 18  LEU A CG   5  
ATOM 8999  C CD1  . LEU A 1 18  ? 132.053 3.874   -1.720  1.00 0.00 ? 18  LEU A CD1  5  
ATOM 9000  C CD2  . LEU A 1 18  ? 129.776 3.884   -2.621  1.00 0.00 ? 18  LEU A CD2  5  
ATOM 9001  H H    . LEU A 1 18  ? 132.153 1.439   -5.721  1.00 0.00 ? 18  LEU A H    5  
ATOM 9002  H HA   . LEU A 1 18  ? 133.497 2.018   -3.403  1.00 0.00 ? 18  LEU A HA   5  
ATOM 9003  H HB2  . LEU A 1 18  ? 131.725 3.316   -4.311  1.00 0.00 ? 18  LEU A HB2  5  
ATOM 9004  H HB3  . LEU A 1 18  ? 130.600 1.994   -4.153  1.00 0.00 ? 18  LEU A HB3  5  
ATOM 9005  H HG   . LEU A 1 18  ? 130.691 2.254   -1.697  1.00 0.00 ? 18  LEU A HG   5  
ATOM 9006  H HD11 . LEU A 1 18  ? 132.924 3.257   -1.550  1.00 0.00 ? 18  LEU A HD11 5  
ATOM 9007  H HD12 . LEU A 1 18  ? 131.697 4.258   -0.775  1.00 0.00 ? 18  LEU A HD12 5  
ATOM 9008  H HD13 . LEU A 1 18  ? 132.320 4.694   -2.369  1.00 0.00 ? 18  LEU A HD13 5  
ATOM 9009  H HD21 . LEU A 1 18  ? 129.009 3.247   -3.034  1.00 0.00 ? 18  LEU A HD21 5  
ATOM 9010  H HD22 . LEU A 1 18  ? 130.066 4.618   -3.360  1.00 0.00 ? 18  LEU A HD22 5  
ATOM 9011  H HD23 . LEU A 1 18  ? 129.442 4.351   -1.707  1.00 0.00 ? 18  LEU A HD23 5  
ATOM 9012  N N    . LEU A 1 19  ? 131.294 -0.418  -3.064  1.00 0.00 ? 19  LEU A N    5  
ATOM 9013  C CA   . LEU A 1 19  ? 130.851 -1.566  -2.286  1.00 0.00 ? 19  LEU A CA   5  
ATOM 9014  C C    . LEU A 1 19  ? 131.844 -2.724  -2.289  1.00 0.00 ? 19  LEU A C    5  
ATOM 9015  O O    . LEU A 1 19  ? 131.923 -3.478  -1.319  1.00 0.00 ? 19  LEU A O    5  
ATOM 9016  C CB   . LEU A 1 19  ? 129.488 -2.015  -2.791  1.00 0.00 ? 19  LEU A CB   5  
ATOM 9017  C CG   . LEU A 1 19  ? 128.247 -1.451  -2.075  1.00 0.00 ? 19  LEU A CG   5  
ATOM 9018  C CD1  . LEU A 1 19  ? 128.480 -0.063  -1.485  1.00 0.00 ? 19  LEU A CD1  5  
ATOM 9019  C CD2  . LEU A 1 19  ? 127.110 -1.390  -3.068  1.00 0.00 ? 19  LEU A CD2  5  
ATOM 9020  H H    . LEU A 1 19  ? 130.788 -0.181  -3.873  1.00 0.00 ? 19  LEU A H    5  
ATOM 9021  H HA   . LEU A 1 19  ? 130.724 -1.228  -1.268  1.00 0.00 ? 19  LEU A HA   5  
ATOM 9022  H HB2  . LEU A 1 19  ? 129.417 -1.743  -3.834  1.00 0.00 ? 19  LEU A HB2  5  
ATOM 9023  H HB3  . LEU A 1 19  ? 129.451 -3.092  -2.725  1.00 0.00 ? 19  LEU A HB3  5  
ATOM 9024  H HG   . LEU A 1 19  ? 127.945 -2.120  -1.283  1.00 0.00 ? 19  LEU A HG   5  
ATOM 9025  H HD11 . LEU A 1 19  ? 129.381 -0.076  -0.891  1.00 0.00 ? 19  LEU A HD11 5  
ATOM 9026  H HD12 . LEU A 1 19  ? 127.655 0.157   -0.818  1.00 0.00 ? 19  LEU A HD12 5  
ATOM 9027  H HD13 . LEU A 1 19  ? 128.550 0.682   -2.264  1.00 0.00 ? 19  LEU A HD13 5  
ATOM 9028  H HD21 . LEU A 1 19  ? 126.902 -2.383  -3.437  1.00 0.00 ? 19  LEU A HD21 5  
ATOM 9029  H HD22 . LEU A 1 19  ? 127.389 -0.750  -3.894  1.00 0.00 ? 19  LEU A HD22 5  
ATOM 9030  H HD23 . LEU A 1 19  ? 126.229 -0.992  -2.588  1.00 0.00 ? 19  LEU A HD23 5  
ATOM 9031  N N    . SER A 1 20  ? 132.601 -2.869  -3.356  1.00 0.00 ? 20  SER A N    5  
ATOM 9032  C CA   . SER A 1 20  ? 133.595 -3.925  -3.431  1.00 0.00 ? 20  SER A CA   5  
ATOM 9033  C C    . SER A 1 20  ? 134.821 -3.565  -2.590  1.00 0.00 ? 20  SER A C    5  
ATOM 9034  O O    . SER A 1 20  ? 135.575 -4.442  -2.135  1.00 0.00 ? 20  SER A O    5  
ATOM 9035  C CB   . SER A 1 20  ? 133.983 -4.190  -4.883  1.00 0.00 ? 20  SER A CB   5  
ATOM 9036  O OG   . SER A 1 20  ? 132.828 -4.493  -5.658  1.00 0.00 ? 20  SER A OG   5  
ATOM 9037  H H    . SER A 1 20  ? 132.484 -2.267  -4.122  1.00 0.00 ? 20  SER A H    5  
ATOM 9038  H HA   . SER A 1 20  ? 133.149 -4.818  -3.017  1.00 0.00 ? 20  SER A HA   5  
ATOM 9039  H HB2  . SER A 1 20  ? 134.459 -3.311  -5.293  1.00 0.00 ? 20  SER A HB2  5  
ATOM 9040  H HB3  . SER A 1 20  ? 134.664 -5.026  -4.928  1.00 0.00 ? 20  SER A HB3  5  
ATOM 9041  H HG   . SER A 1 20  ? 132.540 -3.657  -6.052  1.00 0.00 ? 20  SER A HG   5  
ATOM 9042  N N    . HIS A 1 21  ? 135.000 -2.289  -2.345  1.00 0.00 ? 21  HIS A N    5  
ATOM 9043  C CA   . HIS A 1 21  ? 136.095 -1.835  -1.548  1.00 0.00 ? 21  HIS A CA   5  
ATOM 9044  C C    . HIS A 1 21  ? 135.591 -1.857  -0.131  1.00 0.00 ? 21  HIS A C    5  
ATOM 9045  O O    . HIS A 1 21  ? 134.582 -1.234  0.153   1.00 0.00 ? 21  HIS A O    5  
ATOM 9046  C CB   . HIS A 1 21  ? 136.488 -0.392  -1.926  1.00 0.00 ? 21  HIS A CB   5  
ATOM 9047  C CG   . HIS A 1 21  ? 137.947 -0.094  -1.782  1.00 0.00 ? 21  HIS A CG   5  
ATOM 9048  N ND1  . HIS A 1 21  ? 138.516 0.479   -0.663  1.00 0.00 ? 21  HIS A ND1  5  
ATOM 9049  C CD2  . HIS A 1 21  ? 138.957 -0.267  -2.659  1.00 0.00 ? 21  HIS A CD2  5  
ATOM 9050  C CE1  . HIS A 1 21  ? 139.806 0.638   -0.870  1.00 0.00 ? 21  HIS A CE1  5  
ATOM 9051  N NE2  . HIS A 1 21  ? 140.092 0.194   -2.067  1.00 0.00 ? 21  HIS A NE2  5  
ATOM 9052  H H    . HIS A 1 21  ? 134.343 -1.639  -2.680  1.00 0.00 ? 21  HIS A H    5  
ATOM 9053  H HA   . HIS A 1 21  ? 136.937 -2.500  -1.665  1.00 0.00 ? 21  HIS A HA   5  
ATOM 9054  H HB2  . HIS A 1 21  ? 136.217 -0.161  -2.943  1.00 0.00 ? 21  HIS A HB2  5  
ATOM 9055  H HB3  . HIS A 1 21  ? 135.959 0.283   -1.271  1.00 0.00 ? 21  HIS A HB3  5  
ATOM 9056  H HD1  . HIS A 1 21  ? 138.085 0.730   0.178   1.00 0.00 ? 21  HIS A HD1  5  
ATOM 9057  H HD2  . HIS A 1 21  ? 138.876 -0.682  -3.655  1.00 0.00 ? 21  HIS A HD2  5  
ATOM 9058  H HE1  . HIS A 1 21  ? 140.506 1.066   -0.168  1.00 0.00 ? 21  HIS A HE1  5  
ATOM 9059  H HE2  . HIS A 1 21  ? 141.000 -0.102  -2.328  1.00 0.00 ? 21  HIS A HE2  5  
ATOM 9060  N N    . ARG A 1 22  ? 136.274 -2.549  0.752   1.00 0.00 ? 22  ARG A N    5  
ATOM 9061  C CA   . ARG A 1 22  ? 135.824 -2.682  2.142   1.00 0.00 ? 22  ARG A CA   5  
ATOM 9062  C C    . ARG A 1 22  ? 135.653 -1.307  2.765   1.00 0.00 ? 22  ARG A C    5  
ATOM 9063  O O    . ARG A 1 22  ? 134.638 -1.018  3.358   1.00 0.00 ? 22  ARG A O    5  
ATOM 9064  C CB   . ARG A 1 22  ? 136.810 -3.512  2.961   1.00 0.00 ? 22  ARG A CB   5  
ATOM 9065  C CG   . ARG A 1 22  ? 136.389 -3.701  4.410   1.00 0.00 ? 22  ARG A CG   5  
ATOM 9066  C CD   . ARG A 1 22  ? 137.441 -4.436  5.212   1.00 0.00 ? 22  ARG A CD   5  
ATOM 9067  N NE   . ARG A 1 22  ? 138.718 -3.701  5.270   1.00 0.00 ? 22  ARG A NE   5  
ATOM 9068  C CZ   . ARG A 1 22  ? 139.416 -3.472  6.397   1.00 0.00 ? 22  ARG A CZ   5  
ATOM 9069  N NH1  . ARG A 1 22  ? 138.869 -3.718  7.586   1.00 0.00 ? 22  ARG A NH1  5  
ATOM 9070  N NH2  . ARG A 1 22  ? 140.644 -2.951  6.334   1.00 0.00 ? 22  ARG A NH2  5  
ATOM 9071  H H    . ARG A 1 22  ? 137.122 -2.968  0.467   1.00 0.00 ? 22  ARG A H    5  
ATOM 9072  H HA   . ARG A 1 22  ? 134.859 -3.170  2.142   1.00 0.00 ? 22  ARG A HA   5  
ATOM 9073  H HB2  . ARG A 1 22  ? 136.908 -4.487  2.505   1.00 0.00 ? 22  ARG A HB2  5  
ATOM 9074  H HB3  . ARG A 1 22  ? 137.772 -3.022  2.951   1.00 0.00 ? 22  ARG A HB3  5  
ATOM 9075  H HG2  . ARG A 1 22  ? 136.228 -2.731  4.857   1.00 0.00 ? 22  ARG A HG2  5  
ATOM 9076  H HG3  . ARG A 1 22  ? 135.469 -4.266  4.434   1.00 0.00 ? 22  ARG A HG3  5  
ATOM 9077  H HD2  . ARG A 1 22  ? 137.074 -4.577  6.217   1.00 0.00 ? 22  ARG A HD2  5  
ATOM 9078  H HD3  . ARG A 1 22  ? 137.615 -5.400  4.756   1.00 0.00 ? 22  ARG A HD3  5  
ATOM 9079  H HE   . ARG A 1 22  ? 139.084 -3.411  4.398   1.00 0.00 ? 22  ARG A HE   5  
ATOM 9080  H HH11 . ARG A 1 22  ? 137.935 -4.076  7.705   1.00 0.00 ? 22  ARG A HH11 5  
ATOM 9081  H HH12 . ARG A 1 22  ? 139.372 -3.533  8.444   1.00 0.00 ? 22  ARG A HH12 5  
ATOM 9082  H HH21 . ARG A 1 22  ? 141.095 -2.713  5.466   1.00 0.00 ? 22  ARG A HH21 5  
ATOM 9083  H HH22 . ARG A 1 22  ? 141.192 -2.768  7.158   1.00 0.00 ? 22  ARG A HH22 5  
ATOM 9084  N N    . ASP A 1 23  ? 136.640 -0.454  2.548   1.00 0.00 ? 23  ASP A N    5  
ATOM 9085  C CA   . ASP A 1 23  ? 136.637 0.936   3.051   1.00 0.00 ? 23  ASP A CA   5  
ATOM 9086  C C    . ASP A 1 23  ? 135.458 1.737   2.497   1.00 0.00 ? 23  ASP A C    5  
ATOM 9087  O O    . ASP A 1 23  ? 134.972 2.667   3.135   1.00 0.00 ? 23  ASP A O    5  
ATOM 9088  C CB   . ASP A 1 23  ? 137.919 1.671   2.640   1.00 0.00 ? 23  ASP A CB   5  
ATOM 9089  C CG   . ASP A 1 23  ? 139.182 1.005   3.096   1.00 0.00 ? 23  ASP A CG   5  
ATOM 9090  O OD1  . ASP A 1 23  ? 139.613 1.234   4.233   1.00 0.00 ? 23  ASP A OD1  5  
ATOM 9091  O OD2  . ASP A 1 23  ? 139.767 0.248   2.299   1.00 0.00 ? 23  ASP A OD2  5  
ATOM 9092  H H    . ASP A 1 23  ? 137.427 -0.797  2.071   1.00 0.00 ? 23  ASP A H    5  
ATOM 9093  H HA   . ASP A 1 23  ? 136.585 0.913   4.129   1.00 0.00 ? 23  ASP A HA   5  
ATOM 9094  H HB2  . ASP A 1 23  ? 137.952 1.738   1.563   1.00 0.00 ? 23  ASP A HB2  5  
ATOM 9095  H HB3  . ASP A 1 23  ? 137.891 2.671   3.049   1.00 0.00 ? 23  ASP A HB3  5  
ATOM 9096  N N    . GLY A 1 24  ? 135.002 1.369   1.310   1.00 0.00 ? 24  GLY A N    5  
ATOM 9097  C CA   . GLY A 1 24  ? 133.953 2.118   0.659   1.00 0.00 ? 24  GLY A CA   5  
ATOM 9098  C C    . GLY A 1 24  ? 132.625 1.644   1.067   1.00 0.00 ? 24  GLY A C    5  
ATOM 9099  O O    . GLY A 1 24  ? 131.729 2.441   1.325   1.00 0.00 ? 24  GLY A O    5  
ATOM 9100  H H    . GLY A 1 24  ? 135.330 0.544   0.895   1.00 0.00 ? 24  GLY A H    5  
ATOM 9101  H HA2  . GLY A 1 24  ? 134.049 3.160   0.922   1.00 0.00 ? 24  GLY A HA2  5  
ATOM 9102  H HA3  . GLY A 1 24  ? 134.041 2.025   -0.408  1.00 0.00 ? 24  GLY A HA3  5  
ATOM 9103  N N    . LEU A 1 25  ? 132.491 0.348   1.121   1.00 0.00 ? 25  LEU A N    5  
ATOM 9104  C CA   . LEU A 1 25  ? 131.326 -0.280  1.651   1.00 0.00 ? 25  LEU A CA   5  
ATOM 9105  C C    . LEU A 1 25  ? 131.102 0.224   3.061   1.00 0.00 ? 25  LEU A C    5  
ATOM 9106  O O    . LEU A 1 25  ? 130.008 0.610   3.419   1.00 0.00 ? 25  LEU A O    5  
ATOM 9107  C CB   . LEU A 1 25  ? 131.485 -1.823  1.553   1.00 0.00 ? 25  LEU A CB   5  
ATOM 9108  C CG   . LEU A 1 25  ? 130.880 -2.704  2.660   1.00 0.00 ? 25  LEU A CG   5  
ATOM 9109  C CD1  . LEU A 1 25  ? 130.543 -4.072  2.088   1.00 0.00 ? 25  LEU A CD1  5  
ATOM 9110  C CD2  . LEU A 1 25  ? 131.910 -2.891  3.781   1.00 0.00 ? 25  LEU A CD2  5  
ATOM 9111  H H    . LEU A 1 25  ? 133.208 -0.218  0.758   1.00 0.00 ? 25  LEU A H    5  
ATOM 9112  H HA   . LEU A 1 25  ? 130.488 0.026   1.042   1.00 0.00 ? 25  LEU A HA   5  
ATOM 9113  H HB2  . LEU A 1 25  ? 131.047 -2.139  0.618   1.00 0.00 ? 25  LEU A HB2  5  
ATOM 9114  H HB3  . LEU A 1 25  ? 132.544 -2.034  1.501   1.00 0.00 ? 25  LEU A HB3  5  
ATOM 9115  H HG   . LEU A 1 25  ? 129.994 -2.248  3.076   1.00 0.00 ? 25  LEU A HG   5  
ATOM 9116  H HD11 . LEU A 1 25  ? 131.442 -4.536  1.709   1.00 0.00 ? 25  LEU A HD11 5  
ATOM 9117  H HD12 . LEU A 1 25  ? 129.829 -3.961  1.287   1.00 0.00 ? 25  LEU A HD12 5  
ATOM 9118  H HD13 . LEU A 1 25  ? 130.122 -4.691  2.865   1.00 0.00 ? 25  LEU A HD13 5  
ATOM 9119  H HD21 . LEU A 1 25  ? 132.189 -1.937  4.210   1.00 0.00 ? 25  LEU A HD21 5  
ATOM 9120  H HD22 . LEU A 1 25  ? 132.797 -3.337  3.351   1.00 0.00 ? 25  LEU A HD22 5  
ATOM 9121  H HD23 . LEU A 1 25  ? 131.509 -3.539  4.547   1.00 0.00 ? 25  LEU A HD23 5  
ATOM 9122  N N    . GLU A 1 26  ? 132.186 0.312   3.804   1.00 0.00 ? 26  GLU A N    5  
ATOM 9123  C CA   . GLU A 1 26  ? 132.177 0.787   5.155   1.00 0.00 ? 26  GLU A CA   5  
ATOM 9124  C C    . GLU A 1 26  ? 131.776 2.279   5.157   1.00 0.00 ? 26  GLU A C    5  
ATOM 9125  O O    . GLU A 1 26  ? 130.927 2.680   5.953   1.00 0.00 ? 26  GLU A O    5  
ATOM 9126  C CB   . GLU A 1 26  ? 133.567 0.511   5.757   1.00 0.00 ? 26  GLU A CB   5  
ATOM 9127  C CG   . GLU A 1 26  ? 133.702 0.516   7.286   1.00 0.00 ? 26  GLU A CG   5  
ATOM 9128  C CD   . GLU A 1 26  ? 133.528 1.859   7.936   1.00 0.00 ? 26  GLU A CD   5  
ATOM 9129  O OE1  . GLU A 1 26  ? 134.440 2.706   7.833   1.00 0.00 ? 26  GLU A OE1  5  
ATOM 9130  O OE2  . GLU A 1 26  ? 132.512 2.070   8.606   1.00 0.00 ? 26  GLU A OE2  5  
ATOM 9131  H H    . GLU A 1 26  ? 133.044 0.015   3.426   1.00 0.00 ? 26  GLU A H    5  
ATOM 9132  H HA   . GLU A 1 26  ? 131.431 0.225   5.698   1.00 0.00 ? 26  GLU A HA   5  
ATOM 9133  H HB2  . GLU A 1 26  ? 133.816 -0.484  5.414   1.00 0.00 ? 26  GLU A HB2  5  
ATOM 9134  H HB3  . GLU A 1 26  ? 134.275 1.207   5.331   1.00 0.00 ? 26  GLU A HB3  5  
ATOM 9135  H HG2  . GLU A 1 26  ? 132.955 -0.145  7.696   1.00 0.00 ? 26  GLU A HG2  5  
ATOM 9136  H HG3  . GLU A 1 26  ? 134.679 0.131   7.538   1.00 0.00 ? 26  GLU A HG3  5  
ATOM 9137  N N    . ALA A 1 27  ? 132.291 3.070   4.188   1.00 0.00 ? 27  ALA A N    5  
ATOM 9138  C CA   . ALA A 1 27  ? 131.928 4.495   4.107   1.00 0.00 ? 27  ALA A CA   5  
ATOM 9139  C C    . ALA A 1 27  ? 130.429 4.637   3.848   1.00 0.00 ? 27  ALA A C    5  
ATOM 9140  O O    . ALA A 1 27  ? 129.745 5.455   4.479   1.00 0.00 ? 27  ALA A O    5  
ATOM 9141  C CB   . ALA A 1 27  ? 132.715 5.234   3.006   1.00 0.00 ? 27  ALA A CB   5  
ATOM 9142  H H    . ALA A 1 27  ? 132.904 2.698   3.510   1.00 0.00 ? 27  ALA A H    5  
ATOM 9143  H HA   . ALA A 1 27  ? 132.154 4.946   5.063   1.00 0.00 ? 27  ALA A HA   5  
ATOM 9144  H HB1  . ALA A 1 27  ? 132.617 4.724   2.059   1.00 0.00 ? 27  ALA A HB1  5  
ATOM 9145  H HB2  . ALA A 1 27  ? 133.762 5.358   3.248   1.00 0.00 ? 27  ALA A HB2  5  
ATOM 9146  H HB3  . ALA A 1 27  ? 132.265 6.215   2.900   1.00 0.00 ? 27  ALA A HB3  5  
ATOM 9147  N N    . PHE A 1 28  ? 129.916 3.807   2.954   1.00 0.00 ? 28  PHE A N    5  
ATOM 9148  C CA   . PHE A 1 28  ? 128.525 3.867   2.577   1.00 0.00 ? 28  PHE A CA   5  
ATOM 9149  C C    . PHE A 1 28  ? 127.622 3.333   3.689   1.00 0.00 ? 28  PHE A C    5  
ATOM 9150  O O    . PHE A 1 28  ? 126.550 3.885   3.916   1.00 0.00 ? 28  PHE A O    5  
ATOM 9151  C CB   . PHE A 1 28  ? 128.264 3.142   1.248   1.00 0.00 ? 28  PHE A CB   5  
ATOM 9152  C CG   . PHE A 1 28  ? 126.883 3.391   0.694   1.00 0.00 ? 28  PHE A CG   5  
ATOM 9153  C CD1  . PHE A 1 28  ? 126.626 4.522   -0.055  1.00 0.00 ? 28  PHE A CD1  5  
ATOM 9154  C CD2  . PHE A 1 28  ? 125.848 2.506   0.929   1.00 0.00 ? 28  PHE A CD2  5  
ATOM 9155  C CE1  . PHE A 1 28  ? 125.367 4.766   -0.557  1.00 0.00 ? 28  PHE A CE1  5  
ATOM 9156  C CE2  . PHE A 1 28  ? 124.588 2.743   0.428   1.00 0.00 ? 28  PHE A CE2  5  
ATOM 9157  C CZ   . PHE A 1 28  ? 124.348 3.874   -0.314  1.00 0.00 ? 28  PHE A CZ   5  
ATOM 9158  H H    . PHE A 1 28  ? 130.513 3.149   2.531   1.00 0.00 ? 28  PHE A H    5  
ATOM 9159  H HA   . PHE A 1 28  ? 128.289 4.912   2.449   1.00 0.00 ? 28  PHE A HA   5  
ATOM 9160  H HB2  . PHE A 1 28  ? 128.981 3.478   0.515   1.00 0.00 ? 28  PHE A HB2  5  
ATOM 9161  H HB3  . PHE A 1 28  ? 128.378 2.078   1.396   1.00 0.00 ? 28  PHE A HB3  5  
ATOM 9162  H HD1  . PHE A 1 28  ? 127.425 5.222   -0.246  1.00 0.00 ? 28  PHE A HD1  5  
ATOM 9163  H HD2  . PHE A 1 28  ? 126.036 1.616   1.512   1.00 0.00 ? 28  PHE A HD2  5  
ATOM 9164  H HE1  . PHE A 1 28  ? 125.180 5.654   -1.142  1.00 0.00 ? 28  PHE A HE1  5  
ATOM 9165  H HE2  . PHE A 1 28  ? 123.789 2.041   0.620   1.00 0.00 ? 28  PHE A HE2  5  
ATOM 9166  H HZ   . PHE A 1 28  ? 123.359 4.061   -0.706  1.00 0.00 ? 28  PHE A HZ   5  
ATOM 9167  N N    . THR A 1 29  ? 128.053 2.266   4.392   1.00 0.00 ? 29  THR A N    5  
ATOM 9168  C CA   . THR A 1 29  ? 127.255 1.736   5.511   1.00 0.00 ? 29  THR A CA   5  
ATOM 9169  C C    . THR A 1 29  ? 127.053 2.785   6.517   1.00 0.00 ? 29  THR A C    5  
ATOM 9170  O O    . THR A 1 29  ? 125.968 2.975   6.993   1.00 0.00 ? 29  THR A O    5  
ATOM 9171  C CB   . THR A 1 29  ? 127.872 0.508   6.219   1.00 0.00 ? 29  THR A CB   5  
ATOM 9172  O OG1  . THR A 1 29  ? 129.180 0.791   6.753   1.00 0.00 ? 29  THR A OG1  5  
ATOM 9173  C CG2  . THR A 1 29  ? 128.001 -0.575  5.270   1.00 0.00 ? 29  THR A CG2  5  
ATOM 9174  H H    . THR A 1 29  ? 128.888 1.823   4.118   1.00 0.00 ? 29  THR A H    5  
ATOM 9175  H HA   . THR A 1 29  ? 126.290 1.459   5.112   1.00 0.00 ? 29  THR A HA   5  
ATOM 9176  H HB   . THR A 1 29  ? 127.215 0.196   7.017   1.00 0.00 ? 29  THR A HB   5  
ATOM 9177  H HG1  . THR A 1 29  ? 129.674 1.417   6.208   1.00 0.00 ? 29  THR A HG1  5  
ATOM 9178  H HG21 . THR A 1 29  ? 127.034 -0.834  4.872   1.00 0.00 ? 29  THR A HG21 5  
ATOM 9179  H HG22 . THR A 1 29  ? 128.513 -1.394  5.753   1.00 0.00 ? 29  THR A HG22 5  
ATOM 9180  H HG23 . THR A 1 29  ? 128.607 -0.089  4.521   1.00 0.00 ? 29  THR A HG23 5  
ATOM 9181  N N    . ARG A 1 30  ? 128.113 3.494   6.794   1.00 0.00 ? 30  ARG A N    5  
ATOM 9182  C CA   . ARG A 1 30  ? 128.078 4.580   7.758   1.00 0.00 ? 30  ARG A CA   5  
ATOM 9183  C C    . ARG A 1 30  ? 127.017 5.604   7.385   1.00 0.00 ? 30  ARG A C    5  
ATOM 9184  O O    . ARG A 1 30  ? 126.162 5.969   8.199   1.00 0.00 ? 30  ARG A O    5  
ATOM 9185  C CB   . ARG A 1 30  ? 129.414 5.281   7.876   1.00 0.00 ? 30  ARG A CB   5  
ATOM 9186  C CG   . ARG A 1 30  ? 130.505 4.463   8.490   1.00 0.00 ? 30  ARG A CG   5  
ATOM 9187  C CD   . ARG A 1 30  ? 131.769 5.278   8.612   1.00 0.00 ? 30  ARG A CD   5  
ATOM 9188  N NE   . ARG A 1 30  ? 131.540 6.514   9.372   1.00 0.00 ? 30  ARG A NE   5  
ATOM 9189  C CZ   . ARG A 1 30  ? 132.442 7.480   9.567   1.00 0.00 ? 30  ARG A CZ   5  
ATOM 9190  N NH1  . ARG A 1 30  ? 133.688 7.338   9.133   1.00 0.00 ? 30  ARG A NH1  5  
ATOM 9191  N NH2  . ARG A 1 30  ? 132.091 8.579   10.205  1.00 0.00 ? 30  ARG A NH2  5  
ATOM 9192  H H    . ARG A 1 30  ? 128.927 3.211   6.317   1.00 0.00 ? 30  ARG A H    5  
ATOM 9193  H HA   . ARG A 1 30  ? 127.852 4.074   8.683   1.00 0.00 ? 30  ARG A HA   5  
ATOM 9194  H HB2  . ARG A 1 30  ? 129.737 5.577   6.889   1.00 0.00 ? 30  ARG A HB2  5  
ATOM 9195  H HB3  . ARG A 1 30  ? 129.280 6.171   8.475   1.00 0.00 ? 30  ARG A HB3  5  
ATOM 9196  H HG2  . ARG A 1 30  ? 130.192 4.129   9.468   1.00 0.00 ? 30  ARG A HG2  5  
ATOM 9197  H HG3  . ARG A 1 30  ? 130.699 3.607   7.859   1.00 0.00 ? 30  ARG A HG3  5  
ATOM 9198  H HD2  . ARG A 1 30  ? 132.519 4.686   9.117   1.00 0.00 ? 30  ARG A HD2  5  
ATOM 9199  H HD3  . ARG A 1 30  ? 132.117 5.537   7.624   1.00 0.00 ? 30  ARG A HD3  5  
ATOM 9200  H HE   . ARG A 1 30  ? 130.629 6.607   9.744   1.00 0.00 ? 30  ARG A HE   5  
ATOM 9201  H HH11 . ARG A 1 30  ? 134.007 6.515   8.643   1.00 0.00 ? 30  ARG A HH11 5  
ATOM 9202  H HH12 . ARG A 1 30  ? 134.407 8.032   9.271   1.00 0.00 ? 30  ARG A HH12 5  
ATOM 9203  H HH21 . ARG A 1 30  ? 131.160 8.734   10.552  1.00 0.00 ? 30  ARG A HH21 5  
ATOM 9204  H HH22 . ARG A 1 30  ? 132.765 9.308   10.390  1.00 0.00 ? 30  ARG A HH22 5  
ATOM 9205  N N    . PHE A 1 31  ? 127.080 6.030   6.144   1.00 0.00 ? 31  PHE A N    5  
ATOM 9206  C CA   . PHE A 1 31  ? 126.140 6.965   5.562   1.00 0.00 ? 31  PHE A CA   5  
ATOM 9207  C C    . PHE A 1 31  ? 124.699 6.450   5.685   1.00 0.00 ? 31  PHE A C    5  
ATOM 9208  O O    . PHE A 1 31  ? 123.785 7.181   6.094   1.00 0.00 ? 31  PHE A O    5  
ATOM 9209  C CB   . PHE A 1 31  ? 126.522 7.175   4.083   1.00 0.00 ? 31  PHE A CB   5  
ATOM 9210  C CG   . PHE A 1 31  ? 125.463 7.818   3.244   1.00 0.00 ? 31  PHE A CG   5  
ATOM 9211  C CD1  . PHE A 1 31  ? 125.289 9.180   3.245   1.00 0.00 ? 31  PHE A CD1  5  
ATOM 9212  C CD2  . PHE A 1 31  ? 124.626 7.034   2.459   1.00 0.00 ? 31  PHE A CD2  5  
ATOM 9213  C CE1  . PHE A 1 31  ? 124.303 9.754   2.484   1.00 0.00 ? 31  PHE A CE1  5  
ATOM 9214  C CE2  . PHE A 1 31  ? 123.641 7.603   1.702   1.00 0.00 ? 31  PHE A CE2  5  
ATOM 9215  C CZ   . PHE A 1 31  ? 123.479 8.963   1.714   1.00 0.00 ? 31  PHE A CZ   5  
ATOM 9216  H H    . PHE A 1 31  ? 127.809 5.691   5.579   1.00 0.00 ? 31  PHE A H    5  
ATOM 9217  H HA   . PHE A 1 31  ? 126.231 7.911   6.075   1.00 0.00 ? 31  PHE A HA   5  
ATOM 9218  H HB2  . PHE A 1 31  ? 127.398 7.804   4.033   1.00 0.00 ? 31  PHE A HB2  5  
ATOM 9219  H HB3  . PHE A 1 31  ? 126.759 6.215   3.648   1.00 0.00 ? 31  PHE A HB3  5  
ATOM 9220  H HD1  . PHE A 1 31  ? 125.936 9.799   3.848   1.00 0.00 ? 31  PHE A HD1  5  
ATOM 9221  H HD2  . PHE A 1 31  ? 124.757 5.963   2.456   1.00 0.00 ? 31  PHE A HD2  5  
ATOM 9222  H HE1  . PHE A 1 31  ? 124.171 10.826  2.491   1.00 0.00 ? 31  PHE A HE1  5  
ATOM 9223  H HE2  . PHE A 1 31  ? 122.998 6.984   1.094   1.00 0.00 ? 31  PHE A HE2  5  
ATOM 9224  H HZ   . PHE A 1 31  ? 122.701 9.416   1.117   1.00 0.00 ? 31  PHE A HZ   5  
ATOM 9225  N N    . LEU A 1 32  ? 124.528 5.204   5.362   1.00 0.00 ? 32  LEU A N    5  
ATOM 9226  C CA   . LEU A 1 32  ? 123.239 4.576   5.317   1.00 0.00 ? 32  LEU A CA   5  
ATOM 9227  C C    . LEU A 1 32  ? 122.702 4.307   6.745   1.00 0.00 ? 32  LEU A C    5  
ATOM 9228  O O    . LEU A 1 32  ? 121.496 4.412   7.003   1.00 0.00 ? 32  LEU A O    5  
ATOM 9229  C CB   . LEU A 1 32  ? 123.386 3.285   4.510   1.00 0.00 ? 32  LEU A CB   5  
ATOM 9230  C CG   . LEU A 1 32  ? 122.143 2.751   3.833   1.00 0.00 ? 32  LEU A CG   5  
ATOM 9231  C CD1  . LEU A 1 32  ? 121.586 3.781   2.858   1.00 0.00 ? 32  LEU A CD1  5  
ATOM 9232  C CD2  . LEU A 1 32  ? 122.471 1.460   3.107   1.00 0.00 ? 32  LEU A CD2  5  
ATOM 9233  H H    . LEU A 1 32  ? 125.319 4.678   5.104   1.00 0.00 ? 32  LEU A H    5  
ATOM 9234  H HA   . LEU A 1 32  ? 122.556 5.231   4.796   1.00 0.00 ? 32  LEU A HA   5  
ATOM 9235  H HB2  . LEU A 1 32  ? 124.131 3.452   3.747   1.00 0.00 ? 32  LEU A HB2  5  
ATOM 9236  H HB3  . LEU A 1 32  ? 123.758 2.524   5.180   1.00 0.00 ? 32  LEU A HB3  5  
ATOM 9237  H HG   . LEU A 1 32  ? 121.388 2.538   4.575   1.00 0.00 ? 32  LEU A HG   5  
ATOM 9238  H HD11 . LEU A 1 32  ? 121.330 4.683   3.395   1.00 0.00 ? 32  LEU A HD11 5  
ATOM 9239  H HD12 . LEU A 1 32  ? 120.702 3.386   2.379   1.00 0.00 ? 32  LEU A HD12 5  
ATOM 9240  H HD13 . LEU A 1 32  ? 122.329 4.008   2.109   1.00 0.00 ? 32  LEU A HD13 5  
ATOM 9241  H HD21 . LEU A 1 32  ? 122.770 0.710   3.823   1.00 0.00 ? 32  LEU A HD21 5  
ATOM 9242  H HD22 . LEU A 1 32  ? 123.297 1.615   2.425   1.00 0.00 ? 32  LEU A HD22 5  
ATOM 9243  H HD23 . LEU A 1 32  ? 121.607 1.112   2.562   1.00 0.00 ? 32  LEU A HD23 5  
ATOM 9244  N N    . LYS A 1 33  ? 123.606 3.986   7.661   1.00 0.00 ? 33  LYS A N    5  
ATOM 9245  C CA   . LYS A 1 33  ? 123.268 3.734   9.064   1.00 0.00 ? 33  LYS A CA   5  
ATOM 9246  C C    . LYS A 1 33  ? 122.848 5.003   9.766   1.00 0.00 ? 33  LYS A C    5  
ATOM 9247  O O    . LYS A 1 33  ? 121.840 5.018   10.482  1.00 0.00 ? 33  LYS A O    5  
ATOM 9248  C CB   . LYS A 1 33  ? 124.449 3.099   9.839   1.00 0.00 ? 33  LYS A CB   5  
ATOM 9249  C CG   . LYS A 1 33  ? 124.767 1.660   9.465   1.00 0.00 ? 33  LYS A CG   5  
ATOM 9250  C CD   . LYS A 1 33  ? 125.989 1.135   10.203  1.00 0.00 ? 33  LYS A CD   5  
ATOM 9251  C CE   . LYS A 1 33  ? 126.236 -0.339  9.883   1.00 0.00 ? 33  LYS A CE   5  
ATOM 9252  N NZ   . LYS A 1 33  ? 125.186 -1.225  10.440  1.00 0.00 ? 33  LYS A NZ   5  
ATOM 9253  H H    . LYS A 1 33  ? 124.546 3.894   7.381   1.00 0.00 ? 33  LYS A H    5  
ATOM 9254  H HA   . LYS A 1 33  ? 122.439 3.042   9.081   1.00 0.00 ? 33  LYS A HA   5  
ATOM 9255  H HB2  . LYS A 1 33  ? 125.335 3.689   9.659   1.00 0.00 ? 33  LYS A HB2  5  
ATOM 9256  H HB3  . LYS A 1 33  ? 124.223 3.131   10.895  1.00 0.00 ? 33  LYS A HB3  5  
ATOM 9257  H HG2  . LYS A 1 33  ? 123.919 1.038   9.713   1.00 0.00 ? 33  LYS A HG2  5  
ATOM 9258  H HG3  . LYS A 1 33  ? 124.951 1.610   8.401   1.00 0.00 ? 33  LYS A HG3  5  
ATOM 9259  H HD2  . LYS A 1 33  ? 126.852 1.712   9.907   1.00 0.00 ? 33  LYS A HD2  5  
ATOM 9260  H HD3  . LYS A 1 33  ? 125.828 1.241   11.266  1.00 0.00 ? 33  LYS A HD3  5  
ATOM 9261  H HE2  . LYS A 1 33  ? 126.259 -0.461  8.810   1.00 0.00 ? 33  LYS A HE2  5  
ATOM 9262  H HE3  . LYS A 1 33  ? 127.194 -0.626  10.293  1.00 0.00 ? 33  LYS A HE3  5  
ATOM 9263  H HZ1  . LYS A 1 33  ? 124.216 -0.876  10.271  1.00 0.00 ? 33  LYS A HZ1  5  
ATOM 9264  H HZ2  . LYS A 1 33  ? 125.307 -1.359  11.468  1.00 0.00 ? 33  LYS A HZ2  5  
ATOM 9265  H HZ3  . LYS A 1 33  ? 125.232 -2.173  10.003  1.00 0.00 ? 33  LYS A HZ3  5  
ATOM 9266  N N    . THR A 1 34  ? 123.584 6.074   9.528   1.00 0.00 ? 34  THR A N    5  
ATOM 9267  C CA   . THR A 1 34  ? 123.356 7.313   10.224  1.00 0.00 ? 34  THR A CA   5  
ATOM 9268  C C    . THR A 1 34  ? 121.975 7.934   9.884   1.00 0.00 ? 34  THR A C    5  
ATOM 9269  O O    . THR A 1 34  ? 121.350 8.574   10.740  1.00 0.00 ? 34  THR A O    5  
ATOM 9270  C CB   . THR A 1 34  ? 124.545 8.322   10.044  1.00 0.00 ? 34  THR A CB   5  
ATOM 9271  O OG1  . THR A 1 34  ? 124.432 9.411   10.968  1.00 0.00 ? 34  THR A OG1  5  
ATOM 9272  C CG2  . THR A 1 34  ? 124.617 8.878   8.636   1.00 0.00 ? 34  THR A CG2  5  
ATOM 9273  H H    . THR A 1 34  ? 124.325 6.021   8.883   1.00 0.00 ? 34  THR A H    5  
ATOM 9274  H HA   . THR A 1 34  ? 123.306 7.040   11.269  1.00 0.00 ? 34  THR A HA   5  
ATOM 9275  H HB   . THR A 1 34  ? 125.461 7.792   10.260  1.00 0.00 ? 34  THR A HB   5  
ATOM 9276  H HG1  . THR A 1 34  ? 124.372 9.006   11.850  1.00 0.00 ? 34  THR A HG1  5  
ATOM 9277  H HG21 . THR A 1 34  ? 123.699 9.399   8.404   1.00 0.00 ? 34  THR A HG21 5  
ATOM 9278  H HG22 . THR A 1 34  ? 124.754 8.065   7.938   1.00 0.00 ? 34  THR A HG22 5  
ATOM 9279  H HG23 . THR A 1 34  ? 125.450 9.562   8.559   1.00 0.00 ? 34  THR A HG23 5  
ATOM 9280  N N    . GLU A 1 35  ? 121.467 7.695   8.673   1.00 0.00 ? 35  GLU A N    5  
ATOM 9281  C CA   . GLU A 1 35  ? 120.139 8.192   8.324   1.00 0.00 ? 35  GLU A CA   5  
ATOM 9282  C C    . GLU A 1 35  ? 119.097 7.076   8.381   1.00 0.00 ? 35  GLU A C    5  
ATOM 9283  O O    . GLU A 1 35  ? 118.006 7.202   7.841   1.00 0.00 ? 35  GLU A O    5  
ATOM 9284  C CB   . GLU A 1 35  ? 120.109 8.928   6.975   1.00 0.00 ? 35  GLU A CB   5  
ATOM 9285  C CG   . GLU A 1 35  ? 120.556 8.133   5.761   1.00 0.00 ? 35  GLU A CG   5  
ATOM 9286  C CD   . GLU A 1 35  ? 120.346 8.926   4.491   1.00 0.00 ? 35  GLU A CD   5  
ATOM 9287  O OE1  . GLU A 1 35  ? 121.119 9.884   4.228   1.00 0.00 ? 35  GLU A OE1  5  
ATOM 9288  O OE2  . GLU A 1 35  ? 119.372 8.660   3.776   1.00 0.00 ? 35  GLU A OE2  5  
ATOM 9289  H H    . GLU A 1 35  ? 121.987 7.187   8.015   1.00 0.00 ? 35  GLU A H    5  
ATOM 9290  H HA   . GLU A 1 35  ? 119.879 8.890   9.107   1.00 0.00 ? 35  GLU A HA   5  
ATOM 9291  H HB2  . GLU A 1 35  ? 119.096 9.253   6.789   1.00 0.00 ? 35  GLU A HB2  5  
ATOM 9292  H HB3  . GLU A 1 35  ? 120.737 9.803   7.055   1.00 0.00 ? 35  GLU A HB3  5  
ATOM 9293  H HG2  . GLU A 1 35  ? 121.605 7.896   5.863   1.00 0.00 ? 35  GLU A HG2  5  
ATOM 9294  H HG3  . GLU A 1 35  ? 119.980 7.220   5.703   1.00 0.00 ? 35  GLU A HG3  5  
ATOM 9295  N N    . PHE A 1 36  ? 119.446 6.014   9.099   1.00 0.00 ? 36  PHE A N    5  
ATOM 9296  C CA   . PHE A 1 36  ? 118.594 4.841   9.335   1.00 0.00 ? 36  PHE A CA   5  
ATOM 9297  C C    . PHE A 1 36  ? 117.937 4.228   8.090   1.00 0.00 ? 36  PHE A C    5  
ATOM 9298  O O    . PHE A 1 36  ? 116.719 4.204   7.947   1.00 0.00 ? 36  PHE A O    5  
ATOM 9299  C CB   . PHE A 1 36  ? 117.616 4.991   10.552  1.00 0.00 ? 36  PHE A CB   5  
ATOM 9300  C CG   . PHE A 1 36  ? 116.719 6.216   10.568  1.00 0.00 ? 36  PHE A CG   5  
ATOM 9301  C CD1  . PHE A 1 36  ? 115.481 6.207   9.937   1.00 0.00 ? 36  PHE A CD1  5  
ATOM 9302  C CD2  . PHE A 1 36  ? 117.116 7.369   11.230  1.00 0.00 ? 36  PHE A CD2  5  
ATOM 9303  C CE1  . PHE A 1 36  ? 114.665 7.321   9.964   1.00 0.00 ? 36  PHE A CE1  5  
ATOM 9304  C CE2  . PHE A 1 36  ? 116.304 8.484   11.257  1.00 0.00 ? 36  PHE A CE2  5  
ATOM 9305  C CZ   . PHE A 1 36  ? 115.078 8.460   10.623  1.00 0.00 ? 36  PHE A CZ   5  
ATOM 9306  H H    . PHE A 1 36  ? 120.336 6.014   9.513   1.00 0.00 ? 36  PHE A H    5  
ATOM 9307  H HA   . PHE A 1 36  ? 119.321 4.090   9.615   1.00 0.00 ? 36  PHE A HA   5  
ATOM 9308  H HB2  . PHE A 1 36  ? 116.966 4.129   10.573  1.00 0.00 ? 36  PHE A HB2  5  
ATOM 9309  H HB3  . PHE A 1 36  ? 118.202 4.995   11.460  1.00 0.00 ? 36  PHE A HB3  5  
ATOM 9310  H HD1  . PHE A 1 36  ? 115.160 5.317   9.418   1.00 0.00 ? 36  PHE A HD1  5  
ATOM 9311  H HD2  . PHE A 1 36  ? 118.074 7.390   11.728  1.00 0.00 ? 36  PHE A HD2  5  
ATOM 9312  H HE1  . PHE A 1 36  ? 113.707 7.300   9.467   1.00 0.00 ? 36  PHE A HE1  5  
ATOM 9313  H HE2  . PHE A 1 36  ? 116.628 9.376   11.773  1.00 0.00 ? 36  PHE A HE2  5  
ATOM 9314  H HZ   . PHE A 1 36  ? 114.440 9.333   10.645  1.00 0.00 ? 36  PHE A HZ   5  
ATOM 9315  N N    . SER A 1 37  ? 118.750 3.796   7.169   1.00 0.00 ? 37  SER A N    5  
ATOM 9316  C CA   . SER A 1 37  ? 118.275 3.102   5.981   1.00 0.00 ? 37  SER A CA   5  
ATOM 9317  C C    . SER A 1 37  ? 119.285 2.008   5.611   1.00 0.00 ? 37  SER A C    5  
ATOM 9318  O O    . SER A 1 37  ? 119.307 1.486   4.488   1.00 0.00 ? 37  SER A O    5  
ATOM 9319  C CB   . SER A 1 37  ? 118.088 4.118   4.840   1.00 0.00 ? 37  SER A CB   5  
ATOM 9320  O OG   . SER A 1 37  ? 117.181 5.153   5.247   1.00 0.00 ? 37  SER A OG   5  
ATOM 9321  H H    . SER A 1 37  ? 119.717 3.971   7.242   1.00 0.00 ? 37  SER A H    5  
ATOM 9322  H HA   . SER A 1 37  ? 117.326 2.642   6.219   1.00 0.00 ? 37  SER A HA   5  
ATOM 9323  H HB2  . SER A 1 37  ? 119.043 4.560   4.590   1.00 0.00 ? 37  SER A HB2  5  
ATOM 9324  H HB3  . SER A 1 37  ? 117.681 3.618   3.974   1.00 0.00 ? 37  SER A HB3  5  
ATOM 9325  H HG   . SER A 1 37  ? 116.943 4.934   6.160   1.00 0.00 ? 37  SER A HG   5  
ATOM 9326  N N    . GLU A 1 38  ? 120.048 1.599   6.629   1.00 0.00 ? 38  GLU A N    5  
ATOM 9327  C CA   . GLU A 1 38  ? 121.166 0.663   6.504   1.00 0.00 ? 38  GLU A CA   5  
ATOM 9328  C C    . GLU A 1 38  ? 120.708 -0.723  6.082   1.00 0.00 ? 38  GLU A C    5  
ATOM 9329  O O    . GLU A 1 38  ? 121.494 -1.511  5.535   1.00 0.00 ? 38  GLU A O    5  
ATOM 9330  C CB   . GLU A 1 38  ? 121.918 0.577   7.834   1.00 0.00 ? 38  GLU A CB   5  
ATOM 9331  C CG   . GLU A 1 38  ? 121.070 0.093   9.006   1.00 0.00 ? 38  GLU A CG   5  
ATOM 9332  C CD   . GLU A 1 38  ? 121.814 0.072   10.311  1.00 0.00 ? 38  GLU A CD   5  
ATOM 9333  O OE1  . GLU A 1 38  ? 122.534 -0.897  10.589  1.00 0.00 ? 38  GLU A OE1  5  
ATOM 9334  O OE2  . GLU A 1 38  ? 121.692 1.024   11.093  1.00 0.00 ? 38  GLU A OE2  5  
ATOM 9335  H H    . GLU A 1 38  ? 119.798 1.912   7.523   1.00 0.00 ? 38  GLU A H    5  
ATOM 9336  H HA   . GLU A 1 38  ? 121.844 1.051   5.759   1.00 0.00 ? 38  GLU A HA   5  
ATOM 9337  H HB2  . GLU A 1 38  ? 122.748 -0.106  7.717   1.00 0.00 ? 38  GLU A HB2  5  
ATOM 9338  H HB3  . GLU A 1 38  ? 122.305 1.555   8.079   1.00 0.00 ? 38  GLU A HB3  5  
ATOM 9339  H HG2  . GLU A 1 38  ? 120.220 0.752   9.110   1.00 0.00 ? 38  GLU A HG2  5  
ATOM 9340  H HG3  . GLU A 1 38  ? 120.719 -0.905  8.785   1.00 0.00 ? 38  GLU A HG3  5  
ATOM 9341  N N    . GLU A 1 39  ? 119.444 -0.999  6.312   1.00 0.00 ? 39  GLU A N    5  
ATOM 9342  C CA   . GLU A 1 39  ? 118.838 -2.284  6.032   1.00 0.00 ? 39  GLU A CA   5  
ATOM 9343  C C    . GLU A 1 39  ? 118.878 -2.653  4.547   1.00 0.00 ? 39  GLU A C    5  
ATOM 9344  O O    . GLU A 1 39  ? 118.648 -3.787  4.195   1.00 0.00 ? 39  GLU A O    5  
ATOM 9345  C CB   . GLU A 1 39  ? 117.400 -2.344  6.547   1.00 0.00 ? 39  GLU A CB   5  
ATOM 9346  C CG   . GLU A 1 39  ? 117.230 -1.936  8.003   1.00 0.00 ? 39  GLU A CG   5  
ATOM 9347  C CD   . GLU A 1 39  ? 116.987 -0.453  8.193   1.00 0.00 ? 39  GLU A CD   5  
ATOM 9348  O OE1  . GLU A 1 39  ? 117.940 0.337   8.174   1.00 0.00 ? 39  GLU A OE1  5  
ATOM 9349  O OE2  . GLU A 1 39  ? 115.819 -0.063  8.387   1.00 0.00 ? 39  GLU A OE2  5  
ATOM 9350  H H    . GLU A 1 39  ? 118.892 -0.304  6.744   1.00 0.00 ? 39  GLU A H    5  
ATOM 9351  H HA   . GLU A 1 39  ? 119.412 -3.023  6.569   1.00 0.00 ? 39  GLU A HA   5  
ATOM 9352  H HB2  . GLU A 1 39  ? 116.789 -1.687  5.945   1.00 0.00 ? 39  GLU A HB2  5  
ATOM 9353  H HB3  . GLU A 1 39  ? 117.037 -3.354  6.435   1.00 0.00 ? 39  GLU A HB3  5  
ATOM 9354  H HG2  . GLU A 1 39  ? 116.390 -2.472  8.418   1.00 0.00 ? 39  GLU A HG2  5  
ATOM 9355  H HG3  . GLU A 1 39  ? 118.125 -2.211  8.541   1.00 0.00 ? 39  GLU A HG3  5  
ATOM 9356  N N    . ASN A 1 40  ? 119.140 -1.697  3.684   1.00 0.00 ? 40  ASN A N    5  
ATOM 9357  C CA   . ASN A 1 40  ? 119.256 -1.987  2.251   1.00 0.00 ? 40  ASN A CA   5  
ATOM 9358  C C    . ASN A 1 40  ? 120.604 -2.635  1.948   1.00 0.00 ? 40  ASN A C    5  
ATOM 9359  O O    . ASN A 1 40  ? 120.697 -3.747  1.342   1.00 0.00 ? 40  ASN A O    5  
ATOM 9360  C CB   . ASN A 1 40  ? 119.055 -0.723  1.410   1.00 0.00 ? 40  ASN A CB   5  
ATOM 9361  C CG   . ASN A 1 40  ? 117.618 -0.245  1.389   1.00 0.00 ? 40  ASN A CG   5  
ATOM 9362  O OD1  . ASN A 1 40  ? 116.680 -1.046  1.457   1.00 0.00 ? 40  ASN A OD1  5  
ATOM 9363  N ND2  . ASN A 1 40  ? 117.428 1.042   1.295   1.00 0.00 ? 40  ASN A ND2  5  
ATOM 9364  H H    . ASN A 1 40  ? 119.246 -0.782  4.022   1.00 0.00 ? 40  ASN A H    5  
ATOM 9365  H HA   . ASN A 1 40  ? 118.482 -2.702  2.009   1.00 0.00 ? 40  ASN A HA   5  
ATOM 9366  H HB2  . ASN A 1 40  ? 119.670 0.068   1.817   1.00 0.00 ? 40  ASN A HB2  5  
ATOM 9367  H HB3  . ASN A 1 40  ? 119.367 -0.922  0.396   1.00 0.00 ? 40  ASN A HB3  5  
ATOM 9368  H HD21 . ASN A 1 40  ? 118.212 1.643   1.243   1.00 0.00 ? 40  ASN A HD21 5  
ATOM 9369  H HD22 . ASN A 1 40  ? 116.516 1.407   1.264   1.00 0.00 ? 40  ASN A HD22 5  
ATOM 9370  N N    . ILE A 1 41  ? 121.658 -2.009  2.419   1.00 0.00 ? 41  ILE A N    5  
ATOM 9371  C CA   . ILE A 1 41  ? 122.965 -2.556  2.193   1.00 0.00 ? 41  ILE A CA   5  
ATOM 9372  C C    . ILE A 1 41  ? 123.087 -3.833  3.017   1.00 0.00 ? 41  ILE A C    5  
ATOM 9373  O O    . ILE A 1 41  ? 123.665 -4.814  2.575   1.00 0.00 ? 41  ILE A O    5  
ATOM 9374  C CB   . ILE A 1 41  ? 124.112 -1.529  2.491   1.00 0.00 ? 41  ILE A CB   5  
ATOM 9375  C CG1  . ILE A 1 41  ? 125.338 -1.825  1.616   1.00 0.00 ? 41  ILE A CG1  5  
ATOM 9376  C CG2  . ILE A 1 41  ? 124.505 -1.511  3.976   1.00 0.00 ? 41  ILE A CG2  5  
ATOM 9377  C CD1  . ILE A 1 41  ? 126.402 -0.752  1.689   1.00 0.00 ? 41  ILE A CD1  5  
ATOM 9378  H H    . ILE A 1 41  ? 121.550 -1.168  2.909   1.00 0.00 ? 41  ILE A H    5  
ATOM 9379  H HA   . ILE A 1 41  ? 122.996 -2.845  1.152   1.00 0.00 ? 41  ILE A HA   5  
ATOM 9380  H HB   . ILE A 1 41  ? 123.743 -0.546  2.239   1.00 0.00 ? 41  ILE A HB   5  
ATOM 9381  H HG12 . ILE A 1 41  ? 125.787 -2.758  1.920   1.00 0.00 ? 41  ILE A HG12 5  
ATOM 9382  H HG13 . ILE A 1 41  ? 125.024 -1.908  0.586   1.00 0.00 ? 41  ILE A HG13 5  
ATOM 9383  H HG21 . ILE A 1 41  ? 124.805 -2.501  4.292   1.00 0.00 ? 41  ILE A HG21 5  
ATOM 9384  H HG22 . ILE A 1 41  ? 123.657 -1.197  4.568   1.00 0.00 ? 41  ILE A HG22 5  
ATOM 9385  H HG23 . ILE A 1 41  ? 125.323 -0.823  4.123   1.00 0.00 ? 41  ILE A HG23 5  
ATOM 9386  H HD11 . ILE A 1 41  ? 127.139 -0.881  0.907   1.00 0.00 ? 41  ILE A HD11 5  
ATOM 9387  H HD12 . ILE A 1 41  ? 126.883 -0.797  2.656   1.00 0.00 ? 41  ILE A HD12 5  
ATOM 9388  H HD13 . ILE A 1 41  ? 125.913 0.207   1.582   1.00 0.00 ? 41  ILE A HD13 5  
ATOM 9389  N N    . GLU A 1 42  ? 122.432 -3.846  4.183   1.00 0.00 ? 42  GLU A N    5  
ATOM 9390  C CA   . GLU A 1 42  ? 122.409 -5.025  4.988   1.00 0.00 ? 42  GLU A CA   5  
ATOM 9391  C C    . GLU A 1 42  ? 121.334 -6.003  4.609   1.00 0.00 ? 42  GLU A C    5  
ATOM 9392  O O    . GLU A 1 42  ? 121.201 -7.039  5.212   1.00 0.00 ? 42  GLU A O    5  
ATOM 9393  C CB   . GLU A 1 42  ? 122.574 -4.793  6.479   1.00 0.00 ? 42  GLU A CB   5  
ATOM 9394  C CG   . GLU A 1 42  ? 124.023 -4.497  6.846   1.00 0.00 ? 42  GLU A CG   5  
ATOM 9395  C CD   . GLU A 1 42  ? 124.245 -4.366  8.328   1.00 0.00 ? 42  GLU A CD   5  
ATOM 9396  O OE1  . GLU A 1 42  ? 124.355 -5.398  9.038   1.00 0.00 ? 42  GLU A OE1  5  
ATOM 9397  O OE2  . GLU A 1 42  ? 124.309 -3.231  8.825   1.00 0.00 ? 42  GLU A OE2  5  
ATOM 9398  H H    . GLU A 1 42  ? 121.973 -3.034  4.497   1.00 0.00 ? 42  GLU A H    5  
ATOM 9399  H HA   . GLU A 1 42  ? 123.290 -5.526  4.636   1.00 0.00 ? 42  GLU A HA   5  
ATOM 9400  H HB2  . GLU A 1 42  ? 121.961 -3.954  6.774   1.00 0.00 ? 42  GLU A HB2  5  
ATOM 9401  H HB3  . GLU A 1 42  ? 122.264 -5.677  7.016   1.00 0.00 ? 42  GLU A HB3  5  
ATOM 9402  H HG2  . GLU A 1 42  ? 124.645 -5.287  6.456   1.00 0.00 ? 42  GLU A HG2  5  
ATOM 9403  H HG3  . GLU A 1 42  ? 124.343 -3.589  6.360   1.00 0.00 ? 42  GLU A HG3  5  
ATOM 9404  N N    . PHE A 1 43  ? 120.593 -5.669  3.583   1.00 0.00 ? 43  PHE A N    5  
ATOM 9405  C CA   . PHE A 1 43  ? 119.728 -6.613  2.933   1.00 0.00 ? 43  PHE A CA   5  
ATOM 9406  C C    . PHE A 1 43  ? 120.623 -7.577  2.206   1.00 0.00 ? 43  PHE A C    5  
ATOM 9407  O O    . PHE A 1 43  ? 120.611 -8.791  2.464   1.00 0.00 ? 43  PHE A O    5  
ATOM 9408  C CB   . PHE A 1 43  ? 118.794 -5.896  1.934   1.00 0.00 ? 43  PHE A CB   5  
ATOM 9409  C CG   . PHE A 1 43  ? 118.057 -6.785  0.983   1.00 0.00 ? 43  PHE A CG   5  
ATOM 9410  C CD1  . PHE A 1 43  ? 118.636 -7.168  -0.220  1.00 0.00 ? 43  PHE A CD1  5  
ATOM 9411  C CD2  . PHE A 1 43  ? 116.803 -7.227  1.275   1.00 0.00 ? 43  PHE A CD2  5  
ATOM 9412  C CE1  . PHE A 1 43  ? 117.968 -7.976  -1.097  1.00 0.00 ? 43  PHE A CE1  5  
ATOM 9413  C CE2  . PHE A 1 43  ? 116.126 -8.032  0.402   1.00 0.00 ? 43  PHE A CE2  5  
ATOM 9414  C CZ   . PHE A 1 43  ? 116.710 -8.408  -0.789  1.00 0.00 ? 43  PHE A CZ   5  
ATOM 9415  H H    . PHE A 1 43  ? 120.592 -4.741  3.269   1.00 0.00 ? 43  PHE A H    5  
ATOM 9416  H HA   . PHE A 1 43  ? 119.147 -7.135  3.679   1.00 0.00 ? 43  PHE A HA   5  
ATOM 9417  H HB2  . PHE A 1 43  ? 118.054 -5.340  2.490   1.00 0.00 ? 43  PHE A HB2  5  
ATOM 9418  H HB3  . PHE A 1 43  ? 119.382 -5.199  1.355   1.00 0.00 ? 43  PHE A HB3  5  
ATOM 9419  H HD1  . PHE A 1 43  ? 119.630 -6.815  -0.455  1.00 0.00 ? 43  PHE A HD1  5  
ATOM 9420  H HD2  . PHE A 1 43  ? 116.339 -6.935  2.206   1.00 0.00 ? 43  PHE A HD2  5  
ATOM 9421  H HE1  . PHE A 1 43  ? 118.430 -8.266  -2.031  1.00 0.00 ? 43  PHE A HE1  5  
ATOM 9422  H HE2  . PHE A 1 43  ? 115.127 -8.363  0.650   1.00 0.00 ? 43  PHE A HE2  5  
ATOM 9423  H HZ   . PHE A 1 43  ? 116.174 -9.047  -1.475  1.00 0.00 ? 43  PHE A HZ   5  
ATOM 9424  N N    . TRP A 1 44  ? 121.462 -7.052  1.317   1.00 0.00 ? 44  TRP A N    5  
ATOM 9425  C CA   . TRP A 1 44  ? 122.324 -7.980  0.621   1.00 0.00 ? 44  TRP A CA   5  
ATOM 9426  C C    . TRP A 1 44  ? 123.552 -8.404  1.410   1.00 0.00 ? 44  TRP A C    5  
ATOM 9427  O O    . TRP A 1 44  ? 124.149 -9.447  1.128   1.00 0.00 ? 44  TRP A O    5  
ATOM 9428  C CB   . TRP A 1 44  ? 122.578 -7.698  -0.863  1.00 0.00 ? 44  TRP A CB   5  
ATOM 9429  C CG   . TRP A 1 44  ? 123.164 -6.380  -1.235  1.00 0.00 ? 44  TRP A CG   5  
ATOM 9430  C CD1  . TRP A 1 44  ? 122.547 -5.403  -1.952  1.00 0.00 ? 44  TRP A CD1  5  
ATOM 9431  C CD2  . TRP A 1 44  ? 124.482 -5.904  -0.955  1.00 0.00 ? 44  TRP A CD2  5  
ATOM 9432  N NE1  . TRP A 1 44  ? 123.402 -4.365  -2.158  1.00 0.00 ? 44  TRP A NE1  5  
ATOM 9433  C CE2  . TRP A 1 44  ? 124.592 -4.638  -1.534  1.00 0.00 ? 44  TRP A CE2  5  
ATOM 9434  C CE3  . TRP A 1 44  ? 125.583 -6.426  -0.265  1.00 0.00 ? 44  TRP A CE3  5  
ATOM 9435  C CZ2  . TRP A 1 44  ? 125.745 -3.890  -1.449  1.00 0.00 ? 44  TRP A CZ2  5  
ATOM 9436  C CZ3  . TRP A 1 44  ? 126.729 -5.674  -0.180  1.00 0.00 ? 44  TRP A CZ3  5  
ATOM 9437  C CH2  . TRP A 1 44  ? 126.803 -4.419  -0.767  1.00 0.00 ? 44  TRP A CH2  5  
ATOM 9438  H H    . TRP A 1 44  ? 121.455 -6.076  1.160   1.00 0.00 ? 44  TRP A H    5  
ATOM 9439  H HA   . TRP A 1 44  ? 121.720 -8.877  0.678   1.00 0.00 ? 44  TRP A HA   5  
ATOM 9440  H HB2  . TRP A 1 44  ? 123.258 -8.448  -1.238  1.00 0.00 ? 44  TRP A HB2  5  
ATOM 9441  H HB3  . TRP A 1 44  ? 121.642 -7.807  -1.391  1.00 0.00 ? 44  TRP A HB3  5  
ATOM 9442  H HD1  . TRP A 1 44  ? 121.536 -5.469  -2.324  1.00 0.00 ? 44  TRP A HD1  5  
ATOM 9443  H HE1  . TRP A 1 44  ? 123.184 -3.551  -2.661  1.00 0.00 ? 44  TRP A HE1  5  
ATOM 9444  H HE3  . TRP A 1 44  ? 125.540 -7.401  0.199   1.00 0.00 ? 44  TRP A HE3  5  
ATOM 9445  H HZ2  . TRP A 1 44  ? 125.822 -2.911  -1.900  1.00 0.00 ? 44  TRP A HZ2  5  
ATOM 9446  H HZ3  . TRP A 1 44  ? 127.589 -6.057  0.353   1.00 0.00 ? 44  TRP A HZ3  5  
ATOM 9447  H HH2  . TRP A 1 44  ? 127.722 -3.860  -0.679  1.00 0.00 ? 44  TRP A HH2  5  
ATOM 9448  N N    . ILE A 1 45  ? 123.929 -7.615  2.409   1.00 0.00 ? 45  ILE A N    5  
ATOM 9449  C CA   . ILE A 1 45  ? 124.955 -8.050  3.348   1.00 0.00 ? 45  ILE A CA   5  
ATOM 9450  C C    . ILE A 1 45  ? 124.395 -9.186  4.210   1.00 0.00 ? 45  ILE A C    5  
ATOM 9451  O O    . ILE A 1 45  ? 125.125 -10.078 4.615   1.00 0.00 ? 45  ILE A O    5  
ATOM 9452  C CB   . ILE A 1 45  ? 125.550 -6.879  4.207   1.00 0.00 ? 45  ILE A CB   5  
ATOM 9453  C CG1  . ILE A 1 45  ? 126.527 -6.038  3.365   1.00 0.00 ? 45  ILE A CG1  5  
ATOM 9454  C CG2  . ILE A 1 45  ? 126.182 -7.349  5.510   1.00 0.00 ? 45  ILE A CG2  5  
ATOM 9455  C CD1  . ILE A 1 45  ? 127.097 -4.825  4.076   1.00 0.00 ? 45  ILE A CD1  5  
ATOM 9456  H H    . ILE A 1 45  ? 123.549 -6.712  2.495   1.00 0.00 ? 45  ILE A H    5  
ATOM 9457  H HA   . ILE A 1 45  ? 125.736 -8.485  2.741   1.00 0.00 ? 45  ILE A HA   5  
ATOM 9458  H HB   . ILE A 1 45  ? 124.744 -6.239  4.510   1.00 0.00 ? 45  ILE A HB   5  
ATOM 9459  H HG12 . ILE A 1 45  ? 127.358 -6.660  3.066   1.00 0.00 ? 45  ILE A HG12 5  
ATOM 9460  H HG13 . ILE A 1 45  ? 126.015 -5.693  2.478   1.00 0.00 ? 45  ILE A HG13 5  
ATOM 9461  H HG21 . ILE A 1 45  ? 125.457 -7.963  6.029   1.00 0.00 ? 45  ILE A HG21 5  
ATOM 9462  H HG22 . ILE A 1 45  ? 126.390 -6.474  6.110   1.00 0.00 ? 45  ILE A HG22 5  
ATOM 9463  H HG23 . ILE A 1 45  ? 127.084 -7.910  5.316   1.00 0.00 ? 45  ILE A HG23 5  
ATOM 9464  H HD11 . ILE A 1 45  ? 126.291 -4.168  4.367   1.00 0.00 ? 45  ILE A HD11 5  
ATOM 9465  H HD12 . ILE A 1 45  ? 127.763 -4.304  3.404   1.00 0.00 ? 45  ILE A HD12 5  
ATOM 9466  H HD13 . ILE A 1 45  ? 127.641 -5.145  4.952   1.00 0.00 ? 45  ILE A HD13 5  
ATOM 9467  N N    . ALA A 1 46  ? 123.076 -9.183  4.432   1.00 0.00 ? 46  ALA A N    5  
ATOM 9468  C CA   . ALA A 1 46  ? 122.436 -10.298 5.118   1.00 0.00 ? 46  ALA A CA   5  
ATOM 9469  C C    . ALA A 1 46  ? 122.575 -11.538 4.270   1.00 0.00 ? 46  ALA A C    5  
ATOM 9470  O O    . ALA A 1 46  ? 122.781 -12.605 4.790   1.00 0.00 ? 46  ALA A O    5  
ATOM 9471  C CB   . ALA A 1 46  ? 120.965 -10.048 5.396   1.00 0.00 ? 46  ALA A CB   5  
ATOM 9472  H H    . ALA A 1 46  ? 122.527 -8.416  4.165   1.00 0.00 ? 46  ALA A H    5  
ATOM 9473  H HA   . ALA A 1 46  ? 122.968 -10.417 6.051   1.00 0.00 ? 46  ALA A HA   5  
ATOM 9474  H HB1  . ALA A 1 46  ? 120.483 -9.769  4.471   1.00 0.00 ? 46  ALA A HB1  5  
ATOM 9475  H HB2  . ALA A 1 46  ? 120.840 -9.269  6.133   1.00 0.00 ? 46  ALA A HB2  5  
ATOM 9476  H HB3  . ALA A 1 46  ? 120.516 -10.970 5.745   1.00 0.00 ? 46  ALA A HB3  5  
ATOM 9477  N N    . CYS A 1 47  ? 122.464 -11.374 2.950   1.00 0.00 ? 47  CYS A N    5  
ATOM 9478  C CA   . CYS A 1 47  ? 122.657 -12.481 2.006   1.00 0.00 ? 47  CYS A CA   5  
ATOM 9479  C C    . CYS A 1 47  ? 124.143 -12.917 1.994   1.00 0.00 ? 47  CYS A C    5  
ATOM 9480  O O    . CYS A 1 47  ? 124.468 -14.089 1.800   1.00 0.00 ? 47  CYS A O    5  
ATOM 9481  C CB   . CYS A 1 47  ? 122.182 -12.083 0.596   1.00 0.00 ? 47  CYS A CB   5  
ATOM 9482  S SG   . CYS A 1 47  ? 122.260 -13.407 -0.639  1.00 0.00 ? 47  CYS A SG   5  
ATOM 9483  H H    . CYS A 1 47  ? 122.211 -10.484 2.617   1.00 0.00 ? 47  CYS A H    5  
ATOM 9484  H HA   . CYS A 1 47  ? 122.068 -13.313 2.366   1.00 0.00 ? 47  CYS A HA   5  
ATOM 9485  H HB2  . CYS A 1 47  ? 121.154 -11.758 0.652   1.00 0.00 ? 47  CYS A HB2  5  
ATOM 9486  H HB3  . CYS A 1 47  ? 122.789 -11.264 0.243   1.00 0.00 ? 47  CYS A HB3  5  
ATOM 9487  H HG   . CYS A 1 47  ? 122.970 -12.961 -1.670  1.00 0.00 ? 47  CYS A HG   5  
ATOM 9488  N N    . GLU A 1 48  ? 125.028 -11.973 2.216   1.00 0.00 ? 48  GLU A N    5  
ATOM 9489  C CA   . GLU A 1 48  ? 126.459 -12.239 2.338   1.00 0.00 ? 48  GLU A CA   5  
ATOM 9490  C C    . GLU A 1 48  ? 126.705 -13.046 3.625   1.00 0.00 ? 48  GLU A C    5  
ATOM 9491  O O    . GLU A 1 48  ? 127.447 -14.028 3.638   1.00 0.00 ? 48  GLU A O    5  
ATOM 9492  C CB   . GLU A 1 48  ? 127.199 -10.897 2.358   1.00 0.00 ? 48  GLU A CB   5  
ATOM 9493  C CG   . GLU A 1 48  ? 128.689 -10.940 2.649   1.00 0.00 ? 48  GLU A CG   5  
ATOM 9494  C CD   . GLU A 1 48  ? 129.481 -11.634 1.585   1.00 0.00 ? 48  GLU A CD   5  
ATOM 9495  O OE1  . GLU A 1 48  ? 129.517 -11.140 0.443   1.00 0.00 ? 48  GLU A OE1  5  
ATOM 9496  O OE2  . GLU A 1 48  ? 130.126 -12.648 1.875   1.00 0.00 ? 48  GLU A OE2  5  
ATOM 9497  H H    . GLU A 1 48  ? 124.709 -11.048 2.294   1.00 0.00 ? 48  GLU A H    5  
ATOM 9498  H HA   . GLU A 1 48  ? 126.773 -12.819 1.482   1.00 0.00 ? 48  GLU A HA   5  
ATOM 9499  H HB2  . GLU A 1 48  ? 127.077 -10.440 1.388   1.00 0.00 ? 48  GLU A HB2  5  
ATOM 9500  H HB3  . GLU A 1 48  ? 126.713 -10.273 3.087   1.00 0.00 ? 48  GLU A HB3  5  
ATOM 9501  H HG2  . GLU A 1 48  ? 129.056 -9.929  2.740   1.00 0.00 ? 48  GLU A HG2  5  
ATOM 9502  H HG3  . GLU A 1 48  ? 128.839 -11.455 3.586   1.00 0.00 ? 48  GLU A HG3  5  
ATOM 9503  N N    . ASP A 1 49  ? 126.040 -12.641 4.687   1.00 0.00 ? 49  ASP A N    5  
ATOM 9504  C CA   . ASP A 1 49  ? 126.095 -13.330 5.974   1.00 0.00 ? 49  ASP A CA   5  
ATOM 9505  C C    . ASP A 1 49  ? 125.382 -14.671 5.872   1.00 0.00 ? 49  ASP A C    5  
ATOM 9506  O O    . ASP A 1 49  ? 125.722 -15.626 6.544   1.00 0.00 ? 49  ASP A O    5  
ATOM 9507  C CB   . ASP A 1 49  ? 125.442 -12.476 7.052   1.00 0.00 ? 49  ASP A CB   5  
ATOM 9508  C CG   . ASP A 1 49  ? 125.547 -13.097 8.413   1.00 0.00 ? 49  ASP A CG   5  
ATOM 9509  O OD1  . ASP A 1 49  ? 126.611 -12.954 9.055   1.00 0.00 ? 49  ASP A OD1  5  
ATOM 9510  O OD2  . ASP A 1 49  ? 124.580 -13.743 8.866   1.00 0.00 ? 49  ASP A OD2  5  
ATOM 9511  H H    . ASP A 1 49  ? 125.503 -11.818 4.610   1.00 0.00 ? 49  ASP A H    5  
ATOM 9512  H HA   . ASP A 1 49  ? 127.127 -13.510 6.242   1.00 0.00 ? 49  ASP A HA   5  
ATOM 9513  H HB2  . ASP A 1 49  ? 125.925 -11.511 7.079   1.00 0.00 ? 49  ASP A HB2  5  
ATOM 9514  H HB3  . ASP A 1 49  ? 124.398 -12.345 6.811   1.00 0.00 ? 49  ASP A HB3  5  
ATOM 9515  N N    . PHE A 1 50  ? 124.406 -14.719 5.015   1.00 0.00 ? 50  PHE A N    5  
ATOM 9516  C CA   . PHE A 1 50  ? 123.658 -15.915 4.701   1.00 0.00 ? 50  PHE A CA   5  
ATOM 9517  C C    . PHE A 1 50  ? 124.573 -16.940 4.032   1.00 0.00 ? 50  PHE A C    5  
ATOM 9518  O O    . PHE A 1 50  ? 124.580 -18.101 4.394   1.00 0.00 ? 50  PHE A O    5  
ATOM 9519  C CB   . PHE A 1 50  ? 122.480 -15.529 3.799   1.00 0.00 ? 50  PHE A CB   5  
ATOM 9520  C CG   . PHE A 1 50  ? 121.707 -16.660 3.264   1.00 0.00 ? 50  PHE A CG   5  
ATOM 9521  C CD1  . PHE A 1 50  ? 120.852 -17.354 4.066   1.00 0.00 ? 50  PHE A CD1  5  
ATOM 9522  C CD2  . PHE A 1 50  ? 121.849 -17.033 1.951   1.00 0.00 ? 50  PHE A CD2  5  
ATOM 9523  C CE1  . PHE A 1 50  ? 120.145 -18.408 3.575   1.00 0.00 ? 50  PHE A CE1  5  
ATOM 9524  C CE2  . PHE A 1 50  ? 121.146 -18.086 1.452   1.00 0.00 ? 50  PHE A CE2  5  
ATOM 9525  C CZ   . PHE A 1 50  ? 120.292 -18.777 2.262   1.00 0.00 ? 50  PHE A CZ   5  
ATOM 9526  H H    . PHE A 1 50  ? 124.137 -13.880 4.580   1.00 0.00 ? 50  PHE A H    5  
ATOM 9527  H HA   . PHE A 1 50  ? 123.275 -16.327 5.622   1.00 0.00 ? 50  PHE A HA   5  
ATOM 9528  H HB2  . PHE A 1 50  ? 121.798 -14.910 4.362   1.00 0.00 ? 50  PHE A HB2  5  
ATOM 9529  H HB3  . PHE A 1 50  ? 122.860 -14.955 2.966   1.00 0.00 ? 50  PHE A HB3  5  
ATOM 9530  H HD1  . PHE A 1 50  ? 120.741 -17.044 5.095   1.00 0.00 ? 50  PHE A HD1  5  
ATOM 9531  H HD2  . PHE A 1 50  ? 122.527 -16.484 1.314   1.00 0.00 ? 50  PHE A HD2  5  
ATOM 9532  H HE1  . PHE A 1 50  ? 119.470 -18.955 4.218   1.00 0.00 ? 50  PHE A HE1  5  
ATOM 9533  H HE2  . PHE A 1 50  ? 121.262 -18.375 0.418   1.00 0.00 ? 50  PHE A HE2  5  
ATOM 9534  H HZ   . PHE A 1 50  ? 119.733 -19.612 1.868   1.00 0.00 ? 50  PHE A HZ   5  
ATOM 9535  N N    . LYS A 1 51  ? 125.369 -16.468 3.092   1.00 0.00 ? 51  LYS A N    5  
ATOM 9536  C CA   . LYS A 1 51  ? 126.370 -17.279 2.395   1.00 0.00 ? 51  LYS A CA   5  
ATOM 9537  C C    . LYS A 1 51  ? 127.459 -17.734 3.386   1.00 0.00 ? 51  LYS A C    5  
ATOM 9538  O O    . LYS A 1 51  ? 128.078 -18.793 3.238   1.00 0.00 ? 51  LYS A O    5  
ATOM 9539  C CB   . LYS A 1 51  ? 126.982 -16.427 1.285   1.00 0.00 ? 51  LYS A CB   5  
ATOM 9540  C CG   . LYS A 1 51  ? 128.065 -17.103 0.474   1.00 0.00 ? 51  LYS A CG   5  
ATOM 9541  C CD   . LYS A 1 51  ? 128.630 -16.169 -0.582  1.00 0.00 ? 51  LYS A CD   5  
ATOM 9542  C CE   . LYS A 1 51  ? 129.287 -14.948 0.026   1.00 0.00 ? 51  LYS A CE   5  
ATOM 9543  N NZ   . LYS A 1 51  ? 129.838 -14.052 -0.999  1.00 0.00 ? 51  LYS A NZ   5  
ATOM 9544  H H    . LYS A 1 51  ? 125.252 -15.531 2.824   1.00 0.00 ? 51  LYS A H    5  
ATOM 9545  H HA   . LYS A 1 51  ? 125.884 -18.140 1.960   1.00 0.00 ? 51  LYS A HA   5  
ATOM 9546  H HB2  . LYS A 1 51  ? 126.199 -16.130 0.605   1.00 0.00 ? 51  LYS A HB2  5  
ATOM 9547  H HB3  . LYS A 1 51  ? 127.400 -15.537 1.731   1.00 0.00 ? 51  LYS A HB3  5  
ATOM 9548  H HG2  . LYS A 1 51  ? 128.862 -17.407 1.136   1.00 0.00 ? 51  LYS A HG2  5  
ATOM 9549  H HG3  . LYS A 1 51  ? 127.646 -17.973 -0.011  1.00 0.00 ? 51  LYS A HG3  5  
ATOM 9550  H HD2  . LYS A 1 51  ? 129.365 -16.704 -1.164  1.00 0.00 ? 51  LYS A HD2  5  
ATOM 9551  H HD3  . LYS A 1 51  ? 127.825 -15.851 -1.230  1.00 0.00 ? 51  LYS A HD3  5  
ATOM 9552  H HE2  . LYS A 1 51  ? 128.549 -14.408 0.601   1.00 0.00 ? 51  LYS A HE2  5  
ATOM 9553  H HE3  . LYS A 1 51  ? 130.083 -15.273 0.680   1.00 0.00 ? 51  LYS A HE3  5  
ATOM 9554  H HZ1  . LYS A 1 51  ? 130.510 -14.566 -1.611  1.00 0.00 ? 51  LYS A HZ1  5  
ATOM 9555  H HZ2  . LYS A 1 51  ? 130.349 -13.261 -0.555  1.00 0.00 ? 51  LYS A HZ2  5  
ATOM 9556  H HZ3  . LYS A 1 51  ? 129.089 -13.654 -1.609  1.00 0.00 ? 51  LYS A HZ3  5  
ATOM 9557  N N    . LYS A 1 52  ? 127.666 -16.908 4.385   1.00 0.00 ? 52  LYS A N    5  
ATOM 9558  C CA   . LYS A 1 52  ? 128.597 -17.153 5.481   1.00 0.00 ? 52  LYS A CA   5  
ATOM 9559  C C    . LYS A 1 52  ? 128.011 -18.251 6.392   1.00 0.00 ? 52  LYS A C    5  
ATOM 9560  O O    . LYS A 1 52  ? 128.727 -19.004 7.045   1.00 0.00 ? 52  LYS A O    5  
ATOM 9561  C CB   . LYS A 1 52  ? 128.731 -15.843 6.254   1.00 0.00 ? 52  LYS A CB   5  
ATOM 9562  C CG   . LYS A 1 52  ? 129.688 -15.811 7.426   1.00 0.00 ? 52  LYS A CG   5  
ATOM 9563  C CD   . LYS A 1 52  ? 129.415 -14.560 8.264   1.00 0.00 ? 52  LYS A CD   5  
ATOM 9564  C CE   . LYS A 1 52  ? 129.551 -13.273 7.460   1.00 0.00 ? 52  LYS A CE   5  
ATOM 9565  N NZ   . LYS A 1 52  ? 129.041 -12.104 8.213   1.00 0.00 ? 52  LYS A NZ   5  
ATOM 9566  H H    . LYS A 1 52  ? 127.161 -16.067 4.369   1.00 0.00 ? 52  LYS A H    5  
ATOM 9567  H HA   . LYS A 1 52  ? 129.560 -17.447 5.090   1.00 0.00 ? 52  LYS A HA   5  
ATOM 9568  H HB2  . LYS A 1 52  ? 129.071 -15.086 5.562   1.00 0.00 ? 52  LYS A HB2  5  
ATOM 9569  H HB3  . LYS A 1 52  ? 127.746 -15.577 6.616   1.00 0.00 ? 52  LYS A HB3  5  
ATOM 9570  H HG2  . LYS A 1 52  ? 129.538 -16.692 8.031   1.00 0.00 ? 52  LYS A HG2  5  
ATOM 9571  H HG3  . LYS A 1 52  ? 130.704 -15.775 7.061   1.00 0.00 ? 52  LYS A HG3  5  
ATOM 9572  H HD2  . LYS A 1 52  ? 128.391 -14.605 8.604   1.00 0.00 ? 52  LYS A HD2  5  
ATOM 9573  H HD3  . LYS A 1 52  ? 130.092 -14.531 9.105   1.00 0.00 ? 52  LYS A HD3  5  
ATOM 9574  H HE2  . LYS A 1 52  ? 130.595 -13.114 7.229   1.00 0.00 ? 52  LYS A HE2  5  
ATOM 9575  H HE3  . LYS A 1 52  ? 128.992 -13.375 6.542   1.00 0.00 ? 52  LYS A HE3  5  
ATOM 9576  H HZ1  . LYS A 1 52  ? 129.608 -11.910 9.067   1.00 0.00 ? 52  LYS A HZ1  5  
ATOM 9577  H HZ2  . LYS A 1 52  ? 128.064 -12.293 8.533   1.00 0.00 ? 52  LYS A HZ2  5  
ATOM 9578  H HZ3  . LYS A 1 52  ? 129.032 -11.248 7.615   1.00 0.00 ? 52  LYS A HZ3  5  
ATOM 9579  N N    . SER A 1 53  ? 126.707 -18.352 6.378   1.00 0.00 ? 53  SER A N    5  
ATOM 9580  C CA   . SER A 1 53  ? 125.966 -19.306 7.168   1.00 0.00 ? 53  SER A CA   5  
ATOM 9581  C C    . SER A 1 53  ? 125.597 -20.482 6.283   1.00 0.00 ? 53  SER A C    5  
ATOM 9582  O O    . SER A 1 53  ? 124.486 -20.982 6.337   1.00 0.00 ? 53  SER A O    5  
ATOM 9583  C CB   . SER A 1 53  ? 124.697 -18.641 7.660   1.00 0.00 ? 53  SER A CB   5  
ATOM 9584  O OG   . SER A 1 53  ? 124.993 -17.432 8.361   1.00 0.00 ? 53  SER A OG   5  
ATOM 9585  H H    . SER A 1 53  ? 126.194 -17.776 5.770   1.00 0.00 ? 53  SER A H    5  
ATOM 9586  H HA   . SER A 1 53  ? 126.557 -19.628 8.012   1.00 0.00 ? 53  SER A HA   5  
ATOM 9587  H HB2  . SER A 1 53  ? 124.062 -18.452 6.805   1.00 0.00 ? 53  SER A HB2  5  
ATOM 9588  H HB3  . SER A 1 53  ? 124.182 -19.323 8.319   1.00 0.00 ? 53  SER A HB3  5  
ATOM 9589  H HG   . SER A 1 53  ? 125.486 -16.860 7.754   1.00 0.00 ? 53  SER A HG   5  
ATOM 9590  N N    . LYS A 1 54  ? 126.573 -20.949 5.537   1.00 0.00 ? 54  LYS A N    5  
ATOM 9591  C CA   . LYS A 1 54  ? 126.423 -22.017 4.536   1.00 0.00 ? 54  LYS A CA   5  
ATOM 9592  C C    . LYS A 1 54  ? 126.046 -23.404 5.087   1.00 0.00 ? 54  LYS A C    5  
ATOM 9593  O O    . LYS A 1 54  ? 126.135 -24.402 4.364   1.00 0.00 ? 54  LYS A O    5  
ATOM 9594  C CB   . LYS A 1 54  ? 127.651 -22.080 3.594   1.00 0.00 ? 54  LYS A CB   5  
ATOM 9595  C CG   . LYS A 1 54  ? 129.026 -22.017 4.270   1.00 0.00 ? 54  LYS A CG   5  
ATOM 9596  C CD   . LYS A 1 54  ? 129.321 -23.197 5.175   1.00 0.00 ? 54  LYS A CD   5  
ATOM 9597  C CE   . LYS A 1 54  ? 130.666 -23.029 5.862   1.00 0.00 ? 54  LYS A CE   5  
ATOM 9598  N NZ   . LYS A 1 54  ? 130.722 -21.797 6.690   1.00 0.00 ? 54  LYS A NZ   5  
ATOM 9599  H H    . LYS A 1 54  ? 127.445 -20.532 5.687   1.00 0.00 ? 54  LYS A H    5  
ATOM 9600  H HA   . LYS A 1 54  ? 125.583 -21.708 3.931   1.00 0.00 ? 54  LYS A HA   5  
ATOM 9601  H HB2  . LYS A 1 54  ? 127.604 -23.005 3.038   1.00 0.00 ? 54  LYS A HB2  5  
ATOM 9602  H HB3  . LYS A 1 54  ? 127.582 -21.259 2.894   1.00 0.00 ? 54  LYS A HB3  5  
ATOM 9603  H HG2  . LYS A 1 54  ? 129.784 -21.989 3.503   1.00 0.00 ? 54  LYS A HG2  5  
ATOM 9604  H HG3  . LYS A 1 54  ? 129.078 -21.106 4.851   1.00 0.00 ? 54  LYS A HG3  5  
ATOM 9605  H HD2  . LYS A 1 54  ? 128.546 -23.268 5.923   1.00 0.00 ? 54  LYS A HD2  5  
ATOM 9606  H HD3  . LYS A 1 54  ? 129.339 -24.101 4.581   1.00 0.00 ? 54  LYS A HD3  5  
ATOM 9607  H HE2  . LYS A 1 54  ? 130.840 -23.885 6.498   1.00 0.00 ? 54  LYS A HE2  5  
ATOM 9608  H HE3  . LYS A 1 54  ? 131.438 -22.983 5.107   1.00 0.00 ? 54  LYS A HE3  5  
ATOM 9609  H HZ1  . LYS A 1 54  ? 130.600 -20.939 6.110   1.00 0.00 ? 54  LYS A HZ1  5  
ATOM 9610  H HZ2  . LYS A 1 54  ? 131.661 -21.731 7.145   1.00 0.00 ? 54  LYS A HZ2  5  
ATOM 9611  H HZ3  . LYS A 1 54  ? 129.984 -21.821 7.426   1.00 0.00 ? 54  LYS A HZ3  5  
ATOM 9612  N N    . GLY A 1 55  ? 125.621 -23.468 6.321   1.00 0.00 ? 55  GLY A N    5  
ATOM 9613  C CA   . GLY A 1 55  ? 125.107 -24.688 6.855   1.00 0.00 ? 55  GLY A CA   5  
ATOM 9614  C C    . GLY A 1 55  ? 123.742 -24.882 6.252   1.00 0.00 ? 55  GLY A C    5  
ATOM 9615  O O    . GLY A 1 55  ? 122.912 -24.000 6.376   1.00 0.00 ? 55  GLY A O    5  
ATOM 9616  H H    . GLY A 1 55  ? 125.589 -22.641 6.845   1.00 0.00 ? 55  GLY A H    5  
ATOM 9617  H HA2  . GLY A 1 55  ? 125.762 -25.506 6.591   1.00 0.00 ? 55  GLY A HA2  5  
ATOM 9618  H HA3  . GLY A 1 55  ? 125.014 -24.610 7.928   1.00 0.00 ? 55  GLY A HA3  5  
ATOM 9619  N N    . PRO A 1 56  ? 123.469 -26.011 5.592   1.00 0.00 ? 56  PRO A N    5  
ATOM 9620  C CA   . PRO A 1 56  ? 122.246 -26.182 4.806   1.00 0.00 ? 56  PRO A CA   5  
ATOM 9621  C C    . PRO A 1 56  ? 120.960 -26.039 5.621   1.00 0.00 ? 56  PRO A C    5  
ATOM 9622  O O    . PRO A 1 56  ? 119.950 -25.562 5.111   1.00 0.00 ? 56  PRO A O    5  
ATOM 9623  C CB   . PRO A 1 56  ? 122.378 -27.576 4.191   1.00 0.00 ? 56  PRO A CB   5  
ATOM 9624  C CG   . PRO A 1 56  ? 123.379 -28.278 5.039   1.00 0.00 ? 56  PRO A CG   5  
ATOM 9625  C CD   . PRO A 1 56  ? 124.302 -27.219 5.578   1.00 0.00 ? 56  PRO A CD   5  
ATOM 9626  H HA   . PRO A 1 56  ? 122.236 -25.438 4.020   1.00 0.00 ? 56  PRO A HA   5  
ATOM 9627  H HB2  . PRO A 1 56  ? 121.420 -28.073 4.212   1.00 0.00 ? 56  PRO A HB2  5  
ATOM 9628  H HB3  . PRO A 1 56  ? 122.724 -27.482 3.172   1.00 0.00 ? 56  PRO A HB3  5  
ATOM 9629  H HG2  . PRO A 1 56  ? 122.880 -28.784 5.854   1.00 0.00 ? 56  PRO A HG2  5  
ATOM 9630  H HG3  . PRO A 1 56  ? 123.933 -28.987 4.443   1.00 0.00 ? 56  PRO A HG3  5  
ATOM 9631  H HD2  . PRO A 1 56  ? 124.629 -27.471 6.575   1.00 0.00 ? 56  PRO A HD2  5  
ATOM 9632  H HD3  . PRO A 1 56  ? 125.150 -27.088 4.926   1.00 0.00 ? 56  PRO A HD3  5  
ATOM 9633  N N    . GLN A 1 57  ? 121.004 -26.390 6.890   1.00 0.00 ? 57  GLN A N    5  
ATOM 9634  C CA   . GLN A 1 57  ? 119.827 -26.247 7.729   1.00 0.00 ? 57  GLN A CA   5  
ATOM 9635  C C    . GLN A 1 57  ? 119.638 -24.786 8.079   1.00 0.00 ? 57  GLN A C    5  
ATOM 9636  O O    . GLN A 1 57  ? 118.507 -24.290 8.152   1.00 0.00 ? 57  GLN A O    5  
ATOM 9637  C CB   . GLN A 1 57  ? 119.909 -27.081 9.000   1.00 0.00 ? 57  GLN A CB   5  
ATOM 9638  C CG   . GLN A 1 57  ? 120.051 -28.572 8.771   1.00 0.00 ? 57  GLN A CG   5  
ATOM 9639  C CD   . GLN A 1 57  ? 119.899 -29.371 10.051  1.00 0.00 ? 57  GLN A CD   5  
ATOM 9640  O OE1  . GLN A 1 57  ? 120.511 -30.432 10.218  1.00 0.00 ? 57  GLN A OE1  5  
ATOM 9641  N NE2  . GLN A 1 57  ? 119.062 -28.894 10.949  1.00 0.00 ? 57  GLN A NE2  5  
ATOM 9642  H H    . GLN A 1 57  ? 121.857 -26.717 7.263   1.00 0.00 ? 57  GLN A H    5  
ATOM 9643  H HA   . GLN A 1 57  ? 118.977 -26.565 7.143   1.00 0.00 ? 57  GLN A HA   5  
ATOM 9644  H HB2  . GLN A 1 57  ? 120.762 -26.749 9.573   1.00 0.00 ? 57  GLN A HB2  5  
ATOM 9645  H HB3  . GLN A 1 57  ? 119.013 -26.911 9.580   1.00 0.00 ? 57  GLN A HB3  5  
ATOM 9646  H HG2  . GLN A 1 57  ? 119.291 -28.890 8.072   1.00 0.00 ? 57  GLN A HG2  5  
ATOM 9647  H HG3  . GLN A 1 57  ? 121.028 -28.768 8.355   1.00 0.00 ? 57  GLN A HG3  5  
ATOM 9648  H HE21 . GLN A 1 57  ? 118.589 -28.053 10.760  1.00 0.00 ? 57  GLN A HE21 5  
ATOM 9649  H HE22 . GLN A 1 57  ? 118.915 -29.412 11.768  1.00 0.00 ? 57  GLN A HE22 5  
ATOM 9650  N N    . GLN A 1 58  ? 120.761 -24.090 8.235   1.00 0.00 ? 58  GLN A N    5  
ATOM 9651  C CA   . GLN A 1 58  ? 120.769 -22.669 8.533   1.00 0.00 ? 58  GLN A CA   5  
ATOM 9652  C C    . GLN A 1 58  ? 120.194 -21.910 7.359   1.00 0.00 ? 58  GLN A C    5  
ATOM 9653  O O    . GLN A 1 58  ? 119.505 -20.916 7.541   1.00 0.00 ? 58  GLN A O    5  
ATOM 9654  C CB   . GLN A 1 58  ? 122.197 -22.172 8.829   1.00 0.00 ? 58  GLN A CB   5  
ATOM 9655  C CG   . GLN A 1 58  ? 122.284 -20.685 9.168   1.00 0.00 ? 58  GLN A CG   5  
ATOM 9656  C CD   . GLN A 1 58  ? 121.464 -20.334 10.392  1.00 0.00 ? 58  GLN A CD   5  
ATOM 9657  O OE1  . GLN A 1 58  ? 121.310 -21.140 11.304  1.00 0.00 ? 58  GLN A OE1  5  
ATOM 9658  N NE2  . GLN A 1 58  ? 120.908 -19.166 10.403  1.00 0.00 ? 58  GLN A NE2  5  
ATOM 9659  H H    . GLN A 1 58  ? 121.620 -24.548 8.121   1.00 0.00 ? 58  GLN A H    5  
ATOM 9660  H HA   . GLN A 1 58  ? 120.148 -22.502 9.401   1.00 0.00 ? 58  GLN A HA   5  
ATOM 9661  H HB2  . GLN A 1 58  ? 122.590 -22.729 9.666   1.00 0.00 ? 58  GLN A HB2  5  
ATOM 9662  H HB3  . GLN A 1 58  ? 122.815 -22.359 7.963   1.00 0.00 ? 58  GLN A HB3  5  
ATOM 9663  H HG2  . GLN A 1 58  ? 123.319 -20.477 9.402   1.00 0.00 ? 58  GLN A HG2  5  
ATOM 9664  H HG3  . GLN A 1 58  ? 121.991 -20.056 8.333   1.00 0.00 ? 58  GLN A HG3  5  
ATOM 9665  H HE21 . GLN A 1 58  ? 121.043 -18.579 9.635   1.00 0.00 ? 58  GLN A HE21 5  
ATOM 9666  H HE22 . GLN A 1 58  ? 120.357 -18.916 11.181  1.00 0.00 ? 58  GLN A HE22 5  
ATOM 9667  N N    . ILE A 1 59  ? 120.471 -22.413 6.158   1.00 0.00 ? 59  ILE A N    5  
ATOM 9668  C CA   . ILE A 1 59  ? 119.980 -21.829 4.915   1.00 0.00 ? 59  ILE A CA   5  
ATOM 9669  C C    . ILE A 1 59  ? 118.466 -21.669 4.968   1.00 0.00 ? 59  ILE A C    5  
ATOM 9670  O O    . ILE A 1 59  ? 117.951 -20.604 4.710   1.00 0.00 ? 59  ILE A O    5  
ATOM 9671  C CB   . ILE A 1 59  ? 120.358 -22.696 3.674   1.00 0.00 ? 59  ILE A CB   5  
ATOM 9672  C CG1  . ILE A 1 59  ? 121.873 -22.952 3.613   1.00 0.00 ? 59  ILE A CG1  5  
ATOM 9673  C CG2  . ILE A 1 59  ? 119.850 -22.077 2.375   1.00 0.00 ? 59  ILE A CG2  5  
ATOM 9674  C CD1  . ILE A 1 59  ? 122.753 -21.720 3.702   1.00 0.00 ? 59  ILE A CD1  5  
ATOM 9675  H H    . ILE A 1 59  ? 121.070 -23.192 6.122   1.00 0.00 ? 59  ILE A H    5  
ATOM 9676  H HA   . ILE A 1 59  ? 120.429 -20.853 4.805   1.00 0.00 ? 59  ILE A HA   5  
ATOM 9677  H HB   . ILE A 1 59  ? 119.855 -23.645 3.788   1.00 0.00 ? 59  ILE A HB   5  
ATOM 9678  H HG12 . ILE A 1 59  ? 122.148 -23.596 4.435   1.00 0.00 ? 59  ILE A HG12 5  
ATOM 9679  H HG13 . ILE A 1 59  ? 122.101 -23.458 2.686   1.00 0.00 ? 59  ILE A HG13 5  
ATOM 9680  H HG21 . ILE A 1 59  ? 120.086 -22.707 1.529   1.00 0.00 ? 59  ILE A HG21 5  
ATOM 9681  H HG22 . ILE A 1 59  ? 120.305 -21.106 2.241   1.00 0.00 ? 59  ILE A HG22 5  
ATOM 9682  H HG23 . ILE A 1 59  ? 118.780 -21.943 2.448   1.00 0.00 ? 59  ILE A HG23 5  
ATOM 9683  H HD11 . ILE A 1 59  ? 122.588 -21.069 2.856   1.00 0.00 ? 59  ILE A HD11 5  
ATOM 9684  H HD12 . ILE A 1 59  ? 123.776 -22.066 3.710   1.00 0.00 ? 59  ILE A HD12 5  
ATOM 9685  H HD13 . ILE A 1 59  ? 122.575 -21.189 4.629   1.00 0.00 ? 59  ILE A HD13 5  
ATOM 9686  N N    . HIS A 1 60  ? 117.772 -22.727 5.365   1.00 0.00 ? 60  HIS A N    5  
ATOM 9687  C CA   . HIS A 1 60  ? 116.299 -22.705 5.443   1.00 0.00 ? 60  HIS A CA   5  
ATOM 9688  C C    . HIS A 1 60  ? 115.821 -21.650 6.417   1.00 0.00 ? 60  HIS A C    5  
ATOM 9689  O O    . HIS A 1 60  ? 114.941 -20.855 6.098   1.00 0.00 ? 60  HIS A O    5  
ATOM 9690  C CB   . HIS A 1 60  ? 115.717 -24.067 5.858   1.00 0.00 ? 60  HIS A CB   5  
ATOM 9691  C CG   . HIS A 1 60  ? 115.987 -25.176 4.903   1.00 0.00 ? 60  HIS A CG   5  
ATOM 9692  N ND1  . HIS A 1 60  ? 115.114 -25.561 3.925   1.00 0.00 ? 60  HIS A ND1  5  
ATOM 9693  C CD2  . HIS A 1 60  ? 117.049 -25.981 4.786   1.00 0.00 ? 60  HIS A CD2  5  
ATOM 9694  C CE1  . HIS A 1 60  ? 115.634 -26.554 3.244   1.00 0.00 ? 60  HIS A CE1  5  
ATOM 9695  N NE2  . HIS A 1 60  ? 116.810 -26.827 3.750   1.00 0.00 ? 60  HIS A NE2  5  
ATOM 9696  H H    . HIS A 1 60  ? 118.292 -23.519 5.613   1.00 0.00 ? 60  HIS A H    5  
ATOM 9697  H HA   . HIS A 1 60  ? 115.929 -22.453 4.460   1.00 0.00 ? 60  HIS A HA   5  
ATOM 9698  H HB2  . HIS A 1 60  ? 116.136 -24.351 6.811   1.00 0.00 ? 60  HIS A HB2  5  
ATOM 9699  H HB3  . HIS A 1 60  ? 114.646 -23.969 5.966   1.00 0.00 ? 60  HIS A HB3  5  
ATOM 9700  H HD1  . HIS A 1 60  ? 114.212 -25.185 3.779   1.00 0.00 ? 60  HIS A HD1  5  
ATOM 9701  H HD2  . HIS A 1 60  ? 117.928 -25.949 5.417   1.00 0.00 ? 60  HIS A HD2  5  
ATOM 9702  H HE1  . HIS A 1 60  ? 115.171 -27.058 2.409   1.00 0.00 ? 60  HIS A HE1  5  
ATOM 9703  H HE2  . HIS A 1 60  ? 117.547 -27.245 3.240   1.00 0.00 ? 60  HIS A HE2  5  
ATOM 9704  N N    . LEU A 1 61  ? 116.432 -21.639 7.581   1.00 0.00 ? 61  LEU A N    5  
ATOM 9705  C CA   . LEU A 1 61  ? 116.067 -20.729 8.662   1.00 0.00 ? 61  LEU A CA   5  
ATOM 9706  C C    . LEU A 1 61  ? 116.339 -19.294 8.252   1.00 0.00 ? 61  LEU A C    5  
ATOM 9707  O O    . LEU A 1 61  ? 115.426 -18.484 8.088   1.00 0.00 ? 61  LEU A O    5  
ATOM 9708  C CB   . LEU A 1 61  ? 116.938 -21.030 9.870   1.00 0.00 ? 61  LEU A CB   5  
ATOM 9709  C CG   . LEU A 1 61  ? 117.009 -22.474 10.313  1.00 0.00 ? 61  LEU A CG   5  
ATOM 9710  C CD1  . LEU A 1 61  ? 118.075 -22.615 11.364  1.00 0.00 ? 61  LEU A CD1  5  
ATOM 9711  C CD2  . LEU A 1 61  ? 115.668 -22.942 10.836  1.00 0.00 ? 61  LEU A CD2  5  
ATOM 9712  H H    . LEU A 1 61  ? 117.173 -22.266 7.721   1.00 0.00 ? 61  LEU A H    5  
ATOM 9713  H HA   . LEU A 1 61  ? 115.032 -20.868 8.934   1.00 0.00 ? 61  LEU A HA   5  
ATOM 9714  H HB2  . LEU A 1 61  ? 117.943 -20.704 9.645   1.00 0.00 ? 61  LEU A HB2  5  
ATOM 9715  H HB3  . LEU A 1 61  ? 116.572 -20.442 10.699  1.00 0.00 ? 61  LEU A HB3  5  
ATOM 9716  H HG   . LEU A 1 61  ? 117.285 -23.088 9.468   1.00 0.00 ? 61  LEU A HG   5  
ATOM 9717  H HD11 . LEU A 1 61  ? 118.182 -23.651 11.652  1.00 0.00 ? 61  LEU A HD11 5  
ATOM 9718  H HD12 . LEU A 1 61  ? 117.816 -22.009 12.220  1.00 0.00 ? 61  LEU A HD12 5  
ATOM 9719  H HD13 . LEU A 1 61  ? 118.994 -22.257 10.926  1.00 0.00 ? 61  LEU A HD13 5  
ATOM 9720  H HD21 . LEU A 1 61  ? 115.744 -23.975 11.143  1.00 0.00 ? 61  LEU A HD21 5  
ATOM 9721  H HD22 . LEU A 1 61  ? 114.940 -22.851 10.043  1.00 0.00 ? 61  LEU A HD22 5  
ATOM 9722  H HD23 . LEU A 1 61  ? 115.375 -22.329 11.675  1.00 0.00 ? 61  LEU A HD23 5  
ATOM 9723  N N    . LYS A 1 62  ? 117.610 -19.031 8.047   1.00 0.00 ? 62  LYS A N    5  
ATOM 9724  C CA   . LYS A 1 62  ? 118.128 -17.716 7.737   1.00 0.00 ? 62  LYS A CA   5  
ATOM 9725  C C    . LYS A 1 62  ? 117.518 -17.102 6.477   1.00 0.00 ? 62  LYS A C    5  
ATOM 9726  O O    . LYS A 1 62  ? 117.129 -15.940 6.497   1.00 0.00 ? 62  LYS A O    5  
ATOM 9727  C CB   . LYS A 1 62  ? 119.677 -17.744 7.734   1.00 0.00 ? 62  LYS A CB   5  
ATOM 9728  C CG   . LYS A 1 62  ? 120.354 -16.453 7.318   1.00 0.00 ? 62  LYS A CG   5  
ATOM 9729  C CD   . LYS A 1 62  ? 121.802 -16.328 7.806   1.00 0.00 ? 62  LYS A CD   5  
ATOM 9730  C CE   . LYS A 1 62  ? 121.878 -16.063 9.313   1.00 0.00 ? 62  LYS A CE   5  
ATOM 9731  N NZ   . LYS A 1 62  ? 123.274 -15.856 9.785   1.00 0.00 ? 62  LYS A NZ   5  
ATOM 9732  H H    . LYS A 1 62  ? 118.232 -19.793 8.121   1.00 0.00 ? 62  LYS A H    5  
ATOM 9733  H HA   . LYS A 1 62  ? 117.819 -17.087 8.560   1.00 0.00 ? 62  LYS A HA   5  
ATOM 9734  H HB2  . LYS A 1 62  ? 120.006 -18.011 8.723   1.00 0.00 ? 62  LYS A HB2  5  
ATOM 9735  H HB3  . LYS A 1 62  ? 119.992 -18.526 7.059   1.00 0.00 ? 62  LYS A HB3  5  
ATOM 9736  H HG2  . LYS A 1 62  ? 120.406 -16.497 6.241   1.00 0.00 ? 62  LYS A HG2  5  
ATOM 9737  H HG3  . LYS A 1 62  ? 119.773 -15.608 7.651   1.00 0.00 ? 62  LYS A HG3  5  
ATOM 9738  H HD2  . LYS A 1 62  ? 122.326 -17.247 7.590   1.00 0.00 ? 62  LYS A HD2  5  
ATOM 9739  H HD3  . LYS A 1 62  ? 122.278 -15.511 7.283   1.00 0.00 ? 62  LYS A HD3  5  
ATOM 9740  H HE2  . LYS A 1 62  ? 121.302 -15.179 9.539   1.00 0.00 ? 62  LYS A HE2  5  
ATOM 9741  H HE3  . LYS A 1 62  ? 121.451 -16.908 9.831   1.00 0.00 ? 62  LYS A HE3  5  
ATOM 9742  H HZ1  . LYS A 1 62  ? 123.310 -15.701 10.816  1.00 0.00 ? 62  LYS A HZ1  5  
ATOM 9743  H HZ2  . LYS A 1 62  ? 123.691 -14.996 9.358   1.00 0.00 ? 62  LYS A HZ2  5  
ATOM 9744  H HZ3  . LYS A 1 62  ? 123.908 -16.646 9.539   1.00 0.00 ? 62  LYS A HZ3  5  
ATOM 9745  N N    . ALA A 1 63  ? 117.383 -17.879 5.412   1.00 0.00 ? 63  ALA A N    5  
ATOM 9746  C CA   . ALA A 1 63  ? 116.782 -17.357 4.170   1.00 0.00 ? 63  ALA A CA   5  
ATOM 9747  C C    . ALA A 1 63  ? 115.347 -16.938 4.403   1.00 0.00 ? 63  ALA A C    5  
ATOM 9748  O O    . ALA A 1 63  ? 114.951 -15.830 4.058   1.00 0.00 ? 63  ALA A O    5  
ATOM 9749  C CB   . ALA A 1 63  ? 116.829 -18.372 3.029   1.00 0.00 ? 63  ALA A CB   5  
ATOM 9750  H H    . ALA A 1 63  ? 117.702 -18.808 5.467   1.00 0.00 ? 63  ALA A H    5  
ATOM 9751  H HA   . ALA A 1 63  ? 117.350 -16.484 3.881   1.00 0.00 ? 63  ALA A HA   5  
ATOM 9752  H HB1  . ALA A 1 63  ? 116.489 -17.921 2.104   1.00 0.00 ? 63  ALA A HB1  5  
ATOM 9753  H HB2  . ALA A 1 63  ? 116.163 -19.184 3.283   1.00 0.00 ? 63  ALA A HB2  5  
ATOM 9754  H HB3  . ALA A 1 63  ? 117.827 -18.769 2.901   1.00 0.00 ? 63  ALA A HB3  5  
ATOM 9755  N N    . LYS A 1 64  ? 114.581 -17.816 5.022   1.00 0.00 ? 64  LYS A N    5  
ATOM 9756  C CA   . LYS A 1 64  ? 113.166 -17.572 5.261   1.00 0.00 ? 64  LYS A CA   5  
ATOM 9757  C C    . LYS A 1 64  ? 112.966 -16.388 6.231   1.00 0.00 ? 64  LYS A C    5  
ATOM 9758  O O    . LYS A 1 64  ? 111.975 -15.650 6.133   1.00 0.00 ? 64  LYS A O    5  
ATOM 9759  C CB   . LYS A 1 64  ? 112.512 -18.849 5.786   1.00 0.00 ? 64  LYS A CB   5  
ATOM 9760  C CG   . LYS A 1 64  ? 110.991 -18.840 5.868   1.00 0.00 ? 64  LYS A CG   5  
ATOM 9761  C CD   . LYS A 1 64  ? 110.339 -18.617 4.512   1.00 0.00 ? 64  LYS A CD   5  
ATOM 9762  C CE   . LYS A 1 64  ? 108.836 -18.899 4.559   1.00 0.00 ? 64  LYS A CE   5  
ATOM 9763  N NZ   . LYS A 1 64  ? 108.102 -18.040 5.519   1.00 0.00 ? 64  LYS A NZ   5  
ATOM 9764  H H    . LYS A 1 64  ? 114.981 -18.661 5.325   1.00 0.00 ? 64  LYS A H    5  
ATOM 9765  H HA   . LYS A 1 64  ? 112.718 -17.314 4.313   1.00 0.00 ? 64  LYS A HA   5  
ATOM 9766  H HB2  . LYS A 1 64  ? 112.799 -19.667 5.144   1.00 0.00 ? 64  LYS A HB2  5  
ATOM 9767  H HB3  . LYS A 1 64  ? 112.900 -19.042 6.775   1.00 0.00 ? 64  LYS A HB3  5  
ATOM 9768  H HG2  . LYS A 1 64  ? 110.657 -19.788 6.261   1.00 0.00 ? 64  LYS A HG2  5  
ATOM 9769  H HG3  . LYS A 1 64  ? 110.686 -18.049 6.538   1.00 0.00 ? 64  LYS A HG3  5  
ATOM 9770  H HD2  . LYS A 1 64  ? 110.494 -17.591 4.213   1.00 0.00 ? 64  LYS A HD2  5  
ATOM 9771  H HD3  . LYS A 1 64  ? 110.799 -19.277 3.791   1.00 0.00 ? 64  LYS A HD3  5  
ATOM 9772  H HE2  . LYS A 1 64  ? 108.437 -18.735 3.570   1.00 0.00 ? 64  LYS A HE2  5  
ATOM 9773  H HE3  . LYS A 1 64  ? 108.697 -19.935 4.827   1.00 0.00 ? 64  LYS A HE3  5  
ATOM 9774  H HZ1  . LYS A 1 64  ? 108.536 -18.024 6.467   1.00 0.00 ? 64  LYS A HZ1  5  
ATOM 9775  H HZ2  . LYS A 1 64  ? 107.145 -18.444 5.640   1.00 0.00 ? 64  LYS A HZ2  5  
ATOM 9776  H HZ3  . LYS A 1 64  ? 107.941 -17.072 5.168   1.00 0.00 ? 64  LYS A HZ3  5  
ATOM 9777  N N    . ALA A 1 65  ? 113.922 -16.194 7.126   1.00 0.00 ? 65  ALA A N    5  
ATOM 9778  C CA   . ALA A 1 65  ? 113.890 -15.081 8.059   1.00 0.00 ? 65  ALA A CA   5  
ATOM 9779  C C    . ALA A 1 65  ? 114.088 -13.757 7.317   1.00 0.00 ? 65  ALA A C    5  
ATOM 9780  O O    . ALA A 1 65  ? 113.281 -12.813 7.474   1.00 0.00 ? 65  ALA A O    5  
ATOM 9781  C CB   . ALA A 1 65  ? 114.944 -15.262 9.139   1.00 0.00 ? 65  ALA A CB   5  
ATOM 9782  H H    . ALA A 1 65  ? 114.668 -16.832 7.167   1.00 0.00 ? 65  ALA A H    5  
ATOM 9783  H HA   . ALA A 1 65  ? 112.914 -15.072 8.522   1.00 0.00 ? 65  ALA A HA   5  
ATOM 9784  H HB1  . ALA A 1 65  ? 114.787 -16.201 9.648   1.00 0.00 ? 65  ALA A HB1  5  
ATOM 9785  H HB2  . ALA A 1 65  ? 114.874 -14.450 9.848   1.00 0.00 ? 65  ALA A HB2  5  
ATOM 9786  H HB3  . ALA A 1 65  ? 115.923 -15.256 8.684   1.00 0.00 ? 65  ALA A HB3  5  
ATOM 9787  N N    . ILE A 1 66  ? 115.139 -13.703 6.480   1.00 0.00 ? 66  ILE A N    5  
ATOM 9788  C CA   . ILE A 1 66  ? 115.457 -12.520 5.663   1.00 0.00 ? 66  ILE A CA   5  
ATOM 9789  C C    . ILE A 1 66  ? 114.291 -12.240 4.719   1.00 0.00 ? 66  ILE A C    5  
ATOM 9790  O O    . ILE A 1 66  ? 113.889 -11.093 4.503   1.00 0.00 ? 66  ILE A O    5  
ATOM 9791  C CB   . ILE A 1 66  ? 116.765 -12.742 4.828   1.00 0.00 ? 66  ILE A CB   5  
ATOM 9792  C CG1  . ILE A 1 66  ? 117.960 -13.021 5.758   1.00 0.00 ? 66  ILE A CG1  5  
ATOM 9793  C CG2  . ILE A 1 66  ? 117.050 -11.542 3.919   1.00 0.00 ? 66  ILE A CG2  5  
ATOM 9794  C CD1  . ILE A 1 66  ? 119.264 -13.342 5.039   1.00 0.00 ? 66  ILE A CD1  5  
ATOM 9795  H H    . ILE A 1 66  ? 115.732 -14.487 6.424   1.00 0.00 ? 66  ILE A H    5  
ATOM 9796  H HA   . ILE A 1 66  ? 115.593 -11.678 6.325   1.00 0.00 ? 66  ILE A HA   5  
ATOM 9797  H HB   . ILE A 1 66  ? 116.608 -13.602 4.196   1.00 0.00 ? 66  ILE A HB   5  
ATOM 9798  H HG12 . ILE A 1 66  ? 118.137 -12.151 6.373   1.00 0.00 ? 66  ILE A HG12 5  
ATOM 9799  H HG13 . ILE A 1 66  ? 117.715 -13.860 6.394   1.00 0.00 ? 66  ILE A HG13 5  
ATOM 9800  H HG21 . ILE A 1 66  ? 117.113 -10.642 4.513   1.00 0.00 ? 66  ILE A HG21 5  
ATOM 9801  H HG22 . ILE A 1 66  ? 116.255 -11.449 3.193   1.00 0.00 ? 66  ILE A HG22 5  
ATOM 9802  H HG23 . ILE A 1 66  ? 117.986 -11.702 3.404   1.00 0.00 ? 66  ILE A HG23 5  
ATOM 9803  H HD11 . ILE A 1 66  ? 119.128 -14.155 4.340   1.00 0.00 ? 66  ILE A HD11 5  
ATOM 9804  H HD12 . ILE A 1 66  ? 119.993 -13.652 5.774   1.00 0.00 ? 66  ILE A HD12 5  
ATOM 9805  H HD13 . ILE A 1 66  ? 119.629 -12.460 4.533   1.00 0.00 ? 66  ILE A HD13 5  
ATOM 9806  N N    . TYR A 1 67  ? 113.747 -13.312 4.196   1.00 0.00 ? 67  TYR A N    5  
ATOM 9807  C CA   . TYR A 1 67  ? 112.593 -13.294 3.337   1.00 0.00 ? 67  TYR A CA   5  
ATOM 9808  C C    . TYR A 1 67  ? 111.434 -12.515 3.970   1.00 0.00 ? 67  TYR A C    5  
ATOM 9809  O O    . TYR A 1 67  ? 110.978 -11.535 3.415   1.00 0.00 ? 67  TYR A O    5  
ATOM 9810  C CB   . TYR A 1 67  ? 112.180 -14.736 3.053   1.00 0.00 ? 67  TYR A CB   5  
ATOM 9811  C CG   . TYR A 1 67  ? 110.921 -14.879 2.278   1.00 0.00 ? 67  TYR A CG   5  
ATOM 9812  C CD1  . TYR A 1 67  ? 110.896 -14.619 0.932   1.00 0.00 ? 67  TYR A CD1  5  
ATOM 9813  C CD2  . TYR A 1 67  ? 109.752 -15.262 2.901   1.00 0.00 ? 67  TYR A CD2  5  
ATOM 9814  C CE1  . TYR A 1 67  ? 109.740 -14.732 0.214   1.00 0.00 ? 67  TYR A CE1  5  
ATOM 9815  C CE2  . TYR A 1 67  ? 108.591 -15.385 2.203   1.00 0.00 ? 67  TYR A CE2  5  
ATOM 9816  C CZ   . TYR A 1 67  ? 108.577 -15.123 0.863   1.00 0.00 ? 67  TYR A CZ   5  
ATOM 9817  O OH   . TYR A 1 67  ? 107.393 -15.237 0.181   1.00 0.00 ? 67  TYR A OH   5  
ATOM 9818  H H    . TYR A 1 67  ? 114.170 -14.178 4.394   1.00 0.00 ? 67  TYR A H    5  
ATOM 9819  H HA   . TYR A 1 67  ? 112.839 -12.827 2.391   1.00 0.00 ? 67  TYR A HA   5  
ATOM 9820  H HB2  . TYR A 1 67  ? 112.964 -15.218 2.488   1.00 0.00 ? 67  TYR A HB2  5  
ATOM 9821  H HB3  . TYR A 1 67  ? 112.059 -15.254 3.993   1.00 0.00 ? 67  TYR A HB3  5  
ATOM 9822  H HD1  . TYR A 1 67  ? 111.812 -14.323 0.441   1.00 0.00 ? 67  TYR A HD1  5  
ATOM 9823  H HD2  . TYR A 1 67  ? 109.764 -15.469 3.961   1.00 0.00 ? 67  TYR A HD2  5  
ATOM 9824  H HE1  . TYR A 1 67  ? 109.789 -14.498 -0.841  1.00 0.00 ? 67  TYR A HE1  5  
ATOM 9825  H HE2  . TYR A 1 67  ? 107.687 -15.691 2.708   1.00 0.00 ? 67  TYR A HE2  5  
ATOM 9826  H HH   . TYR A 1 67  ? 107.483 -15.873 -0.537  1.00 0.00 ? 67  TYR A HH   5  
ATOM 9827  N N    . GLU A 1 68  ? 111.015 -12.909 5.150   1.00 0.00 ? 68  GLU A N    5  
ATOM 9828  C CA   . GLU A 1 68  ? 109.849 -12.288 5.777   1.00 0.00 ? 68  GLU A CA   5  
ATOM 9829  C C    . GLU A 1 68  ? 110.131 -10.880 6.292   1.00 0.00 ? 68  GLU A C    5  
ATOM 9830  O O    . GLU A 1 68  ? 109.212 -10.078 6.470   1.00 0.00 ? 68  GLU A O    5  
ATOM 9831  C CB   . GLU A 1 68  ? 109.311 -13.139 6.904   1.00 0.00 ? 68  GLU A CB   5  
ATOM 9832  C CG   . GLU A 1 68  ? 108.926 -14.538 6.490   1.00 0.00 ? 68  GLU A CG   5  
ATOM 9833  C CD   . GLU A 1 68  ? 108.202 -15.258 7.580   1.00 0.00 ? 68  GLU A CD   5  
ATOM 9834  O OE1  . GLU A 1 68  ? 108.837 -15.695 8.560   1.00 0.00 ? 68  GLU A OE1  5  
ATOM 9835  O OE2  . GLU A 1 68  ? 106.982 -15.417 7.481   1.00 0.00 ? 68  GLU A OE2  5  
ATOM 9836  H H    . GLU A 1 68  ? 111.488 -13.636 5.612   1.00 0.00 ? 68  GLU A H    5  
ATOM 9837  H HA   . GLU A 1 68  ? 109.084 -12.216 5.017   1.00 0.00 ? 68  GLU A HA   5  
ATOM 9838  H HB2  . GLU A 1 68  ? 110.065 -13.206 7.674   1.00 0.00 ? 68  GLU A HB2  5  
ATOM 9839  H HB3  . GLU A 1 68  ? 108.441 -12.652 7.315   1.00 0.00 ? 68  GLU A HB3  5  
ATOM 9840  H HG2  . GLU A 1 68  ? 108.280 -14.480 5.627   1.00 0.00 ? 68  GLU A HG2  5  
ATOM 9841  H HG3  . GLU A 1 68  ? 109.816 -15.093 6.236   1.00 0.00 ? 68  GLU A HG3  5  
ATOM 9842  N N    . LYS A 1 69  ? 111.376 -10.577 6.525   1.00 0.00 ? 69  LYS A N    5  
ATOM 9843  C CA   . LYS A 1 69  ? 111.742 -9.287  7.062   1.00 0.00 ? 69  LYS A CA   5  
ATOM 9844  C C    . LYS A 1 69  ? 111.973 -8.257  5.948   1.00 0.00 ? 69  LYS A C    5  
ATOM 9845  O O    . LYS A 1 69  ? 111.806 -7.047  6.159   1.00 0.00 ? 69  LYS A O    5  
ATOM 9846  C CB   . LYS A 1 69  ? 112.989 -9.427  7.958   1.00 0.00 ? 69  LYS A CB   5  
ATOM 9847  C CG   . LYS A 1 69  ? 113.477 -8.124  8.583   1.00 0.00 ? 69  LYS A CG   5  
ATOM 9848  C CD   . LYS A 1 69  ? 114.674 -8.334  9.501   1.00 0.00 ? 69  LYS A CD   5  
ATOM 9849  C CE   . LYS A 1 69  ? 114.307 -9.144  10.731  1.00 0.00 ? 69  LYS A CE   5  
ATOM 9850  N NZ   . LYS A 1 69  ? 115.477 -9.394  11.598  1.00 0.00 ? 69  LYS A NZ   5  
ATOM 9851  H H    . LYS A 1 69  ? 112.071 -11.245 6.341   1.00 0.00 ? 69  LYS A H    5  
ATOM 9852  H HA   . LYS A 1 69  ? 110.921 -8.945  7.675   1.00 0.00 ? 69  LYS A HA   5  
ATOM 9853  H HB2  . LYS A 1 69  ? 112.763 -10.115 8.759   1.00 0.00 ? 69  LYS A HB2  5  
ATOM 9854  H HB3  . LYS A 1 69  ? 113.791 -9.838  7.363   1.00 0.00 ? 69  LYS A HB3  5  
ATOM 9855  H HG2  . LYS A 1 69  ? 113.773 -7.459  7.785   1.00 0.00 ? 69  LYS A HG2  5  
ATOM 9856  H HG3  . LYS A 1 69  ? 112.668 -7.679  9.143   1.00 0.00 ? 69  LYS A HG3  5  
ATOM 9857  H HD2  . LYS A 1 69  ? 115.439 -8.865  8.955   1.00 0.00 ? 69  LYS A HD2  5  
ATOM 9858  H HD3  . LYS A 1 69  ? 115.053 -7.372  9.811   1.00 0.00 ? 69  LYS A HD3  5  
ATOM 9859  H HE2  . LYS A 1 69  ? 113.565 -8.599  11.297  1.00 0.00 ? 69  LYS A HE2  5  
ATOM 9860  H HE3  . LYS A 1 69  ? 113.890 -10.089 10.415  1.00 0.00 ? 69  LYS A HE3  5  
ATOM 9861  H HZ1  . LYS A 1 69  ? 115.926 -8.508  11.915  1.00 0.00 ? 69  LYS A HZ1  5  
ATOM 9862  H HZ2  . LYS A 1 69  ? 116.193 -9.942  11.074  1.00 0.00 ? 69  LYS A HZ2  5  
ATOM 9863  H HZ3  . LYS A 1 69  ? 115.183 -9.941  12.437  1.00 0.00 ? 69  LYS A HZ3  5  
ATOM 9864  N N    . PHE A 1 70  ? 112.266 -8.731  4.755   1.00 0.00 ? 70  PHE A N    5  
ATOM 9865  C CA   . PHE A 1 70  ? 112.666 -7.847  3.678   1.00 0.00 ? 70  PHE A CA   5  
ATOM 9866  C C    . PHE A 1 70  ? 111.903 -8.134  2.400   1.00 0.00 ? 70  PHE A C    5  
ATOM 9867  O O    . PHE A 1 70  ? 111.247 -7.262  1.851   1.00 0.00 ? 70  PHE A O    5  
ATOM 9868  C CB   . PHE A 1 70  ? 114.172 -7.987  3.396   1.00 0.00 ? 70  PHE A CB   5  
ATOM 9869  C CG   . PHE A 1 70  ? 115.098 -7.538  4.496   1.00 0.00 ? 70  PHE A CG   5  
ATOM 9870  C CD1  . PHE A 1 70  ? 115.406 -6.199  4.652   1.00 0.00 ? 70  PHE A CD1  5  
ATOM 9871  C CD2  . PHE A 1 70  ? 115.681 -8.457  5.349   1.00 0.00 ? 70  PHE A CD2  5  
ATOM 9872  C CE1  . PHE A 1 70  ? 116.273 -5.786  5.642   1.00 0.00 ? 70  PHE A CE1  5  
ATOM 9873  C CE2  . PHE A 1 70  ? 116.546 -8.050  6.342   1.00 0.00 ? 70  PHE A CE2  5  
ATOM 9874  C CZ   . PHE A 1 70  ? 116.844 -6.712  6.488   1.00 0.00 ? 70  PHE A CZ   5  
ATOM 9875  H H    . PHE A 1 70  ? 112.172 -9.691  4.571   1.00 0.00 ? 70  PHE A H    5  
ATOM 9876  H HA   . PHE A 1 70  ? 112.479 -6.829  3.986   1.00 0.00 ? 70  PHE A HA   5  
ATOM 9877  H HB2  . PHE A 1 70  ? 114.390 -9.027  3.202   1.00 0.00 ? 70  PHE A HB2  5  
ATOM 9878  H HB3  . PHE A 1 70  ? 114.407 -7.419  2.507   1.00 0.00 ? 70  PHE A HB3  5  
ATOM 9879  H HD1  . PHE A 1 70  ? 114.956 -5.472  3.993   1.00 0.00 ? 70  PHE A HD1  5  
ATOM 9880  H HD2  . PHE A 1 70  ? 115.449 -9.506  5.233   1.00 0.00 ? 70  PHE A HD2  5  
ATOM 9881  H HE1  . PHE A 1 70  ? 116.506 -4.737  5.752   1.00 0.00 ? 70  PHE A HE1  5  
ATOM 9882  H HE2  . PHE A 1 70  ? 116.992 -8.779  7.003   1.00 0.00 ? 70  PHE A HE2  5  
ATOM 9883  H HZ   . PHE A 1 70  ? 117.522 -6.392  7.264   1.00 0.00 ? 70  PHE A HZ   5  
ATOM 9884  N N    . ILE A 1 71  ? 111.994 -9.366  1.947   1.00 0.00 ? 71  ILE A N    5  
ATOM 9885  C CA   . ILE A 1 71  ? 111.399 -9.811  0.675   1.00 0.00 ? 71  ILE A CA   5  
ATOM 9886  C C    . ILE A 1 71  ? 109.870 -9.736  0.741   1.00 0.00 ? 71  ILE A C    5  
ATOM 9887  O O    . ILE A 1 71  ? 109.184 -9.582  -0.287  1.00 0.00 ? 71  ILE A O    5  
ATOM 9888  C CB   . ILE A 1 71  ? 111.839 -11.279 0.353   1.00 0.00 ? 71  ILE A CB   5  
ATOM 9889  C CG1  . ILE A 1 71  ? 113.362 -11.374 0.348   1.00 0.00 ? 71  ILE A CG1  5  
ATOM 9890  C CG2  . ILE A 1 71  ? 111.272 -11.809 -0.977  1.00 0.00 ? 71  ILE A CG2  5  
ATOM 9891  C CD1  . ILE A 1 71  ? 114.027 -10.430 -0.622  1.00 0.00 ? 71  ILE A CD1  5  
ATOM 9892  H H    . ILE A 1 71  ? 112.476 -10.027 2.485   1.00 0.00 ? 71  ILE A H    5  
ATOM 9893  H HA   . ILE A 1 71  ? 111.781 -9.153  -0.094  1.00 0.00 ? 71  ILE A HA   5  
ATOM 9894  H HB   . ILE A 1 71  ? 111.470 -11.916 1.144   1.00 0.00 ? 71  ILE A HB   5  
ATOM 9895  H HG12 . ILE A 1 71  ? 113.732 -11.144 1.336   1.00 0.00 ? 71  ILE A HG12 5  
ATOM 9896  H HG13 . ILE A 1 71  ? 113.652 -12.382 0.086   1.00 0.00 ? 71  ILE A HG13 5  
ATOM 9897  H HG21 . ILE A 1 71  ? 111.328 -12.893 -0.942  1.00 0.00 ? 71  ILE A HG21 5  
ATOM 9898  H HG22 . ILE A 1 71  ? 111.894 -11.477 -1.800  1.00 0.00 ? 71  ILE A HG22 5  
ATOM 9899  H HG23 . ILE A 1 71  ? 110.245 -11.507 -1.112  1.00 0.00 ? 71  ILE A HG23 5  
ATOM 9900  H HD11 . ILE A 1 71  ? 113.799 -9.408  -0.356  1.00 0.00 ? 71  ILE A HD11 5  
ATOM 9901  H HD12 . ILE A 1 71  ? 113.665 -10.602 -1.626  1.00 0.00 ? 71  ILE A HD12 5  
ATOM 9902  H HD13 . ILE A 1 71  ? 115.098 -10.568 -0.604  1.00 0.00 ? 71  ILE A HD13 5  
ATOM 9903  N N    . GLN A 1 72  ? 109.347 -9.845  1.945   1.00 0.00 ? 72  GLN A N    5  
ATOM 9904  C CA   . GLN A 1 72  ? 107.926 -9.764  2.159   1.00 0.00 ? 72  GLN A CA   5  
ATOM 9905  C C    . GLN A 1 72  ? 107.462 -8.358  1.828   1.00 0.00 ? 72  GLN A C    5  
ATOM 9906  O O    . GLN A 1 72  ? 108.156 -7.393  2.135   1.00 0.00 ? 72  GLN A O    5  
ATOM 9907  C CB   . GLN A 1 72  ? 107.566 -10.122 3.600   1.00 0.00 ? 72  GLN A CB   5  
ATOM 9908  C CG   . GLN A 1 72  ? 106.073 -10.292 3.821   1.00 0.00 ? 72  GLN A CG   5  
ATOM 9909  C CD   . GLN A 1 72  ? 105.490 -11.320 2.871   1.00 0.00 ? 72  GLN A CD   5  
ATOM 9910  O OE1  . GLN A 1 72  ? 105.038 -10.983 1.777   1.00 0.00 ? 72  GLN A OE1  5  
ATOM 9911  N NE2  . GLN A 1 72  ? 105.493 -12.566 3.275   1.00 0.00 ? 72  GLN A NE2  5  
ATOM 9912  H H    . GLN A 1 72  ? 109.964 -9.981  2.702   1.00 0.00 ? 72  GLN A H    5  
ATOM 9913  H HA   . GLN A 1 72  ? 107.447 -10.458 1.484   1.00 0.00 ? 72  GLN A HA   5  
ATOM 9914  H HB2  . GLN A 1 72  ? 108.065 -11.041 3.874   1.00 0.00 ? 72  GLN A HB2  5  
ATOM 9915  H HB3  . GLN A 1 72  ? 107.909 -9.321  4.241   1.00 0.00 ? 72  GLN A HB3  5  
ATOM 9916  H HG2  . GLN A 1 72  ? 105.892 -10.600 4.837   1.00 0.00 ? 72  GLN A HG2  5  
ATOM 9917  H HG3  . GLN A 1 72  ? 105.595 -9.341  3.639   1.00 0.00 ? 72  GLN A HG3  5  
ATOM 9918  H HE21 . GLN A 1 72  ? 105.849 -12.773 4.174   1.00 0.00 ? 72  GLN A HE21 5  
ATOM 9919  H HE22 . GLN A 1 72  ? 105.194 -13.284 2.669   1.00 0.00 ? 72  GLN A HE22 5  
ATOM 9920  N N    . THR A 1 73  ? 106.316 -8.246  1.209   1.00 0.00 ? 73  THR A N    5  
ATOM 9921  C CA   . THR A 1 73  ? 105.828 -6.966  0.757   1.00 0.00 ? 73  THR A CA   5  
ATOM 9922  C C    . THR A 1 73  ? 105.550 -6.060  1.951   1.00 0.00 ? 73  THR A C    5  
ATOM 9923  O O    . THR A 1 73  ? 106.168 -5.003  2.096   1.00 0.00 ? 73  THR A O    5  
ATOM 9924  C CB   . THR A 1 73  ? 104.588 -7.130  -0.135  1.00 0.00 ? 73  THR A CB   5  
ATOM 9925  O OG1  . THR A 1 73  ? 104.901 -8.055  -1.206  1.00 0.00 ? 73  THR A OG1  5  
ATOM 9926  C CG2  . THR A 1 73  ? 104.188 -5.796  -0.745  1.00 0.00 ? 73  THR A CG2  5  
ATOM 9927  H H    . THR A 1 73  ? 105.775 -9.060  1.100   1.00 0.00 ? 73  THR A H    5  
ATOM 9928  H HA   . THR A 1 73  ? 106.621 -6.516  0.177   1.00 0.00 ? 73  THR A HA   5  
ATOM 9929  H HB   . THR A 1 73  ? 103.772 -7.518  0.456   1.00 0.00 ? 73  THR A HB   5  
ATOM 9930  H HG1  . THR A 1 73  ? 105.379 -8.831  -0.856  1.00 0.00 ? 73  THR A HG1  5  
ATOM 9931  H HG21 . THR A 1 73  ? 103.969 -5.094  0.046   1.00 0.00 ? 73  THR A HG21 5  
ATOM 9932  H HG22 . THR A 1 73  ? 103.310 -5.929  -1.361  1.00 0.00 ? 73  THR A HG22 5  
ATOM 9933  H HG23 . THR A 1 73  ? 104.999 -5.417  -1.349  1.00 0.00 ? 73  THR A HG23 5  
ATOM 9934  N N    . ASP A 1 74  ? 104.663 -6.470  2.809   1.00 0.00 ? 74  ASP A N    5  
ATOM 9935  C CA   . ASP A 1 74  ? 104.468 -5.749  4.033   1.00 0.00 ? 74  ASP A CA   5  
ATOM 9936  C C    . ASP A 1 74  ? 105.331 -6.396  5.067   1.00 0.00 ? 74  ASP A C    5  
ATOM 9937  O O    . ASP A 1 74  ? 104.975 -7.413  5.645   1.00 0.00 ? 74  ASP A O    5  
ATOM 9938  C CB   . ASP A 1 74  ? 103.013 -5.712  4.489   1.00 0.00 ? 74  ASP A CB   5  
ATOM 9939  C CG   . ASP A 1 74  ? 102.863 -4.917  5.770   1.00 0.00 ? 74  ASP A CG   5  
ATOM 9940  O OD1  . ASP A 1 74  ? 102.849 -3.666  5.716   1.00 0.00 ? 74  ASP A OD1  5  
ATOM 9941  O OD2  . ASP A 1 74  ? 102.763 -5.519  6.853   1.00 0.00 ? 74  ASP A OD2  5  
ATOM 9942  H H    . ASP A 1 74  ? 104.136 -7.285  2.632   1.00 0.00 ? 74  ASP A H    5  
ATOM 9943  H HA   . ASP A 1 74  ? 104.832 -4.746  3.871   1.00 0.00 ? 74  ASP A HA   5  
ATOM 9944  H HB2  . ASP A 1 74  ? 102.410 -5.253  3.719   1.00 0.00 ? 74  ASP A HB2  5  
ATOM 9945  H HB3  . ASP A 1 74  ? 102.667 -6.719  4.667   1.00 0.00 ? 74  ASP A HB3  5  
ATOM 9946  N N    . ALA A 1 75  ? 106.491 -5.865  5.219   1.00 0.00 ? 75  ALA A N    5  
ATOM 9947  C CA   . ALA A 1 75  ? 107.475 -6.402  6.108   1.00 0.00 ? 75  ALA A CA   5  
ATOM 9948  C C    . ALA A 1 75  ? 107.860 -5.340  7.115   1.00 0.00 ? 75  ALA A C    5  
ATOM 9949  O O    . ALA A 1 75  ? 107.499 -4.179  6.938   1.00 0.00 ? 75  ALA A O    5  
ATOM 9950  C CB   . ALA A 1 75  ? 108.688 -6.825  5.292   1.00 0.00 ? 75  ALA A CB   5  
ATOM 9951  H H    . ALA A 1 75  ? 106.708 -5.052  4.716   1.00 0.00 ? 75  ALA A H    5  
ATOM 9952  H HA   . ALA A 1 75  ? 107.074 -7.270  6.610   1.00 0.00 ? 75  ALA A HA   5  
ATOM 9953  H HB1  . ALA A 1 75  ? 109.009 -5.995  4.679   1.00 0.00 ? 75  ALA A HB1  5  
ATOM 9954  H HB2  . ALA A 1 75  ? 108.447 -7.679  4.675   1.00 0.00 ? 75  ALA A HB2  5  
ATOM 9955  H HB3  . ALA A 1 75  ? 109.485 -7.074  5.978   1.00 0.00 ? 75  ALA A HB3  5  
ATOM 9956  N N    . PRO A 1 76  ? 108.567 -5.706  8.200   1.00 0.00 ? 76  PRO A N    5  
ATOM 9957  C CA   . PRO A 1 76  ? 109.036 -4.730  9.175   1.00 0.00 ? 76  PRO A CA   5  
ATOM 9958  C C    . PRO A 1 76  ? 110.098 -3.800  8.580   1.00 0.00 ? 76  PRO A C    5  
ATOM 9959  O O    . PRO A 1 76  ? 110.302 -2.687  9.062   1.00 0.00 ? 76  PRO A O    5  
ATOM 9960  C CB   . PRO A 1 76  ? 109.645 -5.588  10.297  1.00 0.00 ? 76  PRO A CB   5  
ATOM 9961  C CG   . PRO A 1 76  ? 109.942 -6.901  9.662   1.00 0.00 ? 76  PRO A CG   5  
ATOM 9962  C CD   . PRO A 1 76  ? 108.902 -7.092  8.605   1.00 0.00 ? 76  PRO A CD   5  
ATOM 9963  H HA   . PRO A 1 76  ? 108.221 -4.139  9.566   1.00 0.00 ? 76  PRO A HA   5  
ATOM 9964  H HB2  . PRO A 1 76  ? 110.544 -5.114  10.665  1.00 0.00 ? 76  PRO A HB2  5  
ATOM 9965  H HB3  . PRO A 1 76  ? 108.931 -5.693  11.100  1.00 0.00 ? 76  PRO A HB3  5  
ATOM 9966  H HG2  . PRO A 1 76  ? 110.927 -6.876  9.219   1.00 0.00 ? 76  PRO A HG2  5  
ATOM 9967  H HG3  . PRO A 1 76  ? 109.880 -7.688  10.397  1.00 0.00 ? 76  PRO A HG3  5  
ATOM 9968  H HD2  . PRO A 1 76  ? 109.312 -7.646  7.773   1.00 0.00 ? 76  PRO A HD2  5  
ATOM 9969  H HD3  . PRO A 1 76  ? 108.035 -7.595  9.005   1.00 0.00 ? 76  PRO A HD3  5  
ATOM 9970  N N    . LYS A 1 77  ? 110.767 -4.257  7.527   1.00 0.00 ? 77  LYS A N    5  
ATOM 9971  C CA   . LYS A 1 77  ? 111.817 -3.471  6.897   1.00 0.00 ? 77  LYS A CA   5  
ATOM 9972  C C    . LYS A 1 77  ? 111.415 -3.012  5.509   1.00 0.00 ? 77  LYS A C    5  
ATOM 9973  O O    . LYS A 1 77  ? 111.572 -1.834  5.186   1.00 0.00 ? 77  LYS A O    5  
ATOM 9974  C CB   . LYS A 1 77  ? 113.133 -4.247  6.858   1.00 0.00 ? 77  LYS A CB   5  
ATOM 9975  C CG   . LYS A 1 77  ? 113.723 -4.611  8.235   1.00 0.00 ? 77  LYS A CG   5  
ATOM 9976  C CD   . LYS A 1 77  ? 114.381 -3.428  8.967   1.00 0.00 ? 77  LYS A CD   5  
ATOM 9977  C CE   . LYS A 1 77  ? 113.416 -2.328  9.369   1.00 0.00 ? 77  LYS A CE   5  
ATOM 9978  N NZ   . LYS A 1 77  ? 114.092 -1.206  10.046  1.00 0.00 ? 77  LYS A NZ   5  
ATOM 9979  H H    . LYS A 1 77  ? 110.523 -5.140  7.170   1.00 0.00 ? 77  LYS A H    5  
ATOM 9980  H HA   . LYS A 1 77  ? 111.956 -2.591  7.508   1.00 0.00 ? 77  LYS A HA   5  
ATOM 9981  H HB2  . LYS A 1 77  ? 112.973 -5.166  6.316   1.00 0.00 ? 77  LYS A HB2  5  
ATOM 9982  H HB3  . LYS A 1 77  ? 113.866 -3.657  6.327   1.00 0.00 ? 77  LYS A HB3  5  
ATOM 9983  H HG2  . LYS A 1 77  ? 112.927 -4.992  8.857   1.00 0.00 ? 77  LYS A HG2  5  
ATOM 9984  H HG3  . LYS A 1 77  ? 114.459 -5.389  8.091   1.00 0.00 ? 77  LYS A HG3  5  
ATOM 9985  H HD2  . LYS A 1 77  ? 114.854 -3.799  9.864   1.00 0.00 ? 77  LYS A HD2  5  
ATOM 9986  H HD3  . LYS A 1 77  ? 115.141 -3.012  8.321   1.00 0.00 ? 77  LYS A HD3  5  
ATOM 9987  H HE2  . LYS A 1 77  ? 112.929 -1.954  8.479   1.00 0.00 ? 77  LYS A HE2  5  
ATOM 9988  H HE3  . LYS A 1 77  ? 112.673 -2.745  10.032  1.00 0.00 ? 77  LYS A HE3  5  
ATOM 9989  H HZ1  . LYS A 1 77  ? 113.398 -0.451  10.227  1.00 0.00 ? 77  LYS A HZ1  5  
ATOM 9990  H HZ2  . LYS A 1 77  ? 114.844 -0.809  9.438   1.00 0.00 ? 77  LYS A HZ2  5  
ATOM 9991  H HZ3  . LYS A 1 77  ? 114.505 -1.509  10.953  1.00 0.00 ? 77  LYS A HZ3  5  
ATOM 9992  N N    . GLU A 1 78  ? 110.908 -3.959  4.694   1.00 0.00 ? 78  GLU A N    5  
ATOM 9993  C CA   . GLU A 1 78  ? 110.399 -3.702  3.314   1.00 0.00 ? 78  GLU A CA   5  
ATOM 9994  C C    . GLU A 1 78  ? 111.529 -3.373  2.337   1.00 0.00 ? 78  GLU A C    5  
ATOM 9995  O O    . GLU A 1 78  ? 112.529 -2.748  2.695   1.00 0.00 ? 78  GLU A O    5  
ATOM 9996  C CB   . GLU A 1 78  ? 109.370 -2.572  3.292   1.00 0.00 ? 78  GLU A CB   5  
ATOM 9997  C CG   . GLU A 1 78  ? 108.215 -2.761  4.236   1.00 0.00 ? 78  GLU A CG   5  
ATOM 9998  C CD   . GLU A 1 78  ? 107.380 -1.530  4.346   1.00 0.00 ? 78  GLU A CD   5  
ATOM 9999  O OE1  . GLU A 1 78  ? 107.891 -0.489  4.825   1.00 0.00 ? 78  GLU A OE1  5  
ATOM 10000 O OE2  . GLU A 1 78  ? 106.188 -1.570  3.992   1.00 0.00 ? 78  GLU A OE2  5  
ATOM 10001 H H    . GLU A 1 78  ? 110.904 -4.885  5.011   1.00 0.00 ? 78  GLU A H    5  
ATOM 10002 H HA   . GLU A 1 78  ? 109.923 -4.611  2.980   1.00 0.00 ? 78  GLU A HA   5  
ATOM 10003 H HB2  . GLU A 1 78  ? 109.865 -1.649  3.557   1.00 0.00 ? 78  GLU A HB2  5  
ATOM 10004 H HB3  . GLU A 1 78  ? 108.978 -2.481  2.289   1.00 0.00 ? 78  GLU A HB3  5  
ATOM 10005 H HG2  . GLU A 1 78  ? 107.597 -3.569  3.873   1.00 0.00 ? 78  GLU A HG2  5  
ATOM 10006 H HG3  . GLU A 1 78  ? 108.600 -3.010  5.214   1.00 0.00 ? 78  GLU A HG3  5  
ATOM 10007 N N    . VAL A 1 79  ? 111.373 -3.794  1.114   1.00 0.00 ? 79  VAL A N    5  
ATOM 10008 C CA   . VAL A 1 79  ? 112.355 -3.549  0.088   1.00 0.00 ? 79  VAL A CA   5  
ATOM 10009 C C    . VAL A 1 79  ? 111.631 -3.084  -1.164  1.00 0.00 ? 79  VAL A C    5  
ATOM 10010 O O    . VAL A 1 79  ? 110.566 -3.615  -1.500  1.00 0.00 ? 79  VAL A O    5  
ATOM 10011 C CB   . VAL A 1 79  ? 113.163 -4.845  -0.265  1.00 0.00 ? 79  VAL A CB   5  
ATOM 10012 C CG1  . VAL A 1 79  ? 114.279 -4.557  -1.240  1.00 0.00 ? 79  VAL A CG1  5  
ATOM 10013 C CG2  . VAL A 1 79  ? 113.727 -5.513  0.964   1.00 0.00 ? 79  VAL A CG2  5  
ATOM 10014 H H    . VAL A 1 79  ? 110.560 -4.289  0.859   1.00 0.00 ? 79  VAL A H    5  
ATOM 10015 H HA   . VAL A 1 79  ? 113.039 -2.784  0.427   1.00 0.00 ? 79  VAL A HA   5  
ATOM 10016 H HB   . VAL A 1 79  ? 112.481 -5.534  -0.743  1.00 0.00 ? 79  VAL A HB   5  
ATOM 10017 H HG11 . VAL A 1 79  ? 114.959 -3.838  -0.809  1.00 0.00 ? 79  VAL A HG11 5  
ATOM 10018 H HG12 . VAL A 1 79  ? 113.864 -4.163  -2.156  1.00 0.00 ? 79  VAL A HG12 5  
ATOM 10019 H HG13 . VAL A 1 79  ? 114.808 -5.477  -1.445  1.00 0.00 ? 79  VAL A HG13 5  
ATOM 10020 H HG21 . VAL A 1 79  ? 114.418 -4.850  1.462   1.00 0.00 ? 79  VAL A HG21 5  
ATOM 10021 H HG22 . VAL A 1 79  ? 114.217 -6.435  0.681   1.00 0.00 ? 79  VAL A HG22 5  
ATOM 10022 H HG23 . VAL A 1 79  ? 112.914 -5.758  1.634   1.00 0.00 ? 79  VAL A HG23 5  
ATOM 10023 N N    . ASN A 1 80  ? 112.200 -2.126  -1.871  1.00 0.00 ? 80  ASN A N    5  
ATOM 10024 C CA   . ASN A 1 80  ? 111.638 -1.645  -3.152  1.00 0.00 ? 80  ASN A CA   5  
ATOM 10025 C C    . ASN A 1 80  ? 112.089 -2.607  -4.263  1.00 0.00 ? 80  ASN A C    5  
ATOM 10026 O O    . ASN A 1 80  ? 112.495 -2.197  -5.360  1.00 0.00 ? 80  ASN A O    5  
ATOM 10027 C CB   . ASN A 1 80  ? 112.150 -0.224  -3.473  1.00 0.00 ? 80  ASN A CB   5  
ATOM 10028 C CG   . ASN A 1 80  ? 111.819 0.841   -2.427  1.00 0.00 ? 80  ASN A CG   5  
ATOM 10029 O OD1  . ASN A 1 80  ? 112.571 1.806   -2.259  1.00 0.00 ? 80  ASN A OD1  5  
ATOM 10030 N ND2  . ASN A 1 80  ? 110.724 0.699   -1.723  1.00 0.00 ? 80  ASN A ND2  5  
ATOM 10031 H H    . ASN A 1 80  ? 113.032 -1.725  -1.522  1.00 0.00 ? 80  ASN A H    5  
ATOM 10032 H HA   . ASN A 1 80  ? 110.560 -1.649  -3.081  1.00 0.00 ? 80  ASN A HA   5  
ATOM 10033 H HB2  . ASN A 1 80  ? 113.224 -0.259  -3.577  1.00 0.00 ? 80  ASN A HB2  5  
ATOM 10034 H HB3  . ASN A 1 80  ? 111.726 0.083   -4.419  1.00 0.00 ? 80  ASN A HB3  5  
ATOM 10035 H HD21 . ASN A 1 80  ? 110.128 -0.072  -1.863  1.00 0.00 ? 80  ASN A HD21 5  
ATOM 10036 H HD22 . ASN A 1 80  ? 110.528 1.393   -1.053  1.00 0.00 ? 80  ASN A HD22 5  
ATOM 10037 N N    . LEU A 1 81  ? 111.983 -3.877  -3.963  1.00 0.00 ? 81  LEU A N    5  
ATOM 10038 C CA   . LEU A 1 81  ? 112.462 -4.955  -4.783  1.00 0.00 ? 81  LEU A CA   5  
ATOM 10039 C C    . LEU A 1 81  ? 111.529 -5.219  -5.957  1.00 0.00 ? 81  LEU A C    5  
ATOM 10040 O O    . LEU A 1 81  ? 110.303 -5.181  -5.811  1.00 0.00 ? 81  LEU A O    5  
ATOM 10041 C CB   . LEU A 1 81  ? 112.619 -6.200  -3.897  1.00 0.00 ? 81  LEU A CB   5  
ATOM 10042 C CG   . LEU A 1 81  ? 113.193 -7.462  -4.517  1.00 0.00 ? 81  LEU A CG   5  
ATOM 10043 C CD1  . LEU A 1 81  ? 114.612 -7.228  -4.909  1.00 0.00 ? 81  LEU A CD1  5  
ATOM 10044 C CD2  . LEU A 1 81  ? 113.103 -8.622  -3.538  1.00 0.00 ? 81  LEU A CD2  5  
ATOM 10045 H H    . LEU A 1 81  ? 111.516 -4.089  -3.125  1.00 0.00 ? 81  LEU A H    5  
ATOM 10046 H HA   . LEU A 1 81  ? 113.438 -4.686  -5.159  1.00 0.00 ? 81  LEU A HA   5  
ATOM 10047 H HB2  . LEU A 1 81  ? 113.348 -5.914  -3.152  1.00 0.00 ? 81  LEU A HB2  5  
ATOM 10048 H HB3  . LEU A 1 81  ? 111.677 -6.429  -3.421  1.00 0.00 ? 81  LEU A HB3  5  
ATOM 10049 H HG   . LEU A 1 81  ? 112.647 -7.727  -5.411  1.00 0.00 ? 81  LEU A HG   5  
ATOM 10050 H HD11 . LEU A 1 81  ? 115.183 -6.944  -4.038  1.00 0.00 ? 81  LEU A HD11 5  
ATOM 10051 H HD12 . LEU A 1 81  ? 114.664 -6.448  -5.654  1.00 0.00 ? 81  LEU A HD12 5  
ATOM 10052 H HD13 . LEU A 1 81  ? 115.018 -8.148  -5.307  1.00 0.00 ? 81  LEU A HD13 5  
ATOM 10053 H HD21 . LEU A 1 81  ? 112.070 -8.802  -3.283  1.00 0.00 ? 81  LEU A HD21 5  
ATOM 10054 H HD22 . LEU A 1 81  ? 113.657 -8.415  -2.634  1.00 0.00 ? 81  LEU A HD22 5  
ATOM 10055 H HD23 . LEU A 1 81  ? 113.507 -9.515  -3.993  1.00 0.00 ? 81  LEU A HD23 5  
ATOM 10056 N N    . ASP A 1 82  ? 112.134 -5.445  -7.109  1.00 0.00 ? 82  ASP A N    5  
ATOM 10057 C CA   . ASP A 1 82  ? 111.437 -5.764  -8.363  1.00 0.00 ? 82  ASP A CA   5  
ATOM 10058 C C    . ASP A 1 82  ? 110.506 -6.956  -8.182  1.00 0.00 ? 82  ASP A C    5  
ATOM 10059 O O    . ASP A 1 82  ? 110.907 -7.980  -7.602  1.00 0.00 ? 82  ASP A O    5  
ATOM 10060 C CB   . ASP A 1 82  ? 112.464 -6.083  -9.450  1.00 0.00 ? 82  ASP A CB   5  
ATOM 10061 C CG   . ASP A 1 82  ? 111.846 -6.332  -10.808 1.00 0.00 ? 82  ASP A CG   5  
ATOM 10062 O OD1  . ASP A 1 82  ? 111.487 -7.488  -11.127 1.00 0.00 ? 82  ASP A OD1  5  
ATOM 10063 O OD2  . ASP A 1 82  ? 111.708 -5.368  -11.586 1.00 0.00 ? 82  ASP A OD2  5  
ATOM 10064 H H    . ASP A 1 82  ? 113.111 -5.354  -7.126  1.00 0.00 ? 82  ASP A H    5  
ATOM 10065 H HA   . ASP A 1 82  ? 110.866 -4.900  -8.668  1.00 0.00 ? 82  ASP A HA   5  
ATOM 10066 H HB2  . ASP A 1 82  ? 113.149 -5.253  -9.542  1.00 0.00 ? 82  ASP A HB2  5  
ATOM 10067 H HB3  . ASP A 1 82  ? 113.019 -6.963  -9.160  1.00 0.00 ? 82  ASP A HB3  5  
ATOM 10068 N N    . PHE A 1 83  ? 109.284 -6.820  -8.696  1.00 0.00 ? 83  PHE A N    5  
ATOM 10069 C CA   . PHE A 1 83  ? 108.223 -7.820  -8.568  1.00 0.00 ? 83  PHE A CA   5  
ATOM 10070 C C    . PHE A 1 83  ? 108.690 -9.217  -8.980  1.00 0.00 ? 83  PHE A C    5  
ATOM 10071 O O    . PHE A 1 83  ? 108.492 -10.179 -8.236  1.00 0.00 ? 83  PHE A O    5  
ATOM 10072 C CB   . PHE A 1 83  ? 106.989 -7.408  -9.404  1.00 0.00 ? 83  PHE A CB   5  
ATOM 10073 C CG   . PHE A 1 83  ? 105.783 -8.310  -9.232  1.00 0.00 ? 83  PHE A CG   5  
ATOM 10074 C CD1  . PHE A 1 83  ? 105.632 -9.463  -9.992  1.00 0.00 ? 83  PHE A CD1  5  
ATOM 10075 C CD2  . PHE A 1 83  ? 104.806 -8.001  -8.308  1.00 0.00 ? 83  PHE A CD2  5  
ATOM 10076 C CE1  . PHE A 1 83  ? 104.533 -10.283 -9.827  1.00 0.00 ? 83  PHE A CE1  5  
ATOM 10077 C CE2  . PHE A 1 83  ? 103.703 -8.817  -8.139  1.00 0.00 ? 83  PHE A CE2  5  
ATOM 10078 C CZ   . PHE A 1 83  ? 103.568 -9.959  -8.899  1.00 0.00 ? 83  PHE A CZ   5  
ATOM 10079 H H    . PHE A 1 83  ? 109.080 -5.990  -9.177  1.00 0.00 ? 83  PHE A H    5  
ATOM 10080 H HA   . PHE A 1 83  ? 107.930 -7.850  -7.530  1.00 0.00 ? 83  PHE A HA   5  
ATOM 10081 H HB2  . PHE A 1 83  ? 106.693 -6.408  -9.122  1.00 0.00 ? 83  PHE A HB2  5  
ATOM 10082 H HB3  . PHE A 1 83  ? 107.261 -7.409  -10.450 1.00 0.00 ? 83  PHE A HB3  5  
ATOM 10083 H HD1  . PHE A 1 83  ? 106.389 -9.719  -10.720 1.00 0.00 ? 83  PHE A HD1  5  
ATOM 10084 H HD2  . PHE A 1 83  ? 104.908 -7.108  -7.710  1.00 0.00 ? 83  PHE A HD2  5  
ATOM 10085 H HE1  . PHE A 1 83  ? 104.429 -11.176 -10.425 1.00 0.00 ? 83  PHE A HE1  5  
ATOM 10086 H HE2  . PHE A 1 83  ? 102.948 -8.559  -7.412  1.00 0.00 ? 83  PHE A HE2  5  
ATOM 10087 H HZ   . PHE A 1 83  ? 102.707 -10.598 -8.767  1.00 0.00 ? 83  PHE A HZ   5  
ATOM 10088 N N    . HIS A 1 84  ? 109.328 -9.323  -10.138 1.00 0.00 ? 84  HIS A N    5  
ATOM 10089 C CA   . HIS A 1 84  ? 109.764 -10.620 -10.643 1.00 0.00 ? 84  HIS A CA   5  
ATOM 10090 C C    . HIS A 1 84  ? 110.889 -11.198 -9.798  1.00 0.00 ? 84  HIS A C    5  
ATOM 10091 O O    . HIS A 1 84  ? 110.969 -12.407 -9.624  1.00 0.00 ? 84  HIS A O    5  
ATOM 10092 C CB   . HIS A 1 84  ? 110.139 -10.556 -12.134 1.00 0.00 ? 84  HIS A CB   5  
ATOM 10093 C CG   . HIS A 1 84  ? 110.694 -11.845 -12.707 1.00 0.00 ? 84  HIS A CG   5  
ATOM 10094 N ND1  . HIS A 1 84  ? 109.961 -13.004 -12.832 1.00 0.00 ? 84  HIS A ND1  5  
ATOM 10095 C CD2  . HIS A 1 84  ? 111.930 -12.142 -13.174 1.00 0.00 ? 84  HIS A CD2  5  
ATOM 10096 C CE1  . HIS A 1 84  ? 110.714 -13.946 -13.350 1.00 0.00 ? 84  HIS A CE1  5  
ATOM 10097 N NE2  . HIS A 1 84  ? 111.913 -13.454 -13.570 1.00 0.00 ? 84  HIS A NE2  5  
ATOM 10098 H H    . HIS A 1 84  ? 109.523 -8.510  -10.655 1.00 0.00 ? 84  HIS A H    5  
ATOM 10099 H HA   . HIS A 1 84  ? 108.916 -11.279 -10.530 1.00 0.00 ? 84  HIS A HA   5  
ATOM 10100 H HB2  . HIS A 1 84  ? 109.260 -10.303 -12.706 1.00 0.00 ? 84  HIS A HB2  5  
ATOM 10101 H HB3  . HIS A 1 84  ? 110.881 -9.784  -12.272 1.00 0.00 ? 84  HIS A HB3  5  
ATOM 10102 H HD1  . HIS A 1 84  ? 109.027 -13.167 -12.550 1.00 0.00 ? 84  HIS A HD1  5  
ATOM 10103 H HD2  . HIS A 1 84  ? 112.773 -11.467 -13.228 1.00 0.00 ? 84  HIS A HD2  5  
ATOM 10104 H HE1  . HIS A 1 84  ? 110.400 -14.957 -13.563 1.00 0.00 ? 84  HIS A HE1  5  
ATOM 10105 H HE2  . HIS A 1 84  ? 112.462 -13.781 -14.326 1.00 0.00 ? 84  HIS A HE2  5  
ATOM 10106 N N    . THR A 1 85  ? 111.734 -10.347 -9.265  1.00 0.00 ? 85  THR A N    5  
ATOM 10107 C CA   . THR A 1 85  ? 112.783 -10.806 -8.393  1.00 0.00 ? 85  THR A CA   5  
ATOM 10108 C C    . THR A 1 85  ? 112.167 -11.365 -7.103  1.00 0.00 ? 85  THR A C    5  
ATOM 10109 O O    . THR A 1 85  ? 112.501 -12.469 -6.683  1.00 0.00 ? 85  THR A O    5  
ATOM 10110 C CB   . THR A 1 85  ? 113.787 -9.681  -8.103  1.00 0.00 ? 85  THR A CB   5  
ATOM 10111 O OG1  . THR A 1 85  ? 114.356 -9.233  -9.359  1.00 0.00 ? 85  THR A OG1  5  
ATOM 10112 C CG2  . THR A 1 85  ? 114.899 -10.169 -7.176  1.00 0.00 ? 85  THR A CG2  5  
ATOM 10113 H H    . THR A 1 85  ? 111.649 -9.387  -9.456  1.00 0.00 ? 85  THR A H    5  
ATOM 10114 H HA   . THR A 1 85  ? 113.288 -11.614 -8.902  1.00 0.00 ? 85  THR A HA   5  
ATOM 10115 H HB   . THR A 1 85  ? 113.261 -8.858  -7.640  1.00 0.00 ? 85  THR A HB   5  
ATOM 10116 H HG1  . THR A 1 85  ? 114.550 -10.044 -9.862  1.00 0.00 ? 85  THR A HG1  5  
ATOM 10117 H HG21 . THR A 1 85  ? 115.404 -11.016 -7.618  1.00 0.00 ? 85  THR A HG21 5  
ATOM 10118 H HG22 . THR A 1 85  ? 114.504 -10.441 -6.207  1.00 0.00 ? 85  THR A HG22 5  
ATOM 10119 H HG23 . THR A 1 85  ? 115.618 -9.378  -7.023  1.00 0.00 ? 85  THR A HG23 5  
ATOM 10120 N N    . LYS A 1 86  ? 111.222 -10.611 -6.528  1.00 0.00 ? 86  LYS A N    5  
ATOM 10121 C CA   . LYS A 1 86  ? 110.463 -11.053 -5.348  1.00 0.00 ? 86  LYS A CA   5  
ATOM 10122 C C    . LYS A 1 86  ? 109.818 -12.403 -5.640  1.00 0.00 ? 86  LYS A C    5  
ATOM 10123 O O    . LYS A 1 86  ? 109.919 -13.329 -4.853  1.00 0.00 ? 86  LYS A O    5  
ATOM 10124 C CB   . LYS A 1 86  ? 109.362 -10.043 -4.992  1.00 0.00 ? 86  LYS A CB   5  
ATOM 10125 C CG   . LYS A 1 86  ? 109.862 -8.655  -4.648  1.00 0.00 ? 86  LYS A CG   5  
ATOM 10126 C CD   . LYS A 1 86  ? 108.728 -7.672  -4.391  1.00 0.00 ? 86  LYS A CD   5  
ATOM 10127 C CE   . LYS A 1 86  ? 107.856 -8.088  -3.223  1.00 0.00 ? 86  LYS A CE   5  
ATOM 10128 N NZ   . LYS A 1 86  ? 106.775 -7.114  -2.980  1.00 0.00 ? 86  LYS A NZ   5  
ATOM 10129 H H    . LYS A 1 86  ? 111.055 -9.724  -6.916  1.00 0.00 ? 86  LYS A H    5  
ATOM 10130 H HA   . LYS A 1 86  ? 111.146 -11.151 -4.517  1.00 0.00 ? 86  LYS A HA   5  
ATOM 10131 H HB2  . LYS A 1 86  ? 108.678 -9.956  -5.823  1.00 0.00 ? 86  LYS A HB2  5  
ATOM 10132 H HB3  . LYS A 1 86  ? 108.826 -10.422 -4.136  1.00 0.00 ? 86  LYS A HB3  5  
ATOM 10133 H HG2  . LYS A 1 86  ? 110.473 -8.713  -3.758  1.00 0.00 ? 86  LYS A HG2  5  
ATOM 10134 H HG3  . LYS A 1 86  ? 110.464 -8.292  -5.468  1.00 0.00 ? 86  LYS A HG3  5  
ATOM 10135 H HD2  . LYS A 1 86  ? 109.150 -6.702  -4.175  1.00 0.00 ? 86  LYS A HD2  5  
ATOM 10136 H HD3  . LYS A 1 86  ? 108.118 -7.606  -5.281  1.00 0.00 ? 86  LYS A HD3  5  
ATOM 10137 H HE2  . LYS A 1 86  ? 107.419 -9.052  -3.441  1.00 0.00 ? 86  LYS A HE2  5  
ATOM 10138 H HE3  . LYS A 1 86  ? 108.470 -8.165  -2.337  1.00 0.00 ? 86  LYS A HE3  5  
ATOM 10139 H HZ1  . LYS A 1 86  ? 106.126 -7.487  -2.255  1.00 0.00 ? 86  LYS A HZ1  5  
ATOM 10140 H HZ2  . LYS A 1 86  ? 106.208 -6.951  -3.843  1.00 0.00 ? 86  LYS A HZ2  5  
ATOM 10141 H HZ3  . LYS A 1 86  ? 107.156 -6.206  -2.634  1.00 0.00 ? 86  LYS A HZ3  5  
ATOM 10142 N N    . GLU A 1 87  ? 109.189 -12.484 -6.802  1.00 0.00 ? 87  GLU A N    5  
ATOM 10143 C CA   . GLU A 1 87  ? 108.539 -13.687 -7.305  1.00 0.00 ? 87  GLU A CA   5  
ATOM 10144 C C    . GLU A 1 87  ? 109.490 -14.890 -7.272  1.00 0.00 ? 87  GLU A C    5  
ATOM 10145 O O    . GLU A 1 87  ? 109.177 -15.930 -6.666  1.00 0.00 ? 87  GLU A O    5  
ATOM 10146 C CB   . GLU A 1 87  ? 108.071 -13.421 -8.728  1.00 0.00 ? 87  GLU A CB   5  
ATOM 10147 C CG   . GLU A 1 87  ? 107.493 -14.607 -9.447  1.00 0.00 ? 87  GLU A CG   5  
ATOM 10148 C CD   . GLU A 1 87  ? 107.131 -14.261 -10.851 1.00 0.00 ? 87  GLU A CD   5  
ATOM 10149 O OE1  . GLU A 1 87  ? 106.018 -13.779 -11.094 1.00 0.00 ? 87  GLU A OE1  5  
ATOM 10150 O OE2  . GLU A 1 87  ? 107.969 -14.447 -11.747 1.00 0.00 ? 87  GLU A OE2  5  
ATOM 10151 H H    . GLU A 1 87  ? 109.151 -11.673 -7.358  1.00 0.00 ? 87  GLU A H    5  
ATOM 10152 H HA   . GLU A 1 87  ? 107.676 -13.892 -6.690  1.00 0.00 ? 87  GLU A HA   5  
ATOM 10153 H HB2  . GLU A 1 87  ? 107.311 -12.655 -8.702  1.00 0.00 ? 87  GLU A HB2  5  
ATOM 10154 H HB3  . GLU A 1 87  ? 108.910 -13.054 -9.299  1.00 0.00 ? 87  GLU A HB3  5  
ATOM 10155 H HG2  . GLU A 1 87  ? 108.247 -15.382 -9.469  1.00 0.00 ? 87  GLU A HG2  5  
ATOM 10156 H HG3  . GLU A 1 87  ? 106.613 -14.955 -8.925  1.00 0.00 ? 87  GLU A HG3  5  
ATOM 10157 N N    . VAL A 1 88  ? 110.653 -14.735 -7.871  1.00 0.00 ? 88  VAL A N    5  
ATOM 10158 C CA   . VAL A 1 88  ? 111.642 -15.799 -7.896  1.00 0.00 ? 88  VAL A CA   5  
ATOM 10159 C C    . VAL A 1 88  ? 112.018 -16.207 -6.475  1.00 0.00 ? 88  VAL A C    5  
ATOM 10160 O O    . VAL A 1 88  ? 112.027 -17.384 -6.157  1.00 0.00 ? 88  VAL A O    5  
ATOM 10161 C CB   . VAL A 1 88  ? 112.906 -15.411 -8.714  1.00 0.00 ? 88  VAL A CB   5  
ATOM 10162 C CG1  . VAL A 1 88  ? 113.945 -16.527 -8.678  1.00 0.00 ? 88  VAL A CG1  5  
ATOM 10163 C CG2  . VAL A 1 88  ? 112.521 -15.114 -10.153 1.00 0.00 ? 88  VAL A CG2  5  
ATOM 10164 H H    . VAL A 1 88  ? 110.855 -13.878 -8.309  1.00 0.00 ? 88  VAL A H    5  
ATOM 10165 H HA   . VAL A 1 88  ? 111.170 -16.650 -8.367  1.00 0.00 ? 88  VAL A HA   5  
ATOM 10166 H HB   . VAL A 1 88  ? 113.338 -14.519 -8.286  1.00 0.00 ? 88  VAL A HB   5  
ATOM 10167 H HG11 . VAL A 1 88  ? 113.516 -17.425 -9.097  1.00 0.00 ? 88  VAL A HG11 5  
ATOM 10168 H HG12 . VAL A 1 88  ? 114.238 -16.711 -7.655  1.00 0.00 ? 88  VAL A HG12 5  
ATOM 10169 H HG13 . VAL A 1 88  ? 114.810 -16.236 -9.255  1.00 0.00 ? 88  VAL A HG13 5  
ATOM 10170 H HG21 . VAL A 1 88  ? 113.397 -14.830 -10.717 1.00 0.00 ? 88  VAL A HG21 5  
ATOM 10171 H HG22 . VAL A 1 88  ? 111.795 -14.313 -10.169 1.00 0.00 ? 88  VAL A HG22 5  
ATOM 10172 H HG23 . VAL A 1 88  ? 112.078 -15.995 -10.593 1.00 0.00 ? 88  VAL A HG23 5  
ATOM 10173 N N    . ILE A 1 89  ? 112.232 -15.227 -5.614  1.00 0.00 ? 89  ILE A N    5  
ATOM 10174 C CA   . ILE A 1 89  ? 112.589 -15.486 -4.219  1.00 0.00 ? 89  ILE A CA   5  
ATOM 10175 C C    . ILE A 1 89  ? 111.469 -16.232 -3.496  1.00 0.00 ? 89  ILE A C    5  
ATOM 10176 O O    . ILE A 1 89  ? 111.724 -17.215 -2.828  1.00 0.00 ? 89  ILE A O    5  
ATOM 10177 C CB   . ILE A 1 89  ? 112.883 -14.186 -3.453  1.00 0.00 ? 89  ILE A CB   5  
ATOM 10178 C CG1  . ILE A 1 89  ? 113.976 -13.403 -4.160  1.00 0.00 ? 89  ILE A CG1  5  
ATOM 10179 C CG2  . ILE A 1 89  ? 113.288 -14.488 -2.001  1.00 0.00 ? 89  ILE A CG2  5  
ATOM 10180 C CD1  . ILE A 1 89  ? 114.260 -12.080 -3.526  1.00 0.00 ? 89  ILE A CD1  5  
ATOM 10181 H H    . ILE A 1 89  ? 112.157 -14.298 -5.930  1.00 0.00 ? 89  ILE A H    5  
ATOM 10182 H HA   . ILE A 1 89  ? 113.477 -16.101 -4.213  1.00 0.00 ? 89  ILE A HA   5  
ATOM 10183 H HB   . ILE A 1 89  ? 111.982 -13.592 -3.435  1.00 0.00 ? 89  ILE A HB   5  
ATOM 10184 H HG12 . ILE A 1 89  ? 114.890 -13.978 -4.144  1.00 0.00 ? 89  ILE A HG12 5  
ATOM 10185 H HG13 . ILE A 1 89  ? 113.680 -13.229 -5.183  1.00 0.00 ? 89  ILE A HG13 5  
ATOM 10186 H HG21 . ILE A 1 89  ? 114.215 -15.039 -1.976  1.00 0.00 ? 89  ILE A HG21 5  
ATOM 10187 H HG22 . ILE A 1 89  ? 112.506 -15.068 -1.533  1.00 0.00 ? 89  ILE A HG22 5  
ATOM 10188 H HG23 . ILE A 1 89  ? 113.390 -13.556 -1.463  1.00 0.00 ? 89  ILE A HG23 5  
ATOM 10189 H HD11 . ILE A 1 89  ? 113.325 -11.569 -3.332  1.00 0.00 ? 89  ILE A HD11 5  
ATOM 10190 H HD12 . ILE A 1 89  ? 114.866 -11.480 -4.189  1.00 0.00 ? 89  ILE A HD12 5  
ATOM 10191 H HD13 . ILE A 1 89  ? 114.781 -12.229 -2.591  1.00 0.00 ? 89  ILE A HD13 5  
ATOM 10192 N N    . THR A 1 90  ? 110.222 -15.779 -3.669  1.00 0.00 ? 90  THR A N    5  
ATOM 10193 C CA   . THR A 1 90  ? 109.071 -16.398 -3.002  1.00 0.00 ? 90  THR A CA   5  
ATOM 10194 C C    . THR A 1 90  ? 108.957 -17.891 -3.345  1.00 0.00 ? 90  THR A C    5  
ATOM 10195 O O    . THR A 1 90  ? 108.440 -18.691 -2.562  1.00 0.00 ? 90  THR A O    5  
ATOM 10196 C CB   . THR A 1 90  ? 107.731 -15.671 -3.328  1.00 0.00 ? 90  THR A CB   5  
ATOM 10197 O OG1  . THR A 1 90  ? 107.465 -15.696 -4.731  1.00 0.00 ? 90  THR A OG1  5  
ATOM 10198 C CG2  . THR A 1 90  ? 107.768 -14.228 -2.864  1.00 0.00 ? 90  THR A CG2  5  
ATOM 10199 H H    . THR A 1 90  ? 110.085 -14.986 -4.236  1.00 0.00 ? 90  THR A H    5  
ATOM 10200 H HA   . THR A 1 90  ? 109.254 -16.323 -1.939  1.00 0.00 ? 90  THR A HA   5  
ATOM 10201 H HB   . THR A 1 90  ? 106.930 -16.179 -2.811  1.00 0.00 ? 90  THR A HB   5  
ATOM 10202 H HG1  . THR A 1 90  ? 108.295 -15.652 -5.226  1.00 0.00 ? 90  THR A HG1  5  
ATOM 10203 H HG21 . THR A 1 90  ? 106.834 -13.746 -3.115  1.00 0.00 ? 90  THR A HG21 5  
ATOM 10204 H HG22 . THR A 1 90  ? 108.584 -13.717 -3.354  1.00 0.00 ? 90  THR A HG22 5  
ATOM 10205 H HG23 . THR A 1 90  ? 107.919 -14.190 -1.796  1.00 0.00 ? 90  THR A HG23 5  
ATOM 10206 N N    . ASN A 1 91  ? 109.458 -18.251 -4.504  1.00 0.00 ? 91  ASN A N    5  
ATOM 10207 C CA   . ASN A 1 91  ? 109.467 -19.628 -4.927  1.00 0.00 ? 91  ASN A CA   5  
ATOM 10208 C C    . ASN A 1 91  ? 110.771 -20.304 -4.480  1.00 0.00 ? 91  ASN A C    5  
ATOM 10209 O O    . ASN A 1 91  ? 110.757 -21.382 -3.915  1.00 0.00 ? 91  ASN A O    5  
ATOM 10210 C CB   . ASN A 1 91  ? 109.286 -19.708 -6.448  1.00 0.00 ? 91  ASN A CB   5  
ATOM 10211 C CG   . ASN A 1 91  ? 107.972 -19.094 -6.915  1.00 0.00 ? 91  ASN A CG   5  
ATOM 10212 O OD1  . ASN A 1 91  ? 106.959 -19.140 -6.210  1.00 0.00 ? 91  ASN A OD1  5  
ATOM 10213 N ND2  . ASN A 1 91  ? 107.981 -18.486 -8.076  1.00 0.00 ? 91  ASN A ND2  5  
ATOM 10214 H H    . ASN A 1 91  ? 109.822 -17.557 -5.098  1.00 0.00 ? 91  ASN A H    5  
ATOM 10215 H HA   . ASN A 1 91  ? 108.638 -20.125 -4.445  1.00 0.00 ? 91  ASN A HA   5  
ATOM 10216 H HB2  . ASN A 1 91  ? 110.097 -19.184 -6.930  1.00 0.00 ? 91  ASN A HB2  5  
ATOM 10217 H HB3  . ASN A 1 91  ? 109.306 -20.745 -6.750  1.00 0.00 ? 91  ASN A HB3  5  
ATOM 10218 H HD21 . ASN A 1 91  ? 108.826 -18.458 -8.587  1.00 0.00 ? 91  ASN A HD21 5  
ATOM 10219 H HD22 . ASN A 1 91  ? 107.159 -18.044 -8.395  1.00 0.00 ? 91  ASN A HD22 5  
ATOM 10220 N N    . SER A 1 92  ? 111.881 -19.613 -4.657  1.00 0.00 ? 92  SER A N    5  
ATOM 10221 C CA   . SER A 1 92  ? 113.228 -20.102 -4.324  1.00 0.00 ? 92  SER A CA   5  
ATOM 10222 C C    . SER A 1 92  ? 113.504 -20.021 -2.798  1.00 0.00 ? 92  SER A C    5  
ATOM 10223 O O    . SER A 1 92  ? 114.636 -20.222 -2.348  1.00 0.00 ? 92  SER A O    5  
ATOM 10224 C CB   . SER A 1 92  ? 114.261 -19.253 -5.128  1.00 0.00 ? 92  SER A CB   5  
ATOM 10225 O OG   . SER A 1 92  ? 115.620 -19.662 -4.955  1.00 0.00 ? 92  SER A OG   5  
ATOM 10226 H H    . SER A 1 92  ? 111.824 -18.716 -5.058  1.00 0.00 ? 92  SER A H    5  
ATOM 10227 H HA   . SER A 1 92  ? 113.305 -21.130 -4.640  1.00 0.00 ? 92  SER A HA   5  
ATOM 10228 H HB2  . SER A 1 92  ? 114.026 -19.326 -6.179  1.00 0.00 ? 92  SER A HB2  5  
ATOM 10229 H HB3  . SER A 1 92  ? 114.166 -18.220 -4.824  1.00 0.00 ? 92  SER A HB3  5  
ATOM 10230 H HG   . SER A 1 92  ? 115.660 -20.550 -4.565  1.00 0.00 ? 92  SER A HG   5  
ATOM 10231 N N    . ILE A 1 93  ? 112.481 -19.741 -2.017  1.00 0.00 ? 93  ILE A N    5  
ATOM 10232 C CA   . ILE A 1 93  ? 112.648 -19.610 -0.584  1.00 0.00 ? 93  ILE A CA   5  
ATOM 10233 C C    . ILE A 1 93  ? 112.121 -20.853 0.143   1.00 0.00 ? 93  ILE A C    5  
ATOM 10234 O O    . ILE A 1 93  ? 112.510 -21.139 1.279   1.00 0.00 ? 93  ILE A O    5  
ATOM 10235 C CB   . ILE A 1 93  ? 111.926 -18.336 -0.045  1.00 0.00 ? 93  ILE A CB   5  
ATOM 10236 C CG1  . ILE A 1 93  ? 112.479 -17.944 1.314   1.00 0.00 ? 93  ILE A CG1  5  
ATOM 10237 C CG2  . ILE A 1 93  ? 110.417 -18.538 0.031   1.00 0.00 ? 93  ILE A CG2  5  
ATOM 10238 C CD1  . ILE A 1 93  ? 113.918 -17.481 1.248   1.00 0.00 ? 93  ILE A CD1  5  
ATOM 10239 H H    . ILE A 1 93  ? 111.613 -19.566 -2.439  1.00 0.00 ? 93  ILE A H    5  
ATOM 10240 H HA   . ILE A 1 93  ? 113.706 -19.515 -0.383  1.00 0.00 ? 93  ILE A HA   5  
ATOM 10241 H HB   . ILE A 1 93  ? 112.115 -17.531 -0.740  1.00 0.00 ? 93  ILE A HB   5  
ATOM 10242 H HG12 . ILE A 1 93  ? 111.887 -17.134 1.714   1.00 0.00 ? 93  ILE A HG12 5  
ATOM 10243 H HG13 . ILE A 1 93  ? 112.426 -18.791 1.982   1.00 0.00 ? 93  ILE A HG13 5  
ATOM 10244 H HG21 . ILE A 1 93  ? 109.920 -17.602 0.243   1.00 0.00 ? 93  ILE A HG21 5  
ATOM 10245 H HG22 . ILE A 1 93  ? 110.210 -19.244 0.823   1.00 0.00 ? 93  ILE A HG22 5  
ATOM 10246 H HG23 . ILE A 1 93  ? 110.072 -18.956 -0.903  1.00 0.00 ? 93  ILE A HG23 5  
ATOM 10247 H HD11 . ILE A 1 93  ? 113.971 -16.574 0.661   1.00 0.00 ? 93  ILE A HD11 5  
ATOM 10248 H HD12 . ILE A 1 93  ? 114.529 -18.244 0.788   1.00 0.00 ? 93  ILE A HD12 5  
ATOM 10249 H HD13 . ILE A 1 93  ? 114.295 -17.287 2.241   1.00 0.00 ? 93  ILE A HD13 5  
ATOM 10250 N N    . THR A 1 94  ? 111.222 -21.578 -0.510  1.00 0.00 ? 94  THR A N    5  
ATOM 10251 C CA   . THR A 1 94  ? 110.645 -22.780 0.082   1.00 0.00 ? 94  THR A CA   5  
ATOM 10252 C C    . THR A 1 94  ? 111.718 -23.884 0.179   1.00 0.00 ? 94  THR A C    5  
ATOM 10253 O O    . THR A 1 94  ? 111.730 -24.686 1.116   1.00 0.00 ? 94  THR A O    5  
ATOM 10254 C CB   . THR A 1 94  ? 109.365 -23.249 -0.682  1.00 0.00 ? 94  THR A CB   5  
ATOM 10255 O OG1  . THR A 1 94  ? 108.742 -24.373 -0.038  1.00 0.00 ? 94  THR A OG1  5  
ATOM 10256 C CG2  . THR A 1 94  ? 109.671 -23.592 -2.125  1.00 0.00 ? 94  THR A CG2  5  
ATOM 10257 H H    . THR A 1 94  ? 110.935 -21.269 -1.395  1.00 0.00 ? 94  THR A H    5  
ATOM 10258 H HA   . THR A 1 94  ? 110.378 -22.511 1.095   1.00 0.00 ? 94  THR A HA   5  
ATOM 10259 H HB   . THR A 1 94  ? 108.661 -22.428 -0.664  1.00 0.00 ? 94  THR A HB   5  
ATOM 10260 H HG1  . THR A 1 94  ? 107.798 -24.293 -0.263  1.00 0.00 ? 94  THR A HG1  5  
ATOM 10261 H HG21 . THR A 1 94  ? 108.765 -23.883 -2.636  1.00 0.00 ? 94  THR A HG21 5  
ATOM 10262 H HG22 . THR A 1 94  ? 110.388 -24.398 -2.156  1.00 0.00 ? 94  THR A HG22 5  
ATOM 10263 H HG23 . THR A 1 94  ? 110.090 -22.712 -2.595  1.00 0.00 ? 94  THR A HG23 5  
ATOM 10264 N N    . GLN A 1 95  ? 112.630 -23.884 -0.778  1.00 0.00 ? 95  GLN A N    5  
ATOM 10265 C CA   . GLN A 1 95  ? 113.812 -24.712 -0.764  1.00 0.00 ? 95  GLN A CA   5  
ATOM 10266 C C    . GLN A 1 95  ? 114.959 -23.787 -1.138  1.00 0.00 ? 95  GLN A C    5  
ATOM 10267 O O    . GLN A 1 95  ? 115.363 -23.718 -2.303  1.00 0.00 ? 95  GLN A O    5  
ATOM 10268 C CB   . GLN A 1 95  ? 113.743 -25.888 -1.759  1.00 0.00 ? 95  GLN A CB   5  
ATOM 10269 C CG   . GLN A 1 95  ? 112.590 -26.862 -1.561  1.00 0.00 ? 95  GLN A CG   5  
ATOM 10270 C CD   . GLN A 1 95  ? 112.540 -27.516 -0.182  1.00 0.00 ? 95  GLN A CD   5  
ATOM 10271 O OE1  . GLN A 1 95  ? 111.458 -27.863 0.297   1.00 0.00 ? 95  GLN A OE1  5  
ATOM 10272 N NE2  . GLN A 1 95  ? 113.663 -27.700 0.466   1.00 0.00 ? 95  GLN A NE2  5  
ATOM 10273 H H    . GLN A 1 95  ? 112.542 -23.271 -1.537  1.00 0.00 ? 95  GLN A H    5  
ATOM 10274 H HA   . GLN A 1 95  ? 113.962 -25.065 0.247   1.00 0.00 ? 95  GLN A HA   5  
ATOM 10275 H HB2  . GLN A 1 95  ? 113.663 -25.485 -2.757  1.00 0.00 ? 95  GLN A HB2  5  
ATOM 10276 H HB3  . GLN A 1 95  ? 114.670 -26.441 -1.691  1.00 0.00 ? 95  GLN A HB3  5  
ATOM 10277 H HG2  . GLN A 1 95  ? 111.664 -26.326 -1.708  1.00 0.00 ? 95  GLN A HG2  5  
ATOM 10278 H HG3  . GLN A 1 95  ? 112.672 -27.637 -2.309  1.00 0.00 ? 95  GLN A HG3  5  
ATOM 10279 H HE21 . GLN A 1 95  ? 114.524 -27.421 0.069   1.00 0.00 ? 95  GLN A HE21 5  
ATOM 10280 H HE22 . GLN A 1 95  ? 113.619 -28.135 1.348   1.00 0.00 ? 95  GLN A HE22 5  
ATOM 10281 N N    . PRO A 1 96  ? 115.417 -22.984 -0.175  1.00 0.00 ? 96  PRO A N    5  
ATOM 10282 C CA   . PRO A 1 96  ? 116.403 -21.932 -0.411  1.00 0.00 ? 96  PRO A CA   5  
ATOM 10283 C C    . PRO A 1 96  ? 117.788 -22.443 -0.753  1.00 0.00 ? 96  PRO A C    5  
ATOM 10284 O O    . PRO A 1 96  ? 118.187 -23.552 -0.368  1.00 0.00 ? 96  PRO A O    5  
ATOM 10285 C CB   . PRO A 1 96  ? 116.431 -21.171 0.908   1.00 0.00 ? 96  PRO A CB   5  
ATOM 10286 C CG   . PRO A 1 96  ? 116.035 -22.184 1.919   1.00 0.00 ? 96  PRO A CG   5  
ATOM 10287 C CD   . PRO A 1 96  ? 115.018 -23.041 1.237   1.00 0.00 ? 96  PRO A CD   5  
ATOM 10288 H HA   . PRO A 1 96  ? 116.075 -21.262 -1.191  1.00 0.00 ? 96  PRO A HA   5  
ATOM 10289 H HB2  . PRO A 1 96  ? 117.422 -20.777 1.080   1.00 0.00 ? 96  PRO A HB2  5  
ATOM 10290 H HB3  . PRO A 1 96  ? 115.721 -20.358 0.869   1.00 0.00 ? 96  PRO A HB3  5  
ATOM 10291 H HG2  . PRO A 1 96  ? 116.894 -22.771 2.207   1.00 0.00 ? 96  PRO A HG2  5  
ATOM 10292 H HG3  . PRO A 1 96  ? 115.600 -21.699 2.781   1.00 0.00 ? 96  PRO A HG3  5  
ATOM 10293 H HD2  . PRO A 1 96  ? 115.019 -24.062 1.584   1.00 0.00 ? 96  PRO A HD2  5  
ATOM 10294 H HD3  . PRO A 1 96  ? 114.034 -22.610 1.354   1.00 0.00 ? 96  PRO A HD3  5  
ATOM 10295 N N    . THR A 1 97  ? 118.501 -21.624 -1.450  1.00 0.00 ? 97  THR A N    5  
ATOM 10296 C CA   . THR A 1 97  ? 119.832 -21.886 -1.867  1.00 0.00 ? 97  THR A CA   5  
ATOM 10297 C C    . THR A 1 97  ? 120.713 -20.749 -1.402  1.00 0.00 ? 97  THR A C    5  
ATOM 10298 O O    . THR A 1 97  ? 120.200 -19.713 -0.962  1.00 0.00 ? 97  THR A O    5  
ATOM 10299 C CB   . THR A 1 97  ? 119.888 -22.070 -3.398  1.00 0.00 ? 97  THR A CB   5  
ATOM 10300 O OG1  . THR A 1 97  ? 119.011 -21.112 -4.038  1.00 0.00 ? 97  THR A OG1  5  
ATOM 10301 C CG2  . THR A 1 97  ? 119.481 -23.482 -3.791  1.00 0.00 ? 97  THR A CG2  5  
ATOM 10302 H H    . THR A 1 97  ? 118.144 -20.739 -1.695  1.00 0.00 ? 97  THR A H    5  
ATOM 10303 H HA   . THR A 1 97  ? 120.206 -22.778 -1.384  1.00 0.00 ? 97  THR A HA   5  
ATOM 10304 H HB   . THR A 1 97  ? 120.901 -21.886 -3.725  1.00 0.00 ? 97  THR A HB   5  
ATOM 10305 H HG1  . THR A 1 97  ? 118.098 -21.406 -3.885  1.00 0.00 ? 97  THR A HG1  5  
ATOM 10306 H HG21 . THR A 1 97  ? 119.538 -23.593 -4.864  1.00 0.00 ? 97  THR A HG21 5  
ATOM 10307 H HG22 . THR A 1 97  ? 118.470 -23.663 -3.457  1.00 0.00 ? 97  THR A HG22 5  
ATOM 10308 H HG23 . THR A 1 97  ? 120.146 -24.187 -3.315  1.00 0.00 ? 97  THR A HG23 5  
ATOM 10309 N N    . LEU A 1 98  ? 122.015 -20.925 -1.519  1.00 0.00 ? 98  LEU A N    5  
ATOM 10310 C CA   . LEU A 1 98  ? 123.005 -20.010 -0.979  1.00 0.00 ? 98  LEU A CA   5  
ATOM 10311 C C    . LEU A 1 98  ? 122.875 -18.577 -1.515  1.00 0.00 ? 98  LEU A C    5  
ATOM 10312 O O    . LEU A 1 98  ? 123.396 -17.637 -0.924  1.00 0.00 ? 98  LEU A O    5  
ATOM 10313 C CB   . LEU A 1 98  ? 124.398 -20.547 -1.243  1.00 0.00 ? 98  LEU A CB   5  
ATOM 10314 C CG   . LEU A 1 98  ? 125.425 -20.174 -0.201  1.00 0.00 ? 98  LEU A CG   5  
ATOM 10315 C CD1  . LEU A 1 98  ? 125.016 -20.785 1.126   1.00 0.00 ? 98  LEU A CD1  5  
ATOM 10316 C CD2  . LEU A 1 98  ? 126.793 -20.663 -0.618  1.00 0.00 ? 98  LEU A CD2  5  
ATOM 10317 H H    . LEU A 1 98  ? 122.340 -21.729 -1.984  1.00 0.00 ? 98  LEU A H    5  
ATOM 10318 H HA   . LEU A 1 98  ? 122.863 -19.981 0.091   1.00 0.00 ? 98  LEU A HA   5  
ATOM 10319 H HB2  . LEU A 1 98  ? 124.344 -21.624 -1.298  1.00 0.00 ? 98  LEU A HB2  5  
ATOM 10320 H HB3  . LEU A 1 98  ? 124.733 -20.169 -2.197  1.00 0.00 ? 98  LEU A HB3  5  
ATOM 10321 H HG   . LEU A 1 98  ? 125.455 -19.099 -0.090  1.00 0.00 ? 98  LEU A HG   5  
ATOM 10322 H HD11 . LEU A 1 98  ? 125.001 -21.860 1.028   1.00 0.00 ? 98  LEU A HD11 5  
ATOM 10323 H HD12 . LEU A 1 98  ? 124.007 -20.474 1.365   1.00 0.00 ? 98  LEU A HD12 5  
ATOM 10324 H HD13 . LEU A 1 98  ? 125.696 -20.497 1.914   1.00 0.00 ? 98  LEU A HD13 5  
ATOM 10325 H HD21 . LEU A 1 98  ? 127.062 -20.212 -1.561  1.00 0.00 ? 98  LEU A HD21 5  
ATOM 10326 H HD22 . LEU A 1 98  ? 126.760 -21.737 -0.727  1.00 0.00 ? 98  LEU A HD22 5  
ATOM 10327 H HD23 . LEU A 1 98  ? 127.519 -20.393 0.134   1.00 0.00 ? 98  LEU A HD23 5  
ATOM 10328 N N    . HIS A 1 99  ? 122.230 -18.411 -2.643  1.00 0.00 ? 99  HIS A N    5  
ATOM 10329 C CA   . HIS A 1 99  ? 121.991 -17.093 -3.174  1.00 0.00 ? 99  HIS A CA   5  
ATOM 10330 C C    . HIS A 1 99  ? 120.558 -16.921 -3.627  1.00 0.00 ? 99  HIS A C    5  
ATOM 10331 O O    . HIS A 1 99  ? 120.306 -16.424 -4.717  1.00 0.00 ? 99  HIS A O    5  
ATOM 10332 C CB   . HIS A 1 99  ? 122.974 -16.710 -4.302  1.00 0.00 ? 99  HIS A CB   5  
ATOM 10333 C CG   . HIS A 1 99  ? 124.380 -16.518 -3.841  1.00 0.00 ? 99  HIS A CG   5  
ATOM 10334 N ND1  . HIS A 1 99  ? 124.845 -15.347 -3.269  1.00 0.00 ? 99  HIS A ND1  5  
ATOM 10335 C CD2  . HIS A 1 99  ? 125.419 -17.372 -3.829  1.00 0.00 ? 99  HIS A CD2  5  
ATOM 10336 C CE1  . HIS A 1 99  ? 126.099 -15.502 -2.922  1.00 0.00 ? 99  HIS A CE1  5  
ATOM 10337 N NE2  . HIS A 1 99  ? 126.471 -16.723 -3.256  1.00 0.00 ? 99  HIS A NE2  5  
ATOM 10338 H H    . HIS A 1 99  ? 121.912 -19.195 -3.149  1.00 0.00 ? 99  HIS A H    5  
ATOM 10339 H HA   . HIS A 1 99  ? 122.143 -16.411 -2.351  1.00 0.00 ? 99  HIS A HA   5  
ATOM 10340 H HB2  . HIS A 1 99  ? 122.975 -17.490 -5.048  1.00 0.00 ? 99  HIS A HB2  5  
ATOM 10341 H HB3  . HIS A 1 99  ? 122.641 -15.789 -4.758  1.00 0.00 ? 99  HIS A HB3  5  
ATOM 10342 H HD1  . HIS A 1 99  ? 124.367 -14.490 -3.154  1.00 0.00 ? 99  HIS A HD1  5  
ATOM 10343 H HD2  . HIS A 1 99  ? 125.419 -18.385 -4.206  1.00 0.00 ? 99  HIS A HD2  5  
ATOM 10344 H HE1  . HIS A 1 99  ? 126.695 -14.755 -2.412  1.00 0.00 ? 99  HIS A HE1  5  
ATOM 10345 H HE2  . HIS A 1 99  ? 127.294 -17.194 -2.972  1.00 0.00 ? 99  HIS A HE2  5  
ATOM 10346 N N    . SER A 1 100 ? 119.601 -17.308 -2.772  1.00 0.00 ? 100 SER A N    5  
ATOM 10347 C CA   . SER A 1 100 ? 118.169 -17.062 -3.048  1.00 0.00 ? 100 SER A CA   5  
ATOM 10348 C C    . SER A 1 100 ? 117.859 -15.542 -3.146  1.00 0.00 ? 100 SER A C    5  
ATOM 10349 O O    . SER A 1 100 ? 116.781 -15.135 -3.583  1.00 0.00 ? 100 SER A O    5  
ATOM 10350 C CB   . SER A 1 100 ? 117.263 -17.736 -1.976  1.00 0.00 ? 100 SER A CB   5  
ATOM 10351 O OG   . SER A 1 100 ? 117.328 -19.158 -2.055  1.00 0.00 ? 100 SER A OG   5  
ATOM 10352 H H    . SER A 1 100 ? 119.839 -17.816 -1.965  1.00 0.00 ? 100 SER A H    5  
ATOM 10353 H HA   . SER A 1 100 ? 117.957 -17.502 -4.011  1.00 0.00 ? 100 SER A HA   5  
ATOM 10354 H HB2  . SER A 1 100 ? 117.554 -17.444 -0.975  1.00 0.00 ? 100 SER A HB2  5  
ATOM 10355 H HB3  . SER A 1 100 ? 116.238 -17.436 -2.136  1.00 0.00 ? 100 SER A HB3  5  
ATOM 10356 H HG   . SER A 1 100 ? 116.452 -19.448 -2.344  1.00 0.00 ? 100 SER A HG   5  
ATOM 10357 N N    . PHE A 1 101 ? 118.823 -14.718 -2.750  1.00 0.00 ? 101 PHE A N    5  
ATOM 10358 C CA   . PHE A 1 101 ? 118.674 -13.278 -2.782  1.00 0.00 ? 101 PHE A CA   5  
ATOM 10359 C C    . PHE A 1 101 ? 119.705 -12.651 -3.737  1.00 0.00 ? 101 PHE A C    5  
ATOM 10360 O O    . PHE A 1 101 ? 119.959 -11.460 -3.671  1.00 0.00 ? 101 PHE A O    5  
ATOM 10361 C CB   . PHE A 1 101 ? 118.878 -12.697 -1.373  1.00 0.00 ? 101 PHE A CB   5  
ATOM 10362 C CG   . PHE A 1 101 ? 118.080 -13.376 -0.295  1.00 0.00 ? 101 PHE A CG   5  
ATOM 10363 C CD1  . PHE A 1 101 ? 116.742 -13.085 -0.107  1.00 0.00 ? 101 PHE A CD1  5  
ATOM 10364 C CD2  . PHE A 1 101 ? 118.680 -14.314 0.534   1.00 0.00 ? 101 PHE A CD2  5  
ATOM 10365 C CE1  . PHE A 1 101 ? 116.019 -13.717 0.886   1.00 0.00 ? 101 PHE A CE1  5  
ATOM 10366 C CE2  . PHE A 1 101 ? 117.962 -14.944 1.522   1.00 0.00 ? 101 PHE A CE2  5  
ATOM 10367 C CZ   . PHE A 1 101 ? 116.632 -14.644 1.696   1.00 0.00 ? 101 PHE A CZ   5  
ATOM 10368 H H    . PHE A 1 101 ? 119.655 -15.110 -2.417  1.00 0.00 ? 101 PHE A H    5  
ATOM 10369 H HA   . PHE A 1 101 ? 117.678 -13.035 -3.120  1.00 0.00 ? 101 PHE A HA   5  
ATOM 10370 H HB2  . PHE A 1 101 ? 119.921 -12.780 -1.107  1.00 0.00 ? 101 PHE A HB2  5  
ATOM 10371 H HB3  . PHE A 1 101 ? 118.602 -11.652 -1.384  1.00 0.00 ? 101 PHE A HB3  5  
ATOM 10372 H HD1  . PHE A 1 101 ? 116.263 -12.358 -0.744  1.00 0.00 ? 101 PHE A HD1  5  
ATOM 10373 H HD2  . PHE A 1 101 ? 119.726 -14.548 0.397   1.00 0.00 ? 101 PHE A HD2  5  
ATOM 10374 H HE1  . PHE A 1 101 ? 114.975 -13.487 1.033   1.00 0.00 ? 101 PHE A HE1  5  
ATOM 10375 H HE2  . PHE A 1 101 ? 118.438 -15.671 2.162   1.00 0.00 ? 101 PHE A HE2  5  
ATOM 10376 H HZ   . PHE A 1 101 ? 116.066 -15.138 2.472   1.00 0.00 ? 101 PHE A HZ   5  
ATOM 10377 N N    . ASP A 1 102 ? 120.269 -13.447 -4.657  1.00 0.00 ? 102 ASP A N    5  
ATOM 10378 C CA   . ASP A 1 102 ? 121.322 -12.927 -5.574  1.00 0.00 ? 102 ASP A CA   5  
ATOM 10379 C C    . ASP A 1 102 ? 120.792 -11.890 -6.549  1.00 0.00 ? 102 ASP A C    5  
ATOM 10380 O O    . ASP A 1 102 ? 121.431 -10.848 -6.776  1.00 0.00 ? 102 ASP A O    5  
ATOM 10381 C CB   . ASP A 1 102 ? 122.035 -14.030 -6.360  1.00 0.00 ? 102 ASP A CB   5  
ATOM 10382 C CG   . ASP A 1 102 ? 123.025 -13.449 -7.367  1.00 0.00 ? 102 ASP A CG   5  
ATOM 10383 O OD1  . ASP A 1 102 ? 124.149 -13.073 -6.976  1.00 0.00 ? 102 ASP A OD1  5  
ATOM 10384 O OD2  . ASP A 1 102 ? 122.678 -13.329 -8.561  1.00 0.00 ? 102 ASP A OD2  5  
ATOM 10385 H H    . ASP A 1 102 ? 119.963 -14.378 -4.738  1.00 0.00 ? 102 ASP A H    5  
ATOM 10386 H HA   . ASP A 1 102 ? 122.049 -12.433 -4.946  1.00 0.00 ? 102 ASP A HA   5  
ATOM 10387 H HB2  . ASP A 1 102 ? 122.573 -14.666 -5.673  1.00 0.00 ? 102 ASP A HB2  5  
ATOM 10388 H HB3  . ASP A 1 102 ? 121.304 -14.616 -6.896  1.00 0.00 ? 102 ASP A HB3  5  
ATOM 10389 N N    . ALA A 1 103 ? 119.630 -12.145 -7.108  1.00 0.00 ? 103 ALA A N    5  
ATOM 10390 C CA   . ALA A 1 103 ? 119.048 -11.222 -8.067  1.00 0.00 ? 103 ALA A CA   5  
ATOM 10391 C C    . ALA A 1 103 ? 118.607 -9.981  -7.337  1.00 0.00 ? 103 ALA A C    5  
ATOM 10392 O O    . ALA A 1 103 ? 118.735 -8.852  -7.826  1.00 0.00 ? 103 ALA A O    5  
ATOM 10393 C CB   . ALA A 1 103 ? 117.876 -11.857 -8.787  1.00 0.00 ? 103 ALA A CB   5  
ATOM 10394 H H    . ALA A 1 103 ? 119.139 -12.957 -6.856  1.00 0.00 ? 103 ALA A H    5  
ATOM 10395 H HA   . ALA A 1 103 ? 119.809 -10.958 -8.786  1.00 0.00 ? 103 ALA A HA   5  
ATOM 10396 H HB1  . ALA A 1 103 ? 117.092 -12.078 -8.077  1.00 0.00 ? 103 ALA A HB1  5  
ATOM 10397 H HB2  . ALA A 1 103 ? 118.197 -12.770 -9.266  1.00 0.00 ? 103 ALA A HB2  5  
ATOM 10398 H HB3  . ALA A 1 103 ? 117.498 -11.171 -9.532  1.00 0.00 ? 103 ALA A HB3  5  
ATOM 10399 N N    . ALA A 1 104 ? 118.143 -10.197 -6.128  1.00 0.00 ? 104 ALA A N    5  
ATOM 10400 C CA   . ALA A 1 104 ? 117.688 -9.138  -5.280  1.00 0.00 ? 104 ALA A CA   5  
ATOM 10401 C C    . ALA A 1 104 ? 118.855 -8.290  -4.786  1.00 0.00 ? 104 ALA A C    5  
ATOM 10402 O O    . ALA A 1 104 ? 118.689 -7.107  -4.508  1.00 0.00 ? 104 ALA A O    5  
ATOM 10403 C CB   . ALA A 1 104 ? 116.854 -9.704  -4.155  1.00 0.00 ? 104 ALA A CB   5  
ATOM 10404 H H    . ALA A 1 104 ? 118.095 -11.128 -5.817  1.00 0.00 ? 104 ALA A H    5  
ATOM 10405 H HA   . ALA A 1 104 ? 117.053 -8.504  -5.884  1.00 0.00 ? 104 ALA A HA   5  
ATOM 10406 H HB1  . ALA A 1 104 ? 116.016 -10.207 -4.624  1.00 0.00 ? 104 ALA A HB1  5  
ATOM 10407 H HB2  . ALA A 1 104 ? 116.486 -8.897  -3.535  1.00 0.00 ? 104 ALA A HB2  5  
ATOM 10408 H HB3  . ALA A 1 104 ? 117.424 -10.408 -3.567  1.00 0.00 ? 104 ALA A HB3  5  
ATOM 10409 N N    . GLN A 1 105 ? 120.036 -8.896  -4.721  1.00 0.00 ? 105 GLN A N    5  
ATOM 10410 C CA   . GLN A 1 105 ? 121.266 -8.192  -4.383  1.00 0.00 ? 105 GLN A CA   5  
ATOM 10411 C C    . GLN A 1 105 ? 121.488 -7.093  -5.415  1.00 0.00 ? 105 GLN A C    5  
ATOM 10412 O O    . GLN A 1 105 ? 121.713 -5.939  -5.065  1.00 0.00 ? 105 GLN A O    5  
ATOM 10413 C CB   . GLN A 1 105 ? 122.455 -9.208  -4.349  1.00 0.00 ? 105 GLN A CB   5  
ATOM 10414 C CG   . GLN A 1 105 ? 123.842 -8.669  -3.930  1.00 0.00 ? 105 GLN A CG   5  
ATOM 10415 C CD   . GLN A 1 105 ? 124.526 -7.779  -4.958  1.00 0.00 ? 105 GLN A CD   5  
ATOM 10416 O OE1  . GLN A 1 105 ? 124.338 -7.935  -6.167  1.00 0.00 ? 105 GLN A OE1  5  
ATOM 10417 N NE2  . GLN A 1 105 ? 125.309 -6.837  -4.494  1.00 0.00 ? 105 GLN A NE2  5  
ATOM 10418 H H    . GLN A 1 105 ? 120.070 -9.865  -4.876  1.00 0.00 ? 105 GLN A H    5  
ATOM 10419 H HA   . GLN A 1 105 ? 121.144 -7.743  -3.409  1.00 0.00 ? 105 GLN A HA   5  
ATOM 10420 H HB2  . GLN A 1 105 ? 122.199 -10.000 -3.661  1.00 0.00 ? 105 GLN A HB2  5  
ATOM 10421 H HB3  . GLN A 1 105 ? 122.547 -9.642  -5.334  1.00 0.00 ? 105 GLN A HB3  5  
ATOM 10422 H HG2  . GLN A 1 105 ? 123.727 -8.097  -3.021  1.00 0.00 ? 105 GLN A HG2  5  
ATOM 10423 H HG3  . GLN A 1 105 ? 124.482 -9.515  -3.726  1.00 0.00 ? 105 GLN A HG3  5  
ATOM 10424 H HE21 . GLN A 1 105 ? 125.410 -6.750  -3.523  1.00 0.00 ? 105 GLN A HE21 5  
ATOM 10425 H HE22 . GLN A 1 105 ? 125.778 -6.254  -5.133  1.00 0.00 ? 105 GLN A HE22 5  
ATOM 10426 N N    . SER A 1 106 ? 121.355 -7.453  -6.683  1.00 0.00 ? 106 SER A N    5  
ATOM 10427 C CA   . SER A 1 106 ? 121.544 -6.519  -7.767  1.00 0.00 ? 106 SER A CA   5  
ATOM 10428 C C    . SER A 1 106 ? 120.443 -5.445  -7.761  1.00 0.00 ? 106 SER A C    5  
ATOM 10429 O O    . SER A 1 106 ? 120.702 -4.272  -8.057  1.00 0.00 ? 106 SER A O    5  
ATOM 10430 C CB   . SER A 1 106 ? 121.571 -7.280  -9.090  1.00 0.00 ? 106 SER A CB   5  
ATOM 10431 O OG   . SER A 1 106 ? 122.570 -8.308  -9.050  1.00 0.00 ? 106 SER A OG   5  
ATOM 10432 H H    . SER A 1 106 ? 121.114 -8.381  -6.892  1.00 0.00 ? 106 SER A H    5  
ATOM 10433 H HA   . SER A 1 106 ? 122.499 -6.037  -7.624  1.00 0.00 ? 106 SER A HA   5  
ATOM 10434 H HB2  . SER A 1 106 ? 120.606 -7.732  -9.262  1.00 0.00 ? 106 SER A HB2  5  
ATOM 10435 H HB3  . SER A 1 106 ? 121.804 -6.599  -9.895  1.00 0.00 ? 106 SER A HB3  5  
ATOM 10436 H HG   . SER A 1 106 ? 123.067 -8.215  -8.227  1.00 0.00 ? 106 SER A HG   5  
ATOM 10437 N N    . ARG A 1 107 ? 119.237 -5.848  -7.364  1.00 0.00 ? 107 ARG A N    5  
ATOM 10438 C CA   . ARG A 1 107 ? 118.106 -4.946  -7.296  1.00 0.00 ? 107 ARG A CA   5  
ATOM 10439 C C    . ARG A 1 107 ? 118.334 -3.874  -6.255  1.00 0.00 ? 107 ARG A C    5  
ATOM 10440 O O    . ARG A 1 107 ? 118.248 -2.691  -6.543  1.00 0.00 ? 107 ARG A O    5  
ATOM 10441 C CB   . ARG A 1 107 ? 116.827 -5.703  -6.968  1.00 0.00 ? 107 ARG A CB   5  
ATOM 10442 C CG   . ARG A 1 107 ? 116.371 -6.691  -8.020  1.00 0.00 ? 107 ARG A CG   5  
ATOM 10443 C CD   . ARG A 1 107 ? 116.156 -6.007  -9.345  1.00 0.00 ? 107 ARG A CD   5  
ATOM 10444 N NE   . ARG A 1 107 ? 115.600 -6.903  -10.357 1.00 0.00 ? 107 ARG A NE   5  
ATOM 10445 C CZ   . ARG A 1 107 ? 115.606 -6.644  -11.664 1.00 0.00 ? 107 ARG A CZ   5  
ATOM 10446 N NH1  . ARG A 1 107 ? 116.401 -5.696  -12.150 1.00 0.00 ? 107 ARG A NH1  5  
ATOM 10447 N NH2  . ARG A 1 107 ? 114.882 -7.375  -12.487 1.00 0.00 ? 107 ARG A NH2  5  
ATOM 10448 H H    . ARG A 1 107 ? 119.111 -6.783  -7.102  1.00 0.00 ? 107 ARG A H    5  
ATOM 10449 H HA   . ARG A 1 107 ? 117.982 -4.471  -8.257  1.00 0.00 ? 107 ARG A HA   5  
ATOM 10450 H HB2  . ARG A 1 107 ? 116.981 -6.251  -6.050  1.00 0.00 ? 107 ARG A HB2  5  
ATOM 10451 H HB3  . ARG A 1 107 ? 116.034 -4.986  -6.810  1.00 0.00 ? 107 ARG A HB3  5  
ATOM 10452 H HG2  . ARG A 1 107 ? 117.120 -7.461  -8.133  1.00 0.00 ? 107 ARG A HG2  5  
ATOM 10453 H HG3  . ARG A 1 107 ? 115.439 -7.132  -7.693  1.00 0.00 ? 107 ARG A HG3  5  
ATOM 10454 H HD2  . ARG A 1 107 ? 115.477 -5.181  -9.199  1.00 0.00 ? 107 ARG A HD2  5  
ATOM 10455 H HD3  . ARG A 1 107 ? 117.106 -5.629  -9.695  1.00 0.00 ? 107 ARG A HD3  5  
ATOM 10456 H HE   . ARG A 1 107 ? 115.133 -7.694  -9.991  1.00 0.00 ? 107 ARG A HE   5  
ATOM 10457 H HH11 . ARG A 1 107 ? 117.018 -5.174  -11.548 1.00 0.00 ? 107 ARG A HH11 5  
ATOM 10458 H HH12 . ARG A 1 107 ? 116.440 -5.453  -13.127 1.00 0.00 ? 107 ARG A HH12 5  
ATOM 10459 H HH21 . ARG A 1 107 ? 114.310 -8.141  -12.185 1.00 0.00 ? 107 ARG A HH21 5  
ATOM 10460 H HH22 . ARG A 1 107 ? 114.856 -7.173  -13.475 1.00 0.00 ? 107 ARG A HH22 5  
ATOM 10461 N N    . VAL A 1 108 ? 118.673 -4.291  -5.061  1.00 0.00 ? 108 VAL A N    5  
ATOM 10462 C CA   . VAL A 1 108 ? 118.881 -3.372  -3.960  1.00 0.00 ? 108 VAL A CA   5  
ATOM 10463 C C    . VAL A 1 108 ? 120.135 -2.544  -4.170  1.00 0.00 ? 108 VAL A C    5  
ATOM 10464 O O    . VAL A 1 108 ? 120.217 -1.386  -3.735  1.00 0.00 ? 108 VAL A O    5  
ATOM 10465 C CB   . VAL A 1 108 ? 118.886 -4.115  -2.620  1.00 0.00 ? 108 VAL A CB   5  
ATOM 10466 C CG1  . VAL A 1 108 ? 119.088 -3.165  -1.457  1.00 0.00 ? 108 VAL A CG1  5  
ATOM 10467 C CG2  . VAL A 1 108 ? 117.569 -4.826  -2.478  1.00 0.00 ? 108 VAL A CG2  5  
ATOM 10468 H H    . VAL A 1 108 ? 118.781 -5.257  -4.905  1.00 0.00 ? 108 VAL A H    5  
ATOM 10469 H HA   . VAL A 1 108 ? 118.041 -2.691  -3.973  1.00 0.00 ? 108 VAL A HA   5  
ATOM 10470 H HB   . VAL A 1 108 ? 119.664 -4.861  -2.619  1.00 0.00 ? 108 VAL A HB   5  
ATOM 10471 H HG11 . VAL A 1 108 ? 119.096 -3.736  -0.539  1.00 0.00 ? 108 VAL A HG11 5  
ATOM 10472 H HG12 . VAL A 1 108 ? 118.271 -2.458  -1.445  1.00 0.00 ? 108 VAL A HG12 5  
ATOM 10473 H HG13 . VAL A 1 108 ? 120.027 -2.641  -1.575  1.00 0.00 ? 108 VAL A HG13 5  
ATOM 10474 H HG21 . VAL A 1 108 ? 116.774 -4.095  -2.500  1.00 0.00 ? 108 VAL A HG21 5  
ATOM 10475 H HG22 . VAL A 1 108 ? 117.543 -5.379  -1.551  1.00 0.00 ? 108 VAL A HG22 5  
ATOM 10476 H HG23 . VAL A 1 108 ? 117.448 -5.498  -3.314  1.00 0.00 ? 108 VAL A HG23 5  
ATOM 10477 N N    . TYR A 1 109 ? 121.095 -3.124  -4.863  1.00 0.00 ? 109 TYR A N    5  
ATOM 10478 C CA   . TYR A 1 109 ? 122.270 -2.406  -5.270  1.00 0.00 ? 109 TYR A CA   5  
ATOM 10479 C C    . TYR A 1 109 ? 121.871 -1.168  -6.095  1.00 0.00 ? 109 TYR A C    5  
ATOM 10480 O O    . TYR A 1 109 ? 122.233 -0.048  -5.749  1.00 0.00 ? 109 TYR A O    5  
ATOM 10481 C CB   . TYR A 1 109 ? 123.235 -3.330  -6.056  1.00 0.00 ? 109 TYR A CB   5  
ATOM 10482 C CG   . TYR A 1 109 ? 124.232 -2.582  -6.909  1.00 0.00 ? 109 TYR A CG   5  
ATOM 10483 C CD1  . TYR A 1 109 ? 125.430 -2.150  -6.391  1.00 0.00 ? 109 TYR A CD1  5  
ATOM 10484 C CD2  . TYR A 1 109 ? 123.928 -2.256  -8.230  1.00 0.00 ? 109 TYR A CD2  5  
ATOM 10485 C CE1  . TYR A 1 109 ? 126.294 -1.407  -7.155  1.00 0.00 ? 109 TYR A CE1  5  
ATOM 10486 C CE2  . TYR A 1 109 ? 124.788 -1.529  -8.999  1.00 0.00 ? 109 TYR A CE2  5  
ATOM 10487 C CZ   . TYR A 1 109 ? 125.972 -1.099  -8.457  1.00 0.00 ? 109 TYR A CZ   5  
ATOM 10488 O OH   . TYR A 1 109 ? 126.825 -0.317  -9.206  1.00 0.00 ? 109 TYR A OH   5  
ATOM 10489 H H    . TYR A 1 109 ? 121.007 -4.073  -5.103  1.00 0.00 ? 109 TYR A H    5  
ATOM 10490 H HA   . TYR A 1 109 ? 122.763 -2.066  -4.370  1.00 0.00 ? 109 TYR A HA   5  
ATOM 10491 H HB2  . TYR A 1 109 ? 123.792 -3.917  -5.340  1.00 0.00 ? 109 TYR A HB2  5  
ATOM 10492 H HB3  . TYR A 1 109 ? 122.658 -3.996  -6.675  1.00 0.00 ? 109 TYR A HB3  5  
ATOM 10493 H HD1  . TYR A 1 109 ? 125.682 -2.393  -5.369  1.00 0.00 ? 109 TYR A HD1  5  
ATOM 10494 H HD2  . TYR A 1 109 ? 122.994 -2.597  -8.650  1.00 0.00 ? 109 TYR A HD2  5  
ATOM 10495 H HE1  . TYR A 1 109 ? 127.233 -1.074  -6.735  1.00 0.00 ? 109 TYR A HE1  5  
ATOM 10496 H HE2  . TYR A 1 109 ? 124.509 -1.296  -10.017 1.00 0.00 ? 109 TYR A HE2  5  
ATOM 10497 H HH   . TYR A 1 109 ? 126.267 0.426   -9.501  1.00 0.00 ? 109 TYR A HH   5  
ATOM 10498 N N    . GLN A 1 110 ? 121.090 -1.369  -7.155  1.00 0.00 ? 110 GLN A N    5  
ATOM 10499 C CA   . GLN A 1 110 ? 120.693 -0.252  -7.993  1.00 0.00 ? 110 GLN A CA   5  
ATOM 10500 C C    . GLN A 1 110 ? 119.718 0.667   -7.273  1.00 0.00 ? 110 GLN A C    5  
ATOM 10501 O O    . GLN A 1 110 ? 119.694 1.875   -7.536  1.00 0.00 ? 110 GLN A O    5  
ATOM 10502 C CB   . GLN A 1 110 ? 120.147 -0.680  -9.352  1.00 0.00 ? 110 GLN A CB   5  
ATOM 10503 C CG   . GLN A 1 110 ? 118.964 -1.612  -9.297  1.00 0.00 ? 110 GLN A CG   5  
ATOM 10504 C CD   . GLN A 1 110 ? 118.234 -1.690  -10.611 1.00 0.00 ? 110 GLN A CD   5  
ATOM 10505 O OE1  . GLN A 1 110 ? 118.831 -1.535  -11.690 1.00 0.00 ? 110 GLN A OE1  5  
ATOM 10506 N NE2  . GLN A 1 110 ? 116.952 -1.903  -10.551 1.00 0.00 ? 110 GLN A NE2  5  
ATOM 10507 H H    . GLN A 1 110 ? 120.791 -2.282  -7.371  1.00 0.00 ? 110 GLN A H    5  
ATOM 10508 H HA   . GLN A 1 110 ? 121.594 0.324   -8.150  1.00 0.00 ? 110 GLN A HA   5  
ATOM 10509 H HB2  . GLN A 1 110 ? 119.846 0.201   -9.898  1.00 0.00 ? 110 GLN A HB2  5  
ATOM 10510 H HB3  . GLN A 1 110 ? 120.940 -1.168  -9.900  1.00 0.00 ? 110 GLN A HB3  5  
ATOM 10511 H HG2  . GLN A 1 110 ? 119.340 -2.598  -9.062  1.00 0.00 ? 110 GLN A HG2  5  
ATOM 10512 H HG3  . GLN A 1 110 ? 118.294 -1.301  -8.511  1.00 0.00 ? 110 GLN A HG3  5  
ATOM 10513 H HE21 . GLN A 1 110 ? 116.523 -2.004  -9.670  1.00 0.00 ? 110 GLN A HE21 5  
ATOM 10514 H HE22 . GLN A 1 110 ? 116.408 -1.949  -11.371 1.00 0.00 ? 110 GLN A HE22 5  
ATOM 10515 N N    . LEU A 1 111 ? 118.925 0.094   -6.351  1.00 0.00 ? 111 LEU A N    5  
ATOM 10516 C CA   . LEU A 1 111 ? 118.026 0.883   -5.511  1.00 0.00 ? 111 LEU A CA   5  
ATOM 10517 C C    . LEU A 1 111 ? 118.813 1.927   -4.768  1.00 0.00 ? 111 LEU A C    5  
ATOM 10518 O O    . LEU A 1 111 ? 118.466 3.091   -4.781  1.00 0.00 ? 111 LEU A O    5  
ATOM 10519 C CB   . LEU A 1 111 ? 117.278 0.021   -4.485  1.00 0.00 ? 111 LEU A CB   5  
ATOM 10520 C CG   . LEU A 1 111 ? 116.269 -0.978  -5.019  1.00 0.00 ? 111 LEU A CG   5  
ATOM 10521 C CD1  . LEU A 1 111 ? 115.660 -1.759  -3.867  1.00 0.00 ? 111 LEU A CD1  5  
ATOM 10522 C CD2  . LEU A 1 111 ? 115.191 -0.267  -5.816  1.00 0.00 ? 111 LEU A CD2  5  
ATOM 10523 H H    . LEU A 1 111 ? 118.937 -0.884  -6.264  1.00 0.00 ? 111 LEU A H    5  
ATOM 10524 H HA   . LEU A 1 111 ? 117.308 1.372   -6.152  1.00 0.00 ? 111 LEU A HA   5  
ATOM 10525 H HB2  . LEU A 1 111 ? 118.014 -0.528  -3.918  1.00 0.00 ? 111 LEU A HB2  5  
ATOM 10526 H HB3  . LEU A 1 111 ? 116.765 0.687   -3.807  1.00 0.00 ? 111 LEU A HB3  5  
ATOM 10527 H HG   . LEU A 1 111 ? 116.772 -1.678  -5.669  1.00 0.00 ? 111 LEU A HG   5  
ATOM 10528 H HD11 . LEU A 1 111 ? 114.970 -2.496  -4.251  1.00 0.00 ? 111 LEU A HD11 5  
ATOM 10529 H HD12 . LEU A 1 111 ? 115.129 -1.077  -3.219  1.00 0.00 ? 111 LEU A HD12 5  
ATOM 10530 H HD13 . LEU A 1 111 ? 116.444 -2.248  -3.307  1.00 0.00 ? 111 LEU A HD13 5  
ATOM 10531 H HD21 . LEU A 1 111 ? 115.644 0.253   -6.648  1.00 0.00 ? 111 LEU A HD21 5  
ATOM 10532 H HD22 . LEU A 1 111 ? 114.685 0.445   -5.181  1.00 0.00 ? 111 LEU A HD22 5  
ATOM 10533 H HD23 . LEU A 1 111 ? 114.480 -0.989  -6.186  1.00 0.00 ? 111 LEU A HD23 5  
ATOM 10534 N N    . MET A 1 112 ? 119.888 1.504   -4.153  1.00 0.00 ? 112 MET A N    5  
ATOM 10535 C CA   . MET A 1 112 ? 120.726 2.407   -3.402  1.00 0.00 ? 112 MET A CA   5  
ATOM 10536 C C    . MET A 1 112 ? 121.549 3.299   -4.314  1.00 0.00 ? 112 MET A C    5  
ATOM 10537 O O    . MET A 1 112 ? 121.873 4.402   -3.945  1.00 0.00 ? 112 MET A O    5  
ATOM 10538 C CB   . MET A 1 112 ? 121.640 1.656   -2.442  1.00 0.00 ? 112 MET A CB   5  
ATOM 10539 C CG   . MET A 1 112 ? 120.923 0.961   -1.306  1.00 0.00 ? 112 MET A CG   5  
ATOM 10540 S SD   . MET A 1 112 ? 122.049 0.038   -0.245  1.00 0.00 ? 112 MET A SD   5  
ATOM 10541 C CE   . MET A 1 112 ? 122.656 -1.184  -1.396  1.00 0.00 ? 112 MET A CE   5  
ATOM 10542 H H    . MET A 1 112 ? 120.116 0.548   -4.202  1.00 0.00 ? 112 MET A H    5  
ATOM 10543 H HA   . MET A 1 112 ? 120.070 3.038   -2.821  1.00 0.00 ? 112 MET A HA   5  
ATOM 10544 H HB2  . MET A 1 112 ? 122.189 0.910   -2.997  1.00 0.00 ? 112 MET A HB2  5  
ATOM 10545 H HB3  . MET A 1 112 ? 122.343 2.360   -2.020  1.00 0.00 ? 112 MET A HB3  5  
ATOM 10546 H HG2  . MET A 1 112 ? 120.414 1.703   -0.708  1.00 0.00 ? 112 MET A HG2  5  
ATOM 10547 H HG3  . MET A 1 112 ? 120.197 0.276   -1.721  1.00 0.00 ? 112 MET A HG3  5  
ATOM 10548 H HE1  . MET A 1 112 ? 121.821 -1.778  -1.743  1.00 0.00 ? 112 MET A HE1  5  
ATOM 10549 H HE2  . MET A 1 112 ? 123.374 -1.821  -0.903  1.00 0.00 ? 112 MET A HE2  5  
ATOM 10550 H HE3  . MET A 1 112 ? 123.120 -0.692  -2.239  1.00 0.00 ? 112 MET A HE3  5  
ATOM 10551 N N    . GLU A 1 113 ? 121.863 2.827   -5.504  1.00 0.00 ? 113 GLU A N    5  
ATOM 10552 C CA   . GLU A 1 113 ? 122.684 3.583   -6.444  1.00 0.00 ? 113 GLU A CA   5  
ATOM 10553 C C    . GLU A 1 113 ? 122.013 4.921   -6.838  1.00 0.00 ? 113 GLU A C    5  
ATOM 10554 O O    . GLU A 1 113 ? 122.420 5.990   -6.374  1.00 0.00 ? 113 GLU A O    5  
ATOM 10555 C CB   . GLU A 1 113 ? 123.020 2.740   -7.689  1.00 0.00 ? 113 GLU A CB   5  
ATOM 10556 C CG   . GLU A 1 113 ? 124.013 3.401   -8.634  1.00 0.00 ? 113 GLU A CG   5  
ATOM 10557 C CD   . GLU A 1 113 ? 124.307 2.576   -9.865  1.00 0.00 ? 113 GLU A CD   5  
ATOM 10558 O OE1  . GLU A 1 113 ? 123.597 2.738   -10.882 1.00 0.00 ? 113 GLU A OE1  5  
ATOM 10559 O OE2  . GLU A 1 113 ? 125.268 1.772   -9.856  1.00 0.00 ? 113 GLU A OE2  5  
ATOM 10560 H H    . GLU A 1 113 ? 121.547 1.931   -5.753  1.00 0.00 ? 113 GLU A H    5  
ATOM 10561 H HA   . GLU A 1 113 ? 123.603 3.820   -5.928  1.00 0.00 ? 113 GLU A HA   5  
ATOM 10562 H HB2  . GLU A 1 113 ? 123.439 1.797   -7.369  1.00 0.00 ? 113 GLU A HB2  5  
ATOM 10563 H HB3  . GLU A 1 113 ? 122.108 2.548   -8.236  1.00 0.00 ? 113 GLU A HB3  5  
ATOM 10564 H HG2  . GLU A 1 113 ? 123.610 4.351   -8.947  1.00 0.00 ? 113 GLU A HG2  5  
ATOM 10565 H HG3  . GLU A 1 113 ? 124.936 3.567   -8.097  1.00 0.00 ? 113 GLU A HG3  5  
ATOM 10566 N N    . GLN A 1 114 ? 120.927 4.847   -7.574  1.00 0.00 ? 114 GLN A N    5  
ATOM 10567 C CA   . GLN A 1 114 ? 120.228 6.047   -8.109  1.00 0.00 ? 114 GLN A CA   5  
ATOM 10568 C C    . GLN A 1 114 ? 119.421 6.790   -7.023  1.00 0.00 ? 114 GLN A C    5  
ATOM 10569 O O    . GLN A 1 114 ? 118.531 7.595   -7.327  1.00 0.00 ? 114 GLN A O    5  
ATOM 10570 C CB   . GLN A 1 114 ? 119.284 5.611   -9.221  1.00 0.00 ? 114 GLN A CB   5  
ATOM 10571 C CG   . GLN A 1 114 ? 118.233 4.616   -8.747  1.00 0.00 ? 114 GLN A CG   5  
ATOM 10572 C CD   . GLN A 1 114 ? 117.309 4.135   -9.837  1.00 0.00 ? 114 GLN A CD   5  
ATOM 10573 O OE1  . GLN A 1 114 ? 116.824 3.009   -9.784  1.00 0.00 ? 114 GLN A OE1  5  
ATOM 10574 N NE2  . GLN A 1 114 ? 117.025 4.969   -10.800 1.00 0.00 ? 114 GLN A NE2  5  
ATOM 10575 H H    . GLN A 1 114 ? 120.560 3.958   -7.780  1.00 0.00 ? 114 GLN A H    5  
ATOM 10576 H HA   . GLN A 1 114 ? 120.961 6.726   -8.520  1.00 0.00 ? 114 GLN A HA   5  
ATOM 10577 H HB2  . GLN A 1 114 ? 118.779 6.480   -9.615  1.00 0.00 ? 114 GLN A HB2  5  
ATOM 10578 H HB3  . GLN A 1 114 ? 119.859 5.146   -10.009 1.00 0.00 ? 114 GLN A HB3  5  
ATOM 10579 H HG2  . GLN A 1 114 ? 118.737 3.758   -8.329  1.00 0.00 ? 114 GLN A HG2  5  
ATOM 10580 H HG3  . GLN A 1 114 ? 117.643 5.086   -7.974  1.00 0.00 ? 114 GLN A HG3  5  
ATOM 10581 H HE21 . GLN A 1 114 ? 117.415 5.872   -10.780 1.00 0.00 ? 114 GLN A HE21 5  
ATOM 10582 H HE22 . GLN A 1 114 ? 116.427 4.682   -11.523 1.00 0.00 ? 114 GLN A HE22 5  
ATOM 10583 N N    . ASP A 1 115 ? 119.759 6.560   -5.800  1.00 0.00 ? 115 ASP A N    5  
ATOM 10584 C CA   . ASP A 1 115 ? 119.027 7.100   -4.687  1.00 0.00 ? 115 ASP A CA   5  
ATOM 10585 C C    . ASP A 1 115 ? 119.987 7.567   -3.593  1.00 0.00 ? 115 ASP A C    5  
ATOM 10586 O O    . ASP A 1 115 ? 120.149 8.756   -3.357  1.00 0.00 ? 115 ASP A O    5  
ATOM 10587 C CB   . ASP A 1 115 ? 118.091 6.004   -4.174  1.00 0.00 ? 115 ASP A CB   5  
ATOM 10588 C CG   . ASP A 1 115 ? 117.261 6.368   -2.983  1.00 0.00 ? 115 ASP A CG   5  
ATOM 10589 O OD1  . ASP A 1 115 ? 117.714 6.136   -1.845  1.00 0.00 ? 115 ASP A OD1  5  
ATOM 10590 O OD2  . ASP A 1 115 ? 116.111 6.819   -3.158  1.00 0.00 ? 115 ASP A OD2  5  
ATOM 10591 H H    . ASP A 1 115 ? 120.564 6.017   -5.653  1.00 0.00 ? 115 ASP A H    5  
ATOM 10592 H HA   . ASP A 1 115 ? 118.428 7.930   -5.031  1.00 0.00 ? 115 ASP A HA   5  
ATOM 10593 H HB2  . ASP A 1 115 ? 117.412 5.731   -4.967  1.00 0.00 ? 115 ASP A HB2  5  
ATOM 10594 H HB3  . ASP A 1 115 ? 118.688 5.139   -3.924  1.00 0.00 ? 115 ASP A HB3  5  
ATOM 10595 N N    . SER A 1 116 ? 120.682 6.634   -3.005  1.00 0.00 ? 116 SER A N    5  
ATOM 10596 C CA   . SER A 1 116 ? 121.553 6.913   -1.895  1.00 0.00 ? 116 SER A CA   5  
ATOM 10597 C C    . SER A 1 116 ? 123.038 7.118   -2.324  1.00 0.00 ? 116 SER A C    5  
ATOM 10598 O O    . SER A 1 116 ? 123.781 7.769   -1.625  1.00 0.00 ? 116 SER A O    5  
ATOM 10599 C CB   . SER A 1 116 ? 121.436 5.774   -0.879  1.00 0.00 ? 116 SER A CB   5  
ATOM 10600 O OG   . SER A 1 116 ? 120.076 5.542   -0.507  1.00 0.00 ? 116 SER A OG   5  
ATOM 10601 H H    . SER A 1 116 ? 120.626 5.703   -3.311  1.00 0.00 ? 116 SER A H    5  
ATOM 10602 H HA   . SER A 1 116 ? 121.203 7.817   -1.421  1.00 0.00 ? 116 SER A HA   5  
ATOM 10603 H HB2  . SER A 1 116 ? 121.826 4.870   -1.322  1.00 0.00 ? 116 SER A HB2  5  
ATOM 10604 H HB3  . SER A 1 116 ? 122.004 6.021   0.006   1.00 0.00 ? 116 SER A HB3  5  
ATOM 10605 H HG   . SER A 1 116 ? 119.461 6.014   -1.088  1.00 0.00 ? 116 SER A HG   5  
ATOM 10606 N N    . TYR A 1 117 ? 123.448 6.588   -3.481  1.00 0.00 ? 117 TYR A N    5  
ATOM 10607 C CA   . TYR A 1 117 ? 124.856 6.683   -3.938  1.00 0.00 ? 117 TYR A CA   5  
ATOM 10608 C C    . TYR A 1 117 ? 125.272 8.114   -4.231  1.00 0.00 ? 117 TYR A C    5  
ATOM 10609 O O    . TYR A 1 117 ? 126.254 8.598   -3.687  1.00 0.00 ? 117 TYR A O    5  
ATOM 10610 C CB   . TYR A 1 117 ? 125.071 5.759   -5.136  1.00 0.00 ? 117 TYR A CB   5  
ATOM 10611 C CG   . TYR A 1 117 ? 126.350 5.922   -5.934  1.00 0.00 ? 117 TYR A CG   5  
ATOM 10612 C CD1  . TYR A 1 117 ? 127.613 5.866   -5.348  1.00 0.00 ? 117 TYR A CD1  5  
ATOM 10613 C CD2  . TYR A 1 117 ? 126.274 6.118   -7.301  1.00 0.00 ? 117 TYR A CD2  5  
ATOM 10614 C CE1  . TYR A 1 117 ? 128.755 6.007   -6.123  1.00 0.00 ? 117 TYR A CE1  5  
ATOM 10615 C CE2  . TYR A 1 117 ? 127.396 6.257   -8.070  1.00 0.00 ? 117 TYR A CE2  5  
ATOM 10616 C CZ   . TYR A 1 117 ? 128.629 6.202   -7.487  1.00 0.00 ? 117 TYR A CZ   5  
ATOM 10617 O OH   . TYR A 1 117 ? 129.740 6.353   -8.271  1.00 0.00 ? 117 TYR A OH   5  
ATOM 10618 H H    . TYR A 1 117 ? 122.808 6.102   -4.050  1.00 0.00 ? 117 TYR A H    5  
ATOM 10619 H HA   . TYR A 1 117 ? 125.467 6.329   -3.120  1.00 0.00 ? 117 TYR A HA   5  
ATOM 10620 H HB2  . TYR A 1 117 ? 125.044 4.737   -4.786  1.00 0.00 ? 117 TYR A HB2  5  
ATOM 10621 H HB3  . TYR A 1 117 ? 124.242 5.938   -5.813  1.00 0.00 ? 117 TYR A HB3  5  
ATOM 10622 H HD1  . TYR A 1 117 ? 127.695 5.711   -4.283  1.00 0.00 ? 117 TYR A HD1  5  
ATOM 10623 H HD2  . TYR A 1 117 ? 125.301 6.165   -7.768  1.00 0.00 ? 117 TYR A HD2  5  
ATOM 10624 H HE1  . TYR A 1 117 ? 129.731 5.965   -5.664  1.00 0.00 ? 117 TYR A HE1  5  
ATOM 10625 H HE2  . TYR A 1 117 ? 127.310 6.403   -9.136  1.00 0.00 ? 117 TYR A HE2  5  
ATOM 10626 H HH   . TYR A 1 117 ? 129.548 7.103   -8.849  1.00 0.00 ? 117 TYR A HH   5  
ATOM 10627 N N    . THR A 1 118 ? 124.520 8.785   -5.063  1.00 0.00 ? 118 THR A N    5  
ATOM 10628 C CA   . THR A 1 118 ? 124.789 10.181  -5.383  1.00 0.00 ? 118 THR A CA   5  
ATOM 10629 C C    . THR A 1 118 ? 124.668 11.071  -4.111  1.00 0.00 ? 118 THR A C    5  
ATOM 10630 O O    . THR A 1 118 ? 125.446 12.018  -3.895  1.00 0.00 ? 118 THR A O    5  
ATOM 10631 C CB   . THR A 1 118 ? 123.862 10.668  -6.544  1.00 0.00 ? 118 THR A CB   5  
ATOM 10632 O OG1  . THR A 1 118 ? 123.970 12.087  -6.740  1.00 0.00 ? 118 THR A OG1  5  
ATOM 10633 C CG2  . THR A 1 118 ? 122.406 10.245  -6.321  1.00 0.00 ? 118 THR A CG2  5  
ATOM 10634 H H    . THR A 1 118 ? 123.771 8.328   -5.502  1.00 0.00 ? 118 THR A H    5  
ATOM 10635 H HA   . THR A 1 118 ? 125.818 10.226  -5.713  1.00 0.00 ? 118 THR A HA   5  
ATOM 10636 H HB   . THR A 1 118 ? 124.224 10.196  -7.446  1.00 0.00 ? 118 THR A HB   5  
ATOM 10637 H HG1  . THR A 1 118 ? 123.560 12.333  -7.587  1.00 0.00 ? 118 THR A HG1  5  
ATOM 10638 H HG21 . THR A 1 118 ? 122.043 10.664  -5.394  1.00 0.00 ? 118 THR A HG21 5  
ATOM 10639 H HG22 . THR A 1 118 ? 122.371 9.164   -6.264  1.00 0.00 ? 118 THR A HG22 5  
ATOM 10640 H HG23 . THR A 1 118 ? 121.796 10.578  -7.148  1.00 0.00 ? 118 THR A HG23 5  
ATOM 10641 N N    . ARG A 1 119 ? 123.736 10.692  -3.257  1.00 0.00 ? 119 ARG A N    5  
ATOM 10642 C CA   . ARG A 1 119 ? 123.488 11.329  -1.974  1.00 0.00 ? 119 ARG A CA   5  
ATOM 10643 C C    . ARG A 1 119 ? 124.754 11.156  -1.083  1.00 0.00 ? 119 ARG A C    5  
ATOM 10644 O O    . ARG A 1 119 ? 125.263 12.111  -0.472  1.00 0.00 ? 119 ARG A O    5  
ATOM 10645 C CB   . ARG A 1 119 ? 122.246 10.629  -1.407  1.00 0.00 ? 119 ARG A CB   5  
ATOM 10646 C CG   . ARG A 1 119 ? 121.667 11.108  -0.098  1.00 0.00 ? 119 ARG A CG   5  
ATOM 10647 C CD   . ARG A 1 119 ? 120.375 10.337  0.139   1.00 0.00 ? 119 ARG A CD   5  
ATOM 10648 N NE   . ARG A 1 119 ? 119.746 10.570  1.441   1.00 0.00 ? 119 ARG A NE   5  
ATOM 10649 C CZ   . ARG A 1 119 ? 118.475 10.966  1.599   1.00 0.00 ? 119 ARG A CZ   5  
ATOM 10650 N NH1  . ARG A 1 119 ? 117.764 11.410  0.559   1.00 0.00 ? 119 ARG A NH1  5  
ATOM 10651 N NH2  . ARG A 1 119 ? 117.925 10.909  2.798   1.00 0.00 ? 119 ARG A NH2  5  
ATOM 10652 H H    . ARG A 1 119 ? 123.177 9.930   -3.507  1.00 0.00 ? 119 ARG A H    5  
ATOM 10653 H HA   . ARG A 1 119 ? 123.280 12.378  -2.130  1.00 0.00 ? 119 ARG A HA   5  
ATOM 10654 H HB2  . ARG A 1 119 ? 121.457 10.715  -2.139  1.00 0.00 ? 119 ARG A HB2  5  
ATOM 10655 H HB3  . ARG A 1 119 ? 122.485 9.580   -1.306  1.00 0.00 ? 119 ARG A HB3  5  
ATOM 10656 H HG2  . ARG A 1 119 ? 122.369 10.912  0.699   1.00 0.00 ? 119 ARG A HG2  5  
ATOM 10657 H HG3  . ARG A 1 119 ? 121.443 12.162  -0.157  1.00 0.00 ? 119 ARG A HG3  5  
ATOM 10658 H HD2  . ARG A 1 119 ? 119.668 10.618  -0.626  1.00 0.00 ? 119 ARG A HD2  5  
ATOM 10659 H HD3  . ARG A 1 119 ? 120.592 9.282   0.039   1.00 0.00 ? 119 ARG A HD3  5  
ATOM 10660 H HE   . ARG A 1 119 ? 120.276 10.303  2.230   1.00 0.00 ? 119 ARG A HE   5  
ATOM 10661 H HH11 . ARG A 1 119 ? 118.147 11.475  -0.372  1.00 0.00 ? 119 ARG A HH11 5  
ATOM 10662 H HH12 . ARG A 1 119 ? 116.792 11.671  0.642   1.00 0.00 ? 119 ARG A HH12 5  
ATOM 10663 H HH21 . ARG A 1 119 ? 118.461 10.560  3.572   1.00 0.00 ? 119 ARG A HH21 5  
ATOM 10664 H HH22 . ARG A 1 119 ? 116.972 11.186  2.985   1.00 0.00 ? 119 ARG A HH22 5  
ATOM 10665 N N    . PHE A 1 120 ? 125.282 9.943   -1.082  1.00 0.00 ? 120 PHE A N    5  
ATOM 10666 C CA   . PHE A 1 120 ? 126.531 9.614   -0.418  1.00 0.00 ? 120 PHE A CA   5  
ATOM 10667 C C    . PHE A 1 120 ? 127.670 10.435  -0.987  1.00 0.00 ? 120 PHE A C    5  
ATOM 10668 O O    . PHE A 1 120 ? 128.452 10.983  -0.244  1.00 0.00 ? 120 PHE A O    5  
ATOM 10669 C CB   . PHE A 1 120 ? 126.827 8.106   -0.540  1.00 0.00 ? 120 PHE A CB   5  
ATOM 10670 C CG   . PHE A 1 120 ? 128.244 7.685   -0.202  1.00 0.00 ? 120 PHE A CG   5  
ATOM 10671 C CD1  . PHE A 1 120 ? 128.676 7.553   1.111   1.00 0.00 ? 120 PHE A CD1  5  
ATOM 10672 C CD2  . PHE A 1 120 ? 129.138 7.406   -1.223  1.00 0.00 ? 120 PHE A CD2  5  
ATOM 10673 C CE1  . PHE A 1 120 ? 129.978 7.153   1.386   1.00 0.00 ? 120 PHE A CE1  5  
ATOM 10674 C CE2  . PHE A 1 120 ? 130.425 7.014   -0.950  1.00 0.00 ? 120 PHE A CE2  5  
ATOM 10675 C CZ   . PHE A 1 120 ? 130.845 6.886   0.353   1.00 0.00 ? 120 PHE A CZ   5  
ATOM 10676 H H    . PHE A 1 120 ? 124.801 9.214   -1.535  1.00 0.00 ? 120 PHE A H    5  
ATOM 10677 H HA   . PHE A 1 120 ? 126.421 9.861   0.628   1.00 0.00 ? 120 PHE A HA   5  
ATOM 10678 H HB2  . PHE A 1 120 ? 126.168 7.569   0.126   1.00 0.00 ? 120 PHE A HB2  5  
ATOM 10679 H HB3  . PHE A 1 120 ? 126.621 7.797   -1.554  1.00 0.00 ? 120 PHE A HB3  5  
ATOM 10680 H HD1  . PHE A 1 120 ? 127.993 7.765   1.920   1.00 0.00 ? 120 PHE A HD1  5  
ATOM 10681 H HD2  . PHE A 1 120 ? 128.813 7.503   -2.248  1.00 0.00 ? 120 PHE A HD2  5  
ATOM 10682 H HE1  . PHE A 1 120 ? 130.334 7.042   2.401   1.00 0.00 ? 120 PHE A HE1  5  
ATOM 10683 H HE2  . PHE A 1 120 ? 131.108 6.804   -1.759  1.00 0.00 ? 120 PHE A HE2  5  
ATOM 10684 H HZ   . PHE A 1 120 ? 131.857 6.577   0.565   1.00 0.00 ? 120 PHE A HZ   5  
ATOM 10685 N N    . LEU A 1 121 ? 127.725 10.560  -2.299  1.00 0.00 ? 121 LEU A N    5  
ATOM 10686 C CA   . LEU A 1 121 ? 128.788 11.319  -2.951  1.00 0.00 ? 121 LEU A CA   5  
ATOM 10687 C C    . LEU A 1 121 ? 128.792 12.791  -2.537  1.00 0.00 ? 121 LEU A C    5  
ATOM 10688 O O    . LEU A 1 121 ? 129.821 13.466  -2.640  1.00 0.00 ? 121 LEU A O    5  
ATOM 10689 C CB   . LEU A 1 121 ? 128.739 11.177  -4.476  1.00 0.00 ? 121 LEU A CB   5  
ATOM 10690 C CG   . LEU A 1 121 ? 128.938 9.759   -5.024  1.00 0.00 ? 121 LEU A CG   5  
ATOM 10691 C CD1  . LEU A 1 121 ? 128.954 9.772   -6.540  1.00 0.00 ? 121 LEU A CD1  5  
ATOM 10692 C CD2  . LEU A 1 121 ? 130.217 9.140   -4.482  1.00 0.00 ? 121 LEU A CD2  5  
ATOM 10693 H H    . LEU A 1 121 ? 127.043 10.109  -2.847  1.00 0.00 ? 121 LEU A H    5  
ATOM 10694 H HA   . LEU A 1 121 ? 129.716 10.891  -2.602  1.00 0.00 ? 121 LEU A HA   5  
ATOM 10695 H HB2  . LEU A 1 121 ? 127.777 11.537  -4.811  1.00 0.00 ? 121 LEU A HB2  5  
ATOM 10696 H HB3  . LEU A 1 121 ? 129.507 11.810  -4.895  1.00 0.00 ? 121 LEU A HB3  5  
ATOM 10697 H HG   . LEU A 1 121 ? 128.104 9.148   -4.712  1.00 0.00 ? 121 LEU A HG   5  
ATOM 10698 H HD11 . LEU A 1 121 ? 128.018 10.166  -6.908  1.00 0.00 ? 121 LEU A HD11 5  
ATOM 10699 H HD12 . LEU A 1 121 ? 129.087 8.765   -6.906  1.00 0.00 ? 121 LEU A HD12 5  
ATOM 10700 H HD13 . LEU A 1 121 ? 129.768 10.393  -6.886  1.00 0.00 ? 121 LEU A HD13 5  
ATOM 10701 H HD21 . LEU A 1 121 ? 130.341 8.141   -4.875  1.00 0.00 ? 121 LEU A HD21 5  
ATOM 10702 H HD22 . LEU A 1 121 ? 130.169 9.105   -3.402  1.00 0.00 ? 121 LEU A HD22 5  
ATOM 10703 H HD23 . LEU A 1 121 ? 131.061 9.750   -4.767  1.00 0.00 ? 121 LEU A HD23 5  
ATOM 10704 N N    . LYS A 1 122 ? 127.653 13.292  -2.098  1.00 0.00 ? 122 LYS A N    5  
ATOM 10705 C CA   . LYS A 1 122 ? 127.575 14.650  -1.583  1.00 0.00 ? 122 LYS A CA   5  
ATOM 10706 C C    . LYS A 1 122 ? 127.419 14.717  -0.064  1.00 0.00 ? 122 LYS A C    5  
ATOM 10707 O O    . LYS A 1 122 ? 127.223 15.821  0.496   1.00 0.00 ? 122 LYS A O    5  
ATOM 10708 C CB   . LYS A 1 122 ? 126.509 15.498  -2.303  1.00 0.00 ? 122 LYS A CB   5  
ATOM 10709 C CG   . LYS A 1 122 ? 127.057 16.301  -3.483  1.00 0.00 ? 122 LYS A CG   5  
ATOM 10710 C CD   . LYS A 1 122 ? 127.647 15.420  -4.568  1.00 0.00 ? 122 LYS A CD   5  
ATOM 10711 C CE   . LYS A 1 122 ? 128.441 16.233  -5.580  1.00 0.00 ? 122 LYS A CE   5  
ATOM 10712 N NZ   . LYS A 1 122 ? 127.621 17.248  -6.269  1.00 0.00 ? 122 LYS A NZ   5  
ATOM 10713 H H    . LYS A 1 122 ? 126.838 12.742  -2.152  1.00 0.00 ? 122 LYS A H    5  
ATOM 10714 H HA   . LYS A 1 122 ? 128.540 15.090  -1.793  1.00 0.00 ? 122 LYS A HA   5  
ATOM 10715 H HB2  . LYS A 1 122 ? 125.730 14.844  -2.670  1.00 0.00 ? 122 LYS A HB2  5  
ATOM 10716 H HB3  . LYS A 1 122 ? 126.081 16.190  -1.592  1.00 0.00 ? 122 LYS A HB3  5  
ATOM 10717 H HG2  . LYS A 1 122 ? 126.253 16.879  -3.913  1.00 0.00 ? 122 LYS A HG2  5  
ATOM 10718 H HG3  . LYS A 1 122 ? 127.822 16.971  -3.118  1.00 0.00 ? 122 LYS A HG3  5  
ATOM 10719 H HD2  . LYS A 1 122 ? 128.303 14.693  -4.112  1.00 0.00 ? 122 LYS A HD2  5  
ATOM 10720 H HD3  . LYS A 1 122 ? 126.842 14.911  -5.078  1.00 0.00 ? 122 LYS A HD3  5  
ATOM 10721 H HE2  . LYS A 1 122 ? 129.236 16.728  -5.039  1.00 0.00 ? 122 LYS A HE2  5  
ATOM 10722 H HE3  . LYS A 1 122 ? 128.873 15.557  -6.303  1.00 0.00 ? 122 LYS A HE3  5  
ATOM 10723 H HZ1  . LYS A 1 122 ? 127.350 18.030  -5.636  1.00 0.00 ? 122 LYS A HZ1  5  
ATOM 10724 H HZ2  . LYS A 1 122 ? 126.743 16.822  -6.638  1.00 0.00 ? 122 LYS A HZ2  5  
ATOM 10725 H HZ3  . LYS A 1 122 ? 128.100 17.659  -7.099  1.00 0.00 ? 122 LYS A HZ3  5  
ATOM 10726 N N    . SER A 1 123 ? 127.497 13.576  0.622   1.00 0.00 ? 123 SER A N    5  
ATOM 10727 C CA   . SER A 1 123 ? 127.471 13.593  2.068   1.00 0.00 ? 123 SER A CA   5  
ATOM 10728 C C    . SER A 1 123 ? 128.794 14.148  2.583   1.00 0.00 ? 123 SER A C    5  
ATOM 10729 O O    . SER A 1 123 ? 129.819 14.087  1.872   1.00 0.00 ? 123 SER A O    5  
ATOM 10730 C CB   . SER A 1 123 ? 127.252 12.176  2.629   1.00 0.00 ? 123 SER A CB   5  
ATOM 10731 O OG   . SER A 1 123 ? 128.346 11.313  2.321   1.00 0.00 ? 123 SER A OG   5  
ATOM 10732 H H    . SER A 1 123 ? 127.540 12.702  0.173   1.00 0.00 ? 123 SER A H    5  
ATOM 10733 H HA   . SER A 1 123 ? 126.662 14.235  2.388   1.00 0.00 ? 123 SER A HA   5  
ATOM 10734 H HB2  . SER A 1 123 ? 127.149 12.229  3.702   1.00 0.00 ? 123 SER A HB2  5  
ATOM 10735 H HB3  . SER A 1 123 ? 126.350 11.760  2.203   1.00 0.00 ? 123 SER A HB3  5  
ATOM 10736 H HG   . SER A 1 123 ? 128.355 11.155  1.365   1.00 0.00 ? 123 SER A HG   5  
ATOM 10737 N N    . ASP A 1 124 ? 128.794 14.671  3.803   1.00 0.00 ? 124 ASP A N    5  
ATOM 10738 C CA   . ASP A 1 124 ? 130.023 15.157  4.433   1.00 0.00 ? 124 ASP A CA   5  
ATOM 10739 C C    . ASP A 1 124 ? 130.977 14.008  4.560   1.00 0.00 ? 124 ASP A C    5  
ATOM 10740 O O    . ASP A 1 124 ? 132.156 14.168  4.396   1.00 0.00 ? 124 ASP A O    5  
ATOM 10741 C CB   . ASP A 1 124 ? 129.748 15.778  5.811   1.00 0.00 ? 124 ASP A CB   5  
ATOM 10742 C CG   . ASP A 1 124 ? 131.022 16.093  6.598   1.00 0.00 ? 124 ASP A CG   5  
ATOM 10743 O OD1  . ASP A 1 124 ? 131.705 17.109  6.288   1.00 0.00 ? 124 ASP A OD1  5  
ATOM 10744 O OD2  . ASP A 1 124 ? 131.343 15.341  7.562   1.00 0.00 ? 124 ASP A OD2  5  
ATOM 10745 H H    . ASP A 1 124 ? 127.958 14.694  4.316   1.00 0.00 ? 124 ASP A H    5  
ATOM 10746 H HA   . ASP A 1 124 ? 130.463 15.897  3.779   1.00 0.00 ? 124 ASP A HA   5  
ATOM 10747 H HB2  . ASP A 1 124 ? 129.198 16.697  5.679   1.00 0.00 ? 124 ASP A HB2  5  
ATOM 10748 H HB3  . ASP A 1 124 ? 129.150 15.090  6.392   1.00 0.00 ? 124 ASP A HB3  5  
ATOM 10749 N N    . ILE A 1 125 ? 130.408 12.843  4.802   1.00 0.00 ? 125 ILE A N    5  
ATOM 10750 C CA   . ILE A 1 125 ? 131.105 11.576  4.859   1.00 0.00 ? 125 ILE A CA   5  
ATOM 10751 C C    . ILE A 1 125 ? 132.018 11.347  3.628   1.00 0.00 ? 125 ILE A C    5  
ATOM 10752 O O    . ILE A 1 125 ? 133.247 11.230  3.777   1.00 0.00 ? 125 ILE A O    5  
ATOM 10753 C CB   . ILE A 1 125 ? 130.067 10.419  5.056   1.00 0.00 ? 125 ILE A CB   5  
ATOM 10754 C CG1  . ILE A 1 125 ? 129.714 10.266  6.550   1.00 0.00 ? 125 ILE A CG1  5  
ATOM 10755 C CG2  . ILE A 1 125 ? 130.469 9.100   4.392   1.00 0.00 ? 125 ILE A CG2  5  
ATOM 10756 C CD1  . ILE A 1 125 ? 128.654 9.226   6.849   1.00 0.00 ? 125 ILE A CD1  5  
ATOM 10757 H H    . ILE A 1 125 ? 129.437 12.848  4.964   1.00 0.00 ? 125 ILE A H    5  
ATOM 10758 H HA   . ILE A 1 125 ? 131.735 11.607  5.736   1.00 0.00 ? 125 ILE A HA   5  
ATOM 10759 H HB   . ILE A 1 125 ? 129.172 10.740  4.544   1.00 0.00 ? 125 ILE A HB   5  
ATOM 10760 H HG12 . ILE A 1 125 ? 130.604 9.982   7.092   1.00 0.00 ? 125 ILE A HG12 5  
ATOM 10761 H HG13 . ILE A 1 125 ? 129.366 11.217  6.925   1.00 0.00 ? 125 ILE A HG13 5  
ATOM 10762 H HG21 . ILE A 1 125 ? 129.741 8.336   4.623   1.00 0.00 ? 125 ILE A HG21 5  
ATOM 10763 H HG22 . ILE A 1 125 ? 131.460 8.792   4.689   1.00 0.00 ? 125 ILE A HG22 5  
ATOM 10764 H HG23 . ILE A 1 125 ? 130.440 9.292   3.326   1.00 0.00 ? 125 ILE A HG23 5  
ATOM 10765 H HD11 . ILE A 1 125 ? 128.479 9.188   7.913   1.00 0.00 ? 125 ILE A HD11 5  
ATOM 10766 H HD12 . ILE A 1 125 ? 128.990 8.259   6.504   1.00 0.00 ? 125 ILE A HD12 5  
ATOM 10767 H HD13 . ILE A 1 125 ? 127.737 9.491   6.343   1.00 0.00 ? 125 ILE A HD13 5  
ATOM 10768 N N    . TYR A 1 126 ? 131.454 11.335  2.431   1.00 0.00 ? 126 TYR A N    5  
ATOM 10769 C CA   . TYR A 1 126 ? 132.269 11.094  1.248   1.00 0.00 ? 126 TYR A CA   5  
ATOM 10770 C C    . TYR A 1 126 ? 133.132 12.299  0.923   1.00 0.00 ? 126 TYR A C    5  
ATOM 10771 O O    . TYR A 1 126 ? 134.282 12.155  0.511   1.00 0.00 ? 126 TYR A O    5  
ATOM 10772 C CB   . TYR A 1 126 ? 131.430 10.667  0.043   1.00 0.00 ? 126 TYR A CB   5  
ATOM 10773 C CG   . TYR A 1 126 ? 132.241 10.399  -1.212  1.00 0.00 ? 126 TYR A CG   5  
ATOM 10774 C CD1  . TYR A 1 126 ? 133.043 9.273   -1.320  1.00 0.00 ? 126 TYR A CD1  5  
ATOM 10775 C CD2  . TYR A 1 126 ? 132.217 11.284  -2.274  1.00 0.00 ? 126 TYR A CD2  5  
ATOM 10776 C CE1  . TYR A 1 126 ? 133.790 9.035   -2.452  1.00 0.00 ? 126 TYR A CE1  5  
ATOM 10777 C CE2  . TYR A 1 126 ? 132.959 11.059  -3.404  1.00 0.00 ? 126 TYR A CE2  5  
ATOM 10778 C CZ   . TYR A 1 126 ? 133.740 9.933   -3.494  1.00 0.00 ? 126 TYR A CZ   5  
ATOM 10779 O OH   . TYR A 1 126 ? 134.492 9.716   -4.624  1.00 0.00 ? 126 TYR A OH   5  
ATOM 10780 H H    . TYR A 1 126 ? 130.483 11.473  2.362   1.00 0.00 ? 126 TYR A H    5  
ATOM 10781 H HA   . TYR A 1 126 ? 132.937 10.286  1.508   1.00 0.00 ? 126 TYR A HA   5  
ATOM 10782 H HB2  . TYR A 1 126 ? 130.899 9.760   0.290   1.00 0.00 ? 126 TYR A HB2  5  
ATOM 10783 H HB3  . TYR A 1 126 ? 130.714 11.443  -0.181  1.00 0.00 ? 126 TYR A HB3  5  
ATOM 10784 H HD1  . TYR A 1 126 ? 133.074 8.572   -0.498  1.00 0.00 ? 126 TYR A HD1  5  
ATOM 10785 H HD2  . TYR A 1 126 ? 131.594 12.163  -2.212  1.00 0.00 ? 126 TYR A HD2  5  
ATOM 10786 H HE1  . TYR A 1 126 ? 134.406 8.148   -2.518  1.00 0.00 ? 126 TYR A HE1  5  
ATOM 10787 H HE2  . TYR A 1 126 ? 132.927 11.772  -4.215  1.00 0.00 ? 126 TYR A HE2  5  
ATOM 10788 H HH   . TYR A 1 126 ? 134.618 8.762   -4.697  1.00 0.00 ? 126 TYR A HH   5  
ATOM 10789 N N    . LEU A 1 127 ? 132.605 13.483  1.152   1.00 0.00 ? 127 LEU A N    5  
ATOM 10790 C CA   . LEU A 1 127 ? 133.356 14.701  0.891   1.00 0.00 ? 127 LEU A CA   5  
ATOM 10791 C C    . LEU A 1 127 ? 134.541 14.841  1.861   1.00 0.00 ? 127 LEU A C    5  
ATOM 10792 O O    . LEU A 1 127 ? 135.535 15.501  1.563   1.00 0.00 ? 127 LEU A O    5  
ATOM 10793 C CB   . LEU A 1 127 ? 132.436 15.934  0.916   1.00 0.00 ? 127 LEU A CB   5  
ATOM 10794 C CG   . LEU A 1 127 ? 131.357 15.978  -0.175  1.00 0.00 ? 127 LEU A CG   5  
ATOM 10795 C CD1  . LEU A 1 127 ? 130.487 17.212  -0.025  1.00 0.00 ? 127 LEU A CD1  5  
ATOM 10796 C CD2  . LEU A 1 127 ? 131.984 15.936  -1.561  1.00 0.00 ? 127 LEU A CD2  5  
ATOM 10797 H H    . LEU A 1 127 ? 131.684 13.545  1.496   1.00 0.00 ? 127 LEU A H    5  
ATOM 10798 H HA   . LEU A 1 127 ? 133.769 14.595  -0.102  1.00 0.00 ? 127 LEU A HA   5  
ATOM 10799 H HB2  . LEU A 1 127 ? 131.916 15.947  1.862   1.00 0.00 ? 127 LEU A HB2  5  
ATOM 10800 H HB3  . LEU A 1 127 ? 133.033 16.829  0.836   1.00 0.00 ? 127 LEU A HB3  5  
ATOM 10801 H HG   . LEU A 1 127 ? 130.720 15.111  -0.065  1.00 0.00 ? 127 LEU A HG   5  
ATOM 10802 H HD11 . LEU A 1 127 ? 131.093 18.099  -0.135  1.00 0.00 ? 127 LEU A HD11 5  
ATOM 10803 H HD12 . LEU A 1 127 ? 130.023 17.209  0.951   1.00 0.00 ? 127 LEU A HD12 5  
ATOM 10804 H HD13 . LEU A 1 127 ? 129.722 17.198  -0.788  1.00 0.00 ? 127 LEU A HD13 5  
ATOM 10805 H HD21 . LEU A 1 127 ? 132.623 16.796  -1.695  1.00 0.00 ? 127 LEU A HD21 5  
ATOM 10806 H HD22 . LEU A 1 127 ? 131.201 15.944  -2.305  1.00 0.00 ? 127 LEU A HD22 5  
ATOM 10807 H HD23 . LEU A 1 127 ? 132.567 15.033  -1.663  1.00 0.00 ? 127 LEU A HD23 5  
ATOM 10808 N N    . ASP A 1 128 ? 134.446 14.177  2.994   1.00 0.00 ? 128 ASP A N    5  
ATOM 10809 C CA   . ASP A 1 128 ? 135.509 14.171  3.989   1.00 0.00 ? 128 ASP A CA   5  
ATOM 10810 C C    . ASP A 1 128 ? 136.591 13.200  3.560   1.00 0.00 ? 128 ASP A C    5  
ATOM 10811 O O    . ASP A 1 128 ? 137.775 13.419  3.820   1.00 0.00 ? 128 ASP A O    5  
ATOM 10812 C CB   . ASP A 1 128 ? 134.958 13.805  5.368   1.00 0.00 ? 128 ASP A CB   5  
ATOM 10813 C CG   . ASP A 1 128 ? 135.948 14.004  6.474   1.00 0.00 ? 128 ASP A CG   5  
ATOM 10814 O OD1  . ASP A 1 128 ? 136.431 15.151  6.653   1.00 0.00 ? 128 ASP A OD1  5  
ATOM 10815 O OD2  . ASP A 1 128 ? 136.257 13.039  7.194   1.00 0.00 ? 128 ASP A OD2  5  
ATOM 10816 H H    . ASP A 1 128 ? 133.615 13.690  3.194   1.00 0.00 ? 128 ASP A H    5  
ATOM 10817 H HA   . ASP A 1 128 ? 135.930 15.164  4.022   1.00 0.00 ? 128 ASP A HA   5  
ATOM 10818 H HB2  . ASP A 1 128 ? 134.093 14.417  5.576   1.00 0.00 ? 128 ASP A HB2  5  
ATOM 10819 H HB3  . ASP A 1 128 ? 134.657 12.767  5.360   1.00 0.00 ? 128 ASP A HB3  5  
ATOM 10820 N N    . LEU A 1 129 ? 136.175 12.130  2.859   1.00 0.00 ? 129 LEU A N    5  
ATOM 10821 C CA   . LEU A 1 129 ? 137.135 11.182  2.269   1.00 0.00 ? 129 LEU A CA   5  
ATOM 10822 C C    . LEU A 1 129 ? 137.865 11.909  1.140   1.00 0.00 ? 129 LEU A C    5  
ATOM 10823 O O    . LEU A 1 129 ? 139.033 11.650  0.864   1.00 0.00 ? 129 LEU A O    5  
ATOM 10824 C CB   . LEU A 1 129 ? 136.433 9.936   1.666   1.00 0.00 ? 129 LEU A CB   5  
ATOM 10825 C CG   . LEU A 1 129 ? 135.396 9.213   2.544   1.00 0.00 ? 129 LEU A CG   5  
ATOM 10826 C CD1  . LEU A 1 129 ? 134.618 8.218   1.715   1.00 0.00 ? 129 LEU A CD1  5  
ATOM 10827 C CD2  . LEU A 1 129 ? 136.063 8.487   3.697   1.00 0.00 ? 129 LEU A CD2  5  
ATOM 10828 H H    . LEU A 1 129 ? 135.209 11.973  2.765   1.00 0.00 ? 129 LEU A H    5  
ATOM 10829 H HA   . LEU A 1 129 ? 137.842 10.884  3.029   1.00 0.00 ? 129 LEU A HA   5  
ATOM 10830 H HB2  . LEU A 1 129 ? 136.039 10.118  0.676   1.00 0.00 ? 129 LEU A HB2  5  
ATOM 10831 H HB3  . LEU A 1 129 ? 137.234 9.228   1.510   1.00 0.00 ? 129 LEU A HB3  5  
ATOM 10832 H HG   . LEU A 1 129 ? 134.703 9.935   2.947   1.00 0.00 ? 129 LEU A HG   5  
ATOM 10833 H HD11 . LEU A 1 129 ? 134.108 8.737   0.917   1.00 0.00 ? 129 LEU A HD11 5  
ATOM 10834 H HD12 . LEU A 1 129 ? 133.893 7.719   2.341   1.00 0.00 ? 129 LEU A HD12 5  
ATOM 10835 H HD13 . LEU A 1 129 ? 135.294 7.489   1.296   1.00 0.00 ? 129 LEU A HD13 5  
ATOM 10836 H HD21 . LEU A 1 129 ? 135.309 7.922   4.228   1.00 0.00 ? 129 LEU A HD21 5  
ATOM 10837 H HD22 . LEU A 1 129 ? 136.523 9.200   4.364   1.00 0.00 ? 129 LEU A HD22 5  
ATOM 10838 H HD23 . LEU A 1 129 ? 136.809 7.808   3.312   1.00 0.00 ? 129 LEU A HD23 5  
ATOM 10839 N N    . MET A 1 130 ? 137.136 12.828  0.496   1.00 0.00 ? 130 MET A N    5  
ATOM 10840 C CA   . MET A 1 130 ? 137.662 13.639  -0.603  1.00 0.00 ? 130 MET A CA   5  
ATOM 10841 C C    . MET A 1 130 ? 138.758 14.563  -0.139  1.00 0.00 ? 130 MET A C    5  
ATOM 10842 O O    . MET A 1 130 ? 139.832 14.606  -0.762  1.00 0.00 ? 130 MET A O    5  
ATOM 10843 C CB   . MET A 1 130 ? 136.556 14.464  -1.302  1.00 0.00 ? 130 MET A CB   5  
ATOM 10844 C CG   . MET A 1 130 ? 135.460 13.683  -2.057  1.00 0.00 ? 130 MET A CG   5  
ATOM 10845 S SD   . MET A 1 130 ? 136.069 12.694  -3.440  1.00 0.00 ? 130 MET A SD   5  
ATOM 10846 C CE   . MET A 1 130 ? 136.886 11.340  -2.599  1.00 0.00 ? 130 MET A CE   5  
ATOM 10847 H H    . MET A 1 130 ? 136.202 12.927  0.779   1.00 0.00 ? 130 MET A H    5  
ATOM 10848 H HA   . MET A 1 130 ? 138.082 12.957  -1.327  1.00 0.00 ? 130 MET A HA   5  
ATOM 10849 H HB2  . MET A 1 130 ? 136.061 15.065  -0.555  1.00 0.00 ? 130 MET A HB2  5  
ATOM 10850 H HB3  . MET A 1 130 ? 137.036 15.129  -2.005  1.00 0.00 ? 130 MET A HB3  5  
ATOM 10851 H HG2  . MET A 1 130 ? 134.943 13.014  -1.384  1.00 0.00 ? 130 MET A HG2  5  
ATOM 10852 H HG3  . MET A 1 130 ? 134.749 14.399  -2.443  1.00 0.00 ? 130 MET A HG3  5  
ATOM 10853 H HE1  . MET A 1 130 ? 136.164 10.748  -2.058  1.00 0.00 ? 130 MET A HE1  5  
ATOM 10854 H HE2  . MET A 1 130 ? 137.608 11.749  -1.906  1.00 0.00 ? 130 MET A HE2  5  
ATOM 10855 H HE3  . MET A 1 130 ? 137.408 10.726  -3.322  1.00 0.00 ? 130 MET A HE3  5  
ATOM 10856 N N    . GLU A 1 131 ? 138.475 15.299  0.954   1.00 0.00 ? 131 GLU A N    5  
ATOM 10857 C CA   . GLU A 1 131 ? 139.384 16.293  1.560   1.00 0.00 ? 131 GLU A CA   5  
ATOM 10858 C C    . GLU A 1 131 ? 140.087 17.178  0.524   1.00 0.00 ? 131 GLU A C    5  
ATOM 10859 O O    . GLU A 1 131 ? 141.319 17.155  0.383   1.00 0.00 ? 131 GLU A O    5  
ATOM 10860 C CB   . GLU A 1 131 ? 140.378 15.685  2.588   1.00 0.00 ? 131 GLU A CB   5  
ATOM 10861 C CG   . GLU A 1 131 ? 141.246 14.547  2.063   1.00 0.00 ? 131 GLU A CG   5  
ATOM 10862 C CD   . GLU A 1 131 ? 142.325 14.152  3.018   1.00 0.00 ? 131 GLU A CD   5  
ATOM 10863 O OE1  . GLU A 1 131 ? 142.044 13.404  3.984   1.00 0.00 ? 131 GLU A OE1  5  
ATOM 10864 O OE2  . GLU A 1 131 ? 143.487 14.584  2.827   1.00 0.00 ? 131 GLU A OE2  5  
ATOM 10865 H H    . GLU A 1 131 ? 137.599 15.171  1.378   1.00 0.00 ? 131 GLU A H    5  
ATOM 10866 H HA   . GLU A 1 131 ? 138.720 16.962  2.090   1.00 0.00 ? 131 GLU A HA   5  
ATOM 10867 H HB2  . GLU A 1 131 ? 141.037 16.467  2.935   1.00 0.00 ? 131 GLU A HB2  5  
ATOM 10868 H HB3  . GLU A 1 131 ? 139.811 15.317  3.431   1.00 0.00 ? 131 GLU A HB3  5  
ATOM 10869 H HG2  . GLU A 1 131 ? 140.618 13.687  1.884   1.00 0.00 ? 131 GLU A HG2  5  
ATOM 10870 H HG3  . GLU A 1 131 ? 141.698 14.857  1.132   1.00 0.00 ? 131 GLU A HG3  5  
ATOM 10871 N N    . GLY A 1 132 ? 139.299 17.912  -0.225  1.00 0.00 ? 132 GLY A N    5  
ATOM 10872 C CA   . GLY A 1 132 ? 139.840 18.756  -1.249  1.00 0.00 ? 132 GLY A CA   5  
ATOM 10873 C C    . GLY A 1 132 ? 140.420 20.011  -0.668  1.00 0.00 ? 132 GLY A C    5  
ATOM 10874 O O    . GLY A 1 132 ? 141.611 20.302  -0.842  1.00 0.00 ? 132 GLY A O    5  
ATOM 10875 H H    . GLY A 1 132 ? 138.329 17.893  -0.076  1.00 0.00 ? 132 GLY A H    5  
ATOM 10876 H HA2  . GLY A 1 132 ? 140.614 18.217  -1.775  1.00 0.00 ? 132 GLY A HA2  5  
ATOM 10877 H HA3  . GLY A 1 132 ? 139.055 19.020  -1.942  1.00 0.00 ? 132 GLY A HA3  5  
ATOM 10878 N N    . ARG A 1 133 ? 139.601 20.737  0.042   1.00 0.00 ? 133 ARG A N    5  
ATOM 10879 C CA   . ARG A 1 133 ? 140.007 21.965  0.655   1.00 0.00 ? 133 ARG A CA   5  
ATOM 10880 C C    . ARG A 1 133 ? 139.579 22.060  2.118   1.00 0.00 ? 133 ARG A C    5  
ATOM 10881 O O    . ARG A 1 133 ? 138.439 21.760  2.464   1.00 0.00 ? 133 ARG A O    5  
ATOM 10882 C CB   . ARG A 1 133 ? 139.570 23.201  -0.196  1.00 0.00 ? 133 ARG A CB   5  
ATOM 10883 C CG   . ARG A 1 133 ? 138.131 23.213  -0.764  1.00 0.00 ? 133 ARG A CG   5  
ATOM 10884 C CD   . ARG A 1 133 ? 137.034 23.350  0.287   1.00 0.00 ? 133 ARG A CD   5  
ATOM 10885 N NE   . ARG A 1 133 ? 135.697 23.383  -0.331  1.00 0.00 ? 133 ARG A NE   5  
ATOM 10886 C CZ   . ARG A 1 133 ? 134.573 22.868  0.205   1.00 0.00 ? 133 ARG A CZ   5  
ATOM 10887 N NH1  . ARG A 1 133 ? 134.581 22.372  1.439   1.00 0.00 ? 133 ARG A NH1  5  
ATOM 10888 N NH2  . ARG A 1 133 ? 133.434 22.891  -0.486  1.00 0.00 ? 133 ARG A NH2  5  
ATOM 10889 H H    . ARG A 1 133 ? 138.668 20.433  0.155   1.00 0.00 ? 133 ARG A H    5  
ATOM 10890 H HA   . ARG A 1 133 ? 141.086 21.938  0.659   1.00 0.00 ? 133 ARG A HA   5  
ATOM 10891 H HB2  . ARG A 1 133 ? 139.673 24.081  0.420   1.00 0.00 ? 133 ARG A HB2  5  
ATOM 10892 H HB3  . ARG A 1 133 ? 140.258 23.293  -1.025  1.00 0.00 ? 133 ARG A HB3  5  
ATOM 10893 H HG2  . ARG A 1 133 ? 138.042 24.046  -1.445  1.00 0.00 ? 133 ARG A HG2  5  
ATOM 10894 H HG3  . ARG A 1 133 ? 137.981 22.295  -1.314  1.00 0.00 ? 133 ARG A HG3  5  
ATOM 10895 H HD2  . ARG A 1 133 ? 137.093 22.507  0.961   1.00 0.00 ? 133 ARG A HD2  5  
ATOM 10896 H HD3  . ARG A 1 133 ? 137.188 24.264  0.840   1.00 0.00 ? 133 ARG A HD3  5  
ATOM 10897 H HE   . ARG A 1 133 ? 135.674 23.809  -1.222  1.00 0.00 ? 133 ARG A HE   5  
ATOM 10898 H HH11 . ARG A 1 133 ? 135.402 22.359  2.018   1.00 0.00 ? 133 ARG A HH11 5  
ATOM 10899 H HH12 . ARG A 1 133 ? 133.762 21.982  1.878   1.00 0.00 ? 133 ARG A HH12 5  
ATOM 10900 H HH21 . ARG A 1 133 ? 133.349 23.283  -1.412  1.00 0.00 ? 133 ARG A HH21 5  
ATOM 10901 H HH22 . ARG A 1 133 ? 132.571 22.504  -0.128  1.00 0.00 ? 133 ARG A HH22 5  
ATOM 10902 N N    . PRO A 1 134 ? 140.509 22.412  3.012   1.00 0.00 ? 134 PRO A N    5  
ATOM 10903 C CA   . PRO A 1 134 ? 140.201 22.649  4.417   1.00 0.00 ? 134 PRO A CA   5  
ATOM 10904 C C    . PRO A 1 134 ? 139.870 24.126  4.667   1.00 0.00 ? 134 PRO A C    5  
ATOM 10905 O O    . PRO A 1 134 ? 139.656 24.550  5.798   1.00 0.00 ? 134 PRO A O    5  
ATOM 10906 C CB   . PRO A 1 134 ? 141.501 22.258  5.119   1.00 0.00 ? 134 PRO A CB   5  
ATOM 10907 C CG   . PRO A 1 134 ? 142.589 22.545  4.126   1.00 0.00 ? 134 PRO A CG   5  
ATOM 10908 C CD   . PRO A 1 134 ? 141.962 22.536  2.748   1.00 0.00 ? 134 PRO A CD   5  
ATOM 10909 H HA   . PRO A 1 134 ? 139.388 22.026  4.761   1.00 0.00 ? 134 PRO A HA   5  
ATOM 10910 H HB2  . PRO A 1 134 ? 141.617 22.852  6.013   1.00 0.00 ? 134 PRO A HB2  5  
ATOM 10911 H HB3  . PRO A 1 134 ? 141.474 21.211  5.378   1.00 0.00 ? 134 PRO A HB3  5  
ATOM 10912 H HG2  . PRO A 1 134 ? 143.019 23.514  4.328   1.00 0.00 ? 134 PRO A HG2  5  
ATOM 10913 H HG3  . PRO A 1 134 ? 143.348 21.780  4.194   1.00 0.00 ? 134 PRO A HG3  5  
ATOM 10914 H HD2  . PRO A 1 134 ? 142.177 23.461  2.232   1.00 0.00 ? 134 PRO A HD2  5  
ATOM 10915 H HD3  . PRO A 1 134 ? 142.321 21.694  2.175   1.00 0.00 ? 134 PRO A HD3  5  
ATOM 10916 N N    . SER A 1 1   ? 137.627 2.657   7.391   1.00 0.00 ? 1   SER A N    6  
ATOM 10917 C CA   . SER A 1 1   ? 137.565 4.116   7.422   1.00 0.00 ? 1   SER A CA   6  
ATOM 10918 C C    . SER A 1 1   ? 138.874 4.739   6.879   1.00 0.00 ? 1   SER A C    6  
ATOM 10919 O O    . SER A 1 1   ? 139.104 5.950   7.013   1.00 0.00 ? 1   SER A O    6  
ATOM 10920 C CB   . SER A 1 1   ? 137.379 4.555   8.874   1.00 0.00 ? 1   SER A CB   6  
ATOM 10921 O OG   . SER A 1 1   ? 136.350 3.809   9.532   1.00 0.00 ? 1   SER A OG   6  
ATOM 10922 H H1   . SER A 1 1   ? 136.710 2.252   7.680   1.00 0.00 ? 1   SER A H1   6  
ATOM 10923 H H2   . SER A 1 1   ? 138.341 2.331   8.078   1.00 0.00 ? 1   SER A H2   6  
ATOM 10924 H H3   . SER A 1 1   ? 137.890 2.267   6.460   1.00 0.00 ? 1   SER A H3   6  
ATOM 10925 H HA   . SER A 1 1   ? 136.720 4.456   6.842   1.00 0.00 ? 1   SER A HA   6  
ATOM 10926 H HB2  . SER A 1 1   ? 138.305 4.411   9.410   1.00 0.00 ? 1   SER A HB2  6  
ATOM 10927 H HB3  . SER A 1 1   ? 137.115 5.602   8.893   1.00 0.00 ? 1   SER A HB3  6  
ATOM 10928 H HG   . SER A 1 1   ? 135.715 3.446   8.888   1.00 0.00 ? 1   SER A HG   6  
ATOM 10929 N N    . MET A 1 2   ? 139.703 3.936   6.234   1.00 0.00 ? 2   MET A N    6  
ATOM 10930 C CA   . MET A 1 2   ? 140.990 4.393   5.773   1.00 0.00 ? 2   MET A CA   6  
ATOM 10931 C C    . MET A 1 2   ? 141.026 4.311   4.256   1.00 0.00 ? 2   MET A C    6  
ATOM 10932 O O    . MET A 1 2   ? 141.011 3.218   3.674   1.00 0.00 ? 2   MET A O    6  
ATOM 10933 C CB   . MET A 1 2   ? 142.102 3.551   6.448   1.00 0.00 ? 2   MET A CB   6  
ATOM 10934 C CG   . MET A 1 2   ? 143.548 3.979   6.178   1.00 0.00 ? 2   MET A CG   6  
ATOM 10935 S SD   . MET A 1 2   ? 144.156 3.548   4.534   1.00 0.00 ? 2   MET A SD   6  
ATOM 10936 C CE   . MET A 1 2   ? 145.811 4.228   4.619   1.00 0.00 ? 2   MET A CE   6  
ATOM 10937 H H    . MET A 1 2   ? 139.458 3.011   5.992   1.00 0.00 ? 2   MET A H    6  
ATOM 10938 H HA   . MET A 1 2   ? 141.098 5.426   6.068   1.00 0.00 ? 2   MET A HA   6  
ATOM 10939 H HB2  . MET A 1 2   ? 141.950 3.582   7.517   1.00 0.00 ? 2   MET A HB2  6  
ATOM 10940 H HB3  . MET A 1 2   ? 141.990 2.526   6.123   1.00 0.00 ? 2   MET A HB3  6  
ATOM 10941 H HG2  . MET A 1 2   ? 143.611 5.051   6.287   1.00 0.00 ? 2   MET A HG2  6  
ATOM 10942 H HG3  . MET A 1 2   ? 144.183 3.511   6.916   1.00 0.00 ? 2   MET A HG3  6  
ATOM 10943 H HE1  . MET A 1 2   ? 145.755 5.292   4.799   1.00 0.00 ? 2   MET A HE1  6  
ATOM 10944 H HE2  . MET A 1 2   ? 146.325 4.047   3.687   1.00 0.00 ? 2   MET A HE2  6  
ATOM 10945 H HE3  . MET A 1 2   ? 146.354 3.757   5.426   1.00 0.00 ? 2   MET A HE3  6  
ATOM 10946 N N    . VAL A 1 3   ? 140.999 5.455   3.623   1.00 0.00 ? 3   VAL A N    6  
ATOM 10947 C CA   . VAL A 1 3   ? 140.997 5.542   2.180   1.00 0.00 ? 3   VAL A CA   6  
ATOM 10948 C C    . VAL A 1 3   ? 141.679 6.839   1.745   1.00 0.00 ? 3   VAL A C    6  
ATOM 10949 O O    . VAL A 1 3   ? 141.543 7.867   2.408   1.00 0.00 ? 3   VAL A O    6  
ATOM 10950 C CB   . VAL A 1 3   ? 139.523 5.444   1.614   1.00 0.00 ? 3   VAL A CB   6  
ATOM 10951 C CG1  . VAL A 1 3   ? 138.629 6.479   2.241   1.00 0.00 ? 3   VAL A CG1  6  
ATOM 10952 C CG2  . VAL A 1 3   ? 139.473 5.611   0.108   1.00 0.00 ? 3   VAL A CG2  6  
ATOM 10953 H H    . VAL A 1 3   ? 140.975 6.300   4.135   1.00 0.00 ? 3   VAL A H    6  
ATOM 10954 H HA   . VAL A 1 3   ? 141.572 4.709   1.802   1.00 0.00 ? 3   VAL A HA   6  
ATOM 10955 H HB   . VAL A 1 3   ? 139.122 4.467   1.855   1.00 0.00 ? 3   VAL A HB   6  
ATOM 10956 H HG11 . VAL A 1 3   ? 138.640 6.375   3.316   1.00 0.00 ? 3   VAL A HG11 6  
ATOM 10957 H HG12 . VAL A 1 3   ? 137.626 6.331   1.867   1.00 0.00 ? 3   VAL A HG12 6  
ATOM 10958 H HG13 . VAL A 1 3   ? 138.967 7.464   1.953   1.00 0.00 ? 3   VAL A HG13 6  
ATOM 10959 H HG21 . VAL A 1 3   ? 140.191 4.954   -0.360  1.00 0.00 ? 3   VAL A HG21 6  
ATOM 10960 H HG22 . VAL A 1 3   ? 139.634 6.641   -0.183  1.00 0.00 ? 3   VAL A HG22 6  
ATOM 10961 H HG23 . VAL A 1 3   ? 138.487 5.324   -0.226  1.00 0.00 ? 3   VAL A HG23 6  
ATOM 10962 N N    . SER A 1 4   ? 142.451 6.773   0.693   1.00 0.00 ? 4   SER A N    6  
ATOM 10963 C CA   . SER A 1 4   ? 143.102 7.931   0.140   1.00 0.00 ? 4   SER A CA   6  
ATOM 10964 C C    . SER A 1 4   ? 142.154 8.556   -0.885  1.00 0.00 ? 4   SER A C    6  
ATOM 10965 O O    . SER A 1 4   ? 141.221 7.890   -1.325  1.00 0.00 ? 4   SER A O    6  
ATOM 10966 C CB   . SER A 1 4   ? 144.385 7.469   -0.551  1.00 0.00 ? 4   SER A CB   6  
ATOM 10967 O OG   . SER A 1 4   ? 144.090 6.480   -1.539  1.00 0.00 ? 4   SER A OG   6  
ATOM 10968 H H    . SER A 1 4   ? 142.603 5.925   0.227   1.00 0.00 ? 4   SER A H    6  
ATOM 10969 H HA   . SER A 1 4   ? 143.339 8.637   0.921   1.00 0.00 ? 4   SER A HA   6  
ATOM 10970 H HB2  . SER A 1 4   ? 144.860 8.314   -1.028  1.00 0.00 ? 4   SER A HB2  6  
ATOM 10971 H HB3  . SER A 1 4   ? 145.054 7.041   0.182   1.00 0.00 ? 4   SER A HB3  6  
ATOM 10972 H HG   . SER A 1 4   ? 144.923 6.096   -1.857  1.00 0.00 ? 4   SER A HG   6  
ATOM 10973 N N    . PRO A 1 5   ? 142.357 9.823   -1.297  1.00 0.00 ? 5   PRO A N    6  
ATOM 10974 C CA   . PRO A 1 5   ? 141.531 10.443  -2.338  1.00 0.00 ? 5   PRO A CA   6  
ATOM 10975 C C    . PRO A 1 5   ? 141.664 9.687   -3.668  1.00 0.00 ? 5   PRO A C    6  
ATOM 10976 O O    . PRO A 1 5   ? 140.764 9.703   -4.495  1.00 0.00 ? 5   PRO A O    6  
ATOM 10977 C CB   . PRO A 1 5   ? 142.095 11.866  -2.466  1.00 0.00 ? 5   PRO A CB   6  
ATOM 10978 C CG   . PRO A 1 5   ? 143.442 11.805  -1.841  1.00 0.00 ? 5   PRO A CG   6  
ATOM 10979 C CD   . PRO A 1 5   ? 143.357 10.762  -0.768  1.00 0.00 ? 5   PRO A CD   6  
ATOM 10980 H HA   . PRO A 1 5   ? 140.490 10.473  -2.048  1.00 0.00 ? 5   PRO A HA   6  
ATOM 10981 H HB2  . PRO A 1 5   ? 142.155 12.139  -3.510  1.00 0.00 ? 5   PRO A HB2  6  
ATOM 10982 H HB3  . PRO A 1 5   ? 141.449 12.558  -1.946  1.00 0.00 ? 5   PRO A HB3  6  
ATOM 10983 H HG2  . PRO A 1 5   ? 144.175 11.523  -2.582  1.00 0.00 ? 5   PRO A HG2  6  
ATOM 10984 H HG3  . PRO A 1 5   ? 143.690 12.765  -1.412  1.00 0.00 ? 5   PRO A HG3  6  
ATOM 10985 H HD2  . PRO A 1 5   ? 144.312 10.276  -0.636  1.00 0.00 ? 5   PRO A HD2  6  
ATOM 10986 H HD3  . PRO A 1 5   ? 143.020 11.199  0.161   1.00 0.00 ? 5   PRO A HD3  6  
ATOM 10987 N N    . GLU A 1 6   ? 142.784 8.988   -3.824  1.00 0.00 ? 6   GLU A N    6  
ATOM 10988 C CA   . GLU A 1 6   ? 143.061 8.191   -5.006  1.00 0.00 ? 6   GLU A CA   6  
ATOM 10989 C C    . GLU A 1 6   ? 142.140 6.960   -4.986  1.00 0.00 ? 6   GLU A C    6  
ATOM 10990 O O    . GLU A 1 6   ? 141.467 6.639   -5.959  1.00 0.00 ? 6   GLU A O    6  
ATOM 10991 C CB   . GLU A 1 6   ? 144.533 7.751   -4.978  1.00 0.00 ? 6   GLU A CB   6  
ATOM 10992 C CG   . GLU A 1 6   ? 145.264 7.818   -6.319  1.00 0.00 ? 6   GLU A CG   6  
ATOM 10993 C CD   . GLU A 1 6   ? 144.663 6.957   -7.394  1.00 0.00 ? 6   GLU A CD   6  
ATOM 10994 O OE1  . GLU A 1 6   ? 144.902 5.741   -7.398  1.00 0.00 ? 6   GLU A OE1  6  
ATOM 10995 O OE2  . GLU A 1 6   ? 143.972 7.480   -8.285  1.00 0.00 ? 6   GLU A OE2  6  
ATOM 10996 H H    . GLU A 1 6   ? 143.442 9.021   -3.098  1.00 0.00 ? 6   GLU A H    6  
ATOM 10997 H HA   . GLU A 1 6   ? 142.873 8.784   -5.887  1.00 0.00 ? 6   GLU A HA   6  
ATOM 10998 H HB2  . GLU A 1 6   ? 145.066 8.380   -4.280  1.00 0.00 ? 6   GLU A HB2  6  
ATOM 10999 H HB3  . GLU A 1 6   ? 144.577 6.733   -4.621  1.00 0.00 ? 6   GLU A HB3  6  
ATOM 11000 H HG2  . GLU A 1 6   ? 145.249 8.841   -6.664  1.00 0.00 ? 6   GLU A HG2  6  
ATOM 11001 H HG3  . GLU A 1 6   ? 146.290 7.516   -6.163  1.00 0.00 ? 6   GLU A HG3  6  
ATOM 11002 N N    . GLU A 1 7   ? 142.098 6.289   -3.865  1.00 0.00 ? 7   GLU A N    6  
ATOM 11003 C CA   . GLU A 1 7   ? 141.232 5.137   -3.704  1.00 0.00 ? 7   GLU A CA   6  
ATOM 11004 C C    . GLU A 1 7   ? 139.761 5.593   -3.687  1.00 0.00 ? 7   GLU A C    6  
ATOM 11005 O O    . GLU A 1 7   ? 138.891 4.929   -4.220  1.00 0.00 ? 7   GLU A O    6  
ATOM 11006 C CB   . GLU A 1 7   ? 141.625 4.386   -2.421  1.00 0.00 ? 7   GLU A CB   6  
ATOM 11007 C CG   . GLU A 1 7   ? 140.748 3.199   -2.039  1.00 0.00 ? 7   GLU A CG   6  
ATOM 11008 C CD   . GLU A 1 7   ? 140.658 2.141   -3.101  1.00 0.00 ? 7   GLU A CD   6  
ATOM 11009 O OE1  . GLU A 1 7   ? 141.701 1.690   -3.601  1.00 0.00 ? 7   GLU A OE1  6  
ATOM 11010 O OE2  . GLU A 1 7   ? 139.541 1.668   -3.387  1.00 0.00 ? 7   GLU A OE2  6  
ATOM 11011 H H    . GLU A 1 7   ? 142.660 6.564   -3.106  1.00 0.00 ? 7   GLU A H    6  
ATOM 11012 H HA   . GLU A 1 7   ? 141.396 4.498   -4.561  1.00 0.00 ? 7   GLU A HA   6  
ATOM 11013 H HB2  . GLU A 1 7   ? 142.633 4.020   -2.540  1.00 0.00 ? 7   GLU A HB2  6  
ATOM 11014 H HB3  . GLU A 1 7   ? 141.615 5.091   -1.602  1.00 0.00 ? 7   GLU A HB3  6  
ATOM 11015 H HG2  . GLU A 1 7   ? 141.153 2.745   -1.148  1.00 0.00 ? 7   GLU A HG2  6  
ATOM 11016 H HG3  . GLU A 1 7   ? 139.754 3.566   -1.826  1.00 0.00 ? 7   GLU A HG3  6  
ATOM 11017 N N    . ALA A 1 8   ? 139.511 6.753   -3.113  1.00 0.00 ? 8   ALA A N    6  
ATOM 11018 C CA   . ALA A 1 8   ? 138.172 7.293   -3.062  1.00 0.00 ? 8   ALA A CA   6  
ATOM 11019 C C    . ALA A 1 8   ? 137.647 7.664   -4.470  1.00 0.00 ? 8   ALA A C    6  
ATOM 11020 O O    . ALA A 1 8   ? 136.490 7.387   -4.773  1.00 0.00 ? 8   ALA A O    6  
ATOM 11021 C CB   . ALA A 1 8   ? 138.056 8.432   -2.037  1.00 0.00 ? 8   ALA A CB   6  
ATOM 11022 H H    . ALA A 1 8   ? 140.252 7.234   -2.681  1.00 0.00 ? 8   ALA A H    6  
ATOM 11023 H HA   . ALA A 1 8   ? 137.555 6.472   -2.725  1.00 0.00 ? 8   ALA A HA   6  
ATOM 11024 H HB1  . ALA A 1 8   ? 138.460 8.080   -1.094  1.00 0.00 ? 8   ALA A HB1  6  
ATOM 11025 H HB2  . ALA A 1 8   ? 137.018 8.703   -1.889  1.00 0.00 ? 8   ALA A HB2  6  
ATOM 11026 H HB3  . ALA A 1 8   ? 138.614 9.296   -2.367  1.00 0.00 ? 8   ALA A HB3  6  
ATOM 11027 N N    . VAL A 1 9   ? 138.496 8.269   -5.354  1.00 0.00 ? 9   VAL A N    6  
ATOM 11028 C CA   . VAL A 1 9   ? 138.063 8.508   -6.761  1.00 0.00 ? 9   VAL A CA   6  
ATOM 11029 C C    . VAL A 1 9   ? 137.730 7.191   -7.453  1.00 0.00 ? 9   VAL A C    6  
ATOM 11030 O O    . VAL A 1 9   ? 136.877 7.154   -8.335  1.00 0.00 ? 9   VAL A O    6  
ATOM 11031 C CB   . VAL A 1 9   ? 139.047 9.338   -7.673  1.00 0.00 ? 9   VAL A CB   6  
ATOM 11032 C CG1  . VAL A 1 9   ? 139.281 10.734  -7.156  1.00 0.00 ? 9   VAL A CG1  6  
ATOM 11033 C CG2  . VAL A 1 9   ? 140.361 8.624   -7.925  1.00 0.00 ? 9   VAL A CG2  6  
ATOM 11034 H H    . VAL A 1 9   ? 139.369 8.605   -5.050  1.00 0.00 ? 9   VAL A H    6  
ATOM 11035 H HA   . VAL A 1 9   ? 137.125 9.040   -6.675  1.00 0.00 ? 9   VAL A HA   6  
ATOM 11036 H HB   . VAL A 1 9   ? 138.545 9.455   -8.622  1.00 0.00 ? 9   VAL A HB   6  
ATOM 11037 H HG11 . VAL A 1 9   ? 139.963 11.254  -7.813  1.00 0.00 ? 9   VAL A HG11 6  
ATOM 11038 H HG12 . VAL A 1 9   ? 139.705 10.681  -6.164  1.00 0.00 ? 9   VAL A HG12 6  
ATOM 11039 H HG13 . VAL A 1 9   ? 138.341 11.264  -7.122  1.00 0.00 ? 9   VAL A HG13 6  
ATOM 11040 H HG21 . VAL A 1 9   ? 140.984 9.222   -8.575  1.00 0.00 ? 9   VAL A HG21 6  
ATOM 11041 H HG22 . VAL A 1 9   ? 140.156 7.669   -8.389  1.00 0.00 ? 9   VAL A HG22 6  
ATOM 11042 H HG23 . VAL A 1 9   ? 140.867 8.463   -6.985  1.00 0.00 ? 9   VAL A HG23 6  
ATOM 11043 N N    . LYS A 1 10  ? 138.405 6.109   -7.046  1.00 0.00 ? 10  LYS A N    6  
ATOM 11044 C CA   . LYS A 1 10  ? 138.063 4.777   -7.547  1.00 0.00 ? 10  LYS A CA   6  
ATOM 11045 C C    . LYS A 1 10  ? 136.617 4.436   -7.196  1.00 0.00 ? 10  LYS A C    6  
ATOM 11046 O O    . LYS A 1 10  ? 135.860 3.962   -8.030  1.00 0.00 ? 10  LYS A O    6  
ATOM 11047 C CB   . LYS A 1 10  ? 139.023 3.694   -7.016  1.00 0.00 ? 10  LYS A CB   6  
ATOM 11048 C CG   . LYS A 1 10  ? 140.249 3.422   -7.883  1.00 0.00 ? 10  LYS A CG   6  
ATOM 11049 C CD   . LYS A 1 10  ? 140.962 4.686   -8.293  1.00 0.00 ? 10  LYS A CD   6  
ATOM 11050 C CE   . LYS A 1 10  ? 142.185 4.382   -9.115  1.00 0.00 ? 10  LYS A CE   6  
ATOM 11051 N NZ   . LYS A 1 10  ? 142.735 5.605   -9.727  1.00 0.00 ? 10  LYS A NZ   6  
ATOM 11052 H H    . LYS A 1 10  ? 139.154 6.223   -6.414  1.00 0.00 ? 10  LYS A H    6  
ATOM 11053 H HA   . LYS A 1 10  ? 138.155 4.839   -8.622  1.00 0.00 ? 10  LYS A HA   6  
ATOM 11054 H HB2  . LYS A 1 10  ? 139.370 3.996   -6.038  1.00 0.00 ? 10  LYS A HB2  6  
ATOM 11055 H HB3  . LYS A 1 10  ? 138.470 2.772   -6.913  1.00 0.00 ? 10  LYS A HB3  6  
ATOM 11056 H HG2  . LYS A 1 10  ? 140.939 2.806   -7.325  1.00 0.00 ? 10  LYS A HG2  6  
ATOM 11057 H HG3  . LYS A 1 10  ? 139.931 2.892   -8.768  1.00 0.00 ? 10  LYS A HG3  6  
ATOM 11058 H HD2  . LYS A 1 10  ? 140.289 5.295   -8.878  1.00 0.00 ? 10  LYS A HD2  6  
ATOM 11059 H HD3  . LYS A 1 10  ? 141.256 5.225   -7.404  1.00 0.00 ? 10  LYS A HD3  6  
ATOM 11060 H HE2  . LYS A 1 10  ? 142.915 3.965   -8.436  1.00 0.00 ? 10  LYS A HE2  6  
ATOM 11061 H HE3  . LYS A 1 10  ? 141.933 3.664   -9.879  1.00 0.00 ? 10  LYS A HE3  6  
ATOM 11062 H HZ1  . LYS A 1 10  ? 141.979 6.090   -10.257 1.00 0.00 ? 10  LYS A HZ1  6  
ATOM 11063 H HZ2  . LYS A 1 10  ? 143.486 5.371   -10.409 1.00 0.00 ? 10  LYS A HZ2  6  
ATOM 11064 H HZ3  . LYS A 1 10  ? 143.134 6.270   -9.026  1.00 0.00 ? 10  LYS A HZ3  6  
ATOM 11065 N N    . TRP A 1 11  ? 136.222 4.751   -5.980  1.00 0.00 ? 11  TRP A N    6  
ATOM 11066 C CA   . TRP A 1 11  ? 134.850 4.508   -5.506  1.00 0.00 ? 11  TRP A CA   6  
ATOM 11067 C C    . TRP A 1 11  ? 133.845 5.274   -6.353  1.00 0.00 ? 11  TRP A C    6  
ATOM 11068 O O    . TRP A 1 11  ? 132.712 4.837   -6.543  1.00 0.00 ? 11  TRP A O    6  
ATOM 11069 C CB   . TRP A 1 11  ? 134.685 4.937   -4.050  1.00 0.00 ? 11  TRP A CB   6  
ATOM 11070 C CG   . TRP A 1 11  ? 135.547 4.206   -3.074  1.00 0.00 ? 11  TRP A CG   6  
ATOM 11071 C CD1  . TRP A 1 11  ? 136.439 3.218   -3.338  1.00 0.00 ? 11  TRP A CD1  6  
ATOM 11072 C CD2  . TRP A 1 11  ? 135.565 4.401   -1.670  1.00 0.00 ? 11  TRP A CD2  6  
ATOM 11073 N NE1  . TRP A 1 11  ? 137.031 2.802   -2.188  1.00 0.00 ? 11  TRP A NE1  6  
ATOM 11074 C CE2  . TRP A 1 11  ? 136.502 3.505   -1.139  1.00 0.00 ? 11  TRP A CE2  6  
ATOM 11075 C CE3  . TRP A 1 11  ? 134.878 5.256   -0.809  1.00 0.00 ? 11  TRP A CE3  6  
ATOM 11076 C CZ2  . TRP A 1 11  ? 136.765 3.431   0.220   1.00 0.00 ? 11  TRP A CZ2  6  
ATOM 11077 C CZ3  . TRP A 1 11  ? 135.138 5.176   0.549   1.00 0.00 ? 11  TRP A CZ3  6  
ATOM 11078 C CH2  . TRP A 1 11  ? 136.073 4.270   1.046   1.00 0.00 ? 11  TRP A CH2  6  
ATOM 11079 H H    . TRP A 1 11  ? 136.874 5.154   -5.365  1.00 0.00 ? 11  TRP A H    6  
ATOM 11080 H HA   . TRP A 1 11  ? 134.650 3.449   -5.586  1.00 0.00 ? 11  TRP A HA   6  
ATOM 11081 H HB2  . TRP A 1 11  ? 134.921 5.987   -3.966  1.00 0.00 ? 11  TRP A HB2  6  
ATOM 11082 H HB3  . TRP A 1 11  ? 133.656 4.789   -3.762  1.00 0.00 ? 11  TRP A HB3  6  
ATOM 11083 H HD1  . TRP A 1 11  ? 136.654 2.841   -4.328  1.00 0.00 ? 11  TRP A HD1  6  
ATOM 11084 H HE1  . TRP A 1 11  ? 137.724 2.105   -2.179  1.00 0.00 ? 11  TRP A HE1  6  
ATOM 11085 H HE3  . TRP A 1 11  ? 134.163 5.965   -1.209  1.00 0.00 ? 11  TRP A HE3  6  
ATOM 11086 H HZ2  . TRP A 1 11  ? 137.486 2.736   0.626   1.00 0.00 ? 11  TRP A HZ2  6  
ATOM 11087 H HZ3  . TRP A 1 11  ? 134.607 5.810   1.249   1.00 0.00 ? 11  TRP A HZ3  6  
ATOM 11088 H HH2  . TRP A 1 11  ? 136.244 4.241   2.112   1.00 0.00 ? 11  TRP A HH2  6  
ATOM 11089 N N    . GLY A 1 12  ? 134.292 6.402   -6.882  1.00 0.00 ? 12  GLY A N    6  
ATOM 11090 C CA   . GLY A 1 12  ? 133.457 7.243   -7.708  1.00 0.00 ? 12  GLY A CA   6  
ATOM 11091 C C    . GLY A 1 12  ? 133.374 6.746   -9.140  1.00 0.00 ? 12  GLY A C    6  
ATOM 11092 O O    . GLY A 1 12  ? 132.584 7.259   -9.939  1.00 0.00 ? 12  GLY A O    6  
ATOM 11093 H H    . GLY A 1 12  ? 135.225 6.653   -6.715  1.00 0.00 ? 12  GLY A H    6  
ATOM 11094 H HA2  . GLY A 1 12  ? 132.464 7.270   -7.287  1.00 0.00 ? 12  GLY A HA2  6  
ATOM 11095 H HA3  . GLY A 1 12  ? 133.864 8.243   -7.709  1.00 0.00 ? 12  GLY A HA3  6  
ATOM 11096 N N    . GLU A 1 13  ? 134.191 5.759   -9.481  1.00 0.00 ? 13  GLU A N    6  
ATOM 11097 C CA   . GLU A 1 13  ? 134.162 5.185   -10.813 1.00 0.00 ? 13  GLU A CA   6  
ATOM 11098 C C    . GLU A 1 13  ? 132.988 4.241   -10.905 1.00 0.00 ? 13  GLU A C    6  
ATOM 11099 O O    . GLU A 1 13  ? 132.303 4.168   -11.928 1.00 0.00 ? 13  GLU A O    6  
ATOM 11100 C CB   . GLU A 1 13  ? 135.433 4.390   -11.115 1.00 0.00 ? 13  GLU A CB   6  
ATOM 11101 C CG   . GLU A 1 13  ? 136.729 5.144   -10.934 1.00 0.00 ? 13  GLU A CG   6  
ATOM 11102 C CD   . GLU A 1 13  ? 137.923 4.272   -11.221 1.00 0.00 ? 13  GLU A CD   6  
ATOM 11103 O OE1  . GLU A 1 13  ? 138.082 3.229   -10.569 1.00 0.00 ? 13  GLU A OE1  6  
ATOM 11104 O OE2  . GLU A 1 13  ? 138.735 4.616   -12.112 1.00 0.00 ? 13  GLU A OE2  6  
ATOM 11105 H H    . GLU A 1 13  ? 134.827 5.409   -8.819  1.00 0.00 ? 13  GLU A H    6  
ATOM 11106 H HA   . GLU A 1 13  ? 134.053 5.979   -11.536 1.00 0.00 ? 13  GLU A HA   6  
ATOM 11107 H HB2  . GLU A 1 13  ? 135.461 3.531   -10.461 1.00 0.00 ? 13  GLU A HB2  6  
ATOM 11108 H HB3  . GLU A 1 13  ? 135.384 4.042   -12.137 1.00 0.00 ? 13  GLU A HB3  6  
ATOM 11109 H HG2  . GLU A 1 13  ? 136.742 5.993   -11.602 1.00 0.00 ? 13  GLU A HG2  6  
ATOM 11110 H HG3  . GLU A 1 13  ? 136.783 5.481   -9.909  1.00 0.00 ? 13  GLU A HG3  6  
ATOM 11111 N N    . SER A 1 14  ? 132.769 3.492   -9.839  1.00 0.00 ? 14  SER A N    6  
ATOM 11112 C CA   . SER A 1 14  ? 131.701 2.514   -9.794  1.00 0.00 ? 14  SER A CA   6  
ATOM 11113 C C    . SER A 1 14  ? 131.253 2.259   -8.355  1.00 0.00 ? 14  SER A C    6  
ATOM 11114 O O    . SER A 1 14  ? 132.085 1.975   -7.469  1.00 0.00 ? 14  SER A O    6  
ATOM 11115 C CB   . SER A 1 14  ? 132.169 1.197   -10.434 1.00 0.00 ? 14  SER A CB   6  
ATOM 11116 O OG   . SER A 1 14  ? 132.603 1.408   -11.775 1.00 0.00 ? 14  SER A OG   6  
ATOM 11117 H H    . SER A 1 14  ? 133.336 3.612   -9.046  1.00 0.00 ? 14  SER A H    6  
ATOM 11118 H HA   . SER A 1 14  ? 130.869 2.896   -10.365 1.00 0.00 ? 14  SER A HA   6  
ATOM 11119 H HB2  . SER A 1 14  ? 132.992 0.794   -9.862  1.00 0.00 ? 14  SER A HB2  6  
ATOM 11120 H HB3  . SER A 1 14  ? 131.351 0.493   -10.436 1.00 0.00 ? 14  SER A HB3  6  
ATOM 11121 H HG   . SER A 1 14  ? 132.439 2.350   -11.946 1.00 0.00 ? 14  SER A HG   6  
ATOM 11122 N N    . PHE A 1 15  ? 129.945 2.321   -8.141  1.00 0.00 ? 15  PHE A N    6  
ATOM 11123 C CA   . PHE A 1 15  ? 129.321 2.078   -6.844  1.00 0.00 ? 15  PHE A CA   6  
ATOM 11124 C C    . PHE A 1 15  ? 129.668 0.683   -6.326  1.00 0.00 ? 15  PHE A C    6  
ATOM 11125 O O    . PHE A 1 15  ? 129.818 0.477   -5.133  1.00 0.00 ? 15  PHE A O    6  
ATOM 11126 C CB   . PHE A 1 15  ? 127.791 2.249   -6.970  1.00 0.00 ? 15  PHE A CB   6  
ATOM 11127 C CG   . PHE A 1 15  ? 127.001 1.910   -5.736  1.00 0.00 ? 15  PHE A CG   6  
ATOM 11128 C CD1  . PHE A 1 15  ? 127.240 2.551   -4.542  1.00 0.00 ? 15  PHE A CD1  6  
ATOM 11129 C CD2  . PHE A 1 15  ? 126.025 0.940   -5.777  1.00 0.00 ? 15  PHE A CD2  6  
ATOM 11130 C CE1  . PHE A 1 15  ? 126.521 2.235   -3.415  1.00 0.00 ? 15  PHE A CE1  6  
ATOM 11131 C CE2  . PHE A 1 15  ? 125.303 0.620   -4.650  1.00 0.00 ? 15  PHE A CE2  6  
ATOM 11132 C CZ   . PHE A 1 15  ? 125.550 1.269   -3.468  1.00 0.00 ? 15  PHE A CZ   6  
ATOM 11133 H H    . PHE A 1 15  ? 129.349 2.529   -8.899  1.00 0.00 ? 15  PHE A H    6  
ATOM 11134 H HA   . PHE A 1 15  ? 129.696 2.814   -6.149  1.00 0.00 ? 15  PHE A HA   6  
ATOM 11135 H HB2  . PHE A 1 15  ? 127.576 3.279   -7.213  1.00 0.00 ? 15  PHE A HB2  6  
ATOM 11136 H HB3  . PHE A 1 15  ? 127.437 1.622   -7.776  1.00 0.00 ? 15  PHE A HB3  6  
ATOM 11137 H HD1  . PHE A 1 15  ? 128.005 3.312   -4.498  1.00 0.00 ? 15  PHE A HD1  6  
ATOM 11138 H HD2  . PHE A 1 15  ? 125.827 0.427   -6.707  1.00 0.00 ? 15  PHE A HD2  6  
ATOM 11139 H HE1  . PHE A 1 15  ? 126.720 2.750   -2.487  1.00 0.00 ? 15  PHE A HE1  6  
ATOM 11140 H HE2  . PHE A 1 15  ? 124.540 -0.144  -4.697  1.00 0.00 ? 15  PHE A HE2  6  
ATOM 11141 H HZ   . PHE A 1 15  ? 124.984 1.020   -2.583  1.00 0.00 ? 15  PHE A HZ   6  
ATOM 11142 N N    . ASP A 1 16  ? 129.831 -0.246  -7.238  1.00 0.00 ? 16  ASP A N    6  
ATOM 11143 C CA   . ASP A 1 16  ? 130.155 -1.626  -6.895  1.00 0.00 ? 16  ASP A CA   6  
ATOM 11144 C C    . ASP A 1 16  ? 131.506 -1.739  -6.195  1.00 0.00 ? 16  ASP A C    6  
ATOM 11145 O O    . ASP A 1 16  ? 131.634 -2.465  -5.219  1.00 0.00 ? 16  ASP A O    6  
ATOM 11146 C CB   . ASP A 1 16  ? 130.140 -2.501  -8.136  1.00 0.00 ? 16  ASP A CB   6  
ATOM 11147 C CG   . ASP A 1 16  ? 130.424 -3.955  -7.847  1.00 0.00 ? 16  ASP A CG   6  
ATOM 11148 O OD1  . ASP A 1 16  ? 129.490 -4.689  -7.445  1.00 0.00 ? 16  ASP A OD1  6  
ATOM 11149 O OD2  . ASP A 1 16  ? 131.571 -4.395  -8.073  1.00 0.00 ? 16  ASP A OD2  6  
ATOM 11150 H H    . ASP A 1 16  ? 129.709 0.001   -8.183  1.00 0.00 ? 16  ASP A H    6  
ATOM 11151 H HA   . ASP A 1 16  ? 129.390 -1.978  -6.219  1.00 0.00 ? 16  ASP A HA   6  
ATOM 11152 H HB2  . ASP A 1 16  ? 129.166 -2.435  -8.599  1.00 0.00 ? 16  ASP A HB2  6  
ATOM 11153 H HB3  . ASP A 1 16  ? 130.883 -2.137  -8.831  1.00 0.00 ? 16  ASP A HB3  6  
ATOM 11154 N N    . LYS A 1 17  ? 132.508 -0.979  -6.645  1.00 0.00 ? 17  LYS A N    6  
ATOM 11155 C CA   . LYS A 1 17  ? 133.820 -1.093  -6.010  1.00 0.00 ? 17  LYS A CA   6  
ATOM 11156 C C    . LYS A 1 17  ? 133.841 -0.333  -4.693  1.00 0.00 ? 17  LYS A C    6  
ATOM 11157 O O    . LYS A 1 17  ? 134.595 -0.668  -3.788  1.00 0.00 ? 17  LYS A O    6  
ATOM 11158 C CB   . LYS A 1 17  ? 135.000 -0.707  -6.920  1.00 0.00 ? 17  LYS A CB   6  
ATOM 11159 C CG   . LYS A 1 17  ? 135.055 0.739   -7.345  1.00 0.00 ? 17  LYS A CG   6  
ATOM 11160 C CD   . LYS A 1 17  ? 136.340 1.038   -8.102  1.00 0.00 ? 17  LYS A CD   6  
ATOM 11161 C CE   . LYS A 1 17  ? 136.420 0.329   -9.436  1.00 0.00 ? 17  LYS A CE   6  
ATOM 11162 N NZ   . LYS A 1 17  ? 137.678 0.647   -10.140 1.00 0.00 ? 17  LYS A NZ   6  
ATOM 11163 H H    . LYS A 1 17  ? 132.345 -0.340  -7.370  1.00 0.00 ? 17  LYS A H    6  
ATOM 11164 H HA   . LYS A 1 17  ? 133.905 -2.139  -5.743  1.00 0.00 ? 17  LYS A HA   6  
ATOM 11165 H HB2  . LYS A 1 17  ? 135.919 -0.926  -6.397  1.00 0.00 ? 17  LYS A HB2  6  
ATOM 11166 H HB3  . LYS A 1 17  ? 134.958 -1.322  -7.807  1.00 0.00 ? 17  LYS A HB3  6  
ATOM 11167 H HG2  . LYS A 1 17  ? 134.209 0.950   -7.983  1.00 0.00 ? 17  LYS A HG2  6  
ATOM 11168 H HG3  . LYS A 1 17  ? 135.010 1.363   -6.465  1.00 0.00 ? 17  LYS A HG3  6  
ATOM 11169 H HD2  . LYS A 1 17  ? 136.400 2.103   -8.276  1.00 0.00 ? 17  LYS A HD2  6  
ATOM 11170 H HD3  . LYS A 1 17  ? 137.176 0.734   -7.489  1.00 0.00 ? 17  LYS A HD3  6  
ATOM 11171 H HE2  . LYS A 1 17  ? 136.373 -0.737  -9.266  1.00 0.00 ? 17  LYS A HE2  6  
ATOM 11172 H HE3  . LYS A 1 17  ? 135.584 0.635   -10.047 1.00 0.00 ? 17  LYS A HE3  6  
ATOM 11173 H HZ1  . LYS A 1 17  ? 137.760 1.671   -10.337 1.00 0.00 ? 17  LYS A HZ1  6  
ATOM 11174 H HZ2  . LYS A 1 17  ? 137.746 0.120   -11.038 1.00 0.00 ? 17  LYS A HZ2  6  
ATOM 11175 H HZ3  . LYS A 1 17  ? 138.494 0.369   -9.551  1.00 0.00 ? 17  LYS A HZ3  6  
ATOM 11176 N N    . LEU A 1 18  ? 132.991 0.687   -4.600  1.00 0.00 ? 18  LEU A N    6  
ATOM 11177 C CA   . LEU A 1 18  ? 132.765 1.393   -3.341  1.00 0.00 ? 18  LEU A CA   6  
ATOM 11178 C C    . LEU A 1 18  ? 132.225 0.412   -2.321  1.00 0.00 ? 18  LEU A C    6  
ATOM 11179 O O    . LEU A 1 18  ? 132.736 0.274   -1.212  1.00 0.00 ? 18  LEU A O    6  
ATOM 11180 C CB   . LEU A 1 18  ? 131.691 2.492   -3.538  1.00 0.00 ? 18  LEU A CB   6  
ATOM 11181 C CG   . LEU A 1 18  ? 131.033 3.027   -2.244  1.00 0.00 ? 18  LEU A CG   6  
ATOM 11182 C CD1  . LEU A 1 18  ? 131.989 3.839   -1.429  1.00 0.00 ? 18  LEU A CD1  6  
ATOM 11183 C CD2  . LEU A 1 18  ? 129.779 3.811   -2.531  1.00 0.00 ? 18  LEU A CD2  6  
ATOM 11184 H H    . LEU A 1 18  ? 132.511 0.976   -5.405  1.00 0.00 ? 18  LEU A H    6  
ATOM 11185 H HA   . LEU A 1 18  ? 133.681 1.849   -2.999  1.00 0.00 ? 18  LEU A HA   6  
ATOM 11186 H HB2  . LEU A 1 18  ? 132.150 3.325   -4.052  1.00 0.00 ? 18  LEU A HB2  6  
ATOM 11187 H HB3  . LEU A 1 18  ? 130.911 2.089   -4.166  1.00 0.00 ? 18  LEU A HB3  6  
ATOM 11188 H HG   . LEU A 1 18  ? 130.755 2.171   -1.643  1.00 0.00 ? 18  LEU A HG   6  
ATOM 11189 H HD11 . LEU A 1 18  ? 131.504 4.193   -0.529  1.00 0.00 ? 18  LEU A HD11 6  
ATOM 11190 H HD12 . LEU A 1 18  ? 132.330 4.684   -2.008  1.00 0.00 ? 18  LEU A HD12 6  
ATOM 11191 H HD13 . LEU A 1 18  ? 132.836 3.227   -1.156  1.00 0.00 ? 18  LEU A HD13 6  
ATOM 11192 H HD21 . LEU A 1 18  ? 129.096 3.200   -3.103  1.00 0.00 ? 18  LEU A HD21 6  
ATOM 11193 H HD22 . LEU A 1 18  ? 130.017 4.713   -3.075  1.00 0.00 ? 18  LEU A HD22 6  
ATOM 11194 H HD23 . LEU A 1 18  ? 129.316 4.059   -1.585  1.00 0.00 ? 18  LEU A HD23 6  
ATOM 11195 N N    . LEU A 1 19  ? 131.226 -0.291  -2.754  1.00 0.00 ? 19  LEU A N    6  
ATOM 11196 C CA   . LEU A 1 19  ? 130.440 -1.146  -1.933  1.00 0.00 ? 19  LEU A CA   6  
ATOM 11197 C C    . LEU A 1 19  ? 131.166 -2.447  -1.581  1.00 0.00 ? 19  LEU A C    6  
ATOM 11198 O O    . LEU A 1 19  ? 130.913 -3.040  -0.534  1.00 0.00 ? 19  LEU A O    6  
ATOM 11199 C CB   . LEU A 1 19  ? 129.162 -1.423  -2.677  1.00 0.00 ? 19  LEU A CB   6  
ATOM 11200 C CG   . LEU A 1 19  ? 127.974 -1.823  -1.860  1.00 0.00 ? 19  LEU A CG   6  
ATOM 11201 C CD1  . LEU A 1 19  ? 127.640 -0.702  -0.855  1.00 0.00 ? 19  LEU A CD1  6  
ATOM 11202 C CD2  . LEU A 1 19  ? 126.820 -2.066  -2.810  1.00 0.00 ? 19  LEU A CD2  6  
ATOM 11203 H H    . LEU A 1 19  ? 130.974 -0.207  -3.699  1.00 0.00 ? 19  LEU A H    6  
ATOM 11204 H HA   . LEU A 1 19  ? 130.186 -0.615  -1.031  1.00 0.00 ? 19  LEU A HA   6  
ATOM 11205 H HB2  . LEU A 1 19  ? 128.898 -0.531  -3.226  1.00 0.00 ? 19  LEU A HB2  6  
ATOM 11206 H HB3  . LEU A 1 19  ? 129.359 -2.210  -3.389  1.00 0.00 ? 19  LEU A HB3  6  
ATOM 11207 H HG   . LEU A 1 19  ? 128.176 -2.736  -1.320  1.00 0.00 ? 19  LEU A HG   6  
ATOM 11208 H HD11 . LEU A 1 19  ? 126.841 -0.984  -0.182  1.00 0.00 ? 19  LEU A HD11 6  
ATOM 11209 H HD12 . LEU A 1 19  ? 127.341 0.180   -1.403  1.00 0.00 ? 19  LEU A HD12 6  
ATOM 11210 H HD13 . LEU A 1 19  ? 128.526 -0.462  -0.286  1.00 0.00 ? 19  LEU A HD13 6  
ATOM 11211 H HD21 . LEU A 1 19  ? 125.950 -2.397  -2.261  1.00 0.00 ? 19  LEU A HD21 6  
ATOM 11212 H HD22 . LEU A 1 19  ? 127.109 -2.807  -3.542  1.00 0.00 ? 19  LEU A HD22 6  
ATOM 11213 H HD23 . LEU A 1 19  ? 126.593 -1.145  -3.327  1.00 0.00 ? 19  LEU A HD23 6  
ATOM 11214 N N    . SER A 1 20  ? 132.051 -2.896  -2.441  1.00 0.00 ? 20  SER A N    6  
ATOM 11215 C CA   . SER A 1 20  ? 132.824 -4.085  -2.156  1.00 0.00 ? 20  SER A CA   6  
ATOM 11216 C C    . SER A 1 20  ? 134.029 -3.753  -1.269  1.00 0.00 ? 20  SER A C    6  
ATOM 11217 O O    . SER A 1 20  ? 134.649 -4.642  -0.667  1.00 0.00 ? 20  SER A O    6  
ATOM 11218 C CB   . SER A 1 20  ? 133.240 -4.785  -3.458  1.00 0.00 ? 20  SER A CB   6  
ATOM 11219 O OG   . SER A 1 20  ? 133.821 -3.865  -4.373  1.00 0.00 ? 20  SER A OG   6  
ATOM 11220 H H    . SER A 1 20  ? 132.176 -2.443  -3.304  1.00 0.00 ? 20  SER A H    6  
ATOM 11221 H HA   . SER A 1 20  ? 132.179 -4.747  -1.596  1.00 0.00 ? 20  SER A HA   6  
ATOM 11222 H HB2  . SER A 1 20  ? 133.965 -5.554  -3.234  1.00 0.00 ? 20  SER A HB2  6  
ATOM 11223 H HB3  . SER A 1 20  ? 132.370 -5.231  -3.916  1.00 0.00 ? 20  SER A HB3  6  
ATOM 11224 H HG   . SER A 1 20  ? 133.110 -3.610  -4.978  1.00 0.00 ? 20  SER A HG   6  
ATOM 11225 N N    . HIS A 1 21  ? 134.322 -2.466  -1.154  1.00 0.00 ? 21  HIS A N    6  
ATOM 11226 C CA   . HIS A 1 21  ? 135.418 -2.006  -0.344  1.00 0.00 ? 21  HIS A CA   6  
ATOM 11227 C C    . HIS A 1 21  ? 134.875 -1.890  1.053   1.00 0.00 ? 21  HIS A C    6  
ATOM 11228 O O    . HIS A 1 21  ? 133.876 -1.212  1.239   1.00 0.00 ? 21  HIS A O    6  
ATOM 11229 C CB   . HIS A 1 21  ? 135.890 -0.614  -0.807  1.00 0.00 ? 21  HIS A CB   6  
ATOM 11230 C CG   . HIS A 1 21  ? 137.338 -0.327  -0.566  1.00 0.00 ? 21  HIS A CG   6  
ATOM 11231 N ND1  . HIS A 1 21  ? 137.835 0.386   0.516   1.00 0.00 ? 21  HIS A ND1  6  
ATOM 11232 C CD2  . HIS A 1 21  ? 138.399 -0.621  -1.322  1.00 0.00 ? 21  HIS A CD2  6  
ATOM 11233 C CE1  . HIS A 1 21  ? 139.143 0.507   0.383   1.00 0.00 ? 21  HIS A CE1  6  
ATOM 11234 N NE2  . HIS A 1 21  ? 139.496 -0.100  -0.720  1.00 0.00 ? 21  HIS A NE2  6  
ATOM 11235 H H    . HIS A 1 21  ? 133.747 -1.813  -1.607  1.00 0.00 ? 21  HIS A H    6  
ATOM 11236 H HA   . HIS A 1 21  ? 136.233 -2.714  -0.385  1.00 0.00 ? 21  HIS A HA   6  
ATOM 11237 H HB2  . HIS A 1 21  ? 135.719 -0.474  -1.864  1.00 0.00 ? 21  HIS A HB2  6  
ATOM 11238 H HB3  . HIS A 1 21  ? 135.323 0.130   -0.268  1.00 0.00 ? 21  HIS A HB3  6  
ATOM 11239 H HD1  . HIS A 1 21  ? 137.338 0.750   1.276   1.00 0.00 ? 21  HIS A HD1  6  
ATOM 11240 H HD2  . HIS A 1 21  ? 138.386 -1.164  -2.255  1.00 0.00 ? 21  HIS A HD2  6  
ATOM 11241 H HE1  . HIS A 1 21  ? 139.797 1.029   1.066   1.00 0.00 ? 21  HIS A HE1  6  
ATOM 11242 H HE2  . HIS A 1 21  ? 140.367 -0.059  -1.186  1.00 0.00 ? 21  HIS A HE2  6  
ATOM 11243 N N    . ARG A 1 22  ? 135.509 -2.534  2.024   1.00 0.00 ? 22  ARG A N    6  
ATOM 11244 C CA   . ARG A 1 22  ? 135.023 -2.505  3.427   1.00 0.00 ? 22  ARG A CA   6  
ATOM 11245 C C    . ARG A 1 22  ? 134.802 -1.065  3.891   1.00 0.00 ? 22  ARG A C    6  
ATOM 11246 O O    . ARG A 1 22  ? 133.749 -0.727  4.399   1.00 0.00 ? 22  ARG A O    6  
ATOM 11247 C CB   . ARG A 1 22  ? 135.998 -3.206  4.387   1.00 0.00 ? 22  ARG A CB   6  
ATOM 11248 C CG   . ARG A 1 22  ? 136.300 -4.657  4.044   1.00 0.00 ? 22  ARG A CG   6  
ATOM 11249 C CD   . ARG A 1 22  ? 137.161 -5.322  5.120   1.00 0.00 ? 22  ARG A CD   6  
ATOM 11250 N NE   . ARG A 1 22  ? 138.416 -4.594  5.371   1.00 0.00 ? 22  ARG A NE   6  
ATOM 11251 C CZ   . ARG A 1 22  ? 139.544 -5.120  5.869   1.00 0.00 ? 22  ARG A CZ   6  
ATOM 11252 N NH1  . ARG A 1 22  ? 139.583 -6.387  6.278   1.00 0.00 ? 22  ARG A NH1  6  
ATOM 11253 N NH2  . ARG A 1 22  ? 140.610 -4.349  6.010   1.00 0.00 ? 22  ARG A NH2  6  
ATOM 11254 H H    . ARG A 1 22  ? 136.306 -3.059  1.771   1.00 0.00 ? 22  ARG A H    6  
ATOM 11255 H HA   . ARG A 1 22  ? 134.065 -3.005  3.464   1.00 0.00 ? 22  ARG A HA   6  
ATOM 11256 H HB2  . ARG A 1 22  ? 136.933 -2.666  4.385   1.00 0.00 ? 22  ARG A HB2  6  
ATOM 11257 H HB3  . ARG A 1 22  ? 135.582 -3.174  5.382   1.00 0.00 ? 22  ARG A HB3  6  
ATOM 11258 H HG2  . ARG A 1 22  ? 135.369 -5.199  3.957   1.00 0.00 ? 22  ARG A HG2  6  
ATOM 11259 H HG3  . ARG A 1 22  ? 136.826 -4.691  3.102   1.00 0.00 ? 22  ARG A HG3  6  
ATOM 11260 H HD2  . ARG A 1 22  ? 136.595 -5.363  6.039   1.00 0.00 ? 22  ARG A HD2  6  
ATOM 11261 H HD3  . ARG A 1 22  ? 137.397 -6.327  4.802   1.00 0.00 ? 22  ARG A HD3  6  
ATOM 11262 H HE   . ARG A 1 22  ? 138.415 -3.627  5.153   1.00 0.00 ? 22  ARG A HE   6  
ATOM 11263 H HH11 . ARG A 1 22  ? 138.788 -6.999  6.242   1.00 0.00 ? 22  ARG A HH11 6  
ATOM 11264 H HH12 . ARG A 1 22  ? 140.419 -6.801  6.668   1.00 0.00 ? 22  ARG A HH12 6  
ATOM 11265 H HH21 . ARG A 1 22  ? 140.578 -3.377  5.762   1.00 0.00 ? 22  ARG A HH21 6  
ATOM 11266 H HH22 . ARG A 1 22  ? 141.497 -4.698  6.336   1.00 0.00 ? 22  ARG A HH22 6  
ATOM 11267 N N    . ASP A 1 23  ? 135.785 -0.223  3.634   1.00 0.00 ? 23  ASP A N    6  
ATOM 11268 C CA   . ASP A 1 23  ? 135.735 1.202   4.001   1.00 0.00 ? 23  ASP A CA   6  
ATOM 11269 C C    . ASP A 1 23  ? 134.626 1.930   3.270   1.00 0.00 ? 23  ASP A C    6  
ATOM 11270 O O    . ASP A 1 23  ? 134.055 2.871   3.789   1.00 0.00 ? 23  ASP A O    6  
ATOM 11271 C CB   . ASP A 1 23  ? 137.042 1.897   3.638   1.00 0.00 ? 23  ASP A CB   6  
ATOM 11272 C CG   . ASP A 1 23  ? 138.241 1.221   4.195   1.00 0.00 ? 23  ASP A CG   6  
ATOM 11273 O OD1  . ASP A 1 23  ? 138.704 0.251   3.575   1.00 0.00 ? 23  ASP A OD1  6  
ATOM 11274 O OD2  . ASP A 1 23  ? 138.753 1.647   5.231   1.00 0.00 ? 23  ASP A OD2  6  
ATOM 11275 H H    . ASP A 1 23  ? 136.606 -0.584  3.239   1.00 0.00 ? 23  ASP A H    6  
ATOM 11276 H HA   . ASP A 1 23  ? 135.591 1.285   5.067   1.00 0.00 ? 23  ASP A HA   6  
ATOM 11277 H HB2  . ASP A 1 23  ? 137.141 1.924   2.563   1.00 0.00 ? 23  ASP A HB2  6  
ATOM 11278 H HB3  . ASP A 1 23  ? 137.014 2.911   4.011   1.00 0.00 ? 23  ASP A HB3  6  
ATOM 11279 N N    . GLY A 1 24  ? 134.315 1.486   2.072   1.00 0.00 ? 24  GLY A N    6  
ATOM 11280 C CA   . GLY A 1 24  ? 133.346 2.189   1.263   1.00 0.00 ? 24  GLY A CA   6  
ATOM 11281 C C    . GLY A 1 24  ? 131.970 1.795   1.611   1.00 0.00 ? 24  GLY A C    6  
ATOM 11282 O O    . GLY A 1 24  ? 131.085 2.642   1.730   1.00 0.00 ? 24  GLY A O    6  
ATOM 11283 H H    . GLY A 1 24  ? 134.684 0.636   1.758   1.00 0.00 ? 24  GLY A H    6  
ATOM 11284 H HA2  . GLY A 1 24  ? 133.455 3.250   1.425   1.00 0.00 ? 24  GLY A HA2  6  
ATOM 11285 H HA3  . GLY A 1 24  ? 133.511 1.979   0.222   1.00 0.00 ? 24  GLY A HA3  6  
ATOM 11286 N N    . LEU A 1 25  ? 131.786 0.508   1.779   1.00 0.00 ? 25  LEU A N    6  
ATOM 11287 C CA   . LEU A 1 25  ? 130.563 -0.046  2.278   1.00 0.00 ? 25  LEU A CA   6  
ATOM 11288 C C    . LEU A 1 25  ? 130.221 0.643   3.586   1.00 0.00 ? 25  LEU A C    6  
ATOM 11289 O O    . LEU A 1 25  ? 129.119 1.123   3.770   1.00 0.00 ? 25  LEU A O    6  
ATOM 11290 C CB   . LEU A 1 25  ? 130.716 -1.593  2.396   1.00 0.00 ? 25  LEU A CB   6  
ATOM 11291 C CG   . LEU A 1 25  ? 130.013 -2.336  3.547   1.00 0.00 ? 25  LEU A CG   6  
ATOM 11292 C CD1  . LEU A 1 25  ? 129.687 -3.755  3.106   1.00 0.00 ? 25  LEU A CD1  6  
ATOM 11293 C CD2  . LEU A 1 25  ? 130.954 -2.415  4.758   1.00 0.00 ? 25  LEU A CD2  6  
ATOM 11294 H H    . LEU A 1 25  ? 132.513 -0.111  1.536   1.00 0.00 ? 25  LEU A H    6  
ATOM 11295 H HA   . LEU A 1 25  ? 129.789 0.180   1.560   1.00 0.00 ? 25  LEU A HA   6  
ATOM 11296 H HB2  . LEU A 1 25  ? 130.355 -2.024  1.474   1.00 0.00 ? 25  LEU A HB2  6  
ATOM 11297 H HB3  . LEU A 1 25  ? 131.774 -1.805  2.458   1.00 0.00 ? 25  LEU A HB3  6  
ATOM 11298 H HG   . LEU A 1 25  ? 129.111 -1.825  3.843   1.00 0.00 ? 25  LEU A HG   6  
ATOM 11299 H HD11 . LEU A 1 25  ? 130.598 -4.271  2.841   1.00 0.00 ? 25  LEU A HD11 6  
ATOM 11300 H HD12 . LEU A 1 25  ? 129.030 -3.723  2.250   1.00 0.00 ? 25  LEU A HD12 6  
ATOM 11301 H HD13 . LEU A 1 25  ? 129.199 -4.277  3.916   1.00 0.00 ? 25  LEU A HD13 6  
ATOM 11302 H HD21 . LEU A 1 25  ? 130.485 -2.974  5.554   1.00 0.00 ? 25  LEU A HD21 6  
ATOM 11303 H HD22 . LEU A 1 25  ? 131.204 -1.421  5.112   1.00 0.00 ? 25  LEU A HD22 6  
ATOM 11304 H HD23 . LEU A 1 25  ? 131.869 -2.909  4.460   1.00 0.00 ? 25  LEU A HD23 6  
ATOM 11305 N N    . GLU A 1 26  ? 131.226 0.784   4.417   1.00 0.00 ? 26  GLU A N    6  
ATOM 11306 C CA   . GLU A 1 26  ? 131.136 1.443   5.691   1.00 0.00 ? 26  GLU A CA   6  
ATOM 11307 C C    . GLU A 1 26  ? 130.828 2.948   5.535   1.00 0.00 ? 26  GLU A C    6  
ATOM 11308 O O    . GLU A 1 26  ? 130.027 3.498   6.297   1.00 0.00 ? 26  GLU A O    6  
ATOM 11309 C CB   . GLU A 1 26  ? 132.444 1.221   6.412   1.00 0.00 ? 26  GLU A CB   6  
ATOM 11310 C CG   . GLU A 1 26  ? 132.582 1.900   7.748   1.00 0.00 ? 26  GLU A CG   6  
ATOM 11311 C CD   . GLU A 1 26  ? 133.945 1.681   8.320   1.00 0.00 ? 26  GLU A CD   6  
ATOM 11312 O OE1  . GLU A 1 26  ? 134.895 2.397   7.926   1.00 0.00 ? 26  GLU A OE1  6  
ATOM 11313 O OE2  . GLU A 1 26  ? 134.107 0.775   9.158   1.00 0.00 ? 26  GLU A OE2  6  
ATOM 11314 H H    . GLU A 1 26  ? 132.090 0.392   4.163   1.00 0.00 ? 26  GLU A H    6  
ATOM 11315 H HA   . GLU A 1 26  ? 130.348 0.976   6.261   1.00 0.00 ? 26  GLU A HA   6  
ATOM 11316 H HB2  . GLU A 1 26  ? 132.527 0.151   6.545   1.00 0.00 ? 26  GLU A HB2  6  
ATOM 11317 H HB3  . GLU A 1 26  ? 133.248 1.543   5.765   1.00 0.00 ? 26  GLU A HB3  6  
ATOM 11318 H HG2  . GLU A 1 26  ? 132.418 2.960   7.623   1.00 0.00 ? 26  GLU A HG2  6  
ATOM 11319 H HG3  . GLU A 1 26  ? 131.848 1.494   8.428   1.00 0.00 ? 26  GLU A HG3  6  
ATOM 11320 N N    . ALA A 1 27  ? 131.410 3.593   4.516   1.00 0.00 ? 27  ALA A N    6  
ATOM 11321 C CA   . ALA A 1 27  ? 131.175 5.031   4.295   1.00 0.00 ? 27  ALA A CA   6  
ATOM 11322 C C    . ALA A 1 27  ? 129.716 5.237   3.887   1.00 0.00 ? 27  ALA A C    6  
ATOM 11323 O O    . ALA A 1 27  ? 129.049 6.181   4.327   1.00 0.00 ? 27  ALA A O    6  
ATOM 11324 C CB   . ALA A 1 27  ? 132.142 5.627   3.232   1.00 0.00 ? 27  ALA A CB   6  
ATOM 11325 H H    . ALA A 1 27  ? 131.981 3.087   3.895   1.00 0.00 ? 27  ALA A H    6  
ATOM 11326 H HA   . ALA A 1 27  ? 131.330 5.528   5.242   1.00 0.00 ? 27  ALA A HA   6  
ATOM 11327 H HB1  . ALA A 1 27  ? 131.858 6.659   3.067   1.00 0.00 ? 27  ALA A HB1  6  
ATOM 11328 H HB2  . ALA A 1 27  ? 132.078 5.097   2.292   1.00 0.00 ? 27  ALA A HB2  6  
ATOM 11329 H HB3  . ALA A 1 27  ? 133.174 5.617   3.557   1.00 0.00 ? 27  ALA A HB3  6  
ATOM 11330 N N    . PHE A 1 28  ? 129.214 4.300   3.097   1.00 0.00 ? 28  PHE A N    6  
ATOM 11331 C CA   . PHE A 1 28  ? 127.837 4.321   2.627   1.00 0.00 ? 28  PHE A CA   6  
ATOM 11332 C C    . PHE A 1 28  ? 126.922 4.041   3.782   1.00 0.00 ? 28  PHE A C    6  
ATOM 11333 O O    . PHE A 1 28  ? 125.851 4.611   3.904   1.00 0.00 ? 28  PHE A O    6  
ATOM 11334 C CB   . PHE A 1 28  ? 127.627 3.231   1.614   1.00 0.00 ? 28  PHE A CB   6  
ATOM 11335 C CG   . PHE A 1 28  ? 126.624 3.601   0.564   1.00 0.00 ? 28  PHE A CG   6  
ATOM 11336 C CD1  . PHE A 1 28  ? 126.919 4.577   -0.369  1.00 0.00 ? 28  PHE A CD1  6  
ATOM 11337 C CD2  . PHE A 1 28  ? 125.380 3.001   0.529   1.00 0.00 ? 28  PHE A CD2  6  
ATOM 11338 C CE1  . PHE A 1 28  ? 125.996 4.943   -1.323  1.00 0.00 ? 28  PHE A CE1  6  
ATOM 11339 C CE2  . PHE A 1 28  ? 124.452 3.366   -0.420  1.00 0.00 ? 28  PHE A CE2  6  
ATOM 11340 C CZ   . PHE A 1 28  ? 124.760 4.339   -1.348  1.00 0.00 ? 28  PHE A CZ   6  
ATOM 11341 H H    . PHE A 1 28  ? 129.812 3.575   2.805   1.00 0.00 ? 28  PHE A H    6  
ATOM 11342 H HA   . PHE A 1 28  ? 127.615 5.277   2.178   1.00 0.00 ? 28  PHE A HA   6  
ATOM 11343 H HB2  . PHE A 1 28  ? 128.568 2.866   1.249   1.00 0.00 ? 28  PHE A HB2  6  
ATOM 11344 H HB3  . PHE A 1 28  ? 127.203 2.405   2.168   1.00 0.00 ? 28  PHE A HB3  6  
ATOM 11345 H HD1  . PHE A 1 28  ? 127.890 5.051   -0.351  1.00 0.00 ? 28  PHE A HD1  6  
ATOM 11346 H HD2  . PHE A 1 28  ? 125.137 2.238   1.254   1.00 0.00 ? 28  PHE A HD2  6  
ATOM 11347 H HE1  . PHE A 1 28  ? 126.240 5.705   -2.048  1.00 0.00 ? 28  PHE A HE1  6  
ATOM 11348 H HE2  . PHE A 1 28  ? 123.482 2.891   -0.439  1.00 0.00 ? 28  PHE A HE2  6  
ATOM 11349 H HZ   . PHE A 1 28  ? 124.033 4.625   -2.092  1.00 0.00 ? 28  PHE A HZ   6  
ATOM 11350 N N    . THR A 1 29  ? 127.366 3.148   4.615   1.00 0.00 ? 29  THR A N    6  
ATOM 11351 C CA   . THR A 1 29  ? 126.658 2.755   5.782   1.00 0.00 ? 29  THR A CA   6  
ATOM 11352 C C    . THR A 1 29  ? 126.456 3.961   6.730   1.00 0.00 ? 29  THR A C    6  
ATOM 11353 O O    . THR A 1 29  ? 125.379 4.136   7.314   1.00 0.00 ? 29  THR A O    6  
ATOM 11354 C CB   . THR A 1 29  ? 127.412 1.612   6.482   1.00 0.00 ? 29  THR A CB   6  
ATOM 11355 O OG1  . THR A 1 29  ? 127.492 0.467   5.623   1.00 0.00 ? 29  THR A OG1  6  
ATOM 11356 C CG2  . THR A 1 29  ? 126.712 1.207   7.684   1.00 0.00 ? 29  THR A CG2  6  
ATOM 11357 H H    . THR A 1 29  ? 128.230 2.727   4.414   1.00 0.00 ? 29  THR A H    6  
ATOM 11358 H HA   . THR A 1 29  ? 125.689 2.390   5.473   1.00 0.00 ? 29  THR A HA   6  
ATOM 11359 H HB   . THR A 1 29  ? 128.407 1.944   6.740   1.00 0.00 ? 29  THR A HB   6  
ATOM 11360 H HG1  . THR A 1 29  ? 127.934 0.715   4.799   1.00 0.00 ? 29  THR A HG1  6  
ATOM 11361 H HG21 . THR A 1 29  ? 127.259 0.376   8.101   1.00 0.00 ? 29  THR A HG21 6  
ATOM 11362 H HG22 . THR A 1 29  ? 125.719 0.935   7.360   1.00 0.00 ? 29  THR A HG22 6  
ATOM 11363 H HG23 . THR A 1 29  ? 126.705 2.049   8.364   1.00 0.00 ? 29  THR A HG23 6  
ATOM 11364 N N    . ARG A 1 30  ? 127.481 4.799   6.842   1.00 0.00 ? 30  ARG A N    6  
ATOM 11365 C CA   . ARG A 1 30  ? 127.403 6.030   7.625   1.00 0.00 ? 30  ARG A CA   6  
ATOM 11366 C C    . ARG A 1 30  ? 126.327 6.955   7.059   1.00 0.00 ? 30  ARG A C    6  
ATOM 11367 O O    . ARG A 1 30  ? 125.548 7.565   7.812   1.00 0.00 ? 30  ARG A O    6  
ATOM 11368 C CB   . ARG A 1 30  ? 128.760 6.749   7.666   1.00 0.00 ? 30  ARG A CB   6  
ATOM 11369 C CG   . ARG A 1 30  ? 129.849 5.970   8.381   1.00 0.00 ? 30  ARG A CG   6  
ATOM 11370 C CD   . ARG A 1 30  ? 131.116 6.773   8.520   1.00 0.00 ? 30  ARG A CD   6  
ATOM 11371 N NE   . ARG A 1 30  ? 132.130 6.083   9.335   1.00 0.00 ? 30  ARG A NE   6  
ATOM 11372 C CZ   . ARG A 1 30  ? 133.330 6.597   9.647   1.00 0.00 ? 30  ARG A CZ   6  
ATOM 11373 N NH1  . ARG A 1 30  ? 133.583 7.872   9.382   1.00 0.00 ? 30  ARG A NH1  6  
ATOM 11374 N NH2  . ARG A 1 30  ? 134.236 5.862   10.301  1.00 0.00 ? 30  ARG A NH2  6  
ATOM 11375 H H    . ARG A 1 30  ? 128.325 4.553   6.405   1.00 0.00 ? 30  ARG A H    6  
ATOM 11376 H HA   . ARG A 1 30  ? 127.114 5.761   8.630   1.00 0.00 ? 30  ARG A HA   6  
ATOM 11377 H HB2  . ARG A 1 30  ? 129.088 6.934   6.654   1.00 0.00 ? 30  ARG A HB2  6  
ATOM 11378 H HB3  . ARG A 1 30  ? 128.635 7.695   8.172   1.00 0.00 ? 30  ARG A HB3  6  
ATOM 11379 H HG2  . ARG A 1 30  ? 129.499 5.702   9.367   1.00 0.00 ? 30  ARG A HG2  6  
ATOM 11380 H HG3  . ARG A 1 30  ? 130.059 5.072   7.817   1.00 0.00 ? 30  ARG A HG3  6  
ATOM 11381 H HD2  . ARG A 1 30  ? 131.523 6.953   7.534   1.00 0.00 ? 30  ARG A HD2  6  
ATOM 11382 H HD3  . ARG A 1 30  ? 130.879 7.718   8.987   1.00 0.00 ? 30  ARG A HD3  6  
ATOM 11383 H HE   . ARG A 1 30  ? 131.863 5.180   9.635   1.00 0.00 ? 30  ARG A HE   6  
ATOM 11384 H HH11 . ARG A 1 30  ? 132.886 8.472   8.966   1.00 0.00 ? 30  ARG A HH11 6  
ATOM 11385 H HH12 . ARG A 1 30  ? 134.465 8.329   9.551   1.00 0.00 ? 30  ARG A HH12 6  
ATOM 11386 H HH21 . ARG A 1 30  ? 134.069 4.912   10.587  1.00 0.00 ? 30  ARG A HH21 6  
ATOM 11387 H HH22 . ARG A 1 30  ? 135.147 6.218   10.550  1.00 0.00 ? 30  ARG A HH22 6  
ATOM 11388 N N    . PHE A 1 31  ? 126.280 7.025   5.744   1.00 0.00 ? 31  PHE A N    6  
ATOM 11389 C CA   . PHE A 1 31  ? 125.295 7.808   5.010   1.00 0.00 ? 31  PHE A CA   6  
ATOM 11390 C C    . PHE A 1 31  ? 123.879 7.235   5.260   1.00 0.00 ? 31  PHE A C    6  
ATOM 11391 O O    . PHE A 1 31  ? 122.917 7.973   5.481   1.00 0.00 ? 31  PHE A O    6  
ATOM 11392 C CB   . PHE A 1 31  ? 125.652 7.753   3.508   1.00 0.00 ? 31  PHE A CB   6  
ATOM 11393 C CG   . PHE A 1 31  ? 124.760 8.543   2.602   1.00 0.00 ? 31  PHE A CG   6  
ATOM 11394 C CD1  . PHE A 1 31  ? 123.610 7.980   2.069   1.00 0.00 ? 31  PHE A CD1  6  
ATOM 11395 C CD2  . PHE A 1 31  ? 125.073 9.844   2.274   1.00 0.00 ? 31  PHE A CD2  6  
ATOM 11396 C CE1  . PHE A 1 31  ? 122.796 8.705   1.237   1.00 0.00 ? 31  PHE A CE1  6  
ATOM 11397 C CE2  . PHE A 1 31  ? 124.261 10.572  1.438   1.00 0.00 ? 31  PHE A CE2  6  
ATOM 11398 C CZ   . PHE A 1 31  ? 123.121 10.001  0.920   1.00 0.00 ? 31  PHE A CZ   6  
ATOM 11399 H H    . PHE A 1 31  ? 126.957 6.529   5.232   1.00 0.00 ? 31  PHE A H    6  
ATOM 11400 H HA   . PHE A 1 31  ? 125.339 8.832   5.349   1.00 0.00 ? 31  PHE A HA   6  
ATOM 11401 H HB2  . PHE A 1 31  ? 126.656 8.128   3.375   1.00 0.00 ? 31  PHE A HB2  6  
ATOM 11402 H HB3  . PHE A 1 31  ? 125.626 6.721   3.188   1.00 0.00 ? 31  PHE A HB3  6  
ATOM 11403 H HD1  . PHE A 1 31  ? 123.356 6.960   2.318   1.00 0.00 ? 31  PHE A HD1  6  
ATOM 11404 H HD2  . PHE A 1 31  ? 125.966 10.293  2.684   1.00 0.00 ? 31  PHE A HD2  6  
ATOM 11405 H HE1  . PHE A 1 31  ? 121.901 8.257   0.831   1.00 0.00 ? 31  PHE A HE1  6  
ATOM 11406 H HE2  . PHE A 1 31  ? 124.517 11.591  1.188   1.00 0.00 ? 31  PHE A HE2  6  
ATOM 11407 H HZ   . PHE A 1 31  ? 122.481 10.572  0.264   1.00 0.00 ? 31  PHE A HZ   6  
ATOM 11408 N N    . LEU A 1 32  ? 123.785 5.928   5.225   1.00 0.00 ? 32  LEU A N    6  
ATOM 11409 C CA   . LEU A 1 32  ? 122.542 5.201   5.447   1.00 0.00 ? 32  LEU A CA   6  
ATOM 11410 C C    . LEU A 1 32  ? 122.004 5.364   6.872   1.00 0.00 ? 32  LEU A C    6  
ATOM 11411 O O    . LEU A 1 32  ? 120.805 5.561   7.064   1.00 0.00 ? 32  LEU A O    6  
ATOM 11412 C CB   . LEU A 1 32  ? 122.745 3.725   5.129   1.00 0.00 ? 32  LEU A CB   6  
ATOM 11413 C CG   . LEU A 1 32  ? 122.110 3.201   3.837   1.00 0.00 ? 32  LEU A CG   6  
ATOM 11414 C CD1  . LEU A 1 32  ? 122.516 4.014   2.633   1.00 0.00 ? 32  LEU A CD1  6  
ATOM 11415 C CD2  . LEU A 1 32  ? 122.479 1.751   3.629   1.00 0.00 ? 32  LEU A CD2  6  
ATOM 11416 H H    . LEU A 1 32  ? 124.599 5.420   5.006   1.00 0.00 ? 32  LEU A H    6  
ATOM 11417 H HA   . LEU A 1 32  ? 121.808 5.591   4.758   1.00 0.00 ? 32  LEU A HA   6  
ATOM 11418 H HB2  . LEU A 1 32  ? 123.807 3.537   5.082   1.00 0.00 ? 32  LEU A HB2  6  
ATOM 11419 H HB3  . LEU A 1 32  ? 122.337 3.163   5.957   1.00 0.00 ? 32  LEU A HB3  6  
ATOM 11420 H HG   . LEU A 1 32  ? 121.036 3.253   3.928   1.00 0.00 ? 32  LEU A HG   6  
ATOM 11421 H HD11 . LEU A 1 32  ? 122.217 5.043   2.772   1.00 0.00 ? 32  LEU A HD11 6  
ATOM 11422 H HD12 . LEU A 1 32  ? 122.006 3.600   1.775   1.00 0.00 ? 32  LEU A HD12 6  
ATOM 11423 H HD13 . LEU A 1 32  ? 123.586 3.948   2.494   1.00 0.00 ? 32  LEU A HD13 6  
ATOM 11424 H HD21 . LEU A 1 32  ? 122.121 1.160   4.459   1.00 0.00 ? 32  LEU A HD21 6  
ATOM 11425 H HD22 . LEU A 1 32  ? 123.553 1.649   3.570   1.00 0.00 ? 32  LEU A HD22 6  
ATOM 11426 H HD23 . LEU A 1 32  ? 122.032 1.390   2.716   1.00 0.00 ? 32  LEU A HD23 6  
ATOM 11427 N N    . LYS A 1 33  ? 122.887 5.279   7.860   1.00 0.00 ? 33  LYS A N    6  
ATOM 11428 C CA   . LYS A 1 33  ? 122.504 5.398   9.277   1.00 0.00 ? 33  LYS A CA   6  
ATOM 11429 C C    . LYS A 1 33  ? 121.741 6.668   9.583   1.00 0.00 ? 33  LYS A C    6  
ATOM 11430 O O    . LYS A 1 33  ? 120.662 6.613   10.183  1.00 0.00 ? 33  LYS A O    6  
ATOM 11431 C CB   . LYS A 1 33  ? 123.713 5.334   10.201  1.00 0.00 ? 33  LYS A CB   6  
ATOM 11432 C CG   . LYS A 1 33  ? 124.281 3.962   10.449  1.00 0.00 ? 33  LYS A CG   6  
ATOM 11433 C CD   . LYS A 1 33  ? 125.468 4.077   11.381  1.00 0.00 ? 33  LYS A CD   6  
ATOM 11434 C CE   . LYS A 1 33  ? 126.015 2.735   11.800  1.00 0.00 ? 33  LYS A CE   6  
ATOM 11435 N NZ   . LYS A 1 33  ? 126.356 1.885   10.677  1.00 0.00 ? 33  LYS A NZ   6  
ATOM 11436 H H    . LYS A 1 33  ? 123.829 5.111   7.630   1.00 0.00 ? 33  LYS A H    6  
ATOM 11437 H HA   . LYS A 1 33  ? 121.866 4.556   9.504   1.00 0.00 ? 33  LYS A HA   6  
ATOM 11438 H HB2  . LYS A 1 33  ? 124.505 5.928   9.767   1.00 0.00 ? 33  LYS A HB2  6  
ATOM 11439 H HB3  . LYS A 1 33  ? 123.441 5.765   11.153  1.00 0.00 ? 33  LYS A HB3  6  
ATOM 11440 H HG2  . LYS A 1 33  ? 123.526 3.337   10.902  1.00 0.00 ? 33  LYS A HG2  6  
ATOM 11441 H HG3  . LYS A 1 33  ? 124.608 3.534   9.513   1.00 0.00 ? 33  LYS A HG3  6  
ATOM 11442 H HD2  . LYS A 1 33  ? 126.253 4.622   10.877  1.00 0.00 ? 33  LYS A HD2  6  
ATOM 11443 H HD3  . LYS A 1 33  ? 125.163 4.623   12.262  1.00 0.00 ? 33  LYS A HD3  6  
ATOM 11444 H HE2  . LYS A 1 33  ? 126.933 2.881   12.348  1.00 0.00 ? 33  LYS A HE2  6  
ATOM 11445 H HE3  . LYS A 1 33  ? 125.287 2.221   12.407  1.00 0.00 ? 33  LYS A HE3  6  
ATOM 11446 H HZ1  . LYS A 1 33  ? 125.499 1.554   10.177  1.00 0.00 ? 33  LYS A HZ1  6  
ATOM 11447 H HZ2  . LYS A 1 33  ? 126.876 1.039   10.995  1.00 0.00 ? 33  LYS A HZ2  6  
ATOM 11448 H HZ3  . LYS A 1 33  ? 126.966 2.403   10.007  1.00 0.00 ? 33  LYS A HZ3  6  
ATOM 11449 N N    . THR A 1 34  ? 122.266 7.786   9.128   1.00 0.00 ? 34  THR A N    6  
ATOM 11450 C CA   . THR A 1 34  ? 121.718 9.087   9.457   1.00 0.00 ? 34  THR A CA   6  
ATOM 11451 C C    . THR A 1 34  ? 120.311 9.314   8.854   1.00 0.00 ? 34  THR A C    6  
ATOM 11452 O O    . THR A 1 34  ? 119.562 10.171  9.315   1.00 0.00 ? 34  THR A O    6  
ATOM 11453 C CB   . THR A 1 34  ? 122.714 10.231  9.087   1.00 0.00 ? 34  THR A CB   6  
ATOM 11454 O OG1  . THR A 1 34  ? 122.207 11.512  9.469   1.00 0.00 ? 34  THR A OG1  6  
ATOM 11455 C CG2  . THR A 1 34  ? 123.029 10.233  7.609   1.00 0.00 ? 34  THR A CG2  6  
ATOM 11456 H H    . THR A 1 34  ? 123.054 7.741   8.547   1.00 0.00 ? 34  THR A H    6  
ATOM 11457 H HA   . THR A 1 34  ? 121.598 9.088   10.531  1.00 0.00 ? 34  THR A HA   6  
ATOM 11458 H HB   . THR A 1 34  ? 123.630 10.058  9.633   1.00 0.00 ? 34  THR A HB   6  
ATOM 11459 H HG1  . THR A 1 34  ? 121.727 11.399  10.306  1.00 0.00 ? 34  THR A HG1  6  
ATOM 11460 H HG21 . THR A 1 34  ? 123.465 9.283   7.335   1.00 0.00 ? 34  THR A HG21 6  
ATOM 11461 H HG22 . THR A 1 34  ? 123.724 11.028  7.384   1.00 0.00 ? 34  THR A HG22 6  
ATOM 11462 H HG23 . THR A 1 34  ? 122.118 10.380  7.048   1.00 0.00 ? 34  THR A HG23 6  
ATOM 11463 N N    . GLU A 1 35  ? 119.947 8.545   7.850   1.00 0.00 ? 35  GLU A N    6  
ATOM 11464 C CA   . GLU A 1 35  ? 118.616 8.653   7.302   1.00 0.00 ? 35  GLU A CA   6  
ATOM 11465 C C    . GLU A 1 35  ? 117.828 7.371   7.515   1.00 0.00 ? 35  GLU A C    6  
ATOM 11466 O O    . GLU A 1 35  ? 116.770 7.159   6.911   1.00 0.00 ? 35  GLU A O    6  
ATOM 11467 C CB   . GLU A 1 35  ? 118.627 9.126   5.850   1.00 0.00 ? 35  GLU A CB   6  
ATOM 11468 C CG   . GLU A 1 35  ? 119.511 8.341   4.914   1.00 0.00 ? 35  GLU A CG   6  
ATOM 11469 C CD   . GLU A 1 35  ? 119.524 8.955   3.550   1.00 0.00 ? 35  GLU A CD   6  
ATOM 11470 O OE1  . GLU A 1 35  ? 120.042 10.072  3.416   1.00 0.00 ? 35  GLU A OE1  6  
ATOM 11471 O OE2  . GLU A 1 35  ? 118.974 8.356   2.591   1.00 0.00 ? 35  GLU A OE2  6  
ATOM 11472 H H    . GLU A 1 35  ? 120.576 7.900   7.463   1.00 0.00 ? 35  GLU A H    6  
ATOM 11473 H HA   . GLU A 1 35  ? 118.126 9.405   7.905   1.00 0.00 ? 35  GLU A HA   6  
ATOM 11474 H HB2  . GLU A 1 35  ? 117.620 9.079   5.467   1.00 0.00 ? 35  GLU A HB2  6  
ATOM 11475 H HB3  . GLU A 1 35  ? 118.951 10.156  5.834   1.00 0.00 ? 35  GLU A HB3  6  
ATOM 11476 H HG2  . GLU A 1 35  ? 120.517 8.329   5.306   1.00 0.00 ? 35  GLU A HG2  6  
ATOM 11477 H HG3  . GLU A 1 35  ? 119.136 7.330   4.839   1.00 0.00 ? 35  GLU A HG3  6  
ATOM 11478 N N    . PHE A 1 36  ? 118.346 6.540   8.430   1.00 0.00 ? 36  PHE A N    6  
ATOM 11479 C CA   . PHE A 1 36  ? 117.708 5.295   8.889   1.00 0.00 ? 36  PHE A CA   6  
ATOM 11480 C C    . PHE A 1 36  ? 117.424 4.328   7.740   1.00 0.00 ? 36  PHE A C    6  
ATOM 11481 O O    . PHE A 1 36  ? 116.525 3.488   7.821   1.00 0.00 ? 36  PHE A O    6  
ATOM 11482 C CB   . PHE A 1 36  ? 116.412 5.616   9.658   1.00 0.00 ? 36  PHE A CB   6  
ATOM 11483 C CG   . PHE A 1 36  ? 116.616 6.509   10.855  1.00 0.00 ? 36  PHE A CG   6  
ATOM 11484 C CD1  . PHE A 1 36  ? 117.079 5.991   12.049  1.00 0.00 ? 36  PHE A CD1  6  
ATOM 11485 C CD2  . PHE A 1 36  ? 116.352 7.868   10.777  1.00 0.00 ? 36  PHE A CD2  6  
ATOM 11486 C CE1  . PHE A 1 36  ? 117.276 6.808   13.143  1.00 0.00 ? 36  PHE A CE1  6  
ATOM 11487 C CE2  . PHE A 1 36  ? 116.546 8.691   11.868  1.00 0.00 ? 36  PHE A CE2  6  
ATOM 11488 C CZ   . PHE A 1 36  ? 117.009 8.161   13.052  1.00 0.00 ? 36  PHE A CZ   6  
ATOM 11489 H H    . PHE A 1 36  ? 119.208 6.790   8.829   1.00 0.00 ? 36  PHE A H    6  
ATOM 11490 H HA   . PHE A 1 36  ? 118.394 4.815   9.572   1.00 0.00 ? 36  PHE A HA   6  
ATOM 11491 H HB2  . PHE A 1 36  ? 115.722 6.115   8.994   1.00 0.00 ? 36  PHE A HB2  6  
ATOM 11492 H HB3  . PHE A 1 36  ? 115.968 4.694   10.002  1.00 0.00 ? 36  PHE A HB3  6  
ATOM 11493 H HD1  . PHE A 1 36  ? 117.288 4.934   12.122  1.00 0.00 ? 36  PHE A HD1  6  
ATOM 11494 H HD2  . PHE A 1 36  ? 115.989 8.285   9.849   1.00 0.00 ? 36  PHE A HD2  6  
ATOM 11495 H HE1  . PHE A 1 36  ? 117.638 6.389   14.071  1.00 0.00 ? 36  PHE A HE1  6  
ATOM 11496 H HE2  . PHE A 1 36  ? 116.336 9.748   11.793  1.00 0.00 ? 36  PHE A HE2  6  
ATOM 11497 H HZ   . PHE A 1 36  ? 117.164 8.800   13.909  1.00 0.00 ? 36  PHE A HZ   6  
ATOM 11498 N N    . SER A 1 37  ? 118.224 4.397   6.713   1.00 0.00 ? 37  SER A N    6  
ATOM 11499 C CA   . SER A 1 37  ? 118.016 3.589   5.546   1.00 0.00 ? 37  SER A CA   6  
ATOM 11500 C C    . SER A 1 37  ? 119.063 2.491   5.455   1.00 0.00 ? 37  SER A C    6  
ATOM 11501 O O    . SER A 1 37  ? 119.247 1.859   4.396   1.00 0.00 ? 37  SER A O    6  
ATOM 11502 C CB   . SER A 1 37  ? 118.065 4.485   4.336   1.00 0.00 ? 37  SER A CB   6  
ATOM 11503 O OG   . SER A 1 37  ? 119.253 5.242   4.347   1.00 0.00 ? 37  SER A OG   6  
ATOM 11504 H H    . SER A 1 37  ? 118.997 5.008   6.717   1.00 0.00 ? 37  SER A H    6  
ATOM 11505 H HA   . SER A 1 37  ? 117.033 3.146   5.607   1.00 0.00 ? 37  SER A HA   6  
ATOM 11506 H HB2  . SER A 1 37  ? 118.039 3.882   3.440   1.00 0.00 ? 37  SER A HB2  6  
ATOM 11507 H HB3  . SER A 1 37  ? 117.222 5.159   4.349   1.00 0.00 ? 37  SER A HB3  6  
ATOM 11508 H HG   . SER A 1 37  ? 119.383 5.561   3.443   1.00 0.00 ? 37  SER A HG   6  
ATOM 11509 N N    . GLU A 1 38  ? 119.705 2.216   6.601   1.00 0.00 ? 38  GLU A N    6  
ATOM 11510 C CA   . GLU A 1 38  ? 120.762 1.198   6.725   1.00 0.00 ? 38  GLU A CA   6  
ATOM 11511 C C    . GLU A 1 38  ? 120.187 -0.198  6.414   1.00 0.00 ? 38  GLU A C    6  
ATOM 11512 O O    . GLU A 1 38  ? 120.916 -1.144  6.103   1.00 0.00 ? 38  GLU A O    6  
ATOM 11513 C CB   . GLU A 1 38  ? 121.373 1.270   8.138   1.00 0.00 ? 38  GLU A CB   6  
ATOM 11514 C CG   . GLU A 1 38  ? 122.509 0.294   8.411   1.00 0.00 ? 38  GLU A CG   6  
ATOM 11515 C CD   . GLU A 1 38  ? 123.016 0.383   9.830   1.00 0.00 ? 38  GLU A CD   6  
ATOM 11516 O OE1  . GLU A 1 38  ? 122.203 0.325   10.772  1.00 0.00 ? 38  GLU A OE1  6  
ATOM 11517 O OE2  . GLU A 1 38  ? 124.236 0.459   10.041  1.00 0.00 ? 38  GLU A OE2  6  
ATOM 11518 H H    . GLU A 1 38  ? 119.435 2.720   7.399   1.00 0.00 ? 38  GLU A H    6  
ATOM 11519 H HA   . GLU A 1 38  ? 121.521 1.429   5.991   1.00 0.00 ? 38  GLU A HA   6  
ATOM 11520 H HB2  . GLU A 1 38  ? 121.753 2.269   8.298   1.00 0.00 ? 38  GLU A HB2  6  
ATOM 11521 H HB3  . GLU A 1 38  ? 120.588 1.083   8.856   1.00 0.00 ? 38  GLU A HB3  6  
ATOM 11522 H HG2  . GLU A 1 38  ? 122.153 -0.710  8.235   1.00 0.00 ? 38  GLU A HG2  6  
ATOM 11523 H HG3  . GLU A 1 38  ? 123.325 0.508   7.736   1.00 0.00 ? 38  GLU A HG3  6  
ATOM 11524 N N    . GLU A 1 39  ? 118.860 -0.254  6.448   1.00 0.00 ? 39  GLU A N    6  
ATOM 11525 C CA   . GLU A 1 39  ? 118.024 -1.411  6.124   1.00 0.00 ? 39  GLU A CA   6  
ATOM 11526 C C    . GLU A 1 39  ? 118.503 -2.075  4.831   1.00 0.00 ? 39  GLU A C    6  
ATOM 11527 O O    . GLU A 1 39  ? 118.657 -3.270  4.776   1.00 0.00 ? 39  GLU A O    6  
ATOM 11528 C CB   . GLU A 1 39  ? 116.597 -0.913  5.843   1.00 0.00 ? 39  GLU A CB   6