data_2JNU
# 
_entry.id   2JNU 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.321 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2JNU         
RCSB  RCSB100066   
WWPDB D_1000100066 
BMRB  15128        
# 
_pdbx_database_related.db_name        BMRB 
_pdbx_database_related.db_id          15128 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.entry_id                        2JNU 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2007-02-02 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  REL 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Dowler, E.F.'                         1  
'Diehl, A.'                            2  
'Bray, J.'                             3  
'Elkins, J.'                           4  
'Soundararajan, M.'                    5  
'Doyle, D.A.'                          6  
'Gileadi, C.'                          7  
'Phillips, C.'                         8  
'Schoch, G.A.'                         9  
'Yang, X.'                             10 
'Brockmann, C.'                        11 
'Leidert, M.'                          12 
'Rehbein, K.'                          13 
'Schmieder, P.'                        14 
'Kuhne, R.'                            15 
'Higman, V.A.'                         16 
'Sundstrom, M.'                        17 
'Arrowsmith, C.'                       18 
'Weigelt, J.'                          19 
'Edwards, A.'                          20 
'Oschkinat, H.'                        21 
'Ball, L.J.'                           22 
'Structural Genomics Consortium (SGC)' 23 
# 
_citation.id                        primary 
_citation.title                     
'Structural diversity in the RGS domain and its interaction with heterotrimeric G protein alpha-subunits.' 
_citation.journal_abbrev            Proc.Natl.Acad.Sci.Usa 
_citation.journal_volume            105 
_citation.page_first                6457 
_citation.page_last                 6462 
_citation.year                      2008 
_citation.journal_id_ASTM           PNASA6 
_citation.country                   US 
_citation.journal_id_ISSN           0027-8424 
_citation.journal_id_CSD            0040 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   18434541 
_citation.pdbx_database_id_DOI      10.1073/pnas.0801508105 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Soundararajan, M.' 1  ? 
primary 'Willard, F.S.'     2  ? 
primary 'Kimple, A.J.'      3  ? 
primary 'Turnbull, A.P.'    4  ? 
primary 'Ball, L.J.'        5  ? 
primary 'Schoch, G.A.'      6  ? 
primary 'Gileadi, C.'       7  ? 
primary 'Fedorov, O.Y.'     8  ? 
primary 'Dowler, E.F.'      9  ? 
primary 'Higman, V.A.'      10 ? 
primary 'Hutsell, S.Q.'     11 ? 
primary 'Sundstrom, M.'     12 ? 
primary 'Doyle, D.A.'       13 ? 
primary 'Siderovski, D.P.'  14 ? 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'Regulator of G-protein signaling 14' 
_entity.formula_weight             17717.902 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              'RGS domain, sequence database residues 56-207' 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        RGS14 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;SMTEEQPVASWALSFERLLQDPLGLAYFTEFLKKEFSAENVTFWKACERFQQIPASDTQQLAQEARNIYQEFLSSQALSP
VNIDRQAWLGEEVLAEPRPDMFRAQQLQIFNLMKFDSYARFVKSPLYRECLLAEAEGRPLREPGSSRLGSPDAT
;
_entity_poly.pdbx_seq_one_letter_code_can   
;SMTEEQPVASWALSFERLLQDPLGLAYFTEFLKKEFSAENVTFWKACERFQQIPASDTQQLAQEARNIYQEFLSSQALSP
VNIDRQAWLGEEVLAEPRPDMFRAQQLQIFNLMKFDSYARFVKSPLYRECLLAEAEGRPLREPGSSRLGSPDAT
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   MET n 
1 3   THR n 
1 4   GLU n 
1 5   GLU n 
1 6   GLN n 
1 7   PRO n 
1 8   VAL n 
1 9   ALA n 
1 10  SER n 
1 11  TRP n 
1 12  ALA n 
1 13  LEU n 
1 14  SER n 
1 15  PHE n 
1 16  GLU n 
1 17  ARG n 
1 18  LEU n 
1 19  LEU n 
1 20  GLN n 
1 21  ASP n 
1 22  PRO n 
1 23  LEU n 
1 24  GLY n 
1 25  LEU n 
1 26  ALA n 
1 27  TYR n 
1 28  PHE n 
1 29  THR n 
1 30  GLU n 
1 31  PHE n 
1 32  LEU n 
1 33  LYS n 
1 34  LYS n 
1 35  GLU n 
1 36  PHE n 
1 37  SER n 
1 38  ALA n 
1 39  GLU n 
1 40  ASN n 
1 41  VAL n 
1 42  THR n 
1 43  PHE n 
1 44  TRP n 
1 45  LYS n 
1 46  ALA n 
1 47  CYS n 
1 48  GLU n 
1 49  ARG n 
1 50  PHE n 
1 51  GLN n 
1 52  GLN n 
1 53  ILE n 
1 54  PRO n 
1 55  ALA n 
1 56  SER n 
1 57  ASP n 
1 58  THR n 
1 59  GLN n 
1 60  GLN n 
1 61  LEU n 
1 62  ALA n 
1 63  GLN n 
1 64  GLU n 
1 65  ALA n 
1 66  ARG n 
1 67  ASN n 
1 68  ILE n 
1 69  TYR n 
1 70  GLN n 
1 71  GLU n 
1 72  PHE n 
1 73  LEU n 
1 74  SER n 
1 75  SER n 
1 76  GLN n 
1 77  ALA n 
1 78  LEU n 
1 79  SER n 
1 80  PRO n 
1 81  VAL n 
1 82  ASN n 
1 83  ILE n 
1 84  ASP n 
1 85  ARG n 
1 86  GLN n 
1 87  ALA n 
1 88  TRP n 
1 89  LEU n 
1 90  GLY n 
1 91  GLU n 
1 92  GLU n 
1 93  VAL n 
1 94  LEU n 
1 95  ALA n 
1 96  GLU n 
1 97  PRO n 
1 98  ARG n 
1 99  PRO n 
1 100 ASP n 
1 101 MET n 
1 102 PHE n 
1 103 ARG n 
1 104 ALA n 
1 105 GLN n 
1 106 GLN n 
1 107 LEU n 
1 108 GLN n 
1 109 ILE n 
1 110 PHE n 
1 111 ASN n 
1 112 LEU n 
1 113 MET n 
1 114 LYS n 
1 115 PHE n 
1 116 ASP n 
1 117 SER n 
1 118 TYR n 
1 119 ALA n 
1 120 ARG n 
1 121 PHE n 
1 122 VAL n 
1 123 LYS n 
1 124 SER n 
1 125 PRO n 
1 126 LEU n 
1 127 TYR n 
1 128 ARG n 
1 129 GLU n 
1 130 CYS n 
1 131 LEU n 
1 132 LEU n 
1 133 ALA n 
1 134 GLU n 
1 135 ALA n 
1 136 GLU n 
1 137 GLY n 
1 138 ARG n 
1 139 PRO n 
1 140 LEU n 
1 141 ARG n 
1 142 GLU n 
1 143 PRO n 
1 144 GLY n 
1 145 SER n 
1 146 SER n 
1 147 ARG n 
1 148 LEU n 
1 149 GLY n 
1 150 SER n 
1 151 PRO n 
1 152 ASP n 
1 153 ALA n 
1 154 THR n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 RGS14 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'Rosetta BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          vector 
_entity_src_gen.pdbx_host_org_vector               pLIC-SGC1 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   'BL21(DE3) strain enriched with genes that encode rare tRNAs' 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    RGS14_HUMAN 
_struct_ref.pdbx_db_accession          O43566 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;TEEQPVASWALSFERLLQDPLGLAYFTEFLKKEFSAENVTFWKACERFQQIPASDTQQLAQEARNIYQEFLSSQALSPVN
IDRQAWLGEEVLAEPRPDMFRAQQLQIFNLMKFDSYARFVKSPLYRECLLAEAEGRPLREPGSSRLGSPDAT
;
_struct_ref.pdbx_align_begin           56 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2JNU 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 3 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 154 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             O43566 
_struct_ref_seq.db_align_beg                  56 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  207 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       3 
_struct_ref_seq.pdbx_auth_seq_align_end       154 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2JNU SER A 1 ? UNP O43566 ? ? 'cloning artifact' 1 1 
1 2JNU MET A 2 ? UNP O43566 ? ? 'cloning artifact' 2 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.type 
1 1  1 '2D 1H-15N HSQC'       
1 2  1 '3D 1H-15N NOESY'      
1 3  2 '3D CBCANH'            
1 4  2 '3D CBCA(CO)NH'        
2 5  3 '3D HNCO'              
2 6  3 '3D HN(CA)CO'          
1 7  4 '3D HCCH-COSY'         
1 8  4 '3D 1H-13C HMQC NOESY' 
1 9  4 '2D 1H-1H NOESY'       
1 10 4 '2D DQF-COSY'          
1 11 4 '3D HCCH-TOCSY'        
# 
loop_
_pdbx_nmr_exptl_sample_conditions.conditions_id 
_pdbx_nmr_exptl_sample_conditions.ionic_strength 
_pdbx_nmr_exptl_sample_conditions.pH 
_pdbx_nmr_exptl_sample_conditions.pressure 
_pdbx_nmr_exptl_sample_conditions.pressure_units 
_pdbx_nmr_exptl_sample_conditions.temperature 
_pdbx_nmr_exptl_sample_conditions.temperature_units 
1 ? 6   ambient ? 297 K 
2 ? 6.2 ambient ? 297 K 
# 
loop_
_pdbx_nmr_sample_details.contents 
_pdbx_nmr_sample_details.solution_id 
_pdbx_nmr_sample_details.solvent_system 
'1 mM [U-95% 15N] RGS14, 20 mM sodium phosphate, 50 mM sodium chloride, 10 % D2O, 1 mM [U-99% 2H] DTT, 90% H2O/10% D2O' 1 
'90% H2O/10% D2O' 

'1.7 mM [U-95% 13C; U-95% 15N] RGS14, 20 mM sodium phosphate, 50 mM sodium chloride, 1 mM [U-99% 2H] DTT, 10 % D2O, 90% H2O/10% D2O' 
2 '90% H2O/10% D2O' 

'1.4 mM [U-95% 13C; U-95% 15N] RGS14, 20 mM sodium phosphate, 50 mM sodium chloride, 1 mM [U-99% 2H] DTT, 10 % D2O, 90% H2O/10% D2O' 
3 '90% H2O/10% D2O' 
;1.1 mM [U-95% 13C; U-95% 15N] RGS14, 20 mM sodium phosphate, 50 mM sodium chloride, 1 mM [U-99% 2H] DTT, 100 % [U-100% 2H] D2O, 0.02 % sodium azide, 100% D2O
;
4 '100% D2O'        
# 
loop_
_pdbx_nmr_spectrometer.field_strength 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.type 
600 Bruker DRX 1 'Bruker DRX' 
750 Bruker DMX 2 'Bruker DMX' 
# 
_pdbx_nmr_refine.details            
;The final ensemble was refined in explicit water to improve Z-scores, side-chain packing and the appearance of the Ramachandran plot.
;
_pdbx_nmr_refine.entry_id           2JNU 
_pdbx_nmr_refine.method             'simulated annealing' 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_details.entry_id   2JNU 
_pdbx_nmr_details.text       
;Only the structured RGS domain region, from residue 1-136 of our construct, is shown here. The unstructured C-terminal tail, from residue  
137-154, has been truncated for ease of viewing. The flexibility of the C-terminal residues is supported by  (a) 15NT1, 15NT2 and heteronuclear  
NOE data (b) lack of significant NOEs in this region.
;
# 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the lowest energy' 
_pdbx_nmr_ensemble.conformers_calculated_total_number            200 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.entry_id                                      2JNU 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   0.3 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    5 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   0.3 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.entry_id             2JNU 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_software.authors 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.ordinal 
'Bruker Biospin'                               collection                  XwinNMR      '2.6 and 3.1' 1 
'Bruker Biospin'                               processing                  XwinNMR      '2.6 and 3.1' 2 
Goddard                                        'peak picking'              Sparky       3.100         3 
Goddard                                        'chemical shift assignment' Sparky       3.100         4 
Goddard                                        'data analysis'             Sparky       3.100         5 
'Guntert, Mumenthaler and Wuthrich'            'structure solution'        CYANA        2.1           6 
'Schwieters, Kuszewski, Tjandra and Clore'     'structure solution'        'X-PLOR NIH' 2.14          7 
'Schwieters, Kuszewski, Tjandra and Clore'     refinement                  'X-PLOR NIH' 2.14          8 
'Brunger, Adams, Clore, Gros, Nilges and Read' refinement                  CNSSOLVE     1.1           9 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.entry_id                   2JNU 
_exptl.method                     'SOLUTION NMR' 
_exptl.method_details             ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      ? 
_exptl_crystal.density_percent_sol   ? 
_exptl_crystal.description           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             ? 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_struct.entry_id                  2JNU 
_struct.title                     'Solution structure of the RGS domain of human RGS14' 
_struct.pdbx_descriptor           'Regulator of G-protein signaling 14' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2JNU 
_struct_keywords.pdbx_keywords   'SIGNALING PROTEIN' 
_struct_keywords.text            
'Regulator of G-protein signalling domain, Structural Genomics, Structural Genomics Consortium, SGC, SIGNALING PROTEIN' 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 PRO A 7   ? LEU A 13  ? PRO A 7   LEU A 13  5 ? 7  
HELX_P HELX_P2 2 SER A 14  ? ASP A 21  ? SER A 14  ASP A 21  1 ? 8  
HELX_P HELX_P3 3 ASP A 21  ? LEU A 32  ? ASP A 21  LEU A 32  1 ? 12 
HELX_P HELX_P4 4 ALA A 38  ? ILE A 53  ? ALA A 38  ILE A 53  1 ? 16 
HELX_P HELX_P5 5 ASP A 57  ? LEU A 73  ? ASP A 57  LEU A 73  1 ? 17 
HELX_P HELX_P6 6 GLY A 90  ? GLU A 96  ? GLY A 90  GLU A 96  1 ? 7  
HELX_P HELX_P7 7 PHE A 102 ? PHE A 115 ? PHE A 102 PHE A 115 1 ? 14 
HELX_P HELX_P8 8 ASP A 116 ? VAL A 122 ? ASP A 116 VAL A 122 1 ? 7  
HELX_P HELX_P9 9 LEU A 126 ? LEU A 132 ? LEU A 126 LEU A 132 1 ? 7  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_atom_sites.entry_id                    2JNU 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . SER A 1 1   ? -13.488 -16.572 5.304   1.00 0.00 ? 1   SER A N    1  
ATOM 2     C CA   . SER A 1 1   ? -12.539 -17.643 4.928   1.00 0.00 ? 1   SER A CA   1  
ATOM 3     C C    . SER A 1 1   ? -11.493 -17.126 3.932   1.00 0.00 ? 1   SER A C    1  
ATOM 4     O O    . SER A 1 1   ? -10.613 -17.873 3.509   1.00 0.00 ? 1   SER A O    1  
ATOM 5     C CB   . SER A 1 1   ? -13.312 -18.824 4.330   1.00 0.00 ? 1   SER A CB   1  
ATOM 6     O OG   . SER A 1 1   ? -14.337 -19.259 5.212   1.00 0.00 ? 1   SER A OG   1  
ATOM 7     H H1   . SER A 1 1   ? -13.958 -16.198 4.454   1.00 0.00 ? 1   SER A H1   1  
ATOM 8     H H2   . SER A 1 1   ? -12.987 -15.795 5.779   1.00 0.00 ? 1   SER A H2   1  
ATOM 9     H H3   . SER A 1 1   ? -14.213 -16.949 5.948   1.00 0.00 ? 1   SER A H3   1  
ATOM 10    H HA   . SER A 1 1   ? -12.031 -17.971 5.824   1.00 0.00 ? 1   SER A HA   1  
ATOM 11    H HB2  . SER A 1 1   ? -13.766 -18.523 3.396   1.00 0.00 ? 1   SER A HB2  1  
ATOM 12    H HB3  . SER A 1 1   ? -12.634 -19.647 4.152   1.00 0.00 ? 1   SER A HB3  1  
ATOM 13    H HG   . SER A 1 1   ? -14.141 -20.156 5.508   1.00 0.00 ? 1   SER A HG   1  
ATOM 14    N N    . MET A 1 2   ? -11.609 -15.842 3.559   1.00 0.00 ? 2   MET A N    1  
ATOM 15    C CA   . MET A 1 2   ? -10.680 -15.191 2.623   1.00 0.00 ? 2   MET A CA   1  
ATOM 16    C C    . MET A 1 2   ? -10.734 -15.843 1.237   1.00 0.00 ? 2   MET A C    1  
ATOM 17    O O    . MET A 1 2   ? -9.833  -15.662 0.418   1.00 0.00 ? 2   MET A O    1  
ATOM 18    C CB   . MET A 1 2   ? -9.242  -15.211 3.169   1.00 0.00 ? 2   MET A CB   1  
ATOM 19    C CG   . MET A 1 2   ? -9.080  -14.520 4.519   1.00 0.00 ? 2   MET A CG   1  
ATOM 20    S SD   . MET A 1 2   ? -9.621  -12.797 4.500   1.00 0.00 ? 2   MET A SD   1  
ATOM 21    C CE   . MET A 1 2   ? -9.211  -12.292 6.170   1.00 0.00 ? 2   MET A CE   1  
ATOM 22    H H    . MET A 1 2   ? -12.346 -15.310 3.922   1.00 0.00 ? 2   MET A H    1  
ATOM 23    H HA   . MET A 1 2   ? -10.997 -14.161 2.521   1.00 0.00 ? 2   MET A HA   1  
ATOM 24    H HB2  . MET A 1 2   ? -8.924  -16.239 3.276   1.00 0.00 ? 2   MET A HB2  1  
ATOM 25    H HB3  . MET A 1 2   ? -8.593  -14.717 2.458   1.00 0.00 ? 2   MET A HB3  1  
ATOM 26    H HG2  . MET A 1 2   ? -9.664  -15.055 5.255   1.00 0.00 ? 2   MET A HG2  1  
ATOM 27    H HG3  . MET A 1 2   ? -8.037  -14.553 4.801   1.00 0.00 ? 2   MET A HG3  1  
ATOM 28    H HE1  . MET A 1 2   ? -9.753  -12.905 6.877   1.00 0.00 ? 2   MET A HE1  1  
ATOM 29    H HE2  . MET A 1 2   ? -9.483  -11.256 6.310   1.00 0.00 ? 2   MET A HE2  1  
ATOM 30    H HE3  . MET A 1 2   ? -8.149  -12.409 6.332   1.00 0.00 ? 2   MET A HE3  1  
ATOM 31    N N    . THR A 1 3   ? -11.809 -16.583 0.976   1.00 0.00 ? 3   THR A N    1  
ATOM 32    C CA   . THR A 1 3   ? -12.000 -17.245 -0.311  1.00 0.00 ? 3   THR A CA   1  
ATOM 33    C C    . THR A 1 3   ? -12.435 -16.240 -1.378  1.00 0.00 ? 3   THR A C    1  
ATOM 34    O O    . THR A 1 3   ? -12.109 -16.383 -2.558  1.00 0.00 ? 3   THR A O    1  
ATOM 35    C CB   . THR A 1 3   ? -13.052 -18.372 -0.194  1.00 0.00 ? 3   THR A CB   1  
ATOM 36    O OG1  . THR A 1 3   ? -14.225 -17.876 0.471   1.00 0.00 ? 3   THR A OG1  1  
ATOM 37    C CG2  . THR A 1 3   ? -12.499 -19.567 0.579   1.00 0.00 ? 3   THR A CG2  1  
ATOM 38    H H    . THR A 1 3   ? -12.495 -16.683 1.665   1.00 0.00 ? 3   THR A H    1  
ATOM 39    H HA   . THR A 1 3   ? -11.057 -17.687 -0.607  1.00 0.00 ? 3   THR A HA   1  
ATOM 40    H HB   . THR A 1 3   ? -13.323 -18.701 -1.188  1.00 0.00 ? 3   THR A HB   1  
ATOM 41    H HG1  . THR A 1 3   ? -14.969 -18.458 0.277   1.00 0.00 ? 3   THR A HG1  1  
ATOM 42    H HG21 . THR A 1 3   ? -13.255 -20.335 0.642   1.00 0.00 ? 3   THR A HG21 1  
ATOM 43    H HG22 . THR A 1 3   ? -12.220 -19.256 1.576   1.00 0.00 ? 3   THR A HG22 1  
ATOM 44    H HG23 . THR A 1 3   ? -11.630 -19.958 0.068   1.00 0.00 ? 3   THR A HG23 1  
ATOM 45    N N    . GLU A 1 4   ? -13.176 -15.225 -0.940  1.00 0.00 ? 4   GLU A N    1  
ATOM 46    C CA   . GLU A 1 4   ? -13.652 -14.152 -1.808  1.00 0.00 ? 4   GLU A CA   1  
ATOM 47    C C    . GLU A 1 4   ? -13.411 -12.809 -1.124  1.00 0.00 ? 4   GLU A C    1  
ATOM 48    O O    . GLU A 1 4   ? -13.174 -12.763 0.084   1.00 0.00 ? 4   GLU A O    1  
ATOM 49    C CB   . GLU A 1 4   ? -15.149 -14.329 -2.110  1.00 0.00 ? 4   GLU A CB   1  
ATOM 50    C CG   . GLU A 1 4   ? -15.471 -15.477 -3.064  1.00 0.00 ? 4   GLU A CG   1  
ATOM 51    C CD   . GLU A 1 4   ? -15.055 -15.188 -4.501  1.00 0.00 ? 4   GLU A CD   1  
ATOM 52    O OE1  . GLU A 1 4   ? -15.712 -14.346 -5.156  1.00 0.00 ? 4   GLU A OE1  1  
ATOM 53    O OE2  . GLU A 1 4   ? -14.088 -15.806 -4.994  1.00 0.00 ? 4   GLU A OE2  1  
ATOM 54    H H    . GLU A 1 4   ? -13.405 -15.190 0.011   1.00 0.00 ? 4   GLU A H    1  
ATOM 55    H HA   . GLU A 1 4   ? -13.091 -14.182 -2.733  1.00 0.00 ? 4   GLU A HA   1  
ATOM 56    H HB2  . GLU A 1 4   ? -15.670 -14.510 -1.180  1.00 0.00 ? 4   GLU A HB2  1  
ATOM 57    H HB3  . GLU A 1 4   ? -15.527 -13.413 -2.546  1.00 0.00 ? 4   GLU A HB3  1  
ATOM 58    H HG2  . GLU A 1 4   ? -14.956 -16.365 -2.725  1.00 0.00 ? 4   GLU A HG2  1  
ATOM 59    H HG3  . GLU A 1 4   ? -16.538 -15.656 -3.043  1.00 0.00 ? 4   GLU A HG3  1  
ATOM 60    N N    . GLU A 1 5   ? -13.484 -11.726 -1.886  1.00 0.00 ? 5   GLU A N    1  
ATOM 61    C CA   . GLU A 1 5   ? -13.243 -10.386 -1.352  1.00 0.00 ? 5   GLU A CA   1  
ATOM 62    C C    . GLU A 1 5   ? -14.272 -9.398  -1.897  1.00 0.00 ? 5   GLU A C    1  
ATOM 63    O O    . GLU A 1 5   ? -14.920 -9.660  -2.914  1.00 0.00 ? 5   GLU A O    1  
ATOM 64    C CB   . GLU A 1 5   ? -11.818 -9.922  -1.707  1.00 0.00 ? 5   GLU A CB   1  
ATOM 65    C CG   . GLU A 1 5   ? -11.566 -9.800  -3.208  1.00 0.00 ? 5   GLU A CG   1  
ATOM 66    C CD   . GLU A 1 5   ? -10.129 -9.422  -3.547  1.00 0.00 ? 5   GLU A CD   1  
ATOM 67    O OE1  . GLU A 1 5   ? -9.766  -8.235  -3.406  1.00 0.00 ? 5   GLU A OE1  1  
ATOM 68    O OE2  . GLU A 1 5   ? -9.358  -10.308 -3.978  1.00 0.00 ? 5   GLU A OE2  1  
ATOM 69    H H    . GLU A 1 5   ? -13.710 -11.823 -2.835  1.00 0.00 ? 5   GLU A H    1  
ATOM 70    H HA   . GLU A 1 5   ? -13.341 -10.432 -0.275  1.00 0.00 ? 5   GLU A HA   1  
ATOM 71    H HB2  . GLU A 1 5   ? -11.644 -8.954  -1.254  1.00 0.00 ? 5   GLU A HB2  1  
ATOM 72    H HB3  . GLU A 1 5   ? -11.110 -10.629 -1.299  1.00 0.00 ? 5   GLU A HB3  1  
ATOM 73    H HG2  . GLU A 1 5   ? -11.792 -10.750 -3.674  1.00 0.00 ? 5   GLU A HG2  1  
ATOM 74    H HG3  . GLU A 1 5   ? -12.226 -9.043  -3.609  1.00 0.00 ? 5   GLU A HG3  1  
ATOM 75    N N    . GLN A 1 6   ? -14.427 -8.275  -1.202  1.00 0.00 ? 6   GLN A N    1  
ATOM 76    C CA   . GLN A 1 6   ? -15.281 -7.183  -1.660  1.00 0.00 ? 6   GLN A CA   1  
ATOM 77    C C    . GLN A 1 6   ? -14.710 -6.579  -2.946  1.00 0.00 ? 6   GLN A C    1  
ATOM 78    O O    . GLN A 1 6   ? -13.545 -6.814  -3.279  1.00 0.00 ? 6   GLN A O    1  
ATOM 79    C CB   . GLN A 1 6   ? -15.374 -6.098  -0.567  1.00 0.00 ? 6   GLN A CB   1  
ATOM 80    C CG   . GLN A 1 6   ? -16.282 -6.451  0.608   1.00 0.00 ? 6   GLN A CG   1  
ATOM 81    C CD   . GLN A 1 6   ? -17.730 -6.036  0.380   1.00 0.00 ? 6   GLN A CD   1  
ATOM 82    O OE1  . GLN A 1 6   ? -18.136 -4.933  0.744   1.00 0.00 ? 6   GLN A OE1  1  
ATOM 83    N NE2  . GLN A 1 6   ? -18.514 -6.908  -0.227  1.00 0.00 ? 6   GLN A NE2  1  
ATOM 84    H H    . GLN A 1 6   ? -13.936 -8.171  -0.361  1.00 0.00 ? 6   GLN A H    1  
ATOM 85    H HA   . GLN A 1 6   ? -16.267 -7.581  -1.857  1.00 0.00 ? 6   GLN A HA   1  
ATOM 86    H HB2  . GLN A 1 6   ? -14.381 -5.917  -0.179  1.00 0.00 ? 6   GLN A HB2  1  
ATOM 87    H HB3  . GLN A 1 6   ? -15.739 -5.184  -1.016  1.00 0.00 ? 6   GLN A HB3  1  
ATOM 88    H HG2  . GLN A 1 6   ? -16.251 -7.519  0.767   1.00 0.00 ? 6   GLN A HG2  1  
ATOM 89    H HG3  . GLN A 1 6   ? -15.916 -5.950  1.494   1.00 0.00 ? 6   GLN A HG3  1  
ATOM 90    H HE21 . GLN A 1 6   ? -18.127 -7.770  -0.496  1.00 0.00 ? 6   GLN A HE21 1  
ATOM 91    H HE22 . GLN A 1 6   ? -19.447 -6.661  -0.386  1.00 0.00 ? 6   GLN A HE22 1  
ATOM 92    N N    . PRO A 1 7   ? -15.519 -5.813  -3.701  1.00 0.00 ? 7   PRO A N    1  
ATOM 93    C CA   . PRO A 1 7   ? -15.019 -5.018  -4.835  1.00 0.00 ? 7   PRO A CA   1  
ATOM 94    C C    . PRO A 1 7   ? -14.009 -3.962  -4.356  1.00 0.00 ? 7   PRO A C    1  
ATOM 95    O O    . PRO A 1 7   ? -13.207 -4.219  -3.454  1.00 0.00 ? 7   PRO A O    1  
ATOM 96    C CB   . PRO A 1 7   ? -16.296 -4.358  -5.398  1.00 0.00 ? 7   PRO A CB   1  
ATOM 97    C CG   . PRO A 1 7   ? -17.423 -5.190  -4.884  1.00 0.00 ? 7   PRO A CG   1  
ATOM 98    C CD   . PRO A 1 7   ? -16.979 -5.684  -3.537  1.00 0.00 ? 7   PRO A CD   1  
ATOM 99    H HA   . PRO A 1 7   ? -14.560 -5.644  -5.588  1.00 0.00 ? 7   PRO A HA   1  
ATOM 100   H HB2  . PRO A 1 7   ? -16.368 -3.336  -5.046  1.00 0.00 ? 7   PRO A HB2  1  
ATOM 101   H HB3  . PRO A 1 7   ? -16.263 -4.365  -6.479  1.00 0.00 ? 7   PRO A HB3  1  
ATOM 102   H HG2  . PRO A 1 7   ? -18.315 -4.586  -4.790  1.00 0.00 ? 7   PRO A HG2  1  
ATOM 103   H HG3  . PRO A 1 7   ? -17.602 -6.024  -5.550  1.00 0.00 ? 7   PRO A HG3  1  
ATOM 104   H HD2  . PRO A 1 7   ? -17.220 -4.963  -2.767  1.00 0.00 ? 7   PRO A HD2  1  
ATOM 105   H HD3  . PRO A 1 7   ? -17.429 -6.640  -3.315  1.00 0.00 ? 7   PRO A HD3  1  
ATOM 106   N N    . VAL A 1 8   ? -14.051 -2.769  -4.943  1.00 0.00 ? 8   VAL A N    1  
ATOM 107   C CA   . VAL A 1 8   ? -13.190 -1.671  -4.500  1.00 0.00 ? 8   VAL A CA   1  
ATOM 108   C C    . VAL A 1 8   ? -13.414 -1.358  -3.011  1.00 0.00 ? 8   VAL A C    1  
ATOM 109   O O    . VAL A 1 8   ? -12.592 -0.702  -2.371  1.00 0.00 ? 8   VAL A O    1  
ATOM 110   C CB   . VAL A 1 8   ? -13.422 -0.394  -5.341  1.00 0.00 ? 8   VAL A CB   1  
ATOM 111   C CG1  . VAL A 1 8   ? -13.106 -0.649  -6.813  1.00 0.00 ? 8   VAL A CG1  1  
ATOM 112   C CG2  . VAL A 1 8   ? -14.849 0.116   -5.171  1.00 0.00 ? 8   VAL A CG2  1  
ATOM 113   H H    . VAL A 1 8   ? -14.660 -2.624  -5.699  1.00 0.00 ? 8   VAL A H    1  
ATOM 114   H HA   . VAL A 1 8   ? -12.161 -1.982  -4.635  1.00 0.00 ? 8   VAL A HA   1  
ATOM 115   H HB   . VAL A 1 8   ? -12.746 0.372   -4.984  1.00 0.00 ? 8   VAL A HB   1  
ATOM 116   H HG11 . VAL A 1 8   ? -12.077 -0.964  -6.913  1.00 0.00 ? 8   VAL A HG11 1  
ATOM 117   H HG12 . VAL A 1 8   ? -13.259 0.259   -7.379  1.00 0.00 ? 8   VAL A HG12 1  
ATOM 118   H HG13 . VAL A 1 8   ? -13.757 -1.423  -7.195  1.00 0.00 ? 8   VAL A HG13 1  
ATOM 119   H HG21 . VAL A 1 8   ? -15.031 0.339   -4.130  1.00 0.00 ? 8   VAL A HG21 1  
ATOM 120   H HG22 . VAL A 1 8   ? -15.546 -0.639  -5.504  1.00 0.00 ? 8   VAL A HG22 1  
ATOM 121   H HG23 . VAL A 1 8   ? -14.984 1.013   -5.759  1.00 0.00 ? 8   VAL A HG23 1  
ATOM 122   N N    . ALA A 1 9   ? -14.527 -1.849  -2.464  1.00 0.00 ? 9   ALA A N    1  
ATOM 123   C CA   . ALA A 1 9   ? -14.856 -1.665  -1.049  1.00 0.00 ? 9   ALA A CA   1  
ATOM 124   C C    . ALA A 1 9   ? -13.757 -2.230  -0.142  1.00 0.00 ? 9   ALA A C    1  
ATOM 125   O O    . ALA A 1 9   ? -13.558 -1.753  0.975   1.00 0.00 ? 9   ALA A O    1  
ATOM 126   C CB   . ALA A 1 9   ? -16.194 -2.323  -0.732  1.00 0.00 ? 9   ALA A CB   1  
ATOM 127   H H    . ALA A 1 9   ? -15.150 -2.347  -3.031  1.00 0.00 ? 9   ALA A H    1  
ATOM 128   H HA   . ALA A 1 9   ? -14.951 -0.604  -0.864  1.00 0.00 ? 9   ALA A HA   1  
ATOM 129   H HB1  . ALA A 1 9   ? -16.960 -1.906  -1.370  1.00 0.00 ? 9   ALA A HB1  1  
ATOM 130   H HB2  . ALA A 1 9   ? -16.450 -2.144  0.302   1.00 0.00 ? 9   ALA A HB2  1  
ATOM 131   H HB3  . ALA A 1 9   ? -16.123 -3.387  -0.906  1.00 0.00 ? 9   ALA A HB3  1  
ATOM 132   N N    . SER A 1 10  ? -13.034 -3.232  -0.644  1.00 0.00 ? 10  SER A N    1  
ATOM 133   C CA   . SER A 1 10  ? -11.978 -3.888  0.125   1.00 0.00 ? 10  SER A CA   1  
ATOM 134   C C    . SER A 1 10  ? -10.898 -2.898  0.572   1.00 0.00 ? 10  SER A C    1  
ATOM 135   O O    . SER A 1 10  ? -10.193 -3.146  1.553   1.00 0.00 ? 10  SER A O    1  
ATOM 136   C CB   . SER A 1 10  ? -11.353 -5.019  -0.695  1.00 0.00 ? 10  SER A CB   1  
ATOM 137   O OG   . SER A 1 10  ? -12.316 -5.998  -1.028  1.00 0.00 ? 10  SER A OG   1  
ATOM 138   H H    . SER A 1 10  ? -13.220 -3.545  -1.555  1.00 0.00 ? 10  SER A H    1  
ATOM 139   H HA   . SER A 1 10  ? -12.437 -4.315  1.006   1.00 0.00 ? 10  SER A HA   1  
ATOM 140   H HB2  . SER A 1 10  ? -10.941 -4.615  -1.610  1.00 0.00 ? 10  SER A HB2  1  
ATOM 141   H HB3  . SER A 1 10  ? -10.565 -5.487  -0.123  1.00 0.00 ? 10  SER A HB3  1  
ATOM 142   H HG   . SER A 1 10  ? -12.324 -6.133  -1.983  1.00 0.00 ? 10  SER A HG   1  
ATOM 143   N N    . TRP A 1 11  ? -10.774 -1.775  -0.140  1.00 0.00 ? 11  TRP A N    1  
ATOM 144   C CA   . TRP A 1 11  ? -9.797  -0.749  0.224   1.00 0.00 ? 11  TRP A CA   1  
ATOM 145   C C    . TRP A 1 11  ? -10.070 -0.242  1.643   1.00 0.00 ? 11  TRP A C    1  
ATOM 146   O O    . TRP A 1 11  ? -9.162  -0.150  2.468   1.00 0.00 ? 11  TRP A O    1  
ATOM 147   C CB   . TRP A 1 11  ? -9.842  0.440   -0.746  1.00 0.00 ? 11  TRP A CB   1  
ATOM 148   C CG   . TRP A 1 11  ? -9.624  0.101   -2.196  1.00 0.00 ? 11  TRP A CG   1  
ATOM 149   C CD1  . TRP A 1 11  ? -8.944  -0.961  -2.722  1.00 0.00 ? 11  TRP A CD1  1  
ATOM 150   C CD2  . TRP A 1 11  ? -10.081 0.872   -3.308  1.00 0.00 ? 11  TRP A CD2  1  
ATOM 151   N NE1  . TRP A 1 11  ? -8.968  -0.895  -4.099  1.00 0.00 ? 11  TRP A NE1  1  
ATOM 152   C CE2  . TRP A 1 11  ? -9.663  0.223   -4.477  1.00 0.00 ? 11  TRP A CE2  1  
ATOM 153   C CE3  . TRP A 1 11  ? -10.816 2.050   -3.418  1.00 0.00 ? 11  TRP A CE3  1  
ATOM 154   C CZ2  . TRP A 1 11  ? -9.953  0.720   -5.748  1.00 0.00 ? 11  TRP A CZ2  1  
ATOM 155   C CZ3  . TRP A 1 11  ? -11.105 2.546   -4.668  1.00 0.00 ? 11  TRP A CZ3  1  
ATOM 156   C CH2  . TRP A 1 11  ? -10.678 1.882   -5.825  1.00 0.00 ? 11  TRP A CH2  1  
ATOM 157   H H    . TRP A 1 11  ? -11.353 -1.632  -0.919  1.00 0.00 ? 11  TRP A H    1  
ATOM 158   H HA   . TRP A 1 11  ? -8.813  -1.198  0.192   1.00 0.00 ? 11  TRP A HA   1  
ATOM 159   H HB2  . TRP A 1 11  ? -10.808 0.914   -0.668  1.00 0.00 ? 11  TRP A HB2  1  
ATOM 160   H HB3  . TRP A 1 11  ? -9.080  1.153   -0.457  1.00 0.00 ? 11  TRP A HB3  1  
ATOM 161   H HD1  . TRP A 1 11  ? -8.468  -1.733  -2.136  1.00 0.00 ? 11  TRP A HD1  1  
ATOM 162   H HE1  . TRP A 1 11  ? -8.550  -1.539  -4.714  1.00 0.00 ? 11  TRP A HE1  1  
ATOM 163   H HE3  . TRP A 1 11  ? -11.153 2.577   -2.540  1.00 0.00 ? 11  TRP A HE3  1  
ATOM 164   H HZ2  . TRP A 1 11  ? -9.629  0.217   -6.648  1.00 0.00 ? 11  TRP A HZ2  1  
ATOM 165   H HZ3  . TRP A 1 11  ? -11.677 3.459   -4.759  1.00 0.00 ? 11  TRP A HZ3  1  
ATOM 166   H HH2  . TRP A 1 11  ? -10.926 2.304   -6.787  1.00 0.00 ? 11  TRP A HH2  1  
ATOM 167   N N    . ALA A 1 12  ? -11.340 0.059   1.920   1.00 0.00 ? 12  ALA A N    1  
ATOM 168   C CA   . ALA A 1 12  ? -11.752 0.609   3.213   1.00 0.00 ? 12  ALA A CA   1  
ATOM 169   C C    . ALA A 1 12  ? -11.752 -0.460  4.306   1.00 0.00 ? 12  ALA A C    1  
ATOM 170   O O    . ALA A 1 12  ? -12.016 -0.166  5.476   1.00 0.00 ? 12  ALA A O    1  
ATOM 171   C CB   . ALA A 1 12  ? -13.133 1.248   3.096   1.00 0.00 ? 12  ALA A CB   1  
ATOM 172   H H    . ALA A 1 12  ? -12.025 -0.089  1.231   1.00 0.00 ? 12  ALA A H    1  
ATOM 173   H HA   . ALA A 1 12  ? -11.048 1.386   3.485   1.00 0.00 ? 12  ALA A HA   1  
ATOM 174   H HB1  . ALA A 1 12  ? -13.862 0.490   2.845   1.00 0.00 ? 12  ALA A HB1  1  
ATOM 175   H HB2  . ALA A 1 12  ? -13.117 2.001   2.323   1.00 0.00 ? 12  ALA A HB2  1  
ATOM 176   H HB3  . ALA A 1 12  ? -13.401 1.706   4.039   1.00 0.00 ? 12  ALA A HB3  1  
ATOM 177   N N    . LEU A 1 13  ? -11.473 -1.700  3.918   1.00 0.00 ? 13  LEU A N    1  
ATOM 178   C CA   . LEU A 1 13  ? -11.378 -2.805  4.871   1.00 0.00 ? 13  LEU A CA   1  
ATOM 179   C C    . LEU A 1 13  ? -9.944  -2.951  5.374   1.00 0.00 ? 13  LEU A C    1  
ATOM 180   O O    . LEU A 1 13  ? -9.714  -3.235  6.554   1.00 0.00 ? 13  LEU A O    1  
ATOM 181   C CB   . LEU A 1 13  ? -11.853 -4.120  4.228   1.00 0.00 ? 13  LEU A CB   1  
ATOM 182   C CG   . LEU A 1 13  ? -13.321 -4.137  3.765   1.00 0.00 ? 13  LEU A CG   1  
ATOM 183   C CD1  . LEU A 1 13  ? -13.681 -5.489  3.150   1.00 0.00 ? 13  LEU A CD1  1  
ATOM 184   C CD2  . LEU A 1 13  ? -14.261 -3.804  4.924   1.00 0.00 ? 13  LEU A CD2  1  
ATOM 185   H H    . LEU A 1 13  ? -11.328 -1.877  2.966   1.00 0.00 ? 13  LEU A H    1  
ATOM 186   H HA   . LEU A 1 13  ? -12.019 -2.574  5.713   1.00 0.00 ? 13  LEU A HA   1  
ATOM 187   H HB2  . LEU A 1 13  ? -11.224 -4.321  3.371   1.00 0.00 ? 13  LEU A HB2  1  
ATOM 188   H HB3  . LEU A 1 13  ? -11.717 -4.917  4.945   1.00 0.00 ? 13  LEU A HB3  1  
ATOM 189   H HG   . LEU A 1 13  ? -13.456 -3.383  3.002   1.00 0.00 ? 13  LEU A HG   1  
ATOM 190   H HD11 . LEU A 1 13  ? -13.027 -5.691  2.313   1.00 0.00 ? 13  LEU A HD11 1  
ATOM 191   H HD12 . LEU A 1 13  ? -14.705 -5.466  2.805   1.00 0.00 ? 13  LEU A HD12 1  
ATOM 192   H HD13 . LEU A 1 13  ? -13.569 -6.267  3.891   1.00 0.00 ? 13  LEU A HD13 1  
ATOM 193   H HD21 . LEU A 1 13  ? -14.028 -2.821  5.309   1.00 0.00 ? 13  LEU A HD21 1  
ATOM 194   H HD22 . LEU A 1 13  ? -14.140 -4.535  5.712   1.00 0.00 ? 13  LEU A HD22 1  
ATOM 195   H HD23 . LEU A 1 13  ? -15.283 -3.819  4.575   1.00 0.00 ? 13  LEU A HD23 1  
ATOM 196   N N    . SER A 1 14  ? -8.983  -2.756  4.476   1.00 0.00 ? 14  SER A N    1  
ATOM 197   C CA   . SER A 1 14  ? -7.568  -2.860  4.821   1.00 0.00 ? 14  SER A CA   1  
ATOM 198   C C    . SER A 1 14  ? -6.723  -1.969  3.907   1.00 0.00 ? 14  SER A C    1  
ATOM 199   O O    . SER A 1 14  ? -6.911  -1.961  2.688   1.00 0.00 ? 14  SER A O    1  
ATOM 200   C CB   . SER A 1 14  ? -7.103  -4.319  4.705   1.00 0.00 ? 14  SER A CB   1  
ATOM 201   O OG   . SER A 1 14  ? -7.947  -5.188  5.444   1.00 0.00 ? 14  SER A OG   1  
ATOM 202   H H    . SER A 1 14  ? -9.229  -2.539  3.551   1.00 0.00 ? 14  SER A H    1  
ATOM 203   H HA   . SER A 1 14  ? -7.445  -2.531  5.845   1.00 0.00 ? 14  SER A HA   1  
ATOM 204   H HB2  . SER A 1 14  ? -7.121  -4.618  3.669   1.00 0.00 ? 14  SER A HB2  1  
ATOM 205   H HB3  . SER A 1 14  ? -6.096  -4.406  5.087   1.00 0.00 ? 14  SER A HB3  1  
ATOM 206   H HG   . SER A 1 14  ? -8.261  -4.733  6.232   1.00 0.00 ? 14  SER A HG   1  
ATOM 207   N N    . PHE A 1 15  ? -5.791  -1.231  4.506   1.00 0.00 ? 15  PHE A N    1  
ATOM 208   C CA   . PHE A 1 15  ? -4.889  -0.363  3.752   1.00 0.00 ? 15  PHE A CA   1  
ATOM 209   C C    . PHE A 1 15  ? -3.979  -1.211  2.872   1.00 0.00 ? 15  PHE A C    1  
ATOM 210   O O    . PHE A 1 15  ? -3.725  -0.874  1.719   1.00 0.00 ? 15  PHE A O    1  
ATOM 211   C CB   . PHE A 1 15  ? -4.058  0.505   4.708   1.00 0.00 ? 15  PHE A CB   1  
ATOM 212   C CG   . PHE A 1 15  ? -3.015  1.351   4.016   1.00 0.00 ? 15  PHE A CG   1  
ATOM 213   C CD1  . PHE A 1 15  ? -3.367  2.196   2.972   1.00 0.00 ? 15  PHE A CD1  1  
ATOM 214   C CD2  . PHE A 1 15  ? -1.685  1.301   4.409   1.00 0.00 ? 15  PHE A CD2  1  
ATOM 215   C CE1  . PHE A 1 15  ? -2.418  2.972   2.337   1.00 0.00 ? 15  PHE A CE1  1  
ATOM 216   C CE2  . PHE A 1 15  ? -0.732  2.074   3.775   1.00 0.00 ? 15  PHE A CE2  1  
ATOM 217   C CZ   . PHE A 1 15  ? -1.099  2.910   2.739   1.00 0.00 ? 15  PHE A CZ   1  
ATOM 218   H H    . PHE A 1 15  ? -5.693  -1.289  5.478   1.00 0.00 ? 15  PHE A H    1  
ATOM 219   H HA   . PHE A 1 15  ? -5.491  0.278   3.122   1.00 0.00 ? 15  PHE A HA   1  
ATOM 220   H HB2  . PHE A 1 15  ? -4.720  1.171   5.245   1.00 0.00 ? 15  PHE A HB2  1  
ATOM 221   H HB3  . PHE A 1 15  ? -3.554  -0.136  5.418   1.00 0.00 ? 15  PHE A HB3  1  
ATOM 222   H HD1  . PHE A 1 15  ? -4.399  2.246   2.656   1.00 0.00 ? 15  PHE A HD1  1  
ATOM 223   H HD2  . PHE A 1 15  ? -1.395  0.648   5.220   1.00 0.00 ? 15  PHE A HD2  1  
ATOM 224   H HE1  . PHE A 1 15  ? -2.706  3.626   1.526   1.00 0.00 ? 15  PHE A HE1  1  
ATOM 225   H HE2  . PHE A 1 15  ? 0.301   2.025   4.091   1.00 0.00 ? 15  PHE A HE2  1  
ATOM 226   H HZ   . PHE A 1 15  ? -0.355  3.515   2.242   1.00 0.00 ? 15  PHE A HZ   1  
ATOM 227   N N    . GLU A 1 16  ? -3.496  -2.309  3.442   1.00 0.00 ? 16  GLU A N    1  
ATOM 228   C CA   . GLU A 1 16  ? -2.728  -3.311  2.713   1.00 0.00 ? 16  GLU A CA   1  
ATOM 229   C C    . GLU A 1 16  ? -3.403  -3.640  1.376   1.00 0.00 ? 16  GLU A C    1  
ATOM 230   O O    . GLU A 1 16  ? -2.763  -3.602  0.330   1.00 0.00 ? 16  GLU A O    1  
ATOM 231   C CB   . GLU A 1 16  ? -2.577  -4.566  3.599   1.00 0.00 ? 16  GLU A CB   1  
ATOM 232   C CG   . GLU A 1 16  ? -1.901  -5.768  2.933   1.00 0.00 ? 16  GLU A CG   1  
ATOM 233   C CD   . GLU A 1 16  ? -2.864  -6.616  2.109   1.00 0.00 ? 16  GLU A CD   1  
ATOM 234   O OE1  . GLU A 1 16  ? -3.875  -7.086  2.675   1.00 0.00 ? 16  GLU A OE1  1  
ATOM 235   O OE2  . GLU A 1 16  ? -2.615  -6.816  0.902   1.00 0.00 ? 16  GLU A OE2  1  
ATOM 236   H H    . GLU A 1 16  ? -3.643  -2.441  4.396   1.00 0.00 ? 16  GLU A H    1  
ATOM 237   H HA   . GLU A 1 16  ? -1.745  -2.896  2.524   1.00 0.00 ? 16  GLU A HA   1  
ATOM 238   H HB2  . GLU A 1 16  ? -1.996  -4.299  4.470   1.00 0.00 ? 16  GLU A HB2  1  
ATOM 239   H HB3  . GLU A 1 16  ? -3.561  -4.872  3.927   1.00 0.00 ? 16  GLU A HB3  1  
ATOM 240   H HG2  . GLU A 1 16  ? -1.114  -5.408  2.285   1.00 0.00 ? 16  GLU A HG2  1  
ATOM 241   H HG3  . GLU A 1 16  ? -1.466  -6.391  3.703   1.00 0.00 ? 16  GLU A HG3  1  
ATOM 242   N N    . ARG A 1 17  ? -4.709  -3.925  1.421   1.00 0.00 ? 17  ARG A N    1  
ATOM 243   C CA   . ARG A 1 17  ? -5.471  -4.268  0.216   1.00 0.00 ? 17  ARG A CA   1  
ATOM 244   C C    . ARG A 1 17  ? -5.452  -3.093  -0.766  1.00 0.00 ? 17  ARG A C    1  
ATOM 245   O O    . ARG A 1 17  ? -5.169  -3.270  -1.951  1.00 0.00 ? 17  ARG A O    1  
ATOM 246   C CB   . ARG A 1 17  ? -6.922  -4.650  0.589   1.00 0.00 ? 17  ARG A CB   1  
ATOM 247   C CG   . ARG A 1 17  ? -7.665  -5.501  -0.454  1.00 0.00 ? 17  ARG A CG   1  
ATOM 248   C CD   . ARG A 1 17  ? -7.958  -4.742  -1.749  1.00 0.00 ? 17  ARG A CD   1  
ATOM 249   N NE   . ARG A 1 17  ? -8.774  -5.527  -2.684  1.00 0.00 ? 17  ARG A NE   1  
ATOM 250   C CZ   . ARG A 1 17  ? -9.272  -5.052  -3.829  1.00 0.00 ? 17  ARG A CZ   1  
ATOM 251   N NH1  . ARG A 1 17  ? -9.027  -3.801  -4.200  1.00 0.00 ? 17  ARG A NH1  1  
ATOM 252   N NH2  . ARG A 1 17  ? -10.014 -5.833  -4.603  1.00 0.00 ? 17  ARG A NH2  1  
ATOM 253   H H    . ARG A 1 17  ? -5.168  -3.907  2.284   1.00 0.00 ? 17  ARG A H    1  
ATOM 254   H HA   . ARG A 1 17  ? -4.990  -5.119  -0.248  1.00 0.00 ? 17  ARG A HA   1  
ATOM 255   H HB2  . ARG A 1 17  ? -6.902  -5.207  1.514   1.00 0.00 ? 17  ARG A HB2  1  
ATOM 256   H HB3  . ARG A 1 17  ? -7.489  -3.741  0.747   1.00 0.00 ? 17  ARG A HB3  1  
ATOM 257   H HG2  . ARG A 1 17  ? -7.060  -6.363  -0.692  1.00 0.00 ? 17  ARG A HG2  1  
ATOM 258   H HG3  . ARG A 1 17  ? -8.601  -5.832  -0.026  1.00 0.00 ? 17  ARG A HG3  1  
ATOM 259   H HD2  . ARG A 1 17  ? -8.487  -3.831  -1.505  1.00 0.00 ? 17  ARG A HD2  1  
ATOM 260   H HD3  . ARG A 1 17  ? -7.021  -4.493  -2.226  1.00 0.00 ? 17  ARG A HD3  1  
ATOM 261   H HE   . ARG A 1 17  ? -8.964  -6.467  -2.440  1.00 0.00 ? 17  ARG A HE   1  
ATOM 262   H HH11 . ARG A 1 17  ? -8.470  -3.206  -3.621  1.00 0.00 ? 17  ARG A HH11 1  
ATOM 263   H HH12 . ARG A 1 17  ? -9.384  -3.454  -5.072  1.00 0.00 ? 17  ARG A HH12 1  
ATOM 264   H HH21 . ARG A 1 17  ? -10.201 -6.783  -4.323  1.00 0.00 ? 17  ARG A HH21 1  
ATOM 265   H HH22 . ARG A 1 17  ? -10.390 -5.485  -5.462  1.00 0.00 ? 17  ARG A HH22 1  
ATOM 266   N N    . LEU A 1 18  ? -5.751  -1.895  -0.262  1.00 0.00 ? 18  LEU A N    1  
ATOM 267   C CA   . LEU A 1 18  ? -5.712  -0.674  -1.075  1.00 0.00 ? 18  LEU A CA   1  
ATOM 268   C C    . LEU A 1 18  ? -4.349  -0.518  -1.742  1.00 0.00 ? 18  LEU A C    1  
ATOM 269   O O    . LEU A 1 18  ? -4.243  -0.156  -2.914  1.00 0.00 ? 18  LEU A O    1  
ATOM 270   C CB   . LEU A 1 18  ? -5.976  0.564   -0.198  1.00 0.00 ? 18  LEU A CB   1  
ATOM 271   C CG   . LEU A 1 18  ? -5.758  1.923   -0.895  1.00 0.00 ? 18  LEU A CG   1  
ATOM 272   C CD1  . LEU A 1 18  ? -6.864  2.206   -1.902  1.00 0.00 ? 18  LEU A CD1  1  
ATOM 273   C CD2  . LEU A 1 18  ? -5.644  3.054   0.123   1.00 0.00 ? 18  LEU A CD2  1  
ATOM 274   H H    . LEU A 1 18  ? -5.998  -1.828  0.687   1.00 0.00 ? 18  LEU A H    1  
ATOM 275   H HA   . LEU A 1 18  ? -6.476  -0.745  -1.834  1.00 0.00 ? 18  LEU A HA   1  
ATOM 276   H HB2  . LEU A 1 18  ? -7.000  0.518   0.151   1.00 0.00 ? 18  LEU A HB2  1  
ATOM 277   H HB3  . LEU A 1 18  ? -5.322  0.514   0.661   1.00 0.00 ? 18  LEU A HB3  1  
ATOM 278   H HG   . LEU A 1 18  ? -4.827  1.884   -1.444  1.00 0.00 ? 18  LEU A HG   1  
ATOM 279   H HD11 . LEU A 1 18  ? -7.814  2.270   -1.390  1.00 0.00 ? 18  LEU A HD11 1  
ATOM 280   H HD12 . LEU A 1 18  ? -6.903  1.408   -2.628  1.00 0.00 ? 18  LEU A HD12 1  
ATOM 281   H HD13 . LEU A 1 18  ? -6.664  3.140   -2.405  1.00 0.00 ? 18  LEU A HD13 1  
ATOM 282   H HD21 . LEU A 1 18  ? -5.516  3.993   -0.395  1.00 0.00 ? 18  LEU A HD21 1  
ATOM 283   H HD22 . LEU A 1 18  ? -4.788  2.877   0.759   1.00 0.00 ? 18  LEU A HD22 1  
ATOM 284   H HD23 . LEU A 1 18  ? -6.540  3.092   0.726   1.00 0.00 ? 18  LEU A HD23 1  
ATOM 285   N N    . LEU A 1 19  ? -3.320  -0.817  -0.970  1.00 0.00 ? 19  LEU A N    1  
ATOM 286   C CA   . LEU A 1 19  ? -1.943  -0.570  -1.359  1.00 0.00 ? 19  LEU A CA   1  
ATOM 287   C C    . LEU A 1 19  ? -1.394  -1.721  -2.208  1.00 0.00 ? 19  LEU A C    1  
ATOM 288   O O    . LEU A 1 19  ? -0.377  -1.580  -2.889  1.00 0.00 ? 19  LEU A O    1  
ATOM 289   C CB   . LEU A 1 19  ? -1.110  -0.376  -0.084  1.00 0.00 ? 19  LEU A CB   1  
ATOM 290   C CG   . LEU A 1 19  ? 0.308   0.161   -0.286  1.00 0.00 ? 19  LEU A CG   1  
ATOM 291   C CD1  . LEU A 1 19  ? 0.286   1.492   -1.036  1.00 0.00 ? 19  LEU A CD1  1  
ATOM 292   C CD2  . LEU A 1 19  ? 1.016   0.317   1.051   1.00 0.00 ? 19  LEU A CD2  1  
ATOM 293   H H    . LEU A 1 19  ? -3.494  -1.223  -0.096  1.00 0.00 ? 19  LEU A H    1  
ATOM 294   H HA   . LEU A 1 19  ? -1.914  0.341   -1.940  1.00 0.00 ? 19  LEU A HA   1  
ATOM 295   H HB2  . LEU A 1 19  ? -1.643  0.308   0.561   1.00 0.00 ? 19  LEU A HB2  1  
ATOM 296   H HB3  . LEU A 1 19  ? -1.041  -1.330  0.421   1.00 0.00 ? 19  LEU A HB3  1  
ATOM 297   H HG   . LEU A 1 19  ? 0.863   -0.550  -0.872  1.00 0.00 ? 19  LEU A HG   1  
ATOM 298   H HD11 . LEU A 1 19  ? -0.310  2.208   -0.486  1.00 0.00 ? 19  LEU A HD11 1  
ATOM 299   H HD12 . LEU A 1 19  ? -0.142  1.346   -2.016  1.00 0.00 ? 19  LEU A HD12 1  
ATOM 300   H HD13 . LEU A 1 19  ? 1.295   1.867   -1.137  1.00 0.00 ? 19  LEU A HD13 1  
ATOM 301   H HD21 . LEU A 1 19  ? 1.073   -0.642  1.543   1.00 0.00 ? 19  LEU A HD21 1  
ATOM 302   H HD22 . LEU A 1 19  ? 0.468   1.010   1.675   1.00 0.00 ? 19  LEU A HD22 1  
ATOM 303   H HD23 . LEU A 1 19  ? 2.015   0.696   0.889   1.00 0.00 ? 19  LEU A HD23 1  
ATOM 304   N N    . GLN A 1 20  ? -2.079  -2.858  -2.155  1.00 0.00 ? 20  GLN A N    1  
ATOM 305   C CA   . GLN A 1 20  ? -1.689  -4.043  -2.923  1.00 0.00 ? 20  GLN A CA   1  
ATOM 306   C C    . GLN A 1 20  ? -2.437  -4.077  -4.260  1.00 0.00 ? 20  GLN A C    1  
ATOM 307   O O    . GLN A 1 20  ? -1.975  -4.682  -5.232  1.00 0.00 ? 20  GLN A O    1  
ATOM 308   C CB   . GLN A 1 20  ? -2.002  -5.317  -2.118  1.00 0.00 ? 20  GLN A CB   1  
ATOM 309   C CG   . GLN A 1 20  ? -1.279  -6.567  -2.618  1.00 0.00 ? 20  GLN A CG   1  
ATOM 310   C CD   . GLN A 1 20  ? 0.219   -6.535  -2.343  1.00 0.00 ? 20  GLN A CD   1  
ATOM 311   O OE1  . GLN A 1 20  ? 1.019   -7.080  -3.110  1.00 0.00 ? 20  GLN A OE1  1  
ATOM 312   N NE2  . GLN A 1 20  ? 0.610   -5.926  -1.230  1.00 0.00 ? 20  GLN A NE2  1  
ATOM 313   H H    . GLN A 1 20  ? -2.866  -2.908  -1.574  1.00 0.00 ? 20  GLN A H    1  
ATOM 314   H HA   . GLN A 1 20  ? -0.625  -3.992  -3.112  1.00 0.00 ? 20  GLN A HA   1  
ATOM 315   H HB2  . GLN A 1 20  ? -1.718  -5.153  -1.087  1.00 0.00 ? 20  GLN A HB2  1  
ATOM 316   H HB3  . GLN A 1 20  ? -3.067  -5.502  -2.158  1.00 0.00 ? 20  GLN A HB3  1  
ATOM 317   H HG2  . GLN A 1 20  ? -1.699  -7.432  -2.125  1.00 0.00 ? 20  GLN A HG2  1  
ATOM 318   H HG3  . GLN A 1 20  ? -1.434  -6.654  -3.685  1.00 0.00 ? 20  GLN A HG3  1  
ATOM 319   H HE21 . GLN A 1 20  ? -0.079  -5.535  -0.650  1.00 0.00 ? 20  GLN A HE21 1  
ATOM 320   H HE22 . GLN A 1 20  ? 1.569   -5.892  -1.033  1.00 0.00 ? 20  GLN A HE22 1  
ATOM 321   N N    . ASP A 1 21  ? -3.597  -3.424  -4.292  1.00 0.00 ? 21  ASP A N    1  
ATOM 322   C CA   . ASP A 1 21  ? -4.461  -3.411  -5.474  1.00 0.00 ? 21  ASP A CA   1  
ATOM 323   C C    . ASP A 1 21  ? -4.097  -2.246  -6.399  1.00 0.00 ? 21  ASP A C    1  
ATOM 324   O O    . ASP A 1 21  ? -4.070  -1.093  -5.967  1.00 0.00 ? 21  ASP A O    1  
ATOM 325   C CB   . ASP A 1 21  ? -5.933  -3.315  -5.046  1.00 0.00 ? 21  ASP A CB   1  
ATOM 326   C CG   . ASP A 1 21  ? -6.894  -3.184  -6.221  1.00 0.00 ? 21  ASP A CG   1  
ATOM 327   O OD1  . ASP A 1 21  ? -6.983  -4.126  -7.036  1.00 0.00 ? 21  ASP A OD1  1  
ATOM 328   O OD2  . ASP A 1 21  ? -7.578  -2.143  -6.316  1.00 0.00 ? 21  ASP A OD2  1  
ATOM 329   H H    . ASP A 1 21  ? -3.878  -2.926  -3.497  1.00 0.00 ? 21  ASP A H    1  
ATOM 330   H HA   . ASP A 1 21  ? -4.311  -4.342  -6.003  1.00 0.00 ? 21  ASP A HA   1  
ATOM 331   H HB2  . ASP A 1 21  ? -6.195  -4.206  -4.492  1.00 0.00 ? 21  ASP A HB2  1  
ATOM 332   H HB3  . ASP A 1 21  ? -6.054  -2.455  -4.403  1.00 0.00 ? 21  ASP A HB3  1  
ATOM 333   N N    . PRO A 1 22  ? -3.814  -2.539  -7.689  1.00 0.00 ? 22  PRO A N    1  
ATOM 334   C CA   . PRO A 1 22  ? -3.401  -1.523  -8.670  1.00 0.00 ? 22  PRO A CA   1  
ATOM 335   C C    . PRO A 1 22  ? -4.379  -0.350  -8.759  1.00 0.00 ? 22  PRO A C    1  
ATOM 336   O O    . PRO A 1 22  ? -3.966  0.811   -8.736  1.00 0.00 ? 22  PRO A O    1  
ATOM 337   C CB   . PRO A 1 22  ? -3.359  -2.299  -9.995  1.00 0.00 ? 22  PRO A CB   1  
ATOM 338   C CG   . PRO A 1 22  ? -3.136  -3.716  -9.593  1.00 0.00 ? 22  PRO A CG   1  
ATOM 339   C CD   . PRO A 1 22  ? -3.869  -3.889  -8.290  1.00 0.00 ? 22  PRO A CD   1  
ATOM 340   H HA   . PRO A 1 22  ? -2.414  -1.142  -8.443  1.00 0.00 ? 22  PRO A HA   1  
ATOM 341   H HB2  . PRO A 1 22  ? -4.298  -2.179  -10.520 1.00 0.00 ? 22  PRO A HB2  1  
ATOM 342   H HB3  . PRO A 1 22  ? -2.549  -1.929  -10.610 1.00 0.00 ? 22  PRO A HB3  1  
ATOM 343   H HG2  . PRO A 1 22  ? -3.539  -4.381  -10.344 1.00 0.00 ? 22  PRO A HG2  1  
ATOM 344   H HG3  . PRO A 1 22  ? -2.078  -3.901  -9.457  1.00 0.00 ? 22  PRO A HG3  1  
ATOM 345   H HD2  . PRO A 1 22  ? -4.891  -4.191  -8.467  1.00 0.00 ? 22  PRO A HD2  1  
ATOM 346   H HD3  . PRO A 1 22  ? -3.363  -4.611  -7.664  1.00 0.00 ? 22  PRO A HD3  1  
ATOM 347   N N    . LEU A 1 23  ? -5.673  -0.660  -8.852  1.00 0.00 ? 23  LEU A N    1  
ATOM 348   C CA   . LEU A 1 23  ? -6.704  0.373   -8.946  1.00 0.00 ? 23  LEU A CA   1  
ATOM 349   C C    . LEU A 1 23  ? -6.673  1.267   -7.714  1.00 0.00 ? 23  LEU A C    1  
ATOM 350   O O    . LEU A 1 23  ? -6.636  2.496   -7.824  1.00 0.00 ? 23  LEU A O    1  
ATOM 351   C CB   . LEU A 1 23  ? -8.096  -0.259  -9.107  1.00 0.00 ? 23  LEU A CB   1  
ATOM 352   C CG   . LEU A 1 23  ? -8.380  -0.890  -10.480 1.00 0.00 ? 23  LEU A CG   1  
ATOM 353   C CD1  . LEU A 1 23  ? -9.744  -1.577  -10.485 1.00 0.00 ? 23  LEU A CD1  1  
ATOM 354   C CD2  . LEU A 1 23  ? -8.303  0.170   -11.580 1.00 0.00 ? 23  LEU A CD2  1  
ATOM 355   H H    . LEU A 1 23  ? -5.940  -1.603  -8.845  1.00 0.00 ? 23  LEU A H    1  
ATOM 356   H HA   . LEU A 1 23  ? -6.488  0.975   -9.818  1.00 0.00 ? 23  LEU A HA   1  
ATOM 357   H HB2  . LEU A 1 23  ? -8.209  -1.025  -8.351  1.00 0.00 ? 23  LEU A HB2  1  
ATOM 358   H HB3  . LEU A 1 23  ? -8.839  0.507   -8.929  1.00 0.00 ? 23  LEU A HB3  1  
ATOM 359   H HG   . LEU A 1 23  ? -7.630  -1.641  -10.686 1.00 0.00 ? 23  LEU A HG   1  
ATOM 360   H HD11 . LEU A 1 23  ? -9.757  -2.357  -9.739  1.00 0.00 ? 23  LEU A HD11 1  
ATOM 361   H HD12 . LEU A 1 23  ? -9.928  -2.008  -11.458 1.00 0.00 ? 23  LEU A HD12 1  
ATOM 362   H HD13 . LEU A 1 23  ? -10.515 -0.853  -10.261 1.00 0.00 ? 23  LEU A HD13 1  
ATOM 363   H HD21 . LEU A 1 23  ? -7.309  0.593   -11.604 1.00 0.00 ? 23  LEU A HD21 1  
ATOM 364   H HD22 . LEU A 1 23  ? -9.021  0.954   -11.379 1.00 0.00 ? 23  LEU A HD22 1  
ATOM 365   H HD23 . LEU A 1 23  ? -8.524  -0.283  -12.535 1.00 0.00 ? 23  LEU A HD23 1  
ATOM 366   N N    . GLY A 1 24  ? -6.669  0.638   -6.545  1.00 0.00 ? 24  GLY A N    1  
ATOM 367   C CA   . GLY A 1 24  ? -6.643  1.371   -5.294  1.00 0.00 ? 24  GLY A CA   1  
ATOM 368   C C    . GLY A 1 24  ? -5.479  2.329   -5.215  1.00 0.00 ? 24  GLY A C    1  
ATOM 369   O O    . GLY A 1 24  ? -5.661  3.528   -4.985  1.00 0.00 ? 24  GLY A O    1  
ATOM 370   H H    . GLY A 1 24  ? -6.683  -0.344  -6.532  1.00 0.00 ? 24  GLY A H    1  
ATOM 371   H HA2  . GLY A 1 24  ? -7.566  1.925   -5.192  1.00 0.00 ? 24  GLY A HA2  1  
ATOM 372   H HA3  . GLY A 1 24  ? -6.569  0.665   -4.480  1.00 0.00 ? 24  GLY A HA3  1  
ATOM 373   N N    . LEU A 1 25  ? -4.283  1.797   -5.429  1.00 0.00 ? 25  LEU A N    1  
ATOM 374   C CA   . LEU A 1 25  ? -3.066  2.590   -5.367  1.00 0.00 ? 25  LEU A CA   1  
ATOM 375   C C    . LEU A 1 25  ? -3.099  3.706   -6.414  1.00 0.00 ? 25  LEU A C    1  
ATOM 376   O O    . LEU A 1 25  ? -2.657  4.823   -6.150  1.00 0.00 ? 25  LEU A O    1  
ATOM 377   C CB   . LEU A 1 25  ? -1.828  1.692   -5.570  1.00 0.00 ? 25  LEU A CB   1  
ATOM 378   C CG   . LEU A 1 25  ? -0.724  1.841   -4.509  1.00 0.00 ? 25  LEU A CG   1  
ATOM 379   C CD1  . LEU A 1 25  ? 0.452   0.919   -4.822  1.00 0.00 ? 25  LEU A CD1  1  
ATOM 380   C CD2  . LEU A 1 25  ? -0.260  3.295   -4.398  1.00 0.00 ? 25  LEU A CD2  1  
ATOM 381   H H    . LEU A 1 25  ? -4.218  0.837   -5.628  1.00 0.00 ? 25  LEU A H    1  
ATOM 382   H HA   . LEU A 1 25  ? -3.016  3.039   -4.384  1.00 0.00 ? 25  LEU A HA   1  
ATOM 383   H HB2  . LEU A 1 25  ? -2.156  0.661   -5.574  1.00 0.00 ? 25  LEU A HB2  1  
ATOM 384   H HB3  . LEU A 1 25  ? -1.398  1.912   -6.537  1.00 0.00 ? 25  LEU A HB3  1  
ATOM 385   H HG   . LEU A 1 25  ? -1.122  1.547   -3.547  1.00 0.00 ? 25  LEU A HG   1  
ATOM 386   H HD11 . LEU A 1 25  ? 0.863   1.170   -5.790  1.00 0.00 ? 25  LEU A HD11 1  
ATOM 387   H HD12 . LEU A 1 25  ? 0.113   -0.107  -4.831  1.00 0.00 ? 25  LEU A HD12 1  
ATOM 388   H HD13 . LEU A 1 25  ? 1.215   1.037   -4.066  1.00 0.00 ? 25  LEU A HD13 1  
ATOM 389   H HD21 . LEU A 1 25  ? 0.518   3.369   -3.652  1.00 0.00 ? 25  LEU A HD21 1  
ATOM 390   H HD22 . LEU A 1 25  ? -1.094  3.919   -4.110  1.00 0.00 ? 25  LEU A HD22 1  
ATOM 391   H HD23 . LEU A 1 25  ? 0.124   3.626   -5.353  1.00 0.00 ? 25  LEU A HD23 1  
ATOM 392   N N    . ALA A 1 26  ? -3.649  3.402   -7.589  1.00 0.00 ? 26  ALA A N    1  
ATOM 393   C CA   . ALA A 1 26  ? -3.698  4.361   -8.693  1.00 0.00 ? 26  ALA A CA   1  
ATOM 394   C C    . ALA A 1 26  ? -4.514  5.598   -8.322  1.00 0.00 ? 26  ALA A C    1  
ATOM 395   O O    . ALA A 1 26  ? -4.007  6.720   -8.378  1.00 0.00 ? 26  ALA A O    1  
ATOM 396   C CB   . ALA A 1 26  ? -4.263  3.712   -9.949  1.00 0.00 ? 26  ALA A CB   1  
ATOM 397   H H    . ALA A 1 26  ? -4.032  2.507   -7.717  1.00 0.00 ? 26  ALA A H    1  
ATOM 398   H HA   . ALA A 1 26  ? -2.682  4.667   -8.906  1.00 0.00 ? 26  ALA A HA   1  
ATOM 399   H HB1  . ALA A 1 26  ? -4.231  4.419   -10.767 1.00 0.00 ? 26  ALA A HB1  1  
ATOM 400   H HB2  . ALA A 1 26  ? -5.286  3.409   -9.774  1.00 0.00 ? 26  ALA A HB2  1  
ATOM 401   H HB3  . ALA A 1 26  ? -3.671  2.844   -10.203 1.00 0.00 ? 26  ALA A HB3  1  
ATOM 402   N N    . TYR A 1 27  ? -5.774  5.389   -7.937  1.00 0.00 ? 27  TYR A N    1  
ATOM 403   C CA   . TYR A 1 27  ? -6.656  6.497   -7.558  1.00 0.00 ? 27  TYR A CA   1  
ATOM 404   C C    . TYR A 1 27  ? -6.085  7.238   -6.352  1.00 0.00 ? 27  TYR A C    1  
ATOM 405   O O    . TYR A 1 27  ? -6.120  8.471   -6.285  1.00 0.00 ? 27  TYR A O    1  
ATOM 406   C CB   . TYR A 1 27  ? -8.073  5.995   -7.244  1.00 0.00 ? 27  TYR A CB   1  
ATOM 407   C CG   . TYR A 1 27  ? -8.786  5.374   -8.434  1.00 0.00 ? 27  TYR A CG   1  
ATOM 408   C CD1  . TYR A 1 27  ? -9.223  6.159   -9.497  1.00 0.00 ? 27  TYR A CD1  1  
ATOM 409   C CD2  . TYR A 1 27  ? -9.023  4.005   -8.492  1.00 0.00 ? 27  TYR A CD2  1  
ATOM 410   C CE1  . TYR A 1 27  ? -9.872  5.596   -10.580 1.00 0.00 ? 27  TYR A CE1  1  
ATOM 411   C CE2  . TYR A 1 27  ? -9.671  3.438   -9.571  1.00 0.00 ? 27  TYR A CE2  1  
ATOM 412   C CZ   . TYR A 1 27  ? -10.093 4.235   -10.611 1.00 0.00 ? 27  TYR A CZ   1  
ATOM 413   O OH   . TYR A 1 27  ? -10.742 3.669   -11.685 1.00 0.00 ? 27  TYR A OH   1  
ATOM 414   H H    . TYR A 1 27  ? -6.117  4.468   -7.902  1.00 0.00 ? 27  TYR A H    1  
ATOM 415   H HA   . TYR A 1 27  ? -6.702  7.182   -8.394  1.00 0.00 ? 27  TYR A HA   1  
ATOM 416   H HB2  . TYR A 1 27  ? -8.018  5.250   -6.463  1.00 0.00 ? 27  TYR A HB2  1  
ATOM 417   H HB3  . TYR A 1 27  ? -8.672  6.826   -6.896  1.00 0.00 ? 27  TYR A HB3  1  
ATOM 418   H HD1  . TYR A 1 27  ? -9.047  7.226   -9.471  1.00 0.00 ? 27  TYR A HD1  1  
ATOM 419   H HD2  . TYR A 1 27  ? -8.691  3.379   -7.678  1.00 0.00 ? 27  TYR A HD2  1  
ATOM 420   H HE1  . TYR A 1 27  ? -10.203 6.221   -11.397 1.00 0.00 ? 27  TYR A HE1  1  
ATOM 421   H HE2  . TYR A 1 27  ? -9.845  2.371   -9.596  1.00 0.00 ? 27  TYR A HE2  1  
ATOM 422   H HH   . TYR A 1 27  ? -11.347 2.988   -11.369 1.00 0.00 ? 27  TYR A HH   1  
ATOM 423   N N    . PHE A 1 28  ? -5.546  6.470   -5.412  1.00 0.00 ? 28  PHE A N    1  
ATOM 424   C CA   . PHE A 1 28  ? -4.912  7.022   -4.220  1.00 0.00 ? 28  PHE A CA   1  
ATOM 425   C C    . PHE A 1 28  ? -3.745  7.931   -4.614  1.00 0.00 ? 28  PHE A C    1  
ATOM 426   O O    . PHE A 1 28  ? -3.564  9.014   -4.053  1.00 0.00 ? 28  PHE A O    1  
ATOM 427   C CB   . PHE A 1 28  ? -4.439  5.870   -3.318  1.00 0.00 ? 28  PHE A CB   1  
ATOM 428   C CG   . PHE A 1 28  ? -3.755  6.297   -2.043  1.00 0.00 ? 28  PHE A CG   1  
ATOM 429   C CD1  . PHE A 1 28  ? -4.227  7.374   -1.305  1.00 0.00 ? 28  PHE A CD1  1  
ATOM 430   C CD2  . PHE A 1 28  ? -2.646  5.606   -1.577  1.00 0.00 ? 28  PHE A CD2  1  
ATOM 431   C CE1  . PHE A 1 28  ? -3.604  7.751   -0.132  1.00 0.00 ? 28  PHE A CE1  1  
ATOM 432   C CE2  . PHE A 1 28  ? -2.021  5.981   -0.405  1.00 0.00 ? 28  PHE A CE2  1  
ATOM 433   C CZ   . PHE A 1 28  ? -2.500  7.053   0.317   1.00 0.00 ? 28  PHE A CZ   1  
ATOM 434   H H    . PHE A 1 28  ? -5.578  5.494   -5.521  1.00 0.00 ? 28  PHE A H    1  
ATOM 435   H HA   . PHE A 1 28  ? -5.651  7.608   -3.690  1.00 0.00 ? 28  PHE A HA   1  
ATOM 436   H HB2  . PHE A 1 28  ? -5.293  5.270   -3.043  1.00 0.00 ? 28  PHE A HB2  1  
ATOM 437   H HB3  . PHE A 1 28  ? -3.746  5.254   -3.877  1.00 0.00 ? 28  PHE A HB3  1  
ATOM 438   H HD1  . PHE A 1 28  ? -5.090  7.922   -1.656  1.00 0.00 ? 28  PHE A HD1  1  
ATOM 439   H HD2  . PHE A 1 28  ? -2.269  4.764   -2.142  1.00 0.00 ? 28  PHE A HD2  1  
ATOM 440   H HE1  . PHE A 1 28  ? -3.978  8.593   0.433   1.00 0.00 ? 28  PHE A HE1  1  
ATOM 441   H HE2  . PHE A 1 28  ? -1.157  5.435   -0.055  1.00 0.00 ? 28  PHE A HE2  1  
ATOM 442   H HZ   . PHE A 1 28  ? -2.011  7.347   1.234   1.00 0.00 ? 28  PHE A HZ   1  
ATOM 443   N N    . THR A 1 29  ? -2.982  7.492   -5.607  1.00 0.00 ? 29  THR A N    1  
ATOM 444   C CA   . THR A 1 29  ? -1.835  8.244   -6.097  1.00 0.00 ? 29  THR A CA   1  
ATOM 445   C C    . THR A 1 29  ? -2.282  9.377   -7.032  1.00 0.00 ? 29  THR A C    1  
ATOM 446   O O    . THR A 1 29  ? -1.545  10.334  -7.250  1.00 0.00 ? 29  THR A O    1  
ATOM 447   C CB   . THR A 1 29  ? -0.836  7.305   -6.819  1.00 0.00 ? 29  THR A CB   1  
ATOM 448   O OG1  . THR A 1 29  ? -0.398  6.283   -5.913  1.00 0.00 ? 29  THR A OG1  1  
ATOM 449   C CG2  . THR A 1 29  ? 0.381   8.057   -7.349  1.00 0.00 ? 29  THR A CG2  1  
ATOM 450   H H    . THR A 1 29  ? -3.199  6.635   -6.029  1.00 0.00 ? 29  THR A H    1  
ATOM 451   H HA   . THR A 1 29  ? -1.332  8.678   -5.243  1.00 0.00 ? 29  THR A HA   1  
ATOM 452   H HB   . THR A 1 29  ? -1.343  6.837   -7.652  1.00 0.00 ? 29  THR A HB   1  
ATOM 453   H HG1  . THR A 1 29  ? -1.163  5.810   -5.574  1.00 0.00 ? 29  THR A HG1  1  
ATOM 454   H HG21 . THR A 1 29  ? 0.061   8.813   -8.051  1.00 0.00 ? 29  THR A HG21 1  
ATOM 455   H HG22 . THR A 1 29  ? 1.041   7.362   -7.848  1.00 0.00 ? 29  THR A HG22 1  
ATOM 456   H HG23 . THR A 1 29  ? 0.903   8.524   -6.527  1.00 0.00 ? 29  THR A HG23 1  
ATOM 457   N N    . GLU A 1 30  ? -3.495  9.271   -7.579  1.00 0.00 ? 30  GLU A N    1  
ATOM 458   C CA   . GLU A 1 30  ? -4.042  10.327  -8.435  1.00 0.00 ? 30  GLU A CA   1  
ATOM 459   C C    . GLU A 1 30  ? -4.291  11.598  -7.633  1.00 0.00 ? 30  GLU A C    1  
ATOM 460   O O    . GLU A 1 30  ? -4.078  12.709  -8.130  1.00 0.00 ? 30  GLU A O    1  
ATOM 461   C CB   . GLU A 1 30  ? -5.327  9.869   -9.140  1.00 0.00 ? 30  GLU A CB   1  
ATOM 462   C CG   . GLU A 1 30  ? -5.069  9.024   -10.382 1.00 0.00 ? 30  GLU A CG   1  
ATOM 463   C CD   . GLU A 1 30  ? -4.280  9.784   -11.441 1.00 0.00 ? 30  GLU A CD   1  
ATOM 464   O OE1  . GLU A 1 30  ? -3.030  9.737   -11.414 1.00 0.00 ? 30  GLU A OE1  1  
ATOM 465   O OE2  . GLU A 1 30  ? -4.904  10.444  -12.297 1.00 0.00 ? 30  GLU A OE2  1  
ATOM 466   H H    . GLU A 1 30  ? -4.029  8.466   -7.408  1.00 0.00 ? 30  GLU A H    1  
ATOM 467   H HA   . GLU A 1 30  ? -3.296  10.547  -9.188  1.00 0.00 ? 30  GLU A HA   1  
ATOM 468   H HB2  . GLU A 1 30  ? -5.917  9.283   -8.447  1.00 0.00 ? 30  GLU A HB2  1  
ATOM 469   H HB3  . GLU A 1 30  ? -5.897  10.740  -9.435  1.00 0.00 ? 30  GLU A HB3  1  
ATOM 470   H HG2  . GLU A 1 30  ? -4.511  8.143   -10.096 1.00 0.00 ? 30  GLU A HG2  1  
ATOM 471   H HG3  . GLU A 1 30  ? -6.018  8.724   -10.804 1.00 0.00 ? 30  GLU A HG3  1  
ATOM 472   N N    . PHE A 1 31  ? -4.753  11.436  -6.400  1.00 0.00 ? 31  PHE A N    1  
ATOM 473   C CA   . PHE A 1 31  ? -4.842  12.560  -5.475  1.00 0.00 ? 31  PHE A CA   1  
ATOM 474   C C    . PHE A 1 31  ? -3.442  12.947  -5.021  1.00 0.00 ? 31  PHE A C    1  
ATOM 475   O O    . PHE A 1 31  ? -3.026  14.105  -5.135  1.00 0.00 ? 31  PHE A O    1  
ATOM 476   C CB   . PHE A 1 31  ? -5.698  12.206  -4.250  1.00 0.00 ? 31  PHE A CB   1  
ATOM 477   C CG   . PHE A 1 31  ? -7.167  12.049  -4.547  1.00 0.00 ? 31  PHE A CG   1  
ATOM 478   C CD1  . PHE A 1 31  ? -7.942  13.159  -4.853  1.00 0.00 ? 31  PHE A CD1  1  
ATOM 479   C CD2  . PHE A 1 31  ? -7.772  10.803  -4.508  1.00 0.00 ? 31  PHE A CD2  1  
ATOM 480   C CE1  . PHE A 1 31  ? -9.291  13.027  -5.116  1.00 0.00 ? 31  PHE A CE1  1  
ATOM 481   C CE2  . PHE A 1 31  ? -9.120  10.667  -4.771  1.00 0.00 ? 31  PHE A CE2  1  
ATOM 482   C CZ   . PHE A 1 31  ? -9.880  11.781  -5.074  1.00 0.00 ? 31  PHE A CZ   1  
ATOM 483   H H    . PHE A 1 31  ? -5.041  10.543  -6.105  1.00 0.00 ? 31  PHE A H    1  
ATOM 484   H HA   . PHE A 1 31  ? -5.290  13.395  -5.997  1.00 0.00 ? 31  PHE A HA   1  
ATOM 485   H HB2  . PHE A 1 31  ? -5.343  11.275  -3.831  1.00 0.00 ? 31  PHE A HB2  1  
ATOM 486   H HB3  . PHE A 1 31  ? -5.592  12.986  -3.508  1.00 0.00 ? 31  PHE A HB3  1  
ATOM 487   H HD1  . PHE A 1 31  ? -7.482  14.135  -4.888  1.00 0.00 ? 31  PHE A HD1  1  
ATOM 488   H HD2  . PHE A 1 31  ? -7.179  9.931   -4.270  1.00 0.00 ? 31  PHE A HD2  1  
ATOM 489   H HE1  . PHE A 1 31  ? -9.883  13.898  -5.352  1.00 0.00 ? 31  PHE A HE1  1  
ATOM 490   H HE2  . PHE A 1 31  ? -9.581  9.690   -4.737  1.00 0.00 ? 31  PHE A HE2  1  
ATOM 491   H HZ   . PHE A 1 31  ? -10.935 11.675  -5.280  1.00 0.00 ? 31  PHE A HZ   1  
ATOM 492   N N    . LEU A 1 32  ? -2.713  11.948  -4.538  1.00 0.00 ? 32  LEU A N    1  
ATOM 493   C CA   . LEU A 1 32  ? -1.384  12.150  -3.982  1.00 0.00 ? 32  LEU A CA   1  
ATOM 494   C C    . LEU A 1 32  ? -0.353  12.317  -5.105  1.00 0.00 ? 32  LEU A C    1  
ATOM 495   O O    . LEU A 1 32  ? 0.372   11.384  -5.446  1.00 0.00 ? 32  LEU A O    1  
ATOM 496   C CB   . LEU A 1 32  ? -1.021  10.963  -3.070  1.00 0.00 ? 32  LEU A CB   1  
ATOM 497   C CG   . LEU A 1 32  ? 0.005   11.260  -1.965  1.00 0.00 ? 32  LEU A CG   1  
ATOM 498   C CD1  . LEU A 1 32  ? -0.541  12.299  -0.989  1.00 0.00 ? 32  LEU A CD1  1  
ATOM 499   C CD2  . LEU A 1 32  ? 0.388   9.979   -1.228  1.00 0.00 ? 32  LEU A CD2  1  
ATOM 500   H H    . LEU A 1 32  ? -3.082  11.039  -4.560  1.00 0.00 ? 32  LEU A H    1  
ATOM 501   H HA   . LEU A 1 32  ? -1.405  13.054  -3.390  1.00 0.00 ? 32  LEU A HA   1  
ATOM 502   H HB2  . LEU A 1 32  ? -1.928  10.609  -2.602  1.00 0.00 ? 32  LEU A HB2  1  
ATOM 503   H HB3  . LEU A 1 32  ? -0.628  10.169  -3.690  1.00 0.00 ? 32  LEU A HB3  1  
ATOM 504   H HG   . LEU A 1 32  ? 0.898   11.667  -2.415  1.00 0.00 ? 32  LEU A HG   1  
ATOM 505   H HD11 . LEU A 1 32  ? -1.441  11.925  -0.523  1.00 0.00 ? 32  LEU A HD11 1  
ATOM 506   H HD12 . LEU A 1 32  ? -0.765  13.213  -1.522  1.00 0.00 ? 32  LEU A HD12 1  
ATOM 507   H HD13 . LEU A 1 32  ? 0.200   12.502  -0.228  1.00 0.00 ? 32  LEU A HD13 1  
ATOM 508   H HD21 . LEU A 1 32  ? 0.790   9.265   -1.932  1.00 0.00 ? 32  LEU A HD21 1  
ATOM 509   H HD22 . LEU A 1 32  ? -0.486  9.558   -0.750  1.00 0.00 ? 32  LEU A HD22 1  
ATOM 510   H HD23 . LEU A 1 32  ? 1.134   10.203  -0.479  1.00 0.00 ? 32  LEU A HD23 1  
ATOM 511   N N    . LYS A 1 33  ? -0.335  13.513  -5.691  1.00 0.00 ? 33  LYS A N    1  
ATOM 512   C CA   . LYS A 1 33  ? 0.610   13.881  -6.754  1.00 0.00 ? 33  LYS A CA   1  
ATOM 513   C C    . LYS A 1 33  ? 0.398   15.338  -7.163  1.00 0.00 ? 33  LYS A C    1  
ATOM 514   O O    . LYS A 1 33  ? 1.354   16.061  -7.454  1.00 0.00 ? 33  LYS A O    1  
ATOM 515   C CB   . LYS A 1 33  ? 0.478   12.979  -8.002  1.00 0.00 ? 33  LYS A CB   1  
ATOM 516   C CG   . LYS A 1 33  ? -0.921  12.955  -8.627  1.00 0.00 ? 33  LYS A CG   1  
ATOM 517   C CD   . LYS A 1 33  ? -0.892  12.584  -10.115 1.00 0.00 ? 33  LYS A CD   1  
ATOM 518   C CE   . LYS A 1 33  ? -0.094  11.313  -10.401 1.00 0.00 ? 33  LYS A CE   1  
ATOM 519   N NZ   . LYS A 1 33  ? -0.722  10.098  -9.819  1.00 0.00 ? 33  LYS A NZ   1  
ATOM 520   H H    . LYS A 1 33  ? -0.976  14.191  -5.379  1.00 0.00 ? 33  LYS A H    1  
ATOM 521   H HA   . LYS A 1 33  ? 1.609   13.779  -6.350  1.00 0.00 ? 33  LYS A HA   1  
ATOM 522   H HB2  . LYS A 1 33  ? 1.176   13.324  -8.752  1.00 0.00 ? 33  LYS A HB2  1  
ATOM 523   H HB3  . LYS A 1 33  ? 0.742   11.967  -7.726  1.00 0.00 ? 33  LYS A HB3  1  
ATOM 524   H HG2  . LYS A 1 33  ? -1.526  12.231  -8.101  1.00 0.00 ? 33  LYS A HG2  1  
ATOM 525   H HG3  . LYS A 1 33  ? -1.367  13.935  -8.520  1.00 0.00 ? 33  LYS A HG3  1  
ATOM 526   H HD2  . LYS A 1 33  ? -1.908  12.436  -10.455 1.00 0.00 ? 33  LYS A HD2  1  
ATOM 527   H HD3  . LYS A 1 33  ? -0.451  13.404  -10.666 1.00 0.00 ? 33  LYS A HD3  1  
ATOM 528   H HE2  . LYS A 1 33  ? -0.022  11.184  -11.472 1.00 0.00 ? 33  LYS A HE2  1  
ATOM 529   H HE3  . LYS A 1 33  ? 0.898   11.424  -9.990  1.00 0.00 ? 33  LYS A HE3  1  
ATOM 530   H HZ1  . LYS A 1 33  ? -0.111  9.269   -9.978  1.00 0.00 ? 33  LYS A HZ1  1  
ATOM 531   H HZ2  . LYS A 1 33  ? -1.647  9.919   -10.265 1.00 0.00 ? 33  LYS A HZ2  1  
ATOM 532   H HZ3  . LYS A 1 33  ? -0.859  10.221  -8.798  1.00 0.00 ? 33  LYS A HZ3  1  
ATOM 533   N N    . LYS A 1 34  ? -0.865  15.767  -7.164  1.00 0.00 ? 34  LYS A N    1  
ATOM 534   C CA   . LYS A 1 34  ? -1.233  17.113  -7.611  1.00 0.00 ? 34  LYS A CA   1  
ATOM 535   C C    . LYS A 1 34  ? -0.763  18.172  -6.614  1.00 0.00 ? 34  LYS A C    1  
ATOM 536   O O    . LYS A 1 34  ? -0.494  19.317  -6.985  1.00 0.00 ? 34  LYS A O    1  
ATOM 537   C CB   . LYS A 1 34  ? -2.752  17.205  -7.814  1.00 0.00 ? 34  LYS A CB   1  
ATOM 538   C CG   . LYS A 1 34  ? -3.278  16.270  -8.900  1.00 0.00 ? 34  LYS A CG   1  
ATOM 539   C CD   . LYS A 1 34  ? -4.783  16.421  -9.104  1.00 0.00 ? 34  LYS A CD   1  
ATOM 540   C CE   . LYS A 1 34  ? -5.287  15.568  -10.264 1.00 0.00 ? 34  LYS A CE   1  
ATOM 541   N NZ   . LYS A 1 34  ? -5.119  14.113  -10.011 1.00 0.00 ? 34  LYS A NZ   1  
ATOM 542   H H    . LYS A 1 34  ? -1.572  15.160  -6.855  1.00 0.00 ? 34  LYS A H    1  
ATOM 543   H HA   . LYS A 1 34  ? -0.743  17.290  -8.559  1.00 0.00 ? 34  LYS A HA   1  
ATOM 544   H HB2  . LYS A 1 34  ? -3.245  16.960  -6.883  1.00 0.00 ? 34  LYS A HB2  1  
ATOM 545   H HB3  . LYS A 1 34  ? -3.007  18.220  -8.088  1.00 0.00 ? 34  LYS A HB3  1  
ATOM 546   H HG2  . LYS A 1 34  ? -2.776  16.498  -9.831  1.00 0.00 ? 34  LYS A HG2  1  
ATOM 547   H HG3  . LYS A 1 34  ? -3.061  15.248  -8.616  1.00 0.00 ? 34  LYS A HG3  1  
ATOM 548   H HD2  . LYS A 1 34  ? -5.292  16.117  -8.200  1.00 0.00 ? 34  LYS A HD2  1  
ATOM 549   H HD3  . LYS A 1 34  ? -5.005  17.459  -9.310  1.00 0.00 ? 34  LYS A HD3  1  
ATOM 550   H HE2  . LYS A 1 34  ? -6.336  15.775  -10.418 1.00 0.00 ? 34  LYS A HE2  1  
ATOM 551   H HE3  . LYS A 1 34  ? -4.737  15.834  -11.156 1.00 0.00 ? 34  LYS A HE3  1  
ATOM 552   H HZ1  . LYS A 1 34  ? -5.768  13.801  -9.259  1.00 0.00 ? 34  LYS A HZ1  1  
ATOM 553   H HZ2  . LYS A 1 34  ? -4.145  13.906  -9.716  1.00 0.00 ? 34  LYS A HZ2  1  
ATOM 554   H HZ3  . LYS A 1 34  ? -5.325  13.573  -10.876 1.00 0.00 ? 34  LYS A HZ3  1  
ATOM 555   N N    . GLU A 1 35  ? -0.679  17.780  -5.351  1.00 0.00 ? 35  GLU A N    1  
ATOM 556   C CA   . GLU A 1 35  ? -0.165  18.646  -4.286  1.00 0.00 ? 35  GLU A CA   1  
ATOM 557   C C    . GLU A 1 35  ? 1.282   18.266  -3.951  1.00 0.00 ? 35  GLU A C    1  
ATOM 558   O O    . GLU A 1 35  ? 1.992   18.997  -3.254  1.00 0.00 ? 35  GLU A O    1  
ATOM 559   C CB   . GLU A 1 35  ? -1.072  18.556  -3.041  1.00 0.00 ? 35  GLU A CB   1  
ATOM 560   C CG   . GLU A 1 35  ? -1.757  17.198  -2.851  1.00 0.00 ? 35  GLU A CG   1  
ATOM 561   C CD   . GLU A 1 35  ? -0.779  16.039  -2.734  1.00 0.00 ? 35  GLU A CD   1  
ATOM 562   O OE1  . GLU A 1 35  ? -0.361  15.725  -1.605  1.00 0.00 ? 35  GLU A OE1  1  
ATOM 563   O OE2  . GLU A 1 35  ? -0.418  15.450  -3.775  1.00 0.00 ? 35  GLU A OE2  1  
ATOM 564   H H    . GLU A 1 35  ? -0.966  16.869  -5.121  1.00 0.00 ? 35  GLU A H    1  
ATOM 565   H HA   . GLU A 1 35  ? -0.173  19.664  -4.654  1.00 0.00 ? 35  GLU A HA   1  
ATOM 566   H HB2  . GLU A 1 35  ? -0.479  18.759  -2.160  1.00 0.00 ? 35  GLU A HB2  1  
ATOM 567   H HB3  . GLU A 1 35  ? -1.842  19.311  -3.120  1.00 0.00 ? 35  GLU A HB3  1  
ATOM 568   H HG2  . GLU A 1 35  ? -2.356  17.237  -1.951  1.00 0.00 ? 35  GLU A HG2  1  
ATOM 569   H HG3  . GLU A 1 35  ? -2.406  17.019  -3.699  1.00 0.00 ? 35  GLU A HG3  1  
ATOM 570   N N    . PHE A 1 36  ? 1.685   17.105  -4.461  1.00 0.00 ? 36  PHE A N    1  
ATOM 571   C CA   . PHE A 1 36  ? 3.046   16.592  -4.343  1.00 0.00 ? 36  PHE A CA   1  
ATOM 572   C C    . PHE A 1 36  ? 3.384   16.206  -2.899  1.00 0.00 ? 36  PHE A C    1  
ATOM 573   O O    . PHE A 1 36  ? 4.219   16.832  -2.244  1.00 0.00 ? 36  PHE A O    1  
ATOM 574   C CB   . PHE A 1 36  ? 4.075   17.589  -4.911  1.00 0.00 ? 36  PHE A CB   1  
ATOM 575   C CG   . PHE A 1 36  ? 5.476   17.028  -5.003  1.00 0.00 ? 36  PHE A CG   1  
ATOM 576   C CD1  . PHE A 1 36  ? 5.789   16.064  -5.954  1.00 0.00 ? 36  PHE A CD1  1  
ATOM 577   C CD2  . PHE A 1 36  ? 6.477   17.459  -4.141  1.00 0.00 ? 36  PHE A CD2  1  
ATOM 578   C CE1  . PHE A 1 36  ? 7.067   15.544  -6.041  1.00 0.00 ? 36  PHE A CE1  1  
ATOM 579   C CE2  . PHE A 1 36  ? 7.755   16.941  -4.227  1.00 0.00 ? 36  PHE A CE2  1  
ATOM 580   C CZ   . PHE A 1 36  ? 8.050   15.983  -5.177  1.00 0.00 ? 36  PHE A CZ   1  
ATOM 581   H H    . PHE A 1 36  ? 1.024   16.555  -4.929  1.00 0.00 ? 36  PHE A H    1  
ATOM 582   H HA   . PHE A 1 36  ? 3.087   15.691  -4.940  1.00 0.00 ? 36  PHE A HA   1  
ATOM 583   H HB2  . PHE A 1 36  ? 3.769   17.882  -5.906  1.00 0.00 ? 36  PHE A HB2  1  
ATOM 584   H HB3  . PHE A 1 36  ? 4.104   18.465  -4.279  1.00 0.00 ? 36  PHE A HB3  1  
ATOM 585   H HD1  . PHE A 1 36  ? 5.021   15.718  -6.631  1.00 0.00 ? 36  PHE A HD1  1  
ATOM 586   H HD2  . PHE A 1 36  ? 6.251   18.209  -3.397  1.00 0.00 ? 36  PHE A HD2  1  
ATOM 587   H HE1  . PHE A 1 36  ? 7.296   14.795  -6.784  1.00 0.00 ? 36  PHE A HE1  1  
ATOM 588   H HE2  . PHE A 1 36  ? 8.525   17.283  -3.549  1.00 0.00 ? 36  PHE A HE2  1  
ATOM 589   H HZ   . PHE A 1 36  ? 9.049   15.578  -5.244  1.00 0.00 ? 36  PHE A HZ   1  
ATOM 590   N N    . SER A 1 37  ? 2.693   15.192  -2.396  1.00 0.00 ? 37  SER A N    1  
ATOM 591   C CA   . SER A 1 37  ? 3.083   14.525  -1.156  1.00 0.00 ? 37  SER A CA   1  
ATOM 592   C C    . SER A 1 37  ? 3.154   13.024  -1.411  1.00 0.00 ? 37  SER A C    1  
ATOM 593   O O    . SER A 1 37  ? 3.086   12.215  -0.491  1.00 0.00 ? 37  SER A O    1  
ATOM 594   C CB   . SER A 1 37  ? 2.095   14.843  -0.022  1.00 0.00 ? 37  SER A CB   1  
ATOM 595   O OG   . SER A 1 37  ? 2.524   14.291  1.217   1.00 0.00 ? 37  SER A OG   1  
ATOM 596   H H    . SER A 1 37  ? 1.873   14.898  -2.855  1.00 0.00 ? 37  SER A H    1  
ATOM 597   H HA   . SER A 1 37  ? 4.069   14.875  -0.879  1.00 0.00 ? 37  SER A HA   1  
ATOM 598   H HB2  . SER A 1 37  ? 2.014   15.914  0.088   1.00 0.00 ? 37  SER A HB2  1  
ATOM 599   H HB3  . SER A 1 37  ? 1.125   14.434  -0.267  1.00 0.00 ? 37  SER A HB3  1  
ATOM 600   H HG   . SER A 1 37  ? 3.107   13.538  1.048   1.00 0.00 ? 37  SER A HG   1  
ATOM 601   N N    . ALA A 1 38  ? 3.313   12.668  -2.686  1.00 0.00 ? 38  ALA A N    1  
ATOM 602   C CA   . ALA A 1 38  ? 3.396   11.271  -3.108  1.00 0.00 ? 38  ALA A CA   1  
ATOM 603   C C    . ALA A 1 38  ? 4.687   10.615  -2.628  1.00 0.00 ? 38  ALA A C    1  
ATOM 604   O O    . ALA A 1 38  ? 4.851   9.402   -2.750  1.00 0.00 ? 38  ALA A O    1  
ATOM 605   C CB   . ALA A 1 38  ? 3.294   11.176  -4.626  1.00 0.00 ? 38  ALA A CB   1  
ATOM 606   H H    . ALA A 1 38  ? 3.372   13.368  -3.366  1.00 0.00 ? 38  ALA A H    1  
ATOM 607   H HA   . ALA A 1 38  ? 2.554   10.743  -2.681  1.00 0.00 ? 38  ALA A HA   1  
ATOM 608   H HB1  . ALA A 1 38  ? 2.381   11.649  -4.957  1.00 0.00 ? 38  ALA A HB1  1  
ATOM 609   H HB2  . ALA A 1 38  ? 3.288   10.137  -4.923  1.00 0.00 ? 38  ALA A HB2  1  
ATOM 610   H HB3  . ALA A 1 38  ? 4.141   11.674  -5.077  1.00 0.00 ? 38  ALA A HB3  1  
ATOM 611   N N    . GLU A 1 39  ? 5.589   11.424  -2.074  1.00 0.00 ? 39  GLU A N    1  
ATOM 612   C CA   . GLU A 1 39  ? 6.909   10.957  -1.659  1.00 0.00 ? 39  GLU A CA   1  
ATOM 613   C C    . GLU A 1 39  ? 6.836   9.695   -0.799  1.00 0.00 ? 39  GLU A C    1  
ATOM 614   O O    . GLU A 1 39  ? 7.648   8.786   -0.958  1.00 0.00 ? 39  GLU A O    1  
ATOM 615   C CB   . GLU A 1 39  ? 7.681   12.084  -0.946  1.00 0.00 ? 39  GLU A CB   1  
ATOM 616   C CG   . GLU A 1 39  ? 6.842   12.992  -0.043  1.00 0.00 ? 39  GLU A CG   1  
ATOM 617   C CD   . GLU A 1 39  ? 6.401   12.330  1.251   1.00 0.00 ? 39  GLU A CD   1  
ATOM 618   O OE1  . GLU A 1 39  ? 7.259   12.096  2.124   1.00 0.00 ? 39  GLU A OE1  1  
ATOM 619   O OE2  . GLU A 1 39  ? 5.193   12.063  1.407   1.00 0.00 ? 39  GLU A OE2  1  
ATOM 620   H H    . GLU A 1 39  ? 5.357   12.362  -1.937  1.00 0.00 ? 39  GLU A H    1  
ATOM 621   H HA   . GLU A 1 39  ? 7.447   10.704  -2.563  1.00 0.00 ? 39  GLU A HA   1  
ATOM 622   H HB2  . GLU A 1 39  ? 8.465   11.645  -0.346  1.00 0.00 ? 39  GLU A HB2  1  
ATOM 623   H HB3  . GLU A 1 39  ? 8.134   12.700  -1.699  1.00 0.00 ? 39  GLU A HB3  1  
ATOM 624   H HG2  . GLU A 1 39  ? 7.429   13.864  0.207   1.00 0.00 ? 39  GLU A HG2  1  
ATOM 625   H HG3  . GLU A 1 39  ? 5.962   13.305  -0.591  1.00 0.00 ? 39  GLU A HG3  1  
ATOM 626   N N    . ASN A 1 40  ? 5.848   9.631   0.082   1.00 0.00 ? 40  ASN A N    1  
ATOM 627   C CA   . ASN A 1 40  ? 5.680   8.470   0.958   1.00 0.00 ? 40  ASN A CA   1  
ATOM 628   C C    . ASN A 1 40  ? 5.326   7.209   0.151   1.00 0.00 ? 40  ASN A C    1  
ATOM 629   O O    . ASN A 1 40  ? 6.064   6.222   0.189   1.00 0.00 ? 40  ASN A O    1  
ATOM 630   C CB   . ASN A 1 40  ? 4.635   8.744   2.061   1.00 0.00 ? 40  ASN A CB   1  
ATOM 631   C CG   . ASN A 1 40  ? 3.238   9.030   1.531   1.00 0.00 ? 40  ASN A CG   1  
ATOM 632   O OD1  . ASN A 1 40  ? 2.423   8.128   1.374   1.00 0.00 ? 40  ASN A OD1  1  
ATOM 633   N ND2  . ASN A 1 40  ? 2.951   10.290  1.257   1.00 0.00 ? 40  ASN A ND2  1  
ATOM 634   H H    . ASN A 1 40  ? 5.231   10.390  0.156   1.00 0.00 ? 40  ASN A H    1  
ATOM 635   H HA   . ASN A 1 40  ? 6.637   8.298   1.435   1.00 0.00 ? 40  ASN A HA   1  
ATOM 636   H HB2  . ASN A 1 40  ? 4.577   7.883   2.711   1.00 0.00 ? 40  ASN A HB2  1  
ATOM 637   H HB3  . ASN A 1 40  ? 4.960   9.597   2.643   1.00 0.00 ? 40  ASN A HB3  1  
ATOM 638   H HD21 . ASN A 1 40  ? 3.645   10.968  1.408   1.00 0.00 ? 40  ASN A HD21 1  
ATOM 639   H HD22 . ASN A 1 40  ? 2.060   10.498  0.911   1.00 0.00 ? 40  ASN A HD22 1  
ATOM 640   N N    . VAL A 1 41  ? 4.227   7.248   -0.609  1.00 0.00 ? 41  VAL A N    1  
ATOM 641   C CA   . VAL A 1 41  ? 3.778   6.076   -1.362  1.00 0.00 ? 41  VAL A CA   1  
ATOM 642   C C    . VAL A 1 41  ? 4.807   5.654   -2.408  1.00 0.00 ? 41  VAL A C    1  
ATOM 643   O O    . VAL A 1 41  ? 5.032   4.462   -2.610  1.00 0.00 ? 41  VAL A O    1  
ATOM 644   C CB   . VAL A 1 41  ? 2.406   6.298   -2.058  1.00 0.00 ? 41  VAL A CB   1  
ATOM 645   C CG1  . VAL A 1 41  ? 1.308   6.531   -1.027  1.00 0.00 ? 41  VAL A CG1  1  
ATOM 646   C CG2  . VAL A 1 41  ? 2.467   7.454   -3.056  1.00 0.00 ? 41  VAL A CG2  1  
ATOM 647   H H    . VAL A 1 41  ? 3.708   8.073   -0.657  1.00 0.00 ? 41  VAL A H    1  
ATOM 648   H HA   . VAL A 1 41  ? 3.661   5.264   -0.655  1.00 0.00 ? 41  VAL A HA   1  
ATOM 649   H HB   . VAL A 1 41  ? 2.159   5.399   -2.605  1.00 0.00 ? 41  VAL A HB   1  
ATOM 650   H HG11 . VAL A 1 41  ? 1.533   7.415   -0.450  1.00 0.00 ? 41  VAL A HG11 1  
ATOM 651   H HG12 . VAL A 1 41  ? 1.247   5.677   -0.366  1.00 0.00 ? 41  VAL A HG12 1  
ATOM 652   H HG13 . VAL A 1 41  ? 0.360   6.662   -1.531  1.00 0.00 ? 41  VAL A HG13 1  
ATOM 653   H HG21 . VAL A 1 41  ? 2.734   8.366   -2.539  1.00 0.00 ? 41  VAL A HG21 1  
ATOM 654   H HG22 . VAL A 1 41  ? 1.501   7.578   -3.525  1.00 0.00 ? 41  VAL A HG22 1  
ATOM 655   H HG23 . VAL A 1 41  ? 3.208   7.241   -3.813  1.00 0.00 ? 41  VAL A HG23 1  
ATOM 656   N N    . THR A 1 42  ? 5.444   6.625   -3.060  1.00 0.00 ? 42  THR A N    1  
ATOM 657   C CA   . THR A 1 42  ? 6.415   6.320   -4.104  1.00 0.00 ? 42  THR A CA   1  
ATOM 658   C C    . THR A 1 42  ? 7.741   5.859   -3.489  1.00 0.00 ? 42  THR A C    1  
ATOM 659   O O    . THR A 1 42  ? 8.531   5.185   -4.151  1.00 0.00 ? 42  THR A O    1  
ATOM 660   C CB   . THR A 1 42  ? 6.644   7.516   -5.065  1.00 0.00 ? 42  THR A CB   1  
ATOM 661   O OG1  . THR A 1 42  ? 7.436   7.104   -6.189  1.00 0.00 ? 42  THR A OG1  1  
ATOM 662   C CG2  . THR A 1 42  ? 7.334   8.678   -4.363  1.00 0.00 ? 42  THR A CG2  1  
ATOM 663   H H    . THR A 1 42  ? 5.255   7.560   -2.836  1.00 0.00 ? 42  THR A H    1  
ATOM 664   H HA   . THR A 1 42  ? 6.012   5.500   -4.687  1.00 0.00 ? 42  THR A HA   1  
ATOM 665   H HB   . THR A 1 42  ? 5.681   7.855   -5.423  1.00 0.00 ? 42  THR A HB   1  
ATOM 666   H HG1  . THR A 1 42  ? 8.117   6.489   -5.894  1.00 0.00 ? 42  THR A HG1  1  
ATOM 667   H HG21 . THR A 1 42  ? 6.731   9.007   -3.531  1.00 0.00 ? 42  THR A HG21 1  
ATOM 668   H HG22 . THR A 1 42  ? 7.462   9.495   -5.059  1.00 0.00 ? 42  THR A HG22 1  
ATOM 669   H HG23 . THR A 1 42  ? 8.300   8.358   -4.003  1.00 0.00 ? 42  THR A HG23 1  
ATOM 670   N N    . PHE A 1 43  ? 7.982   6.218   -2.224  1.00 0.00 ? 43  PHE A N    1  
ATOM 671   C CA   . PHE A 1 43  ? 9.128   5.685   -1.485  1.00 0.00 ? 43  PHE A CA   1  
ATOM 672   C C    . PHE A 1 43  ? 8.868   4.228   -1.136  1.00 0.00 ? 43  PHE A C    1  
ATOM 673   O O    . PHE A 1 43  ? 9.744   3.375   -1.284  1.00 0.00 ? 43  PHE A O    1  
ATOM 674   C CB   . PHE A 1 43  ? 9.397   6.492   -0.207  1.00 0.00 ? 43  PHE A CB   1  
ATOM 675   C CG   . PHE A 1 43  ? 10.508  5.922   0.647   1.00 0.00 ? 43  PHE A CG   1  
ATOM 676   C CD1  . PHE A 1 43  ? 11.836  6.062   0.267   1.00 0.00 ? 43  PHE A CD1  1  
ATOM 677   C CD2  . PHE A 1 43  ? 10.223  5.248   1.828   1.00 0.00 ? 43  PHE A CD2  1  
ATOM 678   C CE1  . PHE A 1 43  ? 12.852  5.542   1.045   1.00 0.00 ? 43  PHE A CE1  1  
ATOM 679   C CE2  . PHE A 1 43  ? 11.239  4.727   2.608   1.00 0.00 ? 43  PHE A CE2  1  
ATOM 680   C CZ   . PHE A 1 43  ? 12.554  4.875   2.216   1.00 0.00 ? 43  PHE A CZ   1  
ATOM 681   H H    . PHE A 1 43  ? 7.381   6.856   -1.780  1.00 0.00 ? 43  PHE A H    1  
ATOM 682   H HA   . PHE A 1 43  ? 9.997   5.742   -2.129  1.00 0.00 ? 43  PHE A HA   1  
ATOM 683   H HB2  . PHE A 1 43  ? 9.671   7.501   -0.477  1.00 0.00 ? 43  PHE A HB2  1  
ATOM 684   H HB3  . PHE A 1 43  ? 8.495   6.519   0.390   1.00 0.00 ? 43  PHE A HB3  1  
ATOM 685   H HD1  . PHE A 1 43  ? 12.073  6.584   -0.649  1.00 0.00 ? 43  PHE A HD1  1  
ATOM 686   H HD2  . PHE A 1 43  ? 9.194   5.129   2.135   1.00 0.00 ? 43  PHE A HD2  1  
ATOM 687   H HE1  . PHE A 1 43  ? 13.882  5.659   0.735   1.00 0.00 ? 43  PHE A HE1  1  
ATOM 688   H HE2  . PHE A 1 43  ? 11.003  4.206   3.524   1.00 0.00 ? 43  PHE A HE2  1  
ATOM 689   H HZ   . PHE A 1 43  ? 13.348  4.468   2.826   1.00 0.00 ? 43  PHE A HZ   1  
ATOM 690   N N    . TRP A 1 44  ? 7.651   3.953   -0.677  1.00 0.00 ? 44  TRP A N    1  
ATOM 691   C CA   . TRP A 1 44  ? 7.225   2.587   -0.394  1.00 0.00 ? 44  TRP A CA   1  
ATOM 692   C C    . TRP A 1 44  ? 7.295   1.764   -1.683  1.00 0.00 ? 44  TRP A C    1  
ATOM 693   O O    . TRP A 1 44  ? 7.747   0.620   -1.682  1.00 0.00 ? 44  TRP A O    1  
ATOM 694   C CB   . TRP A 1 44  ? 5.801   2.585   0.187   1.00 0.00 ? 44  TRP A CB   1  
ATOM 695   C CG   . TRP A 1 44  ? 5.348   1.241   0.680   1.00 0.00 ? 44  TRP A CG   1  
ATOM 696   C CD1  . TRP A 1 44  ? 5.522   0.724   1.932   1.00 0.00 ? 44  TRP A CD1  1  
ATOM 697   C CD2  . TRP A 1 44  ? 4.643   0.246   -0.070  1.00 0.00 ? 44  TRP A CD2  1  
ATOM 698   N NE1  . TRP A 1 44  ? 4.979   -0.536  2.005   1.00 0.00 ? 44  TRP A NE1  1  
ATOM 699   C CE2  . TRP A 1 44  ? 4.431   -0.852  0.786   1.00 0.00 ? 44  TRP A CE2  1  
ATOM 700   C CE3  . TRP A 1 44  ? 4.175   0.178   -1.386  1.00 0.00 ? 44  TRP A CE3  1  
ATOM 701   C CZ2  . TRP A 1 44  ? 3.768   -2.004  0.368   1.00 0.00 ? 44  TRP A CZ2  1  
ATOM 702   C CZ3  . TRP A 1 44  ? 3.516   -0.965  -1.800  1.00 0.00 ? 44  TRP A CZ3  1  
ATOM 703   C CH2  . TRP A 1 44  ? 3.319   -2.044  -0.925  1.00 0.00 ? 44  TRP A CH2  1  
ATOM 704   H H    . TRP A 1 44  ? 7.023   4.690   -0.522  1.00 0.00 ? 44  TRP A H    1  
ATOM 705   H HA   . TRP A 1 44  ? 7.909   2.166   0.332   1.00 0.00 ? 44  TRP A HA   1  
ATOM 706   H HB2  . TRP A 1 44  ? 5.758   3.273   1.018   1.00 0.00 ? 44  TRP A HB2  1  
ATOM 707   H HB3  . TRP A 1 44  ? 5.107   2.912   -0.576  1.00 0.00 ? 44  TRP A HB3  1  
ATOM 708   H HD1  . TRP A 1 44  ? 6.024   1.239   2.738   1.00 0.00 ? 44  TRP A HD1  1  
ATOM 709   H HE1  . TRP A 1 44  ? 4.980   -1.111  2.802   1.00 0.00 ? 44  TRP A HE1  1  
ATOM 710   H HE3  . TRP A 1 44  ? 4.316   1.005   -2.070  1.00 0.00 ? 44  TRP A HE3  1  
ATOM 711   H HZ2  . TRP A 1 44  ? 3.607   -2.843  1.030   1.00 0.00 ? 44  TRP A HZ2  1  
ATOM 712   H HZ3  . TRP A 1 44  ? 3.145   -1.035  -2.812  1.00 0.00 ? 44  TRP A HZ3  1  
ATOM 713   H HH2  . TRP A 1 44  ? 2.797   -2.917  -1.292  1.00 0.00 ? 44  TRP A HH2  1  
ATOM 714   N N    . LYS A 1 45  ? 6.860   2.381   -2.783  1.00 0.00 ? 45  LYS A N    1  
ATOM 715   C CA   . LYS A 1 45  ? 6.957   1.783   -4.114  1.00 0.00 ? 45  LYS A CA   1  
ATOM 716   C C    . LYS A 1 45  ? 8.413   1.551   -4.498  1.00 0.00 ? 45  LYS A C    1  
ATOM 717   O O    . LYS A 1 45  ? 8.739   0.556   -5.141  1.00 0.00 ? 45  LYS A O    1  
ATOM 718   C CB   . LYS A 1 45  ? 6.298   2.690   -5.165  1.00 0.00 ? 45  LYS A CB   1  
ATOM 719   C CG   . LYS A 1 45  ? 4.776   2.651   -5.167  1.00 0.00 ? 45  LYS A CG   1  
ATOM 720   C CD   . LYS A 1 45  ? 4.195   3.673   -6.141  1.00 0.00 ? 45  LYS A CD   1  
ATOM 721   C CE   . LYS A 1 45  ? 2.739   3.377   -6.468  1.00 0.00 ? 45  LYS A CE   1  
ATOM 722   N NZ   . LYS A 1 45  ? 2.594   2.097   -7.211  1.00 0.00 ? 45  LYS A NZ   1  
ATOM 723   H H    . LYS A 1 45  ? 6.455   3.268   -2.693  1.00 0.00 ? 45  LYS A H    1  
ATOM 724   H HA   . LYS A 1 45  ? 6.442   0.832   -4.094  1.00 0.00 ? 45  LYS A HA   1  
ATOM 725   H HB2  . LYS A 1 45  ? 6.608   3.709   -4.984  1.00 0.00 ? 45  LYS A HB2  1  
ATOM 726   H HB3  . LYS A 1 45  ? 6.642   2.390   -6.146  1.00 0.00 ? 45  LYS A HB3  1  
ATOM 727   H HG2  . LYS A 1 45  ? 4.451   1.662   -5.457  1.00 0.00 ? 45  LYS A HG2  1  
ATOM 728   H HG3  . LYS A 1 45  ? 4.418   2.871   -4.170  1.00 0.00 ? 45  LYS A HG3  1  
ATOM 729   H HD2  . LYS A 1 45  ? 4.260   4.656   -5.696  1.00 0.00 ? 45  LYS A HD2  1  
ATOM 730   H HD3  . LYS A 1 45  ? 4.771   3.653   -7.056  1.00 0.00 ? 45  LYS A HD3  1  
ATOM 731   H HE2  . LYS A 1 45  ? 2.178   3.314   -5.548  1.00 0.00 ? 45  LYS A HE2  1  
ATOM 732   H HE3  . LYS A 1 45  ? 2.347   4.181   -7.074  1.00 0.00 ? 45  LYS A HE3  1  
ATOM 733   H HZ1  . LYS A 1 45  ? 3.106   2.151   -8.120  1.00 0.00 ? 45  LYS A HZ1  1  
ATOM 734   H HZ2  . LYS A 1 45  ? 1.592   1.909   -7.406  1.00 0.00 ? 45  LYS A HZ2  1  
ATOM 735   H HZ3  . LYS A 1 45  ? 2.985   1.308   -6.655  1.00 0.00 ? 45  LYS A HZ3  1  
ATOM 736   N N    . ALA A 1 46  ? 9.276   2.485   -4.113  1.00 0.00 ? 46  ALA A N    1  
ATOM 737   C CA   . ALA A 1 46  ? 10.700  2.399   -4.419  1.00 0.00 ? 46  ALA A CA   1  
ATOM 738   C C    . ALA A 1 46  ? 11.346  1.240   -3.664  1.00 0.00 ? 46  ALA A C    1  
ATOM 739   O O    . ALA A 1 46  ? 12.143  0.488   -4.224  1.00 0.00 ? 46  ALA A O    1  
ATOM 740   C CB   . ALA A 1 46  ? 11.394  3.715   -4.082  1.00 0.00 ? 46  ALA A CB   1  
ATOM 741   H H    . ALA A 1 46  ? 8.945   3.259   -3.612  1.00 0.00 ? 46  ALA A H    1  
ATOM 742   H HA   . ALA A 1 46  ? 10.803  2.227   -5.483  1.00 0.00 ? 46  ALA A HA   1  
ATOM 743   H HB1  . ALA A 1 46  ? 11.325  3.900   -3.019  1.00 0.00 ? 46  ALA A HB1  1  
ATOM 744   H HB2  . ALA A 1 46  ? 10.914  4.522   -4.617  1.00 0.00 ? 46  ALA A HB2  1  
ATOM 745   H HB3  . ALA A 1 46  ? 12.431  3.661   -4.371  1.00 0.00 ? 46  ALA A HB3  1  
ATOM 746   N N    . CYS A 1 47  ? 10.987  1.096   -2.394  1.00 0.00 ? 47  CYS A N    1  
ATOM 747   C CA   . CYS A 1 47  ? 11.501  0.009   -1.570  1.00 0.00 ? 47  CYS A CA   1  
ATOM 748   C C    . CYS A 1 47  ? 10.926  -1.328  -2.043  1.00 0.00 ? 47  CYS A C    1  
ATOM 749   O O    . CYS A 1 47  ? 11.616  -2.349  -2.049  1.00 0.00 ? 47  CYS A O    1  
ATOM 750   C CB   . CYS A 1 47  ? 11.161  0.261   -0.100  1.00 0.00 ? 47  CYS A CB   1  
ATOM 751   S SG   . CYS A 1 47  ? 11.775  1.840   0.536   1.00 0.00 ? 47  CYS A SG   1  
ATOM 752   H H    . CYS A 1 47  ? 10.356  1.735   -2.003  1.00 0.00 ? 47  CYS A H    1  
ATOM 753   H HA   . CYS A 1 47  ? 12.576  -0.013  -1.683  1.00 0.00 ? 47  CYS A HA   1  
ATOM 754   H HB2  . CYS A 1 47  ? 10.086  0.255   0.022   1.00 0.00 ? 47  CYS A HB2  1  
ATOM 755   H HB3  . CYS A 1 47  ? 11.590  -0.526  0.504   1.00 0.00 ? 47  CYS A HB3  1  
ATOM 756   H HG   . CYS A 1 47  ? 11.316  2.803   -0.252  1.00 0.00 ? 47  CYS A HG   1  
ATOM 757   N N    . GLU A 1 48  ? 9.659   -1.300  -2.460  1.00 0.00 ? 48  GLU A N    1  
ATOM 758   C CA   . GLU A 1 48  ? 9.007   -2.461  -3.060  1.00 0.00 ? 48  GLU A CA   1  
ATOM 759   C C    . GLU A 1 48  ? 9.702   -2.816  -4.377  1.00 0.00 ? 48  GLU A C    1  
ATOM 760   O O    . GLU A 1 48  ? 9.928   -3.987  -4.685  1.00 0.00 ? 48  GLU A O    1  
ATOM 761   C CB   . GLU A 1 48  ? 7.508   -2.162  -3.262  1.00 0.00 ? 48  GLU A CB   1  
ATOM 762   C CG   . GLU A 1 48  ? 6.730   -3.218  -4.053  1.00 0.00 ? 48  GLU A CG   1  
ATOM 763   C CD   . GLU A 1 48  ? 6.463   -2.798  -5.493  1.00 0.00 ? 48  GLU A CD   1  
ATOM 764   O OE1  . GLU A 1 48  ? 5.443   -2.118  -5.741  1.00 0.00 ? 48  GLU A OE1  1  
ATOM 765   O OE2  . GLU A 1 48  ? 7.274   -3.131  -6.383  1.00 0.00 ? 48  GLU A OE2  1  
ATOM 766   H H    . GLU A 1 48  ? 9.146   -0.472  -2.354  1.00 0.00 ? 48  GLU A H    1  
ATOM 767   H HA   . GLU A 1 48  ? 9.112   -3.292  -2.375  1.00 0.00 ? 48  GLU A HA   1  
ATOM 768   H HB2  . GLU A 1 48  ? 7.046   -2.070  -2.289  1.00 0.00 ? 48  GLU A HB2  1  
ATOM 769   H HB3  . GLU A 1 48  ? 7.412   -1.215  -3.776  1.00 0.00 ? 48  GLU A HB3  1  
ATOM 770   H HG2  . GLU A 1 48  ? 7.298   -4.138  -4.061  1.00 0.00 ? 48  GLU A HG2  1  
ATOM 771   H HG3  . GLU A 1 48  ? 5.782   -3.394  -3.564  1.00 0.00 ? 48  GLU A HG3  1  
ATOM 772   N N    . ARG A 1 49  ? 10.073  -1.778  -5.121  1.00 0.00 ? 49  ARG A N    1  
ATOM 773   C CA   . ARG A 1 49  ? 10.825  -1.920  -6.367  1.00 0.00 ? 49  ARG A CA   1  
ATOM 774   C C    . ARG A 1 49  ? 12.195  -2.529  -6.078  1.00 0.00 ? 49  ARG A C    1  
ATOM 775   O O    . ARG A 1 49  ? 12.735  -3.302  -6.873  1.00 0.00 ? 49  ARG A O    1  
ATOM 776   C CB   . ARG A 1 49  ? 10.993  -0.538  -7.021  1.00 0.00 ? 49  ARG A CB   1  
ATOM 777   C CG   . ARG A 1 49  ? 11.792  -0.536  -8.320  1.00 0.00 ? 49  ARG A CG   1  
ATOM 778   C CD   . ARG A 1 49  ? 11.010  -1.124  -9.487  1.00 0.00 ? 49  ARG A CD   1  
ATOM 779   N NE   . ARG A 1 49  ? 11.784  -1.071  -10.730 1.00 0.00 ? 49  ARG A NE   1  
ATOM 780   C CZ   . ARG A 1 49  ? 11.934  0.026   -11.480 1.00 0.00 ? 49  ARG A CZ   1  
ATOM 781   N NH1  . ARG A 1 49  ? 11.343  1.166   -11.131 1.00 0.00 ? 49  ARG A NH1  1  
ATOM 782   N NH2  . ARG A 1 49  ? 12.678  -0.019  -12.576 1.00 0.00 ? 49  ARG A NH2  1  
ATOM 783   H H    . ARG A 1 49  ? 9.837   -0.879  -4.817  1.00 0.00 ? 49  ARG A H    1  
ATOM 784   H HA   . ARG A 1 49  ? 10.273  -2.570  -7.031  1.00 0.00 ? 49  ARG A HA   1  
ATOM 785   H HB2  . ARG A 1 49  ? 10.012  -0.134  -7.230  1.00 0.00 ? 49  ARG A HB2  1  
ATOM 786   H HB3  . ARG A 1 49  ? 11.491  0.117   -6.319  1.00 0.00 ? 49  ARG A HB3  1  
ATOM 787   H HG2  . ARG A 1 49  ? 12.059  0.484   -8.563  1.00 0.00 ? 49  ARG A HG2  1  
ATOM 788   H HG3  . ARG A 1 49  ? 12.694  -1.114  -8.177  1.00 0.00 ? 49  ARG A HG3  1  
ATOM 789   H HD2  . ARG A 1 49  ? 10.773  -2.154  -9.267  1.00 0.00 ? 49  ARG A HD2  1  
ATOM 790   H HD3  . ARG A 1 49  ? 10.096  -0.563  -9.617  1.00 0.00 ? 49  ARG A HD3  1  
ATOM 791   H HE   . ARG A 1 49  ? 12.230  -1.901  -11.013 1.00 0.00 ? 49  ARG A HE   1  
ATOM 792   H HH11 . ARG A 1 49  ? 10.782  1.210   -10.300 1.00 0.00 ? 49  ARG A HH11 1  
ATOM 793   H HH12 . ARG A 1 49  ? 11.462  1.991   -11.690 1.00 0.00 ? 49  ARG A HH12 1  
ATOM 794   H HH21 . ARG A 1 49  ? 13.131  -0.875  -12.842 1.00 0.00 ? 49  ARG A HH21 1  
ATOM 795   H HH22 . ARG A 1 49  ? 12.794  0.800   -13.144 1.00 0.00 ? 49  ARG A HH22 1  
ATOM 796   N N    . PHE A 1 50  ? 12.738  -2.172  -4.922  1.00 0.00 ? 50  PHE A N    1  
ATOM 797   C CA   . PHE A 1 50  ? 14.061  -2.615  -4.507  1.00 0.00 ? 50  PHE A CA   1  
ATOM 798   C C    . PHE A 1 50  ? 14.029  -4.093  -4.112  1.00 0.00 ? 50  PHE A C    1  
ATOM 799   O O    . PHE A 1 50  ? 14.886  -4.874  -4.528  1.00 0.00 ? 50  PHE A O    1  
ATOM 800   C CB   . PHE A 1 50  ? 14.546  -1.745  -3.338  1.00 0.00 ? 50  PHE A CB   1  
ATOM 801   C CG   . PHE A 1 50  ? 16.027  -1.829  -3.071  1.00 0.00 ? 50  PHE A CG   1  
ATOM 802   C CD1  . PHE A 1 50  ? 16.932  -1.288  -3.971  1.00 0.00 ? 50  PHE A CD1  1  
ATOM 803   C CD2  . PHE A 1 50  ? 16.516  -2.434  -1.922  1.00 0.00 ? 50  PHE A CD2  1  
ATOM 804   C CE1  . PHE A 1 50  ? 18.290  -1.351  -3.733  1.00 0.00 ? 50  PHE A CE1  1  
ATOM 805   C CE2  . PHE A 1 50  ? 17.875  -2.496  -1.681  1.00 0.00 ? 50  PHE A CE2  1  
ATOM 806   C CZ   . PHE A 1 50  ? 18.763  -1.954  -2.588  1.00 0.00 ? 50  PHE A CZ   1  
ATOM 807   H H    . PHE A 1 50  ? 12.229  -1.583  -4.326  1.00 0.00 ? 50  PHE A H    1  
ATOM 808   H HA   . PHE A 1 50  ? 14.733  -2.488  -5.345  1.00 0.00 ? 50  PHE A HA   1  
ATOM 809   H HB2  . PHE A 1 50  ? 14.309  -0.711  -3.549  1.00 0.00 ? 50  PHE A HB2  1  
ATOM 810   H HB3  . PHE A 1 50  ? 14.025  -2.043  -2.439  1.00 0.00 ? 50  PHE A HB3  1  
ATOM 811   H HD1  . PHE A 1 50  ? 16.566  -0.813  -4.869  1.00 0.00 ? 50  PHE A HD1  1  
ATOM 812   H HD2  . PHE A 1 50  ? 15.825  -2.862  -1.211  1.00 0.00 ? 50  PHE A HD2  1  
ATOM 813   H HE1  . PHE A 1 50  ? 18.983  -0.925  -4.443  1.00 0.00 ? 50  PHE A HE1  1  
ATOM 814   H HE2  . PHE A 1 50  ? 18.242  -2.969  -0.783  1.00 0.00 ? 50  PHE A HE2  1  
ATOM 815   H HZ   . PHE A 1 50  ? 19.826  -2.002  -2.400  1.00 0.00 ? 50  PHE A HZ   1  
ATOM 816   N N    . GLN A 1 51  ? 13.024  -4.478  -3.320  1.00 0.00 ? 51  GLN A N    1  
ATOM 817   C CA   . GLN A 1 51  ? 12.882  -5.870  -2.882  1.00 0.00 ? 51  GLN A CA   1  
ATOM 818   C C    . GLN A 1 51  ? 12.392  -6.752  -4.031  1.00 0.00 ? 51  GLN A C    1  
ATOM 819   O O    . GLN A 1 51  ? 12.447  -7.983  -3.948  1.00 0.00 ? 51  GLN A O    1  
ATOM 820   C CB   . GLN A 1 51  ? 11.928  -5.985  -1.682  1.00 0.00 ? 51  GLN A CB   1  
ATOM 821   C CG   . GLN A 1 51  ? 10.496  -5.545  -1.972  1.00 0.00 ? 51  GLN A CG   1  
ATOM 822   C CD   . GLN A 1 51  ? 9.552   -5.815  -0.811  1.00 0.00 ? 51  GLN A CD   1  
ATOM 823   O OE1  . GLN A 1 51  ? 9.382   -4.983  0.079   1.00 0.00 ? 51  GLN A OE1  1  
ATOM 824   N NE2  . GLN A 1 51  ? 8.925   -6.982  -0.811  1.00 0.00 ? 51  GLN A NE2  1  
ATOM 825   H H    . GLN A 1 51  ? 12.366  -3.814  -3.024  1.00 0.00 ? 51  GLN A H    1  
ATOM 826   H HA   . GLN A 1 51  ? 13.862  -6.218  -2.579  1.00 0.00 ? 51  GLN A HA   1  
ATOM 827   H HB2  . GLN A 1 51  ? 11.904  -7.017  -1.357  1.00 0.00 ? 51  GLN A HB2  1  
ATOM 828   H HB3  . GLN A 1 51  ? 12.311  -5.375  -0.877  1.00 0.00 ? 51  GLN A HB3  1  
ATOM 829   H HG2  . GLN A 1 51  ? 10.495  -4.484  -2.178  1.00 0.00 ? 51  GLN A HG2  1  
ATOM 830   H HG3  . GLN A 1 51  ? 10.137  -6.077  -2.843  1.00 0.00 ? 51  GLN A HG3  1  
ATOM 831   H HE21 . GLN A 1 51  ? 9.096   -7.604  -1.551  1.00 0.00 ? 51  GLN A HE21 1  
ATOM 832   H HE22 . GLN A 1 51  ? 8.318   -7.180  -0.069  1.00 0.00 ? 51  GLN A HE22 1  
ATOM 833   N N    . GLN A 1 52  ? 11.898  -6.113  -5.093  1.00 0.00 ? 52  GLN A N    1  
ATOM 834   C CA   . GLN A 1 52  ? 11.486  -6.822  -6.302  1.00 0.00 ? 52  GLN A CA   1  
ATOM 835   C C    . GLN A 1 52  ? 12.716  -7.397  -7.001  1.00 0.00 ? 52  GLN A C    1  
ATOM 836   O O    . GLN A 1 52  ? 12.656  -8.466  -7.617  1.00 0.00 ? 52  GLN A O    1  
ATOM 837   C CB   . GLN A 1 52  ? 10.710  -5.874  -7.239  1.00 0.00 ? 52  GLN A CB   1  
ATOM 838   C CG   . GLN A 1 52  ? 10.086  -6.547  -8.472  1.00 0.00 ? 52  GLN A CG   1  
ATOM 839   C CD   . GLN A 1 52  ? 10.924  -6.424  -9.742  1.00 0.00 ? 52  GLN A CD   1  
ATOM 840   O OE1  . GLN A 1 52  ? 12.154  -6.356  -9.699  1.00 0.00 ? 52  GLN A OE1  1  
ATOM 841   N NE2  . GLN A 1 52  ? 10.259  -6.391  -10.889 1.00 0.00 ? 52  GLN A NE2  1  
ATOM 842   H H    . GLN A 1 52  ? 11.800  -5.138  -5.056  1.00 0.00 ? 52  GLN A H    1  
ATOM 843   H HA   . GLN A 1 52  ? 10.839  -7.637  -6.007  1.00 0.00 ? 52  GLN A HA   1  
ATOM 844   H HB2  . GLN A 1 52  ? 9.913   -5.410  -6.673  1.00 0.00 ? 52  GLN A HB2  1  
ATOM 845   H HB3  . GLN A 1 52  ? 11.382  -5.099  -7.581  1.00 0.00 ? 52  GLN A HB3  1  
ATOM 846   H HG2  . GLN A 1 52  ? 9.950   -7.596  -8.259  1.00 0.00 ? 52  GLN A HG2  1  
ATOM 847   H HG3  . GLN A 1 52  ? 9.118   -6.097  -8.655  1.00 0.00 ? 52  GLN A HG3  1  
ATOM 848   H HE21 . GLN A 1 52  ? 9.279   -6.448  -10.858 1.00 0.00 ? 52  GLN A HE21 1  
ATOM 849   H HE22 . GLN A 1 52  ? 10.772  -6.309  -11.724 1.00 0.00 ? 52  GLN A HE22 1  
ATOM 850   N N    . ILE A 1 53  ? 13.836  -6.688  -6.875  1.00 0.00 ? 53  ILE A N    1  
ATOM 851   C CA   . ILE A 1 53  ? 15.093  -7.099  -7.491  1.00 0.00 ? 53  ILE A CA   1  
ATOM 852   C C    . ILE A 1 53  ? 15.668  -8.319  -6.767  1.00 0.00 ? 53  ILE A C    1  
ATOM 853   O O    . ILE A 1 53  ? 15.757  -8.326  -5.537  1.00 0.00 ? 53  ILE A O    1  
ATOM 854   C CB   . ILE A 1 53  ? 16.143  -5.959  -7.447  1.00 0.00 ? 53  ILE A CB   1  
ATOM 855   C CG1  . ILE A 1 53  ? 15.571  -4.665  -8.045  1.00 0.00 ? 53  ILE A CG1  1  
ATOM 856   C CG2  . ILE A 1 53  ? 17.422  -6.370  -8.181  1.00 0.00 ? 53  ILE A CG2  1  
ATOM 857   C CD1  . ILE A 1 53  ? 16.500  -3.474  -7.917  1.00 0.00 ? 53  ILE A CD1  1  
ATOM 858   H H    . ILE A 1 53  ? 13.818  -5.866  -6.337  1.00 0.00 ? 53  ILE A H    1  
ATOM 859   H HA   . ILE A 1 53  ? 14.898  -7.349  -8.525  1.00 0.00 ? 53  ILE A HA   1  
ATOM 860   H HB   . ILE A 1 53  ? 16.399  -5.781  -6.411  1.00 0.00 ? 53  ILE A HB   1  
ATOM 861   H HG12 . ILE A 1 53  ? 15.372  -4.817  -9.096  1.00 0.00 ? 53  ILE A HG12 1  
ATOM 862   H HG13 . ILE A 1 53  ? 14.647  -4.420  -7.541  1.00 0.00 ? 53  ILE A HG13 1  
ATOM 863   H HG21 . ILE A 1 53  ? 18.144  -5.568  -8.127  1.00 0.00 ? 53  ILE A HG21 1  
ATOM 864   H HG22 . ILE A 1 53  ? 17.193  -6.578  -9.217  1.00 0.00 ? 53  ILE A HG22 1  
ATOM 865   H HG23 . ILE A 1 53  ? 17.835  -7.256  -7.721  1.00 0.00 ? 53  ILE A HG23 1  
ATOM 866   H HD11 . ILE A 1 53  ? 16.710  -3.290  -6.873  1.00 0.00 ? 53  ILE A HD11 1  
ATOM 867   H HD12 . ILE A 1 53  ? 16.030  -2.602  -8.347  1.00 0.00 ? 53  ILE A HD12 1  
ATOM 868   H HD13 . ILE A 1 53  ? 17.423  -3.678  -8.439  1.00 0.00 ? 53  ILE A HD13 1  
ATOM 869   N N    . PRO A 1 54  ? 16.047  -9.377  -7.510  1.00 0.00 ? 54  PRO A N    1  
ATOM 870   C CA   . PRO A 1 54  ? 16.708  -10.550 -6.926  1.00 0.00 ? 54  PRO A CA   1  
ATOM 871   C C    . PRO A 1 54  ? 18.061  -10.179 -6.319  1.00 0.00 ? 54  PRO A C    1  
ATOM 872   O O    . PRO A 1 54  ? 18.862  -9.491  -6.956  1.00 0.00 ? 54  PRO A O    1  
ATOM 873   C CB   . PRO A 1 54  ? 16.890  -11.508 -8.121  1.00 0.00 ? 54  PRO A CB   1  
ATOM 874   C CG   . PRO A 1 54  ? 15.952  -11.008 -9.171  1.00 0.00 ? 54  PRO A CG   1  
ATOM 875   C CD   . PRO A 1 54  ? 15.858  -9.522  -8.964  1.00 0.00 ? 54  PRO A CD   1  
ATOM 876   H HA   . PRO A 1 54  ? 16.089  -11.017 -6.171  1.00 0.00 ? 54  PRO A HA   1  
ATOM 877   H HB2  . PRO A 1 54  ? 17.917  -11.475 -8.464  1.00 0.00 ? 54  PRO A HB2  1  
ATOM 878   H HB3  . PRO A 1 54  ? 16.642  -12.516 -7.819  1.00 0.00 ? 54  PRO A HB3  1  
ATOM 879   H HG2  . PRO A 1 54  ? 16.345  -11.228 -10.153 1.00 0.00 ? 54  PRO A HG2  1  
ATOM 880   H HG3  . PRO A 1 54  ? 14.981  -11.466 -9.045  1.00 0.00 ? 54  PRO A HG3  1  
ATOM 881   H HD2  . PRO A 1 54  ? 16.641  -9.012  -9.509  1.00 0.00 ? 54  PRO A HD2  1  
ATOM 882   H HD3  . PRO A 1 54  ? 14.886  -9.156  -9.266  1.00 0.00 ? 54  PRO A HD3  1  
ATOM 883   N N    . ALA A 1 55  ? 18.316  -10.646 -5.098  1.00 0.00 ? 55  ALA A N    1  
ATOM 884   C CA   . ALA A 1 55  ? 19.570  -10.357 -4.398  1.00 0.00 ? 55  ALA A CA   1  
ATOM 885   C C    . ALA A 1 55  ? 20.778  -10.775 -5.237  1.00 0.00 ? 55  ALA A C    1  
ATOM 886   O O    . ALA A 1 55  ? 21.889  -10.266 -5.055  1.00 0.00 ? 55  ALA A O    1  
ATOM 887   C CB   . ALA A 1 55  ? 19.591  -11.068 -3.051  1.00 0.00 ? 55  ALA A CB   1  
ATOM 888   H H    . ALA A 1 55  ? 17.640  -11.199 -4.651  1.00 0.00 ? 55  ALA A H    1  
ATOM 889   H HA   . ALA A 1 55  ? 19.615  -9.291  -4.219  1.00 0.00 ? 55  ALA A HA   1  
ATOM 890   H HB1  . ALA A 1 55  ? 18.727  -10.773 -2.474  1.00 0.00 ? 55  ALA A HB1  1  
ATOM 891   H HB2  . ALA A 1 55  ? 20.490  -10.801 -2.515  1.00 0.00 ? 55  ALA A HB2  1  
ATOM 892   H HB3  . ALA A 1 55  ? 19.570  -12.138 -3.207  1.00 0.00 ? 55  ALA A HB3  1  
ATOM 893   N N    . SER A 1 56  ? 20.543  -11.711 -6.150  1.00 0.00 ? 56  SER A N    1  
ATOM 894   C CA   . SER A 1 56  ? 21.575  -12.214 -7.042  1.00 0.00 ? 56  SER A CA   1  
ATOM 895   C C    . SER A 1 56  ? 22.156  -11.088 -7.899  1.00 0.00 ? 56  SER A C    1  
ATOM 896   O O    . SER A 1 56  ? 23.376  -10.985 -8.059  1.00 0.00 ? 56  SER A O    1  
ATOM 897   C CB   . SER A 1 56  ? 20.983  -13.314 -7.928  1.00 0.00 ? 56  SER A CB   1  
ATOM 898   O OG   . SER A 1 56  ? 20.298  -14.272 -7.138  1.00 0.00 ? 56  SER A OG   1  
ATOM 899   H H    . SER A 1 56  ? 19.641  -12.083 -6.221  1.00 0.00 ? 56  SER A H    1  
ATOM 900   H HA   . SER A 1 56  ? 22.362  -12.638 -6.434  1.00 0.00 ? 56  SER A HA   1  
ATOM 901   H HB2  . SER A 1 56  ? 20.285  -12.878 -8.628  1.00 0.00 ? 56  SER A HB2  1  
ATOM 902   H HB3  . SER A 1 56  ? 21.776  -13.810 -8.468  1.00 0.00 ? 56  SER A HB3  1  
ATOM 903   H HG   . SER A 1 56  ? 20.116  -15.054 -7.673  1.00 0.00 ? 56  SER A HG   1  
ATOM 904   N N    . ASP A 1 57  ? 21.286  -10.230 -8.432  1.00 0.00 ? 57  ASP A N    1  
ATOM 905   C CA   . ASP A 1 57  ? 21.727  -9.133  -9.290  1.00 0.00 ? 57  ASP A CA   1  
ATOM 906   C C    . ASP A 1 57  ? 22.009  -7.899  -8.439  1.00 0.00 ? 57  ASP A C    1  
ATOM 907   O O    . ASP A 1 57  ? 21.206  -6.963  -8.373  1.00 0.00 ? 57  ASP A O    1  
ATOM 908   C CB   . ASP A 1 57  ? 20.686  -8.818  -10.374 1.00 0.00 ? 57  ASP A CB   1  
ATOM 909   C CG   . ASP A 1 57  ? 21.286  -8.061  -11.555 1.00 0.00 ? 57  ASP A CG   1  
ATOM 910   O OD1  . ASP A 1 57  ? 21.591  -6.859  -11.418 1.00 0.00 ? 57  ASP A OD1  1  
ATOM 911   O OD2  . ASP A 1 57  ? 21.466  -8.677  -12.630 1.00 0.00 ? 57  ASP A OD2  1  
ATOM 912   H H    . ASP A 1 57  ? 20.332  -10.322 -8.229  1.00 0.00 ? 57  ASP A H    1  
ATOM 913   H HA   . ASP A 1 57  ? 22.651  -9.438  -9.766  1.00 0.00 ? 57  ASP A HA   1  
ATOM 914   H HB2  . ASP A 1 57  ? 20.262  -9.745  -10.738 1.00 0.00 ? 57  ASP A HB2  1  
ATOM 915   H HB3  . ASP A 1 57  ? 19.896  -8.215  -9.946  1.00 0.00 ? 57  ASP A HB3  1  
ATOM 916   N N    . THR A 1 58  ? 23.150  -7.927  -7.762  1.00 0.00 ? 58  THR A N    1  
ATOM 917   C CA   . THR A 1 58  ? 23.554  -6.847  -6.872  1.00 0.00 ? 58  THR A CA   1  
ATOM 918   C C    . THR A 1 58  ? 23.784  -5.550  -7.654  1.00 0.00 ? 58  THR A C    1  
ATOM 919   O O    . THR A 1 58  ? 23.696  -4.452  -7.101  1.00 0.00 ? 58  THR A O    1  
ATOM 920   C CB   . THR A 1 58  ? 24.838  -7.237  -6.104  1.00 0.00 ? 58  THR A CB   1  
ATOM 921   O OG1  . THR A 1 58  ? 24.690  -8.562  -5.567  1.00 0.00 ? 58  THR A OG1  1  
ATOM 922   C CG2  . THR A 1 58  ? 25.131  -6.257  -4.968  1.00 0.00 ? 58  THR A CG2  1  
ATOM 923   H H    . THR A 1 58  ? 23.738  -8.706  -7.858  1.00 0.00 ? 58  THR A H    1  
ATOM 924   H HA   . THR A 1 58  ? 22.762  -6.689  -6.154  1.00 0.00 ? 58  THR A HA   1  
ATOM 925   H HB   . THR A 1 58  ? 25.672  -7.229  -6.793  1.00 0.00 ? 58  THR A HB   1  
ATOM 926   H HG1  . THR A 1 58  ? 23.751  -8.758  -5.456  1.00 0.00 ? 58  THR A HG1  1  
ATOM 927   H HG21 . THR A 1 58  ? 26.023  -6.569  -4.444  1.00 0.00 ? 58  THR A HG21 1  
ATOM 928   H HG22 . THR A 1 58  ? 24.298  -6.240  -4.281  1.00 0.00 ? 58  THR A HG22 1  
ATOM 929   H HG23 . THR A 1 58  ? 25.281  -5.267  -5.374  1.00 0.00 ? 58  THR A HG23 1  
ATOM 930   N N    . GLN A 1 59  ? 24.055  -5.691  -8.951  1.00 0.00 ? 59  GLN A N    1  
ATOM 931   C CA   . GLN A 1 59  ? 24.305  -4.545  -9.817  1.00 0.00 ? 59  GLN A CA   1  
ATOM 932   C C    . GLN A 1 59  ? 23.042  -3.693  -9.950  1.00 0.00 ? 59  GLN A C    1  
ATOM 933   O O    . GLN A 1 59  ? 23.099  -2.465  -9.852  1.00 0.00 ? 59  GLN A O    1  
ATOM 934   C CB   . GLN A 1 59  ? 24.789  -5.017  -11.197 1.00 0.00 ? 59  GLN A CB   1  
ATOM 935   C CG   . GLN A 1 59  ? 25.161  -3.881  -12.146 1.00 0.00 ? 59  GLN A CG   1  
ATOM 936   C CD   . GLN A 1 59  ? 25.822  -4.373  -13.423 1.00 0.00 ? 59  GLN A CD   1  
ATOM 937   O OE1  . GLN A 1 59  ? 26.505  -5.401  -13.432 1.00 0.00 ? 59  GLN A OE1  1  
ATOM 938   N NE2  . GLN A 1 59  ? 25.636  -3.639  -14.508 1.00 0.00 ? 59  GLN A NE2  1  
ATOM 939   H H    . GLN A 1 59  ? 24.082  -6.590  -9.335  1.00 0.00 ? 59  GLN A H    1  
ATOM 940   H HA   . GLN A 1 59  ? 25.081  -3.947  -9.358  1.00 0.00 ? 59  GLN A HA   1  
ATOM 941   H HB2  . GLN A 1 59  ? 25.660  -5.643  -11.063 1.00 0.00 ? 59  GLN A HB2  1  
ATOM 942   H HB3  . GLN A 1 59  ? 24.007  -5.602  -11.659 1.00 0.00 ? 59  GLN A HB3  1  
ATOM 943   H HG2  . GLN A 1 59  ? 24.262  -3.340  -12.408 1.00 0.00 ? 59  GLN A HG2  1  
ATOM 944   H HG3  . GLN A 1 59  ? 25.843  -3.212  -11.639 1.00 0.00 ? 59  GLN A HG3  1  
ATOM 945   H HE21 . GLN A 1 59  ? 25.087  -2.827  -14.434 1.00 0.00 ? 59  GLN A HE21 1  
ATOM 946   H HE22 . GLN A 1 59  ? 26.050  -3.937  -15.344 1.00 0.00 ? 59  GLN A HE22 1  
ATOM 947   N N    . GLN A 1 60  ? 21.901  -4.351  -10.152 1.00 0.00 ? 60  GLN A N    1  
ATOM 948   C CA   . GLN A 1 60  ? 20.624  -3.648  -10.270 1.00 0.00 ? 60  GLN A CA   1  
ATOM 949   C C    . GLN A 1 60  ? 20.273  -3.000  -8.936  1.00 0.00 ? 60  GLN A C    1  
ATOM 950   O O    . GLN A 1 60  ? 19.795  -1.864  -8.888  1.00 0.00 ? 60  GLN A O    1  
ATOM 951   C CB   . GLN A 1 60  ? 19.504  -4.611  -10.703 1.00 0.00 ? 60  GLN A CB   1  
ATOM 952   C CG   . GLN A 1 60  ? 18.264  -3.910  -11.262 1.00 0.00 ? 60  GLN A CG   1  
ATOM 953   C CD   . GLN A 1 60  ? 18.499  -3.293  -12.636 1.00 0.00 ? 60  GLN A CD   1  
ATOM 954   O OE1  . GLN A 1 60  ? 19.616  -2.903  -12.982 1.00 0.00 ? 60  GLN A OE1  1  
ATOM 955   N NE2  . GLN A 1 60  ? 17.444  -3.189  -13.427 1.00 0.00 ? 60  GLN A NE2  1  
ATOM 956   H H    . GLN A 1 60  ? 21.916  -5.332  -10.224 1.00 0.00 ? 60  GLN A H    1  
ATOM 957   H HA   . GLN A 1 60  ? 20.737  -2.875  -11.019 1.00 0.00 ? 60  GLN A HA   1  
ATOM 958   H HB2  . GLN A 1 60  ? 19.890  -5.273  -11.465 1.00 0.00 ? 60  GLN A HB2  1  
ATOM 959   H HB3  . GLN A 1 60  ? 19.202  -5.203  -9.849  1.00 0.00 ? 60  GLN A HB3  1  
ATOM 960   H HG2  . GLN A 1 60  ? 17.465  -4.634  -11.342 1.00 0.00 ? 60  GLN A HG2  1  
ATOM 961   H HG3  . GLN A 1 60  ? 17.968  -3.127  -10.577 1.00 0.00 ? 60  GLN A HG3  1  
ATOM 962   H HE21 . GLN A 1 60  ? 16.577  -3.506  -13.089 1.00 0.00 ? 60  GLN A HE21 1  
ATOM 963   H HE22 . GLN A 1 60  ? 17.569  -2.811  -14.327 1.00 0.00 ? 60  GLN A HE22 1  
ATOM 964   N N    . LEU A 1 61  ? 20.529  -3.736  -7.855  1.00 0.00 ? 61  LEU A N    1  
ATOM 965   C CA   . LEU A 1 61  ? 20.331  -3.225  -6.501  1.00 0.00 ? 61  LEU A CA   1  
ATOM 966   C C    . LEU A 1 61  ? 21.120  -1.933  -6.297  1.00 0.00 ? 61  LEU A C    1  
ATOM 967   O O    . LEU A 1 61  ? 20.609  -0.961  -5.742  1.00 0.00 ? 61  LEU A O    1  
ATOM 968   C CB   . LEU A 1 61  ? 20.766  -4.275  -5.468  1.00 0.00 ? 61  LEU A CB   1  
ATOM 969   C CG   . LEU A 1 61  ? 19.878  -5.528  -5.379  1.00 0.00 ? 61  LEU A CG   1  
ATOM 970   C CD1  . LEU A 1 61  ? 20.526  -6.591  -4.493  1.00 0.00 ? 61  LEU A CD1  1  
ATOM 971   C CD2  . LEU A 1 61  ? 18.493  -5.165  -4.849  1.00 0.00 ? 61  LEU A CD2  1  
ATOM 972   H H    . LEU A 1 61  ? 20.860  -4.653  -7.974  1.00 0.00 ? 61  LEU A H    1  
ATOM 973   H HA   . LEU A 1 61  ? 19.276  -3.018  -6.375  1.00 0.00 ? 61  LEU A HA   1  
ATOM 974   H HB2  . LEU A 1 61  ? 21.771  -4.590  -5.712  1.00 0.00 ? 61  LEU A HB2  1  
ATOM 975   H HB3  . LEU A 1 61  ? 20.782  -3.806  -4.493  1.00 0.00 ? 61  LEU A HB3  1  
ATOM 976   H HG   . LEU A 1 61  ? 19.759  -5.949  -6.368  1.00 0.00 ? 61  LEU A HG   1  
ATOM 977   H HD11 . LEU A 1 61  ? 19.885  -7.459  -4.441  1.00 0.00 ? 61  LEU A HD11 1  
ATOM 978   H HD12 . LEU A 1 61  ? 20.674  -6.194  -3.499  1.00 0.00 ? 61  LEU A HD12 1  
ATOM 979   H HD13 . LEU A 1 61  ? 21.482  -6.876  -4.910  1.00 0.00 ? 61  LEU A HD13 1  
ATOM 980   H HD21 . LEU A 1 61  ? 18.027  -4.451  -5.515  1.00 0.00 ? 61  LEU A HD21 1  
ATOM 981   H HD22 . LEU A 1 61  ? 18.584  -4.729  -3.864  1.00 0.00 ? 61  LEU A HD22 1  
ATOM 982   H HD23 . LEU A 1 61  ? 17.882  -6.054  -4.793  1.00 0.00 ? 61  LEU A HD23 1  
ATOM 983   N N    . ALA A 1 62  ? 22.368  -1.933  -6.759  1.00 0.00 ? 62  ALA A N    1  
ATOM 984   C CA   . ALA A 1 62  ? 23.237  -0.764  -6.645  1.00 0.00 ? 62  ALA A CA   1  
ATOM 985   C C    . ALA A 1 62  ? 22.635  0.433   -7.375  1.00 0.00 ? 62  ALA A C    1  
ATOM 986   O O    . ALA A 1 62  ? 22.657  1.563   -6.874  1.00 0.00 ? 62  ALA A O    1  
ATOM 987   C CB   . ALA A 1 62  ? 24.623  -1.085  -7.197  1.00 0.00 ? 62  ALA A CB   1  
ATOM 988   H H    . ALA A 1 62  ? 22.716  -2.743  -7.189  1.00 0.00 ? 62  ALA A H    1  
ATOM 989   H HA   . ALA A 1 62  ? 23.337  -0.523  -5.597  1.00 0.00 ? 62  ALA A HA   1  
ATOM 990   H HB1  . ALA A 1 62  ? 25.040  -1.923  -6.658  1.00 0.00 ? 62  ALA A HB1  1  
ATOM 991   H HB2  . ALA A 1 62  ? 25.267  -0.225  -7.078  1.00 0.00 ? 62  ALA A HB2  1  
ATOM 992   H HB3  . ALA A 1 62  ? 24.546  -1.335  -8.246  1.00 0.00 ? 62  ALA A HB3  1  
ATOM 993   N N    . GLN A 1 63  ? 22.087  0.170   -8.558  1.00 0.00 ? 63  GLN A N    1  
ATOM 994   C CA   . GLN A 1 63  ? 21.472  1.212   -9.374  1.00 0.00 ? 63  GLN A CA   1  
ATOM 995   C C    . GLN A 1 63  ? 20.248  1.792   -8.672  1.00 0.00 ? 63  GLN A C    1  
ATOM 996   O O    . GLN A 1 63  ? 20.110  3.008   -8.544  1.00 0.00 ? 63  GLN A O    1  
ATOM 997   C CB   . GLN A 1 63  ? 21.075  0.656   -10.751 1.00 0.00 ? 63  GLN A CB   1  
ATOM 998   C CG   . GLN A 1 63  ? 22.232  0.050   -11.549 1.00 0.00 ? 63  GLN A CG   1  
ATOM 999   C CD   . GLN A 1 63  ? 23.170  1.072   -12.191 1.00 0.00 ? 63  GLN A CD   1  
ATOM 1000  O OE1  . GLN A 1 63  ? 23.743  0.812   -13.250 1.00 0.00 ? 63  GLN A OE1  1  
ATOM 1001  N NE2  . GLN A 1 63  ? 23.349  2.233   -11.575 1.00 0.00 ? 63  GLN A NE2  1  
ATOM 1002  H H    . GLN A 1 63  ? 22.095  -0.754  -8.892  1.00 0.00 ? 63  GLN A H    1  
ATOM 1003  H HA   . GLN A 1 63  ? 22.202  1.998   -9.509  1.00 0.00 ? 63  GLN A HA   1  
ATOM 1004  H HB2  . GLN A 1 63  ? 20.326  -0.111  -10.610 1.00 0.00 ? 63  GLN A HB2  1  
ATOM 1005  H HB3  . GLN A 1 63  ? 20.644  1.457   -11.337 1.00 0.00 ? 63  GLN A HB3  1  
ATOM 1006  H HG2  . GLN A 1 63  ? 22.817  -0.571  -10.885 1.00 0.00 ? 63  GLN A HG2  1  
ATOM 1007  H HG3  . GLN A 1 63  ? 21.817  -0.571  -12.332 1.00 0.00 ? 63  GLN A HG3  1  
ATOM 1008  H HE21 . GLN A 1 63  ? 22.878  2.397   -10.739 1.00 0.00 ? 63  GLN A HE21 1  
ATOM 1009  H HE22 . GLN A 1 63  ? 23.957  2.883   -11.988 1.00 0.00 ? 63  GLN A HE22 1  
ATOM 1010  N N    . GLU A 1 64  ? 19.370  0.914   -8.201  1.00 0.00 ? 64  GLU A N    1  
ATOM 1011  C CA   . GLU A 1 64  ? 18.128  1.342   -7.575  1.00 0.00 ? 64  GLU A CA   1  
ATOM 1012  C C    . GLU A 1 64  ? 18.414  2.054   -6.250  1.00 0.00 ? 64  GLU A C    1  
ATOM 1013  O O    . GLU A 1 64  ? 17.749  3.031   -5.902  1.00 0.00 ? 64  GLU A O    1  
ATOM 1014  C CB   . GLU A 1 64  ? 17.201  0.139   -7.354  1.00 0.00 ? 64  GLU A CB   1  
ATOM 1015  C CG   . GLU A 1 64  ? 15.744  0.522   -7.114  1.00 0.00 ? 64  GLU A CG   1  
ATOM 1016  C CD   . GLU A 1 64  ? 15.138  1.256   -8.302  1.00 0.00 ? 64  GLU A CD   1  
ATOM 1017  O OE1  . GLU A 1 64  ? 14.760  0.588   -9.290  1.00 0.00 ? 64  GLU A OE1  1  
ATOM 1018  O OE2  . GLU A 1 64  ? 15.045  2.503   -8.263  1.00 0.00 ? 64  GLU A OE2  1  
ATOM 1019  H H    . GLU A 1 64  ? 19.562  -0.044  -8.279  1.00 0.00 ? 64  GLU A H    1  
ATOM 1020  H HA   . GLU A 1 64  ? 17.643  2.040   -8.245  1.00 0.00 ? 64  GLU A HA   1  
ATOM 1021  H HB2  . GLU A 1 64  ? 17.244  -0.498  -8.227  1.00 0.00 ? 64  GLU A HB2  1  
ATOM 1022  H HB3  . GLU A 1 64  ? 17.550  -0.420  -6.498  1.00 0.00 ? 64  GLU A HB3  1  
ATOM 1023  H HG2  . GLU A 1 64  ? 15.173  -0.379  -6.934  1.00 0.00 ? 64  GLU A HG2  1  
ATOM 1024  H HG3  . GLU A 1 64  ? 15.689  1.160   -6.243  1.00 0.00 ? 64  GLU A HG3  1  
ATOM 1025  N N    . ALA A 1 65  ? 19.427  1.572   -5.531  1.00 0.00 ? 65  ALA A N    1  
ATOM 1026  C CA   . ALA A 1 65  ? 19.802  2.145   -4.241  1.00 0.00 ? 65  ALA A CA   1  
ATOM 1027  C C    . ALA A 1 65  ? 20.150  3.623   -4.378  1.00 0.00 ? 65  ALA A C    1  
ATOM 1028  O O    . ALA A 1 65  ? 19.668  4.456   -3.607  1.00 0.00 ? 65  ALA A O    1  
ATOM 1029  C CB   . ALA A 1 65  ? 20.973  1.380   -3.631  1.00 0.00 ? 65  ALA A CB   1  
ATOM 1030  H H    . ALA A 1 65  ? 19.934  0.807   -5.878  1.00 0.00 ? 65  ALA A H    1  
ATOM 1031  H HA   . ALA A 1 65  ? 18.954  2.045   -3.576  1.00 0.00 ? 65  ALA A HA   1  
ATOM 1032  H HB1  . ALA A 1 65  ? 20.716  0.333   -3.548  1.00 0.00 ? 65  ALA A HB1  1  
ATOM 1033  H HB2  . ALA A 1 65  ? 21.190  1.775   -2.647  1.00 0.00 ? 65  ALA A HB2  1  
ATOM 1034  H HB3  . ALA A 1 65  ? 21.843  1.487   -4.261  1.00 0.00 ? 65  ALA A HB3  1  
ATOM 1035  N N    . ARG A 1 66  ? 20.979  3.952   -5.373  1.00 0.00 ? 66  ARG A N    1  
ATOM 1036  C CA   . ARG A 1 66  ? 21.401  5.337   -5.578  1.00 0.00 ? 66  ARG A CA   1  
ATOM 1037  C C    . ARG A 1 66  ? 20.231  6.197   -6.059  1.00 0.00 ? 66  ARG A C    1  
ATOM 1038  O O    . ARG A 1 66  ? 20.178  7.396   -5.771  1.00 0.00 ? 66  ARG A O    1  
ATOM 1039  C CB   . ARG A 1 66  ? 22.574  5.431   -6.569  1.00 0.00 ? 66  ARG A CB   1  
ATOM 1040  C CG   . ARG A 1 66  ? 22.233  4.994   -7.989  1.00 0.00 ? 66  ARG A CG   1  
ATOM 1041  C CD   . ARG A 1 66  ? 23.372  5.282   -8.961  1.00 0.00 ? 66  ARG A CD   1  
ATOM 1042  N NE   . ARG A 1 66  ? 23.707  6.709   -9.003  1.00 0.00 ? 66  ARG A NE   1  
ATOM 1043  C CZ   . ARG A 1 66  ? 23.377  7.533   -10.002 1.00 0.00 ? 66  ARG A CZ   1  
ATOM 1044  N NH1  . ARG A 1 66  ? 22.690  7.083   -11.047 1.00 0.00 ? 66  ARG A NH1  1  
ATOM 1045  N NH2  . ARG A 1 66  ? 23.730  8.810   -9.949  1.00 0.00 ? 66  ARG A NH2  1  
ATOM 1046  H H    . ARG A 1 66  ? 21.312  3.249   -5.975  1.00 0.00 ? 66  ARG A H    1  
ATOM 1047  H HA   . ARG A 1 66  ? 21.728  5.719   -4.618  1.00 0.00 ? 66  ARG A HA   1  
ATOM 1048  H HB2  . ARG A 1 66  ? 22.917  6.456   -6.604  1.00 0.00 ? 66  ARG A HB2  1  
ATOM 1049  H HB3  . ARG A 1 66  ? 23.380  4.807   -6.207  1.00 0.00 ? 66  ARG A HB3  1  
ATOM 1050  H HG2  . ARG A 1 66  ? 22.035  3.932   -7.989  1.00 0.00 ? 66  ARG A HG2  1  
ATOM 1051  H HG3  . ARG A 1 66  ? 21.350  5.525   -8.317  1.00 0.00 ? 66  ARG A HG3  1  
ATOM 1052  H HD2  . ARG A 1 66  ? 24.246  4.727   -8.648  1.00 0.00 ? 66  ARG A HD2  1  
ATOM 1053  H HD3  . ARG A 1 66  ? 23.077  4.958   -9.950  1.00 0.00 ? 66  ARG A HD3  1  
ATOM 1054  H HE   . ARG A 1 66  ? 24.213  7.072   -8.239  1.00 0.00 ? 66  ARG A HE   1  
ATOM 1055  H HH11 . ARG A 1 66  ? 22.412  6.118   -11.095 1.00 0.00 ? 66  ARG A HH11 1  
ATOM 1056  H HH12 . ARG A 1 66  ? 22.441  7.708   -11.795 1.00 0.00 ? 66  ARG A HH12 1  
ATOM 1057  H HH21 . ARG A 1 66  ? 24.248  9.163   -9.162  1.00 0.00 ? 66  ARG A HH21 1  
ATOM 1058  H HH22 . ARG A 1 66  ? 23.487  9.435   -10.700 1.00 0.00 ? 66  ARG A HH22 1  
ATOM 1059  N N    . ASN A 1 67  ? 19.295  5.582   -6.789  1.00 0.00 ? 67  ASN A N    1  
ATOM 1060  C CA   . ASN A 1 67  ? 18.091  6.285   -7.242  1.00 0.00 ? 67  ASN A CA   1  
ATOM 1061  C C    . ASN A 1 67  ? 17.282  6.746   -6.037  1.00 0.00 ? 67  ASN A C    1  
ATOM 1062  O O    . ASN A 1 67  ? 17.077  7.944   -5.825  1.00 0.00 ? 67  ASN A O    1  
ATOM 1063  C CB   . ASN A 1 67  ? 17.206  5.383   -8.122  1.00 0.00 ? 67  ASN A CB   1  
ATOM 1064  C CG   . ASN A 1 67  ? 17.890  4.892   -9.387  1.00 0.00 ? 67  ASN A CG   1  
ATOM 1065  O OD1  . ASN A 1 67  ? 18.798  5.536   -9.918  1.00 0.00 ? 67  ASN A OD1  1  
ATOM 1066  N ND2  . ASN A 1 67  ? 17.444  3.746   -9.882  1.00 0.00 ? 67  ASN A ND2  1  
ATOM 1067  H H    . ASN A 1 67  ? 19.419  4.637   -7.030  1.00 0.00 ? 67  ASN A H    1  
ATOM 1068  H HA   . ASN A 1 67  ? 18.400  7.150   -7.815  1.00 0.00 ? 67  ASN A HA   1  
ATOM 1069  H HB2  . ASN A 1 67  ? 16.906  4.518   -7.547  1.00 0.00 ? 67  ASN A HB2  1  
ATOM 1070  H HB3  . ASN A 1 67  ? 16.321  5.935   -8.410  1.00 0.00 ? 67  ASN A HB3  1  
ATOM 1071  H HD21 . ASN A 1 67  ? 16.713  3.290   -9.408  1.00 0.00 ? 67  ASN A HD21 1  
ATOM 1072  H HD22 . ASN A 1 67  ? 17.851  3.408   -10.706 1.00 0.00 ? 67  ASN A HD22 1  
ATOM 1073  N N    . ILE A 1 68  ? 16.854  5.768   -5.239  1.00 0.00 ? 68  ILE A N    1  
ATOM 1074  C CA   . ILE A 1 68  ? 16.049  6.016   -4.045  1.00 0.00 ? 68  ILE A CA   1  
ATOM 1075  C C    . ILE A 1 68  ? 16.780  6.959   -3.093  1.00 0.00 ? 68  ILE A C    1  
ATOM 1076  O O    . ILE A 1 68  ? 16.177  7.853   -2.491  1.00 0.00 ? 68  ILE A O    1  
ATOM 1077  C CB   . ILE A 1 68  ? 15.734  4.686   -3.310  1.00 0.00 ? 68  ILE A CB   1  
ATOM 1078  C CG1  . ILE A 1 68  ? 15.097  3.678   -4.284  1.00 0.00 ? 68  ILE A CG1  1  
ATOM 1079  C CG2  . ILE A 1 68  ? 14.819  4.931   -2.110  1.00 0.00 ? 68  ILE A CG2  1  
ATOM 1080  C CD1  . ILE A 1 68  ? 14.837  2.313   -3.676  1.00 0.00 ? 68  ILE A CD1  1  
ATOM 1081  H H    . ILE A 1 68  ? 17.089  4.840   -5.464  1.00 0.00 ? 68  ILE A H    1  
ATOM 1082  H HA   . ILE A 1 68  ? 15.117  6.470   -4.352  1.00 0.00 ? 68  ILE A HA   1  
ATOM 1083  H HB   . ILE A 1 68  ? 16.665  4.277   -2.940  1.00 0.00 ? 68  ILE A HB   1  
ATOM 1084  H HG12 . ILE A 1 68  ? 14.152  4.068   -4.631  1.00 0.00 ? 68  ILE A HG12 1  
ATOM 1085  H HG13 . ILE A 1 68  ? 15.754  3.542   -5.131  1.00 0.00 ? 68  ILE A HG13 1  
ATOM 1086  H HG21 . ILE A 1 68  ? 15.300  5.609   -1.420  1.00 0.00 ? 68  ILE A HG21 1  
ATOM 1087  H HG22 . ILE A 1 68  ? 14.617  3.994   -1.610  1.00 0.00 ? 68  ILE A HG22 1  
ATOM 1088  H HG23 . ILE A 1 68  ? 13.887  5.364   -2.448  1.00 0.00 ? 68  ILE A HG23 1  
ATOM 1089  H HD11 . ILE A 1 68  ? 14.378  1.673   -4.415  1.00 0.00 ? 68  ILE A HD11 1  
ATOM 1090  H HD12 . ILE A 1 68  ? 14.176  2.414   -2.828  1.00 0.00 ? 68  ILE A HD12 1  
ATOM 1091  H HD13 . ILE A 1 68  ? 15.771  1.878   -3.356  1.00 0.00 ? 68  ILE A HD13 1  
ATOM 1092  N N    . TYR A 1 69  ? 18.090  6.756   -2.983  1.00 0.00 ? 69  TYR A N    1  
ATOM 1093  C CA   . TYR A 1 69  ? 18.933  7.568   -2.119  1.00 0.00 ? 69  TYR A CA   1  
ATOM 1094  C C    . TYR A 1 69  ? 18.816  9.049   -2.479  1.00 0.00 ? 69  TYR A C    1  
ATOM 1095  O O    . TYR A 1 69  ? 18.327  9.850   -1.688  1.00 0.00 ? 69  TYR A O    1  
ATOM 1096  C CB   . TYR A 1 69  ? 20.397  7.109   -2.219  1.00 0.00 ? 69  TYR A CB   1  
ATOM 1097  C CG   . TYR A 1 69  ? 21.353  7.932   -1.376  1.00 0.00 ? 69  TYR A CG   1  
ATOM 1098  C CD1  . TYR A 1 69  ? 21.561  7.641   -0.030  1.00 0.00 ? 69  TYR A CD1  1  
ATOM 1099  C CD2  . TYR A 1 69  ? 22.043  9.006   -1.927  1.00 0.00 ? 69  TYR A CD2  1  
ATOM 1100  C CE1  . TYR A 1 69  ? 22.427  8.398   0.737   1.00 0.00 ? 69  TYR A CE1  1  
ATOM 1101  C CE2  . TYR A 1 69  ? 22.909  9.764   -1.171  1.00 0.00 ? 69  TYR A CE2  1  
ATOM 1102  C CZ   . TYR A 1 69  ? 23.099  9.457   0.164   1.00 0.00 ? 69  TYR A CZ   1  
ATOM 1103  O OH   . TYR A 1 69  ? 23.960  10.216  0.925   1.00 0.00 ? 69  TYR A OH   1  
ATOM 1104  H H    . TYR A 1 69  ? 18.499  6.030   -3.500  1.00 0.00 ? 69  TYR A H    1  
ATOM 1105  H HA   . TYR A 1 69  ? 18.594  7.429   -1.103  1.00 0.00 ? 69  TYR A HA   1  
ATOM 1106  H HB2  . TYR A 1 69  ? 20.468  6.080   -1.896  1.00 0.00 ? 69  TYR A HB2  1  
ATOM 1107  H HB3  . TYR A 1 69  ? 20.718  7.176   -3.249  1.00 0.00 ? 69  TYR A HB3  1  
ATOM 1108  H HD1  . TYR A 1 69  ? 21.033  6.810   0.417   1.00 0.00 ? 69  TYR A HD1  1  
ATOM 1109  H HD2  . TYR A 1 69  ? 21.894  9.244   -2.972  1.00 0.00 ? 69  TYR A HD2  1  
ATOM 1110  H HE1  . TYR A 1 69  ? 22.576  8.157   1.781   1.00 0.00 ? 69  TYR A HE1  1  
ATOM 1111  H HE2  . TYR A 1 69  ? 23.432  10.593  -1.624  1.00 0.00 ? 69  TYR A HE2  1  
ATOM 1112  H HH   . TYR A 1 69  ? 23.711  11.147  0.854   1.00 0.00 ? 69  TYR A HH   1  
ATOM 1113  N N    . GLN A 1 70  ? 19.244  9.397   -3.686  1.00 0.00 ? 70  GLN A N    1  
ATOM 1114  C CA   . GLN A 1 70  ? 19.305  10.796  -4.113  1.00 0.00 ? 70  GLN A CA   1  
ATOM 1115  C C    . GLN A 1 70  ? 17.926  11.460  -4.095  1.00 0.00 ? 70  GLN A C    1  
ATOM 1116  O O    . GLN A 1 70  ? 17.815  12.665  -3.862  1.00 0.00 ? 70  GLN A O    1  
ATOM 1117  C CB   . GLN A 1 70  ? 19.911  10.890  -5.516  1.00 0.00 ? 70  GLN A CB   1  
ATOM 1118  C CG   . GLN A 1 70  ? 21.377  10.471  -5.582  1.00 0.00 ? 70  GLN A CG   1  
ATOM 1119  C CD   . GLN A 1 70  ? 21.876  10.352  -7.010  1.00 0.00 ? 70  GLN A CD   1  
ATOM 1120  O OE1  . GLN A 1 70  ? 22.387  11.313  -7.582  1.00 0.00 ? 70  GLN A OE1  1  
ATOM 1121  N NE2  . GLN A 1 70  ? 21.711  9.179   -7.602  1.00 0.00 ? 70  GLN A NE2  1  
ATOM 1122  H H    . GLN A 1 70  ? 19.518  8.695   -4.315  1.00 0.00 ? 70  GLN A H    1  
ATOM 1123  H HA   . GLN A 1 70  ? 19.949  11.322  -3.423  1.00 0.00 ? 70  GLN A HA   1  
ATOM 1124  H HB2  . GLN A 1 70  ? 19.347  10.252  -6.182  1.00 0.00 ? 70  GLN A HB2  1  
ATOM 1125  H HB3  . GLN A 1 70  ? 19.835  11.912  -5.863  1.00 0.00 ? 70  GLN A HB3  1  
ATOM 1126  H HG2  . GLN A 1 70  ? 21.971  11.217  -5.072  1.00 0.00 ? 70  GLN A HG2  1  
ATOM 1127  H HG3  . GLN A 1 70  ? 21.496  9.518   -5.085  1.00 0.00 ? 70  GLN A HG3  1  
ATOM 1128  H HE21 . GLN A 1 70  ? 21.282  8.459   -7.092  1.00 0.00 ? 70  GLN A HE21 1  
ATOM 1129  H HE22 . GLN A 1 70  ? 22.014  9.081   -8.529  1.00 0.00 ? 70  GLN A HE22 1  
ATOM 1130  N N    . GLU A 1 71  ? 16.886  10.669  -4.326  1.00 0.00 ? 71  GLU A N    1  
ATOM 1131  C CA   . GLU A 1 71  ? 15.531  11.196  -4.450  1.00 0.00 ? 71  GLU A CA   1  
ATOM 1132  C C    . GLU A 1 71  ? 14.900  11.465  -3.082  1.00 0.00 ? 71  GLU A C    1  
ATOM 1133  O O    . GLU A 1 71  ? 14.394  12.562  -2.831  1.00 0.00 ? 71  GLU A O    1  
ATOM 1134  C CB   . GLU A 1 71  ? 14.664  10.216  -5.257  1.00 0.00 ? 71  GLU A CB   1  
ATOM 1135  C CG   . GLU A 1 71  ? 13.230  10.685  -5.501  1.00 0.00 ? 71  GLU A CG   1  
ATOM 1136  C CD   . GLU A 1 71  ? 13.145  11.922  -6.383  1.00 0.00 ? 71  GLU A CD   1  
ATOM 1137  O OE1  . GLU A 1 71  ? 13.375  11.801  -7.608  1.00 0.00 ? 71  GLU A OE1  1  
ATOM 1138  O OE2  . GLU A 1 71  ? 12.840  13.015  -5.859  1.00 0.00 ? 71  GLU A OE2  1  
ATOM 1139  H H    . GLU A 1 71  ? 17.032  9.704   -4.424  1.00 0.00 ? 71  GLU A H    1  
ATOM 1140  H HA   . GLU A 1 71  ? 15.595  12.130  -4.984  1.00 0.00 ? 71  GLU A HA   1  
ATOM 1141  H HB2  . GLU A 1 71  ? 15.129  10.053  -6.220  1.00 0.00 ? 71  GLU A HB2  1  
ATOM 1142  H HB3  . GLU A 1 71  ? 14.625  9.273   -4.728  1.00 0.00 ? 71  GLU A HB3  1  
ATOM 1143  H HG2  . GLU A 1 71  ? 12.680  9.886   -5.979  1.00 0.00 ? 71  GLU A HG2  1  
ATOM 1144  H HG3  . GLU A 1 71  ? 12.772  10.907  -4.546  1.00 0.00 ? 71  GLU A HG3  1  
ATOM 1145  N N    . PHE A 1 72  ? 14.942  10.470  -2.198  1.00 0.00 ? 72  PHE A N    1  
ATOM 1146  C CA   . PHE A 1 72  ? 14.216  10.542  -0.926  1.00 0.00 ? 72  PHE A CA   1  
ATOM 1147  C C    . PHE A 1 72  ? 15.156  10.667  0.271   1.00 0.00 ? 72  PHE A C    1  
ATOM 1148  O O    . PHE A 1 72  ? 14.826  11.313  1.270   1.00 0.00 ? 72  PHE A O    1  
ATOM 1149  C CB   . PHE A 1 72  ? 13.353  9.284   -0.742  1.00 0.00 ? 72  PHE A CB   1  
ATOM 1150  C CG   . PHE A 1 72  ? 12.458  8.970   -1.914  1.00 0.00 ? 72  PHE A CG   1  
ATOM 1151  C CD1  . PHE A 1 72  ? 11.290  9.686   -2.124  1.00 0.00 ? 72  PHE A CD1  1  
ATOM 1152  C CD2  . PHE A 1 72  ? 12.787  7.955   -2.802  1.00 0.00 ? 72  PHE A CD2  1  
ATOM 1153  C CE1  . PHE A 1 72  ? 10.471  9.397   -3.197  1.00 0.00 ? 72  PHE A CE1  1  
ATOM 1154  C CE2  . PHE A 1 72  ? 11.969  7.662   -3.876  1.00 0.00 ? 72  PHE A CE2  1  
ATOM 1155  C CZ   . PHE A 1 72  ? 10.809  8.384   -4.073  1.00 0.00 ? 72  PHE A CZ   1  
ATOM 1156  H H    . PHE A 1 72  ? 15.468  9.669   -2.405  1.00 0.00 ? 72  PHE A H    1  
ATOM 1157  H HA   . PHE A 1 72  ? 13.568  11.407  -0.952  1.00 0.00 ? 72  PHE A HA   1  
ATOM 1158  H HB2  . PHE A 1 72  ? 14.000  8.432   -0.582  1.00 0.00 ? 72  PHE A HB2  1  
ATOM 1159  H HB3  . PHE A 1 72  ? 12.725  9.414   0.129   1.00 0.00 ? 72  PHE A HB3  1  
ATOM 1160  H HD1  . PHE A 1 72  ? 11.022  10.478  -1.441  1.00 0.00 ? 72  PHE A HD1  1  
ATOM 1161  H HD2  . PHE A 1 72  ? 13.695  7.389   -2.649  1.00 0.00 ? 72  PHE A HD2  1  
ATOM 1162  H HE1  . PHE A 1 72  ? 9.563   9.963   -3.350  1.00 0.00 ? 72  PHE A HE1  1  
ATOM 1163  H HE2  . PHE A 1 72  ? 12.237  6.870   -4.560  1.00 0.00 ? 72  PHE A HE2  1  
ATOM 1164  H HZ   . PHE A 1 72  ? 10.167  8.157   -4.912  1.00 0.00 ? 72  PHE A HZ   1  
ATOM 1165  N N    . LEU A 1 73  ? 16.325  10.051  0.165   1.00 0.00 ? 73  LEU A N    1  
ATOM 1166  C CA   . LEU A 1 73  ? 17.190  9.824   1.322   1.00 0.00 ? 73  LEU A CA   1  
ATOM 1167  C C    . LEU A 1 73  ? 18.382  10.784  1.361   1.00 0.00 ? 73  LEU A C    1  
ATOM 1168  O O    . LEU A 1 73  ? 19.079  10.866  2.373   1.00 0.00 ? 73  LEU A O    1  
ATOM 1169  C CB   . LEU A 1 73  ? 17.677  8.372   1.285   1.00 0.00 ? 73  LEU A CB   1  
ATOM 1170  C CG   . LEU A 1 73  ? 16.556  7.325   1.151   1.00 0.00 ? 73  LEU A CG   1  
ATOM 1171  C CD1  . LEU A 1 73  ? 17.121  5.959   0.776   1.00 0.00 ? 73  LEU A CD1  1  
ATOM 1172  C CD2  . LEU A 1 73  ? 15.743  7.243   2.441   1.00 0.00 ? 73  LEU A CD2  1  
ATOM 1173  H H    . LEU A 1 73  ? 16.619  9.735   -0.716  1.00 0.00 ? 73  LEU A H    1  
ATOM 1174  H HA   . LEU A 1 73  ? 16.600  9.967   2.216   1.00 0.00 ? 73  LEU A HA   1  
ATOM 1175  H HB2  . LEU A 1 73  ? 18.352  8.263   0.448   1.00 0.00 ? 73  LEU A HB2  1  
ATOM 1176  H HB3  . LEU A 1 73  ? 18.224  8.170   2.195   1.00 0.00 ? 73  LEU A HB3  1  
ATOM 1177  H HG   . LEU A 1 73  ? 15.886  7.629   0.358   1.00 0.00 ? 73  LEU A HG   1  
ATOM 1178  H HD11 . LEU A 1 73  ? 16.316  5.243   0.698   1.00 0.00 ? 73  LEU A HD11 1  
ATOM 1179  H HD12 . LEU A 1 73  ? 17.819  5.633   1.533   1.00 0.00 ? 73  LEU A HD12 1  
ATOM 1180  H HD13 . LEU A 1 73  ? 17.631  6.028   -0.174  1.00 0.00 ? 73  LEU A HD13 1  
ATOM 1181  H HD21 . LEU A 1 73  ? 14.972  6.494   2.336   1.00 0.00 ? 73  LEU A HD21 1  
ATOM 1182  H HD22 . LEU A 1 73  ? 15.286  8.202   2.641   1.00 0.00 ? 73  LEU A HD22 1  
ATOM 1183  H HD23 . LEU A 1 73  ? 16.393  6.977   3.263   1.00 0.00 ? 73  LEU A HD23 1  
ATOM 1184  N N    . SER A 1 74  ? 18.617  11.503  0.266   1.00 0.00 ? 74  SER A N    1  
ATOM 1185  C CA   . SER A 1 74  ? 19.755  12.417  0.186   1.00 0.00 ? 74  SER A CA   1  
ATOM 1186  C C    . SER A 1 74  ? 19.542  13.640  1.074   1.00 0.00 ? 74  SER A C    1  
ATOM 1187  O O    . SER A 1 74  ? 18.409  13.985  1.420   1.00 0.00 ? 74  SER A O    1  
ATOM 1188  C CB   . SER A 1 74  ? 19.989  12.863  -1.266  1.00 0.00 ? 74  SER A CB   1  
ATOM 1189  O OG   . SER A 1 74  ? 21.008  13.850  -1.344  1.00 0.00 ? 74  SER A OG   1  
ATOM 1190  H H    . SER A 1 74  ? 18.011  11.419  -0.507  1.00 0.00 ? 74  SER A H    1  
ATOM 1191  H HA   . SER A 1 74  ? 20.631  11.885  0.531   1.00 0.00 ? 74  SER A HA   1  
ATOM 1192  H HB2  . SER A 1 74  ? 20.288  12.011  -1.858  1.00 0.00 ? 74  SER A HB2  1  
ATOM 1193  H HB3  . SER A 1 74  ? 19.074  13.275  -1.667  1.00 0.00 ? 74  SER A HB3  1  
ATOM 1194  H HG   . SER A 1 74  ? 21.436  13.809  -2.208  1.00 0.00 ? 74  SER A HG   1  
ATOM 1195  N N    . SER A 1 75  ? 20.639  14.295  1.432   1.00 0.00 ? 75  SER A N    1  
ATOM 1196  C CA   . SER A 1 75  ? 20.581  15.546  2.175   1.00 0.00 ? 75  SER A CA   1  
ATOM 1197  C C    . SER A 1 75  ? 20.041  16.662  1.280   1.00 0.00 ? 75  SER A C    1  
ATOM 1198  O O    . SER A 1 75  ? 19.570  17.693  1.758   1.00 0.00 ? 75  SER A O    1  
ATOM 1199  C CB   . SER A 1 75  ? 21.977  15.893  2.701   1.00 0.00 ? 75  SER A CB   1  
ATOM 1200  O OG   . SER A 1 75  ? 22.958  15.710  1.694   1.00 0.00 ? 75  SER A OG   1  
ATOM 1201  H H    . SER A 1 75  ? 21.516  13.930  1.183   1.00 0.00 ? 75  SER A H    1  
ATOM 1202  H HA   . SER A 1 75  ? 19.909  15.410  3.011   1.00 0.00 ? 75  SER A HA   1  
ATOM 1203  H HB2  . SER A 1 75  ? 21.996  16.926  3.023   1.00 0.00 ? 75  SER A HB2  1  
ATOM 1204  H HB3  . SER A 1 75  ? 22.215  15.252  3.537   1.00 0.00 ? 75  SER A HB3  1  
ATOM 1205  H HG   . SER A 1 75  ? 23.351  14.835  1.792   1.00 0.00 ? 75  SER A HG   1  
ATOM 1206  N N    . GLN A 1 76  ? 20.114  16.430  -0.030  1.00 0.00 ? 76  GLN A N    1  
ATOM 1207  C CA   . GLN A 1 76  ? 19.590  17.361  -1.029  1.00 0.00 ? 76  GLN A CA   1  
ATOM 1208  C C    . GLN A 1 76  ? 18.409  16.719  -1.758  1.00 0.00 ? 76  GLN A C    1  
ATOM 1209  O O    . GLN A 1 76  ? 18.087  17.089  -2.889  1.00 0.00 ? 76  GLN A O    1  
ATOM 1210  C CB   . GLN A 1 76  ? 20.690  17.726  -2.035  1.00 0.00 ? 76  GLN A CB   1  
ATOM 1211  C CG   . GLN A 1 76  ? 21.947  18.309  -1.397  1.00 0.00 ? 76  GLN A CG   1  
ATOM 1212  C CD   . GLN A 1 76  ? 23.041  18.576  -2.415  1.00 0.00 ? 76  GLN A CD   1  
ATOM 1213  O OE1  . GLN A 1 76  ? 23.862  17.705  -2.702  1.00 0.00 ? 76  GLN A OE1  1  
ATOM 1214  N NE2  . GLN A 1 76  ? 23.060  19.776  -2.968  1.00 0.00 ? 76  GLN A NE2  1  
ATOM 1215  H H    . GLN A 1 76  ? 20.537  15.599  -0.338  1.00 0.00 ? 76  GLN A H    1  
ATOM 1216  H HA   . GLN A 1 76  ? 19.251  18.255  -0.525  1.00 0.00 ? 76  GLN A HA   1  
ATOM 1217  H HB2  . GLN A 1 76  ? 20.972  16.837  -2.581  1.00 0.00 ? 76  GLN A HB2  1  
ATOM 1218  H HB3  . GLN A 1 76  ? 20.296  18.454  -2.732  1.00 0.00 ? 76  GLN A HB3  1  
ATOM 1219  H HG2  . GLN A 1 76  ? 21.691  19.241  -0.911  1.00 0.00 ? 76  GLN A HG2  1  
ATOM 1220  H HG3  . GLN A 1 76  ? 22.321  17.612  -0.660  1.00 0.00 ? 76  GLN A HG3  1  
ATOM 1221  H HE21 . GLN A 1 76  ? 22.378  20.425  -2.692  1.00 0.00 ? 76  GLN A HE21 1  
ATOM 1222  H HE22 . GLN A 1 76  ? 23.753  19.968  -3.633  1.00 0.00 ? 76  GLN A HE22 1  
ATOM 1223  N N    . ALA A 1 77  ? 17.769  15.762  -1.084  1.00 0.00 ? 77  ALA A N    1  
ATOM 1224  C CA   . ALA A 1 77  ? 16.672  14.989  -1.662  1.00 0.00 ? 77  ALA A CA   1  
ATOM 1225  C C    . ALA A 1 77  ? 15.566  15.894  -2.196  1.00 0.00 ? 77  ALA A C    1  
ATOM 1226  O O    . ALA A 1 77  ? 15.201  16.887  -1.562  1.00 0.00 ? 77  ALA A O    1  
ATOM 1227  C CB   . ALA A 1 77  ? 16.106  14.026  -0.624  1.00 0.00 ? 77  ALA A CB   1  
ATOM 1228  H H    . ALA A 1 77  ? 18.041  15.575  -0.162  1.00 0.00 ? 77  ALA A H    1  
ATOM 1229  H HA   . ALA A 1 77  ? 17.071  14.402  -2.479  1.00 0.00 ? 77  ALA A HA   1  
ATOM 1230  H HB1  . ALA A 1 77  ? 16.899  13.395  -0.247  1.00 0.00 ? 77  ALA A HB1  1  
ATOM 1231  H HB2  . ALA A 1 77  ? 15.344  13.410  -1.079  1.00 0.00 ? 77  ALA A HB2  1  
ATOM 1232  H HB3  . ALA A 1 77  ? 15.674  14.587  0.193   1.00 0.00 ? 77  ALA A HB3  1  
ATOM 1233  N N    . LEU A 1 78  ? 15.036  15.539  -3.360  1.00 0.00 ? 78  LEU A N    1  
ATOM 1234  C CA   . LEU A 1 78  ? 13.961  16.302  -3.985  1.00 0.00 ? 78  LEU A CA   1  
ATOM 1235  C C    . LEU A 1 78  ? 12.627  15.952  -3.327  1.00 0.00 ? 78  LEU A C    1  
ATOM 1236  O O    . LEU A 1 78  ? 11.672  16.736  -3.367  1.00 0.00 ? 78  LEU A O    1  
ATOM 1237  C CB   . LEU A 1 78  ? 13.897  16.027  -5.498  1.00 0.00 ? 78  LEU A CB   1  
ATOM 1238  C CG   . LEU A 1 78  ? 15.119  16.475  -6.326  1.00 0.00 ? 78  LEU A CG   1  
ATOM 1239  C CD1  . LEU A 1 78  ? 16.351  15.628  -6.008  1.00 0.00 ? 78  LEU A CD1  1  
ATOM 1240  C CD2  . LEU A 1 78  ? 14.799  16.423  -7.818  1.00 0.00 ? 78  LEU A CD2  1  
ATOM 1241  H H    . LEU A 1 78  ? 15.373  14.735  -3.810  1.00 0.00 ? 78  LEU A H    1  
ATOM 1242  H HA   . LEU A 1 78  ? 14.162  17.355  -3.826  1.00 0.00 ? 78  LEU A HA   1  
ATOM 1243  H HB2  . LEU A 1 78  ? 13.767  14.963  -5.638  1.00 0.00 ? 78  LEU A HB2  1  
ATOM 1244  H HB3  . LEU A 1 78  ? 13.024  16.528  -5.892  1.00 0.00 ? 78  LEU A HB3  1  
ATOM 1245  H HG   . LEU A 1 78  ? 15.355  17.500  -6.075  1.00 0.00 ? 78  LEU A HG   1  
ATOM 1246  H HD11 . LEU A 1 78  ? 16.601  15.732  -4.962  1.00 0.00 ? 78  LEU A HD11 1  
ATOM 1247  H HD12 . LEU A 1 78  ? 17.185  15.962  -6.610  1.00 0.00 ? 78  LEU A HD12 1  
ATOM 1248  H HD13 . LEU A 1 78  ? 16.145  14.590  -6.226  1.00 0.00 ? 78  LEU A HD13 1  
ATOM 1249  H HD21 . LEU A 1 78  ? 13.972  17.084  -8.033  1.00 0.00 ? 78  LEU A HD21 1  
ATOM 1250  H HD22 . LEU A 1 78  ? 14.532  15.414  -8.098  1.00 0.00 ? 78  LEU A HD22 1  
ATOM 1251  H HD23 . LEU A 1 78  ? 15.664  16.736  -8.386  1.00 0.00 ? 78  LEU A HD23 1  
ATOM 1252  N N    . SER A 1 79  ? 12.577  14.769  -2.721  1.00 0.00 ? 79  SER A N    1  
ATOM 1253  C CA   . SER A 1 79  ? 11.393  14.304  -2.007  1.00 0.00 ? 79  SER A CA   1  
ATOM 1254  C C    . SER A 1 79  ? 11.802  13.692  -0.660  1.00 0.00 ? 79  SER A C    1  
ATOM 1255  O O    . SER A 1 79  ? 11.818  12.471  -0.500  1.00 0.00 ? 79  SER A O    1  
ATOM 1256  C CB   . SER A 1 79  ? 10.642  13.274  -2.861  1.00 0.00 ? 79  SER A CB   1  
ATOM 1257  O OG   . SER A 1 79  ? 10.541  13.704  -4.209  1.00 0.00 ? 79  SER A OG   1  
ATOM 1258  H H    . SER A 1 79  ? 13.363  14.183  -2.760  1.00 0.00 ? 79  SER A H    1  
ATOM 1259  H HA   . SER A 1 79  ? 10.749  15.155  -1.826  1.00 0.00 ? 79  SER A HA   1  
ATOM 1260  H HB2  . SER A 1 79  ? 11.168  12.331  -2.838  1.00 0.00 ? 79  SER A HB2  1  
ATOM 1261  H HB3  . SER A 1 79  ? 9.647   13.140  -2.467  1.00 0.00 ? 79  SER A HB3  1  
ATOM 1262  H HG   . SER A 1 79  ? 11.321  13.398  -4.692  1.00 0.00 ? 79  SER A HG   1  
ATOM 1263  N N    . PRO A 1 80  ? 12.160  14.538  0.326   1.00 0.00 ? 80  PRO A N    1  
ATOM 1264  C CA   . PRO A 1 80  ? 12.666  14.074  1.624   1.00 0.00 ? 80  PRO A CA   1  
ATOM 1265  C C    . PRO A 1 80  ? 11.598  13.354  2.453   1.00 0.00 ? 80  PRO A C    1  
ATOM 1266  O O    . PRO A 1 80  ? 10.715  13.988  3.033   1.00 0.00 ? 80  PRO A O    1  
ATOM 1267  C CB   . PRO A 1 80  ? 13.115  15.369  2.318   1.00 0.00 ? 80  PRO A CB   1  
ATOM 1268  C CG   . PRO A 1 80  ? 12.297  16.442  1.684   1.00 0.00 ? 80  PRO A CG   1  
ATOM 1269  C CD   . PRO A 1 80  ? 12.094  16.012  0.255   1.00 0.00 ? 80  PRO A CD   1  
ATOM 1270  H HA   . PRO A 1 80  ? 13.518  13.419  1.499   1.00 0.00 ? 80  PRO A HA   1  
ATOM 1271  H HB2  . PRO A 1 80  ? 12.930  15.302  3.381   1.00 0.00 ? 80  PRO A HB2  1  
ATOM 1272  H HB3  . PRO A 1 80  ? 14.172  15.526  2.143   1.00 0.00 ? 80  PRO A HB3  1  
ATOM 1273  H HG2  . PRO A 1 80  ? 11.345  16.528  2.190   1.00 0.00 ? 80  PRO A HG2  1  
ATOM 1274  H HG3  . PRO A 1 80  ? 12.828  17.383  1.722   1.00 0.00 ? 80  PRO A HG3  1  
ATOM 1275  H HD2  . PRO A 1 80  ? 11.127  16.338  -0.104  1.00 0.00 ? 80  PRO A HD2  1  
ATOM 1276  H HD3  . PRO A 1 80  ? 12.881  16.403  -0.374  1.00 0.00 ? 80  PRO A HD3  1  
ATOM 1277  N N    . VAL A 1 81  ? 11.673  12.026  2.485   1.00 0.00 ? 81  VAL A N    1  
ATOM 1278  C CA   . VAL A 1 81  ? 10.771  11.224  3.309   1.00 0.00 ? 81  VAL A CA   1  
ATOM 1279  C C    . VAL A 1 81  ? 11.214  11.260  4.774   1.00 0.00 ? 81  VAL A C    1  
ATOM 1280  O O    . VAL A 1 81  ? 12.416  11.223  5.072   1.00 0.00 ? 81  VAL A O    1  
ATOM 1281  C CB   . VAL A 1 81  ? 10.696  9.756   2.817   1.00 0.00 ? 81  VAL A CB   1  
ATOM 1282  C CG1  . VAL A 1 81  ? 10.089  9.696   1.417   1.00 0.00 ? 81  VAL A CG1  1  
ATOM 1283  C CG2  . VAL A 1 81  ? 12.076  9.096   2.842   1.00 0.00 ? 81  VAL A CG2  1  
ATOM 1284  H H    . VAL A 1 81  ? 12.344  11.575  1.932   1.00 0.00 ? 81  VAL A H    1  
ATOM 1285  H HA   . VAL A 1 81  ? 9.780   11.657  3.235   1.00 0.00 ? 81  VAL A HA   1  
ATOM 1286  H HB   . VAL A 1 81  ? 10.046  9.207   3.486   1.00 0.00 ? 81  VAL A HB   1  
ATOM 1287  H HG11 . VAL A 1 81  ? 10.693  10.277  0.735   1.00 0.00 ? 81  VAL A HG11 1  
ATOM 1288  H HG12 . VAL A 1 81  ? 9.085   10.098  1.440   1.00 0.00 ? 81  VAL A HG12 1  
ATOM 1289  H HG13 . VAL A 1 81  ? 10.055  8.669   1.081   1.00 0.00 ? 81  VAL A HG13 1  
ATOM 1290  H HG21 . VAL A 1 81  ? 12.750  9.644   2.199   1.00 0.00 ? 81  VAL A HG21 1  
ATOM 1291  H HG22 . VAL A 1 81  ? 11.996  8.077   2.493   1.00 0.00 ? 81  VAL A HG22 1  
ATOM 1292  H HG23 . VAL A 1 81  ? 12.459  9.099   3.853   1.00 0.00 ? 81  VAL A HG23 1  
ATOM 1293  N N    . ASN A 1 82  ? 10.244  11.336  5.679   1.00 0.00 ? 82  ASN A N    1  
ATOM 1294  C CA   . ASN A 1 82  ? 10.527  11.503  7.103   1.00 0.00 ? 82  ASN A CA   1  
ATOM 1295  C C    . ASN A 1 82  ? 10.754  10.158  7.791   1.00 0.00 ? 82  ASN A C    1  
ATOM 1296  O O    . ASN A 1 82  ? 9.808   9.454   8.147   1.00 0.00 ? 82  ASN A O    1  
ATOM 1297  C CB   . ASN A 1 82  ? 9.398   12.277  7.798   1.00 0.00 ? 82  ASN A CB   1  
ATOM 1298  C CG   . ASN A 1 82  ? 9.295   13.718  7.316   1.00 0.00 ? 82  ASN A CG   1  
ATOM 1299  O OD1  . ASN A 1 82  ? 8.569   14.022  6.365   1.00 0.00 ? 82  ASN A OD1  1  
ATOM 1300  N ND2  . ASN A 1 82  ? 10.020  14.618  7.968   1.00 0.00 ? 82  ASN A ND2  1  
ATOM 1301  H H    . ASN A 1 82  ? 9.310   11.274  5.384   1.00 0.00 ? 82  ASN A H    1  
ATOM 1302  H HA   . ASN A 1 82  ? 11.439  12.082  7.186   1.00 0.00 ? 82  ASN A HA   1  
ATOM 1303  H HB2  . ASN A 1 82  ? 8.456   11.785  7.602   1.00 0.00 ? 82  ASN A HB2  1  
ATOM 1304  H HB3  . ASN A 1 82  ? 9.577   12.286  8.865   1.00 0.00 ? 82  ASN A HB3  1  
ATOM 1305  H HD21 . ASN A 1 82  ? 10.576  14.310  8.716   1.00 0.00 ? 82  ASN A HD21 1  
ATOM 1306  H HD22 . ASN A 1 82  ? 9.970   15.552  7.677   1.00 0.00 ? 82  ASN A HD22 1  
ATOM 1307  N N    . ILE A 1 83  ? 12.025  9.811   7.943   1.00 0.00 ? 83  ILE A N    1  
ATOM 1308  C CA   . ILE A 1 83  ? 12.454  8.621   8.679   1.00 0.00 ? 83  ILE A CA   1  
ATOM 1309  C C    . ILE A 1 83  ? 13.646  9.008   9.555   1.00 0.00 ? 83  ILE A C    1  
ATOM 1310  O O    . ILE A 1 83  ? 14.170  10.119  9.413   1.00 0.00 ? 83  ILE A O    1  
ATOM 1311  C CB   . ILE A 1 83  ? 12.851  7.467   7.717   1.00 0.00 ? 83  ILE A CB   1  
ATOM 1312  C CG1  . ILE A 1 83  ? 14.021  7.903   6.813   1.00 0.00 ? 83  ILE A CG1  1  
ATOM 1313  C CG2  . ILE A 1 83  ? 11.653  7.027   6.879   1.00 0.00 ? 83  ILE A CG2  1  
ATOM 1314  C CD1  . ILE A 1 83  ? 14.407  6.881   5.764   1.00 0.00 ? 83  ILE A CD1  1  
ATOM 1315  H H    . ILE A 1 83  ? 12.714  10.385  7.550   1.00 0.00 ? 83  ILE A H    1  
ATOM 1316  H HA   . ILE A 1 83  ? 11.638  8.292   9.311   1.00 0.00 ? 83  ILE A HA   1  
ATOM 1317  H HB   . ILE A 1 83  ? 13.156  6.618   8.314   1.00 0.00 ? 83  ILE A HB   1  
ATOM 1318  H HG12 . ILE A 1 83  ? 13.751  8.815   6.297   1.00 0.00 ? 83  ILE A HG12 1  
ATOM 1319  H HG13 . ILE A 1 83  ? 14.891  8.091   7.427   1.00 0.00 ? 83  ILE A HG13 1  
ATOM 1320  H HG21 . ILE A 1 83  ? 10.852  6.713   7.533   1.00 0.00 ? 83  ILE A HG21 1  
ATOM 1321  H HG22 . ILE A 1 83  ? 11.940  6.202   6.244   1.00 0.00 ? 83  ILE A HG22 1  
ATOM 1322  H HG23 . ILE A 1 83  ? 11.315  7.852   6.267   1.00 0.00 ? 83  ILE A HG23 1  
ATOM 1323  H HD11 . ILE A 1 83  ? 15.207  7.275   5.155   1.00 0.00 ? 83  ILE A HD11 1  
ATOM 1324  H HD12 . ILE A 1 83  ? 13.553  6.662   5.139   1.00 0.00 ? 83  ILE A HD12 1  
ATOM 1325  H HD13 . ILE A 1 83  ? 14.738  5.976   6.250   1.00 0.00 ? 83  ILE A HD13 1  
ATOM 1326  N N    . ASP A 1 84  ? 14.089  8.122   10.443  1.00 0.00 ? 84  ASP A N    1  
ATOM 1327  C CA   . ASP A 1 84  ? 15.170  8.471   11.369  1.00 0.00 ? 84  ASP A CA   1  
ATOM 1328  C C    . ASP A 1 84  ? 16.508  8.549   10.630  1.00 0.00 ? 84  ASP A C    1  
ATOM 1329  O O    . ASP A 1 84  ? 17.152  7.538   10.350  1.00 0.00 ? 84  ASP A O    1  
ATOM 1330  C CB   . ASP A 1 84  ? 15.236  7.507   12.572  1.00 0.00 ? 84  ASP A CB   1  
ATOM 1331  C CG   . ASP A 1 84  ? 15.525  6.056   12.208  1.00 0.00 ? 84  ASP A CG   1  
ATOM 1332  O OD1  . ASP A 1 84  ? 14.616  5.380   11.684  1.00 0.00 ? 84  ASP A OD1  1  
ATOM 1333  O OD2  . ASP A 1 84  ? 16.646  5.574   12.492  1.00 0.00 ? 84  ASP A OD2  1  
ATOM 1334  H H    . ASP A 1 84  ? 13.701  7.218   10.465  1.00 0.00 ? 84  ASP A H    1  
ATOM 1335  H HA   . ASP A 1 84  ? 14.945  9.463   11.746  1.00 0.00 ? 84  ASP A HA   1  
ATOM 1336  H HB2  . ASP A 1 84  ? 16.009  7.846   13.246  1.00 0.00 ? 84  ASP A HB2  1  
ATOM 1337  H HB3  . ASP A 1 84  ? 14.288  7.542   13.093  1.00 0.00 ? 84  ASP A HB3  1  
ATOM 1338  N N    . ARG A 1 85  ? 16.898  9.776   10.289  1.00 0.00 ? 85  ARG A N    1  
ATOM 1339  C CA   . ARG A 1 85  ? 18.125  10.031  9.540   1.00 0.00 ? 85  ARG A CA   1  
ATOM 1340  C C    . ARG A 1 85  ? 19.338  9.942   10.463  1.00 0.00 ? 85  ARG A C    1  
ATOM 1341  O O    . ARG A 1 85  ? 20.408  9.481   10.059  1.00 0.00 ? 85  ARG A O    1  
ATOM 1342  C CB   . ARG A 1 85  ? 18.070  11.422  8.890   1.00 0.00 ? 85  ARG A CB   1  
ATOM 1343  C CG   . ARG A 1 85  ? 16.870  11.644  7.972   1.00 0.00 ? 85  ARG A CG   1  
ATOM 1344  C CD   . ARG A 1 85  ? 16.909  10.736  6.748   1.00 0.00 ? 85  ARG A CD   1  
ATOM 1345  N NE   . ARG A 1 85  ? 15.788  10.997  5.837   1.00 0.00 ? 85  ARG A NE   1  
ATOM 1346  C CZ   . ARG A 1 85  ? 15.884  11.713  4.713   1.00 0.00 ? 85  ARG A CZ   1  
ATOM 1347  N NH1  . ARG A 1 85  ? 17.038  12.275  4.370   1.00 0.00 ? 85  ARG A NH1  1  
ATOM 1348  N NH2  . ARG A 1 85  ? 14.819  11.886  3.942   1.00 0.00 ? 85  ARG A NH2  1  
ATOM 1349  H H    . ARG A 1 85  ? 16.342  10.539  10.558  1.00 0.00 ? 85  ARG A H    1  
ATOM 1350  H HA   . ARG A 1 85  ? 18.213  9.280   8.767   1.00 0.00 ? 85  ARG A HA   1  
ATOM 1351  H HB2  . ARG A 1 85  ? 18.033  12.167  9.672   1.00 0.00 ? 85  ARG A HB2  1  
ATOM 1352  H HB3  . ARG A 1 85  ? 18.971  11.571  8.310   1.00 0.00 ? 85  ARG A HB3  1  
ATOM 1353  H HG2  . ARG A 1 85  ? 15.963  11.442  8.525   1.00 0.00 ? 85  ARG A HG2  1  
ATOM 1354  H HG3  . ARG A 1 85  ? 16.868  12.674  7.643   1.00 0.00 ? 85  ARG A HG3  1  
ATOM 1355  H HD2  . ARG A 1 85  ? 17.840  10.900  6.221   1.00 0.00 ? 85  ARG A HD2  1  
ATOM 1356  H HD3  . ARG A 1 85  ? 16.861  9.708   7.077   1.00 0.00 ? 85  ARG A HD3  1  
ATOM 1357  H HE   . ARG A 1 85  ? 14.918  10.613  6.078   1.00 0.00 ? 85  ARG A HE   1  
ATOM 1358  H HH11 . ARG A 1 85  ? 17.851  12.168  4.952   1.00 0.00 ? 85  ARG A HH11 1  
ATOM 1359  H HH12 . ARG A 1 85  ? 17.101  12.822  3.531   1.00 0.00 ? 85  ARG A HH12 1  
ATOM 1360  H HH21 . ARG A 1 85  ? 13.935  11.484  4.200   1.00 0.00 ? 85  ARG A HH21 1  
ATOM 1361  H HH22 . ARG A 1 85  ? 14.897  12.413  3.088   1.00 0.00 ? 85  ARG A HH22 1  
ATOM 1362  N N    . GLN A 1 86  ? 19.149  10.382  11.706  1.00 0.00 ? 86  GLN A N    1  
ATOM 1363  C CA   . GLN A 1 86  ? 20.211  10.395  12.710  1.00 0.00 ? 86  GLN A CA   1  
ATOM 1364  C C    . GLN A 1 86  ? 20.888  9.027   12.816  1.00 0.00 ? 86  GLN A C    1  
ATOM 1365  O O    . GLN A 1 86  ? 22.114  8.929   12.872  1.00 0.00 ? 86  GLN A O    1  
ATOM 1366  C CB   . GLN A 1 86  ? 19.636  10.801  14.075  1.00 0.00 ? 86  GLN A CB   1  
ATOM 1367  C CG   . GLN A 1 86  ? 20.675  10.888  15.189  1.00 0.00 ? 86  GLN A CG   1  
ATOM 1368  C CD   . GLN A 1 86  ? 21.684  12.007  14.980  1.00 0.00 ? 86  GLN A CD   1  
ATOM 1369  O OE1  . GLN A 1 86  ? 21.366  13.051  14.406  1.00 0.00 ? 86  GLN A OE1  1  
ATOM 1370  N NE2  . GLN A 1 86  ? 22.908  11.794  15.436  1.00 0.00 ? 86  GLN A NE2  1  
ATOM 1371  H H    . GLN A 1 86  ? 18.260  10.721  11.955  1.00 0.00 ? 86  GLN A H    1  
ATOM 1372  H HA   . GLN A 1 86  ? 20.947  11.128  12.406  1.00 0.00 ? 86  GLN A HA   1  
ATOM 1373  H HB2  . GLN A 1 86  ? 19.163  11.770  13.979  1.00 0.00 ? 86  GLN A HB2  1  
ATOM 1374  H HB3  . GLN A 1 86  ? 18.887  10.077  14.365  1.00 0.00 ? 86  GLN A HB3  1  
ATOM 1375  H HG2  . GLN A 1 86  ? 20.164  11.060  16.126  1.00 0.00 ? 86  GLN A HG2  1  
ATOM 1376  H HG3  . GLN A 1 86  ? 21.208  9.947   15.242  1.00 0.00 ? 86  GLN A HG3  1  
ATOM 1377  H HE21 . GLN A 1 86  ? 23.096  10.937  15.878  1.00 0.00 ? 86  GLN A HE21 1  
ATOM 1378  H HE22 . GLN A 1 86  ? 23.578  12.501  15.318  1.00 0.00 ? 86  GLN A HE22 1  
ATOM 1379  N N    . ALA A 1 87  ? 20.076  7.973   12.828  1.00 0.00 ? 87  ALA A N    1  
ATOM 1380  C CA   . ALA A 1 87  ? 20.578  6.607   12.959  1.00 0.00 ? 87  ALA A CA   1  
ATOM 1381  C C    . ALA A 1 87  ? 20.433  5.844   11.647  1.00 0.00 ? 87  ALA A C    1  
ATOM 1382  O O    . ALA A 1 87  ? 20.444  4.609   11.626  1.00 0.00 ? 87  ALA A O    1  
ATOM 1383  C CB   . ALA A 1 87  ? 19.838  5.883   14.078  1.00 0.00 ? 87  ALA A CB   1  
ATOM 1384  H H    . ALA A 1 87  ? 19.110  8.116   12.741  1.00 0.00 ? 87  ALA A H    1  
ATOM 1385  H HA   . ALA A 1 87  ? 21.626  6.652   13.223  1.00 0.00 ? 87  ALA A HA   1  
ATOM 1386  H HB1  . ALA A 1 87  ? 18.792  5.791   13.822  1.00 0.00 ? 87  ALA A HB1  1  
ATOM 1387  H HB2  . ALA A 1 87  ? 19.933  6.447   14.996  1.00 0.00 ? 87  ALA A HB2  1  
ATOM 1388  H HB3  . ALA A 1 87  ? 20.263  4.899   14.217  1.00 0.00 ? 87  ALA A HB3  1  
ATOM 1389  N N    . TRP A 1 88  ? 20.297  6.577   10.546  1.00 0.00 ? 88  TRP A N    1  
ATOM 1390  C CA   . TRP A 1 88  ? 20.158  5.952   9.238   1.00 0.00 ? 88  TRP A CA   1  
ATOM 1391  C C    . TRP A 1 88  ? 21.518  5.440   8.759   1.00 0.00 ? 88  TRP A C    1  
ATOM 1392  O O    . TRP A 1 88  ? 22.561  5.884   9.247   1.00 0.00 ? 88  TRP A O    1  
ATOM 1393  C CB   . TRP A 1 88  ? 19.546  6.925   8.219   1.00 0.00 ? 88  TRP A CB   1  
ATOM 1394  C CG   . TRP A 1 88  ? 18.927  6.220   7.051   1.00 0.00 ? 88  TRP A CG   1  
ATOM 1395  C CD1  . TRP A 1 88  ? 17.749  5.530   7.051   1.00 0.00 ? 88  TRP A CD1  1  
ATOM 1396  C CD2  . TRP A 1 88  ? 19.451  6.120   5.722   1.00 0.00 ? 88  TRP A CD2  1  
ATOM 1397  N NE1  . TRP A 1 88  ? 17.514  5.000   5.808   1.00 0.00 ? 88  TRP A NE1  1  
ATOM 1398  C CE2  . TRP A 1 88  ? 18.542  5.349   4.975   1.00 0.00 ? 88  TRP A CE2  1  
ATOM 1399  C CE3  . TRP A 1 88  ? 20.598  6.606   5.091   1.00 0.00 ? 88  TRP A CE3  1  
ATOM 1400  C CZ2  . TRP A 1 88  ? 18.749  5.051   3.634   1.00 0.00 ? 88  TRP A CZ2  1  
ATOM 1401  C CZ3  . TRP A 1 88  ? 20.802  6.307   3.757   1.00 0.00 ? 88  TRP A CZ3  1  
ATOM 1402  C CH2  . TRP A 1 88  ? 19.881  5.538   3.043   1.00 0.00 ? 88  TRP A CH2  1  
ATOM 1403  H H    . TRP A 1 88  ? 20.296  7.555   10.615  1.00 0.00 ? 88  TRP A H    1  
ATOM 1404  H HA   . TRP A 1 88  ? 19.495  5.103   9.353   1.00 0.00 ? 88  TRP A HA   1  
ATOM 1405  H HB2  . TRP A 1 88  ? 18.777  7.512   8.703   1.00 0.00 ? 88  TRP A HB2  1  
ATOM 1406  H HB3  . TRP A 1 88  ? 20.315  7.587   7.846   1.00 0.00 ? 88  TRP A HB3  1  
ATOM 1407  H HD1  . TRP A 1 88  ? 17.108  5.421   7.915   1.00 0.00 ? 88  TRP A HD1  1  
ATOM 1408  H HE1  . TRP A 1 88  ? 16.735  4.461   5.557   1.00 0.00 ? 88  TRP A HE1  1  
ATOM 1409  H HE3  . TRP A 1 88  ? 21.320  7.203   5.629   1.00 0.00 ? 88  TRP A HE3  1  
ATOM 1410  H HZ2  . TRP A 1 88  ? 18.047  4.458   3.066   1.00 0.00 ? 88  TRP A HZ2  1  
ATOM 1411  H HZ3  . TRP A 1 88  ? 21.686  6.670   3.251   1.00 0.00 ? 88  TRP A HZ3  1  
ATOM 1412  H HH2  . TRP A 1 88  ? 20.084  5.327   2.003   1.00 0.00 ? 88  TRP A HH2  1  
ATOM 1413  N N    . LEU A 1 89  ? 21.496  4.515   7.805   1.00 0.00 ? 89  LEU A N    1  
ATOM 1414  C CA   . LEU A 1 89  ? 22.708  3.831   7.347   1.00 0.00 ? 89  LEU A CA   1  
ATOM 1415  C C    . LEU A 1 89  ? 23.706  4.824   6.752   1.00 0.00 ? 89  LEU A C    1  
ATOM 1416  O O    . LEU A 1 89  ? 24.788  5.042   7.297   1.00 0.00 ? 89  LEU A O    1  
ATOM 1417  C CB   . LEU A 1 89  ? 22.368  2.751   6.301   1.00 0.00 ? 89  LEU A CB   1  
ATOM 1418  C CG   . LEU A 1 89  ? 21.429  1.622   6.772   1.00 0.00 ? 89  LEU A CG   1  
ATOM 1419  C CD1  . LEU A 1 89  ? 19.993  2.123   6.931   1.00 0.00 ? 89  LEU A CD1  1  
ATOM 1420  C CD2  . LEU A 1 89  ? 21.486  0.442   5.805   1.00 0.00 ? 89  LEU A CD2  1  
ATOM 1421  H H    . LEU A 1 89  ? 20.640  4.293   7.391   1.00 0.00 ? 89  LEU A H    1  
ATOM 1422  H HA   . LEU A 1 89  ? 23.161  3.355   8.206   1.00 0.00 ? 89  LEU A HA   1  
ATOM 1423  H HB2  . LEU A 1 89  ? 21.910  3.237   5.451   1.00 0.00 ? 89  LEU A HB2  1  
ATOM 1424  H HB3  . LEU A 1 89  ? 23.296  2.300   5.973   1.00 0.00 ? 89  LEU A HB3  1  
ATOM 1425  H HG   . LEU A 1 89  ? 21.762  1.272   7.739   1.00 0.00 ? 89  LEU A HG   1  
ATOM 1426  H HD11 . LEU A 1 89  ? 19.369  1.319   7.293   1.00 0.00 ? 89  LEU A HD11 1  
ATOM 1427  H HD12 . LEU A 1 89  ? 19.617  2.465   5.975   1.00 0.00 ? 89  LEU A HD12 1  
ATOM 1428  H HD13 . LEU A 1 89  ? 19.971  2.940   7.638   1.00 0.00 ? 89  LEU A HD13 1  
ATOM 1429  H HD21 . LEU A 1 89  ? 22.497  0.065   5.756   1.00 0.00 ? 89  LEU A HD21 1  
ATOM 1430  H HD22 . LEU A 1 89  ? 21.174  0.763   4.820   1.00 0.00 ? 89  LEU A HD22 1  
ATOM 1431  H HD23 . LEU A 1 89  ? 20.827  -0.340  6.152   1.00 0.00 ? 89  LEU A HD23 1  
ATOM 1432  N N    . GLY A 1 90  ? 23.329  5.417   5.628   1.00 0.00 ? 90  GLY A N    1  
ATOM 1433  C CA   . GLY A 1 90  ? 24.191  6.362   4.946   1.00 0.00 ? 90  GLY A CA   1  
ATOM 1434  C C    . GLY A 1 90  ? 24.915  5.712   3.786   1.00 0.00 ? 90  GLY A C    1  
ATOM 1435  O O    . GLY A 1 90  ? 24.313  4.964   3.018   1.00 0.00 ? 90  GLY A O    1  
ATOM 1436  H H    . GLY A 1 90  ? 22.455  5.202   5.249   1.00 0.00 ? 90  GLY A H    1  
ATOM 1437  H HA2  . GLY A 1 90  ? 23.587  7.177   4.571   1.00 0.00 ? 90  GLY A HA2  1  
ATOM 1438  H HA3  . GLY A 1 90  ? 24.917  6.756   5.643   1.00 0.00 ? 90  GLY A HA3  1  
ATOM 1439  N N    . GLU A 1 91  ? 26.213  5.967   3.687   1.00 0.00 ? 91  GLU A N    1  
ATOM 1440  C CA   . GLU A 1 91  ? 27.041  5.433   2.603   1.00 0.00 ? 91  GLU A CA   1  
ATOM 1441  C C    . GLU A 1 91  ? 27.008  3.898   2.571   1.00 0.00 ? 91  GLU A C    1  
ATOM 1442  O O    . GLU A 1 91  ? 27.250  3.287   1.527   1.00 0.00 ? 91  GLU A O    1  
ATOM 1443  C CB   . GLU A 1 91  ? 28.488  5.927   2.767   1.00 0.00 ? 91  GLU A CB   1  
ATOM 1444  C CG   . GLU A 1 91  ? 29.413  5.546   1.614   1.00 0.00 ? 91  GLU A CG   1  
ATOM 1445  C CD   . GLU A 1 91  ? 30.832  6.056   1.811   1.00 0.00 ? 91  GLU A CD   1  
ATOM 1446  O OE1  . GLU A 1 91  ? 31.033  7.289   1.779   1.00 0.00 ? 91  GLU A OE1  1  
ATOM 1447  O OE2  . GLU A 1 91  ? 31.754  5.232   2.006   1.00 0.00 ? 91  GLU A OE2  1  
ATOM 1448  H H    . GLU A 1 91  ? 26.629  6.545   4.357   1.00 0.00 ? 91  GLU A H    1  
ATOM 1449  H HA   . GLU A 1 91  ? 26.648  5.808   1.670   1.00 0.00 ? 91  GLU A HA   1  
ATOM 1450  H HB2  . GLU A 1 91  ? 28.477  7.005   2.848   1.00 0.00 ? 91  GLU A HB2  1  
ATOM 1451  H HB3  . GLU A 1 91  ? 28.895  5.514   3.680   1.00 0.00 ? 91  GLU A HB3  1  
ATOM 1452  H HG2  . GLU A 1 91  ? 29.439  4.467   1.531   1.00 0.00 ? 91  GLU A HG2  1  
ATOM 1453  H HG3  . GLU A 1 91  ? 29.017  5.964   0.699   1.00 0.00 ? 91  GLU A HG3  1  
ATOM 1454  N N    . GLU A 1 92  ? 26.666  3.284   3.705   1.00 0.00 ? 92  GLU A N    1  
ATOM 1455  C CA   . GLU A 1 92  ? 26.690  1.833   3.832   1.00 0.00 ? 92  GLU A CA   1  
ATOM 1456  C C    . GLU A 1 92  ? 25.713  1.195   2.856   1.00 0.00 ? 92  GLU A C    1  
ATOM 1457  O O    . GLU A 1 92  ? 25.986  0.133   2.294   1.00 0.00 ? 92  GLU A O    1  
ATOM 1458  C CB   . GLU A 1 92  ? 26.348  1.406   5.267   1.00 0.00 ? 92  GLU A CB   1  
ATOM 1459  C CG   . GLU A 1 92  ? 26.372  -0.106  5.473   1.00 0.00 ? 92  GLU A CG   1  
ATOM 1460  C CD   . GLU A 1 92  ? 26.039  -0.521  6.896   1.00 0.00 ? 92  GLU A CD   1  
ATOM 1461  O OE1  . GLU A 1 92  ? 26.930  -0.444  7.768   1.00 0.00 ? 92  GLU A OE1  1  
ATOM 1462  O OE2  . GLU A 1 92  ? 24.890  -0.944  7.146   1.00 0.00 ? 92  GLU A OE2  1  
ATOM 1463  H H    . GLU A 1 92  ? 26.373  3.818   4.466   1.00 0.00 ? 92  GLU A H    1  
ATOM 1464  H HA   . GLU A 1 92  ? 27.690  1.497   3.595   1.00 0.00 ? 92  GLU A HA   1  
ATOM 1465  H HB2  . GLU A 1 92  ? 27.063  1.854   5.944   1.00 0.00 ? 92  GLU A HB2  1  
ATOM 1466  H HB3  . GLU A 1 92  ? 25.358  1.767   5.514   1.00 0.00 ? 92  GLU A HB3  1  
ATOM 1467  H HG2  . GLU A 1 92  ? 25.653  -0.558  4.805   1.00 0.00 ? 92  GLU A HG2  1  
ATOM 1468  H HG3  . GLU A 1 92  ? 27.360  -0.472  5.229   1.00 0.00 ? 92  GLU A HG3  1  
ATOM 1469  N N    . VAL A 1 93  ? 24.584  1.862   2.632   1.00 0.00 ? 93  VAL A N    1  
ATOM 1470  C CA   . VAL A 1 93  ? 23.543  1.297   1.790   1.00 0.00 ? 93  VAL A CA   1  
ATOM 1471  C C    . VAL A 1 93  ? 23.952  1.344   0.314   1.00 0.00 ? 93  VAL A C    1  
ATOM 1472  O O    . VAL A 1 93  ? 23.445  0.579   -0.507  1.00 0.00 ? 93  VAL A O    1  
ATOM 1473  C CB   . VAL A 1 93  ? 22.172  1.996   1.996   1.00 0.00 ? 93  VAL A CB   1  
ATOM 1474  C CG1  . VAL A 1 93  ? 22.165  3.405   1.411   1.00 0.00 ? 93  VAL A CG1  1  
ATOM 1475  C CG2  . VAL A 1 93  ? 21.047  1.150   1.406   1.00 0.00 ? 93  VAL A CG2  1  
ATOM 1476  H H    . VAL A 1 93  ? 24.456  2.747   3.034   1.00 0.00 ? 93  VAL A H    1  
ATOM 1477  H HA   . VAL A 1 93  ? 23.437  0.265   2.082   1.00 0.00 ? 93  VAL A HA   1  
ATOM 1478  H HB   . VAL A 1 93  ? 21.999  2.080   3.061   1.00 0.00 ? 93  VAL A HB   1  
ATOM 1479  H HG11 . VAL A 1 93  ? 22.345  3.357   0.346   1.00 0.00 ? 93  VAL A HG11 1  
ATOM 1480  H HG12 . VAL A 1 93  ? 22.941  3.993   1.879   1.00 0.00 ? 93  VAL A HG12 1  
ATOM 1481  H HG13 . VAL A 1 93  ? 21.207  3.868   1.593   1.00 0.00 ? 93  VAL A HG13 1  
ATOM 1482  H HG21 . VAL A 1 93  ? 20.099  1.636   1.584   1.00 0.00 ? 93  VAL A HG21 1  
ATOM 1483  H HG22 . VAL A 1 93  ? 21.043  0.176   1.874   1.00 0.00 ? 93  VAL A HG22 1  
ATOM 1484  H HG23 . VAL A 1 93  ? 21.199  1.036   0.341   1.00 0.00 ? 93  VAL A HG23 1  
ATOM 1485  N N    . LEU A 1 94  ? 24.875  2.249   -0.013  1.00 0.00 ? 94  LEU A N    1  
ATOM 1486  C CA   . LEU A 1 94  ? 25.455  2.302   -1.354  1.00 0.00 ? 94  LEU A CA   1  
ATOM 1487  C C    . LEU A 1 94  ? 26.588  1.288   -1.456  1.00 0.00 ? 94  LEU A C    1  
ATOM 1488  O O    . LEU A 1 94  ? 26.830  0.710   -2.517  1.00 0.00 ? 94  LEU A O    1  
ATOM 1489  C CB   . LEU A 1 94  ? 25.990  3.710   -1.690  1.00 0.00 ? 94  LEU A CB   1  
ATOM 1490  C CG   . LEU A 1 94  ? 24.941  4.837   -1.795  1.00 0.00 ? 94  LEU A CG   1  
ATOM 1491  C CD1  . LEU A 1 94  ? 23.765  4.414   -2.675  1.00 0.00 ? 94  LEU A CD1  1  
ATOM 1492  C CD2  . LEU A 1 94  ? 24.467  5.282   -0.414  1.00 0.00 ? 94  LEU A CD2  1  
ATOM 1493  H H    . LEU A 1 94  ? 25.179  2.888   0.665   1.00 0.00 ? 94  LEU A H    1  
ATOM 1494  H HA   . LEU A 1 94  ? 24.683  2.037   -2.064  1.00 0.00 ? 94  LEU A HA   1  
ATOM 1495  H HB2  . LEU A 1 94  ? 26.706  3.988   -0.928  1.00 0.00 ? 94  LEU A HB2  1  
ATOM 1496  H HB3  . LEU A 1 94  ? 26.512  3.652   -2.635  1.00 0.00 ? 94  LEU A HB3  1  
ATOM 1497  H HG   . LEU A 1 94  ? 25.406  5.692   -2.271  1.00 0.00 ? 94  LEU A HG   1  
ATOM 1498  H HD11 . LEU A 1 94  ? 23.063  5.233   -2.756  1.00 0.00 ? 94  LEU A HD11 1  
ATOM 1499  H HD12 . LEU A 1 94  ? 23.270  3.560   -2.236  1.00 0.00 ? 94  LEU A HD12 1  
ATOM 1500  H HD13 . LEU A 1 94  ? 24.125  4.153   -3.660  1.00 0.00 ? 94  LEU A HD13 1  
ATOM 1501  H HD21 . LEU A 1 94  ? 23.730  6.066   -0.520  1.00 0.00 ? 94  LEU A HD21 1  
ATOM 1502  H HD22 . LEU A 1 94  ? 25.308  5.655   0.154   1.00 0.00 ? 94  LEU A HD22 1  
ATOM 1503  H HD23 . LEU A 1 94  ? 24.029  4.444   0.106   1.00 0.00 ? 94  LEU A HD23 1  
ATOM 1504  N N    . ALA A 1 95  ? 27.274  1.078   -0.333  1.00 0.00 ? 95  ALA A N    1  
ATOM 1505  C CA   . ALA A 1 95  ? 28.400  0.153   -0.265  1.00 0.00 ? 95  ALA A CA   1  
ATOM 1506  C C    . ALA A 1 95  ? 27.941  -1.284  -0.497  1.00 0.00 ? 95  ALA A C    1  
ATOM 1507  O O    . ALA A 1 95  ? 28.552  -2.025  -1.273  1.00 0.00 ? 95  ALA A O    1  
ATOM 1508  C CB   . ALA A 1 95  ? 29.103  0.280   1.084   1.00 0.00 ? 95  ALA A CB   1  
ATOM 1509  H H    . ALA A 1 95  ? 27.013  1.566   0.477   1.00 0.00 ? 95  ALA A H    1  
ATOM 1510  H HA   . ALA A 1 95  ? 29.104  0.427   -1.038  1.00 0.00 ? 95  ALA A HA   1  
ATOM 1511  H HB1  . ALA A 1 95  ? 28.421  0.003   1.875   1.00 0.00 ? 95  ALA A HB1  1  
ATOM 1512  H HB2  . ALA A 1 95  ? 29.427  1.300   1.229   1.00 0.00 ? 95  ALA A HB2  1  
ATOM 1513  H HB3  . ALA A 1 95  ? 29.963  -0.375  1.107   1.00 0.00 ? 95  ALA A HB3  1  
ATOM 1514  N N    . GLU A 1 96  ? 26.861  -1.674  0.175   1.00 0.00 ? 96  GLU A N    1  
ATOM 1515  C CA   . GLU A 1 96  ? 26.317  -3.021  0.042   1.00 0.00 ? 96  GLU A CA   1  
ATOM 1516  C C    . GLU A 1 96  ? 24.795  -2.980  -0.147  1.00 0.00 ? 96  GLU A C    1  
ATOM 1517  O O    . GLU A 1 96  ? 24.031  -2.968  0.820   1.00 0.00 ? 96  GLU A O    1  
ATOM 1518  C CB   . GLU A 1 96  ? 26.693  -3.884  1.261   1.00 0.00 ? 96  GLU A CB   1  
ATOM 1519  C CG   . GLU A 1 96  ? 26.247  -3.308  2.604   1.00 0.00 ? 96  GLU A CG   1  
ATOM 1520  C CD   . GLU A 1 96  ? 26.471  -4.274  3.755   1.00 0.00 ? 96  GLU A CD   1  
ATOM 1521  O OE1  . GLU A 1 96  ? 25.879  -5.378  3.733   1.00 0.00 ? 96  GLU A OE1  1  
ATOM 1522  O OE2  . GLU A 1 96  ? 27.236  -3.939  4.682   1.00 0.00 ? 96  GLU A OE2  1  
ATOM 1523  H H    . GLU A 1 96  ? 26.415  -1.038  0.774   1.00 0.00 ? 96  GLU A H    1  
ATOM 1524  H HA   . GLU A 1 96  ? 26.756  -3.467  -0.841  1.00 0.00 ? 96  GLU A HA   1  
ATOM 1525  H HB2  . GLU A 1 96  ? 26.244  -4.860  1.147   1.00 0.00 ? 96  GLU A HB2  1  
ATOM 1526  H HB3  . GLU A 1 96  ? 27.769  -3.997  1.283   1.00 0.00 ? 96  GLU A HB3  1  
ATOM 1527  H HG2  . GLU A 1 96  ? 26.802  -2.400  2.796   1.00 0.00 ? 96  GLU A HG2  1  
ATOM 1528  H HG3  . GLU A 1 96  ? 25.193  -3.075  2.550   1.00 0.00 ? 96  GLU A HG3  1  
ATOM 1529  N N    . PRO A 1 97  ? 24.328  -2.924  -1.403  1.00 0.00 ? 97  PRO A N    1  
ATOM 1530  C CA   . PRO A 1 97  ? 22.901  -2.956  -1.701  1.00 0.00 ? 97  PRO A CA   1  
ATOM 1531  C C    . PRO A 1 97  ? 22.343  -4.376  -1.609  1.00 0.00 ? 97  PRO A C    1  
ATOM 1532  O O    . PRO A 1 97  ? 22.875  -5.309  -2.216  1.00 0.00 ? 97  PRO A O    1  
ATOM 1533  C CB   . PRO A 1 97  ? 22.831  -2.431  -3.133  1.00 0.00 ? 97  PRO A CB   1  
ATOM 1534  C CG   . PRO A 1 97  ? 24.129  -2.848  -3.744  1.00 0.00 ? 97  PRO A CG   1  
ATOM 1535  C CD   . PRO A 1 97  ? 25.148  -2.815  -2.628  1.00 0.00 ? 97  PRO A CD   1  
ATOM 1536  H HA   . PRO A 1 97  ? 22.343  -2.304  -1.043  1.00 0.00 ? 97  PRO A HA   1  
ATOM 1537  H HB2  . PRO A 1 97  ? 21.984  -2.875  -3.641  1.00 0.00 ? 97  PRO A HB2  1  
ATOM 1538  H HB3  . PRO A 1 97  ? 22.726  -1.355  -3.123  1.00 0.00 ? 97  PRO A HB3  1  
ATOM 1539  H HG2  . PRO A 1 97  ? 24.041  -3.850  -4.144  1.00 0.00 ? 97  PRO A HG2  1  
ATOM 1540  H HG3  . PRO A 1 97  ? 24.406  -2.156  -4.526  1.00 0.00 ? 97  PRO A HG3  1  
ATOM 1541  H HD2  . PRO A 1 97  ? 25.828  -3.650  -2.712  1.00 0.00 ? 97  PRO A HD2  1  
ATOM 1542  H HD3  . PRO A 1 97  ? 25.693  -1.882  -2.642  1.00 0.00 ? 97  PRO A HD3  1  
ATOM 1543  N N    . ARG A 1 98  ? 21.273  -4.528  -0.843  1.00 0.00 ? 98  ARG A N    1  
ATOM 1544  C CA   . ARG A 1 98  ? 20.633  -5.822  -0.644  1.00 0.00 ? 98  ARG A CA   1  
ATOM 1545  C C    . ARG A 1 98  ? 19.128  -5.611  -0.484  1.00 0.00 ? 98  ARG A C    1  
ATOM 1546  O O    . ARG A 1 98  ? 18.708  -4.647  0.162   1.00 0.00 ? 98  ARG A O    1  
ATOM 1547  C CB   . ARG A 1 98  ? 21.242  -6.527  0.583   1.00 0.00 ? 98  ARG A CB   1  
ATOM 1548  C CG   . ARG A 1 98  ? 21.096  -5.746  1.889   1.00 0.00 ? 98  ARG A CG   1  
ATOM 1549  C CD   . ARG A 1 98  ? 22.150  -6.143  2.921   1.00 0.00 ? 98  ARG A CD   1  
ATOM 1550  N NE   . ARG A 1 98  ? 22.046  -7.547  3.320   1.00 0.00 ? 98  ARG A NE   1  
ATOM 1551  C CZ   . ARG A 1 98  ? 22.933  -8.171  4.099   1.00 0.00 ? 98  ARG A CZ   1  
ATOM 1552  N NH1  . ARG A 1 98  ? 24.025  -7.537  4.517   1.00 0.00 ? 98  ARG A NH1  1  
ATOM 1553  N NH2  . ARG A 1 98  ? 22.733  -9.433  4.454   1.00 0.00 ? 98  ARG A NH2  1  
ATOM 1554  H H    . ARG A 1 98  ? 20.895  -3.742  -0.399  1.00 0.00 ? 98  ARG A H    1  
ATOM 1555  H HA   . ARG A 1 98  ? 20.811  -6.423  -1.526  1.00 0.00 ? 98  ARG A HA   1  
ATOM 1556  H HB2  . ARG A 1 98  ? 20.759  -7.487  0.706   1.00 0.00 ? 98  ARG A HB2  1  
ATOM 1557  H HB3  . ARG A 1 98  ? 22.295  -6.689  0.399   1.00 0.00 ? 98  ARG A HB3  1  
ATOM 1558  H HG2  . ARG A 1 98  ? 21.194  -4.689  1.679   1.00 0.00 ? 98  ARG A HG2  1  
ATOM 1559  H HG3  . ARG A 1 98  ? 20.115  -5.937  2.301   1.00 0.00 ? 98  ARG A HG3  1  
ATOM 1560  H HD2  . ARG A 1 98  ? 23.131  -5.972  2.499   1.00 0.00 ? 98  ARG A HD2  1  
ATOM 1561  H HD3  . ARG A 1 98  ? 22.027  -5.521  3.797   1.00 0.00 ? 98  ARG A HD3  1  
ATOM 1562  H HE   . ARG A 1 98  ? 21.261  -8.049  3.001   1.00 0.00 ? 98  ARG A HE   1  
ATOM 1563  H HH11 . ARG A 1 98  ? 24.197  -6.585  4.247   1.00 0.00 ? 98  ARG A HH11 1  
ATOM 1564  H HH12 . ARG A 1 98  ? 24.684  -8.008  5.116   1.00 0.00 ? 98  ARG A HH12 1  
ATOM 1565  H HH21 . ARG A 1 98  ? 21.916  -9.927  4.142   1.00 0.00 ? 98  ARG A HH21 1  
ATOM 1566  H HH22 . ARG A 1 98  ? 23.404  -9.901  5.037   1.00 0.00 ? 98  ARG A HH22 1  
ATOM 1567  N N    . PRO A 1 99  ? 18.299  -6.513  -1.045  1.00 0.00 ? 99  PRO A N    1  
ATOM 1568  C CA   . PRO A 1 99  ? 16.839  -6.310  -1.154  1.00 0.00 ? 99  PRO A CA   1  
ATOM 1569  C C    . PRO A 1 99  ? 16.101  -6.476  0.180   1.00 0.00 ? 99  PRO A C    1  
ATOM 1570  O O    . PRO A 1 99  ? 14.945  -6.905  0.211   1.00 0.00 ? 99  PRO A O    1  
ATOM 1571  C CB   . PRO A 1 99  ? 16.424  -7.397  -2.154  1.00 0.00 ? 99  PRO A CB   1  
ATOM 1572  C CG   . PRO A 1 99  ? 17.399  -8.497  -1.922  1.00 0.00 ? 99  PRO A CG   1  
ATOM 1573  C CD   . PRO A 1 99  ? 18.709  -7.823  -1.597  1.00 0.00 ? 99  PRO A CD   1  
ATOM 1574  H HA   . PRO A 1 99  ? 16.609  -5.337  -1.565  1.00 0.00 ? 99  PRO A HA   1  
ATOM 1575  H HB2  . PRO A 1 99  ? 15.410  -7.714  -1.955  1.00 0.00 ? 99  PRO A HB2  1  
ATOM 1576  H HB3  . PRO A 1 99  ? 16.495  -7.012  -3.162  1.00 0.00 ? 99  PRO A HB3  1  
ATOM 1577  H HG2  . PRO A 1 99  ? 17.074  -9.109  -1.092  1.00 0.00 ? 99  PRO A HG2  1  
ATOM 1578  H HG3  . PRO A 1 99  ? 17.497  -9.098  -2.815  1.00 0.00 ? 99  PRO A HG3  1  
ATOM 1579  H HD2  . PRO A 1 99  ? 19.257  -8.397  -0.862  1.00 0.00 ? 99  PRO A HD2  1  
ATOM 1580  H HD3  . PRO A 1 99  ? 19.301  -7.694  -2.492  1.00 0.00 ? 99  PRO A HD3  1  
ATOM 1581  N N    . ASP A 1 100 ? 16.771  -6.117  1.270   1.00 0.00 ? 100 ASP A N    1  
ATOM 1582  C CA   . ASP A 1 100 ? 16.178  -6.161  2.607   1.00 0.00 ? 100 ASP A CA   1  
ATOM 1583  C C    . ASP A 1 100 ? 16.597  -4.919  3.401   1.00 0.00 ? 100 ASP A C    1  
ATOM 1584  O O    . ASP A 1 100 ? 16.253  -4.764  4.569   1.00 0.00 ? 100 ASP A O    1  
ATOM 1585  C CB   . ASP A 1 100 ? 16.619  -7.446  3.331   1.00 0.00 ? 100 ASP A CB   1  
ATOM 1586  C CG   . ASP A 1 100 ? 15.933  -7.650  4.678   1.00 0.00 ? 100 ASP A CG   1  
ATOM 1587  O OD1  . ASP A 1 100 ? 14.743  -8.034  4.695   1.00 0.00 ? 100 ASP A OD1  1  
ATOM 1588  O OD2  . ASP A 1 100 ? 16.585  -7.453  5.727   1.00 0.00 ? 100 ASP A OD2  1  
ATOM 1589  H H    . ASP A 1 100 ? 17.697  -5.821  1.177   1.00 0.00 ? 100 ASP A H    1  
ATOM 1590  H HA   . ASP A 1 100 ? 15.100  -6.162  2.501   1.00 0.00 ? 100 ASP A HA   1  
ATOM 1591  H HB2  . ASP A 1 100 ? 16.389  -8.297  2.704   1.00 0.00 ? 100 ASP A HB2  1  
ATOM 1592  H HB3  . ASP A 1 100 ? 17.688  -7.408  3.491   1.00 0.00 ? 100 ASP A HB3  1  
ATOM 1593  N N    . MET A 1 101 ? 17.325  -4.018  2.736   1.00 0.00 ? 101 MET A N    1  
ATOM 1594  C CA   . MET A 1 101 ? 17.860  -2.814  3.381   1.00 0.00 ? 101 MET A CA   1  
ATOM 1595  C C    . MET A 1 101 ? 16.755  -1.928  3.958   1.00 0.00 ? 101 MET A C    1  
ATOM 1596  O O    . MET A 1 101 ? 16.595  -1.832  5.175   1.00 0.00 ? 101 MET A O    1  
ATOM 1597  C CB   . MET A 1 101 ? 18.713  -1.994  2.391   1.00 0.00 ? 101 MET A CB   1  
ATOM 1598  C CG   . MET A 1 101 ? 20.185  -2.377  2.370   1.00 0.00 ? 101 MET A CG   1  
ATOM 1599  S SD   . MET A 1 101 ? 20.961  -2.168  3.984   1.00 0.00 ? 101 MET A SD   1  
ATOM 1600  C CE   . MET A 1 101 ? 22.680  -2.497  3.601   1.00 0.00 ? 101 MET A CE   1  
ATOM 1601  H H    . MET A 1 101 ? 17.503  -4.163  1.783   1.00 0.00 ? 101 MET A H    1  
ATOM 1602  H HA   . MET A 1 101 ? 18.496  -3.138  4.194   1.00 0.00 ? 101 MET A HA   1  
ATOM 1603  H HB2  . MET A 1 101 ? 18.316  -2.130  1.395   1.00 0.00 ? 101 MET A HB2  1  
ATOM 1604  H HB3  . MET A 1 101 ? 18.644  -0.947  2.651   1.00 0.00 ? 101 MET A HB3  1  
ATOM 1605  H HG2  . MET A 1 101 ? 20.273  -3.411  2.072   1.00 0.00 ? 101 MET A HG2  1  
ATOM 1606  H HG3  . MET A 1 101 ? 20.700  -1.752  1.654   1.00 0.00 ? 101 MET A HG3  1  
ATOM 1607  H HE1  . MET A 1 101 ? 23.272  -2.410  4.500   1.00 0.00 ? 101 MET A HE1  1  
ATOM 1608  H HE2  . MET A 1 101 ? 23.031  -1.783  2.870   1.00 0.00 ? 101 MET A HE2  1  
ATOM 1609  H HE3  . MET A 1 101 ? 22.776  -3.496  3.203   1.00 0.00 ? 101 MET A HE3  1  
ATOM 1610  N N    . PHE A 1 102 ? 15.979  -1.309  3.076   1.00 0.00 ? 102 PHE A N    1  
ATOM 1611  C CA   . PHE A 1 102 ? 15.054  -0.233  3.462   1.00 0.00 ? 102 PHE A CA   1  
ATOM 1612  C C    . PHE A 1 102 ? 13.765  -0.757  4.109   1.00 0.00 ? 102 PHE A C    1  
ATOM 1613  O O    . PHE A 1 102 ? 12.790  -0.018  4.211   1.00 0.00 ? 102 PHE A O    1  
ATOM 1614  C CB   . PHE A 1 102 ? 14.691  0.609   2.230   1.00 0.00 ? 102 PHE A CB   1  
ATOM 1615  C CG   . PHE A 1 102 ? 15.880  1.111   1.449   1.00 0.00 ? 102 PHE A CG   1  
ATOM 1616  C CD1  . PHE A 1 102 ? 16.690  2.122   1.952   1.00 0.00 ? 102 PHE A CD1  1  
ATOM 1617  C CD2  . PHE A 1 102 ? 16.189  0.571   0.206   1.00 0.00 ? 102 PHE A CD2  1  
ATOM 1618  C CE1  . PHE A 1 102 ? 17.775  2.580   1.231   1.00 0.00 ? 102 PHE A CE1  1  
ATOM 1619  C CE2  . PHE A 1 102 ? 17.273  1.029   -0.516  1.00 0.00 ? 102 PHE A CE2  1  
ATOM 1620  C CZ   . PHE A 1 102 ? 18.067  2.034   -0.005  1.00 0.00 ? 102 PHE A CZ   1  
ATOM 1621  H H    . PHE A 1 102 ? 16.024  -1.579  2.136   1.00 0.00 ? 102 PHE A H    1  
ATOM 1622  H HA   . PHE A 1 102 ? 15.565  0.402   4.172   1.00 0.00 ? 102 PHE A HA   1  
ATOM 1623  H HB2  . PHE A 1 102 ? 14.084  0.011   1.563   1.00 0.00 ? 102 PHE A HB2  1  
ATOM 1624  H HB3  . PHE A 1 102 ? 14.116  1.468   2.548   1.00 0.00 ? 102 PHE A HB3  1  
ATOM 1625  H HD1  . PHE A 1 102 ? 16.469  2.550   2.921   1.00 0.00 ? 102 PHE A HD1  1  
ATOM 1626  H HD2  . PHE A 1 102 ? 15.569  -0.216  -0.199  1.00 0.00 ? 102 PHE A HD2  1  
ATOM 1627  H HE1  . PHE A 1 102 ? 18.397  3.368   1.633   1.00 0.00 ? 102 PHE A HE1  1  
ATOM 1628  H HE2  . PHE A 1 102 ? 17.502  0.597   -1.479  1.00 0.00 ? 102 PHE A HE2  1  
ATOM 1629  H HZ   . PHE A 1 102 ? 18.915  2.393   -0.568  1.00 0.00 ? 102 PHE A HZ   1  
ATOM 1630  N N    . ARG A 1 103 ? 13.772  -2.004  4.575   1.00 0.00 ? 103 ARG A N    1  
ATOM 1631  C CA   . ARG A 1 103 ? 12.555  -2.649  5.085   1.00 0.00 ? 103 ARG A CA   1  
ATOM 1632  C C    . ARG A 1 103 ? 11.883  -1.840  6.209   1.00 0.00 ? 103 ARG A C    1  
ATOM 1633  O O    . ARG A 1 103 ? 10.702  -1.504  6.113   1.00 0.00 ? 103 ARG A O    1  
ATOM 1634  C CB   . ARG A 1 103 ? 12.861  -4.078  5.562   1.00 0.00 ? 103 ARG A CB   1  
ATOM 1635  C CG   . ARG A 1 103 ? 13.982  -4.170  6.592   1.00 0.00 ? 103 ARG A CG   1  
ATOM 1636  C CD   . ARG A 1 103 ? 14.181  -5.597  7.078   1.00 0.00 ? 103 ARG A CD   1  
ATOM 1637  N NE   . ARG A 1 103 ? 13.000  -6.100  7.786   1.00 0.00 ? 103 ARG A NE   1  
ATOM 1638  C CZ   . ARG A 1 103 ? 12.528  -7.343  7.681   1.00 0.00 ? 103 ARG A CZ   1  
ATOM 1639  N NH1  . ARG A 1 103 ? 13.100  -8.214  6.859   1.00 0.00 ? 103 ARG A NH1  1  
ATOM 1640  N NH2  . ARG A 1 103 ? 11.469  -7.709  8.392   1.00 0.00 ? 103 ARG A NH2  1  
ATOM 1641  H H    . ARG A 1 103 ? 14.614  -2.504  4.584   1.00 0.00 ? 103 ARG A H    1  
ATOM 1642  H HA   . ARG A 1 103 ? 11.861  -2.711  4.258   1.00 0.00 ? 103 ARG A HA   1  
ATOM 1643  H HB2  . ARG A 1 103 ? 11.965  -4.497  6.000   1.00 0.00 ? 103 ARG A HB2  1  
ATOM 1644  H HB3  . ARG A 1 103 ? 13.140  -4.676  4.706   1.00 0.00 ? 103 ARG A HB3  1  
ATOM 1645  H HG2  . ARG A 1 103 ? 14.901  -3.820  6.144   1.00 0.00 ? 103 ARG A HG2  1  
ATOM 1646  H HG3  . ARG A 1 103 ? 13.734  -3.542  7.438   1.00 0.00 ? 103 ARG A HG3  1  
ATOM 1647  H HD2  . ARG A 1 103 ? 14.381  -6.231  6.225   1.00 0.00 ? 103 ARG A HD2  1  
ATOM 1648  H HD3  . ARG A 1 103 ? 15.028  -5.622  7.748   1.00 0.00 ? 103 ARG A HD3  1  
ATOM 1649  H HE   . ARG A 1 103 ? 12.539  -5.471  8.386   1.00 0.00 ? 103 ARG A HE   1  
ATOM 1650  H HH11 . ARG A 1 103 ? 13.896  -7.944  6.303   1.00 0.00 ? 103 ARG A HH11 1  
ATOM 1651  H HH12 . ARG A 1 103 ? 12.742  -9.149  6.790   1.00 0.00 ? 103 ARG A HH12 1  
ATOM 1652  H HH21 . ARG A 1 103 ? 11.019  -7.052  9.008   1.00 0.00 ? 103 ARG A HH21 1  
ATOM 1653  H HH22 . ARG A 1 103 ? 11.111  -8.645  8.316   1.00 0.00 ? 103 ARG A HH22 1  
ATOM 1654  N N    . ALA A 1 104 ? 12.630  -1.512  7.260   1.00 0.00 ? 104 ALA A N    1  
ATOM 1655  C CA   . ALA A 1 104 ? 12.061  -0.806  8.409   1.00 0.00 ? 104 ALA A CA   1  
ATOM 1656  C C    . ALA A 1 104 ? 11.574  0.582   8.002   1.00 0.00 ? 104 ALA A C    1  
ATOM 1657  O O    . ALA A 1 104 ? 10.492  1.019   8.400   1.00 0.00 ? 104 ALA A O    1  
ATOM 1658  C CB   . ALA A 1 104 ? 13.084  -0.710  9.535   1.00 0.00 ? 104 ALA A CB   1  
ATOM 1659  H H    . ALA A 1 104 ? 13.583  -1.740  7.264   1.00 0.00 ? 104 ALA A H    1  
ATOM 1660  H HA   . ALA A 1 104 ? 11.218  -1.381  8.769   1.00 0.00 ? 104 ALA A HA   1  
ATOM 1661  H HB1  . ALA A 1 104 ? 12.636  -0.229  10.391  1.00 0.00 ? 104 ALA A HB1  1  
ATOM 1662  H HB2  . ALA A 1 104 ? 13.935  -0.132  9.201   1.00 0.00 ? 104 ALA A HB2  1  
ATOM 1663  H HB3  . ALA A 1 104 ? 13.412  -1.703  9.810   1.00 0.00 ? 104 ALA A HB3  1  
ATOM 1664  N N    . GLN A 1 105 ? 12.375  1.257   7.184   1.00 0.00 ? 105 GLN A N    1  
ATOM 1665  C CA   . GLN A 1 105 ? 12.039  2.592   6.692   1.00 0.00 ? 105 GLN A CA   1  
ATOM 1666  C C    . GLN A 1 105 ? 10.803  2.524   5.793   1.00 0.00 ? 105 GLN A C    1  
ATOM 1667  O O    . GLN A 1 105 ? 9.985   3.448   5.761   1.00 0.00 ? 105 GLN A O    1  
ATOM 1668  C CB   . GLN A 1 105 ? 13.228  3.198   5.926   1.00 0.00 ? 105 GLN A CB   1  
ATOM 1669  C CG   . GLN A 1 105 ? 14.447  3.526   6.796   1.00 0.00 ? 105 GLN A CG   1  
ATOM 1670  C CD   . GLN A 1 105 ? 15.042  2.312   7.493   1.00 0.00 ? 105 GLN A CD   1  
ATOM 1671  O OE1  . GLN A 1 105 ? 14.685  1.995   8.625   1.00 0.00 ? 105 GLN A OE1  1  
ATOM 1672  N NE2  . GLN A 1 105 ? 15.945  1.615   6.820   1.00 0.00 ? 105 GLN A NE2  1  
ATOM 1673  H H    . GLN A 1 105 ? 13.216  0.843   6.902   1.00 0.00 ? 105 GLN A H    1  
ATOM 1674  H HA   . GLN A 1 105 ? 11.815  3.214   7.548   1.00 0.00 ? 105 GLN A HA   1  
ATOM 1675  H HB2  . GLN A 1 105 ? 13.540  2.500   5.162   1.00 0.00 ? 105 GLN A HB2  1  
ATOM 1676  H HB3  . GLN A 1 105 ? 12.902  4.112   5.447   1.00 0.00 ? 105 GLN A HB3  1  
ATOM 1677  H HG2  . GLN A 1 105 ? 15.210  3.967   6.169   1.00 0.00 ? 105 GLN A HG2  1  
ATOM 1678  H HG3  . GLN A 1 105 ? 14.150  4.248   7.551   1.00 0.00 ? 105 GLN A HG3  1  
ATOM 1679  H HE21 . GLN A 1 105 ? 16.186  1.909   5.917   1.00 0.00 ? 105 GLN A HE21 1  
ATOM 1680  H HE22 . GLN A 1 105 ? 16.337  0.823   7.254   1.00 0.00 ? 105 GLN A HE22 1  
ATOM 1681  N N    . GLN A 1 106 ? 10.674  1.410   5.081   1.00 0.00 ? 106 GLN A N    1  
ATOM 1682  C CA   . GLN A 1 106 ? 9.539   1.166   4.198   1.00 0.00 ? 106 GLN A CA   1  
ATOM 1683  C C    . GLN A 1 106 ? 8.253   1.088   5.015   1.00 0.00 ? 106 GLN A C    1  
ATOM 1684  O O    . GLN A 1 106 ? 7.238   1.701   4.673   1.00 0.00 ? 106 GLN A O    1  
ATOM 1685  C CB   . GLN A 1 106 ? 9.759   -0.143  3.424   1.00 0.00 ? 106 GLN A CB   1  
ATOM 1686  C CG   . GLN A 1 106 ? 8.673   -0.475  2.408   1.00 0.00 ? 106 GLN A CG   1  
ATOM 1687  C CD   . GLN A 1 106 ? 8.931   -1.792  1.695   1.00 0.00 ? 106 GLN A CD   1  
ATOM 1688  O OE1  . GLN A 1 106 ? 10.076  -2.212  1.537   1.00 0.00 ? 106 GLN A OE1  1  
ATOM 1689  N NE2  . GLN A 1 106 ? 7.872   -2.446  1.246   1.00 0.00 ? 106 GLN A NE2  1  
ATOM 1690  H H    . GLN A 1 106 ? 11.368  0.722   5.155   1.00 0.00 ? 106 GLN A H    1  
ATOM 1691  H HA   . GLN A 1 106 ? 9.469   1.987   3.499   1.00 0.00 ? 106 GLN A HA   1  
ATOM 1692  H HB2  . GLN A 1 106 ? 10.701  -0.078  2.899   1.00 0.00 ? 106 GLN A HB2  1  
ATOM 1693  H HB3  . GLN A 1 106 ? 9.815   -0.957  4.135   1.00 0.00 ? 106 GLN A HB3  1  
ATOM 1694  H HG2  . GLN A 1 106 ? 7.724   -0.539  2.920   1.00 0.00 ? 106 GLN A HG2  1  
ATOM 1695  H HG3  . GLN A 1 106 ? 8.631   0.315   1.670   1.00 0.00 ? 106 GLN A HG3  1  
ATOM 1696  H HE21 . GLN A 1 106 ? 6.987   -2.053  1.393   1.00 0.00 ? 106 GLN A HE21 1  
ATOM 1697  H HE22 . GLN A 1 106 ? 8.020   -3.298  0.782   1.00 0.00 ? 106 GLN A HE22 1  
ATOM 1698  N N    . LEU A 1 107 ? 8.314   0.338   6.112   1.00 0.00 ? 107 LEU A N    1  
ATOM 1699  C CA   . LEU A 1 107 ? 7.170   0.187   7.006   1.00 0.00 ? 107 LEU A CA   1  
ATOM 1700  C C    . LEU A 1 107 ? 6.932   1.465   7.809   1.00 0.00 ? 107 LEU A C    1  
ATOM 1701  O O    . LEU A 1 107 ? 5.805   1.732   8.234   1.00 0.00 ? 107 LEU A O    1  
ATOM 1702  C CB   . LEU A 1 107 ? 7.353   -1.027  7.937   1.00 0.00 ? 107 LEU A CB   1  
ATOM 1703  C CG   . LEU A 1 107 ? 6.990   -2.396  7.322   1.00 0.00 ? 107 LEU A CG   1  
ATOM 1704  C CD1  . LEU A 1 107 ? 5.515   -2.438  6.929   1.00 0.00 ? 107 LEU A CD1  1  
ATOM 1705  C CD2  . LEU A 1 107 ? 7.877   -2.717  6.119   1.00 0.00 ? 107 LEU A CD2  1  
ATOM 1706  H H    . LEU A 1 107 ? 9.153   -0.126  6.327   1.00 0.00 ? 107 LEU A H    1  
ATOM 1707  H HA   . LEU A 1 107 ? 6.300   0.015   6.386   1.00 0.00 ? 107 LEU A HA   1  
ATOM 1708  H HB2  . LEU A 1 107 ? 8.388   -1.059  8.251   1.00 0.00 ? 107 LEU A HB2  1  
ATOM 1709  H HB3  . LEU A 1 107 ? 6.738   -0.879  8.814   1.00 0.00 ? 107 LEU A HB3  1  
ATOM 1710  H HG   . LEU A 1 107 ? 7.150   -3.163  8.064   1.00 0.00 ? 107 LEU A HG   1  
ATOM 1711  H HD11 . LEU A 1 107 ? 4.903   -2.256  7.801   1.00 0.00 ? 107 LEU A HD11 1  
ATOM 1712  H HD12 . LEU A 1 107 ? 5.279   -3.411  6.523   1.00 0.00 ? 107 LEU A HD12 1  
ATOM 1713  H HD13 . LEU A 1 107 ? 5.315   -1.679  6.185   1.00 0.00 ? 107 LEU A HD13 1  
ATOM 1714  H HD21 . LEU A 1 107 ? 7.600   -3.680  5.714   1.00 0.00 ? 107 LEU A HD21 1  
ATOM 1715  H HD22 . LEU A 1 107 ? 8.912   -2.744  6.430   1.00 0.00 ? 107 LEU A HD22 1  
ATOM 1716  H HD23 . LEU A 1 107 ? 7.749   -1.958  5.361   1.00 0.00 ? 107 LEU A HD23 1  
ATOM 1717  N N    . GLN A 1 108 ? 7.986   2.260   8.011   1.00 0.00 ? 108 GLN A N    1  
ATOM 1718  C CA   . GLN A 1 108 ? 7.839   3.564   8.658   1.00 0.00 ? 108 GLN A CA   1  
ATOM 1719  C C    . GLN A 1 108 ? 6.895   4.437   7.835   1.00 0.00 ? 108 GLN A C    1  
ATOM 1720  O O    . GLN A 1 108 ? 5.965   5.046   8.369   1.00 0.00 ? 108 GLN A O    1  
ATOM 1721  C CB   . GLN A 1 108 ? 9.205   4.259   8.843   1.00 0.00 ? 108 GLN A CB   1  
ATOM 1722  C CG   . GLN A 1 108 ? 9.108   5.643   9.486   1.00 0.00 ? 108 GLN A CG   1  
ATOM 1723  C CD   . GLN A 1 108 ? 8.476   5.616   10.870  1.00 0.00 ? 108 GLN A CD   1  
ATOM 1724  O OE1  . GLN A 1 108 ? 8.602   4.638   11.611  1.00 0.00 ? 108 GLN A OE1  1  
ATOM 1725  N NE2  . GLN A 1 108 ? 7.785   6.689   11.226  1.00 0.00 ? 108 GLN A NE2  1  
ATOM 1726  H H    . GLN A 1 108 ? 8.877   1.960   7.727   1.00 0.00 ? 108 GLN A H    1  
ATOM 1727  H HA   . GLN A 1 108 ? 7.394   3.397   9.631   1.00 0.00 ? 108 GLN A HA   1  
ATOM 1728  H HB2  . GLN A 1 108 ? 9.826   3.639   9.473   1.00 0.00 ? 108 GLN A HB2  1  
ATOM 1729  H HB3  . GLN A 1 108 ? 9.688   4.369   7.879   1.00 0.00 ? 108 GLN A HB3  1  
ATOM 1730  H HG2  . GLN A 1 108 ? 10.104  6.054   9.574   1.00 0.00 ? 108 GLN A HG2  1  
ATOM 1731  H HG3  . GLN A 1 108 ? 8.515   6.281   8.845   1.00 0.00 ? 108 GLN A HG3  1  
ATOM 1732  H HE21 . GLN A 1 108 ? 7.717   7.430   10.587  1.00 0.00 ? 108 GLN A HE21 1  
ATOM 1733  H HE22 . GLN A 1 108 ? 7.364   6.698   12.111  1.00 0.00 ? 108 GLN A HE22 1  
ATOM 1734  N N    . ILE A 1 109 ? 7.125   4.465   6.524   1.00 0.00 ? 109 ILE A N    1  
ATOM 1735  C CA   . ILE A 1 109 ? 6.248   5.178   5.598   1.00 0.00 ? 109 ILE A CA   1  
ATOM 1736  C C    . ILE A 1 109 ? 4.871   4.513   5.539   1.00 0.00 ? 109 ILE A C    1  
ATOM 1737  O O    . ILE A 1 109 ? 3.845   5.197   5.581   1.00 0.00 ? 109 ILE A O    1  
ATOM 1738  C CB   . ILE A 1 109 ? 6.874   5.262   4.172   1.00 0.00 ? 109 ILE A CB   1  
ATOM 1739  C CG1  . ILE A 1 109 ? 7.732   6.533   4.029   1.00 0.00 ? 109 ILE A CG1  1  
ATOM 1740  C CG2  . ILE A 1 109 ? 5.802   5.216   3.082   1.00 0.00 ? 109 ILE A CG2  1  
ATOM 1741  C CD1  . ILE A 1 109 ? 8.880   6.614   5.010   1.00 0.00 ? 109 ILE A CD1  1  
ATOM 1742  H H    . ILE A 1 109 ? 7.912   3.994   6.168   1.00 0.00 ? 109 ILE A H    1  
ATOM 1743  H HA   . ILE A 1 109 ? 6.127   6.186   5.974   1.00 0.00 ? 109 ILE A HA   1  
ATOM 1744  H HB   . ILE A 1 109 ? 7.513   4.400   4.039   1.00 0.00 ? 109 ILE A HB   1  
ATOM 1745  H HG12 . ILE A 1 109 ? 8.151   6.566   3.034   1.00 0.00 ? 109 ILE A HG12 1  
ATOM 1746  H HG13 . ILE A 1 109 ? 7.107   7.402   4.178   1.00 0.00 ? 109 ILE A HG13 1  
ATOM 1747  H HG21 . ILE A 1 109 ? 6.271   5.294   2.112   1.00 0.00 ? 109 ILE A HG21 1  
ATOM 1748  H HG22 . ILE A 1 109 ? 5.113   6.039   3.215   1.00 0.00 ? 109 ILE A HG22 1  
ATOM 1749  H HG23 . ILE A 1 109 ? 5.262   4.282   3.145   1.00 0.00 ? 109 ILE A HG23 1  
ATOM 1750  H HD11 . ILE A 1 109 ? 8.494   6.627   6.018   1.00 0.00 ? 109 ILE A HD11 1  
ATOM 1751  H HD12 . ILE A 1 109 ? 9.445   7.518   4.830   1.00 0.00 ? 109 ILE A HD12 1  
ATOM 1752  H HD13 . ILE A 1 109 ? 9.526   5.756   4.884   1.00 0.00 ? 109 ILE A HD13 1  
ATOM 1753  N N    . PHE A 1 110 ? 4.859   3.181   5.463   1.00 0.00 ? 110 PHE A N    1  
ATOM 1754  C CA   . PHE A 1 110 ? 3.611   2.419   5.388   1.00 0.00 ? 110 PHE A CA   1  
ATOM 1755  C C    . PHE A 1 110 ? 2.658   2.836   6.511   1.00 0.00 ? 110 PHE A C    1  
ATOM 1756  O O    . PHE A 1 110 ? 1.499   3.171   6.262   1.00 0.00 ? 110 PHE A O    1  
ATOM 1757  C CB   . PHE A 1 110 ? 3.891   0.905   5.456   1.00 0.00 ? 110 PHE A CB   1  
ATOM 1758  C CG   . PHE A 1 110 ? 2.652   0.039   5.340   1.00 0.00 ? 110 PHE A CG   1  
ATOM 1759  C CD1  . PHE A 1 110 ? 1.869   -0.248  6.454   1.00 0.00 ? 110 PHE A CD1  1  
ATOM 1760  C CD2  . PHE A 1 110 ? 2.269   -0.482  4.114   1.00 0.00 ? 110 PHE A CD2  1  
ATOM 1761  C CE1  . PHE A 1 110 ? 0.732   -1.029  6.340   1.00 0.00 ? 110 PHE A CE1  1  
ATOM 1762  C CE2  . PHE A 1 110 ? 1.135   -1.266  3.998   1.00 0.00 ? 110 PHE A CE2  1  
ATOM 1763  C CZ   . PHE A 1 110 ? 0.366   -1.539  5.110   1.00 0.00 ? 110 PHE A CZ   1  
ATOM 1764  H H    . PHE A 1 110 ? 5.713   2.698   5.447   1.00 0.00 ? 110 PHE A H    1  
ATOM 1765  H HA   . PHE A 1 110 ? 3.146   2.646   4.439   1.00 0.00 ? 110 PHE A HA   1  
ATOM 1766  H HB2  . PHE A 1 110 ? 4.557   0.637   4.648   1.00 0.00 ? 110 PHE A HB2  1  
ATOM 1767  H HB3  . PHE A 1 110 ? 4.373   0.674   6.395   1.00 0.00 ? 110 PHE A HB3  1  
ATOM 1768  H HD1  . PHE A 1 110 ? 2.153   0.151   7.419   1.00 0.00 ? 110 PHE A HD1  1  
ATOM 1769  H HD2  . PHE A 1 110 ? 2.868   -0.273  3.239   1.00 0.00 ? 110 PHE A HD2  1  
ATOM 1770  H HE1  . PHE A 1 110 ? 0.134   -1.243  7.214   1.00 0.00 ? 110 PHE A HE1  1  
ATOM 1771  H HE2  . PHE A 1 110 ? 0.851   -1.664  3.034   1.00 0.00 ? 110 PHE A HE2  1  
ATOM 1772  H HZ   . PHE A 1 110 ? -0.525  -2.145  5.014   1.00 0.00 ? 110 PHE A HZ   1  
ATOM 1773  N N    . ASN A 1 111 ? 3.166   2.840   7.740   1.00 0.00 ? 111 ASN A N    1  
ATOM 1774  C CA   . ASN A 1 111 ? 2.346   3.168   8.906   1.00 0.00 ? 111 ASN A CA   1  
ATOM 1775  C C    . ASN A 1 111 ? 2.079   4.669   8.991   1.00 0.00 ? 111 ASN A C    1  
ATOM 1776  O O    . ASN A 1 111 ? 1.095   5.096   9.599   1.00 0.00 ? 111 ASN A O    1  
ATOM 1777  C CB   . ASN A 1 111 ? 2.999   2.663   10.202  1.00 0.00 ? 111 ASN A CB   1  
ATOM 1778  C CG   . ASN A 1 111 ? 2.923   1.149   10.338  1.00 0.00 ? 111 ASN A CG   1  
ATOM 1779  O OD1  . ASN A 1 111 ? 1.938   0.609   10.838  1.00 0.00 ? 111 ASN A OD1  1  
ATOM 1780  N ND2  . ASN A 1 111 ? 3.967   0.452   9.910   1.00 0.00 ? 111 ASN A ND2  1  
ATOM 1781  H H    . ASN A 1 111 ? 4.115   2.624   7.866   1.00 0.00 ? 111 ASN A H    1  
ATOM 1782  H HA   . ASN A 1 111 ? 1.394   2.665   8.782   1.00 0.00 ? 111 ASN A HA   1  
ATOM 1783  H HB2  . ASN A 1 111 ? 4.039   2.957   10.216  1.00 0.00 ? 111 ASN A HB2  1  
ATOM 1784  H HB3  . ASN A 1 111 ? 2.496   3.106   11.050  1.00 0.00 ? 111 ASN A HB3  1  
ATOM 1785  H HD21 . ASN A 1 111 ? 4.729   0.940   9.534   1.00 0.00 ? 111 ASN A HD21 1  
ATOM 1786  H HD22 . ASN A 1 111 ? 3.936   -0.525  9.990   1.00 0.00 ? 111 ASN A HD22 1  
ATOM 1787  N N    . LEU A 1 112 ? 2.945   5.467   8.373   1.00 0.00 ? 112 LEU A N    1  
ATOM 1788  C CA   . LEU A 1 112 ? 2.772   6.919   8.353   1.00 0.00 ? 112 LEU A CA   1  
ATOM 1789  C C    . LEU A 1 112 ? 1.498   7.272   7.578   1.00 0.00 ? 112 LEU A C    1  
ATOM 1790  O O    . LEU A 1 112 ? 0.643   8.005   8.068   1.00 0.00 ? 112 LEU A O    1  
ATOM 1791  C CB   . LEU A 1 112 ? 4.015   7.589   7.727   1.00 0.00 ? 112 LEU A CB   1  
ATOM 1792  C CG   . LEU A 1 112 ? 4.154   9.117   7.922   1.00 0.00 ? 112 LEU A CG   1  
ATOM 1793  C CD1  . LEU A 1 112 ? 5.581   9.563   7.601   1.00 0.00 ? 112 LEU A CD1  1  
ATOM 1794  C CD2  . LEU A 1 112 ? 3.155   9.894   7.060   1.00 0.00 ? 112 LEU A CD2  1  
ATOM 1795  H H    . LEU A 1 112 ? 3.723   5.074   7.922   1.00 0.00 ? 112 LEU A H    1  
ATOM 1796  H HA   . LEU A 1 112 ? 2.665   7.256   9.375   1.00 0.00 ? 112 LEU A HA   1  
ATOM 1797  H HB2  . LEU A 1 112 ? 4.891   7.118   8.150   1.00 0.00 ? 112 LEU A HB2  1  
ATOM 1798  H HB3  . LEU A 1 112 ? 4.005   7.386   6.665   1.00 0.00 ? 112 LEU A HB3  1  
ATOM 1799  H HG   . LEU A 1 112 ? 3.961   9.359   8.959   1.00 0.00 ? 112 LEU A HG   1  
ATOM 1800  H HD11 . LEU A 1 112 ? 6.272   9.055   8.259   1.00 0.00 ? 112 LEU A HD11 1  
ATOM 1801  H HD12 . LEU A 1 112 ? 5.668   10.629  7.745   1.00 0.00 ? 112 LEU A HD12 1  
ATOM 1802  H HD13 . LEU A 1 112 ? 5.815   9.318   6.575   1.00 0.00 ? 112 LEU A HD13 1  
ATOM 1803  H HD21 . LEU A 1 112 ? 2.149   9.640   7.356   1.00 0.00 ? 112 LEU A HD21 1  
ATOM 1804  H HD22 . LEU A 1 112 ? 3.298   9.638   6.019   1.00 0.00 ? 112 LEU A HD22 1  
ATOM 1805  H HD23 . LEU A 1 112 ? 3.310   10.956  7.193   1.00 0.00 ? 112 LEU A HD23 1  
ATOM 1806  N N    . MET A 1 113 ? 1.368   6.716   6.377   1.00 0.00 ? 113 MET A N    1  
ATOM 1807  C CA   . MET A 1 113 ? 0.220   6.997   5.511   1.00 0.00 ? 113 MET A CA   1  
ATOM 1808  C C    . MET A 1 113 ? -0.990  6.133   5.885   1.00 0.00 ? 113 MET A C    1  
ATOM 1809  O O    . MET A 1 113 ? -2.128  6.449   5.518   1.00 0.00 ? 113 MET A O    1  
ATOM 1810  C CB   . MET A 1 113 ? 0.605   6.775   4.040   1.00 0.00 ? 113 MET A CB   1  
ATOM 1811  C CG   . MET A 1 113 ? 1.171   5.392   3.741   1.00 0.00 ? 113 MET A CG   1  
ATOM 1812  S SD   . MET A 1 113 ? 1.601   5.182   2.002   1.00 0.00 ? 113 MET A SD   1  
ATOM 1813  C CE   . MET A 1 113 ? 2.396   3.576   2.024   1.00 0.00 ? 113 MET A CE   1  
ATOM 1814  H H    . MET A 1 113 ? 2.065   6.103   6.059   1.00 0.00 ? 113 MET A H    1  
ATOM 1815  H HA   . MET A 1 113 ? -0.047  8.036   5.645   1.00 0.00 ? 113 MET A HA   1  
ATOM 1816  H HB2  . MET A 1 113 ? -0.271  6.918   3.424   1.00 0.00 ? 113 MET A HB2  1  
ATOM 1817  H HB3  . MET A 1 113 ? 1.348   7.509   3.762   1.00 0.00 ? 113 MET A HB3  1  
ATOM 1818  H HG2  . MET A 1 113 ? 2.059   5.244   4.337   1.00 0.00 ? 113 MET A HG2  1  
ATOM 1819  H HG3  . MET A 1 113 ? 0.432   4.649   4.008   1.00 0.00 ? 113 MET A HG3  1  
ATOM 1820  H HE1  . MET A 1 113 ? 3.258   3.610   2.675   1.00 0.00 ? 113 MET A HE1  1  
ATOM 1821  H HE2  . MET A 1 113 ? 2.709   3.316   1.025   1.00 0.00 ? 113 MET A HE2  1  
ATOM 1822  H HE3  . MET A 1 113 ? 1.699   2.834   2.387   1.00 0.00 ? 113 MET A HE3  1  
ATOM 1823  N N    . LYS A 1 114 ? -0.733  5.063   6.636   1.00 0.00 ? 114 LYS A N    1  
ATOM 1824  C CA   . LYS A 1 114 ? -1.757  4.080   7.008   1.00 0.00 ? 114 LYS A CA   1  
ATOM 1825  C C    . LYS A 1 114 ? -2.970  4.720   7.697   1.00 0.00 ? 114 LYS A C    1  
ATOM 1826  O O    . LYS A 1 114 ? -4.103  4.300   7.475   1.00 0.00 ? 114 LYS A O    1  
ATOM 1827  C CB   . LYS A 1 114 ? -1.138  3.013   7.927   1.00 0.00 ? 114 LYS A CB   1  
ATOM 1828  C CG   . LYS A 1 114 ? -2.116  1.945   8.408   1.00 0.00 ? 114 LYS A CG   1  
ATOM 1829  C CD   . LYS A 1 114 ? -1.422  0.897   9.275   1.00 0.00 ? 114 LYS A CD   1  
ATOM 1830  C CE   . LYS A 1 114 ? -2.406  -0.120  9.843   1.00 0.00 ? 114 LYS A CE   1  
ATOM 1831  N NZ   . LYS A 1 114 ? -3.396  0.511   10.756  1.00 0.00 ? 114 LYS A NZ   1  
ATOM 1832  H H    . LYS A 1 114 ? 0.186   4.920   6.946   1.00 0.00 ? 114 LYS A H    1  
ATOM 1833  H HA   . LYS A 1 114 ? -2.091  3.595   6.099   1.00 0.00 ? 114 LYS A HA   1  
ATOM 1834  H HB2  . LYS A 1 114 ? -0.339  2.520   7.393   1.00 0.00 ? 114 LYS A HB2  1  
ATOM 1835  H HB3  . LYS A 1 114 ? -0.722  3.506   8.796   1.00 0.00 ? 114 LYS A HB3  1  
ATOM 1836  H HG2  . LYS A 1 114 ? -2.896  2.419   8.988   1.00 0.00 ? 114 LYS A HG2  1  
ATOM 1837  H HG3  . LYS A 1 114 ? -2.554  1.457   7.548   1.00 0.00 ? 114 LYS A HG3  1  
ATOM 1838  H HD2  . LYS A 1 114 ? -0.691  0.374   8.675   1.00 0.00 ? 114 LYS A HD2  1  
ATOM 1839  H HD3  . LYS A 1 114 ? -0.922  1.395   10.095  1.00 0.00 ? 114 LYS A HD3  1  
ATOM 1840  H HE2  . LYS A 1 114 ? -2.933  -0.591  9.027   1.00 0.00 ? 114 LYS A HE2  1  
ATOM 1841  H HE3  . LYS A 1 114 ? -1.853  -0.870  10.393  1.00 0.00 ? 114 LYS A HE3  1  
ATOM 1842  H HZ1  . LYS A 1 114 ? -3.974  1.203   10.239  1.00 0.00 ? 114 LYS A HZ1  1  
ATOM 1843  H HZ2  . LYS A 1 114 ? -2.906  1.001   11.533  1.00 0.00 ? 114 LYS A HZ2  1  
ATOM 1844  H HZ3  . LYS A 1 114 ? -4.022  -0.212  11.161  1.00 0.00 ? 114 LYS A HZ3  1  
ATOM 1845  N N    . PHE A 1 115 ? -2.736  5.734   8.526   1.00 0.00 ? 115 PHE A N    1  
ATOM 1846  C CA   . PHE A 1 115 ? -3.811  6.333   9.325   1.00 0.00 ? 115 PHE A CA   1  
ATOM 1847  C C    . PHE A 1 115 ? -4.028  7.801   8.947   1.00 0.00 ? 115 PHE A C    1  
ATOM 1848  O O    . PHE A 1 115 ? -4.710  8.544   9.653   1.00 0.00 ? 115 PHE A O    1  
ATOM 1849  C CB   . PHE A 1 115 ? -3.470  6.198   10.822  1.00 0.00 ? 115 PHE A CB   1  
ATOM 1850  C CG   . PHE A 1 115 ? -4.585  6.597   11.762  1.00 0.00 ? 115 PHE A CG   1  
ATOM 1851  C CD1  . PHE A 1 115 ? -5.736  5.827   11.858  1.00 0.00 ? 115 PHE A CD1  1  
ATOM 1852  C CD2  . PHE A 1 115 ? -4.479  7.737   12.550  1.00 0.00 ? 115 PHE A CD2  1  
ATOM 1853  C CE1  . PHE A 1 115 ? -6.756  6.185   12.720  1.00 0.00 ? 115 PHE A CE1  1  
ATOM 1854  C CE2  . PHE A 1 115 ? -5.497  8.097   13.412  1.00 0.00 ? 115 PHE A CE2  1  
ATOM 1855  C CZ   . PHE A 1 115 ? -6.636  7.320   13.497  1.00 0.00 ? 115 PHE A CZ   1  
ATOM 1856  H H    . PHE A 1 115 ? -1.825  6.090   8.607   1.00 0.00 ? 115 PHE A H    1  
ATOM 1857  H HA   . PHE A 1 115 ? -4.724  5.787   9.124   1.00 0.00 ? 115 PHE A HA   1  
ATOM 1858  H HB2  . PHE A 1 115 ? -3.220  5.168   11.031  1.00 0.00 ? 115 PHE A HB2  1  
ATOM 1859  H HB3  . PHE A 1 115 ? -2.610  6.817   11.042  1.00 0.00 ? 115 PHE A HB3  1  
ATOM 1860  H HD1  . PHE A 1 115 ? -5.832  4.938   11.251  1.00 0.00 ? 115 PHE A HD1  1  
ATOM 1861  H HD2  . PHE A 1 115 ? -3.590  8.345   12.484  1.00 0.00 ? 115 PHE A HD2  1  
ATOM 1862  H HE1  . PHE A 1 115 ? -7.647  5.575   12.785  1.00 0.00 ? 115 PHE A HE1  1  
ATOM 1863  H HE2  . PHE A 1 115 ? -5.403  8.986   14.019  1.00 0.00 ? 115 PHE A HE2  1  
ATOM 1864  H HZ   . PHE A 1 115 ? -7.433  7.600   14.171  1.00 0.00 ? 115 PHE A HZ   1  
ATOM 1865  N N    . ASP A 1 116 ? -3.489  8.209   7.802   1.00 0.00 ? 116 ASP A N    1  
ATOM 1866  C CA   . ASP A 1 116 ? -3.523  9.620   7.407   1.00 0.00 ? 116 ASP A CA   1  
ATOM 1867  C C    . ASP A 1 116 ? -4.063  9.772   5.991   1.00 0.00 ? 116 ASP A C    1  
ATOM 1868  O O    . ASP A 1 116 ? -5.254  10.029  5.800   1.00 0.00 ? 116 ASP A O    1  
ATOM 1869  C CB   . ASP A 1 116 ? -2.128  10.259  7.529   1.00 0.00 ? 116 ASP A CB   1  
ATOM 1870  C CG   . ASP A 1 116 ? -1.698  10.466  8.977   1.00 0.00 ? 116 ASP A CG   1  
ATOM 1871  O OD1  . ASP A 1 116 ? -1.214  9.504   9.608   1.00 0.00 ? 116 ASP A OD1  1  
ATOM 1872  O OD2  . ASP A 1 116 ? -1.851  11.594  9.493   1.00 0.00 ? 116 ASP A OD2  1  
ATOM 1873  H H    . ASP A 1 116 ? -3.089  7.550   7.196   1.00 0.00 ? 116 ASP A H    1  
ATOM 1874  H HA   . ASP A 1 116 ? -4.198  10.133  8.081   1.00 0.00 ? 116 ASP A HA   1  
ATOM 1875  H HB2  . ASP A 1 116 ? -1.402  9.619   7.046   1.00 0.00 ? 116 ASP A HB2  1  
ATOM 1876  H HB3  . ASP A 1 116 ? -2.134  11.221  7.032   1.00 0.00 ? 116 ASP A HB3  1  
ATOM 1877  N N    . SER A 1 117 ? -3.200  9.583   4.999   1.00 0.00 ? 117 SER A N    1  
ATOM 1878  C CA   . SER A 1 117 ? -3.604  9.717   3.606   1.00 0.00 ? 117 SER A CA   1  
ATOM 1879  C C    . SER A 1 117 ? -4.631  8.643   3.250   1.00 0.00 ? 117 SER A C    1  
ATOM 1880  O O    . SER A 1 117 ? -5.583  8.903   2.512   1.00 0.00 ? 117 SER A O    1  
ATOM 1881  C CB   . SER A 1 117 ? -2.378  9.642   2.695   1.00 0.00 ? 117 SER A CB   1  
ATOM 1882  O OG   . SER A 1 117 ? -1.568  8.530   3.028   1.00 0.00 ? 117 SER A OG   1  
ATOM 1883  H H    . SER A 1 117 ? -2.274  9.339   5.205   1.00 0.00 ? 117 SER A H    1  
ATOM 1884  H HA   . SER A 1 117 ? -4.067  10.688  3.491   1.00 0.00 ? 117 SER A HA   1  
ATOM 1885  H HB2  . SER A 1 117 ? -2.695  9.545   1.666   1.00 0.00 ? 117 SER A HB2  1  
ATOM 1886  H HB3  . SER A 1 117 ? -1.792  10.544  2.806   1.00 0.00 ? 117 SER A HB3  1  
ATOM 1887  H HG   . SER A 1 117 ? -0.924  8.379   2.327   1.00 0.00 ? 117 SER A HG   1  
ATOM 1888  N N    . TYR A 1 118 ? -4.437  7.440   3.795   1.00 0.00 ? 118 TYR A N    1  
ATOM 1889  C CA   . TYR A 1 118 ? -5.419  6.362   3.656   1.00 0.00 ? 118 TYR A CA   1  
ATOM 1890  C C    . TYR A 1 118 ? -6.775  6.801   4.204   1.00 0.00 ? 118 TYR A C    1  
ATOM 1891  O O    . TYR A 1 118 ? -7.798  6.702   3.518   1.00 0.00 ? 118 TYR A O    1  
ATOM 1892  C CB   . TYR A 1 118 ? -4.940  5.102   4.393   1.00 0.00 ? 118 TYR A CB   1  
ATOM 1893  C CG   . TYR A 1 118 ? -6.005  4.022   4.536   1.00 0.00 ? 118 TYR A CG   1  
ATOM 1894  C CD1  . TYR A 1 118 ? -6.556  3.402   3.421   1.00 0.00 ? 118 TYR A CD1  1  
ATOM 1895  C CD2  . TYR A 1 118 ? -6.457  3.624   5.793   1.00 0.00 ? 118 TYR A CD2  1  
ATOM 1896  C CE1  . TYR A 1 118 ? -7.521  2.421   3.550   1.00 0.00 ? 118 TYR A CE1  1  
ATOM 1897  C CE2  . TYR A 1 118 ? -7.420  2.643   5.929   1.00 0.00 ? 118 TYR A CE2  1  
ATOM 1898  C CZ   . TYR A 1 118 ? -7.948  2.045   4.806   1.00 0.00 ? 118 TYR A CZ   1  
ATOM 1899  O OH   . TYR A 1 118 ? -8.908  1.067   4.941   1.00 0.00 ? 118 TYR A OH   1  
ATOM 1900  H H    . TYR A 1 118 ? -3.603  7.268   4.290   1.00 0.00 ? 118 TYR A H    1  
ATOM 1901  H HA   . TYR A 1 118 ? -5.521  6.139   2.602   1.00 0.00 ? 118 TYR A HA   1  
ATOM 1902  H HB2  . TYR A 1 118 ? -4.108  4.673   3.852   1.00 0.00 ? 118 TYR A HB2  1  
ATOM 1903  H HB3  . TYR A 1 118 ? -4.608  5.378   5.385   1.00 0.00 ? 118 TYR A HB3  1  
ATOM 1904  H HD1  . TYR A 1 118 ? -6.220  3.698   2.438   1.00 0.00 ? 118 TYR A HD1  1  
ATOM 1905  H HD2  . TYR A 1 118 ? -6.043  4.093   6.672   1.00 0.00 ? 118 TYR A HD2  1  
ATOM 1906  H HE1  . TYR A 1 118 ? -7.933  1.951   2.669   1.00 0.00 ? 118 TYR A HE1  1  
ATOM 1907  H HE2  . TYR A 1 118 ? -7.757  2.350   6.913   1.00 0.00 ? 118 TYR A HE2  1  
ATOM 1908  H HH   . TYR A 1 118 ? -8.795  0.412   4.242   1.00 0.00 ? 118 TYR A HH   1  
ATOM 1909  N N    . ALA A 1 119 ? -6.766  7.306   5.437   1.00 0.00 ? 119 ALA A N    1  
ATOM 1910  C CA   . ALA A 1 119 ? -7.994  7.735   6.108   1.00 0.00 ? 119 ALA A CA   1  
ATOM 1911  C C    . ALA A 1 119 ? -8.697  8.835   5.314   1.00 0.00 ? 119 ALA A C    1  
ATOM 1912  O O    . ALA A 1 119 ? -9.921  8.959   5.350   1.00 0.00 ? 119 ALA A O    1  
ATOM 1913  C CB   . ALA A 1 119 ? -7.683  8.213   7.523   1.00 0.00 ? 119 ALA A CB   1  
ATOM 1914  H H    . ALA A 1 119 ? -5.908  7.398   5.909   1.00 0.00 ? 119 ALA A H    1  
ATOM 1915  H HA   . ALA A 1 119 ? -8.652  6.878   6.178   1.00 0.00 ? 119 ALA A HA   1  
ATOM 1916  H HB1  . ALA A 1 119 ? -8.600  8.491   8.023   1.00 0.00 ? 119 ALA A HB1  1  
ATOM 1917  H HB2  . ALA A 1 119 ? -7.024  9.068   7.479   1.00 0.00 ? 119 ALA A HB2  1  
ATOM 1918  H HB3  . ALA A 1 119 ? -7.202  7.418   8.074   1.00 0.00 ? 119 ALA A HB3  1  
ATOM 1919  N N    . ARG A 1 120 ? -7.910  9.622   4.592   1.00 0.00 ? 120 ARG A N    1  
ATOM 1920  C CA   . ARG A 1 120 ? -8.435  10.717  3.784   1.00 0.00 ? 120 ARG A CA   1  
ATOM 1921  C C    . ARG A 1 120 ? -8.986  10.202  2.452   1.00 0.00 ? 120 ARG A C    1  
ATOM 1922  O O    . ARG A 1 120 ? -10.031 10.662  1.980   1.00 0.00 ? 120 ARG A O    1  
ATOM 1923  C CB   . ARG A 1 120 ? -7.330  11.750  3.531   1.00 0.00 ? 120 ARG A CB   1  
ATOM 1924  C CG   . ARG A 1 120 ? -7.793  12.995  2.778   1.00 0.00 ? 120 ARG A CG   1  
ATOM 1925  C CD   . ARG A 1 120 ? -6.633  13.946  2.513   1.00 0.00 ? 120 ARG A CD   1  
ATOM 1926  N NE   . ARG A 1 120 ? -7.066  15.189  1.875   1.00 0.00 ? 120 ARG A NE   1  
ATOM 1927  C CZ   . ARG A 1 120 ? -6.233  16.153  1.485   1.00 0.00 ? 120 ARG A CZ   1  
ATOM 1928  N NH1  . ARG A 1 120 ? -4.919  15.990  1.606   1.00 0.00 ? 120 ARG A NH1  1  
ATOM 1929  N NH2  . ARG A 1 120 ? -6.710  17.271  0.961   1.00 0.00 ? 120 ARG A NH2  1  
ATOM 1930  H H    . ARG A 1 120 ? -6.941  9.469   4.613   1.00 0.00 ? 120 ARG A H    1  
ATOM 1931  H HA   . ARG A 1 120 ? -9.236  11.188  4.338   1.00 0.00 ? 120 ARG A HA   1  
ATOM 1932  H HB2  . ARG A 1 120 ? -6.926  12.063  4.484   1.00 0.00 ? 120 ARG A HB2  1  
ATOM 1933  H HB3  . ARG A 1 120 ? -6.542  11.281  2.957   1.00 0.00 ? 120 ARG A HB3  1  
ATOM 1934  H HG2  . ARG A 1 120 ? -8.224  12.696  1.833   1.00 0.00 ? 120 ARG A HG2  1  
ATOM 1935  H HG3  . ARG A 1 120 ? -8.539  13.507  3.371   1.00 0.00 ? 120 ARG A HG3  1  
ATOM 1936  H HD2  . ARG A 1 120 ? -6.158  14.185  3.454   1.00 0.00 ? 120 ARG A HD2  1  
ATOM 1937  H HD3  . ARG A 1 120 ? -5.918  13.451  1.868   1.00 0.00 ? 120 ARG A HD3  1  
ATOM 1938  H HE   . ARG A 1 120 ? -8.036  15.319  1.749   1.00 0.00 ? 120 ARG A HE   1  
ATOM 1939  H HH11 . ARG A 1 120 ? -4.547  15.140  1.988   1.00 0.00 ? 120 ARG A HH11 1  
ATOM 1940  H HH12 . ARG A 1 120 ? -4.291  16.719  1.311   1.00 0.00 ? 120 ARG A HH12 1  
ATOM 1941  H HH21 . ARG A 1 120 ? -7.701  17.396  0.851   1.00 0.00 ? 120 ARG A HH21 1  
ATOM 1942  H HH22 . ARG A 1 120 ? -6.084  18.005  0.687   1.00 0.00 ? 120 ARG A HH22 1  
ATOM 1943  N N    . PHE A 1 121 ? -8.287  9.235   1.856   1.00 0.00 ? 121 PHE A N    1  
ATOM 1944  C CA   . PHE A 1 121 ? -8.648  8.718   0.535   1.00 0.00 ? 121 PHE A CA   1  
ATOM 1945  C C    . PHE A 1 121 ? -10.056 8.129   0.533   1.00 0.00 ? 121 PHE A C    1  
ATOM 1946  O O    . PHE A 1 121 ? -10.855 8.419   -0.357  1.00 0.00 ? 121 PHE A O    1  
ATOM 1947  C CB   . PHE A 1 121 ? -7.640  7.658   0.067   1.00 0.00 ? 121 PHE A CB   1  
ATOM 1948  C CG   . PHE A 1 121 ? -8.027  7.005   -1.239  1.00 0.00 ? 121 PHE A CG   1  
ATOM 1949  C CD1  . PHE A 1 121 ? -8.061  7.741   -2.415  1.00 0.00 ? 121 PHE A CD1  1  
ATOM 1950  C CD2  . PHE A 1 121 ? -8.377  5.661   -1.287  1.00 0.00 ? 121 PHE A CD2  1  
ATOM 1951  C CE1  . PHE A 1 121 ? -8.431  7.151   -3.608  1.00 0.00 ? 121 PHE A CE1  1  
ATOM 1952  C CE2  . PHE A 1 121 ? -8.750  5.069   -2.478  1.00 0.00 ? 121 PHE A CE2  1  
ATOM 1953  C CZ   . PHE A 1 121 ? -8.776  5.814   -3.640  1.00 0.00 ? 121 PHE A CZ   1  
ATOM 1954  H H    . PHE A 1 121 ? -7.509  8.856   2.318   1.00 0.00 ? 121 PHE A H    1  
ATOM 1955  H HA   . PHE A 1 121 ? -8.623  9.549   -0.157  1.00 0.00 ? 121 PHE A HA   1  
ATOM 1956  H HB2  . PHE A 1 121 ? -6.673  8.122   -0.066  1.00 0.00 ? 121 PHE A HB2  1  
ATOM 1957  H HB3  . PHE A 1 121 ? -7.562  6.886   0.821   1.00 0.00 ? 121 PHE A HB3  1  
ATOM 1958  H HD1  . PHE A 1 121 ? -7.791  8.788   -2.394  1.00 0.00 ? 121 PHE A HD1  1  
ATOM 1959  H HD2  . PHE A 1 121 ? -8.355  5.074   -0.380  1.00 0.00 ? 121 PHE A HD2  1  
ATOM 1960  H HE1  . PHE A 1 121 ? -8.451  7.735   -4.516  1.00 0.00 ? 121 PHE A HE1  1  
ATOM 1961  H HE2  . PHE A 1 121 ? -9.019  4.023   -2.501  1.00 0.00 ? 121 PHE A HE2  1  
ATOM 1962  H HZ   . PHE A 1 121 ? -9.067  5.353   -4.573  1.00 0.00 ? 121 PHE A HZ   1  
ATOM 1963  N N    . VAL A 1 122 ? -10.357 7.317   1.541   1.00 0.00 ? 122 VAL A N    1  
ATOM 1964  C CA   . VAL A 1 122 ? -11.658 6.649   1.628   1.00 0.00 ? 122 VAL A CA   1  
ATOM 1965  C C    . VAL A 1 122 ? -12.802 7.665   1.751   1.00 0.00 ? 122 VAL A C    1  
ATOM 1966  O O    . VAL A 1 122 ? -13.973 7.332   1.548   1.00 0.00 ? 122 VAL A O    1  
ATOM 1967  C CB   . VAL A 1 122 ? -11.709 5.654   2.818   1.00 0.00 ? 122 VAL A CB   1  
ATOM 1968  C CG1  . VAL A 1 122 ? -10.631 4.580   2.669   1.00 0.00 ? 122 VAL A CG1  1  
ATOM 1969  C CG2  . VAL A 1 122 ? -11.566 6.380   4.155   1.00 0.00 ? 122 VAL A CG2  1  
ATOM 1970  H H    . VAL A 1 122 ? -9.687  7.157   2.243   1.00 0.00 ? 122 VAL A H    1  
ATOM 1971  H HA   . VAL A 1 122 ? -11.797 6.084   0.712   1.00 0.00 ? 122 VAL A HA   1  
ATOM 1972  H HB   . VAL A 1 122 ? -12.673 5.162   2.803   1.00 0.00 ? 122 VAL A HB   1  
ATOM 1973  H HG11 . VAL A 1 122 ? -9.655  5.044   2.662   1.00 0.00 ? 122 VAL A HG11 1  
ATOM 1974  H HG12 . VAL A 1 122 ? -10.780 4.047   1.742   1.00 0.00 ? 122 VAL A HG12 1  
ATOM 1975  H HG13 . VAL A 1 122 ? -10.694 3.886   3.495   1.00 0.00 ? 122 VAL A HG13 1  
ATOM 1976  H HG21 . VAL A 1 122 ? -12.369 7.094   4.266   1.00 0.00 ? 122 VAL A HG21 1  
ATOM 1977  H HG22 . VAL A 1 122 ? -10.618 6.898   4.186   1.00 0.00 ? 122 VAL A HG22 1  
ATOM 1978  H HG23 . VAL A 1 122 ? -11.609 5.662   4.963   1.00 0.00 ? 122 VAL A HG23 1  
ATOM 1979  N N    . LYS A 1 123 ? -12.450 8.909   2.073   1.00 0.00 ? 123 LYS A N    1  
ATOM 1980  C CA   . LYS A 1 123 ? -13.424 9.990   2.219   1.00 0.00 ? 123 LYS A CA   1  
ATOM 1981  C C    . LYS A 1 123 ? -13.467 10.838  0.948   1.00 0.00 ? 123 LYS A C    1  
ATOM 1982  O O    . LYS A 1 123 ? -14.453 11.526  0.674   1.00 0.00 ? 123 LYS A O    1  
ATOM 1983  C CB   . LYS A 1 123 ? -13.054 10.877  3.419   1.00 0.00 ? 123 LYS A CB   1  
ATOM 1984  C CG   . LYS A 1 123 ? -12.929 10.117  4.738   1.00 0.00 ? 123 LYS A CG   1  
ATOM 1985  C CD   . LYS A 1 123 ? -12.507 11.037  5.882   1.00 0.00 ? 123 LYS A CD   1  
ATOM 1986  C CE   . LYS A 1 123 ? -12.327 10.276  7.193   1.00 0.00 ? 123 LYS A CE   1  
ATOM 1987  N NZ   . LYS A 1 123 ? -13.582 9.600   7.626   1.00 0.00 ? 123 LYS A NZ   1  
ATOM 1988  H H    . LYS A 1 123 ? -11.501 9.110   2.204   1.00 0.00 ? 123 LYS A H    1  
ATOM 1989  H HA   . LYS A 1 123 ? -14.400 9.552   2.387   1.00 0.00 ? 123 LYS A HA   1  
ATOM 1990  H HB2  . LYS A 1 123 ? -12.106 11.356  3.217   1.00 0.00 ? 123 LYS A HB2  1  
ATOM 1991  H HB3  . LYS A 1 123 ? -13.813 11.638  3.538   1.00 0.00 ? 123 LYS A HB3  1  
ATOM 1992  H HG2  . LYS A 1 123 ? -13.885 9.674   4.979   1.00 0.00 ? 123 LYS A HG2  1  
ATOM 1993  H HG3  . LYS A 1 123 ? -12.189 9.337   4.622   1.00 0.00 ? 123 LYS A HG3  1  
ATOM 1994  H HD2  . LYS A 1 123 ? -11.569 11.510  5.623   1.00 0.00 ? 123 LYS A HD2  1  
ATOM 1995  H HD3  . LYS A 1 123 ? -13.265 11.796  6.018   1.00 0.00 ? 123 LYS A HD3  1  
ATOM 1996  H HE2  . LYS A 1 123 ? -11.556 9.532   7.062   1.00 0.00 ? 123 LYS A HE2  1  
ATOM 1997  H HE3  . LYS A 1 123 ? -12.023 10.974  7.962   1.00 0.00 ? 123 LYS A HE3  1  
ATOM 1998  H HZ1  . LYS A 1 123 ? -14.365 10.283  7.665   1.00 0.00 ? 123 LYS A HZ1  1  
ATOM 1999  H HZ2  . LYS A 1 123 ? -13.457 9.185   8.572   1.00 0.00 ? 123 LYS A HZ2  1  
ATOM 2000  H HZ3  . LYS A 1 123 ? -13.830 8.841   6.961   1.00 0.00 ? 123 LYS A HZ3  1  
ATOM 2001  N N    . SER A 1 124 ? -12.386 10.772  0.176   1.00 0.00 ? 124 SER A N    1  
ATOM 2002  C CA   . SER A 1 124 ? -12.236 11.569  -1.039  1.00 0.00 ? 124 SER A CA   1  
ATOM 2003  C C    . SER A 1 124 ? -12.952 10.911  -2.228  1.00 0.00 ? 124 SER A C    1  
ATOM 2004  O O    . SER A 1 124 ? -13.285 9.723   -2.177  1.00 0.00 ? 124 SER A O    1  
ATOM 2005  C CB   . SER A 1 124 ? -10.742 11.757  -1.343  1.00 0.00 ? 124 SER A CB   1  
ATOM 2006  O OG   . SER A 1 124 ? -10.083 12.409  -0.266  1.00 0.00 ? 124 SER A OG   1  
ATOM 2007  H H    . SER A 1 124 ? -11.667 10.154  0.422   1.00 0.00 ? 124 SER A H    1  
ATOM 2008  H HA   . SER A 1 124 ? -12.681 12.536  -0.861  1.00 0.00 ? 124 SER A HA   1  
ATOM 2009  H HB2  . SER A 1 124 ? -10.281 10.791  -1.497  1.00 0.00 ? 124 SER A HB2  1  
ATOM 2010  H HB3  . SER A 1 124 ? -10.627 12.356  -2.234  1.00 0.00 ? 124 SER A HB3  1  
ATOM 2011  H HG   . SER A 1 124 ? -10.312 11.967  0.560   1.00 0.00 ? 124 SER A HG   1  
ATOM 2012  N N    . PRO A 1 125 ? -13.230 11.692  -3.300  1.00 0.00 ? 125 PRO A N    1  
ATOM 2013  C CA   . PRO A 1 125 ? -13.835 11.169  -4.539  1.00 0.00 ? 125 PRO A CA   1  
ATOM 2014  C C    . PRO A 1 125 ? -13.000 10.057  -5.182  1.00 0.00 ? 125 PRO A C    1  
ATOM 2015  O O    . PRO A 1 125 ? -12.033 9.571   -4.593  1.00 0.00 ? 125 PRO A O    1  
ATOM 2016  C CB   . PRO A 1 125 ? -13.900 12.403  -5.458  1.00 0.00 ? 125 PRO A CB   1  
ATOM 2017  C CG   . PRO A 1 125 ? -13.883 13.568  -4.529  1.00 0.00 ? 125 PRO A CG   1  
ATOM 2018  C CD   . PRO A 1 125 ? -13.010 13.152  -3.379  1.00 0.00 ? 125 PRO A CD   1  
ATOM 2019  H HA   . PRO A 1 125 ? -14.835 10.800  -4.358  1.00 0.00 ? 125 PRO A HA   1  
ATOM 2020  H HB2  . PRO A 1 125 ? -13.044 12.412  -6.121  1.00 0.00 ? 125 PRO A HB2  1  
ATOM 2021  H HB3  . PRO A 1 125 ? -14.811 12.376  -6.041  1.00 0.00 ? 125 PRO A HB3  1  
ATOM 2022  H HG2  . PRO A 1 125 ? -13.467 14.432  -5.028  1.00 0.00 ? 125 PRO A HG2  1  
ATOM 2023  H HG3  . PRO A 1 125 ? -14.885 13.779  -4.184  1.00 0.00 ? 125 PRO A HG3  1  
ATOM 2024  H HD2  . PRO A 1 125 ? -11.973 13.377  -3.588  1.00 0.00 ? 125 PRO A HD2  1  
ATOM 2025  H HD3  . PRO A 1 125 ? -13.326 13.639  -2.467  1.00 0.00 ? 125 PRO A HD3  1  
ATOM 2026  N N    . LEU A 1 126 ? -13.387 9.669   -6.397  1.00 0.00 ? 126 LEU A N    1  
ATOM 2027  C CA   . LEU A 1 126 ? -12.764 8.563   -7.135  1.00 0.00 ? 126 LEU A CA   1  
ATOM 2028  C C    . LEU A 1 126 ? -13.101 7.213   -6.502  1.00 0.00 ? 126 LEU A C    1  
ATOM 2029  O O    . LEU A 1 126 ? -13.527 6.292   -7.203  1.00 0.00 ? 126 LEU A O    1  
ATOM 2030  C CB   . LEU A 1 126 ? -11.242 8.742   -7.274  1.00 0.00 ? 126 LEU A CB   1  
ATOM 2031  C CG   . LEU A 1 126 ? -10.805 9.926   -8.153  1.00 0.00 ? 126 LEU A CG   1  
ATOM 2032  C CD1  . LEU A 1 126 ? -9.282  10.011  -8.236  1.00 0.00 ? 126 LEU A CD1  1  
ATOM 2033  C CD2  . LEU A 1 126 ? -11.415 9.816   -9.550  1.00 0.00 ? 126 LEU A CD2  1  
ATOM 2034  H H    . LEU A 1 126 ? -14.129 10.150  -6.823  1.00 0.00 ? 126 LEU A H    1  
ATOM 2035  H HA   . LEU A 1 126 ? -13.197 8.575   -8.125  1.00 0.00 ? 126 LEU A HA   1  
ATOM 2036  H HB2  . LEU A 1 126 ? -10.823 8.876   -6.286  1.00 0.00 ? 126 LEU A HB2  1  
ATOM 2037  H HB3  . LEU A 1 126 ? -10.831 7.837   -7.699  1.00 0.00 ? 126 LEU A HB3  1  
ATOM 2038  H HG   . LEU A 1 126 ? -11.166 10.843  -7.706  1.00 0.00 ? 126 LEU A HG   1  
ATOM 2039  H HD11 . LEU A 1 126 ? -8.999  10.861  -8.841  1.00 0.00 ? 126 LEU A HD11 1  
ATOM 2040  H HD12 . LEU A 1 126 ? -8.892  9.107   -8.682  1.00 0.00 ? 126 LEU A HD12 1  
ATOM 2041  H HD13 . LEU A 1 126 ? -8.872  10.127  -7.243  1.00 0.00 ? 126 LEU A HD13 1  
ATOM 2042  H HD21 . LEU A 1 126 ? -12.492 9.834   -9.475  1.00 0.00 ? 126 LEU A HD21 1  
ATOM 2043  H HD22 . LEU A 1 126 ? -11.103 8.888   -10.008 1.00 0.00 ? 126 LEU A HD22 1  
ATOM 2044  H HD23 . LEU A 1 126 ? -11.083 10.646  -10.156 1.00 0.00 ? 126 LEU A HD23 1  
ATOM 2045  N N    . TYR A 1 127 ? -12.917 7.088   -5.185  1.00 0.00 ? 127 TYR A N    1  
ATOM 2046  C CA   . TYR A 1 127 ? -13.293 5.869   -4.481  1.00 0.00 ? 127 TYR A CA   1  
ATOM 2047  C C    . TYR A 1 127 ? -14.788 5.623   -4.679  1.00 0.00 ? 127 TYR A C    1  
ATOM 2048  O O    . TYR A 1 127 ? -15.195 4.611   -5.259  1.00 0.00 ? 127 TYR A O    1  
ATOM 2049  C CB   . TYR A 1 127 ? -12.959 5.983   -2.979  1.00 0.00 ? 127 TYR A CB   1  
ATOM 2050  C CG   . TYR A 1 127 ? -12.990 4.662   -2.212  1.00 0.00 ? 127 TYR A CG   1  
ATOM 2051  C CD1  . TYR A 1 127 ? -13.876 3.639   -2.549  1.00 0.00 ? 127 TYR A CD1  1  
ATOM 2052  C CD2  . TYR A 1 127 ? -12.123 4.440   -1.146  1.00 0.00 ? 127 TYR A CD2  1  
ATOM 2053  C CE1  . TYR A 1 127 ? -13.892 2.447   -1.858  1.00 0.00 ? 127 TYR A CE1  1  
ATOM 2054  C CE2  . TYR A 1 127 ? -12.137 3.246   -0.449  1.00 0.00 ? 127 TYR A CE2  1  
ATOM 2055  C CZ   . TYR A 1 127 ? -13.022 2.253   -0.809  1.00 0.00 ? 127 TYR A CZ   1  
ATOM 2056  O OH   . TYR A 1 127 ? -13.032 1.058   -0.128  1.00 0.00 ? 127 TYR A OH   1  
ATOM 2057  H H    . TYR A 1 127 ? -12.519 7.829   -4.677  1.00 0.00 ? 127 TYR A H    1  
ATOM 2058  H HA   . TYR A 1 127 ? -12.736 5.046   -4.911  1.00 0.00 ? 127 TYR A HA   1  
ATOM 2059  H HB2  . TYR A 1 127 ? -11.968 6.399   -2.875  1.00 0.00 ? 127 TYR A HB2  1  
ATOM 2060  H HB3  . TYR A 1 127 ? -13.668 6.653   -2.512  1.00 0.00 ? 127 TYR A HB3  1  
ATOM 2061  H HD1  . TYR A 1 127 ? -14.560 3.786   -3.370  1.00 0.00 ? 127 TYR A HD1  1  
ATOM 2062  H HD2  . TYR A 1 127 ? -11.429 5.219   -0.863  1.00 0.00 ? 127 TYR A HD2  1  
ATOM 2063  H HE1  . TYR A 1 127 ? -14.584 1.671   -2.144  1.00 0.00 ? 127 TYR A HE1  1  
ATOM 2064  H HE2  . TYR A 1 127 ? -11.453 3.094   0.373   1.00 0.00 ? 127 TYR A HE2  1  
ATOM 2065  H HH   . TYR A 1 127 ? -13.047 0.335   -0.762  1.00 0.00 ? 127 TYR A HH   1  
ATOM 2066  N N    . ARG A 1 128 ? -15.595 6.569   -4.207  1.00 0.00 ? 128 ARG A N    1  
ATOM 2067  C CA   . ARG A 1 128 ? -17.046 6.477   -4.318  1.00 0.00 ? 128 ARG A CA   1  
ATOM 2068  C C    . ARG A 1 128 ? -17.474 6.248   -5.772  1.00 0.00 ? 128 ARG A C    1  
ATOM 2069  O O    . ARG A 1 128 ? -18.329 5.409   -6.031  1.00 0.00 ? 128 ARG A O    1  
ATOM 2070  C CB   . ARG A 1 128 ? -17.715 7.739   -3.753  1.00 0.00 ? 128 ARG A CB   1  
ATOM 2071  C CG   . ARG A 1 128 ? -17.291 9.013   -4.465  1.00 0.00 ? 128 ARG A CG   1  
ATOM 2072  C CD   . ARG A 1 128 ? -18.029 10.244  -3.962  1.00 0.00 ? 128 ARG A CD   1  
ATOM 2073  N NE   . ARG A 1 128 ? -17.720 11.414  -4.788  1.00 0.00 ? 128 ARG A NE   1  
ATOM 2074  C CZ   . ARG A 1 128 ? -18.206 12.635  -4.580  1.00 0.00 ? 128 ARG A CZ   1  
ATOM 2075  N NH1  . ARG A 1 128 ? -19.009 12.870  -3.551  1.00 0.00 ? 128 ARG A NH1  1  
ATOM 2076  N NH2  . ARG A 1 128 ? -17.887 13.623  -5.405  1.00 0.00 ? 128 ARG A NH2  1  
ATOM 2077  H H    . ARG A 1 128 ? -15.203 7.346   -3.754  1.00 0.00 ? 128 ARG A H    1  
ATOM 2078  H HA   . ARG A 1 128 ? -17.362 5.625   -3.729  1.00 0.00 ? 128 ARG A HA   1  
ATOM 2079  H HB2  . ARG A 1 128 ? -18.788 7.638   -3.844  1.00 0.00 ? 128 ARG A HB2  1  
ATOM 2080  H HB3  . ARG A 1 128 ? -17.459 7.834   -2.708  1.00 0.00 ? 128 ARG A HB3  1  
ATOM 2081  H HG2  . ARG A 1 128 ? -16.232 9.161   -4.311  1.00 0.00 ? 128 ARG A HG2  1  
ATOM 2082  H HG3  . ARG A 1 128 ? -17.484 8.900   -5.524  1.00 0.00 ? 128 ARG A HG3  1  
ATOM 2083  H HD2  . ARG A 1 128 ? -19.094 10.057  -3.999  1.00 0.00 ? 128 ARG A HD2  1  
ATOM 2084  H HD3  . ARG A 1 128 ? -17.730 10.442  -2.943  1.00 0.00 ? 128 ARG A HD3  1  
ATOM 2085  H HE   . ARG A 1 128 ? -17.119 11.267  -5.557  1.00 0.00 ? 128 ARG A HE   1  
ATOM 2086  H HH11 . ARG A 1 128 ? -19.251 12.127  -2.919  1.00 0.00 ? 128 ARG A HH11 1  
ATOM 2087  H HH12 . ARG A 1 128 ? -19.380 13.788  -3.400  1.00 0.00 ? 128 ARG A HH12 1  
ATOM 2088  H HH21 . ARG A 1 128 ? -17.282 13.453  -6.184  1.00 0.00 ? 128 ARG A HH21 1  
ATOM 2089  H HH22 . ARG A 1 128 ? -18.252 14.546  -5.255  1.00 0.00 ? 128 ARG A HH22 1  
ATOM 2090  N N    . GLU A 1 129 ? -16.853 6.963   -6.721  1.00 0.00 ? 129 GLU A N    1  
ATOM 2091  C CA   . GLU A 1 129 ? -17.221 6.835   -8.139  1.00 0.00 ? 129 GLU A CA   1  
ATOM 2092  C C    . GLU A 1 129 ? -17.039 5.399   -8.645  1.00 0.00 ? 129 GLU A C    1  
ATOM 2093  O O    . GLU A 1 129 ? -17.711 4.975   -9.585  1.00 0.00 ? 129 GLU A O    1  
ATOM 2094  C CB   . GLU A 1 129 ? -16.416 7.809   -9.025  1.00 0.00 ? 129 GLU A CB   1  
ATOM 2095  C CG   . GLU A 1 129 ? -16.891 9.267   -8.960  1.00 0.00 ? 129 GLU A CG   1  
ATOM 2096  C CD   . GLU A 1 129 ? -15.972 10.169  -8.151  1.00 0.00 ? 129 GLU A CD   1  
ATOM 2097  O OE1  . GLU A 1 129 ? -16.129 10.241  -6.920  1.00 0.00 ? 129 GLU A OE1  1  
ATOM 2098  O OE2  . GLU A 1 129 ? -15.085 10.818  -8.745  1.00 0.00 ? 129 GLU A OE2  1  
ATOM 2099  H H    . GLU A 1 129 ? -16.138 7.588   -6.466  1.00 0.00 ? 129 GLU A H    1  
ATOM 2100  H HA   . GLU A 1 129 ? -18.270 7.088   -8.219  1.00 0.00 ? 129 GLU A HA   1  
ATOM 2101  H HB2  . GLU A 1 129 ? -15.378 7.775   -8.722  1.00 0.00 ? 129 GLU A HB2  1  
ATOM 2102  H HB3  . GLU A 1 129 ? -16.484 7.479   -10.054 1.00 0.00 ? 129 GLU A HB3  1  
ATOM 2103  H HG2  . GLU A 1 129 ? -16.952 9.656   -9.967  1.00 0.00 ? 129 GLU A HG2  1  
ATOM 2104  H HG3  . GLU A 1 129 ? -17.876 9.291   -8.515  1.00 0.00 ? 129 GLU A HG3  1  
ATOM 2105  N N    . CYS A 1 130 ? -16.128 4.654   -8.025  1.00 0.00 ? 130 CYS A N    1  
ATOM 2106  C CA   . CYS A 1 130 ? -15.867 3.270   -8.422  1.00 0.00 ? 130 CYS A CA   1  
ATOM 2107  C C    . CYS A 1 130 ? -16.624 2.285   -7.527  1.00 0.00 ? 130 CYS A C    1  
ATOM 2108  O O    . CYS A 1 130 ? -16.720 1.094   -7.835  1.00 0.00 ? 130 CYS A O    1  
ATOM 2109  C CB   . CYS A 1 130 ? -14.361 2.984   -8.369  1.00 0.00 ? 130 CYS A CB   1  
ATOM 2110  S SG   . CYS A 1 130 ? -13.370 4.077   -9.417  1.00 0.00 ? 130 CYS A SG   1  
ATOM 2111  H H    . CYS A 1 130 ? -15.616 5.043   -7.283  1.00 0.00 ? 130 CYS A H    1  
ATOM 2112  H HA   . CYS A 1 130 ? -16.209 3.145   -9.441  1.00 0.00 ? 130 CYS A HA   1  
ATOM 2113  H HB2  . CYS A 1 130 ? -14.012 3.100   -7.353  1.00 0.00 ? 130 CYS A HB2  1  
ATOM 2114  H HB3  . CYS A 1 130 ? -14.181 1.968   -8.692  1.00 0.00 ? 130 CYS A HB3  1  
ATOM 2115  H HG   . CYS A 1 130 ? -13.215 5.226   -8.772  1.00 0.00 ? 130 CYS A HG   1  
ATOM 2116  N N    . LEU A 1 131 ? -17.163 2.789   -6.420  1.00 0.00 ? 131 LEU A N    1  
ATOM 2117  C CA   . LEU A 1 131 ? -17.837 1.948   -5.432  1.00 0.00 ? 131 LEU A CA   1  
ATOM 2118  C C    . LEU A 1 131 ? -19.354 1.945   -5.633  1.00 0.00 ? 131 LEU A C    1  
ATOM 2119  O O    . LEU A 1 131 ? -19.991 0.888   -5.588  1.00 0.00 ? 131 LEU A O    1  
ATOM 2120  C CB   . LEU A 1 131 ? -17.490 2.431   -4.013  1.00 0.00 ? 131 LEU A CB   1  
ATOM 2121  C CG   . LEU A 1 131 ? -18.124 1.628   -2.863  1.00 0.00 ? 131 LEU A CG   1  
ATOM 2122  C CD1  . LEU A 1 131 ? -17.697 0.163   -2.918  1.00 0.00 ? 131 LEU A CD1  1  
ATOM 2123  C CD2  . LEU A 1 131 ? -17.765 2.247   -1.512  1.00 0.00 ? 131 LEU A CD2  1  
ATOM 2124  H H    . LEU A 1 131 ? -17.108 3.756   -6.264  1.00 0.00 ? 131 LEU A H    1  
ATOM 2125  H HA   . LEU A 1 131 ? -17.470 0.937   -5.552  1.00 0.00 ? 131 LEU A HA   1  
ATOM 2126  H HB2  . LEU A 1 131 ? -16.415 2.394   -3.900  1.00 0.00 ? 131 LEU A HB2  1  
ATOM 2127  H HB3  . LEU A 1 131 ? -17.807 3.460   -3.920  1.00 0.00 ? 131 LEU A HB3  1  
ATOM 2128  H HG   . LEU A 1 131 ? -19.201 1.659   -2.965  1.00 0.00 ? 131 LEU A HG   1  
ATOM 2129  H HD11 . LEU A 1 131 ? -18.159 -0.380  -2.107  1.00 0.00 ? 131 LEU A HD11 1  
ATOM 2130  H HD12 . LEU A 1 131 ? -16.622 0.094   -2.831  1.00 0.00 ? 131 LEU A HD12 1  
ATOM 2131  H HD13 . LEU A 1 131 ? -18.008 -0.268  -3.860  1.00 0.00 ? 131 LEU A HD13 1  
ATOM 2132  H HD21 . LEU A 1 131 ? -16.691 2.247   -1.387  1.00 0.00 ? 131 LEU A HD21 1  
ATOM 2133  H HD22 . LEU A 1 131 ? -18.219 1.672   -0.718  1.00 0.00 ? 131 LEU A HD22 1  
ATOM 2134  H HD23 . LEU A 1 131 ? -18.131 3.263   -1.473  1.00 0.00 ? 131 LEU A HD23 1  
ATOM 2135  N N    . LEU A 1 132 ? -19.924 3.124   -5.856  1.00 0.00 ? 132 LEU A N    1  
ATOM 2136  C CA   . LEU A 1 132 ? -21.374 3.278   -5.943  1.00 0.00 ? 132 LEU A CA   1  
ATOM 2137  C C    . LEU A 1 132 ? -21.735 4.594   -6.632  1.00 0.00 ? 132 LEU A C    1  
ATOM 2138  O O    . LEU A 1 132 ? -20.865 5.418   -6.907  1.00 0.00 ? 132 LEU A O    1  
ATOM 2139  C CB   . LEU A 1 132 ? -22.005 3.214   -4.533  1.00 0.00 ? 132 LEU A CB   1  
ATOM 2140  C CG   . LEU A 1 132 ? -21.770 4.433   -3.607  1.00 0.00 ? 132 LEU A CG   1  
ATOM 2141  C CD1  . LEU A 1 132 ? -22.407 4.197   -2.241  1.00 0.00 ? 132 LEU A CD1  1  
ATOM 2142  C CD2  . LEU A 1 132 ? -20.283 4.745   -3.445  1.00 0.00 ? 132 LEU A CD2  1  
ATOM 2143  H H    . LEU A 1 132 ? -19.359 3.913   -5.978  1.00 0.00 ? 132 LEU A H    1  
ATOM 2144  H HA   . LEU A 1 132 ? -21.760 2.461   -6.537  1.00 0.00 ? 132 LEU A HA   1  
ATOM 2145  H HB2  . LEU A 1 132 ? -23.073 3.088   -4.652  1.00 0.00 ? 132 LEU A HB2  1  
ATOM 2146  H HB3  . LEU A 1 132 ? -21.617 2.337   -4.034  1.00 0.00 ? 132 LEU A HB3  1  
ATOM 2147  H HG   . LEU A 1 132 ? -22.246 5.300   -4.045  1.00 0.00 ? 132 LEU A HG   1  
ATOM 2148  H HD11 . LEU A 1 132 ? -21.958 3.330   -1.776  1.00 0.00 ? 132 LEU A HD11 1  
ATOM 2149  H HD12 . LEU A 1 132 ? -23.467 4.030   -2.362  1.00 0.00 ? 132 LEU A HD12 1  
ATOM 2150  H HD13 . LEU A 1 132 ? -22.251 5.063   -1.615  1.00 0.00 ? 132 LEU A HD13 1  
ATOM 2151  H HD21 . LEU A 1 132 ? -19.851 4.953   -4.413  1.00 0.00 ? 132 LEU A HD21 1  
ATOM 2152  H HD22 . LEU A 1 132 ? -19.780 3.897   -3.001  1.00 0.00 ? 132 LEU A HD22 1  
ATOM 2153  H HD23 . LEU A 1 132 ? -20.163 5.608   -2.806  1.00 0.00 ? 132 LEU A HD23 1  
ATOM 2154  N N    . ALA A 1 133 ? -23.021 4.781   -6.909  1.00 0.00 ? 133 ALA A N    1  
ATOM 2155  C CA   . ALA A 1 133 ? -23.510 6.002   -7.554  1.00 0.00 ? 133 ALA A CA   1  
ATOM 2156  C C    . ALA A 1 133 ? -24.907 6.343   -7.047  1.00 0.00 ? 133 ALA A C    1  
ATOM 2157  O O    . ALA A 1 133 ? -25.232 7.504   -6.799  1.00 0.00 ? 133 ALA A O    1  
ATOM 2158  C CB   . ALA A 1 133 ? -23.514 5.838   -9.071  1.00 0.00 ? 133 ALA A CB   1  
ATOM 2159  H H    . ALA A 1 133 ? -23.664 4.076   -6.672  1.00 0.00 ? 133 ALA A H    1  
ATOM 2160  H HA   . ALA A 1 133 ? -22.836 6.813   -7.300  1.00 0.00 ? 133 ALA A HA   1  
ATOM 2161  H HB1  . ALA A 1 133 ? -23.839 6.760   -9.535  1.00 0.00 ? 133 ALA A HB1  1  
ATOM 2162  H HB2  . ALA A 1 133 ? -24.189 5.041   -9.347  1.00 0.00 ? 133 ALA A HB2  1  
ATOM 2163  H HB3  . ALA A 1 133 ? -22.517 5.596   -9.411  1.00 0.00 ? 133 ALA A HB3  1  
ATOM 2164  N N    . GLU A 1 134 ? -25.718 5.307   -6.889  1.00 0.00 ? 134 GLU A N    1  
ATOM 2165  C CA   . GLU A 1 134 ? -27.075 5.434   -6.355  1.00 0.00 ? 134 GLU A CA   1  
ATOM 2166  C C    . GLU A 1 134 ? -27.044 5.612   -4.834  1.00 0.00 ? 134 GLU A C    1  
ATOM 2167  O O    . GLU A 1 134 ? -28.084 5.823   -4.205  1.00 0.00 ? 134 GLU A O    1  
ATOM 2168  C CB   . GLU A 1 134 ? -27.917 4.195   -6.722  1.00 0.00 ? 134 GLU A CB   1  
ATOM 2169  C CG   . GLU A 1 134 ? -27.445 2.885   -6.079  1.00 0.00 ? 134 GLU A CG   1  
ATOM 2170  C CD   . GLU A 1 134 ? -26.056 2.459   -6.535  1.00 0.00 ? 134 GLU A CD   1  
ATOM 2171  O OE1  . GLU A 1 134 ? -25.942 1.842   -7.615  1.00 0.00 ? 134 GLU A OE1  1  
ATOM 2172  O OE2  . GLU A 1 134 ? -25.068 2.771   -5.836  1.00 0.00 ? 134 GLU A OE2  1  
ATOM 2173  H H    . GLU A 1 134 ? -25.396 4.422   -7.146  1.00 0.00 ? 134 GLU A H    1  
ATOM 2174  H HA   . GLU A 1 134 ? -27.528 6.310   -6.798  1.00 0.00 ? 134 GLU A HA   1  
ATOM 2175  H HB2  . GLU A 1 134 ? -28.940 4.370   -6.414  1.00 0.00 ? 134 GLU A HB2  1  
ATOM 2176  H HB3  . GLU A 1 134 ? -27.897 4.070   -7.795  1.00 0.00 ? 134 GLU A HB3  1  
ATOM 2177  H HG2  . GLU A 1 134 ? -27.431 3.011   -5.005  1.00 0.00 ? 134 GLU A HG2  1  
ATOM 2178  H HG3  . GLU A 1 134 ? -28.148 2.103   -6.333  1.00 0.00 ? 134 GLU A HG3  1  
ATOM 2179  N N    . ALA A 1 135 ? -25.842 5.515   -4.266  1.00 0.00 ? 135 ALA A N    1  
ATOM 2180  C CA   . ALA A 1 135 ? -25.625 5.633   -2.823  1.00 0.00 ? 135 ALA A CA   1  
ATOM 2181  C C    . ALA A 1 135 ? -26.169 4.407   -2.089  1.00 0.00 ? 135 ALA A C    1  
ATOM 2182  O O    . ALA A 1 135 ? -25.408 3.519   -1.705  1.00 0.00 ? 135 ALA A O    1  
ATOM 2183  C CB   . ALA A 1 135 ? -26.225 6.925   -2.268  1.00 0.00 ? 135 ALA A CB   1  
ATOM 2184  H H    . ALA A 1 135 ? -25.068 5.346   -4.841  1.00 0.00 ? 135 ALA A H    1  
ATOM 2185  H HA   . ALA A 1 135 ? -24.555 5.673   -2.665  1.00 0.00 ? 135 ALA A HA   1  
ATOM 2186  H HB1  . ALA A 1 135 ? -25.983 7.015   -1.218  1.00 0.00 ? 135 ALA A HB1  1  
ATOM 2187  H HB2  . ALA A 1 135 ? -27.298 6.907   -2.389  1.00 0.00 ? 135 ALA A HB2  1  
ATOM 2188  H HB3  . ALA A 1 135 ? -25.818 7.771   -2.804  1.00 0.00 ? 135 ALA A HB3  1  
ATOM 2189  N N    . GLU A 1 136 ? -27.484 4.347   -1.921  1.00 0.00 ? 136 GLU A N    1  
ATOM 2190  C CA   . GLU A 1 136 ? -28.119 3.235   -1.227  1.00 0.00 ? 136 GLU A CA   1  
ATOM 2191  C C    . GLU A 1 136 ? -28.423 2.107   -2.212  1.00 0.00 ? 136 GLU A C    1  
ATOM 2192  O O    . GLU A 1 136 ? -29.368 2.195   -3.001  1.00 0.00 ? 136 GLU A O    1  
ATOM 2193  C CB   . GLU A 1 136 ? -29.399 3.713   -0.532  1.00 0.00 ? 136 GLU A CB   1  
ATOM 2194  C CG   . GLU A 1 136 ? -29.154 4.812   0.496   1.00 0.00 ? 136 GLU A CG   1  
ATOM 2195  C CD   . GLU A 1 136 ? -30.437 5.360   1.100   1.00 0.00 ? 136 GLU A CD   1  
ATOM 2196  O OE1  . GLU A 1 136 ? -31.040 6.272   0.497   1.00 0.00 ? 136 GLU A OE1  1  
ATOM 2197  O OE2  . GLU A 1 136 ? -30.847 4.889   2.182   1.00 0.00 ? 136 GLU A OE2  1  
ATOM 2198  H H    . GLU A 1 136 ? -28.044 5.066   -2.282  1.00 0.00 ? 136 GLU A H    1  
ATOM 2199  H HA   . GLU A 1 136 ? -27.429 2.868   -0.477  1.00 0.00 ? 136 GLU A HA   1  
ATOM 2200  H HB2  . GLU A 1 136 ? -30.080 4.094   -1.282  1.00 0.00 ? 136 GLU A HB2  1  
ATOM 2201  H HB3  . GLU A 1 136 ? -29.863 2.874   -0.031  1.00 0.00 ? 136 GLU A HB3  1  
ATOM 2202  H HG2  . GLU A 1 136 ? -28.540 4.412   1.291   1.00 0.00 ? 136 GLU A HG2  1  
ATOM 2203  H HG3  . GLU A 1 136 ? -28.623 5.623   0.015   1.00 0.00 ? 136 GLU A HG3  1  
ATOM 2204  N N    . SER A 1 1   ? -15.024 -1.847  -18.991 1.00 0.00 ? 1   SER A N    2  
ATOM 2205  C CA   . SER A 1 1   ? -13.875 -1.034  -19.456 1.00 0.00 ? 1   SER A CA   2  
ATOM 2206  C C    . SER A 1 1   ? -13.803 0.292   -18.689 1.00 0.00 ? 1   SER A C    2  
ATOM 2207  O O    . SER A 1 1   ? -14.807 0.994   -18.566 1.00 0.00 ? 1   SER A O    2  
ATOM 2208  C CB   . SER A 1 1   ? -14.004 -0.771  -20.962 1.00 0.00 ? 1   SER A CB   2  
ATOM 2209  O OG   . SER A 1 1   ? -14.199 -1.984  -21.678 1.00 0.00 ? 1   SER A OG   2  
ATOM 2210  H H1   . SER A 1 1   ? -14.886 -2.134  -18.001 1.00 0.00 ? 1   SER A H1   2  
ATOM 2211  H H2   . SER A 1 1   ? -15.121 -2.697  -19.577 1.00 0.00 ? 1   SER A H2   2  
ATOM 2212  H H3   . SER A 1 1   ? -15.903 -1.294  -19.059 1.00 0.00 ? 1   SER A H3   2  
ATOM 2213  H HA   . SER A 1 1   ? -12.970 -1.595  -19.271 1.00 0.00 ? 1   SER A HA   2  
ATOM 2214  H HB2  . SER A 1 1   ? -14.849 -0.123  -21.143 1.00 0.00 ? 1   SER A HB2  2  
ATOM 2215  H HB3  . SER A 1 1   ? -13.102 -0.298  -21.323 1.00 0.00 ? 1   SER A HB3  2  
ATOM 2216  H HG   . SER A 1 1   ? -13.372 -2.486  -21.690 1.00 0.00 ? 1   SER A HG   2  
ATOM 2217  N N    . MET A 1 2   ? -12.611 0.619   -18.178 1.00 0.00 ? 2   MET A N    2  
ATOM 2218  C CA   . MET A 1 2   ? -12.382 1.847   -17.406 1.00 0.00 ? 2   MET A CA   2  
ATOM 2219  C C    . MET A 1 2   ? -13.300 1.906   -16.182 1.00 0.00 ? 2   MET A C    2  
ATOM 2220  O O    . MET A 1 2   ? -12.961 1.384   -15.119 1.00 0.00 ? 2   MET A O    2  
ATOM 2221  C CB   . MET A 1 2   ? -12.564 3.104   -18.278 1.00 0.00 ? 2   MET A CB   2  
ATOM 2222  C CG   . MET A 1 2   ? -11.570 3.215   -19.426 1.00 0.00 ? 2   MET A CG   2  
ATOM 2223  S SD   . MET A 1 2   ? -11.862 4.668   -20.458 1.00 0.00 ? 2   MET A SD   2  
ATOM 2224  C CE   . MET A 1 2   ? -13.540 4.365   -21.014 1.00 0.00 ? 2   MET A CE   2  
ATOM 2225  H H    . MET A 1 2   ? -11.855 0.006   -18.318 1.00 0.00 ? 2   MET A H    2  
ATOM 2226  H HA   . MET A 1 2   ? -11.359 1.816   -17.057 1.00 0.00 ? 2   MET A HA   2  
ATOM 2227  H HB2  . MET A 1 2   ? -13.560 3.096   -18.695 1.00 0.00 ? 2   MET A HB2  2  
ATOM 2228  H HB3  . MET A 1 2   ? -12.455 3.980   -17.652 1.00 0.00 ? 2   MET A HB3  2  
ATOM 2229  H HG2  . MET A 1 2   ? -10.570 3.278   -19.018 1.00 0.00 ? 2   MET A HG2  2  
ATOM 2230  H HG3  . MET A 1 2   ? -11.650 2.331   -20.043 1.00 0.00 ? 2   MET A HG3  2  
ATOM 2231  H HE1  . MET A 1 2   ? -13.852 5.165   -21.669 1.00 0.00 ? 2   MET A HE1  2  
ATOM 2232  H HE2  . MET A 1 2   ? -14.202 4.321   -20.161 1.00 0.00 ? 2   MET A HE2  2  
ATOM 2233  H HE3  . MET A 1 2   ? -13.579 3.428   -21.549 1.00 0.00 ? 2   MET A HE3  2  
ATOM 2234  N N    . THR A 1 3   ? -14.473 2.519   -16.338 1.00 0.00 ? 3   THR A N    2  
ATOM 2235  C CA   . THR A 1 3   ? -15.442 2.598   -15.260 1.00 0.00 ? 3   THR A CA   2  
ATOM 2236  C C    . THR A 1 3   ? -16.224 1.291   -15.183 1.00 0.00 ? 3   THR A C    2  
ATOM 2237  O O    . THR A 1 3   ? -17.280 1.138   -15.803 1.00 0.00 ? 3   THR A O    2  
ATOM 2238  C CB   . THR A 1 3   ? -16.403 3.797   -15.454 1.00 0.00 ? 3   THR A CB   2  
ATOM 2239  O OG1  . THR A 1 3   ? -16.921 3.799   -16.792 1.00 0.00 ? 3   THR A OG1  2  
ATOM 2240  C CG2  . THR A 1 3   ? -15.693 5.121   -15.182 1.00 0.00 ? 3   THR A CG2  2  
ATOM 2241  H H    . THR A 1 3   ? -14.698 2.910   -17.207 1.00 0.00 ? 3   THR A H    2  
ATOM 2242  H HA   . THR A 1 3   ? -14.903 2.739   -14.331 1.00 0.00 ? 3   THR A HA   2  
ATOM 2243  H HB   . THR A 1 3   ? -17.226 3.699   -14.758 1.00 0.00 ? 3   THR A HB   2  
ATOM 2244  H HG1  . THR A 1 3   ? -17.408 2.980   -16.948 1.00 0.00 ? 3   THR A HG1  2  
ATOM 2245  H HG21 . THR A 1 3   ? -14.854 5.226   -15.855 1.00 0.00 ? 3   THR A HG21 2  
ATOM 2246  H HG22 . THR A 1 3   ? -15.340 5.138   -14.161 1.00 0.00 ? 3   THR A HG22 2  
ATOM 2247  H HG23 . THR A 1 3   ? -16.382 5.938   -15.338 1.00 0.00 ? 3   THR A HG23 2  
ATOM 2248  N N    . GLU A 1 4   ? -15.662 0.330   -14.460 1.00 0.00 ? 4   GLU A N    2  
ATOM 2249  C CA   . GLU A 1 4   ? -16.231 -1.007  -14.368 1.00 0.00 ? 4   GLU A CA   2  
ATOM 2250  C C    . GLU A 1 4   ? -16.559 -1.333  -12.916 1.00 0.00 ? 4   GLU A C    2  
ATOM 2251  O O    . GLU A 1 4   ? -15.920 -0.817  -11.996 1.00 0.00 ? 4   GLU A O    2  
ATOM 2252  C CB   . GLU A 1 4   ? -15.242 -2.023  -14.954 1.00 0.00 ? 4   GLU A CB   2  
ATOM 2253  C CG   . GLU A 1 4   ? -15.835 -3.400  -15.239 1.00 0.00 ? 4   GLU A CG   2  
ATOM 2254  C CD   . GLU A 1 4   ? -14.883 -4.285  -16.031 1.00 0.00 ? 4   GLU A CD   2  
ATOM 2255  O OE1  . GLU A 1 4   ? -14.345 -3.811  -17.058 1.00 0.00 ? 4   GLU A OE1  2  
ATOM 2256  O OE2  . GLU A 1 4   ? -14.648 -5.446  -15.624 1.00 0.00 ? 4   GLU A OE2  2  
ATOM 2257  H H    . GLU A 1 4   ? -14.836 0.528   -13.968 1.00 0.00 ? 4   GLU A H    2  
ATOM 2258  H HA   . GLU A 1 4   ? -17.145 -1.027  -14.947 1.00 0.00 ? 4   GLU A HA   2  
ATOM 2259  H HB2  . GLU A 1 4   ? -14.858 -1.628  -15.883 1.00 0.00 ? 4   GLU A HB2  2  
ATOM 2260  H HB3  . GLU A 1 4   ? -14.418 -2.145  -14.262 1.00 0.00 ? 4   GLU A HB3  2  
ATOM 2261  H HG2  . GLU A 1 4   ? -16.063 -3.884  -14.298 1.00 0.00 ? 4   GLU A HG2  2  
ATOM 2262  H HG3  . GLU A 1 4   ? -16.746 -3.276  -15.808 1.00 0.00 ? 4   GLU A HG3  2  
ATOM 2263  N N    . GLU A 1 5   ? -17.557 -2.183  -12.720 1.00 0.00 ? 5   GLU A N    2  
ATOM 2264  C CA   . GLU A 1 5   ? -18.030 -2.526  -11.384 1.00 0.00 ? 5   GLU A CA   2  
ATOM 2265  C C    . GLU A 1 5   ? -17.004 -3.370  -10.633 1.00 0.00 ? 5   GLU A C    2  
ATOM 2266  O O    . GLU A 1 5   ? -17.049 -4.602  -10.650 1.00 0.00 ? 5   GLU A O    2  
ATOM 2267  C CB   . GLU A 1 5   ? -19.377 -3.251  -11.471 1.00 0.00 ? 5   GLU A CB   2  
ATOM 2268  C CG   . GLU A 1 5   ? -20.492 -2.375  -12.031 1.00 0.00 ? 5   GLU A CG   2  
ATOM 2269  C CD   . GLU A 1 5   ? -21.730 -3.166  -12.403 1.00 0.00 ? 5   GLU A CD   2  
ATOM 2270  O OE1  . GLU A 1 5   ? -22.581 -3.409  -11.520 1.00 0.00 ? 5   GLU A OE1  2  
ATOM 2271  O OE2  . GLU A 1 5   ? -21.860 -3.543  -13.587 1.00 0.00 ? 5   GLU A OE2  2  
ATOM 2272  H H    . GLU A 1 5   ? -17.987 -2.598  -13.500 1.00 0.00 ? 5   GLU A H    2  
ATOM 2273  H HA   . GLU A 1 5   ? -18.173 -1.600  -10.842 1.00 0.00 ? 5   GLU A HA   2  
ATOM 2274  H HB2  . GLU A 1 5   ? -19.269 -4.118  -12.110 1.00 0.00 ? 5   GLU A HB2  2  
ATOM 2275  H HB3  . GLU A 1 5   ? -19.665 -3.577  -10.480 1.00 0.00 ? 5   GLU A HB3  2  
ATOM 2276  H HG2  . GLU A 1 5   ? -20.764 -1.639  -11.287 1.00 0.00 ? 5   GLU A HG2  2  
ATOM 2277  H HG3  . GLU A 1 5   ? -20.125 -1.868  -12.914 1.00 0.00 ? 5   GLU A HG3  2  
ATOM 2278  N N    . GLN A 1 6   ? -16.053 -2.686  -10.010 1.00 0.00 ? 6   GLN A N    2  
ATOM 2279  C CA   . GLN A 1 6   ? -15.061 -3.324  -9.158  1.00 0.00 ? 6   GLN A CA   2  
ATOM 2280  C C    . GLN A 1 6   ? -15.465 -3.144  -7.697  1.00 0.00 ? 6   GLN A C    2  
ATOM 2281  O O    . GLN A 1 6   ? -16.024 -2.105  -7.338  1.00 0.00 ? 6   GLN A O    2  
ATOM 2282  C CB   . GLN A 1 6   ? -13.673 -2.707  -9.401  1.00 0.00 ? 6   GLN A CB   2  
ATOM 2283  C CG   . GLN A 1 6   ? -13.197 -2.811  -10.847 1.00 0.00 ? 6   GLN A CG   2  
ATOM 2284  C CD   . GLN A 1 6   ? -13.032 -4.244  -11.325 1.00 0.00 ? 6   GLN A CD   2  
ATOM 2285  O OE1  . GLN A 1 6   ? -13.246 -4.548  -12.499 1.00 0.00 ? 6   GLN A OE1  2  
ATOM 2286  N NE2  . GLN A 1 6   ? -12.622 -5.133  -10.432 1.00 0.00 ? 6   GLN A NE2  2  
ATOM 2287  H H    . GLN A 1 6   ? -16.017 -1.713  -10.131 1.00 0.00 ? 6   GLN A H    2  
ATOM 2288  H HA   . GLN A 1 6   ? -15.033 -4.380  -9.395  1.00 0.00 ? 6   GLN A HA   2  
ATOM 2289  H HB2  . GLN A 1 6   ? -13.706 -1.661  -9.130  1.00 0.00 ? 6   GLN A HB2  2  
ATOM 2290  H HB3  . GLN A 1 6   ? -12.951 -3.208  -8.770  1.00 0.00 ? 6   GLN A HB3  2  
ATOM 2291  H HG2  . GLN A 1 6   ? -13.916 -2.317  -11.485 1.00 0.00 ? 6   GLN A HG2  2  
ATOM 2292  H HG3  . GLN A 1 6   ? -12.243 -2.308  -10.934 1.00 0.00 ? 6   GLN A HG3  2  
ATOM 2293  H HE21 . GLN A 1 6   ? -12.441 -4.827  -9.519  1.00 0.00 ? 6   GLN A HE21 2  
ATOM 2294  H HE22 . GLN A 1 6   ? -12.517 -6.066  -10.721 1.00 0.00 ? 6   GLN A HE22 2  
ATOM 2295  N N    . PRO A 1 7   ? -15.214 -4.147  -6.835  1.00 0.00 ? 7   PRO A N    2  
ATOM 2296  C CA   . PRO A 1 7   ? -15.504 -4.043  -5.401  1.00 0.00 ? 7   PRO A CA   2  
ATOM 2297  C C    . PRO A 1 7   ? -14.595 -3.018  -4.720  1.00 0.00 ? 7   PRO A C    2  
ATOM 2298  O O    . PRO A 1 7   ? -13.689 -3.373  -3.968  1.00 0.00 ? 7   PRO A O    2  
ATOM 2299  C CB   . PRO A 1 7   ? -15.240 -5.466  -4.861  1.00 0.00 ? 7   PRO A CB   2  
ATOM 2300  C CG   . PRO A 1 7   ? -15.161 -6.337  -6.075  1.00 0.00 ? 7   PRO A CG   2  
ATOM 2301  C CD   . PRO A 1 7   ? -14.641 -5.458  -7.177  1.00 0.00 ? 7   PRO A CD   2  
ATOM 2302  H HA   . PRO A 1 7   ? -16.538 -3.773  -5.228  1.00 0.00 ? 7   PRO A HA   2  
ATOM 2303  H HB2  . PRO A 1 7   ? -14.312 -5.481  -4.306  1.00 0.00 ? 7   PRO A HB2  2  
ATOM 2304  H HB3  . PRO A 1 7   ? -16.052 -5.767  -4.215  1.00 0.00 ? 7   PRO A HB3  2  
ATOM 2305  H HG2  . PRO A 1 7   ? -14.481 -7.159  -5.895  1.00 0.00 ? 7   PRO A HG2  2  
ATOM 2306  H HG3  . PRO A 1 7   ? -16.143 -6.712  -6.325  1.00 0.00 ? 7   PRO A HG3  2  
ATOM 2307  H HD2  . PRO A 1 7   ? -13.560 -5.426  -7.161  1.00 0.00 ? 7   PRO A HD2  2  
ATOM 2308  H HD3  . PRO A 1 7   ? -14.999 -5.800  -8.138  1.00 0.00 ? 7   PRO A HD3  2  
ATOM 2309  N N    . VAL A 1 8   ? -14.842 -1.741  -5.005  1.00 0.00 ? 8   VAL A N    2  
ATOM 2310  C CA   . VAL A 1 8   ? -14.017 -0.643  -4.495  1.00 0.00 ? 8   VAL A CA   2  
ATOM 2311  C C    . VAL A 1 8   ? -13.980 -0.620  -2.964  1.00 0.00 ? 8   VAL A C    2  
ATOM 2312  O O    . VAL A 1 8   ? -13.036 -0.109  -2.364  1.00 0.00 ? 8   VAL A O    2  
ATOM 2313  C CB   . VAL A 1 8   ? -14.526 0.721   -5.024  1.00 0.00 ? 8   VAL A CB   2  
ATOM 2314  C CG1  . VAL A 1 8   ? -14.373 0.800   -6.544  1.00 0.00 ? 8   VAL A CG1  2  
ATOM 2315  C CG2  . VAL A 1 8   ? -15.980 0.951   -4.618  1.00 0.00 ? 8   VAL A CG2  2  
ATOM 2316  H H    . VAL A 1 8   ? -15.600 -1.529  -5.590  1.00 0.00 ? 8   VAL A H    2  
ATOM 2317  H HA   . VAL A 1 8   ? -13.010 -0.791  -4.862  1.00 0.00 ? 8   VAL A HA   2  
ATOM 2318  H HB   . VAL A 1 8   ? -13.921 1.504   -4.584  1.00 0.00 ? 8   VAL A HB   2  
ATOM 2319  H HG11 . VAL A 1 8   ? -14.948 0.010   -7.008  1.00 0.00 ? 8   VAL A HG11 2  
ATOM 2320  H HG12 . VAL A 1 8   ? -13.331 0.689   -6.810  1.00 0.00 ? 8   VAL A HG12 2  
ATOM 2321  H HG13 . VAL A 1 8   ? -14.732 1.757   -6.894  1.00 0.00 ? 8   VAL A HG13 2  
ATOM 2322  H HG21 . VAL A 1 8   ? -16.062 0.930   -3.540  1.00 0.00 ? 8   VAL A HG21 2  
ATOM 2323  H HG22 . VAL A 1 8   ? -16.602 0.175   -5.040  1.00 0.00 ? 8   VAL A HG22 2  
ATOM 2324  H HG23 . VAL A 1 8   ? -16.310 1.913   -4.983  1.00 0.00 ? 8   VAL A HG23 2  
ATOM 2325  N N    . ALA A 1 9   ? -15.002 -1.200  -2.339  1.00 0.00 ? 9   ALA A N    2  
ATOM 2326  C CA   . ALA A 1 9   ? -15.085 -1.263  -0.880  1.00 0.00 ? 9   ALA A CA   2  
ATOM 2327  C C    . ALA A 1 9   ? -13.927 -2.073  -0.290  1.00 0.00 ? 9   ALA A C    2  
ATOM 2328  O O    . ALA A 1 9   ? -13.635 -1.975  0.903   1.00 0.00 ? 9   ALA A O    2  
ATOM 2329  C CB   . ALA A 1 9   ? -16.424 -1.858  -0.458  1.00 0.00 ? 9   ALA A CB   2  
ATOM 2330  H H    . ALA A 1 9   ? -15.721 -1.592  -2.873  1.00 0.00 ? 9   ALA A H    2  
ATOM 2331  H HA   . ALA A 1 9   ? -15.032 -0.251  -0.501  1.00 0.00 ? 9   ALA A HA   2  
ATOM 2332  H HB1  . ALA A 1 9   ? -17.228 -1.274  -0.882  1.00 0.00 ? 9   ALA A HB1  2  
ATOM 2333  H HB2  . ALA A 1 9   ? -16.502 -1.847  0.620   1.00 0.00 ? 9   ALA A HB2  2  
ATOM 2334  H HB3  . ALA A 1 9   ? -16.496 -2.876  -0.814  1.00 0.00 ? 9   ALA A HB3  2  
ATOM 2335  N N    . SER A 1 10  ? -13.264 -2.863  -1.137  1.00 0.00 ? 10  SER A N    2  
ATOM 2336  C CA   . SER A 1 10  ? -12.156 -3.705  -0.698  1.00 0.00 ? 10  SER A CA   2  
ATOM 2337  C C    . SER A 1 10  ? -11.000 -2.853  -0.173  1.00 0.00 ? 10  SER A C    2  
ATOM 2338  O O    . SER A 1 10  ? -10.219 -3.303  0.667   1.00 0.00 ? 10  SER A O    2  
ATOM 2339  C CB   . SER A 1 10  ? -11.675 -4.609  -1.846  1.00 0.00 ? 10  SER A CB   2  
ATOM 2340  O OG   . SER A 1 10  ? -11.233 -3.847  -2.961  1.00 0.00 ? 10  SER A OG   2  
ATOM 2341  H H    . SER A 1 10  ? -13.526 -2.873  -2.080  1.00 0.00 ? 10  SER A H    2  
ATOM 2342  H HA   . SER A 1 10  ? -12.518 -4.328  0.109   1.00 0.00 ? 10  SER A HA   2  
ATOM 2343  H HB2  . SER A 1 10  ? -10.854 -5.221  -1.500  1.00 0.00 ? 10  SER A HB2  2  
ATOM 2344  H HB3  . SER A 1 10  ? -12.487 -5.248  -2.163  1.00 0.00 ? 10  SER A HB3  2  
ATOM 2345  H HG   . SER A 1 10  ? -11.909 -3.865  -3.650  1.00 0.00 ? 10  SER A HG   2  
ATOM 2346  N N    . TRP A 1 11  ? -10.904 -1.615  -0.663  1.00 0.00 ? 11  TRP A N    2  
ATOM 2347  C CA   . TRP A 1 11  ? -9.846  -0.701  -0.243  1.00 0.00 ? 11  TRP A CA   2  
ATOM 2348  C C    . TRP A 1 11  ? -9.922  -0.447  1.262   1.00 0.00 ? 11  TRP A C    2  
ATOM 2349  O O    . TRP A 1 11  ? -8.903  -0.408  1.948   1.00 0.00 ? 11  TRP A O    2  
ATOM 2350  C CB   . TRP A 1 11  ? -9.947  0.637   -0.987  1.00 0.00 ? 11  TRP A CB   2  
ATOM 2351  C CG   . TRP A 1 11  ? -9.912  0.524   -2.484  1.00 0.00 ? 11  TRP A CG   2  
ATOM 2352  C CD1  . TRP A 1 11  ? -9.280  -0.427  -3.237  1.00 0.00 ? 11  TRP A CD1  2  
ATOM 2353  C CD2  . TRP A 1 11  ? -10.526 1.426   -3.411  1.00 0.00 ? 11  TRP A CD2  2  
ATOM 2354  N NE1  . TRP A 1 11  ? -9.476  -0.172  -4.574  1.00 0.00 ? 11  TRP A NE1  2  
ATOM 2355  C CE2  . TRP A 1 11  ? -10.239 0.959   -4.704  1.00 0.00 ? 11  TRP A CE2  2  
ATOM 2356  C CE3  . TRP A 1 11  ? -11.298 2.580   -3.264  1.00 0.00 ? 11  TRP A CE3  2  
ATOM 2357  C CZ2  . TRP A 1 11  ? -10.697 1.611   -5.846  1.00 0.00 ? 11  TRP A CZ2  2  
ATOM 2358  C CZ3  . TRP A 1 11  ? -11.751 3.228   -4.397  1.00 0.00 ? 11  TRP A CZ3  2  
ATOM 2359  C CH2  . TRP A 1 11  ? -11.449 2.742   -5.675  1.00 0.00 ? 11  TRP A CH2  2  
ATOM 2360  H H    . TRP A 1 11  ? -11.563 -1.311  -1.325  1.00 0.00 ? 11  TRP A H    2  
ATOM 2361  H HA   . TRP A 1 11  ? -8.896  -1.162  -0.472  1.00 0.00 ? 11  TRP A HA   2  
ATOM 2362  H HB2  . TRP A 1 11  ? -10.875 1.119   -0.716  1.00 0.00 ? 11  TRP A HB2  2  
ATOM 2363  H HB3  . TRP A 1 11  ? -9.123  1.269   -0.684  1.00 0.00 ? 11  TRP A HB3  2  
ATOM 2364  H HD1  . TRP A 1 11  ? -8.716  -1.252  -2.829  1.00 0.00 ? 11  TRP A HD1  2  
ATOM 2365  H HE1  . TRP A 1 11  ? -9.121  -0.712  -5.319  1.00 0.00 ? 11  TRP A HE1  2  
ATOM 2366  H HE3  . TRP A 1 11  ? -11.541 2.969   -2.286  1.00 0.00 ? 11  TRP A HE3  2  
ATOM 2367  H HZ2  . TRP A 1 11  ? -10.472 1.245   -6.837  1.00 0.00 ? 11  TRP A HZ2  2  
ATOM 2368  H HZ3  . TRP A 1 11  ? -12.347 4.124   -4.299  1.00 0.00 ? 11  TRP A HZ3  2  
ATOM 2369  H HH2  . TRP A 1 11  ? -11.822 3.280   -6.536  1.00 0.00 ? 11  TRP A HH2  2  
ATOM 2370  N N    . ALA A 1 12  ? -11.144 -0.289  1.765   1.00 0.00 ? 12  ALA A N    2  
ATOM 2371  C CA   . ALA A 1 12  ? -11.364 0.000   3.179   1.00 0.00 ? 12  ALA A CA   2  
ATOM 2372  C C    . ALA A 1 12  ? -11.064 -1.221  4.045   1.00 0.00 ? 12  ALA A C    2  
ATOM 2373  O O    . ALA A 1 12  ? -10.882 -1.106  5.254   1.00 0.00 ? 12  ALA A O    2  
ATOM 2374  C CB   . ALA A 1 12  ? -12.796 0.477   3.401   1.00 0.00 ? 12  ALA A CB   2  
ATOM 2375  H H    . ALA A 1 12  ? -11.919 -0.371  1.171   1.00 0.00 ? 12  ALA A H    2  
ATOM 2376  H HA   . ALA A 1 12  ? -10.696 0.802   3.464   1.00 0.00 ? 12  ALA A HA   2  
ATOM 2377  H HB1  . ALA A 1 12  ? -12.934 0.735   4.442   1.00 0.00 ? 12  ALA A HB1  2  
ATOM 2378  H HB2  . ALA A 1 12  ? -13.485 -0.310  3.131   1.00 0.00 ? 12  ALA A HB2  2  
ATOM 2379  H HB3  . ALA A 1 12  ? -12.985 1.347   2.788   1.00 0.00 ? 12  ALA A HB3  2  
ATOM 2380  N N    . LEU A 1 13  ? -11.011 -2.392  3.413   1.00 0.00 ? 13  LEU A N    2  
ATOM 2381  C CA   . LEU A 1 13  ? -10.747 -3.636  4.126   1.00 0.00 ? 13  LEU A CA   2  
ATOM 2382  C C    . LEU A 1 13  ? -9.257  -3.787  4.430   1.00 0.00 ? 13  LEU A C    2  
ATOM 2383  O O    . LEU A 1 13  ? -8.875  -4.578  5.295   1.00 0.00 ? 13  LEU A O    2  
ATOM 2384  C CB   . LEU A 1 13  ? -11.249 -4.841  3.313   1.00 0.00 ? 13  LEU A CB   2  
ATOM 2385  C CG   . LEU A 1 13  ? -12.762 -4.868  3.038   1.00 0.00 ? 13  LEU A CG   2  
ATOM 2386  C CD1  . LEU A 1 13  ? -13.140 -6.095  2.210   1.00 0.00 ? 13  LEU A CD1  2  
ATOM 2387  C CD2  . LEU A 1 13  ? -13.552 -4.836  4.347   1.00 0.00 ? 13  LEU A CD2  2  
ATOM 2388  H H    . LEU A 1 13  ? -11.148 -2.417  2.443   1.00 0.00 ? 13  LEU A H    2  
ATOM 2389  H HA   . LEU A 1 13  ? -11.287 -3.601  5.063   1.00 0.00 ? 13  LEU A HA   2  
ATOM 2390  H HB2  . LEU A 1 13  ? -10.731 -4.847  2.364   1.00 0.00 ? 13  LEU A HB2  2  
ATOM 2391  H HB3  . LEU A 1 13  ? -10.987 -5.744  3.850   1.00 0.00 ? 13  LEU A HB3  2  
ATOM 2392  H HG   . LEU A 1 13  ? -13.030 -3.990  2.467   1.00 0.00 ? 13  LEU A HG   2  
ATOM 2393  H HD11 . LEU A 1 13  ? -14.202 -6.084  2.010   1.00 0.00 ? 13  LEU A HD11 2  
ATOM 2394  H HD12 . LEU A 1 13  ? -12.887 -6.994  2.755   1.00 0.00 ? 13  LEU A HD12 2  
ATOM 2395  H HD13 . LEU A 1 13  ? -12.598 -6.079  1.275   1.00 0.00 ? 13  LEU A HD13 2  
ATOM 2396  H HD21 . LEU A 1 13  ? -13.320 -3.928  4.886   1.00 0.00 ? 13  LEU A HD21 2  
ATOM 2397  H HD22 . LEU A 1 13  ? -13.286 -5.691  4.952   1.00 0.00 ? 13  LEU A HD22 2  
ATOM 2398  H HD23 . LEU A 1 13  ? -14.611 -4.864  4.131   1.00 0.00 ? 13  LEU A HD23 2  
ATOM 2399  N N    . SER A 1 14  ? -8.421  -3.027  3.715   1.00 0.00 ? 14  SER A N    2  
ATOM 2400  C CA   . SER A 1 14  ? -6.973  -3.063  3.914   1.00 0.00 ? 14  SER A CA   2  
ATOM 2401  C C    . SER A 1 14  ? -6.273  -2.008  3.064   1.00 0.00 ? 14  SER A C    2  
ATOM 2402  O O    . SER A 1 14  ? -6.588  -1.841  1.883   1.00 0.00 ? 14  SER A O    2  
ATOM 2403  C CB   . SER A 1 14  ? -6.414  -4.447  3.561   1.00 0.00 ? 14  SER A CB   2  
ATOM 2404  O OG   . SER A 1 14  ? -4.999  -4.480  3.664   1.00 0.00 ? 14  SER A OG   2  
ATOM 2405  H H    . SER A 1 14  ? -8.791  -2.423  3.035   1.00 0.00 ? 14  SER A H    2  
ATOM 2406  H HA   . SER A 1 14  ? -6.775  -2.860  4.957   1.00 0.00 ? 14  SER A HA   2  
ATOM 2407  H HB2  . SER A 1 14  ? -6.822  -5.176  4.238   1.00 0.00 ? 14  SER A HB2  2  
ATOM 2408  H HB3  . SER A 1 14  ? -6.692  -4.700  2.548   1.00 0.00 ? 14  SER A HB3  2  
ATOM 2409  H HG   . SER A 1 14  ? -4.749  -4.911  4.486   1.00 0.00 ? 14  SER A HG   2  
ATOM 2410  N N    . PHE A 1 15  ? -5.310  -1.311  3.664   1.00 0.00 ? 15  PHE A N    2  
ATOM 2411  C CA   . PHE A 1 15  ? -4.490  -0.355  2.920   1.00 0.00 ? 15  PHE A CA   2  
ATOM 2412  C C    . PHE A 1 15  ? -3.644  -1.103  1.895   1.00 0.00 ? 15  PHE A C    2  
ATOM 2413  O O    . PHE A 1 15  ? -3.440  -0.627  0.781   1.00 0.00 ? 15  PHE A O    2  
ATOM 2414  C CB   . PHE A 1 15  ? -3.592  0.469   3.858   1.00 0.00 ? 15  PHE A CB   2  
ATOM 2415  C CG   . PHE A 1 15  ? -2.679  1.438   3.135   1.00 0.00 ? 15  PHE A CG   2  
ATOM 2416  C CD1  . PHE A 1 15  ? -3.155  2.216   2.086   1.00 0.00 ? 15  PHE A CD1  2  
ATOM 2417  C CD2  . PHE A 1 15  ? -1.345  1.564   3.496   1.00 0.00 ? 15  PHE A CD2  2  
ATOM 2418  C CE1  . PHE A 1 15  ? -2.321  3.095   1.419   1.00 0.00 ? 15  PHE A CE1  2  
ATOM 2419  C CE2  . PHE A 1 15  ? -0.508  2.441   2.830   1.00 0.00 ? 15  PHE A CE2  2  
ATOM 2420  C CZ   . PHE A 1 15  ? -0.998  3.207   1.791   1.00 0.00 ? 15  PHE A CZ   2  
ATOM 2421  H H    . PHE A 1 15  ? -5.146  -1.449  4.624   1.00 0.00 ? 15  PHE A H    2  
ATOM 2422  H HA   . PHE A 1 15  ? -5.159  0.315   2.394   1.00 0.00 ? 15  PHE A HA   2  
ATOM 2423  H HB2  . PHE A 1 15  ? -4.216  1.040   4.532   1.00 0.00 ? 15  PHE A HB2  2  
ATOM 2424  H HB3  . PHE A 1 15  ? -2.975  -0.206  4.436   1.00 0.00 ? 15  PHE A HB3  2  
ATOM 2425  H HD1  . PHE A 1 15  ? -4.191  2.132   1.791   1.00 0.00 ? 15  PHE A HD1  2  
ATOM 2426  H HD2  . PHE A 1 15  ? -0.957  0.969   4.310   1.00 0.00 ? 15  PHE A HD2  2  
ATOM 2427  H HE1  . PHE A 1 15  ? -2.706  3.693   0.605   1.00 0.00 ? 15  PHE A HE1  2  
ATOM 2428  H HE2  . PHE A 1 15  ? 0.528   2.528   3.125   1.00 0.00 ? 15  PHE A HE2  2  
ATOM 2429  H HZ   . PHE A 1 15  ? -0.346  3.892   1.270   1.00 0.00 ? 15  PHE A HZ   2  
ATOM 2430  N N    . GLU A 1 16  ? -3.174  -2.284  2.289   1.00 0.00 ? 16  GLU A N    2  
ATOM 2431  C CA   . GLU A 1 16  ? -2.433  -3.170  1.400   1.00 0.00 ? 16  GLU A CA   2  
ATOM 2432  C C    . GLU A 1 16  ? -3.231  -3.390  0.112   1.00 0.00 ? 16  GLU A C    2  
ATOM 2433  O O    . GLU A 1 16  ? -2.695  -3.307  -0.989  1.00 0.00 ? 16  GLU A O    2  
ATOM 2434  C CB   . GLU A 1 16  ? -2.175  -4.516  2.098   1.00 0.00 ? 16  GLU A CB   2  
ATOM 2435  C CG   . GLU A 1 16  ? -1.301  -5.484  1.302   1.00 0.00 ? 16  GLU A CG   2  
ATOM 2436  C CD   . GLU A 1 16  ? 0.160   -5.054  1.237   1.00 0.00 ? 16  GLU A CD   2  
ATOM 2437  O OE1  . GLU A 1 16  ? 0.501   -4.212  0.383   1.00 0.00 ? 16  GLU A OE1  2  
ATOM 2438  O OE2  . GLU A 1 16  ? 0.971   -5.568  2.040   1.00 0.00 ? 16  GLU A OE2  2  
ATOM 2439  H H    . GLU A 1 16  ? -3.325  -2.565  3.206   1.00 0.00 ? 16  GLU A H    2  
ATOM 2440  H HA   . GLU A 1 16  ? -1.488  -2.699  1.168   1.00 0.00 ? 16  GLU A HA   2  
ATOM 2441  H HB2  . GLU A 1 16  ? -1.690  -4.328  3.046   1.00 0.00 ? 16  GLU A HB2  2  
ATOM 2442  H HB3  . GLU A 1 16  ? -3.125  -4.998  2.285   1.00 0.00 ? 16  GLU A HB3  2  
ATOM 2443  H HG2  . GLU A 1 16  ? -1.354  -6.459  1.767   1.00 0.00 ? 16  GLU A HG2  2  
ATOM 2444  H HG3  . GLU A 1 16  ? -1.687  -5.552  0.294   1.00 0.00 ? 16  GLU A HG3  2  
ATOM 2445  N N    . ARG A 1 17  ? -4.533  -3.641  0.272   1.00 0.00 ? 17  ARG A N    2  
ATOM 2446  C CA   . ARG A 1 17  ? -5.437  -3.838  -0.861  1.00 0.00 ? 17  ARG A CA   2  
ATOM 2447  C C    . ARG A 1 17  ? -5.430  -2.613  -1.774  1.00 0.00 ? 17  ARG A C    2  
ATOM 2448  O O    . ARG A 1 17  ? -5.187  -2.729  -2.975  1.00 0.00 ? 17  ARG A O    2  
ATOM 2449  C CB   . ARG A 1 17  ? -6.865  -4.119  -0.362  1.00 0.00 ? 17  ARG A CB   2  
ATOM 2450  C CG   . ARG A 1 17  ? -7.924  -4.137  -1.463  1.00 0.00 ? 17  ARG A CG   2  
ATOM 2451  C CD   . ARG A 1 17  ? -7.656  -5.212  -2.510  1.00 0.00 ? 17  ARG A CD   2  
ATOM 2452  N NE   . ARG A 1 17  ? -8.670  -5.207  -3.569  1.00 0.00 ? 17  ARG A NE   2  
ATOM 2453  C CZ   . ARG A 1 17  ? -8.675  -6.053  -4.603  1.00 0.00 ? 17  ARG A CZ   2  
ATOM 2454  N NH1  . ARG A 1 17  ? -7.728  -6.979  -4.719  1.00 0.00 ? 17  ARG A NH1  2  
ATOM 2455  N NH2  . ARG A 1 17  ? -9.623  -5.967  -5.527  1.00 0.00 ? 17  ARG A NH2  2  
ATOM 2456  H H    . ARG A 1 17  ? -4.894  -3.690  1.182   1.00 0.00 ? 17  ARG A H    2  
ATOM 2457  H HA   . ARG A 1 17  ? -5.086  -4.694  -1.422  1.00 0.00 ? 17  ARG A HA   2  
ATOM 2458  H HB2  . ARG A 1 17  ? -6.876  -5.080  0.133   1.00 0.00 ? 17  ARG A HB2  2  
ATOM 2459  H HB3  . ARG A 1 17  ? -7.138  -3.356  0.355   1.00 0.00 ? 17  ARG A HB3  2  
ATOM 2460  H HG2  . ARG A 1 17  ? -8.888  -4.324  -1.014  1.00 0.00 ? 17  ARG A HG2  2  
ATOM 2461  H HG3  . ARG A 1 17  ? -7.937  -3.171  -1.948  1.00 0.00 ? 17  ARG A HG3  2  
ATOM 2462  H HD2  . ARG A 1 17  ? -6.686  -5.035  -2.954  1.00 0.00 ? 17  ARG A HD2  2  
ATOM 2463  H HD3  . ARG A 1 17  ? -7.659  -6.179  -2.026  1.00 0.00 ? 17  ARG A HD3  2  
ATOM 2464  H HE   . ARG A 1 17  ? -9.387  -4.534  -3.504  1.00 0.00 ? 17  ARG A HE   2  
ATOM 2465  H HH11 . ARG A 1 17  ? -7.004  -7.052  -4.027  1.00 0.00 ? 17  ARG A HH11 2  
ATOM 2466  H HH12 . ARG A 1 17  ? -7.736  -7.615  -5.498  1.00 0.00 ? 17  ARG A HH12 2  
ATOM 2467  H HH21 . ARG A 1 17  ? -10.340 -5.268  -5.454  1.00 0.00 ? 17  ARG A HH21 2  
ATOM 2468  H HH22 . ARG A 1 17  ? -9.623  -6.601  -6.309  1.00 0.00 ? 17  ARG A HH22 2  
ATOM 2469  N N    . LEU A 1 18  ? -5.694  -1.446  -1.193  1.00 0.00 ? 18  LEU A N    2  
ATOM 2470  C CA   . LEU A 1 18  ? -5.700  -0.184  -1.940  1.00 0.00 ? 18  LEU A CA   2  
ATOM 2471  C C    . LEU A 1 18  ? -4.358  0.043   -2.636  1.00 0.00 ? 18  LEU A C    2  
ATOM 2472  O O    . LEU A 1 18  ? -4.297  0.533   -3.764  1.00 0.00 ? 18  LEU A O    2  
ATOM 2473  C CB   . LEU A 1 18  ? -5.970  0.991   -0.988  1.00 0.00 ? 18  LEU A CB   2  
ATOM 2474  C CG   . LEU A 1 18  ? -5.866  2.390   -1.624  1.00 0.00 ? 18  LEU A CG   2  
ATOM 2475  C CD1  . LEU A 1 18  ? -7.075  2.687   -2.507  1.00 0.00 ? 18  LEU A CD1  2  
ATOM 2476  C CD2  . LEU A 1 18  ? -5.689  3.461   -0.553  1.00 0.00 ? 18  LEU A CD2  2  
ATOM 2477  H H    . LEU A 1 18  ? -5.892  -1.429  -0.231  1.00 0.00 ? 18  LEU A H    2  
ATOM 2478  H HA   . LEU A 1 18  ? -6.484  -0.230  -2.681  1.00 0.00 ? 18  LEU A HA   2  
ATOM 2479  H HB2  . LEU A 1 18  ? -6.965  0.873   -0.579  1.00 0.00 ? 18  LEU A HB2  2  
ATOM 2480  H HB3  . LEU A 1 18  ? -5.259  0.936   -0.175  1.00 0.00 ? 18  LEU A HB3  2  
ATOM 2481  H HG   . LEU A 1 18  ? -4.990  2.416   -2.259  1.00 0.00 ? 18  LEU A HG   2  
ATOM 2482  H HD11 . LEU A 1 18  ? -7.135  1.951   -3.296  1.00 0.00 ? 18  LEU A HD11 2  
ATOM 2483  H HD12 . LEU A 1 18  ? -6.971  3.670   -2.942  1.00 0.00 ? 18  LEU A HD12 2  
ATOM 2484  H HD13 . LEU A 1 18  ? -7.976  2.650   -1.911  1.00 0.00 ? 18  LEU A HD13 2  
ATOM 2485  H HD21 . LEU A 1 18  ? -5.666  4.436   -1.019  1.00 0.00 ? 18  LEU A HD21 2  
ATOM 2486  H HD22 . LEU A 1 18  ? -4.759  3.295   -0.029  1.00 0.00 ? 18  LEU A HD22 2  
ATOM 2487  H HD23 . LEU A 1 18  ? -6.511  3.415   0.147   1.00 0.00 ? 18  LEU A HD23 2  
ATOM 2488  N N    . LEU A 1 19  ? -3.295  -0.332  -1.944  1.00 0.00 ? 19  LEU A N    2  
ATOM 2489  C CA   . LEU A 1 19  ? -1.939  -0.032  -2.372  1.00 0.00 ? 19  LEU A CA   2  
ATOM 2490  C C    . LEU A 1 19  ? -1.459  -1.032  -3.431  1.00 0.00 ? 19  LEU A C    2  
ATOM 2491  O O    . LEU A 1 19  ? -0.613  -0.708  -4.267  1.00 0.00 ? 19  LEU A O    2  
ATOM 2492  C CB   . LEU A 1 19  ? -1.019  -0.029  -1.142  1.00 0.00 ? 19  LEU A CB   2  
ATOM 2493  C CG   . LEU A 1 19  ? 0.382   0.542   -1.371  1.00 0.00 ? 19  LEU A CG   2  
ATOM 2494  C CD1  . LEU A 1 19  ? 0.301   1.938   -1.988  1.00 0.00 ? 19  LEU A CD1  2  
ATOM 2495  C CD2  . LEU A 1 19  ? 1.166   0.579   -0.063  1.00 0.00 ? 19  LEU A CD2  2  
ATOM 2496  H H    . LEU A 1 19  ? -3.426  -0.832  -1.113  1.00 0.00 ? 19  LEU A H    2  
ATOM 2497  H HA   . LEU A 1 19  ? -1.941  0.958   -2.808  1.00 0.00 ? 19  LEU A HA   2  
ATOM 2498  H HB2  . LEU A 1 19  ? -1.498  0.551   -0.364  1.00 0.00 ? 19  LEU A HB2  2  
ATOM 2499  H HB3  . LEU A 1 19  ? -0.917  -1.047  -0.792  1.00 0.00 ? 19  LEU A HB3  2  
ATOM 2500  H HG   . LEU A 1 19  ? 0.907   -0.104  -2.054  1.00 0.00 ? 19  LEU A HG   2  
ATOM 2501  H HD11 . LEU A 1 19  ? -0.292  2.583   -1.352  1.00 0.00 ? 19  LEU A HD11 2  
ATOM 2502  H HD12 . LEU A 1 19  ? -0.161  1.873   -2.963  1.00 0.00 ? 19  LEU A HD12 2  
ATOM 2503  H HD13 . LEU A 1 19  ? 1.295   2.347   -2.089  1.00 0.00 ? 19  LEU A HD13 2  
ATOM 2504  H HD21 . LEU A 1 19  ? 2.152   0.983   -0.247  1.00 0.00 ? 19  LEU A HD21 2  
ATOM 2505  H HD22 . LEU A 1 19  ? 1.257   -0.422  0.331   1.00 0.00 ? 19  LEU A HD22 2  
ATOM 2506  H HD23 . LEU A 1 19  ? 0.650   1.203   0.652   1.00 0.00 ? 19  LEU A HD23 2  
ATOM 2507  N N    . GLN A 1 20  ? -2.007  -2.244  -3.392  1.00 0.00 ? 20  GLN A N    2  
ATOM 2508  C CA   . GLN A 1 20  ? -1.700  -3.262  -4.396  1.00 0.00 ? 20  GLN A CA   2  
ATOM 2509  C C    . GLN A 1 20  ? -2.549  -3.043  -5.648  1.00 0.00 ? 20  GLN A C    2  
ATOM 2510  O O    . GLN A 1 20  ? -2.079  -3.245  -6.773  1.00 0.00 ? 20  GLN A O    2  
ATOM 2511  C CB   . GLN A 1 20  ? -1.945  -4.678  -3.843  1.00 0.00 ? 20  GLN A CB   2  
ATOM 2512  C CG   . GLN A 1 20  ? -0.978  -5.096  -2.740  1.00 0.00 ? 20  GLN A CG   2  
ATOM 2513  C CD   . GLN A 1 20  ? 0.471   -5.134  -3.200  1.00 0.00 ? 20  GLN A CD   2  
ATOM 2514  O OE1  . GLN A 1 20  ? 0.763   -5.382  -4.372  1.00 0.00 ? 20  GLN A OE1  2  
ATOM 2515  N NE2  . GLN A 1 20  ? 1.390   -4.902  -2.281  1.00 0.00 ? 20  GLN A NE2  2  
ATOM 2516  H H    . GLN A 1 20  ? -2.631  -2.459  -2.669  1.00 0.00 ? 20  GLN A H    2  
ATOM 2517  H HA   . GLN A 1 20  ? -0.652  -3.164  -4.660  1.00 0.00 ? 20  GLN A HA   2  
ATOM 2518  H HB2  . GLN A 1 20  ? -2.950  -4.728  -3.446  1.00 0.00 ? 20  GLN A HB2  2  
ATOM 2519  H HB3  . GLN A 1 20  ? -1.858  -5.388  -4.654  1.00 0.00 ? 20  GLN A HB3  2  
ATOM 2520  H HG2  . GLN A 1 20  ? -1.059  -4.394  -1.922  1.00 0.00 ? 20  GLN A HG2  2  
ATOM 2521  H HG3  . GLN A 1 20  ? -1.254  -6.081  -2.391  1.00 0.00 ? 20  GLN A HG3  2  
ATOM 2522  H HE21 . GLN A 1 20  ? 1.090   -4.720  -1.359  1.00 0.00 ? 20  GLN A HE21 2  
ATOM 2523  H HE22 . GLN A 1 20  ? 2.328   -4.911  -2.550  1.00 0.00 ? 20  GLN A HE22 2  
ATOM 2524  N N    . ASP A 1 21  ? -3.795  -2.623  -5.437  1.00 0.00 ? 21  ASP A N    2  
ATOM 2525  C CA   . ASP A 1 21  ? -4.748  -2.409  -6.527  1.00 0.00 ? 21  ASP A CA   2  
ATOM 2526  C C    . ASP A 1 21  ? -4.423  -1.115  -7.276  1.00 0.00 ? 21  ASP A C    2  
ATOM 2527  O O    . ASP A 1 21  ? -4.534  -0.023  -6.717  1.00 0.00 ? 21  ASP A O    2  
ATOM 2528  C CB   . ASP A 1 21  ? -6.183  -2.363  -5.974  1.00 0.00 ? 21  ASP A CB   2  
ATOM 2529  C CG   . ASP A 1 21  ? -7.231  -2.124  -7.053  1.00 0.00 ? 21  ASP A CG   2  
ATOM 2530  O OD1  . ASP A 1 21  ? -7.317  -2.938  -7.998  1.00 0.00 ? 21  ASP A OD1  2  
ATOM 2531  O OD2  . ASP A 1 21  ? -7.991  -1.139  -6.949  1.00 0.00 ? 21  ASP A OD2  2  
ATOM 2532  H H    . ASP A 1 21  ? -4.081  -2.436  -4.519  1.00 0.00 ? 21  ASP A H    2  
ATOM 2533  H HA   . ASP A 1 21  ? -4.662  -3.243  -7.209  1.00 0.00 ? 21  ASP A HA   2  
ATOM 2534  H HB2  . ASP A 1 21  ? -6.403  -3.303  -5.490  1.00 0.00 ? 21  ASP A HB2  2  
ATOM 2535  H HB3  . ASP A 1 21  ? -6.252  -1.567  -5.244  1.00 0.00 ? 21  ASP A HB3  2  
ATOM 2536  N N    . PRO A 1 22  ? -4.018  -1.220  -8.560  1.00 0.00 ? 22  PRO A N    2  
ATOM 2537  C CA   . PRO A 1 22  ? -3.597  -0.057  -9.355  1.00 0.00 ? 22  PRO A CA   2  
ATOM 2538  C C    . PRO A 1 22  ? -4.730  0.945   -9.564  1.00 0.00 ? 22  PRO A C    2  
ATOM 2539  O O    . PRO A 1 22  ? -4.489  2.140   -9.734  1.00 0.00 ? 22  PRO A O    2  
ATOM 2540  C CB   . PRO A 1 22  ? -3.156  -0.672  -10.695 1.00 0.00 ? 22  PRO A CB   2  
ATOM 2541  C CG   . PRO A 1 22  ? -3.859  -1.988  -10.760 1.00 0.00 ? 22  PRO A CG   2  
ATOM 2542  C CD   . PRO A 1 22  ? -3.944  -2.472  -9.338  1.00 0.00 ? 22  PRO A CD   2  
ATOM 2543  H HA   . PRO A 1 22  ? -2.758  0.448   -8.895  1.00 0.00 ? 22  PRO A HA   2  
ATOM 2544  H HB2  . PRO A 1 22  ? -3.448  -0.024  -11.512 1.00 0.00 ? 22  PRO A HB2  2  
ATOM 2545  H HB3  . PRO A 1 22  ? -2.083  -0.800  -10.700 1.00 0.00 ? 22  PRO A HB3  2  
ATOM 2546  H HG2  . PRO A 1 22  ? -4.849  -1.856  -11.174 1.00 0.00 ? 22  PRO A HG2  2  
ATOM 2547  H HG3  . PRO A 1 22  ? -3.289  -2.683  -11.361 1.00 0.00 ? 22  PRO A HG3  2  
ATOM 2548  H HD2  . PRO A 1 22  ? -4.833  -3.071  -9.194  1.00 0.00 ? 22  PRO A HD2  2  
ATOM 2549  H HD3  . PRO A 1 22  ? -3.061  -3.036  -9.075  1.00 0.00 ? 22  PRO A HD3  2  
ATOM 2550  N N    . LEU A 1 23  ? -5.964  0.451   -9.542  1.00 0.00 ? 23  LEU A N    2  
ATOM 2551  C CA   . LEU A 1 23  ? -7.141  1.294   -9.741  1.00 0.00 ? 23  LEU A CA   2  
ATOM 2552  C C    . LEU A 1 23  ? -7.323  2.208   -8.528  1.00 0.00 ? 23  LEU A C    2  
ATOM 2553  O O    . LEU A 1 23  ? -7.459  3.432   -8.661  1.00 0.00 ? 23  LEU A O    2  
ATOM 2554  C CB   . LEU A 1 23  ? -8.379  0.402   -9.978  1.00 0.00 ? 23  LEU A CB   2  
ATOM 2555  C CG   . LEU A 1 23  ? -9.642  1.102   -10.530 1.00 0.00 ? 23  LEU A CG   2  
ATOM 2556  C CD1  . LEU A 1 23  ? -10.588 0.081   -11.159 1.00 0.00 ? 23  LEU A CD1  2  
ATOM 2557  C CD2  . LEU A 1 23  ? -10.372 1.879   -9.436  1.00 0.00 ? 23  LEU A CD2  2  
ATOM 2558  H H    . LEU A 1 23  ? -6.088  -0.507  -9.372  1.00 0.00 ? 23  LEU A H    2  
ATOM 2559  H HA   . LEU A 1 23  ? -6.969  1.903   -10.619 1.00 0.00 ? 23  LEU A HA   2  
ATOM 2560  H HB2  . LEU A 1 23  ? -8.096  -0.374  -10.676 1.00 0.00 ? 23  LEU A HB2  2  
ATOM 2561  H HB3  . LEU A 1 23  ? -8.638  -0.070  -9.040  1.00 0.00 ? 23  LEU A HB3  2  
ATOM 2562  H HG   . LEU A 1 23  ? -9.350  1.801   -11.300 1.00 0.00 ? 23  LEU A HG   2  
ATOM 2563  H HD11 . LEU A 1 23  ? -10.079 -0.437  -11.959 1.00 0.00 ? 23  LEU A HD11 2  
ATOM 2564  H HD12 . LEU A 1 23  ? -11.454 0.588   -11.556 1.00 0.00 ? 23  LEU A HD12 2  
ATOM 2565  H HD13 . LEU A 1 23  ? -10.901 -0.634  -10.411 1.00 0.00 ? 23  LEU A HD13 2  
ATOM 2566  H HD21 . LEU A 1 23  ? -9.716  2.638   -9.035  1.00 0.00 ? 23  LEU A HD21 2  
ATOM 2567  H HD22 . LEU A 1 23  ? -10.666 1.205   -8.646  1.00 0.00 ? 23  LEU A HD22 2  
ATOM 2568  H HD23 . LEU A 1 23  ? -11.251 2.351   -9.854  1.00 0.00 ? 23  LEU A HD23 2  
ATOM 2569  N N    . GLY A 1 24  ? -7.301  1.602   -7.347  1.00 0.00 ? 24  GLY A N    2  
ATOM 2570  C CA   . GLY A 1 24  ? -7.392  2.356   -6.115  1.00 0.00 ? 24  GLY A CA   2  
ATOM 2571  C C    . GLY A 1 24  ? -6.236  3.316   -5.958  1.00 0.00 ? 24  GLY A C    2  
ATOM 2572  O O    . GLY A 1 24  ? -6.435  4.502   -5.688  1.00 0.00 ? 24  GLY A O    2  
ATOM 2573  H H    . GLY A 1 24  ? -7.222  0.623   -7.312  1.00 0.00 ? 24  GLY A H    2  
ATOM 2574  H HA2  . GLY A 1 24  ? -8.318  2.914   -6.108  1.00 0.00 ? 24  GLY A HA2  2  
ATOM 2575  H HA3  . GLY A 1 24  ? -7.392  1.667   -5.283  1.00 0.00 ? 24  GLY A HA3  2  
ATOM 2576  N N    . LEU A 1 25  ? -5.023  2.800   -6.143  1.00 0.00 ? 25  LEU A N    2  
ATOM 2577  C CA   . LEU A 1 25  ? -3.815  3.613   -6.054  1.00 0.00 ? 25  LEU A CA   2  
ATOM 2578  C C    . LEU A 1 25  ? -3.874  4.766   -7.064  1.00 0.00 ? 25  LEU A C    2  
ATOM 2579  O O    . LEU A 1 25  ? -3.346  5.843   -6.805  1.00 0.00 ? 25  LEU A O    2  
ATOM 2580  C CB   . LEU A 1 25  ? -2.564  2.741   -6.287  1.00 0.00 ? 25  LEU A CB   2  
ATOM 2581  C CG   . LEU A 1 25  ? -1.288  3.162   -5.519  1.00 0.00 ? 25  LEU A CG   2  
ATOM 2582  C CD1  . LEU A 1 25  ? -0.167  2.158   -5.756  1.00 0.00 ? 25  LEU A CD1  2  
ATOM 2583  C CD2  . LEU A 1 25  ? -0.826  4.567   -5.906  1.00 0.00 ? 25  LEU A CD2  2  
ATOM 2584  H H    . LEU A 1 25  ? -4.938  1.838   -6.323  1.00 0.00 ? 25  LEU A H    2  
ATOM 2585  H HA   . LEU A 1 25  ? -3.774  4.028   -5.056  1.00 0.00 ? 25  LEU A HA   2  
ATOM 2586  H HB2  . LEU A 1 25  ? -2.806  1.726   -5.999  1.00 0.00 ? 25  LEU A HB2  2  
ATOM 2587  H HB3  . LEU A 1 25  ? -2.339  2.746   -7.344  1.00 0.00 ? 25  LEU A HB3  2  
ATOM 2588  H HG   . LEU A 1 25  ? -1.505  3.164   -4.460  1.00 0.00 ? 25  LEU A HG   2  
ATOM 2589  H HD11 . LEU A 1 25  ? 0.075   2.126   -6.809  1.00 0.00 ? 25  LEU A HD11 2  
ATOM 2590  H HD12 . LEU A 1 25  ? -0.486  1.179   -5.430  1.00 0.00 ? 25  LEU A HD12 2  
ATOM 2591  H HD13 . LEU A 1 25  ? 0.708   2.456   -5.195  1.00 0.00 ? 25  LEU A HD13 2  
ATOM 2592  H HD21 . LEU A 1 25  ? -1.599  5.281   -5.662  1.00 0.00 ? 25  LEU A HD21 2  
ATOM 2593  H HD22 . LEU A 1 25  ? -0.626  4.603   -6.967  1.00 0.00 ? 25  LEU A HD22 2  
ATOM 2594  H HD23 . LEU A 1 25  ? 0.075   4.814   -5.361  1.00 0.00 ? 25  LEU A HD23 2  
ATOM 2595  N N    . ALA A 1 26  ? -4.530  4.542   -8.202  1.00 0.00 ? 26  ALA A N    2  
ATOM 2596  C CA   . ALA A 1 26  ? -4.677  5.582   -9.223  1.00 0.00 ? 26  ALA A CA   2  
ATOM 2597  C C    . ALA A 1 26  ? -5.397  6.804   -8.654  1.00 0.00 ? 26  ALA A C    2  
ATOM 2598  O O    . ALA A 1 26  ? -4.906  7.931   -8.746  1.00 0.00 ? 26  ALA A O    2  
ATOM 2599  C CB   . ALA A 1 26  ? -5.421  5.041   -10.439 1.00 0.00 ? 26  ALA A CB   2  
ATOM 2600  H H    . ALA A 1 26  ? -4.920  3.655   -8.366  1.00 0.00 ? 26  ALA A H    2  
ATOM 2601  H HA   . ALA A 1 26  ? -3.685  5.877   -9.539  1.00 0.00 ? 26  ALA A HA   2  
ATOM 2602  H HB1  . ALA A 1 26  ? -6.427  4.766   -10.155 1.00 0.00 ? 26  ALA A HB1  2  
ATOM 2603  H HB2  . ALA A 1 26  ? -4.906  4.171   -10.820 1.00 0.00 ? 26  ALA A HB2  2  
ATOM 2604  H HB3  . ALA A 1 26  ? -5.460  5.800   -11.208 1.00 0.00 ? 26  ALA A HB3  2  
ATOM 2605  N N    . TYR A 1 27  ? -6.556  6.576   -8.048  1.00 0.00 ? 27  TYR A N    2  
ATOM 2606  C CA   . TYR A 1 27  ? -7.315  7.667   -7.435  1.00 0.00 ? 27  TYR A CA   2  
ATOM 2607  C C    . TYR A 1 27  ? -6.626  8.151   -6.158  1.00 0.00 ? 27  TYR A C    2  
ATOM 2608  O O    . TYR A 1 27  ? -6.710  9.330   -5.791  1.00 0.00 ? 27  TYR A O    2  
ATOM 2609  C CB   . TYR A 1 27  ? -8.754  7.224   -7.146  1.00 0.00 ? 27  TYR A CB   2  
ATOM 2610  C CG   . TYR A 1 27  ? -9.550  6.920   -8.405  1.00 0.00 ? 27  TYR A CG   2  
ATOM 2611  C CD1  . TYR A 1 27  ? -9.962  7.946   -9.251  1.00 0.00 ? 27  TYR A CD1  2  
ATOM 2612  C CD2  . TYR A 1 27  ? -9.879  5.614   -8.755  1.00 0.00 ? 27  TYR A CD2  2  
ATOM 2613  C CE1  . TYR A 1 27  ? -10.678 7.681   -10.402 1.00 0.00 ? 27  TYR A CE1  2  
ATOM 2614  C CE2  . TYR A 1 27  ? -10.594 5.343   -9.907  1.00 0.00 ? 27  TYR A CE2  2  
ATOM 2615  C CZ   . TYR A 1 27  ? -10.990 6.378   -10.727 1.00 0.00 ? 27  TYR A CZ   2  
ATOM 2616  O OH   . TYR A 1 27  ? -11.702 6.110   -11.875 1.00 0.00 ? 27  TYR A OH   2  
ATOM 2617  H H    . TYR A 1 27  ? -6.911  5.657   -8.014  1.00 0.00 ? 27  TYR A H    2  
ATOM 2618  H HA   . TYR A 1 27  ? -7.338  8.486   -8.142  1.00 0.00 ? 27  TYR A HA   2  
ATOM 2619  H HB2  . TYR A 1 27  ? -8.734  6.333   -6.536  1.00 0.00 ? 27  TYR A HB2  2  
ATOM 2620  H HB3  . TYR A 1 27  ? -9.267  8.011   -6.610  1.00 0.00 ? 27  TYR A HB3  2  
ATOM 2621  H HD1  . TYR A 1 27  ? -9.717  8.968   -8.995  1.00 0.00 ? 27  TYR A HD1  2  
ATOM 2622  H HD2  . TYR A 1 27  ? -9.569  4.802   -8.111  1.00 0.00 ? 27  TYR A HD2  2  
ATOM 2623  H HE1  . TYR A 1 27  ? -10.987 8.494   -11.044 1.00 0.00 ? 27  TYR A HE1  2  
ATOM 2624  H HE2  . TYR A 1 27  ? -10.839 4.322   -10.162 1.00 0.00 ? 27  TYR A HE2  2  
ATOM 2625  H HH   . TYR A 1 27  ? -11.342 6.623   -12.603 1.00 0.00 ? 27  TYR A HH   2  
ATOM 2626  N N    . PHE A 1 28  ? -5.924  7.237   -5.500  1.00 0.00 ? 28  PHE A N    2  
ATOM 2627  C CA   . PHE A 1 28  ? -5.169  7.556   -4.292  1.00 0.00 ? 28  PHE A CA   2  
ATOM 2628  C C    . PHE A 1 28  ? -4.066  8.567   -4.609  1.00 0.00 ? 28  PHE A C    2  
ATOM 2629  O O    . PHE A 1 28  ? -3.900  9.560   -3.901  1.00 0.00 ? 28  PHE A O    2  
ATOM 2630  C CB   . PHE A 1 28  ? -4.572  6.274   -3.696  1.00 0.00 ? 28  PHE A CB   2  
ATOM 2631  C CG   . PHE A 1 28  ? -3.796  6.482   -2.418  1.00 0.00 ? 28  PHE A CG   2  
ATOM 2632  C CD1  . PHE A 1 28  ? -4.458  6.711   -1.219  1.00 0.00 ? 28  PHE A CD1  2  
ATOM 2633  C CD2  . PHE A 1 28  ? -2.408  6.433   -2.413  1.00 0.00 ? 28  PHE A CD2  2  
ATOM 2634  C CE1  . PHE A 1 28  ? -3.751  6.887   -0.046  1.00 0.00 ? 28  PHE A CE1  2  
ATOM 2635  C CE2  . PHE A 1 28  ? -1.700  6.612   -1.240  1.00 0.00 ? 28  PHE A CE2  2  
ATOM 2636  C CZ   . PHE A 1 28  ? -2.371  6.839   -0.057  1.00 0.00 ? 28  PHE A CZ   2  
ATOM 2637  H H    . PHE A 1 28  ? -5.914  6.316   -5.835  1.00 0.00 ? 28  PHE A H    2  
ATOM 2638  H HA   . PHE A 1 28  ? -5.853  7.994   -3.577  1.00 0.00 ? 28  PHE A HA   2  
ATOM 2639  H HB2  . PHE A 1 28  ? -5.372  5.579   -3.486  1.00 0.00 ? 28  PHE A HB2  2  
ATOM 2640  H HB3  . PHE A 1 28  ? -3.905  5.830   -4.423  1.00 0.00 ? 28  PHE A HB3  2  
ATOM 2641  H HD1  . PHE A 1 28  ? -5.536  6.751   -1.207  1.00 0.00 ? 28  PHE A HD1  2  
ATOM 2642  H HD2  . PHE A 1 28  ? -1.880  6.255   -3.340  1.00 0.00 ? 28  PHE A HD2  2  
ATOM 2643  H HE1  . PHE A 1 28  ? -4.279  7.066   0.880   1.00 0.00 ? 28  PHE A HE1  2  
ATOM 2644  H HE2  . PHE A 1 28  ? -0.621  6.574   -1.251  1.00 0.00 ? 28  PHE A HE2  2  
ATOM 2645  H HZ   . PHE A 1 28  ? -1.818  6.978   0.862   1.00 0.00 ? 28  PHE A HZ   2  
ATOM 2646  N N    . THR A 1 29  ? -3.334  8.320   -5.695  1.00 0.00 ? 29  THR A N    2  
ATOM 2647  C CA   . THR A 1 29  ? -2.245  9.197   -6.099  1.00 0.00 ? 29  THR A CA   2  
ATOM 2648  C C    . THR A 1 29  ? -2.797  10.471  -6.736  1.00 0.00 ? 29  THR A C    2  
ATOM 2649  O O    . THR A 1 29  ? -2.089  11.471  -6.848  1.00 0.00 ? 29  THR A O    2  
ATOM 2650  C CB   . THR A 1 29  ? -1.253  8.498   -7.070  1.00 0.00 ? 29  THR A CB   2  
ATOM 2651  O OG1  . THR A 1 29  ? -0.095  9.322   -7.264  1.00 0.00 ? 29  THR A OG1  2  
ATOM 2652  C CG2  . THR A 1 29  ? -1.894  8.204   -8.423  1.00 0.00 ? 29  THR A CG2  2  
ATOM 2653  H H    . THR A 1 29  ? -3.537  7.533   -6.236  1.00 0.00 ? 29  THR A H    2  
ATOM 2654  H HA   . THR A 1 29  ? -1.699  9.473   -5.205  1.00 0.00 ? 29  THR A HA   2  
ATOM 2655  H HB   . THR A 1 29  ? -0.943  7.562   -6.625  1.00 0.00 ? 29  THR A HB   2  
ATOM 2656  H HG1  . THR A 1 29  ? -0.374  10.210  -7.504  1.00 0.00 ? 29  THR A HG1  2  
ATOM 2657  H HG21 . THR A 1 29  ? -2.750  7.558   -8.286  1.00 0.00 ? 29  THR A HG21 2  
ATOM 2658  H HG22 . THR A 1 29  ? -1.175  7.714   -9.064  1.00 0.00 ? 29  THR A HG22 2  
ATOM 2659  H HG23 . THR A 1 29  ? -2.212  9.129   -8.883  1.00 0.00 ? 29  THR A HG23 2  
ATOM 2660  N N    . GLU A 1 30  ? -4.064  10.427  -7.156  1.00 0.00 ? 30  GLU A N    2  
ATOM 2661  C CA   . GLU A 1 30  ? -4.755  11.617  -7.648  1.00 0.00 ? 30  GLU A CA   2  
ATOM 2662  C C    . GLU A 1 30  ? -4.792  12.680  -6.547  1.00 0.00 ? 30  GLU A C    2  
ATOM 2663  O O    . GLU A 1 30  ? -4.419  13.835  -6.766  1.00 0.00 ? 30  GLU A O    2  
ATOM 2664  C CB   . GLU A 1 30  ? -6.178  11.251  -8.103  1.00 0.00 ? 30  GLU A CB   2  
ATOM 2665  C CG   . GLU A 1 30  ? -7.005  12.426  -8.620  1.00 0.00 ? 30  GLU A CG   2  
ATOM 2666  C CD   . GLU A 1 30  ? -6.385  13.106  -9.830  1.00 0.00 ? 30  GLU A CD   2  
ATOM 2667  O OE1  . GLU A 1 30  ? -6.379  12.502  -10.925 1.00 0.00 ? 30  GLU A OE1  2  
ATOM 2668  O OE2  . GLU A 1 30  ? -5.917  14.257  -9.701  1.00 0.00 ? 30  GLU A OE2  2  
ATOM 2669  H H    . GLU A 1 30  ? -4.541  9.570   -7.143  1.00 0.00 ? 30  GLU A H    2  
ATOM 2670  H HA   . GLU A 1 30  ? -4.199  12.002  -8.493  1.00 0.00 ? 30  GLU A HA   2  
ATOM 2671  H HB2  . GLU A 1 30  ? -6.111  10.515  -8.891  1.00 0.00 ? 30  GLU A HB2  2  
ATOM 2672  H HB3  . GLU A 1 30  ? -6.704  10.812  -7.266  1.00 0.00 ? 30  GLU A HB3  2  
ATOM 2673  H HG2  . GLU A 1 30  ? -7.985  12.063  -8.896  1.00 0.00 ? 30  GLU A HG2  2  
ATOM 2674  H HG3  . GLU A 1 30  ? -7.108  13.152  -7.825  1.00 0.00 ? 30  GLU A HG3  2  
ATOM 2675  N N    . PHE A 1 31  ? -5.227  12.274  -5.355  1.00 0.00 ? 31  PHE A N    2  
ATOM 2676  C CA   . PHE A 1 31  ? -5.226  13.167  -4.193  1.00 0.00 ? 31  PHE A CA   2  
ATOM 2677  C C    . PHE A 1 31  ? -3.799  13.378  -3.686  1.00 0.00 ? 31  PHE A C    2  
ATOM 2678  O O    . PHE A 1 31  ? -3.380  14.509  -3.423  1.00 0.00 ? 31  PHE A O    2  
ATOM 2679  C CB   . PHE A 1 31  ? -6.105  12.601  -3.068  1.00 0.00 ? 31  PHE A CB   2  
ATOM 2680  C CG   . PHE A 1 31  ? -7.575  12.567  -3.403  1.00 0.00 ? 31  PHE A CG   2  
ATOM 2681  C CD1  . PHE A 1 31  ? -8.334  13.728  -3.359  1.00 0.00 ? 31  PHE A CD1  2  
ATOM 2682  C CD2  . PHE A 1 31  ? -8.198  11.378  -3.755  1.00 0.00 ? 31  PHE A CD2  2  
ATOM 2683  C CE1  . PHE A 1 31  ? -9.681  13.704  -3.661  1.00 0.00 ? 31  PHE A CE1  2  
ATOM 2684  C CE2  . PHE A 1 31  ? -9.545  11.350  -4.057  1.00 0.00 ? 31  PHE A CE2  2  
ATOM 2685  C CZ   . PHE A 1 31  ? -10.287 12.513  -4.010  1.00 0.00 ? 31  PHE A CZ   2  
ATOM 2686  H H    . PHE A 1 31  ? -5.559  11.352  -5.255  1.00 0.00 ? 31  PHE A H    2  
ATOM 2687  H HA   . PHE A 1 31  ? -5.627  14.122  -4.506  1.00 0.00 ? 31  PHE A HA   2  
ATOM 2688  H HB2  . PHE A 1 31  ? -5.789  11.591  -2.850  1.00 0.00 ? 31  PHE A HB2  2  
ATOM 2689  H HB3  . PHE A 1 31  ? -5.979  13.206  -2.181  1.00 0.00 ? 31  PHE A HB3  2  
ATOM 2690  H HD1  . PHE A 1 31  ? -7.862  14.662  -3.086  1.00 0.00 ? 31  PHE A HD1  2  
ATOM 2691  H HD2  . PHE A 1 31  ? -7.620  10.466  -3.793  1.00 0.00 ? 31  PHE A HD2  2  
ATOM 2692  H HE1  . PHE A 1 31  ? -10.261 14.616  -3.622  1.00 0.00 ? 31  PHE A HE1  2  
ATOM 2693  H HE2  . PHE A 1 31  ? -10.019 10.418  -4.332  1.00 0.00 ? 31  PHE A HE2  2  
ATOM 2694  H HZ   . PHE A 1 31  ? -11.342 12.492  -4.246  1.00 0.00 ? 31  PHE A HZ   2  
ATOM 2695  N N    . LEU A 1 32  ? -3.058  12.275  -3.582  1.00 0.00 ? 32  LEU A N    2  
ATOM 2696  C CA   . LEU A 1 32  ? -1.673  12.284  -3.098  1.00 0.00 ? 32  LEU A CA   2  
ATOM 2697  C C    . LEU A 1 32  ? -0.809  13.240  -3.934  1.00 0.00 ? 32  LEU A C    2  
ATOM 2698  O O    . LEU A 1 32  ? 0.206   13.765  -3.465  1.00 0.00 ? 32  LEU A O    2  
ATOM 2699  C CB   . LEU A 1 32  ? -1.110  10.855  -3.156  1.00 0.00 ? 32  LEU A CB   2  
ATOM 2700  C CG   . LEU A 1 32  ? 0.188   10.601  -2.379  1.00 0.00 ? 32  LEU A CG   2  
ATOM 2701  C CD1  . LEU A 1 32  ? -0.028  10.775  -0.879  1.00 0.00 ? 32  LEU A CD1  2  
ATOM 2702  C CD2  . LEU A 1 32  ? 0.727   9.205   -2.685  1.00 0.00 ? 32  LEU A CD2  2  
ATOM 2703  H H    . LEU A 1 32  ? -3.462  11.417  -3.829  1.00 0.00 ? 32  LEU A H    2  
ATOM 2704  H HA   . LEU A 1 32  ? -1.681  12.621  -2.072  1.00 0.00 ? 32  LEU A HA   2  
ATOM 2705  H HB2  . LEU A 1 32  ? -1.864  10.184  -2.774  1.00 0.00 ? 32  LEU A HB2  2  
ATOM 2706  H HB3  . LEU A 1 32  ? -0.935  10.607  -4.193  1.00 0.00 ? 32  LEU A HB3  2  
ATOM 2707  H HG   . LEU A 1 32  ? 0.934   11.319  -2.691  1.00 0.00 ? 32  LEU A HG   2  
ATOM 2708  H HD11 . LEU A 1 32  ? -0.391  11.772  -0.679  1.00 0.00 ? 32  LEU A HD11 2  
ATOM 2709  H HD12 . LEU A 1 32  ? 0.911   10.628  -0.363  1.00 0.00 ? 32  LEU A HD12 2  
ATOM 2710  H HD13 . LEU A 1 32  ? -0.748  10.050  -0.528  1.00 0.00 ? 32  LEU A HD13 2  
ATOM 2711  H HD21 . LEU A 1 32  ? 1.643   9.042   -2.135  1.00 0.00 ? 32  LEU A HD21 2  
ATOM 2712  H HD22 . LEU A 1 32  ? 0.925   9.118   -3.744  1.00 0.00 ? 32  LEU A HD22 2  
ATOM 2713  H HD23 . LEU A 1 32  ? -0.003  8.463   -2.394  1.00 0.00 ? 32  LEU A HD23 2  
ATOM 2714  N N    . LYS A 1 33  ? -1.230  13.457  -5.176  1.00 0.00 ? 33  LYS A N    2  
ATOM 2715  C CA   . LYS A 1 33  ? -0.570  14.397  -6.076  1.00 0.00 ? 33  LYS A CA   2  
ATOM 2716  C C    . LYS A 1 33  ? -0.760  15.829  -5.578  1.00 0.00 ? 33  LYS A C    2  
ATOM 2717  O O    . LYS A 1 33  ? 0.196   16.597  -5.460  1.00 0.00 ? 33  LYS A O    2  
ATOM 2718  C CB   . LYS A 1 33  ? -1.162  14.267  -7.490  1.00 0.00 ? 33  LYS A CB   2  
ATOM 2719  C CG   . LYS A 1 33  ? -0.477  15.131  -8.549  1.00 0.00 ? 33  LYS A CG   2  
ATOM 2720  C CD   . LYS A 1 33  ? 0.876   14.562  -8.970  1.00 0.00 ? 33  LYS A CD   2  
ATOM 2721  C CE   . LYS A 1 33  ? 0.736   13.189  -9.622  1.00 0.00 ? 33  LYS A CE   2  
ATOM 2722  N NZ   . LYS A 1 33  ? -0.168  13.217  -10.805 1.00 0.00 ? 33  LYS A NZ   2  
ATOM 2723  H H    . LYS A 1 33  ? -2.012  12.962  -5.501  1.00 0.00 ? 33  LYS A H    2  
ATOM 2724  H HA   . LYS A 1 33  ? 0.485   14.162  -6.105  1.00 0.00 ? 33  LYS A HA   2  
ATOM 2725  H HB2  . LYS A 1 33  ? -1.093  13.234  -7.801  1.00 0.00 ? 33  LYS A HB2  2  
ATOM 2726  H HB3  . LYS A 1 33  ? -2.205  14.546  -7.452  1.00 0.00 ? 33  LYS A HB3  2  
ATOM 2727  H HG2  . LYS A 1 33  ? -1.115  15.190  -9.419  1.00 0.00 ? 33  LYS A HG2  2  
ATOM 2728  H HG3  . LYS A 1 33  ? -0.328  16.124  -8.147  1.00 0.00 ? 33  LYS A HG3  2  
ATOM 2729  H HD2  . LYS A 1 33  ? 1.335   15.238  -9.677  1.00 0.00 ? 33  LYS A HD2  2  
ATOM 2730  H HD3  . LYS A 1 33  ? 1.507   14.474  -8.096  1.00 0.00 ? 33  LYS A HD3  2  
ATOM 2731  H HE2  . LYS A 1 33  ? 1.713   12.854  -9.938  1.00 0.00 ? 33  LYS A HE2  2  
ATOM 2732  H HE3  . LYS A 1 33  ? 0.339   12.495  -8.893  1.00 0.00 ? 33  LYS A HE3  2  
ATOM 2733  H HZ1  . LYS A 1 33  ? -1.132  13.489  -10.518 1.00 0.00 ? 33  LYS A HZ1  2  
ATOM 2734  H HZ2  . LYS A 1 33  ? -0.206  12.274  -11.247 1.00 0.00 ? 33  LYS A HZ2  2  
ATOM 2735  H HZ3  . LYS A 1 33  ? 0.180   13.898  -11.508 1.00 0.00 ? 33  LYS A HZ3  2  
ATOM 2736  N N    . LYS A 1 34  ? -2.008  16.162  -5.258  1.00 0.00 ? 34  LYS A N    2  
ATOM 2737  C CA   . LYS A 1 34  ? -2.391  17.533  -4.928  1.00 0.00 ? 34  LYS A CA   2  
ATOM 2738  C C    . LYS A 1 34  ? -1.888  17.943  -3.545  1.00 0.00 ? 34  LYS A C    2  
ATOM 2739  O O    . LYS A 1 34  ? -1.600  19.118  -3.308  1.00 0.00 ? 34  LYS A O    2  
ATOM 2740  C CB   . LYS A 1 34  ? -3.914  17.687  -5.015  1.00 0.00 ? 34  LYS A CB   2  
ATOM 2741  C CG   . LYS A 1 34  ? -4.481  17.307  -6.380  1.00 0.00 ? 34  LYS A CG   2  
ATOM 2742  C CD   . LYS A 1 34  ? -5.983  17.560  -6.474  1.00 0.00 ? 34  LYS A CD   2  
ATOM 2743  C CE   . LYS A 1 34  ? -6.771  16.771  -5.432  1.00 0.00 ? 34  LYS A CE   2  
ATOM 2744  N NZ   . LYS A 1 34  ? -8.238  16.956  -5.596  1.00 0.00 ? 34  LYS A NZ   2  
ATOM 2745  H H    . LYS A 1 34  ? -2.693  15.458  -5.231  1.00 0.00 ? 34  LYS A H    2  
ATOM 2746  H HA   . LYS A 1 34  ? -1.937  18.183  -5.664  1.00 0.00 ? 34  LYS A HA   2  
ATOM 2747  H HB2  . LYS A 1 34  ? -4.373  17.056  -4.265  1.00 0.00 ? 34  LYS A HB2  2  
ATOM 2748  H HB3  . LYS A 1 34  ? -4.175  18.718  -4.813  1.00 0.00 ? 34  LYS A HB3  2  
ATOM 2749  H HG2  . LYS A 1 34  ? -3.982  17.891  -7.140  1.00 0.00 ? 34  LYS A HG2  2  
ATOM 2750  H HG3  . LYS A 1 34  ? -4.291  16.256  -6.557  1.00 0.00 ? 34  LYS A HG3  2  
ATOM 2751  H HD2  . LYS A 1 34  ? -6.169  18.614  -6.327  1.00 0.00 ? 34  LYS A HD2  2  
ATOM 2752  H HD3  . LYS A 1 34  ? -6.321  17.272  -7.459  1.00 0.00 ? 34  LYS A HD3  2  
ATOM 2753  H HE2  . LYS A 1 34  ? -6.536  15.722  -5.535  1.00 0.00 ? 34  LYS A HE2  2  
ATOM 2754  H HE3  . LYS A 1 34  ? -6.484  17.110  -4.447  1.00 0.00 ? 34  LYS A HE3  2  
ATOM 2755  H HZ1  . LYS A 1 34  ? -8.750  16.492  -4.819  1.00 0.00 ? 34  LYS A HZ1  2  
ATOM 2756  H HZ2  . LYS A 1 34  ? -8.553  16.538  -6.497  1.00 0.00 ? 34  LYS A HZ2  2  
ATOM 2757  H HZ3  . LYS A 1 34  ? -8.476  17.968  -5.595  1.00 0.00 ? 34  LYS A HZ3  2  
ATOM 2758  N N    . GLU A 1 35  ? -1.781  16.979  -2.635  1.00 0.00 ? 35  GLU A N    2  
ATOM 2759  C CA   . GLU A 1 35  ? -1.262  17.249  -1.293  1.00 0.00 ? 35  GLU A CA   2  
ATOM 2760  C C    . GLU A 1 35  ? 0.271   17.246  -1.305  1.00 0.00 ? 35  GLU A C    2  
ATOM 2761  O O    . GLU A 1 35  ? 0.912   17.594  -0.309  1.00 0.00 ? 35  GLU A O    2  
ATOM 2762  C CB   . GLU A 1 35  ? -1.803  16.221  -0.284  1.00 0.00 ? 35  GLU A CB   2  
ATOM 2763  C CG   . GLU A 1 35  ? -1.386  14.783  -0.574  1.00 0.00 ? 35  GLU A CG   2  
ATOM 2764  C CD   . GLU A 1 35  ? -1.887  13.798  0.476   1.00 0.00 ? 35  GLU A CD   2  
ATOM 2765  O OE1  . GLU A 1 35  ? -1.341  13.795  1.605   1.00 0.00 ? 35  GLU A OE1  2  
ATOM 2766  O OE2  . GLU A 1 35  ? -2.834  13.035  0.192   1.00 0.00 ? 35  GLU A OE2  2  
ATOM 2767  H H    . GLU A 1 35  ? -2.060  16.065  -2.867  1.00 0.00 ? 35  GLU A H    2  
ATOM 2768  H HA   . GLU A 1 35  ? -1.601  18.236  -1.001  1.00 0.00 ? 35  GLU A HA   2  
ATOM 2769  H HB2  . GLU A 1 35  ? -1.448  16.482  0.703   1.00 0.00 ? 35  GLU A HB2  2  
ATOM 2770  H HB3  . GLU A 1 35  ? -2.883  16.268  -0.288  1.00 0.00 ? 35  GLU A HB3  2  
ATOM 2771  H HG2  . GLU A 1 35  ? -1.783  14.495  -1.537  1.00 0.00 ? 35  GLU A HG2  2  
ATOM 2772  H HG3  . GLU A 1 35  ? -0.307  14.735  -0.605  1.00 0.00 ? 35  GLU A HG3  2  
ATOM 2773  N N    . PHE A 1 36  ? 0.836   16.865  -2.454  1.00 0.00 ? 36  PHE A N    2  
ATOM 2774  C CA   . PHE A 1 36  ? 2.283   16.790  -2.654  1.00 0.00 ? 36  PHE A CA   2  
ATOM 2775  C C    . PHE A 1 36  ? 2.933   15.831  -1.655  1.00 0.00 ? 36  PHE A C    2  
ATOM 2776  O O    . PHE A 1 36  ? 3.568   16.246  -0.679  1.00 0.00 ? 36  PHE A O    2  
ATOM 2777  C CB   . PHE A 1 36  ? 2.936   18.184  -2.594  1.00 0.00 ? 36  PHE A CB   2  
ATOM 2778  C CG   . PHE A 1 36  ? 4.423   18.177  -2.888  1.00 0.00 ? 36  PHE A CG   2  
ATOM 2779  C CD1  . PHE A 1 36  ? 4.924   17.500  -3.994  1.00 0.00 ? 36  PHE A CD1  2  
ATOM 2780  C CD2  . PHE A 1 36  ? 5.315   18.845  -2.059  1.00 0.00 ? 36  PHE A CD2  2  
ATOM 2781  C CE1  . PHE A 1 36  ? 6.281   17.490  -4.262  1.00 0.00 ? 36  PHE A CE1  2  
ATOM 2782  C CE2  . PHE A 1 36  ? 6.671   18.837  -2.325  1.00 0.00 ? 36  PHE A CE2  2  
ATOM 2783  C CZ   . PHE A 1 36  ? 7.154   18.158  -3.427  1.00 0.00 ? 36  PHE A CZ   2  
ATOM 2784  H H    . PHE A 1 36  ? 0.251   16.617  -3.199  1.00 0.00 ? 36  PHE A H    2  
ATOM 2785  H HA   . PHE A 1 36  ? 2.438   16.386  -3.647  1.00 0.00 ? 36  PHE A HA   2  
ATOM 2786  H HB2  . PHE A 1 36  ? 2.461   18.828  -3.320  1.00 0.00 ? 36  PHE A HB2  2  
ATOM 2787  H HB3  . PHE A 1 36  ? 2.792   18.599  -1.606  1.00 0.00 ? 36  PHE A HB3  2  
ATOM 2788  H HD1  . PHE A 1 36  ? 4.242   16.976  -4.650  1.00 0.00 ? 36  PHE A HD1  2  
ATOM 2789  H HD2  . PHE A 1 36  ? 4.941   19.378  -1.196  1.00 0.00 ? 36  PHE A HD2  2  
ATOM 2790  H HE1  . PHE A 1 36  ? 6.659   16.957  -5.126  1.00 0.00 ? 36  PHE A HE1  2  
ATOM 2791  H HE2  . PHE A 1 36  ? 7.353   19.360  -1.671  1.00 0.00 ? 36  PHE A HE2  2  
ATOM 2792  H HZ   . PHE A 1 36  ? 8.215   18.151  -3.635  1.00 0.00 ? 36  PHE A HZ   2  
ATOM 2793  N N    . SER A 1 37  ? 2.713   14.545  -1.891  1.00 0.00 ? 37  SER A N    2  
ATOM 2794  C CA   . SER A 1 37  ? 3.360   13.482  -1.132  1.00 0.00 ? 37  SER A CA   2  
ATOM 2795  C C    . SER A 1 37  ? 3.363   12.190  -1.953  1.00 0.00 ? 37  SER A C    2  
ATOM 2796  O O    . SER A 1 37  ? 3.474   11.084  -1.416  1.00 0.00 ? 37  SER A O    2  
ATOM 2797  C CB   . SER A 1 37  ? 2.642   13.292  0.210   1.00 0.00 ? 37  SER A CB   2  
ATOM 2798  O OG   . SER A 1 37  ? 1.237   13.301  0.036   1.00 0.00 ? 37  SER A OG   2  
ATOM 2799  H H    . SER A 1 37  ? 2.060   14.296  -2.579  1.00 0.00 ? 37  SER A H    2  
ATOM 2800  H HA   . SER A 1 37  ? 4.385   13.779  -0.949  1.00 0.00 ? 37  SER A HA   2  
ATOM 2801  H HB2  . SER A 1 37  ? 2.931   12.348  0.647   1.00 0.00 ? 37  SER A HB2  2  
ATOM 2802  H HB3  . SER A 1 37  ? 2.913   14.095  0.880   1.00 0.00 ? 37  SER A HB3  2  
ATOM 2803  H HG   . SER A 1 37  ? 0.808   12.997  0.842   1.00 0.00 ? 37  SER A HG   2  
ATOM 2804  N N    . ALA A 1 38  ? 3.285   12.350  -3.276  1.00 0.00 ? 38  ALA A N    2  
ATOM 2805  C CA   . ALA A 1 38  ? 3.200   11.224  -4.205  1.00 0.00 ? 38  ALA A CA   2  
ATOM 2806  C C    . ALA A 1 38  ? 4.483   10.390  -4.229  1.00 0.00 ? 38  ALA A C    2  
ATOM 2807  O O    . ALA A 1 38  ? 4.499   9.279   -4.763  1.00 0.00 ? 38  ALA A O    2  
ATOM 2808  C CB   . ALA A 1 38  ? 2.867   11.728  -5.607  1.00 0.00 ? 38  ALA A CB   2  
ATOM 2809  H H    . ALA A 1 38  ? 3.278   13.257  -3.636  1.00 0.00 ? 38  ALA A H    2  
ATOM 2810  H HA   . ALA A 1 38  ? 2.386   10.592  -3.881  1.00 0.00 ? 38  ALA A HA   2  
ATOM 2811  H HB1  . ALA A 1 38  ? 2.717   10.886  -6.268  1.00 0.00 ? 38  ALA A HB1  2  
ATOM 2812  H HB2  . ALA A 1 38  ? 3.681   12.334  -5.976  1.00 0.00 ? 38  ALA A HB2  2  
ATOM 2813  H HB3  . ALA A 1 38  ? 1.965   12.322  -5.571  1.00 0.00 ? 38  ALA A HB3  2  
ATOM 2814  N N    . GLU A 1 39  ? 5.558   10.915  -3.647  1.00 0.00 ? 39  GLU A N    2  
ATOM 2815  C CA   . GLU A 1 39  ? 6.840   10.211  -3.661  1.00 0.00 ? 39  GLU A CA   2  
ATOM 2816  C C    . GLU A 1 39  ? 6.839   9.072   -2.645  1.00 0.00 ? 39  GLU A C    2  
ATOM 2817  O O    . GLU A 1 39  ? 7.587   8.104   -2.788  1.00 0.00 ? 39  GLU A O    2  
ATOM 2818  C CB   . GLU A 1 39  ? 8.018   11.165  -3.407  1.00 0.00 ? 39  GLU A CB   2  
ATOM 2819  C CG   . GLU A 1 39  ? 8.128   11.711  -1.988  1.00 0.00 ? 39  GLU A CG   2  
ATOM 2820  C CD   . GLU A 1 39  ? 6.919   12.517  -1.560  1.00 0.00 ? 39  GLU A CD   2  
ATOM 2821  O OE1  . GLU A 1 39  ? 6.663   13.579  -2.158  1.00 0.00 ? 39  GLU A OE1  2  
ATOM 2822  O OE2  . GLU A 1 39  ? 6.212   12.078  -0.639  1.00 0.00 ? 39  GLU A OE2  2  
ATOM 2823  H H    . GLU A 1 39  ? 5.484   11.781  -3.191  1.00 0.00 ? 39  GLU A H    2  
ATOM 2824  H HA   . GLU A 1 39  ? 6.958   9.780   -4.648  1.00 0.00 ? 39  GLU A HA   2  
ATOM 2825  H HB2  . GLU A 1 39  ? 8.934   10.639  -3.625  1.00 0.00 ? 39  GLU A HB2  2  
ATOM 2826  H HB3  . GLU A 1 39  ? 7.934   12.002  -4.081  1.00 0.00 ? 39  GLU A HB3  2  
ATOM 2827  H HG2  . GLU A 1 39  ? 8.246   10.879  -1.308  1.00 0.00 ? 39  GLU A HG2  2  
ATOM 2828  H HG3  . GLU A 1 39  ? 9.003   12.343  -1.927  1.00 0.00 ? 39  GLU A HG3  2  
ATOM 2829  N N    . ASN A 1 40  ? 5.984   9.196   -1.628  1.00 0.00 ? 40  ASN A N    2  
ATOM 2830  C CA   . ASN A 1 40  ? 5.810   8.145   -0.617  1.00 0.00 ? 40  ASN A CA   2  
ATOM 2831  C C    . ASN A 1 40  ? 5.574   6.792   -1.282  1.00 0.00 ? 40  ASN A C    2  
ATOM 2832  O O    . ASN A 1 40  ? 6.374   5.865   -1.135  1.00 0.00 ? 40  ASN A O    2  
ATOM 2833  C CB   . ASN A 1 40  ? 4.632   8.459   0.327   1.00 0.00 ? 40  ASN A CB   2  
ATOM 2834  C CG   . ASN A 1 40  ? 4.974   9.477   1.404   1.00 0.00 ? 40  ASN A CG   2  
ATOM 2835  O OD1  . ASN A 1 40  ? 5.469   9.123   2.472   1.00 0.00 ? 40  ASN A OD1  2  
ATOM 2836  N ND2  . ASN A 1 40  ? 4.695   10.740  1.143   1.00 0.00 ? 40  ASN A ND2  2  
ATOM 2837  H H    . ASN A 1 40  ? 5.466   10.025  -1.550  1.00 0.00 ? 40  ASN A H    2  
ATOM 2838  H HA   . ASN A 1 40  ? 6.721   8.091   -0.036  1.00 0.00 ? 40  ASN A HA   2  
ATOM 2839  H HB2  . ASN A 1 40  ? 3.808   8.846   -0.255  1.00 0.00 ? 40  ASN A HB2  2  
ATOM 2840  H HB3  . ASN A 1 40  ? 4.317   7.545   0.813   1.00 0.00 ? 40  ASN A HB3  2  
ATOM 2841  H HD21 . ASN A 1 40  ? 4.290   10.957  0.278   1.00 0.00 ? 40  ASN A HD21 2  
ATOM 2842  H HD22 . ASN A 1 40  ? 4.910   11.412  1.824   1.00 0.00 ? 40  ASN A HD22 2  
ATOM 2843  N N    . VAL A 1 41  ? 4.478   6.694   -2.034  1.00 0.00 ? 41  VAL A N    2  
ATOM 2844  C CA   . VAL A 1 41  ? 4.103   5.435   -2.674  1.00 0.00 ? 41  VAL A CA   2  
ATOM 2845  C C    . VAL A 1 41  ? 5.150   5.011   -3.700  1.00 0.00 ? 41  VAL A C    2  
ATOM 2846  O O    . VAL A 1 41  ? 5.389   3.823   -3.889  1.00 0.00 ? 41  VAL A O    2  
ATOM 2847  C CB   . VAL A 1 41  ? 2.711   5.508   -3.354  1.00 0.00 ? 41  VAL A CB   2  
ATOM 2848  C CG1  . VAL A 1 41  ? 1.623   5.773   -2.317  1.00 0.00 ? 41  VAL A CG1  2  
ATOM 2849  C CG2  . VAL A 1 41  ? 2.687   6.570   -4.454  1.00 0.00 ? 41  VAL A CG2  2  
ATOM 2850  H H    . VAL A 1 41  ? 3.917   7.487   -2.165  1.00 0.00 ? 41  VAL A H    2  
ATOM 2851  H HA   . VAL A 1 41  ? 4.057   4.678   -1.901  1.00 0.00 ? 41  VAL A HA   2  
ATOM 2852  H HB   . VAL A 1 41  ? 2.506   4.546   -3.810  1.00 0.00 ? 41  VAL A HB   2  
ATOM 2853  H HG11 . VAL A 1 41  ? 0.659   5.810   -2.806  1.00 0.00 ? 41  VAL A HG11 2  
ATOM 2854  H HG12 . VAL A 1 41  ? 1.812   6.718   -1.828  1.00 0.00 ? 41  VAL A HG12 2  
ATOM 2855  H HG13 . VAL A 1 41  ? 1.622   4.982   -1.582  1.00 0.00 ? 41  VAL A HG13 2  
ATOM 2856  H HG21 . VAL A 1 41  ? 3.427   6.329   -5.206  1.00 0.00 ? 41  VAL A HG21 2  
ATOM 2857  H HG22 . VAL A 1 41  ? 2.909   7.538   -4.028  1.00 0.00 ? 41  VAL A HG22 2  
ATOM 2858  H HG23 . VAL A 1 41  ? 1.707   6.595   -4.911  1.00 0.00 ? 41  VAL A HG23 2  
ATOM 2859  N N    . THR A 1 42  ? 5.783   5.986   -4.345  1.00 0.00 ? 42  THR A N    2  
ATOM 2860  C CA   . THR A 1 42  ? 6.818   5.705   -5.334  1.00 0.00 ? 42  THR A CA   2  
ATOM 2861  C C    . THR A 1 42  ? 8.033   5.049   -4.668  1.00 0.00 ? 42  THR A C    2  
ATOM 2862  O O    . THR A 1 42  ? 8.645   4.142   -5.231  1.00 0.00 ? 42  THR A O    2  
ATOM 2863  C CB   . THR A 1 42  ? 7.238   6.994   -6.077  1.00 0.00 ? 42  THR A CB   2  
ATOM 2864  O OG1  . THR A 1 42  ? 6.075   7.627   -6.634  1.00 0.00 ? 42  THR A OG1  2  
ATOM 2865  C CG2  . THR A 1 42  ? 8.237   6.692   -7.195  1.00 0.00 ? 42  THR A CG2  2  
ATOM 2866  H H    . THR A 1 42  ? 5.548   6.916   -4.152  1.00 0.00 ? 42  THR A H    2  
ATOM 2867  H HA   . THR A 1 42  ? 6.403   5.015   -6.059  1.00 0.00 ? 42  THR A HA   2  
ATOM 2868  H HB   . THR A 1 42  ? 7.702   7.669   -5.370  1.00 0.00 ? 42  THR A HB   2  
ATOM 2869  H HG1  . THR A 1 42  ? 5.727   8.273   -6.009  1.00 0.00 ? 42  THR A HG1  2  
ATOM 2870  H HG21 . THR A 1 42  ? 8.494   7.608   -7.705  1.00 0.00 ? 42  THR A HG21 2  
ATOM 2871  H HG22 . THR A 1 42  ? 7.795   6.001   -7.898  1.00 0.00 ? 42  THR A HG22 2  
ATOM 2872  H HG23 . THR A 1 42  ? 9.130   6.253   -6.773  1.00 0.00 ? 42  THR A HG23 2  
ATOM 2873  N N    . PHE A 1 43  ? 8.353   5.497   -3.455  1.00 0.00 ? 43  PHE A N    2  
ATOM 2874  C CA   . PHE A 1 43  ? 9.434   4.905   -2.666  1.00 0.00 ? 43  PHE A CA   2  
ATOM 2875  C C    . PHE A 1 43  ? 9.095   3.453   -2.338  1.00 0.00 ? 43  PHE A C    2  
ATOM 2876  O O    . PHE A 1 43  ? 9.926   2.551   -2.483  1.00 0.00 ? 43  PHE A O    2  
ATOM 2877  C CB   . PHE A 1 43  ? 9.642   5.711   -1.372  1.00 0.00 ? 43  PHE A CB   2  
ATOM 2878  C CG   . PHE A 1 43  ? 10.686  5.145   -0.435  1.00 0.00 ? 43  PHE A CG   2  
ATOM 2879  C CD1  . PHE A 1 43  ? 12.022  5.496   -0.563  1.00 0.00 ? 43  PHE A CD1  2  
ATOM 2880  C CD2  . PHE A 1 43  ? 10.327  4.265   0.580   1.00 0.00 ? 43  PHE A CD2  2  
ATOM 2881  C CE1  . PHE A 1 43  ? 12.975  4.984   0.298   1.00 0.00 ? 43  PHE A CE1  2  
ATOM 2882  C CE2  . PHE A 1 43  ? 11.277  3.749   1.442   1.00 0.00 ? 43  PHE A CE2  2  
ATOM 2883  C CZ   . PHE A 1 43  ? 12.603  4.109   1.300   1.00 0.00 ? 43  PHE A CZ   2  
ATOM 2884  H H    . PHE A 1 43  ? 7.844   6.243   -3.074  1.00 0.00 ? 43  PHE A H    2  
ATOM 2885  H HA   . PHE A 1 43  ? 10.339  4.934   -3.256  1.00 0.00 ? 43  PHE A HA   2  
ATOM 2886  H HB2  . PHE A 1 43  ? 9.943   6.716   -1.630  1.00 0.00 ? 43  PHE A HB2  2  
ATOM 2887  H HB3  . PHE A 1 43  ? 8.704   5.757   -0.834  1.00 0.00 ? 43  PHE A HB3  2  
ATOM 2888  H HD1  . PHE A 1 43  ? 12.317  6.179   -1.347  1.00 0.00 ? 43  PHE A HD1  2  
ATOM 2889  H HD2  . PHE A 1 43  ? 9.290   3.981   0.694   1.00 0.00 ? 43  PHE A HD2  2  
ATOM 2890  H HE1  . PHE A 1 43  ? 14.013  5.267   0.186   1.00 0.00 ? 43  PHE A HE1  2  
ATOM 2891  H HE2  . PHE A 1 43  ? 10.983  3.065   2.225   1.00 0.00 ? 43  PHE A HE2  2  
ATOM 2892  H HZ   . PHE A 1 43  ? 13.347  3.707   1.973   1.00 0.00 ? 43  PHE A HZ   2  
ATOM 2893  N N    . TRP A 1 44  ? 7.857   3.242   -1.907  1.00 0.00 ? 44  TRP A N    2  
ATOM 2894  C CA   . TRP A 1 44  ? 7.370   1.913   -1.557  1.00 0.00 ? 44  TRP A CA   2  
ATOM 2895  C C    . TRP A 1 44  ? 7.363   1.010   -2.797  1.00 0.00 ? 44  TRP A C    2  
ATOM 2896  O O    . TRP A 1 44  ? 7.779   -0.149  -2.742  1.00 0.00 ? 44  TRP A O    2  
ATOM 2897  C CB   . TRP A 1 44  ? 5.963   2.029   -0.948  1.00 0.00 ? 44  TRP A CB   2  
ATOM 2898  C CG   . TRP A 1 44  ? 5.420   0.746   -0.380  1.00 0.00 ? 44  TRP A CG   2  
ATOM 2899  C CD1  . TRP A 1 44  ? 5.577   0.275   0.895   1.00 0.00 ? 44  TRP A CD1  2  
ATOM 2900  C CD2  . TRP A 1 44  ? 4.625   -0.225  -1.071  1.00 0.00 ? 44  TRP A CD2  2  
ATOM 2901  N NE1  . TRP A 1 44  ? 4.924   -0.927  1.040   1.00 0.00 ? 44  TRP A NE1  2  
ATOM 2902  C CE2  . TRP A 1 44  ? 4.335   -1.256  -0.157  1.00 0.00 ? 44  TRP A CE2  2  
ATOM 2903  C CE3  . TRP A 1 44  ? 4.132   -0.318  -2.376  1.00 0.00 ? 44  TRP A CE3  2  
ATOM 2904  C CZ2  . TRP A 1 44  ? 3.571   -2.368  -0.513  1.00 0.00 ? 44  TRP A CZ2  2  
ATOM 2905  C CZ3  . TRP A 1 44  ? 3.377   -1.419  -2.726  1.00 0.00 ? 44  TRP A CZ3  2  
ATOM 2906  C CH2  . TRP A 1 44  ? 3.103   -2.430  -1.799  1.00 0.00 ? 44  TRP A CH2  2  
ATOM 2907  H H    . TRP A 1 44  ? 7.248   4.008   -1.824  1.00 0.00 ? 44  TRP A H    2  
ATOM 2908  H HA   . TRP A 1 44  ? 8.043   1.495   -0.821  1.00 0.00 ? 44  TRP A HA   2  
ATOM 2909  H HB2  . TRP A 1 44  ? 5.987   2.756   -0.149  1.00 0.00 ? 44  TRP A HB2  2  
ATOM 2910  H HB3  . TRP A 1 44  ? 5.280   2.370   -1.713  1.00 0.00 ? 44  TRP A HB3  2  
ATOM 2911  H HD1  . TRP A 1 44  ? 6.133   0.785   1.669   1.00 0.00 ? 44  TRP A HD1  2  
ATOM 2912  H HE1  . TRP A 1 44  ? 4.887   -1.463  1.866   1.00 0.00 ? 44  TRP A HE1  2  
ATOM 2913  H HE3  . TRP A 1 44  ? 4.333   0.453   -3.106  1.00 0.00 ? 44  TRP A HE3  2  
ATOM 2914  H HZ2  . TRP A 1 44  ? 3.350   -3.156  0.189   1.00 0.00 ? 44  TRP A HZ2  2  
ATOM 2915  H HZ3  . TRP A 1 44  ? 2.988   -1.507  -3.730  1.00 0.00 ? 44  TRP A HZ3  2  
ATOM 2916  H HH2  . TRP A 1 44  ? 2.505   -3.272  -2.118  1.00 0.00 ? 44  TRP A HH2  2  
ATOM 2917  N N    . LYS A 1 45  ? 6.928   1.569   -3.926  1.00 0.00 ? 45  LYS A N    2  
ATOM 2918  C CA   . LYS A 1 45  ? 6.830   0.814   -5.174  1.00 0.00 ? 45  LYS A CA   2  
ATOM 2919  C C    . LYS A 1 45  ? 8.193   0.668   -5.849  1.00 0.00 ? 45  LYS A C    2  
ATOM 2920  O O    . LYS A 1 45  ? 8.333   -0.065  -6.830  1.00 0.00 ? 45  LYS A O    2  
ATOM 2921  C CB   . LYS A 1 45  ? 5.828   1.472   -6.133  1.00 0.00 ? 45  LYS A CB   2  
ATOM 2922  C CG   . LYS A 1 45  ? 4.396   1.489   -5.604  1.00 0.00 ? 45  LYS A CG   2  
ATOM 2923  C CD   . LYS A 1 45  ? 3.394   1.893   -6.681  1.00 0.00 ? 45  LYS A CD   2  
ATOM 2924  C CE   . LYS A 1 45  ? 3.383   0.899   -7.838  1.00 0.00 ? 45  LYS A CE   2  
ATOM 2925  N NZ   . LYS A 1 45  ? 3.136   -0.494  -7.373  1.00 0.00 ? 45  LYS A NZ   2  
ATOM 2926  H H    . LYS A 1 45  ? 6.664   2.511   -3.919  1.00 0.00 ? 45  LYS A H    2  
ATOM 2927  H HA   . LYS A 1 45  ? 6.469   -0.174  -4.928  1.00 0.00 ? 45  LYS A HA   2  
ATOM 2928  H HB2  . LYS A 1 45  ? 6.136   2.493   -6.315  1.00 0.00 ? 45  LYS A HB2  2  
ATOM 2929  H HB3  . LYS A 1 45  ? 5.838   0.933   -7.071  1.00 0.00 ? 45  LYS A HB3  2  
ATOM 2930  H HG2  . LYS A 1 45  ? 4.144   0.499   -5.247  1.00 0.00 ? 45  LYS A HG2  2  
ATOM 2931  H HG3  . LYS A 1 45  ? 4.334   2.191   -4.784  1.00 0.00 ? 45  LYS A HG3  2  
ATOM 2932  H HD2  . LYS A 1 45  ? 2.406   1.933   -6.244  1.00 0.00 ? 45  LYS A HD2  2  
ATOM 2933  H HD3  . LYS A 1 45  ? 3.661   2.870   -7.059  1.00 0.00 ? 45  LYS A HD3  2  
ATOM 2934  H HE2  . LYS A 1 45  ? 2.603   1.179   -8.531  1.00 0.00 ? 45  LYS A HE2  2  
ATOM 2935  H HE3  . LYS A 1 45  ? 4.339   0.938   -8.339  1.00 0.00 ? 45  LYS A HE3  2  
ATOM 2936  H HZ1  . LYS A 1 45  ? 3.895   -0.799  -6.728  1.00 0.00 ? 45  LYS A HZ1  2  
ATOM 2937  H HZ2  . LYS A 1 45  ? 3.108   -1.142  -8.184  1.00 0.00 ? 45  LYS A HZ2  2  
ATOM 2938  H HZ3  . LYS A 1 45  ? 2.229   -0.551  -6.871  1.00 0.00 ? 45  LYS A HZ3  2  
ATOM 2939  N N    . ALA A 1 46  ? 9.192   1.373   -5.332  1.00 0.00 ? 46  ALA A N    2  
ATOM 2940  C CA   . ALA A 1 46  ? 10.562  1.218   -5.807  1.00 0.00 ? 46  ALA A CA   2  
ATOM 2941  C C    . ALA A 1 46  ? 11.260  0.115   -5.025  1.00 0.00 ? 46  ALA A C    2  
ATOM 2942  O O    . ALA A 1 46  ? 12.013  -0.682  -5.586  1.00 0.00 ? 46  ALA A O    2  
ATOM 2943  C CB   . ALA A 1 46  ? 11.323  2.536   -5.685  1.00 0.00 ? 46  ALA A CB   2  
ATOM 2944  H H    . ALA A 1 46  ? 9.001   2.022   -4.623  1.00 0.00 ? 46  ALA A H    2  
ATOM 2945  H HA   . ALA A 1 46  ? 10.532  0.936   -6.853  1.00 0.00 ? 46  ALA A HA   2  
ATOM 2946  H HB1  . ALA A 1 46  ? 12.324  2.414   -6.075  1.00 0.00 ? 46  ALA A HB1  2  
ATOM 2947  H HB2  . ALA A 1 46  ? 11.376  2.831   -4.647  1.00 0.00 ? 46  ALA A HB2  2  
ATOM 2948  H HB3  . ALA A 1 46  ? 10.810  3.301   -6.250  1.00 0.00 ? 46  ALA A HB3  2  
ATOM 2949  N N    . CYS A 1 47  ? 10.982  0.052   -3.727  1.00 0.00 ? 47  CYS A N    2  
ATOM 2950  C CA   . CYS A 1 47  ? 11.600  -0.945  -2.865  1.00 0.00 ? 47  CYS A CA   2  
ATOM 2951  C C    . CYS A 1 47  ? 10.942  -2.314  -3.044  1.00 0.00 ? 47  CYS A C    2  
ATOM 2952  O O    . CYS A 1 47  ? 11.537  -3.337  -2.701  1.00 0.00 ? 47  CYS A O    2  
ATOM 2953  C CB   . CYS A 1 47  ? 11.555  -0.495  -1.402  1.00 0.00 ? 47  CYS A CB   2  
ATOM 2954  S SG   . CYS A 1 47  ? 9.898   -0.156  -0.773  1.00 0.00 ? 47  CYS A SG   2  
ATOM 2955  H H    . CYS A 1 47  ? 10.345  0.691   -3.340  1.00 0.00 ? 47  CYS A H    2  
ATOM 2956  H HA   . CYS A 1 47  ? 12.637  -1.029  -3.165  1.00 0.00 ? 47  CYS A HA   2  
ATOM 2957  H HB2  . CYS A 1 47  ? 11.987  -1.265  -0.782  1.00 0.00 ? 47  CYS A HB2  2  
ATOM 2958  H HB3  . CYS A 1 47  ? 12.136  0.410   -1.295  1.00 0.00 ? 47  CYS A HB3  2  
ATOM 2959  H HG   . CYS A 1 47  ? 9.680   1.147   -0.887  1.00 0.00 ? 47  CYS A HG   2  
ATOM 2960  N N    . GLU A 1 48  ? 9.718   -2.343  -3.585  1.00 0.00 ? 48  GLU A N    2  
ATOM 2961  C CA   . GLU A 1 48  ? 9.082   -3.617  -3.932  1.00 0.00 ? 48  GLU A CA   2  
ATOM 2962  C C    . GLU A 1 48  ? 9.806   -4.227  -5.135  1.00 0.00 ? 48  GLU A C    2  
ATOM 2963  O O    . GLU A 1 48  ? 9.875   -5.447  -5.287  1.00 0.00 ? 48  GLU A O    2  
ATOM 2964  C CB   . GLU A 1 48  ? 7.577   -3.452  -4.236  1.00 0.00 ? 48  GLU A CB   2  
ATOM 2965  C CG   . GLU A 1 48  ? 7.264   -2.830  -5.596  1.00 0.00 ? 48  GLU A CG   2  
ATOM 2966  C CD   . GLU A 1 48  ? 5.778   -2.874  -5.944  1.00 0.00 ? 48  GLU A CD   2  
ATOM 2967  O OE1  . GLU A 1 48  ? 5.237   -3.985  -6.128  1.00 0.00 ? 48  GLU A OE1  2  
ATOM 2968  O OE2  . GLU A 1 48  ? 5.143   -1.804  -6.037  1.00 0.00 ? 48  GLU A OE2  2  
ATOM 2969  H H    . GLU A 1 48  ? 9.232   -1.503  -3.731  1.00 0.00 ? 48  GLU A H    2  
ATOM 2970  H HA   . GLU A 1 48  ? 9.198   -4.282  -3.087  1.00 0.00 ? 48  GLU A HA   2  
ATOM 2971  H HB2  . GLU A 1 48  ? 7.110   -4.426  -4.199  1.00 0.00 ? 48  GLU A HB2  2  
ATOM 2972  H HB3  . GLU A 1 48  ? 7.137   -2.828  -3.470  1.00 0.00 ? 48  GLU A HB3  2  
ATOM 2973  H HG2  . GLU A 1 48  ? 7.589   -1.800  -5.588  1.00 0.00 ? 48  GLU A HG2  2  
ATOM 2974  H HG3  . GLU A 1 48  ? 7.811   -3.367  -6.359  1.00 0.00 ? 48  GLU A HG3  2  
ATOM 2975  N N    . ARG A 1 49  ? 10.360  -3.354  -5.974  1.00 0.00 ? 49  ARG A N    2  
ATOM 2976  C CA   . ARG A 1 49  ? 11.136  -3.771  -7.140  1.00 0.00 ? 49  ARG A CA   2  
ATOM 2977  C C    . ARG A 1 49  ? 12.511  -4.271  -6.698  1.00 0.00 ? 49  ARG A C    2  
ATOM 2978  O O    . ARG A 1 49  ? 13.074  -5.195  -7.286  1.00 0.00 ? 49  ARG A O    2  
ATOM 2979  C CB   . ARG A 1 49  ? 11.287  -2.595  -8.117  1.00 0.00 ? 49  ARG A CB   2  
ATOM 2980  C CG   . ARG A 1 49  ? 9.959   -2.016  -8.592  1.00 0.00 ? 49  ARG A CG   2  
ATOM 2981  C CD   . ARG A 1 49  ? 10.160  -0.816  -9.512  1.00 0.00 ? 49  ARG A CD   2  
ATOM 2982  N NE   . ARG A 1 49  ? 8.899   -0.124  -9.795  1.00 0.00 ? 49  ARG A NE   2  
ATOM 2983  C CZ   . ARG A 1 49  ? 8.535   0.314   -11.004 1.00 0.00 ? 49  ARG A CZ   2  
ATOM 2984  N NH1  . ARG A 1 49  ? 9.326   0.121   -12.054 1.00 0.00 ? 49  ARG A NH1  2  
ATOM 2985  N NH2  . ARG A 1 49  ? 7.382   0.953   -11.158 1.00 0.00 ? 49  ARG A NH2  2  
ATOM 2986  H H    . ARG A 1 49  ? 10.241  -2.396  -5.804  1.00 0.00 ? 49  ARG A H    2  
ATOM 2987  H HA   . ARG A 1 49  ? 10.605  -4.576  -7.628  1.00 0.00 ? 49  ARG A HA   2  
ATOM 2988  H HB2  . ARG A 1 49  ? 11.841  -1.803  -7.627  1.00 0.00 ? 49  ARG A HB2  2  
ATOM 2989  H HB3  . ARG A 1 49  ? 11.841  -2.928  -8.983  1.00 0.00 ? 49  ARG A HB3  2  
ATOM 2990  H HG2  . ARG A 1 49  ? 9.413   -2.779  -9.126  1.00 0.00 ? 49  ARG A HG2  2  
ATOM 2991  H HG3  . ARG A 1 49  ? 9.385   -1.704  -7.730  1.00 0.00 ? 49  ARG A HG3  2  
ATOM 2992  H HD2  . ARG A 1 49  ? 10.838  -0.121  -9.036  1.00 0.00 ? 49  ARG A HD2  2  
ATOM 2993  H HD3  . ARG A 1 49  ? 10.591  -1.158  -10.442 1.00 0.00 ? 49  ARG A HD3  2  
ATOM 2994  H HE   . ARG A 1 49  ? 8.295   0.030   -9.032  1.00 0.00 ? 49  ARG A HE   2  
ATOM 2995  H HH11 . ARG A 1 49  ? 10.205  -0.352  -11.946 1.00 0.00 ? 49  ARG A HH11 2  
ATOM 2996  H HH12 . ARG A 1 49  ? 9.046   0.443   -12.965 1.00 0.00 ? 49  ARG A HH12 2  
ATOM 2997  H HH21 . ARG A 1 49  ? 6.783   1.116   -10.368 1.00 0.00 ? 49  ARG A HH21 2  
ATOM 2998  H HH22 . ARG A 1 49  ? 7.100   1.277   -12.068 1.00 0.00 ? 49  ARG A HH22 2  
ATOM 2999  N N    . PHE A 1 50  ? 13.028  -3.653  -5.639  1.00 0.00 ? 50  PHE A N    2  
ATOM 3000  C CA   . PHE A 1 50  ? 14.333  -4.001  -5.074  1.00 0.00 ? 50  PHE A CA   2  
ATOM 3001  C C    . PHE A 1 50  ? 14.347  -5.460  -4.599  1.00 0.00 ? 50  PHE A C    2  
ATOM 3002  O O    . PHE A 1 50  ? 15.398  -6.100  -4.553  1.00 0.00 ? 50  PHE A O    2  
ATOM 3003  C CB   . PHE A 1 50  ? 14.648  -3.049  -3.907  1.00 0.00 ? 50  PHE A CB   2  
ATOM 3004  C CG   . PHE A 1 50  ? 16.056  -3.156  -3.364  1.00 0.00 ? 50  PHE A CG   2  
ATOM 3005  C CD1  . PHE A 1 50  ? 17.092  -2.440  -3.947  1.00 0.00 ? 50  PHE A CD1  2  
ATOM 3006  C CD2  . PHE A 1 50  ? 16.341  -3.957  -2.267  1.00 0.00 ? 50  PHE A CD2  2  
ATOM 3007  C CE1  . PHE A 1 50  ? 18.378  -2.521  -3.449  1.00 0.00 ? 50  PHE A CE1  2  
ATOM 3008  C CE2  . PHE A 1 50  ? 17.627  -4.043  -1.767  1.00 0.00 ? 50  PHE A CE2  2  
ATOM 3009  C CZ   . PHE A 1 50  ? 18.647  -3.324  -2.359  1.00 0.00 ? 50  PHE A CZ   2  
ATOM 3010  H H    . PHE A 1 50  ? 12.516  -2.929  -5.223  1.00 0.00 ? 50  PHE A H    2  
ATOM 3011  H HA   . PHE A 1 50  ? 15.078  -3.873  -5.847  1.00 0.00 ? 50  PHE A HA   2  
ATOM 3012  H HB2  . PHE A 1 50  ? 14.502  -2.031  -4.240  1.00 0.00 ? 50  PHE A HB2  2  
ATOM 3013  H HB3  . PHE A 1 50  ? 13.961  -3.251  -3.097  1.00 0.00 ? 50  PHE A HB3  2  
ATOM 3014  H HD1  . PHE A 1 50  ? 16.887  -1.810  -4.801  1.00 0.00 ? 50  PHE A HD1  2  
ATOM 3015  H HD2  . PHE A 1 50  ? 15.544  -4.524  -1.802  1.00 0.00 ? 50  PHE A HD2  2  
ATOM 3016  H HE1  . PHE A 1 50  ? 19.175  -1.958  -3.915  1.00 0.00 ? 50  PHE A HE1  2  
ATOM 3017  H HE2  . PHE A 1 50  ? 17.835  -4.672  -0.914  1.00 0.00 ? 50  PHE A HE2  2  
ATOM 3018  H HZ   . PHE A 1 50  ? 19.652  -3.388  -1.969  1.00 0.00 ? 50  PHE A HZ   2  
ATOM 3019  N N    . GLN A 1 51  ? 13.161  -5.982  -4.275  1.00 0.00 ? 51  GLN A N    2  
ATOM 3020  C CA   . GLN A 1 51  ? 13.013  -7.350  -3.757  1.00 0.00 ? 51  GLN A CA   2  
ATOM 3021  C C    . GLN A 1 51  ? 13.435  -8.388  -4.799  1.00 0.00 ? 51  GLN A C    2  
ATOM 3022  O O    . GLN A 1 51  ? 13.666  -9.554  -4.472  1.00 0.00 ? 51  GLN A O    2  
ATOM 3023  C CB   . GLN A 1 51  ? 11.557  -7.600  -3.331  1.00 0.00 ? 51  GLN A CB   2  
ATOM 3024  C CG   . GLN A 1 51  ? 11.014  -6.546  -2.372  1.00 0.00 ? 51  GLN A CG   2  
ATOM 3025  C CD   . GLN A 1 51  ? 11.780  -6.486  -1.062  1.00 0.00 ? 51  GLN A CD   2  
ATOM 3026  O OE1  . GLN A 1 51  ? 12.248  -7.503  -0.552  1.00 0.00 ? 51  GLN A OE1  2  
ATOM 3027  N NE2  . GLN A 1 51  ? 11.945  -5.284  -0.532  1.00 0.00 ? 51  GLN A NE2  2  
ATOM 3028  H H    . GLN A 1 51  ? 12.359  -5.431  -4.383  1.00 0.00 ? 51  GLN A H    2  
ATOM 3029  H HA   . GLN A 1 51  ? 13.653  -7.446  -2.892  1.00 0.00 ? 51  GLN A HA   2  
ATOM 3030  H HB2  . GLN A 1 51  ? 10.929  -7.611  -4.213  1.00 0.00 ? 51  GLN A HB2  2  
ATOM 3031  H HB3  . GLN A 1 51  ? 11.495  -8.563  -2.846  1.00 0.00 ? 51  GLN A HB3  2  
ATOM 3032  H HG2  . GLN A 1 51  ? 11.071  -5.579  -2.850  1.00 0.00 ? 51  GLN A HG2  2  
ATOM 3033  H HG3  . GLN A 1 51  ? 9.979   -6.775  -2.155  1.00 0.00 ? 51  GLN A HG3  2  
ATOM 3034  H HE21 . GLN A 1 51  ? 11.570  -4.514  -1.010  1.00 0.00 ? 51  GLN A HE21 2  
ATOM 3035  H HE22 . GLN A 1 51  ? 12.451  -5.214  0.308   1.00 0.00 ? 51  GLN A HE22 2  
ATOM 3036  N N    . GLN A 1 52  ? 13.529  -7.959  -6.056  1.00 0.00 ? 52  GLN A N    2  
ATOM 3037  C CA   . GLN A 1 52  ? 13.927  -8.845  -7.147  1.00 0.00 ? 52  GLN A CA   2  
ATOM 3038  C C    . GLN A 1 52  ? 15.416  -9.184  -7.068  1.00 0.00 ? 52  GLN A C    2  
ATOM 3039  O O    . GLN A 1 52  ? 15.892  -10.093 -7.752  1.00 0.00 ? 52  GLN A O    2  
ATOM 3040  C CB   . GLN A 1 52  ? 13.604  -8.204  -8.502  1.00 0.00 ? 52  GLN A CB   2  
ATOM 3041  C CG   . GLN A 1 52  ? 12.111  -8.072  -8.797  1.00 0.00 ? 52  GLN A CG   2  
ATOM 3042  C CD   . GLN A 1 52  ? 11.417  -9.412  -9.019  1.00 0.00 ? 52  GLN A CD   2  
ATOM 3043  O OE1  . GLN A 1 52  ? 11.802  -10.439 -8.452  1.00 0.00 ? 52  GLN A OE1  2  
ATOM 3044  N NE2  . GLN A 1 52  ? 10.392  -9.413  -9.857  1.00 0.00 ? 52  GLN A NE2  2  
ATOM 3045  H H    . GLN A 1 52  ? 13.326  -7.020  -6.254  1.00 0.00 ? 52  GLN A H    2  
ATOM 3046  H HA   . GLN A 1 52  ? 13.362  -9.762  -7.052  1.00 0.00 ? 52  GLN A HA   2  
ATOM 3047  H HB2  . GLN A 1 52  ? 14.040  -7.214  -8.530  1.00 0.00 ? 52  GLN A HB2  2  
ATOM 3048  H HB3  . GLN A 1 52  ? 14.053  -8.800  -9.283  1.00 0.00 ? 52  GLN A HB3  2  
ATOM 3049  H HG2  . GLN A 1 52  ? 11.635  -7.577  -7.964  1.00 0.00 ? 52  GLN A HG2  2  
ATOM 3050  H HG3  . GLN A 1 52  ? 11.990  -7.469  -9.687  1.00 0.00 ? 52  GLN A HG3  2  
ATOM 3051  H HE21 . GLN A 1 52  ? 10.142  -8.563  -10.284 1.00 0.00 ? 52  GLN A HE21 2  
ATOM 3052  H HE22 . GLN A 1 52  ? 9.929   -10.261 -10.025 1.00 0.00 ? 52  GLN A HE22 2  
ATOM 3053  N N    . ILE A 1 53  ? 16.145  -8.442  -6.241  1.00 0.00 ? 53  ILE A N    2  
ATOM 3054  C CA   . ILE A 1 53  ? 17.567  -8.686  -6.024  1.00 0.00 ? 53  ILE A CA   2  
ATOM 3055  C C    . ILE A 1 53  ? 17.759  -9.396  -4.678  1.00 0.00 ? 53  ILE A C    2  
ATOM 3056  O O    . ILE A 1 53  ? 17.694  -8.760  -3.627  1.00 0.00 ? 53  ILE A O    2  
ATOM 3057  C CB   . ILE A 1 53  ? 18.382  -7.364  -6.025  1.00 0.00 ? 53  ILE A CB   2  
ATOM 3058  C CG1  . ILE A 1 53  ? 17.827  -6.381  -7.070  1.00 0.00 ? 53  ILE A CG1  2  
ATOM 3059  C CG2  . ILE A 1 53  ? 19.860  -7.655  -6.300  1.00 0.00 ? 53  ILE A CG2  2  
ATOM 3060  C CD1  . ILE A 1 53  ? 18.461  -5.005  -7.012  1.00 0.00 ? 53  ILE A CD1  2  
ATOM 3061  H H    . ILE A 1 53  ? 15.712  -7.709  -5.754  1.00 0.00 ? 53  ILE A H    2  
ATOM 3062  H HA   . ILE A 1 53  ? 17.933  -9.321  -6.822  1.00 0.00 ? 53  ILE A HA   2  
ATOM 3063  H HB   . ILE A 1 53  ? 18.305  -6.916  -5.043  1.00 0.00 ? 53  ILE A HB   2  
ATOM 3064  H HG12 . ILE A 1 53  ? 17.996  -6.779  -8.060  1.00 0.00 ? 53  ILE A HG12 2  
ATOM 3065  H HG13 . ILE A 1 53  ? 16.764  -6.261  -6.914  1.00 0.00 ? 53  ILE A HG13 2  
ATOM 3066  H HG21 . ILE A 1 53  ? 19.966  -8.094  -7.281  1.00 0.00 ? 53  ILE A HG21 2  
ATOM 3067  H HG22 . ILE A 1 53  ? 20.239  -8.343  -5.557  1.00 0.00 ? 53  ILE A HG22 2  
ATOM 3068  H HG23 . ILE A 1 53  ? 20.425  -6.734  -6.254  1.00 0.00 ? 53  ILE A HG23 2  
ATOM 3069  H HD11 . ILE A 1 53  ? 18.024  -4.375  -7.773  1.00 0.00 ? 53  ILE A HD11 2  
ATOM 3070  H HD12 . ILE A 1 53  ? 19.524  -5.090  -7.184  1.00 0.00 ? 53  ILE A HD12 2  
ATOM 3071  H HD13 . ILE A 1 53  ? 18.287  -4.567  -6.039  1.00 0.00 ? 53  ILE A HD13 2  
ATOM 3072  N N    . PRO A 1 54  ? 17.986  -10.727 -4.690  1.00 0.00 ? 54  PRO A N    2  
ATOM 3073  C CA   . PRO A 1 54  ? 18.054  -11.526 -3.456  1.00 0.00 ? 54  PRO A CA   2  
ATOM 3074  C C    . PRO A 1 54  ? 19.237  -11.146 -2.558  1.00 0.00 ? 54  PRO A C    2  
ATOM 3075  O O    . PRO A 1 54  ? 19.067  -10.982 -1.351  1.00 0.00 ? 54  PRO A O    2  
ATOM 3076  C CB   . PRO A 1 54  ? 18.197  -12.970 -3.970  1.00 0.00 ? 54  PRO A CB   2  
ATOM 3077  C CG   . PRO A 1 54  ? 18.755  -12.834 -5.347  1.00 0.00 ? 54  PRO A CG   2  
ATOM 3078  C CD   . PRO A 1 54  ? 18.192  -11.552 -5.897  1.00 0.00 ? 54  PRO A CD   2  
ATOM 3079  H HA   . PRO A 1 54  ? 17.138  -11.439 -2.887  1.00 0.00 ? 54  PRO A HA   2  
ATOM 3080  H HB2  . PRO A 1 54  ? 18.862  -13.527 -3.323  1.00 0.00 ? 54  PRO A HB2  2  
ATOM 3081  H HB3  . PRO A 1 54  ? 17.226  -13.446 -3.984  1.00 0.00 ? 54  PRO A HB3  2  
ATOM 3082  H HG2  . PRO A 1 54  ? 19.835  -12.782 -5.303  1.00 0.00 ? 54  PRO A HG2  2  
ATOM 3083  H HG3  . PRO A 1 54  ? 18.447  -13.673 -5.956  1.00 0.00 ? 54  PRO A HG3  2  
ATOM 3084  H HD2  . PRO A 1 54  ? 18.899  -11.086 -6.569  1.00 0.00 ? 54  PRO A HD2  2  
ATOM 3085  H HD3  . PRO A 1 54  ? 17.253  -11.734 -6.403  1.00 0.00 ? 54  PRO A HD3  2  
ATOM 3086  N N    . ALA A 1 55  ? 20.421  -11.010 -3.168  1.00 0.00 ? 55  ALA A N    2  
ATOM 3087  C CA   . ALA A 1 55  ? 21.683  -10.744 -2.451  1.00 0.00 ? 55  ALA A CA   2  
ATOM 3088  C C    . ALA A 1 55  ? 22.858  -11.090 -3.361  1.00 0.00 ? 55  ALA A C    2  
ATOM 3089  O O    . ALA A 1 55  ? 23.946  -10.523 -3.243  1.00 0.00 ? 55  ALA A O    2  
ATOM 3090  C CB   . ALA A 1 55  ? 21.790  -11.568 -1.165  1.00 0.00 ? 55  ALA A CB   2  
ATOM 3091  H H    . ALA A 1 55  ? 20.448  -11.073 -4.145  1.00 0.00 ? 55  ALA A H    2  
ATOM 3092  H HA   . ALA A 1 55  ? 21.720  -9.688  -2.191  1.00 0.00 ? 55  ALA A HA   2  
ATOM 3093  H HB1  . ALA A 1 55  ? 20.980  -11.307 -0.500  1.00 0.00 ? 55  ALA A HB1  2  
ATOM 3094  H HB2  . ALA A 1 55  ? 22.733  -11.359 -0.679  1.00 0.00 ? 55  ALA A HB2  2  
ATOM 3095  H HB3  . ALA A 1 55  ? 21.734  -12.621 -1.403  1.00 0.00 ? 55  ALA A HB3  2  
ATOM 3096  N N    . SER A 1 56  ? 22.603  -12.028 -4.276  1.00 0.00 ? 56  SER A N    2  
ATOM 3097  C CA   . SER A 1 56  ? 23.616  -12.579 -5.170  1.00 0.00 ? 56  SER A CA   2  
ATOM 3098  C C    . SER A 1 56  ? 24.412  -11.484 -5.876  1.00 0.00 ? 56  SER A C    2  
ATOM 3099  O O    . SER A 1 56  ? 25.638  -11.406 -5.742  1.00 0.00 ? 56  SER A O    2  
ATOM 3100  C CB   . SER A 1 56  ? 22.927  -13.487 -6.196  1.00 0.00 ? 56  SER A CB   2  
ATOM 3101  O OG   . SER A 1 56  ? 21.768  -12.855 -6.720  1.00 0.00 ? 56  SER A OG   2  
ATOM 3102  H H    . SER A 1 56  ? 21.688  -12.364 -4.357  1.00 0.00 ? 56  SER A H    2  
ATOM 3103  H HA   . SER A 1 56  ? 24.293  -13.177 -4.576  1.00 0.00 ? 56  SER A HA   2  
ATOM 3104  H HB2  . SER A 1 56  ? 23.607  -13.700 -7.009  1.00 0.00 ? 56  SER A HB2  2  
ATOM 3105  H HB3  . SER A 1 56  ? 22.633  -14.412 -5.721  1.00 0.00 ? 56  SER A HB3  2  
ATOM 3106  H HG   . SER A 1 56  ? 21.436  -13.363 -7.471  1.00 0.00 ? 56  SER A HG   2  
ATOM 3107  N N    . ASP A 1 57  ? 23.718  -10.648 -6.637  1.00 0.00 ? 57  ASP A N    2  
ATOM 3108  C CA   . ASP A 1 57  ? 24.370  -9.553  -7.348  1.00 0.00 ? 57  ASP A CA   2  
ATOM 3109  C C    . ASP A 1 57  ? 24.447  -8.330  -6.437  1.00 0.00 ? 57  ASP A C    2  
ATOM 3110  O O    . ASP A 1 57  ? 23.569  -7.461  -6.460  1.00 0.00 ? 57  ASP A O    2  
ATOM 3111  C CB   . ASP A 1 57  ? 23.625  -9.217  -8.652  1.00 0.00 ? 57  ASP A CB   2  
ATOM 3112  C CG   . ASP A 1 57  ? 24.498  -8.452  -9.644  1.00 0.00 ? 57  ASP A CG   2  
ATOM 3113  O OD1  . ASP A 1 57  ? 25.003  -7.366  -9.295  1.00 0.00 ? 57  ASP A OD1  2  
ATOM 3114  O OD2  . ASP A 1 57  ? 24.699  -8.950  -10.775 1.00 0.00 ? 57  ASP A OD2  2  
ATOM 3115  H H    . ASP A 1 57  ? 22.747  -10.767 -6.717  1.00 0.00 ? 57  ASP A H    2  
ATOM 3116  H HA   . ASP A 1 57  ? 25.378  -9.868  -7.590  1.00 0.00 ? 57  ASP A HA   2  
ATOM 3117  H HB2  . ASP A 1 57  ? 23.299  -10.137 -9.119  1.00 0.00 ? 57  ASP A HB2  2  
ATOM 3118  H HB3  . ASP A 1 57  ? 22.759  -8.612  -8.422  1.00 0.00 ? 57  ASP A HB3  2  
ATOM 3119  N N    . THR A 1 58  ? 25.483  -8.295  -5.603  1.00 0.00 ? 58  THR A N    2  
ATOM 3120  C CA   . THR A 1 58  ? 25.672  -7.215  -4.640  1.00 0.00 ? 58  THR A CA   2  
ATOM 3121  C C    . THR A 1 58  ? 25.813  -5.866  -5.349  1.00 0.00 ? 58  THR A C    2  
ATOM 3122  O O    . THR A 1 58  ? 25.424  -4.823  -4.816  1.00 0.00 ? 58  THR A O    2  
ATOM 3123  C CB   . THR A 1 58  ? 26.919  -7.478  -3.764  1.00 0.00 ? 58  THR A CB   2  
ATOM 3124  O OG1  . THR A 1 58  ? 26.846  -8.801  -3.207  1.00 0.00 ? 58  THR A OG1  2  
ATOM 3125  C CG2  . THR A 1 58  ? 27.037  -6.454  -2.636  1.00 0.00 ? 58  THR A CG2  2  
ATOM 3126  H H    . THR A 1 58  ? 26.138  -9.025  -5.631  1.00 0.00 ? 58  THR A H    2  
ATOM 3127  H HA   . THR A 1 58  ? 24.804  -7.185  -3.998  1.00 0.00 ? 58  THR A HA   2  
ATOM 3128  H HB   . THR A 1 58  ? 27.801  -7.410  -4.388  1.00 0.00 ? 58  THR A HB   2  
ATOM 3129  H HG1  . THR A 1 58  ? 25.933  -9.117  -3.248  1.00 0.00 ? 58  THR A HG1  2  
ATOM 3130  H HG21 . THR A 1 58  ? 26.165  -6.513  -2.000  1.00 0.00 ? 58  THR A HG21 2  
ATOM 3131  H HG22 . THR A 1 58  ? 27.108  -5.460  -3.056  1.00 0.00 ? 58  THR A HG22 2  
ATOM 3132  H HG23 . THR A 1 58  ? 27.921  -6.661  -2.052  1.00 0.00 ? 58  THR A HG23 2  
ATOM 3133  N N    . GLN A 1 59  ? 26.348  -5.900  -6.564  1.00 0.00 ? 59  GLN A N    2  
ATOM 3134  C CA   . GLN A 1 59  ? 26.560  -4.690  -7.345  1.00 0.00 ? 59  GLN A CA   2  
ATOM 3135  C C    . GLN A 1 59  ? 25.221  -4.064  -7.724  1.00 0.00 ? 59  GLN A C    2  
ATOM 3136  O O    . GLN A 1 59  ? 25.047  -2.844  -7.635  1.00 0.00 ? 59  GLN A O    2  
ATOM 3137  C CB   . GLN A 1 59  ? 27.374  -5.003  -8.606  1.00 0.00 ? 59  GLN A CB   2  
ATOM 3138  C CG   . GLN A 1 59  ? 28.727  -5.647  -8.319  1.00 0.00 ? 59  GLN A CG   2  
ATOM 3139  C CD   . GLN A 1 59  ? 29.494  -5.986  -9.584  1.00 0.00 ? 59  GLN A CD   2  
ATOM 3140  O OE1  . GLN A 1 59  ? 28.904  -6.265  -10.630 1.00 0.00 ? 59  GLN A OE1  2  
ATOM 3141  N NE2  . GLN A 1 59  ? 30.813  -5.969  -9.500  1.00 0.00 ? 59  GLN A NE2  2  
ATOM 3142  H H    . GLN A 1 59  ? 26.595  -6.767  -6.951  1.00 0.00 ? 59  GLN A H    2  
ATOM 3143  H HA   . GLN A 1 59  ? 27.112  -3.989  -6.733  1.00 0.00 ? 59  GLN A HA   2  
ATOM 3144  H HB2  . GLN A 1 59  ? 26.803  -5.677  -9.229  1.00 0.00 ? 59  GLN A HB2  2  
ATOM 3145  H HB3  . GLN A 1 59  ? 27.545  -4.083  -9.148  1.00 0.00 ? 59  GLN A HB3  2  
ATOM 3146  H HG2  . GLN A 1 59  ? 29.320  -4.964  -7.728  1.00 0.00 ? 59  GLN A HG2  2  
ATOM 3147  H HG3  . GLN A 1 59  ? 28.568  -6.558  -7.759  1.00 0.00 ? 59  GLN A HG3  2  
ATOM 3148  H HE21 . GLN A 1 59  ? 31.220  -5.741  -8.634  1.00 0.00 ? 59  GLN A HE21 2  
ATOM 3149  H HE22 . GLN A 1 59  ? 31.333  -6.193  -10.299 1.00 0.00 ? 59  GLN A HE22 2  
ATOM 3150  N N    . GLN A 1 60  ? 24.270  -4.906  -8.127  1.00 0.00 ? 60  GLN A N    2  
ATOM 3151  C CA   . GLN A 1 60  ? 22.950  -4.434  -8.522  1.00 0.00 ? 60  GLN A CA   2  
ATOM 3152  C C    . GLN A 1 60  ? 22.214  -3.851  -7.319  1.00 0.00 ? 60  GLN A C    2  
ATOM 3153  O O    . GLN A 1 60  ? 21.485  -2.863  -7.447  1.00 0.00 ? 60  GLN A O    2  
ATOM 3154  C CB   . GLN A 1 60  ? 22.116  -5.554  -9.150  1.00 0.00 ? 60  GLN A CB   2  
ATOM 3155  C CG   . GLN A 1 60  ? 20.853  -5.034  -9.824  1.00 0.00 ? 60  GLN A CG   2  
ATOM 3156  C CD   . GLN A 1 60  ? 19.896  -6.126  -10.257 1.00 0.00 ? 60  GLN A CD   2  
ATOM 3157  O OE1  . GLN A 1 60  ? 20.297  -7.249  -10.567 1.00 0.00 ? 60  GLN A OE1  2  
ATOM 3158  N NE2  . GLN A 1 60  ? 18.617  -5.799  -10.287 1.00 0.00 ? 60  GLN A NE2  2  
ATOM 3159  H H    . GLN A 1 60  ? 24.467  -5.868  -8.166  1.00 0.00 ? 60  GLN A H    2  
ATOM 3160  H HA   . GLN A 1 60  ? 23.091  -3.649  -9.254  1.00 0.00 ? 60  GLN A HA   2  
ATOM 3161  H HB2  . GLN A 1 60  ? 22.715  -6.068  -9.890  1.00 0.00 ? 60  GLN A HB2  2  
ATOM 3162  H HB3  . GLN A 1 60  ? 21.829  -6.255  -8.379  1.00 0.00 ? 60  GLN A HB3  2  
ATOM 3163  H HG2  . GLN A 1 60  ? 20.335  -4.385  -9.132  1.00 0.00 ? 60  GLN A HG2  2  
ATOM 3164  H HG3  . GLN A 1 60  ? 21.139  -4.463  -10.697 1.00 0.00 ? 60  GLN A HG3  2  
ATOM 3165  H HE21 . GLN A 1 60  ? 18.370  -4.880  -10.028 1.00 0.00 ? 60  GLN A HE21 2  
ATOM 3166  H HE22 . GLN A 1 60  ? 17.968  -6.475  -10.568 1.00 0.00 ? 60  GLN A HE22 2  
ATOM 3167  N N    . LEU A 1 61  ? 22.416  -4.465  -6.150  1.00 0.00 ? 61  LEU A N    2  
ATOM 3168  C CA   . LEU A 1 61  ? 21.852  -3.948  -4.902  1.00 0.00 ? 61  LEU A CA   2  
ATOM 3169  C C    . LEU A 1 61  ? 22.192  -2.466  -4.760  1.00 0.00 ? 61  LEU A C    2  
ATOM 3170  O O    . LEU A 1 61  ? 21.342  -1.648  -4.412  1.00 0.00 ? 61  LEU A O    2  
ATOM 3171  C CB   . LEU A 1 61  ? 22.395  -4.724  -3.688  1.00 0.00 ? 61  LEU A CB   2  
ATOM 3172  C CG   . LEU A 1 61  ? 21.886  -6.167  -3.515  1.00 0.00 ? 61  LEU A CG   2  
ATOM 3173  C CD1  . LEU A 1 61  ? 22.645  -6.874  -2.393  1.00 0.00 ? 61  LEU A CD1  2  
ATOM 3174  C CD2  . LEU A 1 61  ? 20.386  -6.179  -3.225  1.00 0.00 ? 61  LEU A CD2  2  
ATOM 3175  H H    . LEU A 1 61  ? 22.958  -5.283  -6.127  1.00 0.00 ? 61  LEU A H    2  
ATOM 3176  H HA   . LEU A 1 61  ? 20.777  -4.062  -4.948  1.00 0.00 ? 61  LEU A HA   2  
ATOM 3177  H HB2  . LEU A 1 61  ? 23.473  -4.758  -3.768  1.00 0.00 ? 61  LEU A HB2  2  
ATOM 3178  H HB3  . LEU A 1 61  ? 22.141  -4.170  -2.794  1.00 0.00 ? 61  LEU A HB3  2  
ATOM 3179  H HG   . LEU A 1 61  ? 22.055  -6.716  -4.431  1.00 0.00 ? 61  LEU A HG   2  
ATOM 3180  H HD11 . LEU A 1 61  ? 22.483  -6.350  -1.461  1.00 0.00 ? 61  LEU A HD11 2  
ATOM 3181  H HD12 . LEU A 1 61  ? 23.700  -6.881  -2.620  1.00 0.00 ? 61  LEU A HD12 2  
ATOM 3182  H HD13 . LEU A 1 61  ? 22.289  -7.889  -2.302  1.00 0.00 ? 61  LEU A HD13 2  
ATOM 3183  H HD21 . LEU A 1 61  ? 20.049  -7.199  -3.108  1.00 0.00 ? 61  LEU A HD21 2  
ATOM 3184  H HD22 . LEU A 1 61  ? 19.856  -5.719  -4.048  1.00 0.00 ? 61  LEU A HD22 2  
ATOM 3185  H HD23 . LEU A 1 61  ? 20.188  -5.628  -2.318  1.00 0.00 ? 61  LEU A HD23 2  
ATOM 3186  N N    . ALA A 1 62  ? 23.444  -2.132  -5.068  1.00 0.00 ? 62  ALA A N    2  
ATOM 3187  C CA   . ALA A 1 62  ? 23.919  -0.755  -4.998  1.00 0.00 ? 62  ALA A CA   2  
ATOM 3188  C C    . ALA A 1 62  ? 23.260  0.111   -6.073  1.00 0.00 ? 62  ALA A C    2  
ATOM 3189  O O    . ALA A 1 62  ? 22.983  1.289   -5.846  1.00 0.00 ? 62  ALA A O    2  
ATOM 3190  C CB   . ALA A 1 62  ? 25.437  -0.714  -5.137  1.00 0.00 ? 62  ALA A CB   2  
ATOM 3191  H H    . ALA A 1 62  ? 24.068  -2.836  -5.349  1.00 0.00 ? 62  ALA A H    2  
ATOM 3192  H HA   . ALA A 1 62  ? 23.660  -0.362  -4.024  1.00 0.00 ? 62  ALA A HA   2  
ATOM 3193  H HB1  . ALA A 1 62  ? 25.783  0.306   -5.047  1.00 0.00 ? 62  ALA A HB1  2  
ATOM 3194  H HB2  . ALA A 1 62  ? 25.723  -1.107  -6.102  1.00 0.00 ? 62  ALA A HB2  2  
ATOM 3195  H HB3  . ALA A 1 62  ? 25.885  -1.316  -4.359  1.00 0.00 ? 62  ALA A HB3  2  
ATOM 3196  N N    . GLN A 1 63  ? 22.999  -0.483  -7.238  1.00 0.00 ? 63  GLN A N    2  
ATOM 3197  C CA   . GLN A 1 63  ? 22.432  0.253   -8.372  1.00 0.00 ? 63  GLN A CA   2  
ATOM 3198  C C    . GLN A 1 63  ? 21.040  0.785   -8.036  1.00 0.00 ? 63  GLN A C    2  
ATOM 3199  O O    . GLN A 1 63  ? 20.757  1.974   -8.206  1.00 0.00 ? 63  GLN A O    2  
ATOM 3200  C CB   . GLN A 1 63  ? 22.364  -0.635  -9.623  1.00 0.00 ? 63  GLN A CB   2  
ATOM 3201  C CG   . GLN A 1 63  ? 23.710  -1.213  -10.054 1.00 0.00 ? 63  GLN A CG   2  
ATOM 3202  C CD   . GLN A 1 63  ? 24.787  -0.154  -10.214 1.00 0.00 ? 63  GLN A CD   2  
ATOM 3203  O OE1  . GLN A 1 63  ? 24.949  0.429   -11.287 1.00 0.00 ? 63  GLN A OE1  2  
ATOM 3204  N NE2  . GLN A 1 63  ? 25.541  0.089   -9.154  1.00 0.00 ? 63  GLN A NE2  2  
ATOM 3205  H H    . GLN A 1 63  ? 23.182  -1.442  -7.334  1.00 0.00 ? 63  GLN A H    2  
ATOM 3206  H HA   . GLN A 1 63  ? 23.083  1.093   -8.575  1.00 0.00 ? 63  GLN A HA   2  
ATOM 3207  H HB2  . GLN A 1 63  ? 21.694  -1.460  -9.426  1.00 0.00 ? 63  GLN A HB2  2  
ATOM 3208  H HB3  . GLN A 1 63  ? 21.968  -0.052  -10.443 1.00 0.00 ? 63  GLN A HB3  2  
ATOM 3209  H HG2  . GLN A 1 63  ? 24.036  -1.923  -9.310  1.00 0.00 ? 63  GLN A HG2  2  
ATOM 3210  H HG3  . GLN A 1 63  ? 23.583  -1.721  -11.000 1.00 0.00 ? 63  GLN A HG3  2  
ATOM 3211  H HE21 . GLN A 1 63  ? 25.364  -0.419  -8.334  1.00 0.00 ? 63  GLN A HE21 2  
ATOM 3212  H HE22 . GLN A 1 63  ? 26.249  0.766   -9.232  1.00 0.00 ? 63  GLN A HE22 2  
ATOM 3213  N N    . GLU A 1 64  ? 20.170  -0.102  -7.566  1.00 0.00 ? 64  GLU A N    2  
ATOM 3214  C CA   . GLU A 1 64  ? 18.813  0.286   -7.192  1.00 0.00 ? 64  GLU A CA   2  
ATOM 3215  C C    . GLU A 1 64  ? 18.821  1.125   -5.913  1.00 0.00 ? 64  GLU A C    2  
ATOM 3216  O O    . GLU A 1 64  ? 18.026  2.058   -5.772  1.00 0.00 ? 64  GLU A O    2  
ATOM 3217  C CB   . GLU A 1 64  ? 17.914  -0.954  -7.033  1.00 0.00 ? 64  GLU A CB   2  
ATOM 3218  C CG   . GLU A 1 64  ? 17.155  -1.350  -8.303  1.00 0.00 ? 64  GLU A CG   2  
ATOM 3219  C CD   . GLU A 1 64  ? 18.059  -1.687  -9.483  1.00 0.00 ? 64  GLU A CD   2  
ATOM 3220  O OE1  . GLU A 1 64  ? 18.480  -0.757  -10.207 1.00 0.00 ? 64  GLU A OE1  2  
ATOM 3221  O OE2  . GLU A 1 64  ? 18.331  -2.882  -9.709  1.00 0.00 ? 64  GLU A OE2  2  
ATOM 3222  H H    . GLU A 1 64  ? 20.445  -1.041  -7.473  1.00 0.00 ? 64  GLU A H    2  
ATOM 3223  H HA   . GLU A 1 64  ? 18.421  0.897   -7.994  1.00 0.00 ? 64  GLU A HA   2  
ATOM 3224  H HB2  . GLU A 1 64  ? 18.527  -1.792  -6.735  1.00 0.00 ? 64  GLU A HB2  2  
ATOM 3225  H HB3  . GLU A 1 64  ? 17.187  -0.762  -6.254  1.00 0.00 ? 64  GLU A HB3  2  
ATOM 3226  H HG2  . GLU A 1 64  ? 16.545  -2.215  -8.081  1.00 0.00 ? 64  GLU A HG2  2  
ATOM 3227  H HG3  . GLU A 1 64  ? 16.508  -0.529  -8.587  1.00 0.00 ? 64  GLU A HG3  2  
ATOM 3228  N N    . ALA A 1 65  ? 19.730  0.806   -4.991  1.00 0.00 ? 65  ALA A N    2  
ATOM 3229  C CA   . ALA A 1 65  ? 19.850  1.551   -3.737  1.00 0.00 ? 65  ALA A CA   2  
ATOM 3230  C C    . ALA A 1 65  ? 20.165  3.023   -3.999  1.00 0.00 ? 65  ALA A C    2  
ATOM 3231  O O    . ALA A 1 65  ? 19.469  3.911   -3.507  1.00 0.00 ? 65  ALA A O    2  
ATOM 3232  C CB   . ALA A 1 65  ? 20.913  0.932   -2.836  1.00 0.00 ? 65  ALA A CB   2  
ATOM 3233  H H    . ALA A 1 65  ? 20.329  0.045   -5.154  1.00 0.00 ? 65  ALA A H    2  
ATOM 3234  H HA   . ALA A 1 65  ? 18.898  1.486   -3.224  1.00 0.00 ? 65  ALA A HA   2  
ATOM 3235  H HB1  . ALA A 1 65  ? 20.956  1.473   -1.900  1.00 0.00 ? 65  ALA A HB1  2  
ATOM 3236  H HB2  . ALA A 1 65  ? 21.876  0.981   -3.325  1.00 0.00 ? 65  ALA A HB2  2  
ATOM 3237  H HB3  . ALA A 1 65  ? 20.663  -0.101  -2.642  1.00 0.00 ? 65  ALA A HB3  2  
ATOM 3238  N N    . ARG A 1 66  ? 21.211  3.272   -4.785  1.00 0.00 ? 66  ARG A N    2  
ATOM 3239  C CA   . ARG A 1 66  ? 21.640  4.638   -5.090  1.00 0.00 ? 66  ARG A CA   2  
ATOM 3240  C C    . ARG A 1 66  ? 20.568  5.363   -5.907  1.00 0.00 ? 66  ARG A C    2  
ATOM 3241  O O    . ARG A 1 66  ? 20.409  6.578   -5.800  1.00 0.00 ? 66  ARG A O    2  
ATOM 3242  C CB   . ARG A 1 66  ? 22.995  4.626   -5.832  1.00 0.00 ? 66  ARG A CB   2  
ATOM 3243  C CG   . ARG A 1 66  ? 22.935  4.080   -7.262  1.00 0.00 ? 66  ARG A CG   2  
ATOM 3244  C CD   . ARG A 1 66  ? 22.726  5.185   -8.298  1.00 0.00 ? 66  ARG A CD   2  
ATOM 3245  N NE   . ARG A 1 66  ? 22.201  4.667   -9.563  1.00 0.00 ? 66  ARG A NE   2  
ATOM 3246  C CZ   . ARG A 1 66  ? 22.947  4.244   -10.585 1.00 0.00 ? 66  ARG A CZ   2  
ATOM 3247  N NH1  . ARG A 1 66  ? 24.272  4.214   -10.494 1.00 0.00 ? 66  ARG A NH1  2  
ATOM 3248  N NH2  . ARG A 1 66  ? 22.355  3.844   -11.701 1.00 0.00 ? 66  ARG A NH2  2  
ATOM 3249  H H    . ARG A 1 66  ? 21.712  2.520   -5.166  1.00 0.00 ? 66  ARG A H    2  
ATOM 3250  H HA   . ARG A 1 66  ? 21.762  5.159   -4.149  1.00 0.00 ? 66  ARG A HA   2  
ATOM 3251  H HB2  . ARG A 1 66  ? 23.379  5.636   -5.869  1.00 0.00 ? 66  ARG A HB2  2  
ATOM 3252  H HB3  . ARG A 1 66  ? 23.687  4.016   -5.268  1.00 0.00 ? 66  ARG A HB3  2  
ATOM 3253  H HG2  . ARG A 1 66  ? 23.864  3.573   -7.482  1.00 0.00 ? 66  ARG A HG2  2  
ATOM 3254  H HG3  . ARG A 1 66  ? 22.119  3.374   -7.333  1.00 0.00 ? 66  ARG A HG3  2  
ATOM 3255  H HD2  . ARG A 1 66  ? 22.027  5.906   -7.902  1.00 0.00 ? 66  ARG A HD2  2  
ATOM 3256  H HD3  . ARG A 1 66  ? 23.674  5.671   -8.483  1.00 0.00 ? 66  ARG A HD3  2  
ATOM 3257  H HE   . ARG A 1 66  ? 21.221  4.652   -9.664  1.00 0.00 ? 66  ARG A HE   2  
ATOM 3258  H HH11 . ARG A 1 66  ? 24.731  4.510   -9.649  1.00 0.00 ? 66  ARG A HH11 2  
ATOM 3259  H HH12 . ARG A 1 66  ? 24.824  3.897   -11.271 1.00 0.00 ? 66  ARG A HH12 2  
ATOM 3260  H HH21 . ARG A 1 66  ? 21.354  3.864   -11.775 1.00 0.00 ? 66  ARG A HH21 2  
ATOM 3261  H HH22 . ARG A 1 66  ? 22.905  3.519   -12.477 1.00 0.00 ? 66  ARG A HH22 2  
ATOM 3262  N N    . ASN A 1 67  ? 19.835  4.599   -6.715  1.00 0.00 ? 67  ASN A N    2  
ATOM 3263  C CA   . ASN A 1 67  ? 18.743  5.141   -7.524  1.00 0.00 ? 67  ASN A CA   2  
ATOM 3264  C C    . ASN A 1 67  ? 17.678  5.750   -6.615  1.00 0.00 ? 67  ASN A C    2  
ATOM 3265  O O    . ASN A 1 67  ? 17.330  6.928   -6.741  1.00 0.00 ? 67  ASN A O    2  
ATOM 3266  C CB   . ASN A 1 67  ? 18.136  4.026   -8.393  1.00 0.00 ? 67  ASN A CB   2  
ATOM 3267  C CG   . ASN A 1 67  ? 17.066  4.515   -9.363  1.00 0.00 ? 67  ASN A CG   2  
ATOM 3268  O OD1  . ASN A 1 67  ? 16.344  5.474   -9.096  1.00 0.00 ? 67  ASN A OD1  2  
ATOM 3269  N ND2  . ASN A 1 67  ? 16.957  3.849   -10.503 1.00 0.00 ? 67  ASN A ND2  2  
ATOM 3270  H H    . ASN A 1 67  ? 20.032  3.639   -6.769  1.00 0.00 ? 67  ASN A H    2  
ATOM 3271  H HA   . ASN A 1 67  ? 19.148  5.914   -8.163  1.00 0.00 ? 67  ASN A HA   2  
ATOM 3272  H HB2  . ASN A 1 67  ? 18.925  3.567   -8.971  1.00 0.00 ? 67  ASN A HB2  2  
ATOM 3273  H HB3  . ASN A 1 67  ? 17.695  3.279   -7.748  1.00 0.00 ? 67  ASN A HB3  2  
ATOM 3274  H HD21 . ASN A 1 67  ? 17.565  3.092   -10.657 1.00 0.00 ? 67  ASN A HD21 2  
ATOM 3275  H HD22 . ASN A 1 67  ? 16.277  4.138   -11.146 1.00 0.00 ? 67  ASN A HD22 2  
ATOM 3276  N N    . ILE A 1 68  ? 17.185  4.934   -5.688  1.00 0.00 ? 68  ILE A N    2  
ATOM 3277  C CA   . ILE A 1 68  ? 16.192  5.365   -4.709  1.00 0.00 ? 68  ILE A CA   2  
ATOM 3278  C C    . ILE A 1 68  ? 16.755  6.488   -3.837  1.00 0.00 ? 68  ILE A C    2  
ATOM 3279  O O    . ILE A 1 68  ? 16.078  7.480   -3.549  1.00 0.00 ? 68  ILE A O    2  
ATOM 3280  C CB   . ILE A 1 68  ? 15.763  4.175   -3.808  1.00 0.00 ? 68  ILE A CB   2  
ATOM 3281  C CG1  . ILE A 1 68  ? 15.136  3.054   -4.660  1.00 0.00 ? 68  ILE A CG1  2  
ATOM 3282  C CG2  . ILE A 1 68  ? 14.796  4.628   -2.714  1.00 0.00 ? 68  ILE A CG2  2  
ATOM 3283  C CD1  . ILE A 1 68  ? 14.738  1.822   -3.868  1.00 0.00 ? 68  ILE A CD1  2  
ATOM 3284  H H    . ILE A 1 68  ? 17.504  4.005   -5.661  1.00 0.00 ? 68  ILE A H    2  
ATOM 3285  H HA   . ILE A 1 68  ? 15.323  5.727   -5.242  1.00 0.00 ? 68  ILE A HA   2  
ATOM 3286  H HB   . ILE A 1 68  ? 16.651  3.788   -3.323  1.00 0.00 ? 68  ILE A HB   2  
ATOM 3287  H HG12 . ILE A 1 68  ? 14.247  3.432   -5.143  1.00 0.00 ? 68  ILE A HG12 2  
ATOM 3288  H HG13 . ILE A 1 68  ? 15.844  2.746   -5.415  1.00 0.00 ? 68  ILE A HG13 2  
ATOM 3289  H HG21 . ILE A 1 68  ? 15.263  5.397   -2.115  1.00 0.00 ? 68  ILE A HG21 2  
ATOM 3290  H HG22 . ILE A 1 68  ? 14.543  3.787   -2.083  1.00 0.00 ? 68  ILE A HG22 2  
ATOM 3291  H HG23 . ILE A 1 68  ? 13.896  5.022   -3.166  1.00 0.00 ? 68  ILE A HG23 2  
ATOM 3292  H HD11 . ILE A 1 68  ? 14.326  1.082   -4.538  1.00 0.00 ? 68  ILE A HD11 2  
ATOM 3293  H HD12 . ILE A 1 68  ? 13.997  2.090   -3.129  1.00 0.00 ? 68  ILE A HD12 2  
ATOM 3294  H HD13 . ILE A 1 68  ? 15.608  1.414   -3.373  1.00 0.00 ? 68  ILE A HD13 2  
ATOM 3295  N N    . TYR A 1 69  ? 18.012  6.326   -3.444  1.00 0.00 ? 69  TYR A N    2  
ATOM 3296  C CA   . TYR A 1 69  ? 18.684  7.268   -2.557  1.00 0.00 ? 69  TYR A CA   2  
ATOM 3297  C C    . TYR A 1 69  ? 18.710  8.679   -3.149  1.00 0.00 ? 69  TYR A C    2  
ATOM 3298  O O    . TYR A 1 69  ? 18.311  9.646   -2.495  1.00 0.00 ? 69  TYR A O    2  
ATOM 3299  C CB   . TYR A 1 69  ? 20.115  6.783   -2.274  1.00 0.00 ? 69  TYR A CB   2  
ATOM 3300  C CG   . TYR A 1 69  ? 20.942  7.742   -1.435  1.00 0.00 ? 69  TYR A CG   2  
ATOM 3301  C CD1  . TYR A 1 69  ? 20.938  7.666   -0.044  1.00 0.00 ? 69  TYR A CD1  2  
ATOM 3302  C CD2  . TYR A 1 69  ? 21.723  8.723   -2.035  1.00 0.00 ? 69  TYR A CD2  2  
ATOM 3303  C CE1  . TYR A 1 69  ? 21.688  8.541   0.721   1.00 0.00 ? 69  TYR A CE1  2  
ATOM 3304  C CE2  . TYR A 1 69  ? 22.474  9.599   -1.282  1.00 0.00 ? 69  TYR A CE2  2  
ATOM 3305  C CZ   . TYR A 1 69  ? 22.454  9.506   0.097   1.00 0.00 ? 69  TYR A CZ   2  
ATOM 3306  O OH   . TYR A 1 69  ? 23.195  10.385  0.853   1.00 0.00 ? 69  TYR A OH   2  
ATOM 3307  H H    . TYR A 1 69  ? 18.507  5.540   -3.761  1.00 0.00 ? 69  TYR A H    2  
ATOM 3308  H HA   . TYR A 1 69  ? 18.135  7.290   -1.628  1.00 0.00 ? 69  TYR A HA   2  
ATOM 3309  H HB2  . TYR A 1 69  ? 20.068  5.838   -1.751  1.00 0.00 ? 69  TYR A HB2  2  
ATOM 3310  H HB3  . TYR A 1 69  ? 20.627  6.637   -3.216  1.00 0.00 ? 69  TYR A HB3  2  
ATOM 3311  H HD1  . TYR A 1 69  ? 20.338  6.909   0.439   1.00 0.00 ? 69  TYR A HD1  2  
ATOM 3312  H HD2  . TYR A 1 69  ? 21.736  8.799   -3.114  1.00 0.00 ? 69  TYR A HD2  2  
ATOM 3313  H HE1  . TYR A 1 69  ? 21.672  8.464   1.802   1.00 0.00 ? 69  TYR A HE1  2  
ATOM 3314  H HE2  . TYR A 1 69  ? 23.072  10.351  -1.776  1.00 0.00 ? 69  TYR A HE2  2  
ATOM 3315  H HH   . TYR A 1 69  ? 22.978  11.290  0.598   1.00 0.00 ? 69  TYR A HH   2  
ATOM 3316  N N    . GLN A 1 70  ? 19.172  8.781   -4.387  1.00 0.00 ? 70  GLN A N    2  
ATOM 3317  C CA   . GLN A 1 70  ? 19.396  10.076  -5.034  1.00 0.00 ? 70  GLN A CA   2  
ATOM 3318  C C    . GLN A 1 70  ? 18.106  10.878  -5.229  1.00 0.00 ? 70  GLN A C    2  
ATOM 3319  O O    . GLN A 1 70  ? 18.161  12.076  -5.519  1.00 0.00 ? 70  GLN A O    2  
ATOM 3320  C CB   . GLN A 1 70  ? 20.118  9.876   -6.371  1.00 0.00 ? 70  GLN A CB   2  
ATOM 3321  C CG   . GLN A 1 70  ? 21.620  9.646   -6.220  1.00 0.00 ? 70  GLN A CG   2  
ATOM 3322  C CD   . GLN A 1 70  ? 22.279  9.174   -7.506  1.00 0.00 ? 70  GLN A CD   2  
ATOM 3323  O OE1  . GLN A 1 70  ? 21.818  9.482   -8.609  1.00 0.00 ? 70  GLN A OE1  2  
ATOM 3324  N NE2  . GLN A 1 70  ? 23.371  8.436   -7.377  1.00 0.00 ? 70  GLN A NE2  2  
ATOM 3325  H H    . GLN A 1 70  ? 19.375  7.961   -4.885  1.00 0.00 ? 70  GLN A H    2  
ATOM 3326  H HA   . GLN A 1 70  ? 20.044  10.646  -4.384  1.00 0.00 ? 70  GLN A HA   2  
ATOM 3327  H HB2  . GLN A 1 70  ? 19.689  9.020   -6.873  1.00 0.00 ? 70  GLN A HB2  2  
ATOM 3328  H HB3  . GLN A 1 70  ? 19.970  10.753  -6.988  1.00 0.00 ? 70  GLN A HB3  2  
ATOM 3329  H HG2  . GLN A 1 70  ? 22.082  10.577  -5.924  1.00 0.00 ? 70  GLN A HG2  2  
ATOM 3330  H HG3  . GLN A 1 70  ? 21.787  8.906   -5.445  1.00 0.00 ? 70  GLN A HG3  2  
ATOM 3331  H HE21 . GLN A 1 70  ? 23.692  8.238   -6.471  1.00 0.00 ? 70  GLN A HE21 2  
ATOM 3332  H HE22 . GLN A 1 70  ? 23.822  8.132   -8.192  1.00 0.00 ? 70  GLN A HE22 2  
ATOM 3333  N N    . GLU A 1 71  ? 16.951  10.238  -5.074  1.00 0.00 ? 71  GLU A N    2  
ATOM 3334  C CA   . GLU A 1 71  ? 15.677  10.943  -5.210  1.00 0.00 ? 71  GLU A CA   2  
ATOM 3335  C C    . GLU A 1 71  ? 14.982  11.127  -3.865  1.00 0.00 ? 71  GLU A C    2  
ATOM 3336  O O    . GLU A 1 71  ? 14.503  12.219  -3.553  1.00 0.00 ? 71  GLU A O    2  
ATOM 3337  C CB   . GLU A 1 71  ? 14.736  10.210  -6.175  1.00 0.00 ? 71  GLU A CB   2  
ATOM 3338  C CG   . GLU A 1 71  ? 15.197  10.229  -7.627  1.00 0.00 ? 71  GLU A CG   2  
ATOM 3339  C CD   . GLU A 1 71  ? 14.103  9.780   -8.584  1.00 0.00 ? 71  GLU A CD   2  
ATOM 3340  O OE1  . GLU A 1 71  ? 13.252  10.617  -8.955  1.00 0.00 ? 71  GLU A OE1  2  
ATOM 3341  O OE2  . GLU A 1 71  ? 14.084  8.595   -8.968  1.00 0.00 ? 71  GLU A OE2  2  
ATOM 3342  H H    . GLU A 1 71  ? 16.954  9.278   -4.875  1.00 0.00 ? 71  GLU A H    2  
ATOM 3343  H HA   . GLU A 1 71  ? 15.887  11.924  -5.618  1.00 0.00 ? 71  GLU A HA   2  
ATOM 3344  H HB2  . GLU A 1 71  ? 14.650  9.179   -5.860  1.00 0.00 ? 71  GLU A HB2  2  
ATOM 3345  H HB3  . GLU A 1 71  ? 13.759  10.672  -6.125  1.00 0.00 ? 71  GLU A HB3  2  
ATOM 3346  H HG2  . GLU A 1 71  ? 15.493  11.236  -7.888  1.00 0.00 ? 71  GLU A HG2  2  
ATOM 3347  H HG3  . GLU A 1 71  ? 16.046  9.568   -7.732  1.00 0.00 ? 71  GLU A HG3  2  
ATOM 3348  N N    . PHE A 1 72  ? 14.935  10.064  -3.068  1.00 0.00 ? 72  PHE A N    2  
ATOM 3349  C CA   . PHE A 1 72  ? 14.100  10.043  -1.866  1.00 0.00 ? 72  PHE A CA   2  
ATOM 3350  C C    . PHE A 1 72  ? 14.913  10.163  -0.575  1.00 0.00 ? 72  PHE A C    2  
ATOM 3351  O O    . PHE A 1 72  ? 14.346  10.403  0.490   1.00 0.00 ? 72  PHE A O    2  
ATOM 3352  C CB   . PHE A 1 72  ? 13.280  8.745   -1.824  1.00 0.00 ? 72  PHE A CB   2  
ATOM 3353  C CG   . PHE A 1 72  ? 12.498  8.472   -3.086  1.00 0.00 ? 72  PHE A CG   2  
ATOM 3354  C CD1  . PHE A 1 72  ? 11.306  9.135   -3.342  1.00 0.00 ? 72  PHE A CD1  2  
ATOM 3355  C CD2  . PHE A 1 72  ? 12.960  7.555   -4.020  1.00 0.00 ? 72  PHE A CD2  2  
ATOM 3356  C CE1  . PHE A 1 72  ? 10.595  8.887   -4.502  1.00 0.00 ? 72  PHE A CE1  2  
ATOM 3357  C CE2  . PHE A 1 72  ? 12.252  7.305   -5.179  1.00 0.00 ? 72  PHE A CE2  2  
ATOM 3358  C CZ   . PHE A 1 72  ? 11.068  7.972   -5.420  1.00 0.00 ? 72  PHE A CZ   2  
ATOM 3359  H H    . PHE A 1 72  ? 15.468  9.272   -3.294  1.00 0.00 ? 72  PHE A H    2  
ATOM 3360  H HA   . PHE A 1 72  ? 13.416  10.879  -1.920  1.00 0.00 ? 72  PHE A HA   2  
ATOM 3361  H HB2  . PHE A 1 72  ? 13.949  7.911   -1.661  1.00 0.00 ? 72  PHE A HB2  2  
ATOM 3362  H HB3  . PHE A 1 72  ? 12.578  8.798   -1.002  1.00 0.00 ? 72  PHE A HB3  2  
ATOM 3363  H HD1  . PHE A 1 72  ? 10.932  9.852   -2.624  1.00 0.00 ? 72  PHE A HD1  2  
ATOM 3364  H HD2  . PHE A 1 72  ? 13.886  7.030   -3.835  1.00 0.00 ? 72  PHE A HD2  2  
ATOM 3365  H HE1  . PHE A 1 72  ? 9.668   9.411   -4.689  1.00 0.00 ? 72  PHE A HE1  2  
ATOM 3366  H HE2  . PHE A 1 72  ? 12.625  6.589   -5.897  1.00 0.00 ? 72  PHE A HE2  2  
ATOM 3367  H HZ   . PHE A 1 72  ? 10.514  7.780   -6.327  1.00 0.00 ? 72  PHE A HZ   2  
ATOM 3368  N N    . LEU A 1 73  ? 16.230  9.999   -0.654  1.00 0.00 ? 73  LEU A N    2  
ATOM 3369  C CA   . LEU A 1 73  ? 17.040  9.863   0.562   1.00 0.00 ? 73  LEU A CA   2  
ATOM 3370  C C    . LEU A 1 73  ? 18.245  10.813  0.583   1.00 0.00 ? 73  LEU A C    2  
ATOM 3371  O O    . LEU A 1 73  ? 19.013  10.823  1.549   1.00 0.00 ? 73  LEU A O    2  
ATOM 3372  C CB   . LEU A 1 73  ? 17.500  8.404   0.685   1.00 0.00 ? 73  LEU A CB   2  
ATOM 3373  C CG   . LEU A 1 73  ? 16.361  7.365   0.633   1.00 0.00 ? 73  LEU A CG   2  
ATOM 3374  C CD1  . LEU A 1 73  ? 16.906  5.962   0.370   1.00 0.00 ? 73  LEU A CD1  2  
ATOM 3375  C CD2  . LEU A 1 73  ? 15.553  7.392   1.925   1.00 0.00 ? 73  LEU A CD2  2  
ATOM 3376  H H    . LEU A 1 73  ? 16.661  9.959   -1.532  1.00 0.00 ? 73  LEU A H    2  
ATOM 3377  H HA   . LEU A 1 73  ? 16.410  10.095  1.409   1.00 0.00 ? 73  LEU A HA   2  
ATOM 3378  H HB2  . LEU A 1 73  ? 18.194  8.198   -0.117  1.00 0.00 ? 73  LEU A HB2  2  
ATOM 3379  H HB3  . LEU A 1 73  ? 18.020  8.289   1.624   1.00 0.00 ? 73  LEU A HB3  2  
ATOM 3380  H HG   . LEU A 1 73  ? 15.691  7.619   -0.180  1.00 0.00 ? 73  LEU A HG   2  
ATOM 3381  H HD11 . LEU A 1 73  ? 16.089  5.255   0.356   1.00 0.00 ? 73  LEU A HD11 2  
ATOM 3382  H HD12 . LEU A 1 73  ? 17.602  5.691   1.150   1.00 0.00 ? 73  LEU A HD12 2  
ATOM 3383  H HD13 . LEU A 1 73  ? 17.411  5.944   -0.584  1.00 0.00 ? 73  LEU A HD13 2  
ATOM 3384  H HD21 . LEU A 1 73  ? 15.140  8.379   2.073   1.00 0.00 ? 73  LEU A HD21 2  
ATOM 3385  H HD22 . LEU A 1 73  ? 16.193  7.141   2.759   1.00 0.00 ? 73  LEU A HD22 2  
ATOM 3386  H HD23 . LEU A 1 73  ? 14.749  6.673   1.862   1.00 0.00 ? 73  LEU A HD23 2  
ATOM 3387  N N    . SER A 1 74  ? 18.403  11.618  -0.463  1.00 0.00 ? 74  SER A N    2  
ATOM 3388  C CA   . SER A 1 74  ? 19.518  12.564  -0.542  1.00 0.00 ? 74  SER A CA   2  
ATOM 3389  C C    . SER A 1 74  ? 19.169  13.896  0.131   1.00 0.00 ? 74  SER A C    2  
ATOM 3390  O O    . SER A 1 74  ? 17.996  14.260  0.238   1.00 0.00 ? 74  SER A O    2  
ATOM 3391  C CB   . SER A 1 74  ? 19.912  12.801  -2.004  1.00 0.00 ? 74  SER A CB   2  
ATOM 3392  O OG   . SER A 1 74  ? 20.343  11.600  -2.611  1.00 0.00 ? 74  SER A OG   2  
ATOM 3393  H H    . SER A 1 74  ? 17.757  11.580  -1.197  1.00 0.00 ? 74  SER A H    2  
ATOM 3394  H HA   . SER A 1 74  ? 20.361  12.126  -0.023  1.00 0.00 ? 74  SER A HA   2  
ATOM 3395  H HB2  . SER A 1 74  ? 19.059  13.175  -2.551  1.00 0.00 ? 74  SER A HB2  2  
ATOM 3396  H HB3  . SER A 1 74  ? 20.716  13.523  -2.051  1.00 0.00 ? 74  SER A HB3  2  
ATOM 3397  H HG   . SER A 1 74  ? 19.871  10.856  -2.219  1.00 0.00 ? 74  SER A HG   2  
ATOM 3398  N N    . SER A 1 75  ? 20.199  14.605  0.585   1.00 0.00 ? 75  SER A N    2  
ATOM 3399  C CA   . SER A 1 75  ? 20.037  15.920  1.196   1.00 0.00 ? 75  SER A CA   2  
ATOM 3400  C C    . SER A 1 75  ? 19.419  16.901  0.195   1.00 0.00 ? 75  SER A C    2  
ATOM 3401  O O    . SER A 1 75  ? 19.910  17.033  -0.929  1.00 0.00 ? 75  SER A O    2  
ATOM 3402  C CB   . SER A 1 75  ? 21.402  16.438  1.665   1.00 0.00 ? 75  SER A CB   2  
ATOM 3403  O OG   . SER A 1 75  ? 22.048  15.489  2.501   1.00 0.00 ? 75  SER A OG   2  
ATOM 3404  H H    . SER A 1 75  ? 21.103  14.230  0.513   1.00 0.00 ? 75  SER A H    2  
ATOM 3405  H HA   . SER A 1 75  ? 19.381  15.819  2.050   1.00 0.00 ? 75  SER A HA   2  
ATOM 3406  H HB2  . SER A 1 75  ? 22.030  16.627  0.807   1.00 0.00 ? 75  SER A HB2  2  
ATOM 3407  H HB3  . SER A 1 75  ? 21.267  17.355  2.221   1.00 0.00 ? 75  SER A HB3  2  
ATOM 3408  H HG   . SER A 1 75  ? 21.604  15.467  3.358   1.00 0.00 ? 75  SER A HG   2  
ATOM 3409  N N    . GLN A 1 76  ? 18.340  17.569  0.608   1.00 0.00 ? 76  GLN A N    2  
ATOM 3410  C CA   . GLN A 1 76  ? 17.643  18.541  -0.241  1.00 0.00 ? 76  GLN A CA   2  
ATOM 3411  C C    . GLN A 1 76  ? 17.254  17.924  -1.589  1.00 0.00 ? 76  GLN A C    2  
ATOM 3412  O O    . GLN A 1 76  ? 17.252  18.603  -2.621  1.00 0.00 ? 76  GLN A O    2  
ATOM 3413  C CB   . GLN A 1 76  ? 18.514  19.793  -0.451  1.00 0.00 ? 76  GLN A CB   2  
ATOM 3414  C CG   . GLN A 1 76  ? 18.787  20.569  0.833   1.00 0.00 ? 76  GLN A CG   2  
ATOM 3415  C CD   . GLN A 1 76  ? 19.651  21.805  0.616   1.00 0.00 ? 76  GLN A CD   2  
ATOM 3416  O OE1  . GLN A 1 76  ? 19.502  22.810  1.316   1.00 0.00 ? 76  GLN A OE1  2  
ATOM 3417  N NE2  . GLN A 1 76  ? 20.573  21.737  -0.336  1.00 0.00 ? 76  GLN A NE2  2  
ATOM 3418  H H    . GLN A 1 76  ? 18.005  17.410  1.518   1.00 0.00 ? 76  GLN A H    2  
ATOM 3419  H HA   . GLN A 1 76  ? 16.739  18.830  0.274   1.00 0.00 ? 76  GLN A HA   2  
ATOM 3420  H HB2  . GLN A 1 76  ? 19.463  19.490  -0.873  1.00 0.00 ? 76  GLN A HB2  2  
ATOM 3421  H HB3  . GLN A 1 76  ? 18.016  20.453  -1.146  1.00 0.00 ? 76  GLN A HB3  2  
ATOM 3422  H HG2  . GLN A 1 76  ? 17.842  20.882  1.253   1.00 0.00 ? 76  GLN A HG2  2  
ATOM 3423  H HG3  . GLN A 1 76  ? 19.290  19.916  1.532   1.00 0.00 ? 76  GLN A HG3  2  
ATOM 3424  H HE21 . GLN A 1 76  ? 20.653  20.902  -0.850  1.00 0.00 ? 76  GLN A HE21 2  
ATOM 3425  H HE22 . GLN A 1 76  ? 21.139  22.525  -0.493  1.00 0.00 ? 76  GLN A HE22 2  
ATOM 3426  N N    . ALA A 1 77  ? 16.922  16.633  -1.568  1.00 0.00 ? 77  ALA A N    2  
ATOM 3427  C CA   . ALA A 1 77  ? 16.505  15.919  -2.774  1.00 0.00 ? 77  ALA A CA   2  
ATOM 3428  C C    . ALA A 1 77  ? 15.184  16.469  -3.309  1.00 0.00 ? 77  ALA A C    2  
ATOM 3429  O O    . ALA A 1 77  ? 14.451  17.156  -2.594  1.00 0.00 ? 77  ALA A O    2  
ATOM 3430  C CB   . ALA A 1 77  ? 16.387  14.427  -2.487  1.00 0.00 ? 77  ALA A CB   2  
ATOM 3431  H H    . ALA A 1 77  ? 16.962  16.147  -0.718  1.00 0.00 ? 77  ALA A H    2  
ATOM 3432  H HA   . ALA A 1 77  ? 17.273  16.058  -3.524  1.00 0.00 ? 77  ALA A HA   2  
ATOM 3433  H HB1  . ALA A 1 77  ? 16.116  13.905  -3.394  1.00 0.00 ? 77  ALA A HB1  2  
ATOM 3434  H HB2  . ALA A 1 77  ? 15.628  14.261  -1.735  1.00 0.00 ? 77  ALA A HB2  2  
ATOM 3435  H HB3  . ALA A 1 77  ? 17.335  14.053  -2.130  1.00 0.00 ? 77  ALA A HB3  2  
ATOM 3436  N N    . LEU A 1 78  ? 14.884  16.153  -4.567  1.00 0.00 ? 78  LEU A N    2  
ATOM 3437  C CA   . LEU A 1 78  ? 13.678  16.653  -5.233  1.00 0.00 ? 78  LEU A CA   2  
ATOM 3438  C C    . LEU A 1 78  ? 12.416  16.139  -4.539  1.00 0.00 ? 78  LEU A C    2  
ATOM 3439  O O    . LEU A 1 78  ? 11.413  16.850  -4.442  1.00 0.00 ? 78  LEU A O    2  
ATOM 3440  C CB   . LEU A 1 78  ? 13.659  16.246  -6.718  1.00 0.00 ? 78  LEU A CB   2  
ATOM 3441  C CG   . LEU A 1 78  ? 14.725  16.908  -7.616  1.00 0.00 ? 78  LEU A CG   2  
ATOM 3442  C CD1  . LEU A 1 78  ? 16.134  16.441  -7.254  1.00 0.00 ? 78  LEU A CD1  2  
ATOM 3443  C CD2  . LEU A 1 78  ? 14.426  16.632  -9.089  1.00 0.00 ? 78  LEU A CD2  2  
ATOM 3444  H H    . LEU A 1 78  ? 15.490  15.568  -5.065  1.00 0.00 ? 78  LEU A H    2  
ATOM 3445  H HA   . LEU A 1 78  ? 13.693  17.733  -5.167  1.00 0.00 ? 78  LEU A HA   2  
ATOM 3446  H HB2  . LEU A 1 78  ? 13.787  15.173  -6.776  1.00 0.00 ? 78  LEU A HB2  2  
ATOM 3447  H HB3  . LEU A 1 78  ? 12.685  16.492  -7.120  1.00 0.00 ? 78  LEU A HB3  2  
ATOM 3448  H HG   . LEU A 1 78  ? 14.689  17.978  -7.469  1.00 0.00 ? 78  LEU A HG   2  
ATOM 3449  H HD11 . LEU A 1 78  ? 16.348  16.705  -6.228  1.00 0.00 ? 78  LEU A HD11 2  
ATOM 3450  H HD12 . LEU A 1 78  ? 16.851  16.922  -7.903  1.00 0.00 ? 78  LEU A HD12 2  
ATOM 3451  H HD13 . LEU A 1 78  ? 16.203  15.369  -7.373  1.00 0.00 ? 78  LEU A HD13 2  
ATOM 3452  H HD21 . LEU A 1 78  ? 15.176  17.106  -9.704  1.00 0.00 ? 78  LEU A HD21 2  
ATOM 3453  H HD22 . LEU A 1 78  ? 13.454  17.030  -9.340  1.00 0.00 ? 78  LEU A HD22 2  
ATOM 3454  H HD23 . LEU A 1 78  ? 14.435  15.567  -9.268  1.00 0.00 ? 78  LEU A HD23 2  
ATOM 3455  N N    . SER A 1 79  ? 12.475  14.905  -4.056  1.00 0.00 ? 79  SER A N    2  
ATOM 3456  C CA   . SER A 1 79  ? 11.345  14.287  -3.374  1.00 0.00 ? 79  SER A CA   2  
ATOM 3457  C C    . SER A 1 79  ? 11.844  13.343  -2.277  1.00 0.00 ? 79  SER A C    2  
ATOM 3458  O O    . SER A 1 79  ? 11.793  12.120  -2.424  1.00 0.00 ? 79  SER A O    2  
ATOM 3459  C CB   . SER A 1 79  ? 10.475  13.540  -4.395  1.00 0.00 ? 79  SER A CB   2  
ATOM 3460  O OG   . SER A 1 79  ? 11.252  12.615  -5.146  1.00 0.00 ? 79  SER A OG   2  
ATOM 3461  H H    . SER A 1 79  ? 13.301  14.390  -4.161  1.00 0.00 ? 79  SER A H    2  
ATOM 3462  H HA   . SER A 1 79  ? 10.756  15.072  -2.916  1.00 0.00 ? 79  SER A HA   2  
ATOM 3463  H HB2  . SER A 1 79  ? 9.695   13.001  -3.880  1.00 0.00 ? 79  SER A HB2  2  
ATOM 3464  H HB3  . SER A 1 79  ? 10.029  14.252  -5.077  1.00 0.00 ? 79  SER A HB3  2  
ATOM 3465  H HG   . SER A 1 79  ? 11.671  11.990  -4.540  1.00 0.00 ? 79  SER A HG   2  
ATOM 3466  N N    . PRO A 1 80  ? 12.347  13.905  -1.160  1.00 0.00 ? 80  PRO A N    2  
ATOM 3467  C CA   . PRO A 1 80  ? 12.971  13.128  -0.084  1.00 0.00 ? 80  PRO A CA   2  
ATOM 3468  C C    . PRO A 1 80  ? 11.948  12.523  0.884   1.00 0.00 ? 80  PRO A C    2  
ATOM 3469  O O    . PRO A 1 80  ? 12.109  12.631  2.101   1.00 0.00 ? 80  PRO A O    2  
ATOM 3470  C CB   . PRO A 1 80  ? 13.840  14.180  0.614   1.00 0.00 ? 80  PRO A CB   2  
ATOM 3471  C CG   . PRO A 1 80  ? 13.075  15.454  0.462   1.00 0.00 ? 80  PRO A CG   2  
ATOM 3472  C CD   . PRO A 1 80  ? 12.337  15.353  -0.853  1.00 0.00 ? 80  PRO A CD   2  
ATOM 3473  H HA   . PRO A 1 80  ? 13.602  12.343  -0.478  1.00 0.00 ? 80  PRO A HA   2  
ATOM 3474  H HB2  . PRO A 1 80  ? 13.974  13.915  1.654   1.00 0.00 ? 80  PRO A HB2  2  
ATOM 3475  H HB3  . PRO A 1 80  ? 14.804  14.239  0.126   1.00 0.00 ? 80  PRO A HB3  2  
ATOM 3476  H HG2  . PRO A 1 80  ? 12.374  15.560  1.279   1.00 0.00 ? 80  PRO A HG2  2  
ATOM 3477  H HG3  . PRO A 1 80  ? 13.757  16.292  0.444   1.00 0.00 ? 80  PRO A HG3  2  
ATOM 3478  H HD2  . PRO A 1 80  ? 11.323  15.715  -0.746  1.00 0.00 ? 80  PRO A HD2  2  
ATOM 3479  H HD3  . PRO A 1 80  ? 12.854  15.910  -1.621  1.00 0.00 ? 80  PRO A HD3  2  
ATOM 3480  N N    . VAL A 1 81  ? 10.934  11.848  0.317   1.00 0.00 ? 81  VAL A N    2  
ATOM 3481  C CA   . VAL A 1 81  ? 9.808   11.264  1.075   1.00 0.00 ? 81  VAL A CA   2  
ATOM 3482  C C    . VAL A 1 81  ? 9.544   11.987  2.404   1.00 0.00 ? 81  VAL A C    2  
ATOM 3483  O O    . VAL A 1 81  ? 8.822   12.989  2.436   1.00 0.00 ? 81  VAL A O    2  
ATOM 3484  C CB   . VAL A 1 81  ? 9.977   9.727   1.304   1.00 0.00 ? 81  VAL A CB   2  
ATOM 3485  C CG1  . VAL A 1 81  ? 9.403   8.940   0.128   1.00 0.00 ? 81  VAL A CG1  2  
ATOM 3486  C CG2  . VAL A 1 81  ? 11.446  9.347   1.513   1.00 0.00 ? 81  VAL A CG2  2  
ATOM 3487  H H    . VAL A 1 81  ? 10.953  11.722  -0.654  1.00 0.00 ? 81  VAL A H    2  
ATOM 3488  H HA   . VAL A 1 81  ? 8.928   11.401  0.459   1.00 0.00 ? 81  VAL A HA   2  
ATOM 3489  H HB   . VAL A 1 81  ? 9.425   9.448   2.192   1.00 0.00 ? 81  VAL A HB   2  
ATOM 3490  H HG11 . VAL A 1 81  ? 9.498   7.881   0.322   1.00 0.00 ? 81  VAL A HG11 2  
ATOM 3491  H HG12 . VAL A 1 81  ? 9.943   9.191   -0.774  1.00 0.00 ? 81  VAL A HG12 2  
ATOM 3492  H HG13 . VAL A 1 81  ? 8.359   9.189   0.002   1.00 0.00 ? 81  VAL A HG13 2  
ATOM 3493  H HG21 . VAL A 1 81  ? 12.007  9.580   0.619   1.00 0.00 ? 81  VAL A HG21 2  
ATOM 3494  H HG22 . VAL A 1 81  ? 11.522  8.288   1.719   1.00 0.00 ? 81  VAL A HG22 2  
ATOM 3495  H HG23 . VAL A 1 81  ? 11.850  9.903   2.345   1.00 0.00 ? 81  VAL A HG23 2  
ATOM 3496  N N    . ASN A 1 82  ? 10.148  11.485  3.482   1.00 0.00 ? 82  ASN A N    2  
ATOM 3497  C CA   . ASN A 1 82  ? 10.084  12.110  4.801   1.00 0.00 ? 82  ASN A CA   2  
ATOM 3498  C C    . ASN A 1 82  ? 10.860  11.245  5.792   1.00 0.00 ? 82  ASN A C    2  
ATOM 3499  O O    . ASN A 1 82  ? 12.019  11.526  6.086   1.00 0.00 ? 82  ASN A O    2  
ATOM 3500  C CB   . ASN A 1 82  ? 8.631   12.301  5.274   1.00 0.00 ? 82  ASN A CB   2  
ATOM 3501  C CG   . ASN A 1 82  ? 8.527   13.124  6.550   1.00 0.00 ? 82  ASN A CG   2  
ATOM 3502  O OD1  . ASN A 1 82  ? 7.679   12.860  7.402   1.00 0.00 ? 82  ASN A OD1  2  
ATOM 3503  N ND2  . ASN A 1 82  ? 9.367   14.144  6.683   1.00 0.00 ? 82  ASN A ND2  2  
ATOM 3504  H H    . ASN A 1 82  ? 10.668  10.665  3.387   1.00 0.00 ? 82  ASN A H    2  
ATOM 3505  H HA   . ASN A 1 82  ? 10.566  13.076  4.730   1.00 0.00 ? 82  ASN A HA   2  
ATOM 3506  H HB2  . ASN A 1 82  ? 8.072   12.809  4.501   1.00 0.00 ? 82  ASN A HB2  2  
ATOM 3507  H HB3  . ASN A 1 82  ? 8.185   11.333  5.452   1.00 0.00 ? 82  ASN A HB3  2  
ATOM 3508  H HD21 . ASN A 1 82  ? 10.007  14.319  5.960   1.00 0.00 ? 82  ASN A HD21 2  
ATOM 3509  H HD22 . ASN A 1 82  ? 9.310   14.689  7.497   1.00 0.00 ? 82  ASN A HD22 2  
ATOM 3510  N N    . ILE A 1 83  ? 10.212  10.164  6.253   1.00 0.00 ? 83  ILE A N    2  
ATOM 3511  C CA   . ILE A 1 83  ? 10.809  9.153   7.149   1.00 0.00 ? 83  ILE A CA   2  
ATOM 3512  C C    . ILE A 1 83  ? 11.721  9.750   8.238   1.00 0.00 ? 83  ILE A C    2  
ATOM 3513  O O    . ILE A 1 83  ? 11.626  10.931  8.572   1.00 0.00 ? 83  ILE A O    2  
ATOM 3514  C CB   . ILE A 1 83  ? 11.564  8.046   6.352   1.00 0.00 ? 83  ILE A CB   2  
ATOM 3515  C CG1  . ILE A 1 83  ? 12.725  8.626   5.524   1.00 0.00 ? 83  ILE A CG1  2  
ATOM 3516  C CG2  . ILE A 1 83  ? 10.591  7.286   5.452   1.00 0.00 ? 83  ILE A CG2  2  
ATOM 3517  C CD1  . ILE A 1 83  ? 13.444  7.595   4.683   1.00 0.00 ? 83  ILE A CD1  2  
ATOM 3518  H H    . ILE A 1 83  ? 9.283   10.034  5.977   1.00 0.00 ? 83  ILE A H    2  
ATOM 3519  H HA   . ILE A 1 83  ? 9.981   8.672   7.654   1.00 0.00 ? 83  ILE A HA   2  
ATOM 3520  H HB   . ILE A 1 83  ? 11.964  7.339   7.067   1.00 0.00 ? 83  ILE A HB   2  
ATOM 3521  H HG12 . ILE A 1 83  ? 12.343  9.385   4.857   1.00 0.00 ? 83  ILE A HG12 2  
ATOM 3522  H HG13 . ILE A 1 83  ? 13.448  9.073   6.192   1.00 0.00 ? 83  ILE A HG13 2  
ATOM 3523  H HG21 . ILE A 1 83  ? 9.804   6.854   6.054   1.00 0.00 ? 83  ILE A HG21 2  
ATOM 3524  H HG22 . ILE A 1 83  ? 11.116  6.499   4.932   1.00 0.00 ? 83  ILE A HG22 2  
ATOM 3525  H HG23 . ILE A 1 83  ? 10.157  7.966   4.732   1.00 0.00 ? 83  ILE A HG23 2  
ATOM 3526  H HD11 . ILE A 1 83  ? 12.745  7.136   3.996   1.00 0.00 ? 83  ILE A HD11 2  
ATOM 3527  H HD12 . ILE A 1 83  ? 13.868  6.837   5.324   1.00 0.00 ? 83  ILE A HD12 2  
ATOM 3528  H HD13 . ILE A 1 83  ? 14.232  8.076   4.124   1.00 0.00 ? 83  ILE A HD13 2  
ATOM 3529  N N    . ASP A 1 84  ? 12.571  8.898   8.814   1.00 0.00 ? 84  ASP A N    2  
ATOM 3530  C CA   . ASP A 1 84  ? 13.427  9.267   9.945   1.00 0.00 ? 84  ASP A CA   2  
ATOM 3531  C C    . ASP A 1 84  ? 14.394  10.401  9.601   1.00 0.00 ? 84  ASP A C    2  
ATOM 3532  O O    . ASP A 1 84  ? 14.523  11.360  10.361  1.00 0.00 ? 84  ASP A O    2  
ATOM 3533  C CB   . ASP A 1 84  ? 14.225  8.041   10.410  1.00 0.00 ? 84  ASP A CB   2  
ATOM 3534  C CG   . ASP A 1 84  ? 13.332  6.863   10.764  1.00 0.00 ? 84  ASP A CG   2  
ATOM 3535  O OD1  . ASP A 1 84  ? 12.935  6.118   9.837   1.00 0.00 ? 84  ASP A OD1  2  
ATOM 3536  O OD2  . ASP A 1 84  ? 13.021  6.682   11.962  1.00 0.00 ? 84  ASP A OD2  2  
ATOM 3537  H H    . ASP A 1 84  ? 12.615  7.978   8.478   1.00 0.00 ? 84  ASP A H    2  
ATOM 3538  H HA   . ASP A 1 84  ? 12.784  9.589   10.752  1.00 0.00 ? 84  ASP A HA   2  
ATOM 3539  H HB2  . ASP A 1 84  ? 14.897  7.735   9.620   1.00 0.00 ? 84  ASP A HB2  2  
ATOM 3540  H HB3  . ASP A 1 84  ? 14.806  8.307   11.283  1.00 0.00 ? 84  ASP A HB3  2  
ATOM 3541  N N    . ARG A 1 85  ? 15.074  10.272  8.459   1.00 0.00 ? 85  ARG A N    2  
ATOM 3542  C CA   . ARG A 1 85  ? 16.120  11.219  8.047   1.00 0.00 ? 85  ARG A CA   2  
ATOM 3543  C C    . ARG A 1 85  ? 17.293  11.217  9.033   1.00 0.00 ? 85  ARG A C    2  
ATOM 3544  O O    . ARG A 1 85  ? 18.338  10.631  8.756   1.00 0.00 ? 85  ARG A O    2  
ATOM 3545  C CB   . ARG A 1 85  ? 15.565  12.646  7.883   1.00 0.00 ? 85  ARG A CB   2  
ATOM 3546  C CG   . ARG A 1 85  ? 14.791  12.876  6.588   1.00 0.00 ? 85  ARG A CG   2  
ATOM 3547  C CD   . ARG A 1 85  ? 15.653  12.592  5.360   1.00 0.00 ? 85  ARG A CD   2  
ATOM 3548  N NE   . ARG A 1 85  ? 16.952  13.272  5.427   1.00 0.00 ? 85  ARG A NE   2  
ATOM 3549  C CZ   . ARG A 1 85  ? 17.985  13.010  4.622   1.00 0.00 ? 85  ARG A CZ   2  
ATOM 3550  N NH1  . ARG A 1 85  ? 17.872  12.115  3.646   1.00 0.00 ? 85  ARG A NH1  2  
ATOM 3551  N NH2  . ARG A 1 85  ? 19.132  13.651  4.791   1.00 0.00 ? 85  ARG A NH2  2  
ATOM 3552  H H    . ARG A 1 85  ? 14.866  9.518   7.872   1.00 0.00 ? 85  ARG A H    2  
ATOM 3553  H HA   . ARG A 1 85  ? 16.490  10.882  7.087   1.00 0.00 ? 85  ARG A HA   2  
ATOM 3554  H HB2  . ARG A 1 85  ? 14.905  12.855  8.711   1.00 0.00 ? 85  ARG A HB2  2  
ATOM 3555  H HB3  . ARG A 1 85  ? 16.389  13.347  7.910   1.00 0.00 ? 85  ARG A HB3  2  
ATOM 3556  H HG2  . ARG A 1 85  ? 13.931  12.221  6.571   1.00 0.00 ? 85  ARG A HG2  2  
ATOM 3557  H HG3  . ARG A 1 85  ? 14.459  13.905  6.555   1.00 0.00 ? 85  ARG A HG3  2  
ATOM 3558  H HD2  . ARG A 1 85  ? 15.818  11.526  5.292   1.00 0.00 ? 85  ARG A HD2  2  
ATOM 3559  H HD3  . ARG A 1 85  ? 15.125  12.930  4.480   1.00 0.00 ? 85  ARG A HD3  2  
ATOM 3560  H HE   . ARG A 1 85  ? 17.066  13.954  6.129   1.00 0.00 ? 85  ARG A HE   2  
ATOM 3561  H HH11 . ARG A 1 85  ? 17.010  11.630  3.506   1.00 0.00 ? 85  ARG A HH11 2  
ATOM 3562  H HH12 . ARG A 1 85  ? 18.656  11.922  3.044   1.00 0.00 ? 85  ARG A HH12 2  
ATOM 3563  H HH21 . ARG A 1 85  ? 19.224  14.333  5.524   1.00 0.00 ? 85  ARG A HH21 2  
ATOM 3564  H HH22 . ARG A 1 85  ? 19.916  13.451  4.196   1.00 0.00 ? 85  ARG A HH22 2  
ATOM 3565  N N    . GLN A 1 86  ? 17.106  11.854  10.186  1.00 0.00 ? 86  GLN A N    2  
ATOM 3566  C CA   . GLN A 1 86  ? 18.165  11.966  11.191  1.00 0.00 ? 86  GLN A CA   2  
ATOM 3567  C C    . GLN A 1 86  ? 18.559  10.583  11.707  1.00 0.00 ? 86  GLN A C    2  
ATOM 3568  O O    . GLN A 1 86  ? 19.742  10.262  11.837  1.00 0.00 ? 86  GLN A O    2  
ATOM 3569  C CB   . GLN A 1 86  ? 17.699  12.847  12.359  1.00 0.00 ? 86  GLN A CB   2  
ATOM 3570  C CG   . GLN A 1 86  ? 17.209  14.229  11.935  1.00 0.00 ? 86  GLN A CG   2  
ATOM 3571  C CD   . GLN A 1 86  ? 18.271  15.046  11.213  1.00 0.00 ? 86  GLN A CD   2  
ATOM 3572  O OE1  . GLN A 1 86  ? 19.468  14.911  11.473  1.00 0.00 ? 86  GLN A OE1  2  
ATOM 3573  N NE2  . GLN A 1 86  ? 17.838  15.899  10.298  1.00 0.00 ? 86  GLN A NE2  2  
ATOM 3574  H H    . GLN A 1 86  ? 16.229  12.256  10.370  1.00 0.00 ? 86  GLN A H    2  
ATOM 3575  H HA   . GLN A 1 86  ? 19.024  12.426  10.721  1.00 0.00 ? 86  GLN A HA   2  
ATOM 3576  H HB2  . GLN A 1 86  ? 16.890  12.346  12.872  1.00 0.00 ? 86  GLN A HB2  2  
ATOM 3577  H HB3  . GLN A 1 86  ? 18.523  12.976  13.048  1.00 0.00 ? 86  GLN A HB3  2  
ATOM 3578  H HG2  . GLN A 1 86  ? 16.361  14.109  11.276  1.00 0.00 ? 86  GLN A HG2  2  
ATOM 3579  H HG3  . GLN A 1 86  ? 16.900  14.770  12.817  1.00 0.00 ? 86  GLN A HG3  2  
ATOM 3580  H HE21 . GLN A 1 86  ? 16.871  15.956  10.138  1.00 0.00 ? 86  GLN A HE21 2  
ATOM 3581  H HE22 . GLN A 1 86  ? 18.500  16.443  9.820   1.00 0.00 ? 86  GLN A HE22 2  
ATOM 3582  N N    . ALA A 1 87  ? 17.550  9.762   11.972  1.00 0.00 ? 87  ALA A N    2  
ATOM 3583  C CA   . ALA A 1 87  ? 17.758  8.418   12.505  1.00 0.00 ? 87  ALA A CA   2  
ATOM 3584  C C    . ALA A 1 87  ? 17.891  7.389   11.382  1.00 0.00 ? 87  ALA A C    2  
ATOM 3585  O O    . ALA A 1 87  ? 17.747  6.184   11.611  1.00 0.00 ? 87  ALA A O    2  
ATOM 3586  C CB   . ALA A 1 87  ? 16.608  8.048   13.433  1.00 0.00 ? 87  ALA A CB   2  
ATOM 3587  H H    . ALA A 1 87  ? 16.634  10.070  11.808  1.00 0.00 ? 87  ALA A H    2  
ATOM 3588  H HA   . ALA A 1 87  ? 18.671  8.421   13.085  1.00 0.00 ? 87  ALA A HA   2  
ATOM 3589  H HB1  . ALA A 1 87  ? 16.524  8.786   14.217  1.00 0.00 ? 87  ALA A HB1  2  
ATOM 3590  H HB2  . ALA A 1 87  ? 16.793  7.078   13.872  1.00 0.00 ? 87  ALA A HB2  2  
ATOM 3591  H HB3  . ALA A 1 87  ? 15.684  8.016   12.870  1.00 0.00 ? 87  ALA A HB3  2  
ATOM 3592  N N    . TRP A 1 88  ? 18.187  7.862   10.174  1.00 0.00 ? 88  TRP A N    2  
ATOM 3593  C CA   . TRP A 1 88  ? 18.279  6.986   9.012   1.00 0.00 ? 88  TRP A CA   2  
ATOM 3594  C C    . TRP A 1 88  ? 19.596  6.200   9.030   1.00 0.00 ? 88  TRP A C    2  
ATOM 3595  O O    . TRP A 1 88  ? 20.497  6.502   9.821   1.00 0.00 ? 88  TRP A O    2  
ATOM 3596  C CB   . TRP A 1 88  ? 18.142  7.804   7.717   1.00 0.00 ? 88  TRP A CB   2  
ATOM 3597  C CG   . TRP A 1 88  ? 17.805  6.963   6.521   1.00 0.00 ? 88  TRP A CG   2  
ATOM 3598  C CD1  . TRP A 1 88  ? 16.625  6.318   6.291   1.00 0.00 ? 88  TRP A CD1  2  
ATOM 3599  C CD2  . TRP A 1 88  ? 18.647  6.672   5.399   1.00 0.00 ? 88  TRP A CD2  2  
ATOM 3600  N NE1  . TRP A 1 88  ? 16.686  5.635   5.103   1.00 0.00 ? 88  TRP A NE1  2  
ATOM 3601  C CE2  . TRP A 1 88  ? 17.914  5.839   4.537   1.00 0.00 ? 88  TRP A CE2  2  
ATOM 3602  C CE3  . TRP A 1 88  ? 19.949  7.033   5.040   1.00 0.00 ? 88  TRP A CE3  2  
ATOM 3603  C CZ2  . TRP A 1 88  ? 18.438  5.359   3.344   1.00 0.00 ? 88  TRP A CZ2  2  
ATOM 3604  C CZ3  . TRP A 1 88  ? 20.468  6.556   3.851   1.00 0.00 ? 88  TRP A CZ3  2  
ATOM 3605  C CH2  . TRP A 1 88  ? 19.712  5.726   3.016   1.00 0.00 ? 88  TRP A CH2  2  
ATOM 3606  H H    . TRP A 1 88  ? 18.358  8.822   10.064  1.00 0.00 ? 88  TRP A H    2  
ATOM 3607  H HA   . TRP A 1 88  ? 17.460  6.282   9.068   1.00 0.00 ? 88  TRP A HA   2  
ATOM 3608  H HB2  . TRP A 1 88  ? 17.358  8.539   7.843   1.00 0.00 ? 88  TRP A HB2  2  
ATOM 3609  H HB3  . TRP A 1 88  ? 19.076  8.313   7.519   1.00 0.00 ? 88  TRP A HB3  2  
ATOM 3610  H HD1  . TRP A 1 88  ? 15.777  6.342   6.959   1.00 0.00 ? 88  TRP A HD1  2  
ATOM 3611  H HE1  . TRP A 1 88  ? 15.965  5.092   4.720   1.00 0.00 ? 88  TRP A HE1  2  
ATOM 3612  H HE3  . TRP A 1 88  ? 20.545  7.673   5.674   1.00 0.00 ? 88  TRP A HE3  2  
ATOM 3613  H HZ2  . TRP A 1 88  ? 17.867  4.718   2.687   1.00 0.00 ? 88  TRP A HZ2  2  
ATOM 3614  H HZ3  . TRP A 1 88  ? 21.473  6.820   3.557   1.00 0.00 ? 88  TRP A HZ3  2  
ATOM 3615  H HH2  . TRP A 1 88  ? 20.157  5.372   2.098   1.00 0.00 ? 88  TRP A HH2  2  
ATOM 3616  N N    . LEU A 1 89  ? 19.701  5.203   8.146   1.00 0.00 ? 89  LEU A N    2  
ATOM 3617  C CA   . LEU A 1 89  ? 20.847  4.290   8.122   1.00 0.00 ? 89  LEU A CA   2  
ATOM 3618  C C    . LEU A 1 89  ? 22.146  5.051   7.867   1.00 0.00 ? 89  LEU A C    2  
ATOM 3619  O O    . LEU A 1 89  ? 23.037  5.087   8.721   1.00 0.00 ? 89  LEU A O    2  
ATOM 3620  C CB   . LEU A 1 89  ? 20.663  3.194   7.051   1.00 0.00 ? 89  LEU A CB   2  
ATOM 3621  C CG   . LEU A 1 89  ? 19.544  2.163   7.319   1.00 0.00 ? 89  LEU A CG   2  
ATOM 3622  C CD1  . LEU A 1 89  ? 18.160  2.804   7.226   1.00 0.00 ? 89  LEU A CD1  2  
ATOM 3623  C CD2  . LEU A 1 89  ? 19.660  0.983   6.353   1.00 0.00 ? 89  LEU A CD2  2  
ATOM 3624  H H    . LEU A 1 89  ? 18.995  5.089   7.479   1.00 0.00 ? 89  LEU A H    2  
ATOM 3625  H HA   . LEU A 1 89  ? 20.909  3.819   9.093   1.00 0.00 ? 89  LEU A HA   2  
ATOM 3626  H HB2  . LEU A 1 89  ? 20.457  3.677   6.106   1.00 0.00 ? 89  LEU A HB2  2  
ATOM 3627  H HB3  . LEU A 1 89  ? 21.597  2.655   6.960   1.00 0.00 ? 89  LEU A HB3  2  
ATOM 3628  H HG   . LEU A 1 89  ? 19.659  1.780   8.323   1.00 0.00 ? 89  LEU A HG   2  
ATOM 3629  H HD11 . LEU A 1 89  ? 17.401  2.057   7.411   1.00 0.00 ? 89  LEU A HD11 2  
ATOM 3630  H HD12 . LEU A 1 89  ? 18.018  3.222   6.239   1.00 0.00 ? 89  LEU A HD12 2  
ATOM 3631  H HD13 . LEU A 1 89  ? 18.076  3.591   7.962   1.00 0.00 ? 89  LEU A HD13 2  
ATOM 3632  H HD21 . LEU A 1 89  ? 20.623  0.506   6.480   1.00 0.00 ? 89  LEU A HD21 2  
ATOM 3633  H HD22 . LEU A 1 89  ? 19.567  1.334   5.335   1.00 0.00 ? 89  LEU A HD22 2  
ATOM 3634  H HD23 . LEU A 1 89  ? 18.877  0.268   6.560   1.00 0.00 ? 89  LEU A HD23 2  
ATOM 3635  N N    . GLY A 1 90  ? 22.252  5.644   6.684   1.00 0.00 ? 90  GLY A N    2  
ATOM 3636  C CA   . GLY A 1 90  ? 23.418  6.437   6.335   1.00 0.00 ? 90  GLY A CA   2  
ATOM 3637  C C    . GLY A 1 90  ? 24.026  6.019   5.013   1.00 0.00 ? 90  GLY A C    2  
ATOM 3638  O O    . GLY A 1 90  ? 23.570  5.059   4.390   1.00 0.00 ? 90  GLY A O    2  
ATOM 3639  H H    . GLY A 1 90  ? 21.534  5.534   6.030   1.00 0.00 ? 90  GLY A H    2  
ATOM 3640  H HA2  . GLY A 1 90  ? 23.126  7.474   6.271   1.00 0.00 ? 90  GLY A HA2  2  
ATOM 3641  H HA3  . GLY A 1 90  ? 24.165  6.331   7.110   1.00 0.00 ? 90  GLY A HA3  2  
ATOM 3642  N N    . GLU A 1 91  ? 25.069  6.736   4.596   1.00 0.00 ? 91  GLU A N    2  
ATOM 3643  C CA   . GLU A 1 91  ? 25.761  6.475   3.329   1.00 0.00 ? 91  GLU A CA   2  
ATOM 3644  C C    . GLU A 1 91  ? 26.275  5.035   3.240   1.00 0.00 ? 91  GLU A C    2  
ATOM 3645  O O    . GLU A 1 91  ? 26.591  4.549   2.150   1.00 0.00 ? 91  GLU A O    2  
ATOM 3646  C CB   . GLU A 1 91  ? 26.942  7.441   3.169   1.00 0.00 ? 91  GLU A CB   2  
ATOM 3647  C CG   . GLU A 1 91  ? 28.001  7.290   4.256   1.00 0.00 ? 91  GLU A CG   2  
ATOM 3648  C CD   . GLU A 1 91  ? 29.214  8.175   4.026   1.00 0.00 ? 91  GLU A CD   2  
ATOM 3649  O OE1  . GLU A 1 91  ? 29.216  9.326   4.505   1.00 0.00 ? 91  GLU A OE1  2  
ATOM 3650  O OE2  . GLU A 1 91  ? 30.171  7.723   3.360   1.00 0.00 ? 91  GLU A OE2  2  
ATOM 3651  H H    . GLU A 1 91  ? 25.377  7.482   5.154   1.00 0.00 ? 91  GLU A H    2  
ATOM 3652  H HA   . GLU A 1 91  ? 25.058  6.646   2.526   1.00 0.00 ? 91  GLU A HA   2  
ATOM 3653  H HB2  . GLU A 1 91  ? 27.410  7.266   2.210   1.00 0.00 ? 91  GLU A HB2  2  
ATOM 3654  H HB3  . GLU A 1 91  ? 26.570  8.457   3.196   1.00 0.00 ? 91  GLU A HB3  2  
ATOM 3655  H HG2  . GLU A 1 91  ? 27.559  7.550   5.208   1.00 0.00 ? 91  GLU A HG2  2  
ATOM 3656  H HG3  . GLU A 1 91  ? 28.323  6.258   4.285   1.00 0.00 ? 91  GLU A HG3  2  
ATOM 3657  N N    . GLU A 1 92  ? 26.345  4.349   4.381   1.00 0.00 ? 92  GLU A N    2  
ATOM 3658  C CA   . GLU A 1 92  ? 26.914  3.012   4.436   1.00 0.00 ? 92  GLU A CA   2  
ATOM 3659  C C    . GLU A 1 92  ? 26.115  2.062   3.560   1.00 0.00 ? 92  GLU A C    2  
ATOM 3660  O O    . GLU A 1 92  ? 26.662  1.129   2.994   1.00 0.00 ? 92  GLU A O    2  
ATOM 3661  C CB   . GLU A 1 92  ? 26.942  2.479   5.873   1.00 0.00 ? 92  GLU A CB   2  
ATOM 3662  C CG   . GLU A 1 92  ? 25.561  2.316   6.505   1.00 0.00 ? 92  GLU A CG   2  
ATOM 3663  C CD   . GLU A 1 92  ? 25.599  1.493   7.781   1.00 0.00 ? 92  GLU A CD   2  
ATOM 3664  O OE1  . GLU A 1 92  ? 25.474  0.251   7.695   1.00 0.00 ? 92  GLU A OE1  2  
ATOM 3665  O OE2  . GLU A 1 92  ? 25.755  2.080   8.875   1.00 0.00 ? 92  GLU A OE2  2  
ATOM 3666  H H    . GLU A 1 92  ? 25.987  4.742   5.196   1.00 0.00 ? 92  GLU A H    2  
ATOM 3667  H HA   . GLU A 1 92  ? 27.926  3.066   4.061   1.00 0.00 ? 92  GLU A HA   2  
ATOM 3668  H HB2  . GLU A 1 92  ? 27.432  1.515   5.876   1.00 0.00 ? 92  GLU A HB2  2  
ATOM 3669  H HB3  . GLU A 1 92  ? 27.515  3.162   6.484   1.00 0.00 ? 92  GLU A HB3  2  
ATOM 3670  H HG2  . GLU A 1 92  ? 25.166  3.295   6.735   1.00 0.00 ? 92  GLU A HG2  2  
ATOM 3671  H HG3  . GLU A 1 92  ? 24.909  1.826   5.795   1.00 0.00 ? 92  GLU A HG3  2  
ATOM 3672  N N    . VAL A 1 93  ? 24.818  2.319   3.436   1.00 0.00 ? 93  VAL A N    2  
ATOM 3673  C CA   . VAL A 1 93  ? 23.941  1.423   2.698   1.00 0.00 ? 93  VAL A CA   2  
ATOM 3674  C C    . VAL A 1 93  ? 24.215  1.503   1.190   1.00 0.00 ? 93  VAL A C    2  
ATOM 3675  O O    . VAL A 1 93  ? 23.833  0.612   0.430   1.00 0.00 ? 93  VAL A O    2  
ATOM 3676  C CB   . VAL A 1 93  ? 22.446  1.704   3.002   1.00 0.00 ? 93  VAL A CB   2  
ATOM 3677  C CG1  . VAL A 1 93  ? 22.029  3.079   2.490   1.00 0.00 ? 93  VAL A CG1  2  
ATOM 3678  C CG2  . VAL A 1 93  ? 21.550  0.606   2.425   1.00 0.00 ? 93  VAL A CG2  2  
ATOM 3679  H H    . VAL A 1 93  ? 24.445  3.129   3.848   1.00 0.00 ? 93  VAL A H    2  
ATOM 3680  H HA   . VAL A 1 93  ? 24.166  0.422   3.034   1.00 0.00 ? 93  VAL A HA   2  
ATOM 3681  H HB   . VAL A 1 93  ? 22.321  1.704   4.078   1.00 0.00 ? 93  VAL A HB   2  
ATOM 3682  H HG11 . VAL A 1 93  ? 22.104  3.101   1.412   1.00 0.00 ? 93  VAL A HG11 2  
ATOM 3683  H HG12 . VAL A 1 93  ? 22.680  3.833   2.908   1.00 0.00 ? 93  VAL A HG12 2  
ATOM 3684  H HG13 . VAL A 1 93  ? 21.010  3.281   2.784   1.00 0.00 ? 93  VAL A HG13 2  
ATOM 3685  H HG21 . VAL A 1 93  ? 20.520  0.809   2.680   1.00 0.00 ? 93  VAL A HG21 2  
ATOM 3686  H HG22 . VAL A 1 93  ? 21.840  -0.350  2.838   1.00 0.00 ? 93  VAL A HG22 2  
ATOM 3687  H HG23 . VAL A 1 93  ? 21.657  0.580   1.352   1.00 0.00 ? 93  VAL A HG23 2  
ATOM 3688  N N    . LEU A 1 94  ? 24.891  2.573   0.768   1.00 0.00 ? 94  LEU A N    2  
ATOM 3689  C CA   . LEU A 1 94  ? 25.313  2.720   -0.624  1.00 0.00 ? 94  LEU A CA   2  
ATOM 3690  C C    . LEU A 1 94  ? 26.689  2.086   -0.817  1.00 0.00 ? 94  LEU A C    2  
ATOM 3691  O O    . LEU A 1 94  ? 26.946  1.413   -1.816  1.00 0.00 ? 94  LEU A O    2  
ATOM 3692  C CB   . LEU A 1 94  ? 25.367  4.203   -1.045  1.00 0.00 ? 94  LEU A CB   2  
ATOM 3693  C CG   . LEU A 1 94  ? 24.032  4.974   -1.018  1.00 0.00 ? 94  LEU A CG   2  
ATOM 3694  C CD1  . LEU A 1 94  ? 22.924  4.176   -1.700  1.00 0.00 ? 94  LEU A CD1  2  
ATOM 3695  C CD2  . LEU A 1 94  ? 23.639  5.355   0.407   1.00 0.00 ? 94  LEU A CD2  2  
ATOM 3696  H H    . LEU A 1 94  ? 25.116  3.277   1.410   1.00 0.00 ? 94  LEU A H    2  
ATOM 3697  H HA   . LEU A 1 94  ? 24.599  2.200   -1.250  1.00 0.00 ? 94  LEU A HA   2  
ATOM 3698  H HB2  . LEU A 1 94  ? 26.063  4.712   -0.391  1.00 0.00 ? 94  LEU A HB2  2  
ATOM 3699  H HB3  . LEU A 1 94  ? 25.758  4.251   -2.052  1.00 0.00 ? 94  LEU A HB3  2  
ATOM 3700  H HG   . LEU A 1 94  ? 24.156  5.892   -1.576  1.00 0.00 ? 94  LEU A HG   2  
ATOM 3701  H HD11 . LEU A 1 94  ? 22.771  3.244   -1.173  1.00 0.00 ? 94  LEU A HD11 2  
ATOM 3702  H HD12 . LEU A 1 94  ? 23.207  3.968   -2.721  1.00 0.00 ? 94  LEU A HD12 2  
ATOM 3703  H HD13 . LEU A 1 94  ? 22.009  4.749   -1.691  1.00 0.00 ? 94  LEU A HD13 2  
ATOM 3704  H HD21 . LEU A 1 94  ? 22.696  5.881   0.391   1.00 0.00 ? 94  LEU A HD21 2  
ATOM 3705  H HD22 . LEU A 1 94  ? 24.400  5.995   0.831   1.00 0.00 ? 94  LEU A HD22 2  
ATOM 3706  H HD23 . LEU A 1 94  ? 23.543  4.462   1.007   1.00 0.00 ? 94  LEU A HD23 2  
ATOM 3707  N N    . ALA A 1 95  ? 27.568  2.313   0.157   1.00 0.00 ? 95  ALA A N    2  
ATOM 3708  C CA   . ALA A 1 95  ? 28.929  1.783   0.118   1.00 0.00 ? 95  ALA A CA   2  
ATOM 3709  C C    . ALA A 1 95  ? 28.930  0.264   0.295   1.00 0.00 ? 95  ALA A C    2  
ATOM 3710  O O    . ALA A 1 95  ? 29.774  -0.439  -0.264  1.00 0.00 ? 95  ALA A O    2  
ATOM 3711  C CB   . ALA A 1 95  ? 29.778  2.446   1.195   1.00 0.00 ? 95  ALA A CB   2  
ATOM 3712  H H    . ALA A 1 95  ? 27.294  2.858   0.925   1.00 0.00 ? 95  ALA A H    2  
ATOM 3713  H HA   . ALA A 1 95  ? 29.355  2.025   -0.846  1.00 0.00 ? 95  ALA A HA   2  
ATOM 3714  H HB1  . ALA A 1 95  ? 30.797  2.092   1.120   1.00 0.00 ? 95  ALA A HB1  2  
ATOM 3715  H HB2  . ALA A 1 95  ? 29.382  2.199   2.169   1.00 0.00 ? 95  ALA A HB2  2  
ATOM 3716  H HB3  . ALA A 1 95  ? 29.759  3.517   1.060   1.00 0.00 ? 95  ALA A HB3  2  
ATOM 3717  N N    . GLU A 1 96  ? 27.980  -0.229  1.082   1.00 0.00 ? 96  GLU A N    2  
ATOM 3718  C CA   . GLU A 1 96  ? 27.817  -1.659  1.321   1.00 0.00 ? 96  GLU A CA   2  
ATOM 3719  C C    . GLU A 1 96  ? 26.326  -2.015  1.343   1.00 0.00 ? 96  GLU A C    2  
ATOM 3720  O O    . GLU A 1 96  ? 25.670  -1.971  2.393   1.00 0.00 ? 96  GLU A O    2  
ATOM 3721  C CB   . GLU A 1 96  ? 28.511  -2.086  2.632   1.00 0.00 ? 96  GLU A CB   2  
ATOM 3722  C CG   . GLU A 1 96  ? 28.101  -1.272  3.859   1.00 0.00 ? 96  GLU A CG   2  
ATOM 3723  C CD   . GLU A 1 96  ? 28.765  -1.746  5.141   1.00 0.00 ? 96  GLU A CD   2  
ATOM 3724  O OE1  . GLU A 1 96  ? 29.899  -1.307  5.425   1.00 0.00 ? 96  GLU A OE1  2  
ATOM 3725  O OE2  . GLU A 1 96  ? 28.154  -2.557  5.875   1.00 0.00 ? 96  GLU A OE2  2  
ATOM 3726  H H    . GLU A 1 96  ? 27.358  0.391   1.509   1.00 0.00 ? 96  GLU A H    2  
ATOM 3727  H HA   . GLU A 1 96  ? 28.281  -2.185  0.496   1.00 0.00 ? 96  GLU A HA   2  
ATOM 3728  H HB2  . GLU A 1 96  ? 28.282  -3.125  2.826   1.00 0.00 ? 96  GLU A HB2  2  
ATOM 3729  H HB3  . GLU A 1 96  ? 29.581  -1.987  2.504   1.00 0.00 ? 96  GLU A HB3  2  
ATOM 3730  H HG2  . GLU A 1 96  ? 28.374  -0.239  3.694   1.00 0.00 ? 96  GLU A HG2  2  
ATOM 3731  H HG3  . GLU A 1 96  ? 27.028  -1.340  3.978   1.00 0.00 ? 96  GLU A HG3  2  
ATOM 3732  N N    . PRO A 1 97  ? 25.755  -2.335  0.165   1.00 0.00 ? 97  PRO A N    2  
ATOM 3733  C CA   . PRO A 1 97  ? 24.343  -2.703  0.051   1.00 0.00 ? 97  PRO A CA   2  
ATOM 3734  C C    . PRO A 1 97  ? 24.085  -4.084  0.646   1.00 0.00 ? 97  PRO A C    2  
ATOM 3735  O O    . PRO A 1 97  ? 25.028  -4.801  0.995   1.00 0.00 ? 97  PRO A O    2  
ATOM 3736  C CB   . PRO A 1 97  ? 24.091  -2.693  -1.456  1.00 0.00 ? 97  PRO A CB   2  
ATOM 3737  C CG   . PRO A 1 97  ? 25.420  -2.998  -2.061  1.00 0.00 ? 97  PRO A CG   2  
ATOM 3738  C CD   . PRO A 1 97  ? 26.444  -2.380  -1.143  1.00 0.00 ? 97  PRO A CD   2  
ATOM 3739  H HA   . PRO A 1 97  ? 23.705  -1.978  0.538   1.00 0.00 ? 97  PRO A HA   2  
ATOM 3740  H HB2  . PRO A 1 97  ? 23.354  -3.446  -1.708  1.00 0.00 ? 97  PRO A HB2  2  
ATOM 3741  H HB3  . PRO A 1 97  ? 23.733  -1.718  -1.760  1.00 0.00 ? 97  PRO A HB3  2  
ATOM 3742  H HG2  . PRO A 1 97  ? 25.562  -4.068  -2.118  1.00 0.00 ? 97  PRO A HG2  2  
ATOM 3743  H HG3  . PRO A 1 97  ? 25.486  -2.559  -3.048  1.00 0.00 ? 97  PRO A HG3  2  
ATOM 3744  H HD2  . PRO A 1 97  ? 27.328  -3.002  -1.092  1.00 0.00 ? 97  PRO A HD2  2  
ATOM 3745  H HD3  . PRO A 1 97  ? 26.701  -1.387  -1.477  1.00 0.00 ? 97  PRO A HD3  2  
ATOM 3746  N N    . ARG A 1 98  ? 22.817  -4.463  0.752   1.00 0.00 ? 98  ARG A N    2  
ATOM 3747  C CA   . ARG A 1 98  ? 22.454  -5.685  1.457   1.00 0.00 ? 98  ARG A CA   2  
ATOM 3748  C C    . ARG A 1 98  ? 20.975  -6.011  1.265   1.00 0.00 ? 98  ARG A C    2  
ATOM 3749  O O    . ARG A 1 98  ? 20.163  -5.108  1.050   1.00 0.00 ? 98  ARG A O    2  
ATOM 3750  C CB   . ARG A 1 98  ? 22.766  -5.503  2.951   1.00 0.00 ? 98  ARG A CB   2  
ATOM 3751  C CG   . ARG A 1 98  ? 21.886  -4.452  3.638   1.00 0.00 ? 98  ARG A CG   2  
ATOM 3752  C CD   . ARG A 1 98  ? 22.481  -3.974  4.960   1.00 0.00 ? 98  ARG A CD   2  
ATOM 3753  N NE   . ARG A 1 98  ? 23.669  -3.136  4.761   1.00 0.00 ? 98  ARG A NE   2  
ATOM 3754  C CZ   . ARG A 1 98  ? 24.145  -2.283  5.672   1.00 0.00 ? 98  ARG A CZ   2  
ATOM 3755  N NH1  . ARG A 1 98  ? 23.566  -2.188  6.863   1.00 0.00 ? 98  ARG A NH1  2  
ATOM 3756  N NH2  . ARG A 1 98  ? 25.206  -1.535  5.395   1.00 0.00 ? 98  ARG A NH2  2  
ATOM 3757  H H    . ARG A 1 98  ? 22.112  -3.918  0.346   1.00 0.00 ? 98  ARG A H    2  
ATOM 3758  H HA   . ARG A 1 98  ? 23.049  -6.500  1.059   1.00 0.00 ? 98  ARG A HA   2  
ATOM 3759  H HB2  . ARG A 1 98  ? 22.623  -6.449  3.456   1.00 0.00 ? 98  ARG A HB2  2  
ATOM 3760  H HB3  . ARG A 1 98  ? 23.799  -5.203  3.056   1.00 0.00 ? 98  ARG A HB3  2  
ATOM 3761  H HG2  . ARG A 1 98  ? 21.768  -3.600  2.980   1.00 0.00 ? 98  ARG A HG2  2  
ATOM 3762  H HG3  . ARG A 1 98  ? 20.916  -4.887  3.830   1.00 0.00 ? 98  ARG A HG3  2  
ATOM 3763  H HD2  . ARG A 1 98  ? 21.734  -3.401  5.490   1.00 0.00 ? 98  ARG A HD2  2  
ATOM 3764  H HD3  . ARG A 1 98  ? 22.756  -4.837  5.553   1.00 0.00 ? 98  ARG A HD3  2  
ATOM 3765  H HE   . ARG A 1 98  ? 24.130  -3.207  3.894   1.00 0.00 ? 98  ARG A HE   2  
ATOM 3766  H HH11 . ARG A 1 98  ? 22.771  -2.754  7.084   1.00 0.00 ? 98  ARG A HH11 2  
ATOM 3767  H HH12 . ARG A 1 98  ? 23.926  -1.549  7.551   1.00 0.00 ? 98  ARG A HH12 2  
ATOM 3768  H HH21 . ARG A 1 98  ? 25.657  -1.610  4.498   1.00 0.00 ? 98  ARG A HH21 2  
ATOM 3769  H HH22 . ARG A 1 98  ? 25.559  -0.888  6.078   1.00 0.00 ? 98  ARG A HH22 2  
ATOM 3770  N N    . PRO A 1 99  ? 20.611  -7.307  1.344   1.00 0.00 ? 99  PRO A N    2  
ATOM 3771  C CA   . PRO A 1 99  ? 19.210  -7.749  1.258   1.00 0.00 ? 99  PRO A CA   2  
ATOM 3772  C C    . PRO A 1 99  ? 18.416  -7.342  2.500   1.00 0.00 ? 99  PRO A C    2  
ATOM 3773  O O    . PRO A 1 99  ? 17.189  -7.416  2.523   1.00 0.00 ? 99  PRO A O    2  
ATOM 3774  C CB   . PRO A 1 99  ? 19.326  -9.274  1.158   1.00 0.00 ? 99  PRO A CB   2  
ATOM 3775  C CG   . PRO A 1 99  ? 20.613  -9.595  1.838   1.00 0.00 ? 99  PRO A CG   2  
ATOM 3776  C CD   . PRO A 1 99  ? 21.536  -8.451  1.516   1.00 0.00 ? 99  PRO A CD   2  
ATOM 3777  H HA   . PRO A 1 99  ? 18.723  -7.357  0.376   1.00 0.00 ? 99  PRO A HA   2  
ATOM 3778  H HB2  . PRO A 1 99  ? 18.486  -9.743  1.648   1.00 0.00 ? 99  PRO A HB2  2  
ATOM 3779  H HB3  . PRO A 1 99  ? 19.348  -9.568  0.118   1.00 0.00 ? 99  PRO A HB3  2  
ATOM 3780  H HG2  . PRO A 1 99  ? 20.458  -9.667  2.906   1.00 0.00 ? 99  PRO A HG2  2  
ATOM 3781  H HG3  . PRO A 1 99  ? 21.014  -10.523 1.454   1.00 0.00 ? 99  PRO A HG3  2  
ATOM 3782  H HD2  . PRO A 1 99  ? 22.222  -8.275  2.334   1.00 0.00 ? 99  PRO A HD2  2  
ATOM 3783  H HD3  . PRO A 1 99  ? 22.079  -8.647  0.603   1.00 0.00 ? 99  PRO A HD3  2  
ATOM 3784  N N    . ASP A 1 100 ? 19.142  -6.926  3.536   1.00 0.00 ? 100 ASP A N    2  
ATOM 3785  C CA   . ASP A 1 100 ? 18.536  -6.391  4.758   1.00 0.00 ? 100 ASP A CA   2  
ATOM 3786  C C    . ASP A 1 100 ? 17.792  -5.094  4.427   1.00 0.00 ? 100 ASP A C    2  
ATOM 3787  O O    . ASP A 1 100 ? 16.746  -4.790  5.003   1.00 0.00 ? 100 ASP A O    2  
ATOM 3788  C CB   . ASP A 1 100 ? 19.630  -6.156  5.809   1.00 0.00 ? 100 ASP A CB   2  
ATOM 3789  C CG   . ASP A 1 100 ? 19.143  -5.411  7.039   1.00 0.00 ? 100 ASP A CG   2  
ATOM 3790  O OD1  . ASP A 1 100 ? 18.462  -6.027  7.886   1.00 0.00 ? 100 ASP A OD1  2  
ATOM 3791  O OD2  . ASP A 1 100 ? 19.465  -4.212  7.171   1.00 0.00 ? 100 ASP A OD2  2  
ATOM 3792  H H    . ASP A 1 100 ? 20.118  -6.975  3.473   1.00 0.00 ? 100 ASP A H    2  
ATOM 3793  H HA   . ASP A 1 100 ? 17.829  -7.120  5.131   1.00 0.00 ? 100 ASP A HA   2  
ATOM 3794  H HB2  . ASP A 1 100 ? 20.020  -7.113  6.129   1.00 0.00 ? 100 ASP A HB2  2  
ATOM 3795  H HB3  . ASP A 1 100 ? 20.431  -5.588  5.359   1.00 0.00 ? 100 ASP A HB3  2  
ATOM 3796  N N    . MET A 1 101 ? 18.365  -4.356  3.470   1.00 0.00 ? 101 MET A N    2  
ATOM 3797  C CA   . MET A 1 101 ? 17.739  -3.193  2.821   1.00 0.00 ? 101 MET A CA   2  
ATOM 3798  C C    . MET A 1 101 ? 17.093  -2.196  3.799   1.00 0.00 ? 101 MET A C    2  
ATOM 3799  O O    . MET A 1 101 ? 17.327  -2.225  5.011   1.00 0.00 ? 101 MET A O    2  
ATOM 3800  C CB   . MET A 1 101 ? 16.714  -3.661  1.763   1.00 0.00 ? 101 MET A CB   2  
ATOM 3801  C CG   . MET A 1 101 ? 15.437  -4.275  2.331   1.00 0.00 ? 101 MET A CG   2  
ATOM 3802  S SD   . MET A 1 101 ? 14.302  -4.836  1.047   1.00 0.00 ? 101 MET A SD   2  
ATOM 3803  C CE   . MET A 1 101 ? 15.241  -6.177  0.313   1.00 0.00 ? 101 MET A CE   2  
ATOM 3804  H H    . MET A 1 101 ? 19.260  -4.614  3.175   1.00 0.00 ? 101 MET A H    2  
ATOM 3805  H HA   . MET A 1 101 ? 18.530  -2.669  2.303   1.00 0.00 ? 101 MET A HA   2  
ATOM 3806  H HB2  . MET A 1 101 ? 16.435  -2.814  1.154   1.00 0.00 ? 101 MET A HB2  2  
ATOM 3807  H HB3  . MET A 1 101 ? 17.187  -4.399  1.130   1.00 0.00 ? 101 MET A HB3  2  
ATOM 3808  H HG2  . MET A 1 101 ? 15.701  -5.119  2.951   1.00 0.00 ? 101 MET A HG2  2  
ATOM 3809  H HG3  . MET A 1 101 ? 14.934  -3.532  2.935   1.00 0.00 ? 101 MET A HG3  2  
ATOM 3810  H HE1  . MET A 1 101 ? 15.440  -6.929  1.061   1.00 0.00 ? 101 MET A HE1  2  
ATOM 3811  H HE2  . MET A 1 101 ? 16.175  -5.794  -0.071  1.00 0.00 ? 101 MET A HE2  2  
ATOM 3812  H HE3  . MET A 1 101 ? 14.672  -6.615  -0.495  1.00 0.00 ? 101 MET A HE3  2  
ATOM 3813  N N    . PHE A 1 102 ? 16.288  -1.294  3.234   1.00 0.00 ? 102 PHE A N    2  
ATOM 3814  C CA   . PHE A 1 102 ? 15.623  -0.225  3.984   1.00 0.00 ? 102 PHE A CA   2  
ATOM 3815  C C    . PHE A 1 102 ? 14.313  -0.723  4.611   1.00 0.00 ? 102 PHE A C    2  
ATOM 3816  O O    . PHE A 1 102 ? 13.363  0.051   4.744   1.00 0.00 ? 102 PHE A O    2  
ATOM 3817  C CB   . PHE A 1 102 ? 15.301  0.948   3.033   1.00 0.00 ? 102 PHE A CB   2  
ATOM 3818  C CG   . PHE A 1 102 ? 16.421  1.319   2.091   1.00 0.00 ? 102 PHE A CG   2  
ATOM 3819  C CD1  . PHE A 1 102 ? 17.508  2.054   2.536   1.00 0.00 ? 102 PHE A CD1  2  
ATOM 3820  C CD2  . PHE A 1 102 ? 16.380  0.937   0.754   1.00 0.00 ? 102 PHE A CD2  2  
ATOM 3821  C CE1  . PHE A 1 102 ? 18.529  2.399   1.670   1.00 0.00 ? 102 PHE A CE1  2  
ATOM 3822  C CE2  . PHE A 1 102 ? 17.401  1.280   -0.112  1.00 0.00 ? 102 PHE A CE2  2  
ATOM 3823  C CZ   . PHE A 1 102 ? 18.476  2.012   0.346   1.00 0.00 ? 102 PHE A CZ   2  
ATOM 3824  H H    . PHE A 1 102 ? 16.140  -1.348  2.269   1.00 0.00 ? 102 PHE A H    2  
ATOM 3825  H HA   . PHE A 1 102 ? 16.290  0.121   4.762   1.00 0.00 ? 102 PHE A HA   2  
ATOM 3826  H HB2  . PHE A 1 102 ? 14.440  0.686   2.433   1.00 0.00 ? 102 PHE A HB2  2  
ATOM 3827  H HB3  . PHE A 1 102 ? 15.060  1.822   3.623   1.00 0.00 ? 102 PHE A HB3  2  
ATOM 3828  H HD1  . PHE A 1 102 ? 17.556  2.358   3.572   1.00 0.00 ? 102 PHE A HD1  2  
ATOM 3829  H HD2  . PHE A 1 102 ? 15.537  0.365   0.391   1.00 0.00 ? 102 PHE A HD2  2  
ATOM 3830  H HE1  . PHE A 1 102 ? 19.368  2.973   2.030   1.00 0.00 ? 102 PHE A HE1  2  
ATOM 3831  H HE2  . PHE A 1 102 ? 17.357  0.976   -1.147  1.00 0.00 ? 102 PHE A HE2  2  
ATOM 3832  H HZ   . PHE A 1 102 ? 19.274  2.280   -0.330  1.00 0.00 ? 102 PHE A HZ   2  
ATOM 3833  N N    . ARG A 1 103 ? 14.278  -1.999  5.019   1.00 0.00 ? 103 ARG A N    2  
ATOM 3834  C CA   . ARG A 1 103 ? 13.030  -2.655  5.453   1.00 0.00 ? 103 ARG A CA   2  
ATOM 3835  C C    . ARG A 1 103 ? 12.204  -1.771  6.401   1.00 0.00 ? 103 ARG A C    2  
ATOM 3836  O O    . ARG A 1 103 ? 10.979  -1.680  6.273   1.00 0.00 ? 103 ARG A O    2  
ATOM 3837  C CB   . ARG A 1 103 ? 13.318  -4.023  6.113   1.00 0.00 ? 103 ARG A CB   2  
ATOM 3838  C CG   . ARG A 1 103 ? 13.929  -3.951  7.515   1.00 0.00 ? 103 ARG A CG   2  
ATOM 3839  C CD   . ARG A 1 103 ? 15.351  -3.398  7.511   1.00 0.00 ? 103 ARG A CD   2  
ATOM 3840  N NE   . ARG A 1 103 ? 15.848  -3.162  8.868   1.00 0.00 ? 103 ARG A NE   2  
ATOM 3841  C CZ   . ARG A 1 103 ? 17.046  -2.649  9.147   1.00 0.00 ? 103 ARG A CZ   2  
ATOM 3842  N NH1  . ARG A 1 103 ? 17.882  -2.327  8.166   1.00 0.00 ? 103 ARG A NH1  2  
ATOM 3843  N NH2  . ARG A 1 103 ? 17.413  -2.468  10.411  1.00 0.00 ? 103 ARG A NH2  2  
ATOM 3844  H H    . ARG A 1 103 ? 15.111  -2.516  5.021   1.00 0.00 ? 103 ARG A H    2  
ATOM 3845  H HA   . ARG A 1 103 ? 12.442  -2.827  4.563   1.00 0.00 ? 103 ARG A HA   2  
ATOM 3846  H HB2  . ARG A 1 103 ? 12.389  -4.572  6.184   1.00 0.00 ? 103 ARG A HB2  2  
ATOM 3847  H HB3  . ARG A 1 103 ? 13.996  -4.576  5.477   1.00 0.00 ? 103 ARG A HB3  2  
ATOM 3848  H HG2  . ARG A 1 103 ? 13.313  -3.314  8.132   1.00 0.00 ? 103 ARG A HG2  2  
ATOM 3849  H HG3  . ARG A 1 103 ? 13.944  -4.947  7.938   1.00 0.00 ? 103 ARG A HG3  2  
ATOM 3850  H HD2  . ARG A 1 103 ? 16.001  -4.108  7.017   1.00 0.00 ? 103 ARG A HD2  2  
ATOM 3851  H HD3  . ARG A 1 103 ? 15.360  -2.464  6.966   1.00 0.00 ? 103 ARG A HD3  2  
ATOM 3852  H HE   . ARG A 1 103 ? 15.252  -3.403  9.614   1.00 0.00 ? 103 ARG A HE   2  
ATOM 3853  H HH11 . ARG A 1 103 ? 17.617  -2.469  7.208   1.00 0.00 ? 103 ARG A HH11 2  
ATOM 3854  H HH12 . ARG A 1 103 ? 18.793  -1.965  8.377   1.00 0.00 ? 103 ARG A HH12 2  
ATOM 3855  H HH21 . ARG A 1 103 ? 16.787  -2.718  11.157  1.00 0.00 ? 103 ARG A HH21 2  
ATOM 3856  H HH22 . ARG A 1 103 ? 18.314  -2.085  10.626  1.00 0.00 ? 103 ARG A HH22 2  
ATOM 3857  N N    . ALA A 1 104 ? 12.883  -1.098  7.326   1.00 0.00 ? 104 ALA A N    2  
ATOM 3858  C CA   . ALA A 1 104 ? 12.214  -0.252  8.308   1.00 0.00 ? 104 ALA A CA   2  
ATOM 3859  C C    . ALA A 1 104 ? 11.522  0.926   7.628   1.00 0.00 ? 104 ALA A C    2  
ATOM 3860  O O    . ALA A 1 104 ? 10.348  1.204   7.879   1.00 0.00 ? 104 ALA A O    2  
ATOM 3861  C CB   . ALA A 1 104 ? 13.216  0.240   9.347   1.00 0.00 ? 104 ALA A CB   2  
ATOM 3862  H H    . ALA A 1 104 ? 13.859  -1.164  7.341   1.00 0.00 ? 104 ALA A H    2  
ATOM 3863  H HA   . ALA A 1 104 ? 11.469  -0.852  8.816   1.00 0.00 ? 104 ALA A HA   2  
ATOM 3864  H HB1  . ALA A 1 104 ? 12.703  0.840   10.086  1.00 0.00 ? 104 ALA A HB1  2  
ATOM 3865  H HB2  . ALA A 1 104 ? 13.974  0.837   8.862   1.00 0.00 ? 104 ALA A HB2  2  
ATOM 3866  H HB3  . ALA A 1 104 ? 13.680  -0.607  9.831   1.00 0.00 ? 104 ALA A HB3  2  
ATOM 3867  N N    . GLN A 1 105 ? 12.253  1.602   6.746   1.00 0.00 ? 105 GLN A N    2  
ATOM 3868  C CA   . GLN A 1 105 ? 11.742  2.786   6.063   1.00 0.00 ? 105 GLN A CA   2  
ATOM 3869  C C    . GLN A 1 105 ? 10.702  2.413   5.009   1.00 0.00 ? 105 GLN A C    2  
ATOM 3870  O O    . GLN A 1 105 ? 9.853   3.233   4.653   1.00 0.00 ? 105 GLN A O    2  
ATOM 3871  C CB   . GLN A 1 105 ? 12.890  3.596   5.442   1.00 0.00 ? 105 GLN A CB   2  
ATOM 3872  C CG   . GLN A 1 105 ? 13.714  4.370   6.472   1.00 0.00 ? 105 GLN A CG   2  
ATOM 3873  C CD   . GLN A 1 105 ? 14.433  3.473   7.468   1.00 0.00 ? 105 GLN A CD   2  
ATOM 3874  O OE1  . GLN A 1 105 ? 14.853  2.364   7.135   1.00 0.00 ? 105 GLN A OE1  2  
ATOM 3875  N NE2  . GLN A 1 105 ? 14.556  3.936   8.704   1.00 0.00 ? 105 GLN A NE2  2  
ATOM 3876  H H    . GLN A 1 105 ? 13.161  1.291   6.544   1.00 0.00 ? 105 GLN A H    2  
ATOM 3877  H HA   . GLN A 1 105 ? 11.256  3.400   6.809   1.00 0.00 ? 105 GLN A HA   2  
ATOM 3878  H HB2  . GLN A 1 105 ? 13.550  2.921   4.914   1.00 0.00 ? 105 GLN A HB2  2  
ATOM 3879  H HB3  . GLN A 1 105 ? 12.478  4.306   4.736   1.00 0.00 ? 105 GLN A HB3  2  
ATOM 3880  H HG2  . GLN A 1 105 ? 14.453  4.959   5.950   1.00 0.00 ? 105 GLN A HG2  2  
ATOM 3881  H HG3  . GLN A 1 105 ? 13.053  5.031   7.016   1.00 0.00 ? 105 GLN A HG3  2  
ATOM 3882  H HE21 . GLN A 1 105 ? 14.176  4.821   8.911   1.00 0.00 ? 105 GLN A HE21 2  
ATOM 3883  H HE22 . GLN A 1 105 ? 15.017  3.379   9.364   1.00 0.00 ? 105 GLN A HE22 2  
ATOM 3884  N N    . GLN A 1 106 ? 10.759  1.173   4.526   1.00 0.00 ? 106 GLN A N    2  
ATOM 3885  C CA   . GLN A 1 106 ? 9.744   0.666   3.607   1.00 0.00 ? 106 GLN A CA   2  
ATOM 3886  C C    . GLN A 1 106 ? 8.375   0.711   4.277   1.00 0.00 ? 106 GLN A C    2  
ATOM 3887  O O    . GLN A 1 106 ? 7.439   1.342   3.777   1.00 0.00 ? 106 GLN A O    2  
ATOM 3888  C CB   . GLN A 1 106 ? 10.065  -0.771  3.173   1.00 0.00 ? 106 GLN A CB   2  
ATOM 3889  C CG   . GLN A 1 106 ? 11.280  -0.892  2.263   1.00 0.00 ? 106 GLN A CG   2  
ATOM 3890  C CD   . GLN A 1 106 ? 11.549  -2.328  1.848   1.00 0.00 ? 106 GLN A CD   2  
ATOM 3891  O OE1  . GLN A 1 106 ? 12.313  -3.040  2.493   1.00 0.00 ? 106 GLN A OE1  2  
ATOM 3892  N NE2  . GLN A 1 106 ? 10.900  -2.771  0.782   1.00 0.00 ? 106 GLN A NE2  2  
ATOM 3893  H H    . GLN A 1 106 ? 11.497  0.588   4.797   1.00 0.00 ? 106 GLN A H    2  
ATOM 3894  H HA   . GLN A 1 106 ? 9.731   1.307   2.735   1.00 0.00 ? 106 GLN A HA   2  
ATOM 3895  H HB2  . GLN A 1 106 ? 10.245  -1.367  4.057   1.00 0.00 ? 106 GLN A HB2  2  
ATOM 3896  H HB3  . GLN A 1 106 ? 9.210   -1.175  2.649   1.00 0.00 ? 106 GLN A HB3  2  
ATOM 3897  H HG2  . GLN A 1 106 ? 11.112  -0.300  1.373   1.00 0.00 ? 106 GLN A HG2  2  
ATOM 3898  H HG3  . GLN A 1 106 ? 12.148  -0.515  2.784   1.00 0.00 ? 106 GLN A HG3  2  
ATOM 3899  H HE21 . GLN A 1 106 ? 10.287  -2.155  0.323   1.00 0.00 ? 106 GLN A HE21 2  
ATOM 3900  H HE22 . GLN A 1 106 ? 11.050  -3.697  0.504   1.00 0.00 ? 106 GLN A HE22 2  
ATOM 3901  N N    . LEU A 1 107 ? 8.273   0.054   5.431   1.00 0.00 ? 107 LEU A N    2  
ATOM 3902  C CA   . LEU A 1 107 ? 7.018   0.010   6.174   1.00 0.00 ? 107 LEU A CA   2  
ATOM 3903  C C    . LEU A 1 107 ? 6.757   1.338   6.882   1.00 0.00 ? 107 LEU A C    2  
ATOM 3904  O O    . LEU A 1 107 ? 5.618   1.646   7.225   1.00 0.00 ? 107 LEU A O    2  
ATOM 3905  C CB   . LEU A 1 107 ? 7.006   -1.161  7.175   1.00 0.00 ? 107 LEU A CB   2  
ATOM 3906  C CG   . LEU A 1 107 ? 6.840   -2.564  6.553   1.00 0.00 ? 107 LEU A CG   2  
ATOM 3907  C CD1  . LEU A 1 107 ? 5.583   -2.631  5.688   1.00 0.00 ? 107 LEU A CD1  2  
ATOM 3908  C CD2  . LEU A 1 107 ? 8.076   -2.965  5.749   1.00 0.00 ? 107 LEU A CD2  2  
ATOM 3909  H H    . LEU A 1 107 ? 9.063   -0.411  5.789   1.00 0.00 ? 107 LEU A H    2  
ATOM 3910  H HA   . LEU A 1 107 ? 6.224   -0.148  5.454   1.00 0.00 ? 107 LEU A HA   2  
ATOM 3911  H HB2  . LEU A 1 107 ? 7.935   -1.142  7.730   1.00 0.00 ? 107 LEU A HB2  2  
ATOM 3912  H HB3  . LEU A 1 107 ? 6.192   -1.004  7.869   1.00 0.00 ? 107 LEU A HB3  2  
ATOM 3913  H HG   . LEU A 1 107 ? 6.719   -3.283  7.348   1.00 0.00 ? 107 LEU A HG   2  
ATOM 3914  H HD11 . LEU A 1 107 ? 5.477   -3.626  5.281   1.00 0.00 ? 107 LEU A HD11 2  
ATOM 3915  H HD12 . LEU A 1 107 ? 5.660   -1.919  4.879   1.00 0.00 ? 107 LEU A HD12 2  
ATOM 3916  H HD13 . LEU A 1 107 ? 4.718   -2.397  6.291   1.00 0.00 ? 107 LEU A HD13 2  
ATOM 3917  H HD21 . LEU A 1 107 ? 7.940   -3.960  5.349   1.00 0.00 ? 107 LEU A HD21 2  
ATOM 3918  H HD22 . LEU A 1 107 ? 8.945   -2.953  6.391   1.00 0.00 ? 107 LEU A HD22 2  
ATOM 3919  H HD23 . LEU A 1 107 ? 8.222   -2.267  4.936   1.00 0.00 ? 107 LEU A HD23 2  
ATOM 3920  N N    . GLN A 1 108 ? 7.812   2.123   7.093   1.00 0.00 ? 108 GLN A N    2  
ATOM 3921  C CA   . GLN A 1 108 ? 7.671   3.476   7.640   1.00 0.00 ? 108 GLN A CA   2  
ATOM 3922  C C    . GLN A 1 108 ? 6.732   4.284   6.745   1.00 0.00 ? 108 GLN A C    2  
ATOM 3923  O O    . GLN A 1 108 ? 5.774   4.903   7.213   1.00 0.00 ? 108 GLN A O    2  
ATOM 3924  C CB   . GLN A 1 108 ? 9.043   4.164   7.717   1.00 0.00 ? 108 GLN A CB   2  
ATOM 3925  C CG   . GLN A 1 108 ? 9.035   5.530   8.402   1.00 0.00 ? 108 GLN A CG   2  
ATOM 3926  C CD   . GLN A 1 108 ? 8.954   5.433   9.916   1.00 0.00 ? 108 GLN A CD   2  
ATOM 3927  O OE1  . GLN A 1 108 ? 7.870   5.412   10.497  1.00 0.00 ? 108 GLN A OE1  2  
ATOM 3928  N NE2  . GLN A 1 108 ? 10.107  5.393   10.567  1.00 0.00 ? 108 GLN A NE2  2  
ATOM 3929  H H    . GLN A 1 108 ? 8.708   1.783   6.885   1.00 0.00 ? 108 GLN A H    2  
ATOM 3930  H HA   . GLN A 1 108 ? 7.247   3.400   8.632   1.00 0.00 ? 108 GLN A HA   2  
ATOM 3931  H HB2  . GLN A 1 108 ? 9.721   3.520   8.258   1.00 0.00 ? 108 GLN A HB2  2  
ATOM 3932  H HB3  . GLN A 1 108 ? 9.419   4.295   6.711   1.00 0.00 ? 108 GLN A HB3  2  
ATOM 3933  H HG2  . GLN A 1 108 ? 9.944   6.053   8.140   1.00 0.00 ? 108 GLN A HG2  2  
ATOM 3934  H HG3  . GLN A 1 108 ? 8.185   6.094   8.044   1.00 0.00 ? 108 GLN A HG3  2  
ATOM 3935  H HE21 . GLN A 1 108 ? 10.940  5.430   10.046  1.00 0.00 ? 108 GLN A HE21 2  
ATOM 3936  H HE22 . GLN A 1 108 ? 10.085  5.327   11.545  1.00 0.00 ? 108 GLN A HE22 2  
ATOM 3937  N N    . ILE A 1 109 ? 7.012   4.242   5.443   1.00 0.00 ? 109 ILE A N    2  
ATOM 3938  C CA   . ILE A 1 109 ? 6.191   4.919   4.445   1.00 0.00 ? 109 ILE A CA   2  
ATOM 3939  C C    . ILE A 1 109 ? 4.792   4.301   4.382   1.00 0.00 ? 109 ILE A C    2  
ATOM 3940  O O    . ILE A 1 109 ? 3.787   5.017   4.322   1.00 0.00 ? 109 ILE A O    2  
ATOM 3941  C CB   . ILE A 1 109 ? 6.860   4.865   3.044   1.00 0.00 ? 109 ILE A CB   2  
ATOM 3942  C CG1  . ILE A 1 109 ? 8.108   5.768   3.002   1.00 0.00 ? 109 ILE A CG1  2  
ATOM 3943  C CG2  . ILE A 1 109 ? 5.873   5.258   1.945   1.00 0.00 ? 109 ILE A CG2  2  
ATOM 3944  C CD1  . ILE A 1 109 ? 7.819   7.234   3.259   1.00 0.00 ? 109 ILE A CD1  2  
ATOM 3945  H H    . ILE A 1 109 ? 7.796   3.734   5.144   1.00 0.00 ? 109 ILE A H    2  
ATOM 3946  H HA   . ILE A 1 109 ? 6.100   5.958   4.738   1.00 0.00 ? 109 ILE A HA   2  
ATOM 3947  H HB   . ILE A 1 109 ? 7.168   3.844   2.863   1.00 0.00 ? 109 ILE A HB   2  
ATOM 3948  H HG12 . ILE A 1 109 ? 8.812   5.436   3.750   1.00 0.00 ? 109 ILE A HG12 2  
ATOM 3949  H HG13 . ILE A 1 109 ? 8.568   5.687   2.027   1.00 0.00 ? 109 ILE A HG13 2  
ATOM 3950  H HG21 . ILE A 1 109 ? 6.371   5.233   0.986   1.00 0.00 ? 109 ILE A HG21 2  
ATOM 3951  H HG22 . ILE A 1 109 ? 5.503   6.256   2.132   1.00 0.00 ? 109 ILE A HG22 2  
ATOM 3952  H HG23 . ILE A 1 109 ? 5.046   4.564   1.937   1.00 0.00 ? 109 ILE A HG23 2  
ATOM 3953  H HD11 . ILE A 1 109 ? 8.741   7.795   3.212   1.00 0.00 ? 109 ILE A HD11 2  
ATOM 3954  H HD12 . ILE A 1 109 ? 7.379   7.350   4.240   1.00 0.00 ? 109 ILE A HD12 2  
ATOM 3955  H HD13 . ILE A 1 109 ? 7.134   7.604   2.511   1.00 0.00 ? 109 ILE A HD13 2  
ATOM 3956  N N    . PHE A 1 110 ? 4.733   2.968   4.407   1.00 0.00 ? 110 PHE A N    2  
ATOM 3957  C CA   . PHE A 1 110 ? 3.459   2.254   4.347   1.00 0.00 ? 110 PHE A CA   2  
ATOM 3958  C C    . PHE A 1 110 ? 2.537   2.702   5.485   1.00 0.00 ? 110 PHE A C    2  
ATOM 3959  O O    . PHE A 1 110 ? 1.395   3.102   5.250   1.00 0.00 ? 110 PHE A O    2  
ATOM 3960  C CB   . PHE A 1 110 ? 3.680   0.730   4.405   1.00 0.00 ? 110 PHE A CB   2  
ATOM 3961  C CG   . PHE A 1 110 ? 2.404   -0.075  4.275   1.00 0.00 ? 110 PHE A CG   2  
ATOM 3962  C CD1  . PHE A 1 110 ? 1.639   -0.392  5.393   1.00 0.00 ? 110 PHE A CD1  2  
ATOM 3963  C CD2  . PHE A 1 110 ? 1.964   -0.499  3.031   1.00 0.00 ? 110 PHE A CD2  2  
ATOM 3964  C CE1  . PHE A 1 110 ? 0.467   -1.116  5.266   1.00 0.00 ? 110 PHE A CE1  2  
ATOM 3965  C CE2  . PHE A 1 110 ? 0.792   -1.219  2.900   1.00 0.00 ? 110 PHE A CE2  2  
ATOM 3966  C CZ   . PHE A 1 110 ? 0.043   -1.527  4.017   1.00 0.00 ? 110 PHE A CZ   2  
ATOM 3967  H H    . PHE A 1 110 ? 5.568   2.456   4.462   1.00 0.00 ? 110 PHE A H    2  
ATOM 3968  H HA   . PHE A 1 110 ? 2.990   2.503   3.404   1.00 0.00 ? 110 PHE A HA   2  
ATOM 3969  H HB2  . PHE A 1 110 ? 4.339   0.439   3.598   1.00 0.00 ? 110 PHE A HB2  2  
ATOM 3970  H HB3  . PHE A 1 110 ? 4.145   0.473   5.345   1.00 0.00 ? 110 PHE A HB3  2  
ATOM 3971  H HD1  . PHE A 1 110 ? 1.969   -0.070  6.370   1.00 0.00 ? 110 PHE A HD1  2  
ATOM 3972  H HD2  . PHE A 1 110 ? 2.548   -0.260  2.153   1.00 0.00 ? 110 PHE A HD2  2  
ATOM 3973  H HE1  . PHE A 1 110 ? -0.118  -1.355  6.143   1.00 0.00 ? 110 PHE A HE1  2  
ATOM 3974  H HE2  . PHE A 1 110 ? 0.463   -1.543  1.923   1.00 0.00 ? 110 PHE A HE2  2  
ATOM 3975  H HZ   . PHE A 1 110 ? -0.877  -2.084  3.912   1.00 0.00 ? 110 PHE A HZ   2  
ATOM 3976  N N    . ASN A 1 111 ? 3.048   2.657   6.713   1.00 0.00 ? 111 ASN A N    2  
ATOM 3977  C CA   . ASN A 1 111 ? 2.256   3.018   7.890   1.00 0.00 ? 111 ASN A CA   2  
ATOM 3978  C C    . ASN A 1 111 ? 1.958   4.514   7.910   1.00 0.00 ? 111 ASN A C    2  
ATOM 3979  O O    . ASN A 1 111 ? 0.928   4.942   8.438   1.00 0.00 ? 111 ASN A O    2  
ATOM 3980  C CB   . ASN A 1 111 ? 2.956   2.597   9.193   1.00 0.00 ? 111 ASN A CB   2  
ATOM 3981  C CG   . ASN A 1 111 ? 2.914   1.092   9.421   1.00 0.00 ? 111 ASN A CG   2  
ATOM 3982  O OD1  . ASN A 1 111 ? 1.940   0.561   9.955   1.00 0.00 ? 111 ASN A OD1  2  
ATOM 3983  N ND2  . ASN A 1 111 ? 3.975   0.396   9.045   1.00 0.00 ? 111 ASN A ND2  2  
ATOM 3984  H H    . ASN A 1 111 ? 3.983   2.386   6.831   1.00 0.00 ? 111 ASN A H    2  
ATOM 3985  H HA   . ASN A 1 111 ? 1.316   2.487   7.817   1.00 0.00 ? 111 ASN A HA   2  
ATOM 3986  H HB2  . ASN A 1 111 ? 3.990   2.908   9.154   1.00 0.00 ? 111 ASN A HB2  2  
ATOM 3987  H HB3  . ASN A 1 111 ? 2.473   3.082   10.029  1.00 0.00 ? 111 ASN A HB3  2  
ATOM 3988  H HD21 . ASN A 1 111 ? 4.726   0.880   8.643   1.00 0.00 ? 111 ASN A HD21 2  
ATOM 3989  H HD22 . ASN A 1 111 ? 3.968   -0.571  9.189   1.00 0.00 ? 111 ASN A HD22 2  
ATOM 3990  N N    . LEU A 1 112 ? 2.853   5.304   7.320   1.00 0.00 ? 112 LEU A N    2  
ATOM 3991  C CA   . LEU A 1 112 ? 2.673   6.751   7.248   1.00 0.00 ? 112 LEU A CA   2  
ATOM 3992  C C    . LEU A 1 112 ? 1.370   7.091   6.522   1.00 0.00 ? 112 LEU A C    2  
ATOM 3993  O O    . LEU A 1 112 ? 0.513   7.789   7.063   1.00 0.00 ? 112 LEU A O    2  
ATOM 3994  C CB   . LEU A 1 112 ? 3.869   7.408   6.540   1.00 0.00 ? 112 LEU A CB   2  
ATOM 3995  C CG   . LEU A 1 112 ? 3.837   8.946   6.476   1.00 0.00 ? 112 LEU A CG   2  
ATOM 3996  C CD1  . LEU A 1 112 ? 3.828   9.551   7.880   1.00 0.00 ? 112 LEU A CD1  2  
ATOM 3997  C CD2  . LEU A 1 112 ? 5.021   9.476   5.669   1.00 0.00 ? 112 LEU A CD2  2  
ATOM 3998  H H    . LEU A 1 112 ? 3.659   4.903   6.929   1.00 0.00 ? 112 LEU A H    2  
ATOM 3999  H HA   . LEU A 1 112 ? 2.616   7.125   8.261   1.00 0.00 ? 112 LEU A HA   2  
ATOM 4000  H HB2  . LEU A 1 112 ? 4.772   7.107   7.054   1.00 0.00 ? 112 LEU A HB2  2  
ATOM 4001  H HB3  . LEU A 1 112 ? 3.911   7.029   5.528   1.00 0.00 ? 112 LEU A HB3  2  
ATOM 4002  H HG   . LEU A 1 112 ? 2.929   9.258   5.979   1.00 0.00 ? 112 LEU A HG   2  
ATOM 4003  H HD11 . LEU A 1 112 ? 4.723   9.255   8.409   1.00 0.00 ? 112 LEU A HD11 2  
ATOM 4004  H HD12 . LEU A 1 112 ? 2.960   9.201   8.419   1.00 0.00 ? 112 LEU A HD12 2  
ATOM 4005  H HD13 . LEU A 1 112 ? 3.793   10.629  7.808   1.00 0.00 ? 112 LEU A HD13 2  
ATOM 4006  H HD21 . LEU A 1 112 ? 5.946   9.171   6.137   1.00 0.00 ? 112 LEU A HD21 2  
ATOM 4007  H HD22 . LEU A 1 112 ? 4.978   10.555  5.630   1.00 0.00 ? 112 LEU A HD22 2  
ATOM 4008  H HD23 . LEU A 1 112 ? 4.979   9.080   4.664   1.00 0.00 ? 112 LEU A HD23 2  
ATOM 4009  N N    . MET A 1 113 ? 1.215   6.576   5.301   1.00 0.00 ? 113 MET A N    2  
ATOM 4010  C CA   . MET A 1 113 ? -0.003  6.817   4.522   1.00 0.00 ? 113 MET A CA   2  
ATOM 4011  C C    . MET A 1 113 ? -1.172  6.046   5.129   1.00 0.00 ? 113 MET A C    2  
ATOM 4012  O O    . MET A 1 113 ? -2.310  6.517   5.115   1.00 0.00 ? 113 MET A O    2  
ATOM 4013  C CB   . MET A 1 113 ? 0.180   6.400   3.056   1.00 0.00 ? 113 MET A CB   2  
ATOM 4014  C CG   . MET A 1 113 ? 1.393   7.015   2.354   1.00 0.00 ? 113 MET A CG   2  
ATOM 4015  S SD   . MET A 1 113 ? 1.164   8.750   1.890   1.00 0.00 ? 113 MET A SD   2  
ATOM 4016  C CE   . MET A 1 113 ? 1.409   9.609   3.445   1.00 0.00 ? 113 MET A CE   2  
ATOM 4017  H H    . MET A 1 113 ? 1.932   6.024   4.919   1.00 0.00 ? 113 MET A H    2  
ATOM 4018  H HA   . MET A 1 113 ? -0.222  7.875   4.566   1.00 0.00 ? 113 MET A HA   2  
ATOM 4019  H HB2  . MET A 1 113 ? 0.267   5.327   3.011   1.00 0.00 ? 113 MET A HB2  2  
ATOM 4020  H HB3  . MET A 1 113 ? -0.705  6.693   2.506   1.00 0.00 ? 113 MET A HB3  2  
ATOM 4021  H HG2  . MET A 1 113 ? 2.245   6.948   3.016   1.00 0.00 ? 113 MET A HG2  2  
ATOM 4022  H HG3  . MET A 1 113 ? 1.598   6.445   1.459   1.00 0.00 ? 113 MET A HG3  2  
ATOM 4023  H HE1  . MET A 1 113 ? 0.658   9.293   4.154   1.00 0.00 ? 113 MET A HE1  2  
ATOM 4024  H HE2  . MET A 1 113 ? 1.327   10.674  3.285   1.00 0.00 ? 113 MET A HE2  2  
ATOM 4025  H HE3  . MET A 1 113 ? 2.390   9.379   3.833   1.00 0.00 ? 113 MET A HE3  2  
ATOM 4026  N N    . LYS A 1 114 ? -0.867  4.864   5.667   1.00 0.00 ? 114 LYS A N    2  
ATOM 4027  C CA   . LYS A 1 114 ? -1.861  3.994   6.304   1.00 0.00 ? 114 LYS A CA   2  
ATOM 4028  C C    . LYS A 1 114 ? -2.731  4.780   7.289   1.00 0.00 ? 114 LYS A C    2  
ATOM 4029  O O    . LYS A 1 114 ? -3.953  4.647   7.299   1.00 0.00 ? 114 LYS A O    2  
ATOM 4030  C CB   . LYS A 1 114 ? -1.143  2.855   7.045   1.00 0.00 ? 114 LYS A CB   2  
ATOM 4031  C CG   . LYS A 1 114 ? -2.064  1.879   7.777   1.00 0.00 ? 114 LYS A CG   2  
ATOM 4032  C CD   . LYS A 1 114 ? -1.264  0.956   8.697   1.00 0.00 ? 114 LYS A CD   2  
ATOM 4033  C CE   . LYS A 1 114 ? -2.156  -0.014  9.465   1.00 0.00 ? 114 LYS A CE   2  
ATOM 4034  N NZ   . LYS A 1 114 ? -2.736  -1.057  8.583   1.00 0.00 ? 114 LYS A NZ   2  
ATOM 4035  H H    . LYS A 1 114 ? 0.066   4.561   5.634   1.00 0.00 ? 114 LYS A H    2  
ATOM 4036  H HA   . LYS A 1 114 ? -2.485  3.570   5.529   1.00 0.00 ? 114 LYS A HA   2  
ATOM 4037  H HB2  . LYS A 1 114 ? -0.560  2.291   6.329   1.00 0.00 ? 114 LYS A HB2  2  
ATOM 4038  H HB3  . LYS A 1 114 ? -0.468  3.289   7.771   1.00 0.00 ? 114 LYS A HB3  2  
ATOM 4039  H HG2  . LYS A 1 114 ? -2.773  2.440   8.370   1.00 0.00 ? 114 LYS A HG2  2  
ATOM 4040  H HG3  . LYS A 1 114 ? -2.594  1.279   7.048   1.00 0.00 ? 114 LYS A HG3  2  
ATOM 4041  H HD2  . LYS A 1 114 ? -0.567  0.385   8.100   1.00 0.00 ? 114 LYS A HD2  2  
ATOM 4042  H HD3  . LYS A 1 114 ? -0.716  1.563   9.406   1.00 0.00 ? 114 LYS A HD3  2  
ATOM 4043  H HE2  . LYS A 1 114 ? -1.566  -0.495  10.231  1.00 0.00 ? 114 LYS A HE2  2  
ATOM 4044  H HE3  . LYS A 1 114 ? -2.959  0.542   9.929   1.00 0.00 ? 114 LYS A HE3  2  
ATOM 4045  H HZ1  . LYS A 1 114 ? -3.290  -0.624  7.816   1.00 0.00 ? 114 LYS A HZ1  2  
ATOM 4046  H HZ2  . LYS A 1 114 ? -3.368  -1.677  9.131   1.00 0.00 ? 114 LYS A HZ2  2  
ATOM 4047  H HZ3  . LYS A 1 114 ? -1.982  -1.640  8.167   1.00 0.00 ? 114 LYS A HZ3  2  
ATOM 4048  N N    . PHE A 1 115 ? -2.089  5.614   8.101   1.00 0.00 ? 115 PHE A N    2  
ATOM 4049  C CA   . PHE A 1 115 ? -2.782  6.358   9.154   1.00 0.00 ? 115 PHE A CA   2  
ATOM 4050  C C    . PHE A 1 115 ? -2.957  7.831   8.757   1.00 0.00 ? 115 PHE A C    2  
ATOM 4051  O O    . PHE A 1 115 ? -3.241  8.689   9.599   1.00 0.00 ? 115 PHE A O    2  
ATOM 4052  C CB   . PHE A 1 115 ? -1.993  6.233   10.471  1.00 0.00 ? 115 PHE A CB   2  
ATOM 4053  C CG   . PHE A 1 115 ? -2.752  6.687   11.697  1.00 0.00 ? 115 PHE A CG   2  
ATOM 4054  C CD1  . PHE A 1 115 ? -3.824  5.946   12.177  1.00 0.00 ? 115 PHE A CD1  2  
ATOM 4055  C CD2  . PHE A 1 115 ? -2.396  7.850   12.368  1.00 0.00 ? 115 PHE A CD2  2  
ATOM 4056  C CE1  . PHE A 1 115 ? -4.522  6.355   13.296  1.00 0.00 ? 115 PHE A CE1  2  
ATOM 4057  C CE2  . PHE A 1 115 ? -3.093  8.262   13.489  1.00 0.00 ? 115 PHE A CE2  2  
ATOM 4058  C CZ   . PHE A 1 115 ? -4.157  7.513   13.953  1.00 0.00 ? 115 PHE A CZ   2  
ATOM 4059  H H    . PHE A 1 115 ? -1.118  5.734   7.994   1.00 0.00 ? 115 PHE A H    2  
ATOM 4060  H HA   . PHE A 1 115 ? -3.761  5.916   9.288   1.00 0.00 ? 115 PHE A HA   2  
ATOM 4061  H HB2  . PHE A 1 115 ? -1.721  5.196   10.619  1.00 0.00 ? 115 PHE A HB2  2  
ATOM 4062  H HB3  . PHE A 1 115 ? -1.089  6.823   10.397  1.00 0.00 ? 115 PHE A HB3  2  
ATOM 4063  H HD1  . PHE A 1 115 ? -4.114  5.038   11.665  1.00 0.00 ? 115 PHE A HD1  2  
ATOM 4064  H HD2  . PHE A 1 115 ? -1.564  8.438   12.007  1.00 0.00 ? 115 PHE A HD2  2  
ATOM 4065  H HE1  . PHE A 1 115 ? -5.355  5.769   13.658  1.00 0.00 ? 115 PHE A HE1  2  
ATOM 4066  H HE2  . PHE A 1 115 ? -2.805  9.168   14.002  1.00 0.00 ? 115 PHE A HE2  2  
ATOM 4067  H HZ   . PHE A 1 115 ? -4.703  7.834   14.829  1.00 0.00 ? 115 PHE A HZ   2  
ATOM 4068  N N    . ASP A 1 116 ? -2.817  8.124   7.467   1.00 0.00 ? 116 ASP A N    2  
ATOM 4069  C CA   . ASP A 1 116 ? -2.909  9.502   6.988   1.00 0.00 ? 116 ASP A CA   2  
ATOM 4070  C C    . ASP A 1 116 ? -3.674  9.582   5.668   1.00 0.00 ? 116 ASP A C    2  
ATOM 4071  O O    . ASP A 1 116 ? -4.902  9.694   5.666   1.00 0.00 ? 116 ASP A O    2  
ATOM 4072  C CB   . ASP A 1 116 ? -1.510  10.115  6.845   1.00 0.00 ? 116 ASP A CB   2  
ATOM 4073  C CG   . ASP A 1 116 ? -1.552  11.587  6.466   1.00 0.00 ? 116 ASP A CG   2  
ATOM 4074  O OD1  . ASP A 1 116 ? -1.869  12.418  7.345   1.00 0.00 ? 116 ASP A OD1  2  
ATOM 4075  O OD2  . ASP A 1 116 ? -1.278  11.920  5.293   1.00 0.00 ? 116 ASP A OD2  2  
ATOM 4076  H H    . ASP A 1 116 ? -2.662  7.401   6.825   1.00 0.00 ? 116 ASP A H    2  
ATOM 4077  H HA   . ASP A 1 116 ? -3.459  10.069  7.729   1.00 0.00 ? 116 ASP A HA   2  
ATOM 4078  H HB2  . ASP A 1 116 ? -0.984  10.021  7.786   1.00 0.00 ? 116 ASP A HB2  2  
ATOM 4079  H HB3  . ASP A 1 116 ? -0.965  9.578   6.081   1.00 0.00 ? 116 ASP A HB3  2  
ATOM 4080  N N    . SER A 1 117 ? -2.956  9.486   4.548   1.00 0.00 ? 117 SER A N    2  
ATOM 4081  C CA   . SER A 1 117 ? -3.561  9.648   3.230   1.00 0.00 ? 117 SER A CA   2  
ATOM 4082  C C    . SER A 1 117 ? -4.617  8.567   2.988   1.00 0.00 ? 117 SER A C    2  
ATOM 4083  O O    . SER A 1 117 ? -5.706  8.857   2.493   1.00 0.00 ? 117 SER A O    2  
ATOM 4084  C CB   . SER A 1 117 ? -2.479  9.626   2.138   1.00 0.00 ? 117 SER A CB   2  
ATOM 4085  O OG   . SER A 1 117 ? -3.019  9.944   0.866   1.00 0.00 ? 117 SER A OG   2  
ATOM 4086  H H    . SER A 1 117 ? -1.994  9.310   4.611   1.00 0.00 ? 117 SER A H    2  
ATOM 4087  H HA   . SER A 1 117 ? -4.050  10.613  3.214   1.00 0.00 ? 117 SER A HA   2  
ATOM 4088  H HB2  . SER A 1 117 ? -1.715  10.351  2.379   1.00 0.00 ? 117 SER A HB2  2  
ATOM 4089  H HB3  . SER A 1 117 ? -2.036  8.641   2.092   1.00 0.00 ? 117 SER A HB3  2  
ATOM 4090  H HG   . SER A 1 117 ? -2.850  10.877  0.665   1.00 0.00 ? 117 SER A HG   2  
ATOM 4091  N N    . TYR A 1 118 ? -4.301  7.322   3.358   1.00 0.00 ? 118 TYR A N    2  
ATOM 4092  C CA   . TYR A 1 118 ? -5.269  6.222   3.273   1.00 0.00 ? 118 TYR A CA   2  
ATOM 4093  C C    . TYR A 1 118 ? -6.542  6.551   4.055   1.00 0.00 ? 118 TYR A C    2  
ATOM 4094  O O    . TYR A 1 118 ? -7.652  6.481   3.516   1.00 0.00 ? 118 TYR A O    2  
ATOM 4095  C CB   . TYR A 1 118 ? -4.654  4.920   3.804   1.00 0.00 ? 118 TYR A CB   2  
ATOM 4096  C CG   . TYR A 1 118 ? -5.652  3.784   3.972   1.00 0.00 ? 118 TYR A CG   2  
ATOM 4097  C CD1  . TYR A 1 118 ? -6.334  3.263   2.878   1.00 0.00 ? 118 TYR A CD1  2  
ATOM 4098  C CD2  . TYR A 1 118 ? -5.907  3.232   5.224   1.00 0.00 ? 118 TYR A CD2  2  
ATOM 4099  C CE1  . TYR A 1 118 ? -7.237  2.229   3.026   1.00 0.00 ? 118 TYR A CE1  2  
ATOM 4100  C CE2  . TYR A 1 118 ? -6.809  2.198   5.379   1.00 0.00 ? 118 TYR A CE2  2  
ATOM 4101  C CZ   . TYR A 1 118 ? -7.472  1.702   4.278   1.00 0.00 ? 118 TYR A CZ   2  
ATOM 4102  O OH   . TYR A 1 118 ? -8.370  0.675   4.429   1.00 0.00 ? 118 TYR A OH   2  
ATOM 4103  H H    . TYR A 1 118 ? -3.392  7.134   3.684   1.00 0.00 ? 118 TYR A H    2  
ATOM 4104  H HA   . TYR A 1 118 ? -5.525  6.090   2.230   1.00 0.00 ? 118 TYR A HA   2  
ATOM 4105  H HB2  . TYR A 1 118 ? -3.889  4.586   3.118   1.00 0.00 ? 118 TYR A HB2  2  
ATOM 4106  H HB3  . TYR A 1 118 ? -4.203  5.112   4.768   1.00 0.00 ? 118 TYR A HB3  2  
ATOM 4107  H HD1  . TYR A 1 118 ? -6.151  3.678   1.898   1.00 0.00 ? 118 TYR A HD1  2  
ATOM 4108  H HD2  . TYR A 1 118 ? -5.387  3.623   6.086   1.00 0.00 ? 118 TYR A HD2  2  
ATOM 4109  H HE1  . TYR A 1 118 ? -7.756  1.838   2.162   1.00 0.00 ? 118 TYR A HE1  2  
ATOM 4110  H HE2  . TYR A 1 118 ? -6.993  1.785   6.360   1.00 0.00 ? 118 TYR A HE2  2  
ATOM 4111  H HH   . TYR A 1 118 ? -8.288  0.065   3.691   1.00 0.00 ? 118 TYR A HH   2  
ATOM 4112  N N    . ALA A 1 119 ? -6.369  6.919   5.324   1.00 0.00 ? 119 ALA A N    2  
ATOM 4113  C CA   . ALA A 1 119 ? -7.498  7.231   6.203   1.00 0.00 ? 119 ALA A CA   2  
ATOM 4114  C C    . ALA A 1 119 ? -8.338  8.368   5.625   1.00 0.00 ? 119 ALA A C    2  
ATOM 4115  O O    . ALA A 1 119 ? -9.557  8.414   5.802   1.00 0.00 ? 119 ALA A O    2  
ATOM 4116  C CB   . ALA A 1 119 ? -7.000  7.589   7.600   1.00 0.00 ? 119 ALA A CB   2  
ATOM 4117  H H    . ALA A 1 119 ? -5.456  6.982   5.681   1.00 0.00 ? 119 ALA A H    2  
ATOM 4118  H HA   . ALA A 1 119 ? -8.114  6.345   6.280   1.00 0.00 ? 119 ALA A HA   2  
ATOM 4119  H HB1  . ALA A 1 119 ? -6.410  6.774   7.993   1.00 0.00 ? 119 ALA A HB1  2  
ATOM 4120  H HB2  . ALA A 1 119 ? -7.846  7.766   8.250   1.00 0.00 ? 119 ALA A HB2  2  
ATOM 4121  H HB3  . ALA A 1 119 ? -6.393  8.481   7.551   1.00 0.00 ? 119 ALA A HB3  2  
ATOM 4122  N N    . ARG A 1 120 ? -7.667  9.273   4.926   1.00 0.00 ? 120 ARG A N    2  
ATOM 4123  C CA   . ARG A 1 120 ? -8.311  10.418  4.290   1.00 0.00 ? 120 ARG A CA   2  
ATOM 4124  C C    . ARG A 1 120 ? -9.089  9.975   3.052   1.00 0.00 ? 120 ARG A C    2  
ATOM 4125  O O    . ARG A 1 120 ? -10.242 10.369  2.852   1.00 0.00 ? 120 ARG A O    2  
ATOM 4126  C CB   . ARG A 1 120 ? -7.236  11.441  3.903   1.00 0.00 ? 120 ARG A CB   2  
ATOM 4127  C CG   . ARG A 1 120 ? -7.770  12.777  3.393   1.00 0.00 ? 120 ARG A CG   2  
ATOM 4128  C CD   . ARG A 1 120 ? -6.622  13.707  3.016   1.00 0.00 ? 120 ARG A CD   2  
ATOM 4129  N NE   . ARG A 1 120 ? -5.613  13.767  4.078   1.00 0.00 ? 120 ARG A NE   2  
ATOM 4130  C CZ   . ARG A 1 120 ? -4.315  13.497  3.901   1.00 0.00 ? 120 ARG A CZ   2  
ATOM 4131  N NH1  . ARG A 1 120 ? -3.844  13.225  2.690   1.00 0.00 ? 120 ARG A NH1  2  
ATOM 4132  N NH2  . ARG A 1 120 ? -3.493  13.505  4.940   1.00 0.00 ? 120 ARG A NH2  2  
ATOM 4133  H H    . ARG A 1 120 ? -6.695  9.171   4.839   1.00 0.00 ? 120 ARG A H    2  
ATOM 4134  H HA   . ARG A 1 120 ? -8.990  10.865  5.002   1.00 0.00 ? 120 ARG A HA   2  
ATOM 4135  H HB2  . ARG A 1 120 ? -6.621  11.638  4.770   1.00 0.00 ? 120 ARG A HB2  2  
ATOM 4136  H HB3  . ARG A 1 120 ? -6.613  11.010  3.129   1.00 0.00 ? 120 ARG A HB3  2  
ATOM 4137  H HG2  . ARG A 1 120 ? -8.387  12.603  2.521   1.00 0.00 ? 120 ARG A HG2  2  
ATOM 4138  H HG3  . ARG A 1 120 ? -8.362  13.241  4.171   1.00 0.00 ? 120 ARG A HG3  2  
ATOM 4139  H HD2  . ARG A 1 120 ? -6.162  13.346  2.106   1.00 0.00 ? 120 ARG A HD2  2  
ATOM 4140  H HD3  . ARG A 1 120 ? -7.016  14.701  2.849   1.00 0.00 ? 120 ARG A HD3  2  
ATOM 4141  H HE   . ARG A 1 120 ? -5.930  13.993  4.984   1.00 0.00 ? 120 ARG A HE   2  
ATOM 4142  H HH11 . ARG A 1 120 ? -4.456  13.214  1.896   1.00 0.00 ? 120 ARG A HH11 2  
ATOM 4143  H HH12 . ARG A 1 120 ? -2.863  13.042  2.554   1.00 0.00 ? 120 ARG A HH12 2  
ATOM 4144  H HH21 . ARG A 1 120 ? -3.843  13.717  5.858   1.00 0.00 ? 120 ARG A HH21 2  
ATOM 4145  H HH22 . ARG A 1 120 ? -2.522  13.269  4.822   1.00 0.00 ? 120 ARG A HH22 2  
ATOM 4146  N N    . PHE A 1 121 ? -8.453  9.134   2.241   1.00 0.00 ? 121 PHE A N    2  
ATOM 4147  C CA   . PHE A 1 121 ? -9.018  8.683   0.970   1.00 0.00 ? 121 PHE A CA   2  
ATOM 4148  C C    . PHE A 1 121 ? -10.344 7.955   1.183   1.00 0.00 ? 121 PHE A C    2  
ATOM 4149  O O    . PHE A 1 121 ? -11.332 8.232   0.502   1.00 0.00 ? 121 PHE A O    2  
ATOM 4150  C CB   . PHE A 1 121 ? -8.021  7.767   0.246   1.00 0.00 ? 121 PHE A CB   2  
ATOM 4151  C CG   . PHE A 1 121 ? -8.509  7.276   -1.096  1.00 0.00 ? 121 PHE A CG   2  
ATOM 4152  C CD1  . PHE A 1 121 ? -8.520  8.122   -2.195  1.00 0.00 ? 121 PHE A CD1  2  
ATOM 4153  C CD2  . PHE A 1 121 ? -8.958  5.971   -1.259  1.00 0.00 ? 121 PHE A CD2  2  
ATOM 4154  C CE1  . PHE A 1 121 ? -8.967  7.680   -3.425  1.00 0.00 ? 121 PHE A CE1  2  
ATOM 4155  C CE2  . PHE A 1 121 ? -9.405  5.525   -2.489  1.00 0.00 ? 121 PHE A CE2  2  
ATOM 4156  C CZ   . PHE A 1 121 ? -9.410  6.381   -3.573  1.00 0.00 ? 121 PHE A CZ   2  
ATOM 4157  H H    . PHE A 1 121 ? -7.570  8.802   2.507   1.00 0.00 ? 121 PHE A H    2  
ATOM 4158  H HA   . PHE A 1 121 ? -9.196  9.558   0.360   1.00 0.00 ? 121 PHE A HA   2  
ATOM 4159  H HB2  . PHE A 1 121 ? -7.099  8.309   0.085   1.00 0.00 ? 121 PHE A HB2  2  
ATOM 4160  H HB3  . PHE A 1 121 ? -7.819  6.905   0.866   1.00 0.00 ? 121 PHE A HB3  2  
ATOM 4161  H HD1  . PHE A 1 121 ? -8.174  9.141   -2.084  1.00 0.00 ? 121 PHE A HD1  2  
ATOM 4162  H HD2  . PHE A 1 121 ? -8.955  5.299   -0.412  1.00 0.00 ? 121 PHE A HD2  2  
ATOM 4163  H HE1  . PHE A 1 121 ? -8.970  8.351   -4.273  1.00 0.00 ? 121 PHE A HE1  2  
ATOM 4164  H HE2  . PHE A 1 121 ? -9.752  4.508   -2.601  1.00 0.00 ? 121 PHE A HE2  2  
ATOM 4165  H HZ   . PHE A 1 121 ? -9.760  6.035   -4.537  1.00 0.00 ? 121 PHE A HZ   2  
ATOM 4166  N N    . VAL A 1 122 ? -10.368 7.045   2.151   1.00 0.00 ? 122 VAL A N    2  
ATOM 4167  C CA   . VAL A 1 122 ? -11.562 6.243   2.423   1.00 0.00 ? 122 VAL A CA   2  
ATOM 4168  C C    . VAL A 1 122 ? -12.689 7.093   3.021   1.00 0.00 ? 122 VAL A C    2  
ATOM 4169  O O    . VAL A 1 122 ? -13.791 6.595   3.271   1.00 0.00 ? 122 VAL A O    2  
ATOM 4170  C CB   . VAL A 1 122 ? -11.251 5.055   3.369   1.00 0.00 ? 122 VAL A CB   2  
ATOM 4171  C CG1  . VAL A 1 122 ? -10.256 4.096   2.718   1.00 0.00 ? 122 VAL A CG1  2  
ATOM 4172  C CG2  . VAL A 1 122 ? -10.728 5.553   4.717   1.00 0.00 ? 122 VAL A CG2  2  
ATOM 4173  H H    . VAL A 1 122 ? -9.561  6.905   2.695   1.00 0.00 ? 122 VAL A H    2  
ATOM 4174  H HA   . VAL A 1 122 ? -11.905 5.836   1.477   1.00 0.00 ? 122 VAL A HA   2  
ATOM 4175  H HB   . VAL A 1 122 ? -12.171 4.513   3.544   1.00 0.00 ? 122 VAL A HB   2  
ATOM 4176  H HG11 . VAL A 1 122 ? -10.055 3.272   3.390   1.00 0.00 ? 122 VAL A HG11 2  
ATOM 4177  H HG12 . VAL A 1 122 ? -9.334  4.619   2.507   1.00 0.00 ? 122 VAL A HG12 2  
ATOM 4178  H HG13 . VAL A 1 122 ? -10.672 3.715   1.797   1.00 0.00 ? 122 VAL A HG13 2  
ATOM 4179  H HG21 . VAL A 1 122 ? -9.819  6.119   4.566   1.00 0.00 ? 122 VAL A HG21 2  
ATOM 4180  H HG22 . VAL A 1 122 ? -10.523 4.710   5.360   1.00 0.00 ? 122 VAL A HG22 2  
ATOM 4181  H HG23 . VAL A 1 122 ? -11.471 6.185   5.182   1.00 0.00 ? 122 VAL A HG23 2  
ATOM 4182  N N    . LYS A 1 123 ? -12.410 8.369   3.273   1.00 0.00 ? 123 LYS A N    2  
ATOM 4183  C CA   . LYS A 1 123 ? -13.429 9.306   3.741   1.00 0.00 ? 123 LYS A CA   2  
ATOM 4184  C C    . LYS A 1 123 ? -13.772 10.316  2.646   1.00 0.00 ? 123 LYS A C    2  
ATOM 4185  O O    . LYS A 1 123 ? -14.834 10.945  2.680   1.00 0.00 ? 123 LYS A O    2  
ATOM 4186  C CB   . LYS A 1 123 ? -12.955 10.039  5.005   1.00 0.00 ? 123 LYS A CB   2  
ATOM 4187  C CG   . LYS A 1 123 ? -12.705 9.116   6.197   1.00 0.00 ? 123 LYS A CG   2  
ATOM 4188  C CD   . LYS A 1 123 ? -12.373 9.891   7.473   1.00 0.00 ? 123 LYS A CD   2  
ATOM 4189  C CE   . LYS A 1 123 ? -11.125 10.755  7.317   1.00 0.00 ? 123 LYS A CE   2  
ATOM 4190  N NZ   . LYS A 1 123 ? -10.790 11.472  8.575   1.00 0.00 ? 123 LYS A NZ   2  
ATOM 4191  H H    . LYS A 1 123 ? -11.491 8.689   3.148   1.00 0.00 ? 123 LYS A H    2  
ATOM 4192  H HA   . LYS A 1 123 ? -14.321 8.741   3.979   1.00 0.00 ? 123 LYS A HA   2  
ATOM 4193  H HB2  . LYS A 1 123 ? -12.035 10.559  4.779   1.00 0.00 ? 123 LYS A HB2  2  
ATOM 4194  H HB3  . LYS A 1 123 ? -13.705 10.764  5.289   1.00 0.00 ? 123 LYS A HB3  2  
ATOM 4195  H HG2  . LYS A 1 123 ? -13.591 8.524   6.371   1.00 0.00 ? 123 LYS A HG2  2  
ATOM 4196  H HG3  . LYS A 1 123 ? -11.878 8.459   5.961   1.00 0.00 ? 123 LYS A HG3  2  
ATOM 4197  H HD2  . LYS A 1 123 ? -13.210 10.530  7.722   1.00 0.00 ? 123 LYS A HD2  2  
ATOM 4198  H HD3  . LYS A 1 123 ? -12.212 9.185   8.276   1.00 0.00 ? 123 LYS A HD3  2  
ATOM 4199  H HE2  . LYS A 1 123 ? -10.293 10.122  7.043   1.00 0.00 ? 123 LYS A HE2  2  
ATOM 4200  H HE3  . LYS A 1 123 ? -11.298 11.480  6.534   1.00 0.00 ? 123 LYS A HE3  2  
ATOM 4201  H HZ1  . LYS A 1 123 ? -9.934  12.049  8.443   1.00 0.00 ? 123 LYS A HZ1  2  
ATOM 4202  H HZ2  . LYS A 1 123 ? -10.616 10.791  9.339   1.00 0.00 ? 123 LYS A HZ2  2  
ATOM 4203  H HZ3  . LYS A 1 123 ? -11.575 12.094  8.856   1.00 0.00 ? 123 LYS A HZ3  2  
ATOM 4204  N N    . SER A 1 124 ? -12.872 10.446  1.670   1.00 0.00 ? 124 SER A N    2  
ATOM 4205  C CA   . SER A 1 124 ? -13.030 11.404  0.579   1.00 0.00 ? 124 SER A CA   2  
ATOM 4206  C C    . SER A 1 124 ? -14.301 11.122  -0.232  1.00 0.00 ? 124 SER A C    2  
ATOM 4207  O O    . SER A 1 124 ? -14.727 9.967   -0.353  1.00 0.00 ? 124 SER A O    2  
ATOM 4208  C CB   . SER A 1 124 ? -11.797 11.354  -0.333  1.00 0.00 ? 124 SER A CB   2  
ATOM 4209  O OG   . SER A 1 124 ? -10.613 11.636  0.395   1.00 0.00 ? 124 SER A OG   2  
ATOM 4210  H H    . SER A 1 124 ? -12.078 9.872   1.680   1.00 0.00 ? 124 SER A H    2  
ATOM 4211  H HA   . SER A 1 124 ? -13.104 12.390  1.015   1.00 0.00 ? 124 SER A HA   2  
ATOM 4212  H HB2  . SER A 1 124 ? -11.709 10.369  -0.767  1.00 0.00 ? 124 SER A HB2  2  
ATOM 4213  H HB3  . SER A 1 124 ? -11.904 12.086  -1.122  1.00 0.00 ? 124 SER A HB3  2  
ATOM 4214  H HG   . SER A 1 124 ? -10.769 11.488  1.332   1.00 0.00 ? 124 SER A HG   2  
ATOM 4215  N N    . PRO A 1 125 ? -14.925 12.179  -0.800  1.00 0.00 ? 125 PRO A N    2  
ATOM 4216  C CA   . PRO A 1 125 ? -16.158 12.050  -1.589  1.00 0.00 ? 125 PRO A CA   2  
ATOM 4217  C C    . PRO A 1 125 ? -16.008 11.048  -2.738  1.00 0.00 ? 125 PRO A C    2  
ATOM 4218  O O    . PRO A 1 125 ? -16.912 10.258  -3.006  1.00 0.00 ? 125 PRO A O    2  
ATOM 4219  C CB   . PRO A 1 125 ? -16.409 13.476  -2.124  1.00 0.00 ? 125 PRO A CB   2  
ATOM 4220  C CG   . PRO A 1 125 ? -15.121 14.206  -1.924  1.00 0.00 ? 125 PRO A CG   2  
ATOM 4221  C CD   . PRO A 1 125 ? -14.485 13.584  -0.711  1.00 0.00 ? 125 PRO A CD   2  
ATOM 4222  H HA   . PRO A 1 125 ? -16.987 11.748  -0.966  1.00 0.00 ? 125 PRO A HA   2  
ATOM 4223  H HB2  . PRO A 1 125 ? -16.680 13.435  -3.171  1.00 0.00 ? 125 PRO A HB2  2  
ATOM 4224  H HB3  . PRO A 1 125 ? -17.212 13.935  -1.563  1.00 0.00 ? 125 PRO A HB3  2  
ATOM 4225  H HG2  . PRO A 1 125 ? -14.486 14.077  -2.790  1.00 0.00 ? 125 PRO A HG2  2  
ATOM 4226  H HG3  . PRO A 1 125 ? -15.313 15.255  -1.752  1.00 0.00 ? 125 PRO A HG3  2  
ATOM 4227  H HD2  . PRO A 1 125 ? -13.408 13.661  -0.767  1.00 0.00 ? 125 PRO A HD2  2  
ATOM 4228  H HD3  . PRO A 1 125 ? -14.852 14.049  0.193   1.00 0.00 ? 125 PRO A HD3  2  
ATOM 4229  N N    . LEU A 1 126 ? -14.847 11.067  -3.389  1.00 0.00 ? 126 LEU A N    2  
ATOM 4230  C CA   . LEU A 1 126 ? -14.574 10.178  -4.519  1.00 0.00 ? 126 LEU A CA   2  
ATOM 4231  C C    . LEU A 1 126 ? -14.887 8.726   -4.148  1.00 0.00 ? 126 LEU A C    2  
ATOM 4232  O O    . LEU A 1 126 ? -15.468 7.984   -4.941  1.00 0.00 ? 126 LEU A O    2  
ATOM 4233  C CB   . LEU A 1 126 ? -13.105 10.335  -4.965  1.00 0.00 ? 126 LEU A CB   2  
ATOM 4234  C CG   . LEU A 1 126 ? -12.692 9.596   -6.261  1.00 0.00 ? 126 LEU A CG   2  
ATOM 4235  C CD1  . LEU A 1 126 ? -11.495 10.286  -6.915  1.00 0.00 ? 126 LEU A CD1  2  
ATOM 4236  C CD2  . LEU A 1 126 ? -12.356 8.130   -5.984  1.00 0.00 ? 126 LEU A CD2  2  
ATOM 4237  H H    . LEU A 1 126 ? -14.157 11.699  -3.106  1.00 0.00 ? 126 LEU A H    2  
ATOM 4238  H HA   . LEU A 1 126 ? -15.222 10.474  -5.334  1.00 0.00 ? 126 LEU A HA   2  
ATOM 4239  H HB2  . LEU A 1 126 ? -12.915 11.391  -5.106  1.00 0.00 ? 126 LEU A HB2  2  
ATOM 4240  H HB3  . LEU A 1 126 ? -12.472 9.985   -4.161  1.00 0.00 ? 126 LEU A HB3  2  
ATOM 4241  H HG   . LEU A 1 126 ? -13.514 9.625   -6.964  1.00 0.00 ? 126 LEU A HG   2  
ATOM 4242  H HD11 . LEU A 1 126 ? -10.652 10.265  -6.239  1.00 0.00 ? 126 LEU A HD11 2  
ATOM 4243  H HD12 . LEU A 1 126 ? -11.748 11.311  -7.143  1.00 0.00 ? 126 LEU A HD12 2  
ATOM 4244  H HD13 . LEU A 1 126 ? -11.236 9.771   -7.829  1.00 0.00 ? 126 LEU A HD13 2  
ATOM 4245  H HD21 . LEU A 1 126 ? -13.223 7.630   -5.582  1.00 0.00 ? 126 LEU A HD21 2  
ATOM 4246  H HD22 . LEU A 1 126 ? -11.546 8.073   -5.270  1.00 0.00 ? 126 LEU A HD22 2  
ATOM 4247  H HD23 . LEU A 1 126 ? -12.057 7.647   -6.904  1.00 0.00 ? 126 LEU A HD23 2  
ATOM 4248  N N    . TYR A 1 127 ? -14.526 8.336   -2.929  1.00 0.00 ? 127 TYR A N    2  
ATOM 4249  C CA   . TYR A 1 127 ? -14.748 6.972   -2.461  1.00 0.00 ? 127 TYR A CA   2  
ATOM 4250  C C    . TYR A 1 127 ? -16.244 6.690   -2.295  1.00 0.00 ? 127 TYR A C    2  
ATOM 4251  O O    . TYR A 1 127 ? -16.777 5.756   -2.893  1.00 0.00 ? 127 TYR A O    2  
ATOM 4252  C CB   . TYR A 1 127 ? -14.009 6.738   -1.133  1.00 0.00 ? 127 TYR A CB   2  
ATOM 4253  C CG   . TYR A 1 127 ? -14.191 5.341   -0.558  1.00 0.00 ? 127 TYR A CG   2  
ATOM 4254  C CD1  . TYR A 1 127 ? -13.560 4.241   -1.133  1.00 0.00 ? 127 TYR A CD1  2  
ATOM 4255  C CD2  . TYR A 1 127 ? -14.991 5.124   0.560   1.00 0.00 ? 127 TYR A CD2  2  
ATOM 4256  C CE1  . TYR A 1 127 ? -13.724 2.969   -0.611  1.00 0.00 ? 127 TYR A CE1  2  
ATOM 4257  C CE2  . TYR A 1 127 ? -15.157 3.857   1.086   1.00 0.00 ? 127 TYR A CE2  2  
ATOM 4258  C CZ   . TYR A 1 127 ? -14.522 2.784   0.498   1.00 0.00 ? 127 TYR A CZ   2  
ATOM 4259  O OH   . TYR A 1 127 ? -14.687 1.521   1.021   1.00 0.00 ? 127 TYR A OH   2  
ATOM 4260  H H    . TYR A 1 127 ? -14.107 8.985   -2.325  1.00 0.00 ? 127 TYR A H    2  
ATOM 4261  H HA   . TYR A 1 127 ? -14.348 6.299   -3.206  1.00 0.00 ? 127 TYR A HA   2  
ATOM 4262  H HB2  . TYR A 1 127 ? -12.951 6.896   -1.288  1.00 0.00 ? 127 TYR A HB2  2  
ATOM 4263  H HB3  . TYR A 1 127 ? -14.366 7.451   -0.402  1.00 0.00 ? 127 TYR A HB3  2  
ATOM 4264  H HD1  . TYR A 1 127 ? -12.935 4.388   -2.003  1.00 0.00 ? 127 TYR A HD1  2  
ATOM 4265  H HD2  . TYR A 1 127 ? -15.489 5.966   1.020   1.00 0.00 ? 127 TYR A HD2  2  
ATOM 4266  H HE1  . TYR A 1 127 ? -13.225 2.128   -1.073  1.00 0.00 ? 127 TYR A HE1  2  
ATOM 4267  H HE2  . TYR A 1 127 ? -15.782 3.711   1.955   1.00 0.00 ? 127 TYR A HE2  2  
ATOM 4268  H HH   . TYR A 1 127 ? -15.607 1.394   1.270   1.00 0.00 ? 127 TYR A HH   2  
ATOM 4269  N N    . ARG A 1 128 ? -16.919 7.520   -1.503  1.00 0.00 ? 128 ARG A N    2  
ATOM 4270  C CA   . ARG A 1 128 ? -18.333 7.305   -1.183  1.00 0.00 ? 128 ARG A CA   2  
ATOM 4271  C C    . ARG A 1 128 ? -19.205 7.345   -2.441  1.00 0.00 ? 128 ARG A C    2  
ATOM 4272  O O    . ARG A 1 128 ? -20.247 6.692   -2.495  1.00 0.00 ? 128 ARG A O    2  
ATOM 4273  C CB   . ARG A 1 128 ? -18.815 8.345   -0.159  1.00 0.00 ? 128 ARG A CB   2  
ATOM 4274  C CG   . ARG A 1 128 ? -18.812 9.781   -0.674  1.00 0.00 ? 128 ARG A CG   2  
ATOM 4275  C CD   . ARG A 1 128 ? -19.143 10.781  0.430   1.00 0.00 ? 128 ARG A CD   2  
ATOM 4276  N NE   . ARG A 1 128 ? -18.144 10.763  1.507   1.00 0.00 ? 128 ARG A NE   2  
ATOM 4277  C CZ   . ARG A 1 128 ? -18.419 10.473  2.783   1.00 0.00 ? 128 ARG A CZ   2  
ATOM 4278  N NH1  . ARG A 1 128 ? -19.668 10.227  3.160   1.00 0.00 ? 128 ARG A NH1  2  
ATOM 4279  N NH2  . ARG A 1 128 ? -17.440 10.449  3.680   1.00 0.00 ? 128 ARG A NH2  2  
ATOM 4280  H H    . ARG A 1 128 ? -16.458 8.301   -1.131  1.00 0.00 ? 128 ARG A H    2  
ATOM 4281  H HA   . ARG A 1 128 ? -18.422 6.317   -0.743  1.00 0.00 ? 128 ARG A HA   2  
ATOM 4282  H HB2  . ARG A 1 128 ? -19.823 8.096   0.140   1.00 0.00 ? 128 ARG A HB2  2  
ATOM 4283  H HB3  . ARG A 1 128 ? -18.172 8.296   0.711   1.00 0.00 ? 128 ARG A HB3  2  
ATOM 4284  H HG2  . ARG A 1 128 ? -17.834 10.009  -1.069  1.00 0.00 ? 128 ARG A HG2  2  
ATOM 4285  H HG3  . ARG A 1 128 ? -19.548 9.871   -1.461  1.00 0.00 ? 128 ARG A HG3  2  
ATOM 4286  H HD2  . ARG A 1 128 ? -19.178 11.773  0.001   1.00 0.00 ? 128 ARG A HD2  2  
ATOM 4287  H HD3  . ARG A 1 128 ? -20.113 10.536  0.841   1.00 0.00 ? 128 ARG A HD3  2  
ATOM 4288  H HE   . ARG A 1 128 ? -17.217 10.975  1.261   1.00 0.00 ? 128 ARG A HE   2  
ATOM 4289  H HH11 . ARG A 1 128 ? -20.416 10.273  2.493   1.00 0.00 ? 128 ARG A HH11 2  
ATOM 4290  H HH12 . ARG A 1 128 ? -19.872 9.984   4.114   1.00 0.00 ? 128 ARG A HH12 2  
ATOM 4291  H HH21 . ARG A 1 128 ? -16.496 10.658  3.405   1.00 0.00 ? 128 ARG A HH21 2  
ATOM 4292  H HH22 . ARG A 1 128 ? -17.638 10.220  4.639   1.00 0.00 ? 128 ARG A HH22 2  
ATOM 4293  N N    . GLU A 1 129 ? -18.772 8.107   -3.443  1.00 0.00 ? 129 GLU A N    2  
ATOM 4294  C CA   . GLU A 1 129 ? -19.471 8.165   -4.727  1.00 0.00 ? 129 GLU A CA   2  
ATOM 4295  C C    . GLU A 1 129 ? -19.305 6.859   -5.500  1.00 0.00 ? 129 GLU A C    2  
ATOM 4296  O O    . GLU A 1 129 ? -20.251 6.379   -6.127  1.00 0.00 ? 129 GLU A O    2  
ATOM 4297  C CB   . GLU A 1 129 ? -18.973 9.357   -5.564  1.00 0.00 ? 129 GLU A CB   2  
ATOM 4298  C CG   . GLU A 1 129 ? -19.824 10.617  -5.420  1.00 0.00 ? 129 GLU A CG   2  
ATOM 4299  C CD   . GLU A 1 129 ? -20.014 11.060  -3.975  1.00 0.00 ? 129 GLU A CD   2  
ATOM 4300  O OE1  . GLU A 1 129 ? -20.989 10.611  -3.333  1.00 0.00 ? 129 GLU A OE1  2  
ATOM 4301  O OE2  . GLU A 1 129 ? -19.199 11.869  -3.487  1.00 0.00 ? 129 GLU A OE2  2  
ATOM 4302  H H    . GLU A 1 129 ? -17.969 8.655   -3.314  1.00 0.00 ? 129 GLU A H    2  
ATOM 4303  H HA   . GLU A 1 129 ? -20.524 8.304   -4.517  1.00 0.00 ? 129 GLU A HA   2  
ATOM 4304  H HB2  . GLU A 1 129 ? -17.962 9.596   -5.264  1.00 0.00 ? 129 GLU A HB2  2  
ATOM 4305  H HB3  . GLU A 1 129 ? -18.967 9.076   -6.609  1.00 0.00 ? 129 GLU A HB3  2  
ATOM 4306  H HG2  . GLU A 1 129 ? -19.347 11.420  -5.965  1.00 0.00 ? 129 GLU A HG2  2  
ATOM 4307  H HG3  . GLU A 1 129 ? -20.797 10.426  -5.852  1.00 0.00 ? 129 GLU A HG3  2  
ATOM 4308  N N    . CYS A 1 130 ? -18.101 6.286   -5.451  1.00 0.00 ? 130 CYS A N    2  
ATOM 4309  C CA   . CYS A 1 130 ? -17.832 5.006   -6.108  1.00 0.00 ? 130 CYS A CA   2  
ATOM 4310  C C    . CYS A 1 130 ? -18.663 3.892   -5.467  1.00 0.00 ? 130 CYS A C    2  
ATOM 4311  O O    . CYS A 1 130 ? -18.931 2.864   -6.088  1.00 0.00 ? 130 CYS A O    2  
ATOM 4312  C CB   . CYS A 1 130 ? -16.337 4.670   -6.038  1.00 0.00 ? 130 CYS A CB   2  
ATOM 4313  S SG   . CYS A 1 130 ? -15.277 5.833   -6.931  1.00 0.00 ? 130 CYS A SG   2  
ATOM 4314  H H    . CYS A 1 130 ? -17.378 6.735   -4.965  1.00 0.00 ? 130 CYS A H    2  
ATOM 4315  H HA   . CYS A 1 130 ? -18.122 5.100   -7.146  1.00 0.00 ? 130 CYS A HA   2  
ATOM 4316  H HB2  . CYS A 1 130 ? -16.021 4.667   -5.004  1.00 0.00 ? 130 CYS A HB2  2  
ATOM 4317  H HB3  . CYS A 1 130 ? -16.174 3.687   -6.460  1.00 0.00 ? 130 CYS A HB3  2  
ATOM 4318  H HG   . CYS A 1 130 ? -14.718 6.642   -6.044  1.00 0.00 ? 130 CYS A HG   2  
ATOM 4319  N N    . LEU A 1 131 ? -19.060 4.110   -4.214  1.00 0.00 ? 131 LEU A N    2  
ATOM 4320  C CA   . LEU A 1 131 ? -19.946 3.186   -3.512  1.00 0.00 ? 131 LEU A CA   2  
ATOM 4321  C C    . LEU A 1 131 ? -21.407 3.500   -3.841  1.00 0.00 ? 131 LEU A C    2  
ATOM 4322  O O    . LEU A 1 131 ? -22.072 2.734   -4.544  1.00 0.00 ? 131 LEU A O    2  
ATOM 4323  C CB   . LEU A 1 131 ? -19.702 3.248   -1.991  1.00 0.00 ? 131 LEU A CB   2  
ATOM 4324  C CG   . LEU A 1 131 ? -18.531 2.392   -1.474  1.00 0.00 ? 131 LEU A CG   2  
ATOM 4325  C CD1  . LEU A 1 131 ? -17.197 2.905   -2.001  1.00 0.00 ? 131 LEU A CD1  2  
ATOM 4326  C CD2  . LEU A 1 131 ? -18.530 2.348   0.051   1.00 0.00 ? 131 LEU A CD2  2  
ATOM 4327  H H    . LEU A 1 131 ? -18.750 4.918   -3.753  1.00 0.00 ? 131 LEU A H    2  
ATOM 4328  H HA   . LEU A 1 131 ? -19.724 2.186   -3.860  1.00 0.00 ? 131 LEU A HA   2  
ATOM 4329  H HB2  . LEU A 1 131 ? -19.510 4.278   -1.724  1.00 0.00 ? 131 LEU A HB2  2  
ATOM 4330  H HB3  . LEU A 1 131 ? -20.600 2.932   -1.485  1.00 0.00 ? 131 LEU A HB3  2  
ATOM 4331  H HG   . LEU A 1 131 ? -18.656 1.378   -1.832  1.00 0.00 ? 131 LEU A HG   2  
ATOM 4332  H HD11 . LEU A 1 131 ? -16.396 2.280   -1.631  1.00 0.00 ? 131 LEU A HD11 2  
ATOM 4333  H HD12 . LEU A 1 131 ? -17.041 3.921   -1.669  1.00 0.00 ? 131 LEU A HD12 2  
ATOM 4334  H HD13 . LEU A 1 131 ? -17.201 2.877   -3.081  1.00 0.00 ? 131 LEU A HD13 2  
ATOM 4335  H HD21 . LEU A 1 131 ? -17.709 1.735   0.394   1.00 0.00 ? 131 LEU A HD21 2  
ATOM 4336  H HD22 . LEU A 1 131 ? -19.461 1.925   0.399   1.00 0.00 ? 131 LEU A HD22 2  
ATOM 4337  H HD23 . LEU A 1 131 ? -18.421 3.349   0.443   1.00 0.00 ? 131 LEU A HD23 2  
ATOM 4338  N N    . LEU A 1 132 ? -21.895 4.636   -3.340  1.00 0.00 ? 132 LEU A N    2  
ATOM 4339  C CA   . LEU A 1 132 ? -23.267 5.075   -3.601  1.00 0.00 ? 132 LEU A CA   2  
ATOM 4340  C C    . LEU A 1 132 ? -23.478 6.515   -3.125  1.00 0.00 ? 132 LEU A C    2  
ATOM 4341  O O    . LEU A 1 132 ? -24.008 7.349   -3.860  1.00 0.00 ? 132 LEU A O    2  
ATOM 4342  C CB   . LEU A 1 132 ? -24.307 4.135   -2.941  1.00 0.00 ? 132 LEU A CB   2  
ATOM 4343  C CG   . LEU A 1 132 ? -24.384 4.147   -1.397  1.00 0.00 ? 132 LEU A CG   2  
ATOM 4344  C CD1  . LEU A 1 132 ? -25.592 3.348   -0.914  1.00 0.00 ? 132 LEU A CD1  2  
ATOM 4345  C CD2  . LEU A 1 132 ? -23.103 3.596   -0.771  1.00 0.00 ? 132 LEU A CD2  2  
ATOM 4346  H H    . LEU A 1 132 ? -21.311 5.203   -2.796  1.00 0.00 ? 132 LEU A H    2  
ATOM 4347  H HA   . LEU A 1 132 ? -23.413 5.050   -4.673  1.00 0.00 ? 132 LEU A HA   2  
ATOM 4348  H HB2  . LEU A 1 132 ? -25.282 4.399   -3.325  1.00 0.00 ? 132 LEU A HB2  2  
ATOM 4349  H HB3  . LEU A 1 132 ? -24.087 3.124   -3.257  1.00 0.00 ? 132 LEU A HB3  2  
ATOM 4350  H HG   . LEU A 1 132 ? -24.509 5.167   -1.059  1.00 0.00 ? 132 LEU A HG   2  
ATOM 4351  H HD11 . LEU A 1 132 ? -25.507 2.323   -1.245  1.00 0.00 ? 132 LEU A HD11 2  
ATOM 4352  H HD12 . LEU A 1 132 ? -26.495 3.782   -1.320  1.00 0.00 ? 132 LEU A HD12 2  
ATOM 4353  H HD13 . LEU A 1 132 ? -25.636 3.375   0.165   1.00 0.00 ? 132 LEU A HD13 2  
ATOM 4354  H HD21 . LEU A 1 132 ? -22.949 2.577   -1.098  1.00 0.00 ? 132 LEU A HD21 2  
ATOM 4355  H HD22 . LEU A 1 132 ? -23.187 3.620   0.305   1.00 0.00 ? 132 LEU A HD22 2  
ATOM 4356  H HD23 . LEU A 1 132 ? -22.264 4.204   -1.078  1.00 0.00 ? 132 LEU A HD23 2  
ATOM 4357  N N    . ALA A 1 133 ? -23.029 6.805   -1.903  1.00 0.00 ? 133 ALA A N    2  
ATOM 4358  C CA   . ALA A 1 133 ? -23.249 8.113   -1.280  1.00 0.00 ? 133 ALA A CA   2  
ATOM 4359  C C    . ALA A 1 133 ? -22.512 8.218   0.054   1.00 0.00 ? 133 ALA A C    2  
ATOM 4360  O O    . ALA A 1 133 ? -22.118 9.309   0.468   1.00 0.00 ? 133 ALA A O    2  
ATOM 4361  C CB   . ALA A 1 133 ? -24.741 8.370   -1.074  1.00 0.00 ? 133 ALA A CB   2  
ATOM 4362  H H    . ALA A 1 133 ? -22.519 6.129   -1.418  1.00 0.00 ? 133 ALA A H    2  
ATOM 4363  H HA   . ALA A 1 133 ? -22.866 8.870   -1.952  1.00 0.00 ? 133 ALA A HA   2  
ATOM 4364  H HB1  . ALA A 1 133 ? -25.256 8.291   -2.021  1.00 0.00 ? 133 ALA A HB1  2  
ATOM 4365  H HB2  . ALA A 1 133 ? -24.883 9.362   -0.671  1.00 0.00 ? 133 ALA A HB2  2  
ATOM 4366  H HB3  . ALA A 1 133 ? -25.142 7.641   -0.385  1.00 0.00 ? 133 ALA A HB3  2  
ATOM 4367  N N    . GLU A 1 134 ? -22.324 7.083   0.723   1.00 0.00 ? 134 GLU A N    2  
ATOM 4368  C CA   . GLU A 1 134 ? -21.653 7.040   2.004   1.00 0.00 ? 134 GLU A CA   2  
ATOM 4369  C C    . GLU A 1 134 ? -20.668 5.879   2.003   1.00 0.00 ? 134 GLU A C    2  
ATOM 4370  O O    . GLU A 1 134 ? -20.900 4.855   1.361   1.00 0.00 ? 134 GLU A O    2  
ATOM 4371  C CB   . GLU A 1 134 ? -22.677 6.898   3.146   1.00 0.00 ? 134 GLU A CB   2  
ATOM 4372  C CG   . GLU A 1 134 ? -22.060 6.893   4.543   1.00 0.00 ? 134 GLU A CG   2  
ATOM 4373  C CD   . GLU A 1 134 ? -21.185 8.109   4.806   1.00 0.00 ? 134 GLU A CD   2  
ATOM 4374  O OE1  . GLU A 1 134 ? -21.727 9.212   5.013   1.00 0.00 ? 134 GLU A OE1  2  
ATOM 4375  O OE2  . GLU A 1 134 ? -19.944 7.971   4.798   1.00 0.00 ? 134 GLU A OE2  2  
ATOM 4376  H H    . GLU A 1 134 ? -22.627 6.245   0.343   1.00 0.00 ? 134 GLU A H    2  
ATOM 4377  H HA   . GLU A 1 134 ? -21.106 7.966   2.129   1.00 0.00 ? 134 GLU A HA   2  
ATOM 4378  H HB2  . GLU A 1 134 ? -23.374 7.722   3.090   1.00 0.00 ? 134 GLU A HB2  2  
ATOM 4379  H HB3  . GLU A 1 134 ? -23.221 5.973   3.012   1.00 0.00 ? 134 GLU A HB3  2  
ATOM 4380  H HG2  . GLU A 1 134 ? -22.858 6.880   5.274   1.00 0.00 ? 134 GLU A HG2  2  
ATOM 4381  H HG3  . GLU A 1 134 ? -21.461 6.000   4.656   1.00 0.00 ? 134 GLU A HG3  2  
ATOM 4382  N N    . ALA A 1 135 ? -19.566 6.074   2.698   1.00 0.00 ? 135 ALA A N    2  
ATOM 4383  C CA   . ALA A 1 135 ? -18.485 5.093   2.763   1.00 0.00 ? 135 ALA A CA   2  
ATOM 4384  C C    . ALA A 1 135 ? -18.907 3.840   3.528   1.00 0.00 ? 135 ALA A C    2  
ATOM 4385  O O    . ALA A 1 135 ? -18.670 2.721   3.070   1.00 0.00 ? 135 ALA A O    2  
ATOM 4386  C CB   . ALA A 1 135 ? -17.253 5.719   3.400   1.00 0.00 ? 135 ALA A CB   2  
ATOM 4387  H H    . ALA A 1 135 ? -19.477 6.911   3.187   1.00 0.00 ? 135 ALA A H    2  
ATOM 4388  H HA   . ALA A 1 135 ? -18.229 4.812   1.749   1.00 0.00 ? 135 ALA A HA   2  
ATOM 4389  H HB1  . ALA A 1 135 ? -16.965 6.598   2.839   1.00 0.00 ? 135 ALA A HB1  2  
ATOM 4390  H HB2  . ALA A 1 135 ? -16.438 5.008   3.393   1.00 0.00 ? 135 ALA A HB2  2  
ATOM 4391  H HB3  . ALA A 1 135 ? -17.475 6.002   4.419   1.00 0.00 ? 135 ALA A HB3  2  
ATOM 4392  N N    . GLU A 1 136 ? -19.525 4.039   4.696   1.00 0.00 ? 136 GLU A N    2  
ATOM 4393  C CA   . GLU A 1 136 ? -20.012 2.928   5.522   1.00 0.00 ? 136 GLU A CA   2  
ATOM 4394  C C    . GLU A 1 136 ? -18.867 1.988   5.929   1.00 0.00 ? 136 GLU A C    2  
ATOM 4395  O O    . GLU A 1 136 ? -17.688 2.316   5.756   1.00 0.00 ? 136 GLU A O    2  
ATOM 4396  C CB   . GLU A 1 136 ? -21.104 2.154   4.762   1.00 0.00 ? 136 GLU A CB   2  
ATOM 4397  C CG   . GLU A 1 136 ? -22.357 2.978   4.469   1.00 0.00 ? 136 GLU A CG   2  
ATOM 4398  C CD   . GLU A 1 136 ? -23.215 3.211   5.703   1.00 0.00 ? 136 GLU A CD   2  
ATOM 4399  O OE1  . GLU A 1 136 ? -22.929 4.153   6.473   1.00 0.00 ? 136 GLU A OE1  2  
ATOM 4400  O OE2  . GLU A 1 136 ? -24.190 2.454   5.905   1.00 0.00 ? 136 GLU A OE2  2  
ATOM 4401  H H    . GLU A 1 136 ? -19.658 4.955   5.010   1.00 0.00 ? 136 GLU A H    2  
ATOM 4402  H HA   . GLU A 1 136 ? -20.444 3.352   6.417   1.00 0.00 ? 136 GLU A HA   2  
ATOM 4403  H HB2  . GLU A 1 136 ? -20.697 1.813   3.820   1.00 0.00 ? 136 GLU A HB2  2  
ATOM 4404  H HB3  . GLU A 1 136 ? -21.395 1.292   5.348   1.00 0.00 ? 136 GLU A HB3  2  
ATOM 4405  H HG2  . GLU A 1 136 ? -22.055 3.937   4.071   1.00 0.00 ? 136 GLU A HG2  2  
ATOM 4406  H HG3  . GLU A 1 136 ? -22.949 2.457   3.726   1.00 0.00 ? 136 GLU A HG3  2  
ATOM 4407  N N    . SER A 1 1   ? -10.526 -18.321 -9.970  1.00 0.00 ? 1   SER A N    3  
ATOM 4408  C CA   . SER A 1 1   ? -10.544 -17.550 -8.709  1.00 0.00 ? 1   SER A CA   3  
ATOM 4409  C C    . SER A 1 1   ? -11.407 -18.252 -7.657  1.00 0.00 ? 1   SER A C    3  
ATOM 4410  O O    . SER A 1 1   ? -12.391 -18.918 -7.992  1.00 0.00 ? 1   SER A O    3  
ATOM 4411  C CB   . SER A 1 1   ? -11.066 -16.132 -8.979  1.00 0.00 ? 1   SER A CB   3  
ATOM 4412  O OG   . SER A 1 1   ? -12.268 -16.154 -9.738  1.00 0.00 ? 1   SER A OG   3  
ATOM 4413  H H1   . SER A 1 1   ? -10.143 -19.273 -9.802  1.00 0.00 ? 1   SER A H1   3  
ATOM 4414  H H2   . SER A 1 1   ? -9.929  -17.841 -10.675 1.00 0.00 ? 1   SER A H2   3  
ATOM 4415  H H3   . SER A 1 1   ? -11.490 -18.408 -10.347 1.00 0.00 ? 1   SER A H3   3  
ATOM 4416  H HA   . SER A 1 1   ? -9.530  -17.488 -8.340  1.00 0.00 ? 1   SER A HA   3  
ATOM 4417  H HB2  . SER A 1 1   ? -11.261 -15.633 -8.040  1.00 0.00 ? 1   SER A HB2  3  
ATOM 4418  H HB3  . SER A 1 1   ? -10.321 -15.575 -9.531  1.00 0.00 ? 1   SER A HB3  3  
ATOM 4419  H HG   . SER A 1 1   ? -12.294 -15.379 -10.311 1.00 0.00 ? 1   SER A HG   3  
ATOM 4420  N N    . MET A 1 2   ? -11.018 -18.118 -6.388  1.00 0.00 ? 2   MET A N    3  
ATOM 4421  C CA   . MET A 1 2   ? -11.777 -18.693 -5.278  1.00 0.00 ? 2   MET A CA   3  
ATOM 4422  C C    . MET A 1 2   ? -13.060 -17.903 -5.065  1.00 0.00 ? 2   MET A C    3  
ATOM 4423  O O    . MET A 1 2   ? -14.154 -18.468 -5.006  1.00 0.00 ? 2   MET A O    3  
ATOM 4424  C CB   . MET A 1 2   ? -10.944 -18.682 -3.986  1.00 0.00 ? 2   MET A CB   3  
ATOM 4425  C CG   . MET A 1 2   ? -9.738  -19.611 -4.008  1.00 0.00 ? 2   MET A CG   3  
ATOM 4426  S SD   . MET A 1 2   ? -10.198 -21.348 -4.176  1.00 0.00 ? 2   MET A SD   3  
ATOM 4427  C CE   . MET A 1 2   ? -8.603  -22.139 -3.963  1.00 0.00 ? 2   MET A CE   3  
ATOM 4428  H H    . MET A 1 2   ? -10.201 -17.611 -6.193  1.00 0.00 ? 2   MET A H    3  
ATOM 4429  H HA   . MET A 1 2   ? -12.027 -19.714 -5.533  1.00 0.00 ? 2   MET A HA   3  
ATOM 4430  H HB2  . MET A 1 2   ? -10.591 -17.676 -3.811  1.00 0.00 ? 2   MET A HB2  3  
ATOM 4431  H HB3  . MET A 1 2   ? -11.579 -18.975 -3.161  1.00 0.00 ? 2   MET A HB3  3  
ATOM 4432  H HG2  . MET A 1 2   ? -9.105  -19.340 -4.841  1.00 0.00 ? 2   MET A HG2  3  
ATOM 4433  H HG3  . MET A 1 2   ? -9.189  -19.487 -3.086  1.00 0.00 ? 2   MET A HG3  3  
ATOM 4434  H HE1  . MET A 1 2   ? -8.720  -23.210 -4.034  1.00 0.00 ? 2   MET A HE1  3  
ATOM 4435  H HE2  . MET A 1 2   ? -8.201  -21.885 -2.993  1.00 0.00 ? 2   MET A HE2  3  
ATOM 4436  H HE3  . MET A 1 2   ? -7.927  -21.798 -4.733  1.00 0.00 ? 2   MET A HE3  3  
ATOM 4437  N N    . THR A 1 3   ? -12.906 -16.592 -4.957  1.00 0.00 ? 3   THR A N    3  
ATOM 4438  C CA   . THR A 1 3   ? -14.025 -15.685 -4.762  1.00 0.00 ? 3   THR A CA   3  
ATOM 4439  C C    . THR A 1 3   ? -13.986 -14.592 -5.829  1.00 0.00 ? 3   THR A C    3  
ATOM 4440  O O    . THR A 1 3   ? -12.975 -14.429 -6.522  1.00 0.00 ? 3   THR A O    3  
ATOM 4441  C CB   . THR A 1 3   ? -13.990 -15.054 -3.346  1.00 0.00 ? 3   THR A CB   3  
ATOM 4442  O OG1  . THR A 1 3   ? -15.181 -14.291 -3.107  1.00 0.00 ? 3   THR A OG1  3  
ATOM 4443  C CG2  . THR A 1 3   ? -12.766 -14.157 -3.166  1.00 0.00 ? 3   THR A CG2  3  
ATOM 4444  H H    . THR A 1 3   ? -12.002 -16.216 -5.018  1.00 0.00 ? 3   THR A H    3  
ATOM 4445  H HA   . THR A 1 3   ? -14.944 -16.247 -4.867  1.00 0.00 ? 3   THR A HA   3  
ATOM 4446  H HB   . THR A 1 3   ? -13.938 -15.852 -2.619  1.00 0.00 ? 3   THR A HB   3  
ATOM 4447  H HG1  . THR A 1 3   ? -15.667 -14.685 -2.370  1.00 0.00 ? 3   THR A HG1  3  
ATOM 4448  H HG21 . THR A 1 3   ? -11.867 -14.732 -3.342  1.00 0.00 ? 3   THR A HG21 3  
ATOM 4449  H HG22 . THR A 1 3   ? -12.751 -13.767 -2.160  1.00 0.00 ? 3   THR A HG22 3  
ATOM 4450  H HG23 . THR A 1 3   ? -12.810 -13.337 -3.869  1.00 0.00 ? 3   THR A HG23 3  
ATOM 4451  N N    . GLU A 1 4   ? -15.076 -13.851 -5.957  1.00 0.00 ? 4   GLU A N    3  
ATOM 4452  C CA   . GLU A 1 4   ? -15.184 -12.806 -6.967  1.00 0.00 ? 4   GLU A CA   3  
ATOM 4453  C C    . GLU A 1 4   ? -16.124 -11.709 -6.453  1.00 0.00 ? 4   GLU A C    3  
ATOM 4454  O O    . GLU A 1 4   ? -16.500 -11.727 -5.279  1.00 0.00 ? 4   GLU A O    3  
ATOM 4455  C CB   . GLU A 1 4   ? -15.694 -13.418 -8.285  1.00 0.00 ? 4   GLU A CB   3  
ATOM 4456  C CG   . GLU A 1 4   ? -15.400 -12.580 -9.524  1.00 0.00 ? 4   GLU A CG   3  
ATOM 4457  C CD   . GLU A 1 4   ? -15.902 -13.232 -10.801 1.00 0.00 ? 4   GLU A CD   3  
ATOM 4458  O OE1  . GLU A 1 4   ? -15.184 -14.090 -11.358 1.00 0.00 ? 4   GLU A OE1  3  
ATOM 4459  O OE2  . GLU A 1 4   ? -17.021 -12.898 -11.243 1.00 0.00 ? 4   GLU A OE2  3  
ATOM 4460  H H    . GLU A 1 4   ? -15.833 -14.006 -5.347  1.00 0.00 ? 4   GLU A H    3  
ATOM 4461  H HA   . GLU A 1 4   ? -14.201 -12.381 -7.122  1.00 0.00 ? 4   GLU A HA   3  
ATOM 4462  H HB2  . GLU A 1 4   ? -15.231 -14.386 -8.418  1.00 0.00 ? 4   GLU A HB2  3  
ATOM 4463  H HB3  . GLU A 1 4   ? -16.765 -13.554 -8.214  1.00 0.00 ? 4   GLU A HB3  3  
ATOM 4464  H HG2  . GLU A 1 4   ? -15.878 -11.616 -9.416  1.00 0.00 ? 4   GLU A HG2  3  
ATOM 4465  H HG3  . GLU A 1 4   ? -14.330 -12.439 -9.604  1.00 0.00 ? 4   GLU A HG3  3  
ATOM 4466  N N    . GLU A 1 5   ? -16.487 -10.760 -7.320  1.00 0.00 ? 5   GLU A N    3  
ATOM 4467  C CA   . GLU A 1 5   ? -17.363 -9.650  -6.947  1.00 0.00 ? 5   GLU A CA   3  
ATOM 4468  C C    . GLU A 1 5   ? -16.650 -8.735  -5.956  1.00 0.00 ? 5   GLU A C    3  
ATOM 4469  O O    . GLU A 1 5   ? -16.956 -8.725  -4.759  1.00 0.00 ? 5   GLU A O    3  
ATOM 4470  C CB   . GLU A 1 5   ? -18.695 -10.159 -6.369  1.00 0.00 ? 5   GLU A CB   3  
ATOM 4471  C CG   . GLU A 1 5   ? -19.481 -11.045 -7.328  1.00 0.00 ? 5   GLU A CG   3  
ATOM 4472  C CD   . GLU A 1 5   ? -20.699 -11.677 -6.678  1.00 0.00 ? 5   GLU A CD   3  
ATOM 4473  O OE1  . GLU A 1 5   ? -21.784 -11.054 -6.693  1.00 0.00 ? 5   GLU A OE1  3  
ATOM 4474  O OE2  . GLU A 1 5   ? -20.575 -12.799 -6.142  1.00 0.00 ? 5   GLU A OE2  3  
ATOM 4475  H H    . GLU A 1 5   ? -16.142 -10.796 -8.234  1.00 0.00 ? 5   GLU A H    3  
ATOM 4476  H HA   . GLU A 1 5   ? -17.567 -9.083  -7.847  1.00 0.00 ? 5   GLU A HA   3  
ATOM 4477  H HB2  . GLU A 1 5   ? -18.491 -10.729 -5.473  1.00 0.00 ? 5   GLU A HB2  3  
ATOM 4478  H HB3  . GLU A 1 5   ? -19.312 -9.309  -6.110  1.00 0.00 ? 5   GLU A HB3  3  
ATOM 4479  H HG2  . GLU A 1 5   ? -19.808 -10.447 -8.167  1.00 0.00 ? 5   GLU A HG2  3  
ATOM 4480  H HG3  . GLU A 1 5   ? -18.830 -11.833 -7.685  1.00 0.00 ? 5   GLU A HG3  3  
ATOM 4481  N N    . GLN A 1 6   ? -15.666 -7.999  -6.465  1.00 0.00 ? 6   GLN A N    3  
ATOM 4482  C CA   . GLN A 1 6   ? -14.872 -7.087  -5.648  1.00 0.00 ? 6   GLN A CA   3  
ATOM 4483  C C    . GLN A 1 6   ? -15.225 -5.635  -5.969  1.00 0.00 ? 6   GLN A C    3  
ATOM 4484  O O    . GLN A 1 6   ? -14.855 -5.124  -7.027  1.00 0.00 ? 6   GLN A O    3  
ATOM 4485  C CB   . GLN A 1 6   ? -13.371 -7.315  -5.881  1.00 0.00 ? 6   GLN A CB   3  
ATOM 4486  C CG   . GLN A 1 6   ? -12.876 -8.696  -5.465  1.00 0.00 ? 6   GLN A CG   3  
ATOM 4487  C CD   . GLN A 1 6   ? -11.367 -8.831  -5.588  1.00 0.00 ? 6   GLN A CD   3  
ATOM 4488  O OE1  . GLN A 1 6   ? -10.626 -8.533  -4.650  1.00 0.00 ? 6   GLN A OE1  3  
ATOM 4489  N NE2  . GLN A 1 6   ? -10.897 -9.278  -6.742  1.00 0.00 ? 6   GLN A NE2  3  
ATOM 4490  H H    . GLN A 1 6   ? -15.473 -8.065  -7.427  1.00 0.00 ? 6   GLN A H    3  
ATOM 4491  H HA   . GLN A 1 6   ? -15.098 -7.281  -4.609  1.00 0.00 ? 6   GLN A HA   3  
ATOM 4492  H HB2  . GLN A 1 6   ? -13.159 -7.185  -6.934  1.00 0.00 ? 6   GLN A HB2  3  
ATOM 4493  H HB3  . GLN A 1 6   ? -12.816 -6.575  -5.321  1.00 0.00 ? 6   GLN A HB3  3  
ATOM 4494  H HG2  . GLN A 1 6   ? -13.156 -8.871  -4.436  1.00 0.00 ? 6   GLN A HG2  3  
ATOM 4495  H HG3  . GLN A 1 6   ? -13.344 -9.439  -6.096  1.00 0.00 ? 6   GLN A HG3  3  
ATOM 4496  H HE21 . GLN A 1 6   ? -11.537 -9.500  -7.453  1.00 0.00 ? 6   GLN A HE21 3  
ATOM 4497  H HE22 . GLN A 1 6   ? -9.926  -9.369  -6.844  1.00 0.00 ? 6   GLN A HE22 3  
ATOM 4498  N N    . PRO A 1 7   ? -15.966 -4.959  -5.073  1.00 0.00 ? 7   PRO A N    3  
ATOM 4499  C CA   . PRO A 1 7   ? -16.281 -3.539  -5.219  1.00 0.00 ? 7   PRO A CA   3  
ATOM 4500  C C    . PRO A 1 7   ? -15.090 -2.667  -4.818  1.00 0.00 ? 7   PRO A C    3  
ATOM 4501  O O    . PRO A 1 7   ? -14.250 -3.089  -4.018  1.00 0.00 ? 7   PRO A O    3  
ATOM 4502  C CB   . PRO A 1 7   ? -17.466 -3.321  -4.251  1.00 0.00 ? 7   PRO A CB   3  
ATOM 4503  C CG   . PRO A 1 7   ? -17.803 -4.674  -3.699  1.00 0.00 ? 7   PRO A CG   3  
ATOM 4504  C CD   . PRO A 1 7   ? -16.567 -5.513  -3.856  1.00 0.00 ? 7   PRO A CD   3  
ATOM 4505  H HA   . PRO A 1 7   ? -16.582 -3.298  -6.231  1.00 0.00 ? 7   PRO A HA   3  
ATOM 4506  H HB2  . PRO A 1 7   ? -17.174 -2.639  -3.464  1.00 0.00 ? 7   PRO A HB2  3  
ATOM 4507  H HB3  . PRO A 1 7   ? -18.302 -2.902  -4.796  1.00 0.00 ? 7   PRO A HB3  3  
ATOM 4508  H HG2  . PRO A 1 7   ? -18.070 -4.590  -2.654  1.00 0.00 ? 7   PRO A HG2  3  
ATOM 4509  H HG3  . PRO A 1 7   ? -18.622 -5.106  -4.258  1.00 0.00 ? 7   PRO A HG3  3  
ATOM 4510  H HD2  . PRO A 1 7   ? -15.909 -5.389  -3.006  1.00 0.00 ? 7   PRO A HD2  3  
ATOM 4511  H HD3  . PRO A 1 7   ? -16.826 -6.555  -3.989  1.00 0.00 ? 7   PRO A HD3  3  
ATOM 4512  N N    . VAL A 1 8   ? -15.024 -1.451  -5.355  1.00 0.00 ? 8   VAL A N    3  
ATOM 4513  C CA   . VAL A 1 8   ? -13.939 -0.526  -5.021  1.00 0.00 ? 8   VAL A CA   3  
ATOM 4514  C C    . VAL A 1 8   ? -13.944 -0.204  -3.525  1.00 0.00 ? 8   VAL A C    3  
ATOM 4515  O O    . VAL A 1 8   ? -12.925 0.170   -2.952  1.00 0.00 ? 8   VAL A O    3  
ATOM 4516  C CB   . VAL A 1 8   ? -14.025 0.790   -5.838  1.00 0.00 ? 8   VAL A CB   3  
ATOM 4517  C CG1  . VAL A 1 8   ? -13.931 0.505   -7.337  1.00 0.00 ? 8   VAL A CG1  3  
ATOM 4518  C CG2  . VAL A 1 8   ? -15.303 1.559   -5.509  1.00 0.00 ? 8   VAL A CG2  3  
ATOM 4519  H H    . VAL A 1 8   ? -15.719 -1.170  -5.991  1.00 0.00 ? 8   VAL A H    3  
ATOM 4520  H HA   . VAL A 1 8   ? -13.004 -1.015  -5.265  1.00 0.00 ? 8   VAL A HA   3  
ATOM 4521  H HB   . VAL A 1 8   ? -13.180 1.409   -5.565  1.00 0.00 ? 8   VAL A HB   3  
ATOM 4522  H HG11 . VAL A 1 8   ? -12.991 0.016   -7.554  1.00 0.00 ? 8   VAL A HG11 3  
ATOM 4523  H HG12 . VAL A 1 8   ? -13.987 1.434   -7.886  1.00 0.00 ? 8   VAL A HG12 3  
ATOM 4524  H HG13 . VAL A 1 8   ? -14.748 -0.138  -7.636  1.00 0.00 ? 8   VAL A HG13 3  
ATOM 4525  H HG21 . VAL A 1 8   ? -15.336 2.468   -6.094  1.00 0.00 ? 8   VAL A HG21 3  
ATOM 4526  H HG22 . VAL A 1 8   ? -15.315 1.809   -4.458  1.00 0.00 ? 8   VAL A HG22 3  
ATOM 4527  H HG23 . VAL A 1 8   ? -16.163 0.949   -5.744  1.00 0.00 ? 8   VAL A HG23 3  
ATOM 4528  N N    . ALA A 1 9   ? -15.103 -0.378  -2.896  1.00 0.00 ? 9   ALA A N    3  
ATOM 4529  C CA   . ALA A 1 9   ? -15.251 -0.147  -1.461  1.00 0.00 ? 9   ALA A CA   3  
ATOM 4530  C C    . ALA A 1 9   ? -14.342 -1.077  -0.651  1.00 0.00 ? 9   ALA A C    3  
ATOM 4531  O O    . ALA A 1 9   ? -14.034 -0.805  0.513   1.00 0.00 ? 9   ALA A O    3  
ATOM 4532  C CB   . ALA A 1 9   ? -16.708 -0.331  -1.050  1.00 0.00 ? 9   ALA A CB   3  
ATOM 4533  H H    . ALA A 1 9   ? -15.884 -0.665  -3.413  1.00 0.00 ? 9   ALA A H    3  
ATOM 4534  H HA   . ALA A 1 9   ? -14.972 0.880   -1.260  1.00 0.00 ? 9   ALA A HA   3  
ATOM 4535  H HB1  . ALA A 1 9   ? -16.818 -0.109  0.002   1.00 0.00 ? 9   ALA A HB1  3  
ATOM 4536  H HB2  . ALA A 1 9   ? -17.010 -1.351  -1.237  1.00 0.00 ? 9   ALA A HB2  3  
ATOM 4537  H HB3  . ALA A 1 9   ? -17.333 0.339   -1.625  1.00 0.00 ? 9   ALA A HB3  3  
ATOM 4538  N N    . SER A 1 10  ? -13.894 -2.161  -1.286  1.00 0.00 ? 10  SER A N    3  
ATOM 4539  C CA   . SER A 1 10  ? -13.069 -3.173  -0.629  1.00 0.00 ? 10  SER A CA   3  
ATOM 4540  C C    . SER A 1 10  ? -11.740 -2.586  -0.135  1.00 0.00 ? 10  SER A C    3  
ATOM 4541  O O    . SER A 1 10  ? -11.053 -3.198  0.684   1.00 0.00 ? 10  SER A O    3  
ATOM 4542  C CB   . SER A 1 10  ? -12.811 -4.345  -1.592  1.00 0.00 ? 10  SER A CB   3  
ATOM 4543  O OG   . SER A 1 10  ? -12.176 -5.435  -0.938  1.00 0.00 ? 10  SER A OG   3  
ATOM 4544  H H    . SER A 1 10  ? -14.128 -2.285  -2.231  1.00 0.00 ? 10  SER A H    3  
ATOM 4545  H HA   . SER A 1 10  ? -13.621 -3.542  0.224   1.00 0.00 ? 10  SER A HA   3  
ATOM 4546  H HB2  . SER A 1 10  ? -13.752 -4.688  -1.996  1.00 0.00 ? 10  SER A HB2  3  
ATOM 4547  H HB3  . SER A 1 10  ? -12.177 -4.010  -2.401  1.00 0.00 ? 10  SER A HB3  3  
ATOM 4548  H HG   . SER A 1 10  ? -11.440 -5.109  -0.403  1.00 0.00 ? 10  SER A HG   3  
ATOM 4549  N N    . TRP A 1 11  ? -11.380 -1.401  -0.631  1.00 0.00 ? 11  TRP A N    3  
ATOM 4550  C CA   . TRP A 1 11  ? -10.146 -0.736  -0.209  1.00 0.00 ? 11  TRP A CA   3  
ATOM 4551  C C    . TRP A 1 11  ? -10.171 -0.447  1.294   1.00 0.00 ? 11  TRP A C    3  
ATOM 4552  O O    . TRP A 1 11  ? -9.134  -0.468  1.961   1.00 0.00 ? 11  TRP A O    3  
ATOM 4553  C CB   . TRP A 1 11  ? -9.947  0.582   -0.966  1.00 0.00 ? 11  TRP A CB   3  
ATOM 4554  C CG   . TRP A 1 11  ? -9.906  0.445   -2.461  1.00 0.00 ? 11  TRP A CG   3  
ATOM 4555  C CD1  . TRP A 1 11  ? -9.490  -0.634  -3.193  1.00 0.00 ? 11  TRP A CD1  3  
ATOM 4556  C CD2  . TRP A 1 11  ? -10.279 1.450   -3.406  1.00 0.00 ? 11  TRP A CD2  3  
ATOM 4557  N NE1  . TRP A 1 11  ? -9.598  -0.359  -4.535  1.00 0.00 ? 11  TRP A NE1  3  
ATOM 4558  C CE2  . TRP A 1 11  ? -10.079 0.916   -4.690  1.00 0.00 ? 11  TRP A CE2  3  
ATOM 4559  C CE3  . TRP A 1 11  ? -10.769 2.750   -3.284  1.00 0.00 ? 11  TRP A CE3  3  
ATOM 4560  C CZ2  . TRP A 1 11  ? -10.352 1.641   -5.847  1.00 0.00 ? 11  TRP A CZ2  3  
ATOM 4561  C CZ3  . TRP A 1 11  ? -11.040 3.471   -4.428  1.00 0.00 ? 11  TRP A CZ3  3  
ATOM 4562  C CH2  . TRP A 1 11  ? -10.832 2.916   -5.698  1.00 0.00 ? 11  TRP A CH2  3  
ATOM 4563  H H    . TRP A 1 11  ? -11.954 -0.967  -1.300  1.00 0.00 ? 11  TRP A H    3  
ATOM 4564  H HA   . TRP A 1 11  ? -9.320  -1.396  -0.426  1.00 0.00 ? 11  TRP A HA   3  
ATOM 4565  H HB2  . TRP A 1 11  ? -10.758 1.252   -0.722  1.00 0.00 ? 11  TRP A HB2  3  
ATOM 4566  H HB3  . TRP A 1 11  ? -9.015  1.030   -0.651  1.00 0.00 ? 11  TRP A HB3  3  
ATOM 4567  H HD1  . TRP A 1 11  ? -9.139  -1.562  -2.765  1.00 0.00 ? 11  TRP A HD1  3  
ATOM 4568  H HE1  . TRP A 1 11  ? -9.367  -0.976  -5.265  1.00 0.00 ? 11  TRP A HE1  3  
ATOM 4569  H HE3  . TRP A 1 11  ? -10.936 3.193   -2.313  1.00 0.00 ? 11  TRP A HE3  3  
ATOM 4570  H HZ2  . TRP A 1 11  ? -10.196 1.226   -6.832  1.00 0.00 ? 11  TRP A HZ2  3  
ATOM 4571  H HZ3  . TRP A 1 11  ? -11.418 4.481   -4.347  1.00 0.00 ? 11  TRP A HZ3  3  
ATOM 4572  H HH2  . TRP A 1 11  ? -11.057 3.516   -6.568  1.00 0.00 ? 11  TRP A HH2  3  
ATOM 4573  N N    . ALA A 1 12  ? -11.368 -0.200  1.821   1.00 0.00 ? 12  ALA A N    3  
ATOM 4574  C CA   . ALA A 1 12  ? -11.537 0.182   3.224   1.00 0.00 ? 12  ALA A CA   3  
ATOM 4575  C C    . ALA A 1 12  ? -11.306 -1.002  4.162   1.00 0.00 ? 12  ALA A C    3  
ATOM 4576  O O    . ALA A 1 12  ? -11.284 -0.843  5.385   1.00 0.00 ? 12  ALA A O    3  
ATOM 4577  C CB   . ALA A 1 12  ? -12.924 0.775   3.444   1.00 0.00 ? 12  ALA A CB   3  
ATOM 4578  H H    . ALA A 1 12  ? -12.164 -0.288  1.253   1.00 0.00 ? 12  ALA A H    3  
ATOM 4579  H HA   . ALA A 1 12  ? -10.808 0.949   3.447   1.00 0.00 ? 12  ALA A HA   3  
ATOM 4580  H HB1  . ALA A 1 12  ? -13.069 1.612   2.776   1.00 0.00 ? 12  ALA A HB1  3  
ATOM 4581  H HB2  . ALA A 1 12  ? -13.015 1.114   4.467   1.00 0.00 ? 12  ALA A HB2  3  
ATOM 4582  H HB3  . ALA A 1 12  ? -13.675 0.024   3.247   1.00 0.00 ? 12  ALA A HB3  3  
ATOM 4583  N N    . LEU A 1 13  ? -11.132 -2.186  3.590   1.00 0.00 ? 13  LEU A N    3  
ATOM 4584  C CA   . LEU A 1 13  ? -10.909 -3.394  4.379   1.00 0.00 ? 13  LEU A CA   3  
ATOM 4585  C C    . LEU A 1 13  ? -9.454  -3.481  4.840   1.00 0.00 ? 13  LEU A C    3  
ATOM 4586  O O    . LEU A 1 13  ? -9.178  -3.860  5.979   1.00 0.00 ? 13  LEU A O    3  
ATOM 4587  C CB   . LEU A 1 13  ? -11.288 -4.642  3.569   1.00 0.00 ? 13  LEU A CB   3  
ATOM 4588  C CG   . LEU A 1 13  ? -12.758 -4.714  3.120   1.00 0.00 ? 13  LEU A CG   3  
ATOM 4589  C CD1  . LEU A 1 13  ? -13.006 -5.959  2.272   1.00 0.00 ? 13  LEU A CD1  3  
ATOM 4590  C CD2  . LEU A 1 13  ? -13.696 -4.687  4.328   1.00 0.00 ? 13  LEU A CD2  3  
ATOM 4591  H H    . LEU A 1 13  ? -11.154 -2.251  2.613   1.00 0.00 ? 13  LEU A H    3  
ATOM 4592  H HA   . LEU A 1 13  ? -11.545 -3.340  5.253   1.00 0.00 ? 13  LEU A HA   3  
ATOM 4593  H HB2  . LEU A 1 13  ? -10.660 -4.676  2.688   1.00 0.00 ? 13  LEU A HB2  3  
ATOM 4594  H HB3  . LEU A 1 13  ? -11.075 -5.515  4.172   1.00 0.00 ? 13  LEU A HB3  3  
ATOM 4595  H HG   . LEU A 1 13  ? -12.981 -3.851  2.506   1.00 0.00 ? 13  LEU A HG   3  
ATOM 4596  H HD11 . LEU A 1 13  ? -14.041 -5.990  1.967   1.00 0.00 ? 13  LEU A HD11 3  
ATOM 4597  H HD12 . LEU A 1 13  ? -12.777 -6.844  2.850   1.00 0.00 ? 13  LEU A HD12 3  
ATOM 4598  H HD13 . LEU A 1 13  ? -12.376 -5.930  1.394   1.00 0.00 ? 13  LEU A HD13 3  
ATOM 4599  H HD21 . LEU A 1 13  ? -13.549 -3.769  4.879   1.00 0.00 ? 13  LEU A HD21 3  
ATOM 4600  H HD22 . LEU A 1 13  ? -13.486 -5.530  4.969   1.00 0.00 ? 13  LEU A HD22 3  
ATOM 4601  H HD23 . LEU A 1 13  ? -14.720 -4.740  3.988   1.00 0.00 ? 13  LEU A HD23 3  
ATOM 4602  N N    . SER A 1 14  ? -8.526  -3.123  3.952   1.00 0.00 ? 14  SER A N    3  
ATOM 4603  C CA   . SER A 1 14  ? -7.098  -3.181  4.264   1.00 0.00 ? 14  SER A CA   3  
ATOM 4604  C C    . SER A 1 14  ? -6.316  -2.202  3.385   1.00 0.00 ? 14  SER A C    3  
ATOM 4605  O O    . SER A 1 14  ? -6.515  -2.157  2.167   1.00 0.00 ? 14  SER A O    3  
ATOM 4606  C CB   . SER A 1 14  ? -6.565  -4.605  4.048   1.00 0.00 ? 14  SER A CB   3  
ATOM 4607  O OG   . SER A 1 14  ? -7.392  -5.569  4.684   1.00 0.00 ? 14  SER A OG   3  
ATOM 4608  H H    . SER A 1 14  ? -8.807  -2.811  3.067   1.00 0.00 ? 14  SER A H    3  
ATOM 4609  H HA   . SER A 1 14  ? -6.968  -2.907  5.302   1.00 0.00 ? 14  SER A HA   3  
ATOM 4610  H HB2  . SER A 1 14  ? -6.534  -4.819  2.991   1.00 0.00 ? 14  SER A HB2  3  
ATOM 4611  H HB3  . SER A 1 14  ? -5.567  -4.680  4.457   1.00 0.00 ? 14  SER A HB3  3  
ATOM 4612  H HG   . SER A 1 14  ? -7.688  -5.219  5.537   1.00 0.00 ? 14  SER A HG   3  
ATOM 4613  N N    . PHE A 1 15  ? -5.426  -1.427  4.006   1.00 0.00 ? 15  PHE A N    3  
ATOM 4614  C CA   . PHE A 1 15  ? -4.582  -0.479  3.276   1.00 0.00 ? 15  PHE A CA   3  
ATOM 4615  C C    . PHE A 1 15  ? -3.631  -1.226  2.345   1.00 0.00 ? 15  PHE A C    3  
ATOM 4616  O O    . PHE A 1 15  ? -3.472  -0.860  1.185   1.00 0.00 ? 15  PHE A O    3  
ATOM 4617  C CB   . PHE A 1 15  ? -3.787  0.404   4.255   1.00 0.00 ? 15  PHE A CB   3  
ATOM 4618  C CG   . PHE A 1 15  ? -2.874  1.403   3.580   1.00 0.00 ? 15  PHE A CG   3  
ATOM 4619  C CD1  . PHE A 1 15  ? -3.299  2.116   2.467   1.00 0.00 ? 15  PHE A CD1  3  
ATOM 4620  C CD2  . PHE A 1 15  ? -1.594  1.636   4.065   1.00 0.00 ? 15  PHE A CD2  3  
ATOM 4621  C CE1  . PHE A 1 15  ? -2.470  3.034   1.855   1.00 0.00 ? 15  PHE A CE1  3  
ATOM 4622  C CE2  . PHE A 1 15  ? -0.762  2.554   3.455   1.00 0.00 ? 15  PHE A CE2  3  
ATOM 4623  C CZ   . PHE A 1 15  ? -1.200  3.254   2.348   1.00 0.00 ? 15  PHE A CZ   3  
ATOM 4624  H H    . PHE A 1 15  ? -5.329  -1.499  4.981   1.00 0.00 ? 15  PHE A H    3  
ATOM 4625  H HA   . PHE A 1 15  ? -5.231  0.150   2.681   1.00 0.00 ? 15  PHE A HA   3  
ATOM 4626  H HB2  . PHE A 1 15  ? -4.481  0.957   4.871   1.00 0.00 ? 15  PHE A HB2  3  
ATOM 4627  H HB3  . PHE A 1 15  ? -3.181  -0.230  4.887   1.00 0.00 ? 15  PHE A HB3  3  
ATOM 4628  H HD1  . PHE A 1 15  ? -4.292  1.947   2.077   1.00 0.00 ? 15  PHE A HD1  3  
ATOM 4629  H HD2  . PHE A 1 15  ? -1.248  1.089   4.930   1.00 0.00 ? 15  PHE A HD2  3  
ATOM 4630  H HE1  . PHE A 1 15  ? -2.814  3.582   0.989   1.00 0.00 ? 15  PHE A HE1  3  
ATOM 4631  H HE2  . PHE A 1 15  ? 0.232   2.723   3.843   1.00 0.00 ? 15  PHE A HE2  3  
ATOM 4632  H HZ   . PHE A 1 15  ? -0.550  3.972   1.871   1.00 0.00 ? 15  PHE A HZ   3  
ATOM 4633  N N    . GLU A 1 16  ? -3.004  -2.272  2.879   1.00 0.00 ? 16  GLU A N    3  
ATOM 4634  C CA   . GLU A 1 16  ? -2.125  -3.151  2.113   1.00 0.00 ? 16  GLU A CA   3  
ATOM 4635  C C    . GLU A 1 16  ? -2.758  -3.527  0.776   1.00 0.00 ? 16  GLU A C    3  
ATOM 4636  O O    . GLU A 1 16  ? -2.132  -3.388  -0.274  1.00 0.00 ? 16  GLU A O    3  
ATOM 4637  C CB   . GLU A 1 16  ? -1.825  -4.420  2.921   1.00 0.00 ? 16  GLU A CB   3  
ATOM 4638  C CG   . GLU A 1 16  ? -0.906  -5.415  2.216   1.00 0.00 ? 16  GLU A CG   3  
ATOM 4639  C CD   . GLU A 1 16  ? -0.714  -6.695  3.016   1.00 0.00 ? 16  GLU A CD   3  
ATOM 4640  O OE1  . GLU A 1 16  ? 0.130   -6.708  3.936   1.00 0.00 ? 16  GLU A OE1  3  
ATOM 4641  O OE2  . GLU A 1 16  ? -1.427  -7.690  2.742   1.00 0.00 ? 16  GLU A OE2  3  
ATOM 4642  H H    . GLU A 1 16  ? -3.121  -2.446  3.830   1.00 0.00 ? 16  GLU A H    3  
ATOM 4643  H HA   . GLU A 1 16  ? -1.201  -2.620  1.934   1.00 0.00 ? 16  GLU A HA   3  
ATOM 4644  H HB2  . GLU A 1 16  ? -1.359  -4.135  3.853   1.00 0.00 ? 16  GLU A HB2  3  
ATOM 4645  H HB3  . GLU A 1 16  ? -2.759  -4.920  3.139   1.00 0.00 ? 16  GLU A HB3  3  
ATOM 4646  H HG2  . GLU A 1 16  ? -1.334  -5.665  1.255   1.00 0.00 ? 16  GLU A HG2  3  
ATOM 4647  H HG3  . GLU A 1 16  ? 0.060   -4.950  2.067   1.00 0.00 ? 16  GLU A HG3  3  
ATOM 4648  N N    . ARG A 1 17  ? -4.009  -3.988  0.818   1.00 0.00 ? 17  ARG A N    3  
ATOM 4649  C CA   . ARG A 1 17  ? -4.705  -4.404  -0.396  1.00 0.00 ? 17  ARG A CA   3  
ATOM 4650  C C    . ARG A 1 17  ? -4.836  -3.222  -1.351  1.00 0.00 ? 17  ARG A C    3  
ATOM 4651  O O    . ARG A 1 17  ? -4.454  -3.324  -2.512  1.00 0.00 ? 17  ARG A O    3  
ATOM 4652  C CB   . ARG A 1 17  ? -6.084  -5.010  -0.069  1.00 0.00 ? 17  ARG A CB   3  
ATOM 4653  C CG   . ARG A 1 17  ? -6.778  -5.663  -1.275  1.00 0.00 ? 17  ARG A CG   3  
ATOM 4654  C CD   . ARG A 1 17  ? -7.600  -4.668  -2.097  1.00 0.00 ? 17  ARG A CD   3  
ATOM 4655  N NE   . ARG A 1 17  ? -7.847  -5.148  -3.461  1.00 0.00 ? 17  ARG A NE   3  
ATOM 4656  C CZ   . ARG A 1 17  ? -8.765  -6.057  -3.800  1.00 0.00 ? 17  ARG A CZ   3  
ATOM 4657  N NH1  . ARG A 1 17  ? -9.528  -6.635  -2.877  1.00 0.00 ? 17  ARG A NH1  3  
ATOM 4658  N NH2  . ARG A 1 17  ? -8.910  -6.390  -5.077  1.00 0.00 ? 17  ARG A NH2  3  
ATOM 4659  H H    . ARG A 1 17  ? -4.468  -4.048  1.680   1.00 0.00 ? 17  ARG A H    3  
ATOM 4660  H HA   . ARG A 1 17  ? -4.095  -5.162  -0.871  1.00 0.00 ? 17  ARG A HA   3  
ATOM 4661  H HB2  . ARG A 1 17  ? -5.958  -5.764  0.696   1.00 0.00 ? 17  ARG A HB2  3  
ATOM 4662  H HB3  . ARG A 1 17  ? -6.727  -4.231  0.314   1.00 0.00 ? 17  ARG A HB3  3  
ATOM 4663  H HG2  . ARG A 1 17  ? -6.025  -6.099  -1.916  1.00 0.00 ? 17  ARG A HG2  3  
ATOM 4664  H HG3  . ARG A 1 17  ? -7.435  -6.445  -0.917  1.00 0.00 ? 17  ARG A HG3  3  
ATOM 4665  H HD2  . ARG A 1 17  ? -8.548  -4.507  -1.605  1.00 0.00 ? 17  ARG A HD2  3  
ATOM 4666  H HD3  . ARG A 1 17  ? -7.063  -3.730  -2.150  1.00 0.00 ? 17  ARG A HD3  3  
ATOM 4667  H HE   . ARG A 1 17  ? -7.293  -4.758  -4.177  1.00 0.00 ? 17  ARG A HE   3  
ATOM 4668  H HH11 . ARG A 1 17  ? -9.426  -6.393  -1.908  1.00 0.00 ? 17  ARG A HH11 3  
ATOM 4669  H HH12 . ARG A 1 17  ? -10.208 -7.324  -3.149  1.00 0.00 ? 17  ARG A HH12 3  
ATOM 4670  H HH21 . ARG A 1 17  ? -8.333  -5.954  -5.782  1.00 0.00 ? 17  ARG A HH21 3  
ATOM 4671  H HH22 . ARG A 1 17  ? -9.589  -7.077  -5.346  1.00 0.00 ? 17  ARG A HH22 3  
ATOM 4672  N N    . LEU A 1 18  ? -5.360  -2.101  -0.849  1.00 0.00 ? 18  LEU A N    3  
ATOM 4673  C CA   . LEU A 1 18  ? -5.491  -0.872  -1.644  1.00 0.00 ? 18  LEU A CA   3  
ATOM 4674  C C    . LEU A 1 18  ? -4.164  -0.510  -2.307  1.00 0.00 ? 18  LEU A C    3  
ATOM 4675  O O    . LEU A 1 18  ? -4.098  -0.223  -3.503  1.00 0.00 ? 18  LEU A O    3  
ATOM 4676  C CB   . LEU A 1 18  ? -5.937  0.294   -0.742  1.00 0.00 ? 18  LEU A CB   3  
ATOM 4677  C CG   . LEU A 1 18  ? -5.775  1.705   -1.351  1.00 0.00 ? 18  LEU A CG   3  
ATOM 4678  C CD1  . LEU A 1 18  ? -6.784  1.948   -2.466  1.00 0.00 ? 18  LEU A CD1  3  
ATOM 4679  C CD2  . LEU A 1 18  ? -5.885  2.779   -0.274  1.00 0.00 ? 18  LEU A CD2  3  
ATOM 4680  H H    . LEU A 1 18  ? -5.661  -2.095  0.086   1.00 0.00 ? 18  LEU A H    3  
ATOM 4681  H HA   . LEU A 1 18  ? -6.238  -1.040  -2.407  1.00 0.00 ? 18  LEU A HA   3  
ATOM 4682  H HB2  . LEU A 1 18  ? -6.979  0.149   -0.493  1.00 0.00 ? 18  LEU A HB2  3  
ATOM 4683  H HB3  . LEU A 1 18  ? -5.359  0.254   0.172   1.00 0.00 ? 18  LEU A HB3  3  
ATOM 4684  H HG   . LEU A 1 18  ? -4.788  1.782   -1.787  1.00 0.00 ? 18  LEU A HG   3  
ATOM 4685  H HD11 . LEU A 1 18  ? -6.616  2.924   -2.899  1.00 0.00 ? 18  LEU A HD11 3  
ATOM 4686  H HD12 . LEU A 1 18  ? -7.786  1.900   -2.066  1.00 0.00 ? 18  LEU A HD12 3  
ATOM 4687  H HD13 . LEU A 1 18  ? -6.665  1.193   -3.229  1.00 0.00 ? 18  LEU A HD13 3  
ATOM 4688  H HD21 . LEU A 1 18  ? -5.799  3.756   -0.728  1.00 0.00 ? 18  LEU A HD21 3  
ATOM 4689  H HD22 . LEU A 1 18  ? -5.088  2.650   0.446   1.00 0.00 ? 18  LEU A HD22 3  
ATOM 4690  H HD23 . LEU A 1 18  ? -6.840  2.698   0.227   1.00 0.00 ? 18  LEU A HD23 3  
ATOM 4691  N N    . LEU A 1 19  ? -3.117  -0.553  -1.505  1.00 0.00 ? 19  LEU A N    3  
ATOM 4692  C CA   . LEU A 1 19  ? -1.806  -0.062  -1.889  1.00 0.00 ? 19  LEU A CA   3  
ATOM 4693  C C    . LEU A 1 19  ? -1.068  -1.070  -2.777  1.00 0.00 ? 19  LEU A C    3  
ATOM 4694  O O    . LEU A 1 19  ? -0.183  -0.705  -3.548  1.00 0.00 ? 19  LEU A O    3  
ATOM 4695  C CB   . LEU A 1 19  ? -1.008  0.241   -0.615  1.00 0.00 ? 19  LEU A CB   3  
ATOM 4696  C CG   . LEU A 1 19  ? 0.333   0.944   -0.828  1.00 0.00 ? 19  LEU A CG   3  
ATOM 4697  C CD1  . LEU A 1 19  ? 0.147   2.262   -1.578  1.00 0.00 ? 19  LEU A CD1  3  
ATOM 4698  C CD2  . LEU A 1 19  ? 1.038   1.175   0.500   1.00 0.00 ? 19  LEU A CD2  3  
ATOM 4699  H H    . LEU A 1 19  ? -3.228  -0.934  -0.612  1.00 0.00 ? 19  LEU A H    3  
ATOM 4700  H HA   . LEU A 1 19  ? -1.943  0.856   -2.443  1.00 0.00 ? 19  LEU A HA   3  
ATOM 4701  H HB2  . LEU A 1 19  ? -1.620  0.862   0.024   1.00 0.00 ? 19  LEU A HB2  3  
ATOM 4702  H HB3  . LEU A 1 19  ? -0.823  -0.693  -0.104  1.00 0.00 ? 19  LEU A HB3  3  
ATOM 4703  H HG   . LEU A 1 19  ? 0.959   0.302   -1.424  1.00 0.00 ? 19  LEU A HG   3  
ATOM 4704  H HD11 . LEU A 1 19  ? 1.102   2.757   -1.682  1.00 0.00 ? 19  LEU A HD11 3  
ATOM 4705  H HD12 . LEU A 1 19  ? -0.532  2.899   -1.027  1.00 0.00 ? 19  LEU A HD12 3  
ATOM 4706  H HD13 . LEU A 1 19  ? -0.264  2.063   -2.558  1.00 0.00 ? 19  LEU A HD13 3  
ATOM 4707  H HD21 . LEU A 1 19  ? 1.202   0.227   0.990   1.00 0.00 ? 19  LEU A HD21 3  
ATOM 4708  H HD22 . LEU A 1 19  ? 0.428   1.804   1.131   1.00 0.00 ? 19  LEU A HD22 3  
ATOM 4709  H HD23 . LEU A 1 19  ? 1.989   1.657   0.325   1.00 0.00 ? 19  LEU A HD23 3  
ATOM 4710  N N    . GLN A 1 20  ? -1.437  -2.338  -2.662  1.00 0.00 ? 20  GLN A N    3  
ATOM 4711  C CA   . GLN A 1 20  ? -0.827  -3.395  -3.471  1.00 0.00 ? 20  GLN A CA   3  
ATOM 4712  C C    . GLN A 1 20  ? -1.685  -3.674  -4.711  1.00 0.00 ? 20  GLN A C    3  
ATOM 4713  O O    . GLN A 1 20  ? -1.268  -4.390  -5.626  1.00 0.00 ? 20  GLN A O    3  
ATOM 4714  C CB   . GLN A 1 20  ? -0.665  -4.671  -2.626  1.00 0.00 ? 20  GLN A CB   3  
ATOM 4715  C CG   . GLN A 1 20  ? 0.118   -5.797  -3.303  1.00 0.00 ? 20  GLN A CG   3  
ATOM 4716  C CD   . GLN A 1 20  ? 1.637   -5.655  -3.217  1.00 0.00 ? 20  GLN A CD   3  
ATOM 4717  O OE1  . GLN A 1 20  ? 2.351   -6.657  -3.175  1.00 0.00 ? 20  GLN A OE1  3  
ATOM 4718  N NE2  . GLN A 1 20  ? 2.147   -4.429  -3.204  1.00 0.00 ? 20  GLN A NE2  3  
ATOM 4719  H H    . GLN A 1 20  ? -2.135  -2.573  -2.016  1.00 0.00 ? 20  GLN A H    3  
ATOM 4720  H HA   . GLN A 1 20  ? 0.149   -3.056  -3.791  1.00 0.00 ? 20  GLN A HA   3  
ATOM 4721  H HB2  . GLN A 1 20  ? -0.155  -4.415  -1.709  1.00 0.00 ? 20  GLN A HB2  3  
ATOM 4722  H HB3  . GLN A 1 20  ? -1.649  -5.048  -2.379  1.00 0.00 ? 20  GLN A HB3  3  
ATOM 4723  H HG2  . GLN A 1 20  ? -0.157  -6.732  -2.837  1.00 0.00 ? 20  GLN A HG2  3  
ATOM 4724  H HG3  . GLN A 1 20  ? -0.163  -5.832  -4.346  1.00 0.00 ? 20  GLN A HG3  3  
ATOM 4725  H HE21 . GLN A 1 20  ? 1.539   -3.669  -3.250  1.00 0.00 ? 20  GLN A HE21 3  
ATOM 4726  H HE22 . GLN A 1 20  ? 3.127   -4.333  -3.145  1.00 0.00 ? 20  GLN A HE22 3  
ATOM 4727  N N    . ASP A 1 21  ? -2.884  -3.096  -4.732  1.00 0.00 ? 21  ASP A N    3  
ATOM 4728  C CA   . ASP A 1 21  ? -3.825  -3.282  -5.837  1.00 0.00 ? 21  ASP A CA   3  
ATOM 4729  C C    . ASP A 1 21  ? -3.565  -2.234  -6.921  1.00 0.00 ? 21  ASP A C    3  
ATOM 4730  O O    . ASP A 1 21  ? -3.458  -1.049  -6.617  1.00 0.00 ? 21  ASP A O    3  
ATOM 4731  C CB   . ASP A 1 21  ? -5.269  -3.158  -5.322  1.00 0.00 ? 21  ASP A CB   3  
ATOM 4732  C CG   . ASP A 1 21  ? -6.306  -3.615  -6.334  1.00 0.00 ? 21  ASP A CG   3  
ATOM 4733  O OD1  . ASP A 1 21  ? -6.583  -2.867  -7.291  1.00 0.00 ? 21  ASP A OD1  3  
ATOM 4734  O OD2  . ASP A 1 21  ? -6.855  -4.728  -6.166  1.00 0.00 ? 21  ASP A OD2  3  
ATOM 4735  H H    . ASP A 1 21  ? -3.143  -2.515  -3.985  1.00 0.00 ? 21  ASP A H    3  
ATOM 4736  H HA   . ASP A 1 21  ? -3.675  -4.271  -6.247  1.00 0.00 ? 21  ASP A HA   3  
ATOM 4737  H HB2  . ASP A 1 21  ? -5.375  -3.760  -4.430  1.00 0.00 ? 21  ASP A HB2  3  
ATOM 4738  H HB3  . ASP A 1 21  ? -5.467  -2.125  -5.071  1.00 0.00 ? 21  ASP A HB3  3  
ATOM 4739  N N    . PRO A 1 22  ? -3.455  -2.646  -8.199  1.00 0.00 ? 22  PRO A N    3  
ATOM 4740  C CA   . PRO A 1 22  ? -3.166  -1.715  -9.300  1.00 0.00 ? 22  PRO A CA   3  
ATOM 4741  C C    . PRO A 1 22  ? -4.284  -0.688  -9.509  1.00 0.00 ? 22  PRO A C    3  
ATOM 4742  O O    . PRO A 1 22  ? -4.019  0.478   -9.813  1.00 0.00 ? 22  PRO A O    3  
ATOM 4743  C CB   . PRO A 1 22  ? -3.024  -2.635  -10.526 1.00 0.00 ? 22  PRO A CB   3  
ATOM 4744  C CG   . PRO A 1 22  ? -3.770  -3.875  -10.158 1.00 0.00 ? 22  PRO A CG   3  
ATOM 4745  C CD   . PRO A 1 22  ? -3.597  -4.037  -8.673  1.00 0.00 ? 22  PRO A CD   3  
ATOM 4746  H HA   . PRO A 1 22  ? -2.234  -1.192  -9.130  1.00 0.00 ? 22  PRO A HA   3  
ATOM 4747  H HB2  . PRO A 1 22  ? -3.453  -2.156  -11.396 1.00 0.00 ? 22  PRO A HB2  3  
ATOM 4748  H HB3  . PRO A 1 22  ? -1.978  -2.843  -10.705 1.00 0.00 ? 22  PRO A HB3  3  
ATOM 4749  H HG2  . PRO A 1 22  ? -4.817  -3.761  -10.405 1.00 0.00 ? 22  PRO A HG2  3  
ATOM 4750  H HG3  . PRO A 1 22  ? -3.353  -4.725  -10.681 1.00 0.00 ? 22  PRO A HG3  3  
ATOM 4751  H HD2  . PRO A 1 22  ? -4.469  -4.505  -8.238  1.00 0.00 ? 22  PRO A HD2  3  
ATOM 4752  H HD3  . PRO A 1 22  ? -2.708  -4.612  -8.452  1.00 0.00 ? 22  PRO A HD3  3  
ATOM 4753  N N    . LEU A 1 23  ? -5.527  -1.124  -9.329  1.00 0.00 ? 23  LEU A N    3  
ATOM 4754  C CA   . LEU A 1 23  ? -6.689  -0.253  -9.508  1.00 0.00 ? 23  LEU A CA   3  
ATOM 4755  C C    . LEU A 1 23  ? -6.814  0.658   -8.286  1.00 0.00 ? 23  LEU A C    3  
ATOM 4756  O O    . LEU A 1 23  ? -7.042  1.872   -8.404  1.00 0.00 ? 23  LEU A O    3  
ATOM 4757  C CB   . LEU A 1 23  ? -7.955  -1.119  -9.704  1.00 0.00 ? 23  LEU A CB   3  
ATOM 4758  C CG   . LEU A 1 23  ? -9.200  -0.412  -10.285 1.00 0.00 ? 23  LEU A CG   3  
ATOM 4759  C CD1  . LEU A 1 23  ? -10.232 -1.442  -10.743 1.00 0.00 ? 23  LEU A CD1  3  
ATOM 4760  C CD2  . LEU A 1 23  ? -9.833  0.539   -9.269  1.00 0.00 ? 23  LEU A CD2  3  
ATOM 4761  H H    . LEU A 1 23  ? -5.672  -2.055  -9.049  1.00 0.00 ? 23  LEU A H    3  
ATOM 4762  H HA   . LEU A 1 23  ? -6.526  0.352   -10.389 1.00 0.00 ? 23  LEU A HA   3  
ATOM 4763  H HB2  . LEU A 1 23  ? -7.697  -1.935  -10.364 1.00 0.00 ? 23  LEU A HB2  3  
ATOM 4764  H HB3  . LEU A 1 23  ? -8.224  -1.539  -8.744  1.00 0.00 ? 23  LEU A HB3  3  
ATOM 4765  H HG   . LEU A 1 23  ? -8.907  0.167   -11.148 1.00 0.00 ? 23  LEU A HG   3  
ATOM 4766  H HD11 . LEU A 1 23  ? -11.087 -0.932  -11.161 1.00 0.00 ? 23  LEU A HD11 3  
ATOM 4767  H HD12 . LEU A 1 23  ? -10.547 -2.040  -9.899  1.00 0.00 ? 23  LEU A HD12 3  
ATOM 4768  H HD13 . LEU A 1 23  ? -9.793  -2.082  -11.493 1.00 0.00 ? 23  LEU A HD13 3  
ATOM 4769  H HD21 . LEU A 1 23  ? -10.715 0.991   -9.699  1.00 0.00 ? 23  LEU A HD21 3  
ATOM 4770  H HD22 . LEU A 1 23  ? -9.125  1.313   -9.011  1.00 0.00 ? 23  LEU A HD22 3  
ATOM 4771  H HD23 . LEU A 1 23  ? -10.106 -0.010  -8.379  1.00 0.00 ? 23  LEU A HD23 3  
ATOM 4772  N N    . GLY A 1 24  ? -6.629  0.058   -7.114  1.00 0.00 ? 24  GLY A N    3  
ATOM 4773  C CA   . GLY A 1 24  ? -6.673  0.797   -5.869  1.00 0.00 ? 24  GLY A CA   3  
ATOM 4774  C C    . GLY A 1 24  ? -5.626  1.889   -5.818  1.00 0.00 ? 24  GLY A C    3  
ATOM 4775  O O    . GLY A 1 24  ? -5.951  3.066   -5.639  1.00 0.00 ? 24  GLY A O    3  
ATOM 4776  H H    . GLY A 1 24  ? -6.456  -0.908  -7.099  1.00 0.00 ? 24  GLY A H    3  
ATOM 4777  H HA2  . GLY A 1 24  ? -7.654  1.239   -5.753  1.00 0.00 ? 24  GLY A HA2  3  
ATOM 4778  H HA3  . GLY A 1 24  ? -6.499  0.109   -5.054  1.00 0.00 ? 24  GLY A HA3  3  
ATOM 4779  N N    . LEU A 1 25  ? -4.366  1.500   -5.998  1.00 0.00 ? 25  LEU A N    3  
ATOM 4780  C CA   . LEU A 1 25  ? -3.254  2.443   -5.974  1.00 0.00 ? 25  LEU A CA   3  
ATOM 4781  C C    . LEU A 1 25  ? -3.415  3.472   -7.095  1.00 0.00 ? 25  LEU A C    3  
ATOM 4782  O O    . LEU A 1 25  ? -2.941  4.596   -6.978  1.00 0.00 ? 25  LEU A O    3  
ATOM 4783  C CB   . LEU A 1 25  ? -1.906  1.703   -6.111  1.00 0.00 ? 25  LEU A CB   3  
ATOM 4784  C CG   . LEU A 1 25  ? -0.745  2.243   -5.243  1.00 0.00 ? 25  LEU A CG   3  
ATOM 4785  C CD1  . LEU A 1 25  ? 0.545   1.482   -5.529  1.00 0.00 ? 25  LEU A CD1  3  
ATOM 4786  C CD2  . LEU A 1 25  ? -0.533  3.741   -5.446  1.00 0.00 ? 25  LEU A CD2  3  
ATOM 4787  H H    . LEU A 1 25  ? -4.179  0.549   -6.139  1.00 0.00 ? 25  LEU A H    3  
ATOM 4788  H HA   . LEU A 1 25  ? -3.281  2.958   -5.025  1.00 0.00 ? 25  LEU A HA   3  
ATOM 4789  H HB2  . LEU A 1 25  ? -2.066  0.667   -5.848  1.00 0.00 ? 25  LEU A HB2  3  
ATOM 4790  H HB3  . LEU A 1 25  ? -1.598  1.745   -7.146  1.00 0.00 ? 25  LEU A HB3  3  
ATOM 4791  H HG   . LEU A 1 25  ? -0.991  2.084   -4.202  1.00 0.00 ? 25  LEU A HG   3  
ATOM 4792  H HD11 . LEU A 1 25  ? 0.392   0.428   -5.342  1.00 0.00 ? 25  LEU A HD11 3  
ATOM 4793  H HD12 . LEU A 1 25  ? 1.331   1.847   -4.884  1.00 0.00 ? 25  LEU A HD12 3  
ATOM 4794  H HD13 . LEU A 1 25  ? 0.833   1.625   -6.561  1.00 0.00 ? 25  LEU A HD13 3  
ATOM 4795  H HD21 . LEU A 1 25  ? -1.437  4.272   -5.181  1.00 0.00 ? 25  LEU A HD21 3  
ATOM 4796  H HD22 . LEU A 1 25  ? -0.292  3.938   -6.481  1.00 0.00 ? 25  LEU A HD22 3  
ATOM 4797  H HD23 . LEU A 1 25  ? 0.277   4.080   -4.817  1.00 0.00 ? 25  LEU A HD23 3  
ATOM 4798  N N    . ALA A 1 26  ? -4.090  3.083   -8.177  1.00 0.00 ? 26  ALA A N    3  
ATOM 4799  C CA   . ALA A 1 26  ? -4.351  4.001   -9.282  1.00 0.00 ? 26  ALA A CA   3  
ATOM 4800  C C    . ALA A 1 26  ? -5.050  5.261   -8.780  1.00 0.00 ? 26  ALA A C    3  
ATOM 4801  O O    . ALA A 1 26  ? -4.537  6.371   -8.944  1.00 0.00 ? 26  ALA A O    3  
ATOM 4802  C CB   . ALA A 1 26  ? -5.183  3.323   -10.366 1.00 0.00 ? 26  ALA A CB   3  
ATOM 4803  H H    . ALA A 1 26  ? -4.410  2.157   -8.237  1.00 0.00 ? 26  ALA A H    3  
ATOM 4804  H HA   . ALA A 1 26  ? -3.397  4.279   -9.713  1.00 0.00 ? 26  ALA A HA   3  
ATOM 4805  H HB1  . ALA A 1 26  ? -5.301  3.994   -11.205 1.00 0.00 ? 26  ALA A HB1  3  
ATOM 4806  H HB2  . ALA A 1 26  ? -6.156  3.070   -9.969  1.00 0.00 ? 26  ALA A HB2  3  
ATOM 4807  H HB3  . ALA A 1 26  ? -4.683  2.423   -10.692 1.00 0.00 ? 26  ALA A HB3  3  
ATOM 4808  N N    . TYR A 1 27  ? -6.209  5.081   -8.147  1.00 0.00 ? 27  TYR A N    3  
ATOM 4809  C CA   . TYR A 1 27  ? -6.962  6.209   -7.590  1.00 0.00 ? 27  TYR A CA   3  
ATOM 4810  C C    . TYR A 1 27  ? -6.221  6.821   -6.405  1.00 0.00 ? 27  TYR A C    3  
ATOM 4811  O O    . TYR A 1 27  ? -6.183  8.045   -6.247  1.00 0.00 ? 27  TYR A O    3  
ATOM 4812  C CB   . TYR A 1 27  ? -8.363  5.762   -7.145  1.00 0.00 ? 27  TYR A CB   3  
ATOM 4813  C CG   . TYR A 1 27  ? -9.319  5.482   -8.288  1.00 0.00 ? 27  TYR A CG   3  
ATOM 4814  C CD1  . TYR A 1 27  ? -9.264  4.287   -8.996  1.00 0.00 ? 27  TYR A CD1  3  
ATOM 4815  C CD2  . TYR A 1 27  ? -10.282 6.416   -8.652  1.00 0.00 ? 27  TYR A CD2  3  
ATOM 4816  C CE1  . TYR A 1 27  ? -10.139 4.033   -10.032 1.00 0.00 ? 27  TYR A CE1  3  
ATOM 4817  C CE2  . TYR A 1 27  ? -11.163 6.168   -9.686  1.00 0.00 ? 27  TYR A CE2  3  
ATOM 4818  C CZ   . TYR A 1 27  ? -11.087 4.974   -10.374 1.00 0.00 ? 27  TYR A CZ   3  
ATOM 4819  O OH   . TYR A 1 27  ? -11.963 4.715   -11.408 1.00 0.00 ? 27  TYR A OH   3  
ATOM 4820  H H    . TYR A 1 27  ? -6.563  4.166   -8.042  1.00 0.00 ? 27  TYR A H    3  
ATOM 4821  H HA   . TYR A 1 27  ? -7.059  6.962   -8.363  1.00 0.00 ? 27  TYR A HA   3  
ATOM 4822  H HB2  . TYR A 1 27  ? -8.275  4.857   -6.560  1.00 0.00 ? 27  TYR A HB2  3  
ATOM 4823  H HB3  . TYR A 1 27  ? -8.801  6.535   -6.527  1.00 0.00 ? 27  TYR A HB3  3  
ATOM 4824  H HD1  . TYR A 1 27  ? -8.520  3.550   -8.727  1.00 0.00 ? 27  TYR A HD1  3  
ATOM 4825  H HD2  . TYR A 1 27  ? -10.338 7.351   -8.112  1.00 0.00 ? 27  TYR A HD2  3  
ATOM 4826  H HE1  . TYR A 1 27  ? -10.080 3.098   -10.571 1.00 0.00 ? 27  TYR A HE1  3  
ATOM 4827  H HE2  . TYR A 1 27  ? -11.903 6.912   -9.948  1.00 0.00 ? 27  TYR A HE2  3  
ATOM 4828  H HH   . TYR A 1 27  ? -12.071 5.513   -11.945 1.00 0.00 ? 27  TYR A HH   3  
ATOM 4829  N N    . PHE A 1 28  ? -5.627  5.960   -5.584  1.00 0.00 ? 28  PHE A N    3  
ATOM 4830  C CA   . PHE A 1 28  ? -4.943  6.394   -4.369  1.00 0.00 ? 28  PHE A CA   3  
ATOM 4831  C C    . PHE A 1 28  ? -3.804  7.362   -4.692  1.00 0.00 ? 28  PHE A C    3  
ATOM 4832  O O    . PHE A 1 28  ? -3.691  8.423   -4.075  1.00 0.00 ? 28  PHE A O    3  
ATOM 4833  C CB   . PHE A 1 28  ? -4.414  5.179   -3.594  1.00 0.00 ? 28  PHE A CB   3  
ATOM 4834  C CG   . PHE A 1 28  ? -3.749  5.530   -2.283  1.00 0.00 ? 28  PHE A CG   3  
ATOM 4835  C CD1  . PHE A 1 28  ? -4.405  6.317   -1.346  1.00 0.00 ? 28  PHE A CD1  3  
ATOM 4836  C CD2  . PHE A 1 28  ? -2.473  5.069   -1.986  1.00 0.00 ? 28  PHE A CD2  3  
ATOM 4837  C CE1  . PHE A 1 28  ? -3.804  6.637   -0.144  1.00 0.00 ? 28  PHE A CE1  3  
ATOM 4838  C CE2  . PHE A 1 28  ? -1.870  5.388   -0.784  1.00 0.00 ? 28  PHE A CE2  3  
ATOM 4839  C CZ   . PHE A 1 28  ? -2.535  6.172   0.136   1.00 0.00 ? 28  PHE A CZ   3  
ATOM 4840  H H    . PHE A 1 28  ? -5.653  5.003   -5.800  1.00 0.00 ? 28  PHE A H    3  
ATOM 4841  H HA   . PHE A 1 28  ? -5.669  6.909   -3.755  1.00 0.00 ? 28  PHE A HA   3  
ATOM 4842  H HB2  . PHE A 1 28  ? -5.238  4.512   -3.380  1.00 0.00 ? 28  PHE A HB2  3  
ATOM 4843  H HB3  . PHE A 1 28  ? -3.693  4.658   -4.209  1.00 0.00 ? 28  PHE A HB3  3  
ATOM 4844  H HD1  . PHE A 1 28  ? -5.398  6.683   -1.563  1.00 0.00 ? 28  PHE A HD1  3  
ATOM 4845  H HD2  . PHE A 1 28  ? -1.949  4.455   -2.705  1.00 0.00 ? 28  PHE A HD2  3  
ATOM 4846  H HE1  . PHE A 1 28  ? -4.326  7.252   0.575   1.00 0.00 ? 28  PHE A HE1  3  
ATOM 4847  H HE2  . PHE A 1 28  ? -0.877  5.024   -0.564  1.00 0.00 ? 28  PHE A HE2  3  
ATOM 4848  H HZ   . PHE A 1 28  ? -2.063  6.420   1.077   1.00 0.00 ? 28  PHE A HZ   3  
ATOM 4849  N N    . THR A 1 29  ? -2.976  7.001   -5.668  1.00 0.00 ? 29  THR A N    3  
ATOM 4850  C CA   . THR A 1 29  ? -1.842  7.833   -6.043  1.00 0.00 ? 29  THR A CA   3  
ATOM 4851  C C    . THR A 1 29  ? -2.335  9.132   -6.677  1.00 0.00 ? 29  THR A C    3  
ATOM 4852  O O    . THR A 1 29  ? -1.769  10.192  -6.434  1.00 0.00 ? 29  THR A O    3  
ATOM 4853  C CB   . THR A 1 29  ? -0.857  7.098   -6.998  1.00 0.00 ? 29  THR A CB   3  
ATOM 4854  O OG1  . THR A 1 29  ? 0.358   7.848   -7.138  1.00 0.00 ? 29  THR A OG1  3  
ATOM 4855  C CG2  . THR A 1 29  ? -1.463  6.871   -8.379  1.00 0.00 ? 29  THR A CG2  3  
ATOM 4856  H H    . THR A 1 29  ? -3.134  6.164   -6.146  1.00 0.00 ? 29  THR A H    3  
ATOM 4857  H HA   . THR A 1 29  ? -1.305  8.078   -5.134  1.00 0.00 ? 29  THR A HA   3  
ATOM 4858  H HB   . THR A 1 29  ? -0.620  6.135   -6.567  1.00 0.00 ? 29  THR A HB   3  
ATOM 4859  H HG1  . THR A 1 29  ? 1.035   7.286   -7.528  1.00 0.00 ? 29  THR A HG1  3  
ATOM 4860  H HG21 . THR A 1 29  ? -0.756  6.338   -9.000  1.00 0.00 ? 29  THR A HG21 3  
ATOM 4861  H HG22 . THR A 1 29  ? -1.692  7.823   -8.833  1.00 0.00 ? 29  THR A HG22 3  
ATOM 4862  H HG23 . THR A 1 29  ? -2.369  6.290   -8.286  1.00 0.00 ? 29  THR A HG23 3  
ATOM 4863  N N    . GLU A 1 30  ? -3.417  9.048   -7.457  1.00 0.00 ? 30  GLU A N    3  
ATOM 4864  C CA   . GLU A 1 30  ? -4.006  10.232  -8.085  1.00 0.00 ? 30  GLU A CA   3  
ATOM 4865  C C    . GLU A 1 30  ? -4.393  11.268  -7.029  1.00 0.00 ? 30  GLU A C    3  
ATOM 4866  O O    . GLU A 1 30  ? -3.961  12.424  -7.086  1.00 0.00 ? 30  GLU A O    3  
ATOM 4867  C CB   . GLU A 1 30  ? -5.238  9.849   -8.921  1.00 0.00 ? 30  GLU A CB   3  
ATOM 4868  C CG   . GLU A 1 30  ? -4.908  9.088   -10.199 1.00 0.00 ? 30  GLU A CG   3  
ATOM 4869  C CD   . GLU A 1 30  ? -6.138  8.800   -11.046 1.00 0.00 ? 30  GLU A CD   3  
ATOM 4870  O OE1  . GLU A 1 30  ? -7.061  8.117   -10.554 1.00 0.00 ? 30  GLU A OE1  3  
ATOM 4871  O OE2  . GLU A 1 30  ? -6.188  9.247   -12.210 1.00 0.00 ? 30  GLU A OE2  3  
ATOM 4872  H H    . GLU A 1 30  ? -3.828  8.168   -7.617  1.00 0.00 ? 30  GLU A H    3  
ATOM 4873  H HA   . GLU A 1 30  ? -3.260  10.664  -8.737  1.00 0.00 ? 30  GLU A HA   3  
ATOM 4874  H HB2  . GLU A 1 30  ? -5.885  9.228   -8.317  1.00 0.00 ? 30  GLU A HB2  3  
ATOM 4875  H HB3  . GLU A 1 30  ? -5.775  10.746  -9.190  1.00 0.00 ? 30  GLU A HB3  3  
ATOM 4876  H HG2  . GLU A 1 30  ? -4.214  9.677   -10.783 1.00 0.00 ? 30  GLU A HG2  3  
ATOM 4877  H HG3  . GLU A 1 30  ? -4.444  8.150   -9.935  1.00 0.00 ? 30  GLU A HG3  3  
ATOM 4878  N N    . PHE A 1 31  ? -5.182  10.836  -6.049  1.00 0.00 ? 31  PHE A N    3  
ATOM 4879  C CA   . PHE A 1 31  ? -5.676  11.733  -5.005  1.00 0.00 ? 31  PHE A CA   3  
ATOM 4880  C C    . PHE A 1 31  ? -4.532  12.207  -4.104  1.00 0.00 ? 31  PHE A C    3  
ATOM 4881  O O    . PHE A 1 31  ? -4.654  13.210  -3.404  1.00 0.00 ? 31  PHE A O    3  
ATOM 4882  C CB   . PHE A 1 31  ? -6.760  11.038  -4.168  1.00 0.00 ? 31  PHE A CB   3  
ATOM 4883  C CG   . PHE A 1 31  ? -7.429  11.954  -3.171  1.00 0.00 ? 31  PHE A CG   3  
ATOM 4884  C CD1  . PHE A 1 31  ? -8.418  12.837  -3.581  1.00 0.00 ? 31  PHE A CD1  3  
ATOM 4885  C CD2  . PHE A 1 31  ? -7.062  11.942  -1.830  1.00 0.00 ? 31  PHE A CD2  3  
ATOM 4886  C CE1  . PHE A 1 31  ? -9.026  13.689  -2.679  1.00 0.00 ? 31  PHE A CE1  3  
ATOM 4887  C CE2  . PHE A 1 31  ? -7.669  12.793  -0.924  1.00 0.00 ? 31  PHE A CE2  3  
ATOM 4888  C CZ   . PHE A 1 31  ? -8.651  13.667  -1.349  1.00 0.00 ? 31  PHE A CZ   3  
ATOM 4889  H H    . PHE A 1 31  ? -5.437  9.888   -6.024  1.00 0.00 ? 31  PHE A H    3  
ATOM 4890  H HA   . PHE A 1 31  ? -6.111  12.595  -5.492  1.00 0.00 ? 31  PHE A HA   3  
ATOM 4891  H HB2  . PHE A 1 31  ? -7.524  10.651  -4.829  1.00 0.00 ? 31  PHE A HB2  3  
ATOM 4892  H HB3  . PHE A 1 31  ? -6.317  10.215  -3.625  1.00 0.00 ? 31  PHE A HB3  3  
ATOM 4893  H HD1  . PHE A 1 31  ? -8.715  12.857  -4.621  1.00 0.00 ? 31  PHE A HD1  3  
ATOM 4894  H HD2  . PHE A 1 31  ? -6.295  11.259  -1.494  1.00 0.00 ? 31  PHE A HD2  3  
ATOM 4895  H HE1  . PHE A 1 31  ? -9.793  14.370  -3.014  1.00 0.00 ? 31  PHE A HE1  3  
ATOM 4896  H HE2  . PHE A 1 31  ? -7.374  12.775  0.116   1.00 0.00 ? 31  PHE A HE2  3  
ATOM 4897  H HZ   . PHE A 1 31  ? -9.126  14.334  -0.642  1.00 0.00 ? 31  PHE A HZ   3  
ATOM 4898  N N    . LEU A 1 32  ? -3.424  11.481  -4.123  1.00 0.00 ? 32  LEU A N    3  
ATOM 4899  C CA   . LEU A 1 32  ? -2.263  11.836  -3.314  1.00 0.00 ? 32  LEU A CA   3  
ATOM 4900  C C    . LEU A 1 32  ? -1.253  12.635  -4.150  1.00 0.00 ? 32  LEU A C    3  
ATOM 4901  O O    . LEU A 1 32  ? -0.367  13.306  -3.614  1.00 0.00 ? 32  LEU A O    3  
ATOM 4902  C CB   . LEU A 1 32  ? -1.629  10.551  -2.750  1.00 0.00 ? 32  LEU A CB   3  
ATOM 4903  C CG   . LEU A 1 32  ? -0.639  10.736  -1.587  1.00 0.00 ? 32  LEU A CG   3  
ATOM 4904  C CD1  . LEU A 1 32  ? -1.285  11.499  -0.437  1.00 0.00 ? 32  LEU A CD1  3  
ATOM 4905  C CD2  . LEU A 1 32  ? -0.118  9.382   -1.106  1.00 0.00 ? 32  LEU A CD2  3  
ATOM 4906  H H    . LEU A 1 32  ? -3.390  10.676  -4.682  1.00 0.00 ? 32  LEU A H    3  
ATOM 4907  H HA   . LEU A 1 32  ? -2.601  12.453  -2.492  1.00 0.00 ? 32  LEU A HA   3  
ATOM 4908  H HB2  . LEU A 1 32  ? -2.427  9.909   -2.410  1.00 0.00 ? 32  LEU A HB2  3  
ATOM 4909  H HB3  . LEU A 1 32  ? -1.110  10.050  -3.555  1.00 0.00 ? 32  LEU A HB3  3  
ATOM 4910  H HG   . LEU A 1 32  ? 0.207   11.313  -1.928  1.00 0.00 ? 32  LEU A HG   3  
ATOM 4911  H HD11 . LEU A 1 32  ? -0.555  11.645  0.347   1.00 0.00 ? 32  LEU A HD11 3  
ATOM 4912  H HD12 . LEU A 1 32  ? -2.122  10.936  -0.049  1.00 0.00 ? 32  LEU A HD12 3  
ATOM 4913  H HD13 . LEU A 1 32  ? -1.627  12.461  -0.789  1.00 0.00 ? 32  LEU A HD13 3  
ATOM 4914  H HD21 . LEU A 1 32  ? 0.593   9.533   -0.305  1.00 0.00 ? 32  LEU A HD21 3  
ATOM 4915  H HD22 . LEU A 1 32  ? 0.369   8.872   -1.923  1.00 0.00 ? 32  LEU A HD22 3  
ATOM 4916  H HD23 . LEU A 1 32  ? -0.942  8.781   -0.747  1.00 0.00 ? 32  LEU A HD23 3  
ATOM 4917  N N    . LYS A 1 33  ? -1.411  12.580  -5.473  1.00 0.00 ? 33  LYS A N    3  
ATOM 4918  C CA   . LYS A 1 33  ? -0.489  13.239  -6.401  1.00 0.00 ? 33  LYS A CA   3  
ATOM 4919  C C    . LYS A 1 33  ? -0.965  14.654  -6.736  1.00 0.00 ? 33  LYS A C    3  
ATOM 4920  O O    . LYS A 1 33  ? -0.169  15.501  -7.141  1.00 0.00 ? 33  LYS A O    3  
ATOM 4921  C CB   . LYS A 1 33  ? -0.345  12.401  -7.681  1.00 0.00 ? 33  LYS A CB   3  
ATOM 4922  C CG   . LYS A 1 33  ? 0.771   12.862  -8.616  1.00 0.00 ? 33  LYS A CG   3  
ATOM 4923  C CD   . LYS A 1 33  ? 0.977   11.887  -9.777  1.00 0.00 ? 33  LYS A CD   3  
ATOM 4924  C CE   . LYS A 1 33  ? 1.347   10.489  -9.285  1.00 0.00 ? 33  LYS A CE   3  
ATOM 4925  N NZ   . LYS A 1 33  ? 1.622   9.556   -10.410 1.00 0.00 ? 33  LYS A NZ   3  
ATOM 4926  H H    . LYS A 1 33  ? -2.166  12.069  -5.839  1.00 0.00 ? 33  LYS A H    3  
ATOM 4927  H HA   . LYS A 1 33  ? 0.476   13.305  -5.917  1.00 0.00 ? 33  LYS A HA   3  
ATOM 4928  H HB2  . LYS A 1 33  ? -0.147  11.376  -7.400  1.00 0.00 ? 33  LYS A HB2  3  
ATOM 4929  H HB3  . LYS A 1 33  ? -1.279  12.436  -8.225  1.00 0.00 ? 33  LYS A HB3  3  
ATOM 4930  H HG2  . LYS A 1 33  ? 0.512   13.832  -9.017  1.00 0.00 ? 33  LYS A HG2  3  
ATOM 4931  H HG3  . LYS A 1 33  ? 1.691   12.938  -8.054  1.00 0.00 ? 33  LYS A HG3  3  
ATOM 4932  H HD2  . LYS A 1 33  ? 0.063   11.825  -10.351 1.00 0.00 ? 33  LYS A HD2  3  
ATOM 4933  H HD3  . LYS A 1 33  ? 1.772   12.259  -10.408 1.00 0.00 ? 33  LYS A HD3  3  
ATOM 4934  H HE2  . LYS A 1 33  ? 2.230   10.560  -8.666  1.00 0.00 ? 33  LYS A HE2  3  
ATOM 4935  H HE3  . LYS A 1 33  ? 0.528   10.098  -8.698  1.00 0.00 ? 33  LYS A HE3  3  
ATOM 4936  H HZ1  . LYS A 1 33  ? 1.906   8.627   -10.043 1.00 0.00 ? 33  LYS A HZ1  3  
ATOM 4937  H HZ2  . LYS A 1 33  ? 2.392   9.925   -11.006 1.00 0.00 ? 33  LYS A HZ2  3  
ATOM 4938  H HZ3  . LYS A 1 33  ? 0.772   9.437   -10.996 1.00 0.00 ? 33  LYS A HZ3  3  
ATOM 4939  N N    . LYS A 1 34  ? -2.260  14.908  -6.552  1.00 0.00 ? 34  LYS A N    3  
ATOM 4940  C CA   . LYS A 1 34  ? -2.830  16.248  -6.758  1.00 0.00 ? 34  LYS A CA   3  
ATOM 4941  C C    . LYS A 1 34  ? -2.122  17.277  -5.871  1.00 0.00 ? 34  LYS A C    3  
ATOM 4942  O O    . LYS A 1 34  ? -2.018  18.456  -6.216  1.00 0.00 ? 34  LYS A O    3  
ATOM 4943  C CB   . LYS A 1 34  ? -4.332  16.238  -6.439  1.00 0.00 ? 34  LYS A CB   3  
ATOM 4944  C CG   . LYS A 1 34  ? -4.651  15.738  -5.033  1.00 0.00 ? 34  LYS A CG   3  
ATOM 4945  C CD   . LYS A 1 34  ? -6.135  15.853  -4.695  1.00 0.00 ? 34  LYS A CD   3  
ATOM 4946  C CE   . LYS A 1 34  ? -6.568  17.303  -4.512  1.00 0.00 ? 34  LYS A CE   3  
ATOM 4947  N NZ   . LYS A 1 34  ? -5.845  17.963  -3.389  1.00 0.00 ? 34  LYS A NZ   3  
ATOM 4948  H H    . LYS A 1 34  ? -2.855  14.175  -6.282  1.00 0.00 ? 34  LYS A H    3  
ATOM 4949  H HA   . LYS A 1 34  ? -2.688  16.518  -7.795  1.00 0.00 ? 34  LYS A HA   3  
ATOM 4950  H HB2  . LYS A 1 34  ? -4.719  17.243  -6.540  1.00 0.00 ? 34  LYS A HB2  3  
ATOM 4951  H HB3  . LYS A 1 34  ? -4.835  15.596  -7.150  1.00 0.00 ? 34  LYS A HB3  3  
ATOM 4952  H HG2  . LYS A 1 34  ? -4.360  14.699  -4.960  1.00 0.00 ? 34  LYS A HG2  3  
ATOM 4953  H HG3  . LYS A 1 34  ? -4.083  16.318  -4.318  1.00 0.00 ? 34  LYS A HG3  3  
ATOM 4954  H HD2  . LYS A 1 34  ? -6.712  15.415  -5.496  1.00 0.00 ? 34  LYS A HD2  3  
ATOM 4955  H HD3  . LYS A 1 34  ? -6.327  15.311  -3.778  1.00 0.00 ? 34  LYS A HD3  3  
ATOM 4956  H HE2  . LYS A 1 34  ? -6.368  17.846  -5.424  1.00 0.00 ? 34  LYS A HE2  3  
ATOM 4957  H HE3  . LYS A 1 34  ? -7.628  17.325  -4.307  1.00 0.00 ? 34  LYS A HE3  3  
ATOM 4958  H HZ1  . LYS A 1 34  ? -4.858  18.150  -3.657  1.00 0.00 ? 34  LYS A HZ1  3  
ATOM 4959  H HZ2  . LYS A 1 34  ? -5.848  17.352  -2.547  1.00 0.00 ? 34  LYS A HZ2  3  
ATOM 4960  H HZ3  . LYS A 1 34  ? -6.303  18.866  -3.150  1.00 0.00 ? 34  LYS A HZ3  3  
ATOM 4961  N N    . GLU A 1 35  ? -1.646  16.805  -4.725  1.00 0.00 ? 35  GLU A N    3  
ATOM 4962  C CA   . GLU A 1 35  ? -0.939  17.636  -3.751  1.00 0.00 ? 35  GLU A CA   3  
ATOM 4963  C C    . GLU A 1 35  ? 0.522   17.194  -3.639  1.00 0.00 ? 35  GLU A C    3  
ATOM 4964  O O    . GLU A 1 35  ? 1.258   17.627  -2.753  1.00 0.00 ? 35  GLU A O    3  
ATOM 4965  C CB   . GLU A 1 35  ? -1.673  17.558  -2.402  1.00 0.00 ? 35  GLU A CB   3  
ATOM 4966  C CG   . GLU A 1 35  ? -2.206  16.164  -2.077  1.00 0.00 ? 35  GLU A CG   3  
ATOM 4967  C CD   . GLU A 1 35  ? -3.351  16.188  -1.075  1.00 0.00 ? 35  GLU A CD   3  
ATOM 4968  O OE1  . GLU A 1 35  ? -4.462  16.640  -1.442  1.00 0.00 ? 35  GLU A OE1  3  
ATOM 4969  O OE2  . GLU A 1 35  ? -3.152  15.755  0.079   1.00 0.00 ? 35  GLU A OE2  3  
ATOM 4970  H H    . GLU A 1 35  ? -1.780  15.857  -4.520  1.00 0.00 ? 35  GLU A H    3  
ATOM 4971  H HA   . GLU A 1 35  ? -0.961  18.658  -4.103  1.00 0.00 ? 35  GLU A HA   3  
ATOM 4972  H HB2  . GLU A 1 35  ? -0.996  17.858  -1.612  1.00 0.00 ? 35  GLU A HB2  3  
ATOM 4973  H HB3  . GLU A 1 35  ? -2.509  18.244  -2.423  1.00 0.00 ? 35  GLU A HB3  3  
ATOM 4974  H HG2  . GLU A 1 35  ? -2.561  15.706  -2.991  1.00 0.00 ? 35  GLU A HG2  3  
ATOM 4975  H HG3  . GLU A 1 35  ? -1.399  15.567  -1.672  1.00 0.00 ? 35  GLU A HG3  3  
ATOM 4976  N N    . PHE A 1 36  ? 0.908   16.308  -4.560  1.00 0.00 ? 36  PHE A N    3  
ATOM 4977  C CA   . PHE A 1 36  ? 2.287   15.839  -4.715  1.00 0.00 ? 36  PHE A CA   3  
ATOM 4978  C C    . PHE A 1 36  ? 2.733   15.055  -3.483  1.00 0.00 ? 36  PHE A C    3  
ATOM 4979  O O    . PHE A 1 36  ? 3.902   14.722  -3.334  1.00 0.00 ? 36  PHE A O    3  
ATOM 4980  C CB   . PHE A 1 36  ? 3.243   17.015  -5.000  1.00 0.00 ? 36  PHE A CB   3  
ATOM 4981  C CG   . PHE A 1 36  ? 4.596   16.585  -5.527  1.00 0.00 ? 36  PHE A CG   3  
ATOM 4982  C CD1  . PHE A 1 36  ? 4.736   16.162  -6.844  1.00 0.00 ? 36  PHE A CD1  3  
ATOM 4983  C CD2  . PHE A 1 36  ? 5.722   16.592  -4.711  1.00 0.00 ? 36  PHE A CD2  3  
ATOM 4984  C CE1  . PHE A 1 36  ? 5.965   15.761  -7.333  1.00 0.00 ? 36  PHE A CE1  3  
ATOM 4985  C CE2  . PHE A 1 36  ? 6.952   16.187  -5.198  1.00 0.00 ? 36  PHE A CE2  3  
ATOM 4986  C CZ   . PHE A 1 36  ? 7.073   15.772  -6.510  1.00 0.00 ? 36  PHE A CZ   3  
ATOM 4987  H H    . PHE A 1 36  ? 0.230   15.944  -5.155  1.00 0.00 ? 36  PHE A H    3  
ATOM 4988  H HA   . PHE A 1 36  ? 2.300   15.169  -5.563  1.00 0.00 ? 36  PHE A HA   3  
ATOM 4989  H HB2  . PHE A 1 36  ? 2.791   17.665  -5.736  1.00 0.00 ? 36  PHE A HB2  3  
ATOM 4990  H HB3  . PHE A 1 36  ? 3.399   17.573  -4.087  1.00 0.00 ? 36  PHE A HB3  3  
ATOM 4991  H HD1  . PHE A 1 36  ? 3.871   16.153  -7.491  1.00 0.00 ? 36  PHE A HD1  3  
ATOM 4992  H HD2  . PHE A 1 36  ? 5.631   16.917  -3.685  1.00 0.00 ? 36  PHE A HD2  3  
ATOM 4993  H HE1  . PHE A 1 36  ? 6.058   15.436  -8.360  1.00 0.00 ? 36  PHE A HE1  3  
ATOM 4994  H HE2  . PHE A 1 36  ? 7.819   16.198  -4.554  1.00 0.00 ? 36  PHE A HE2  3  
ATOM 4995  H HZ   . PHE A 1 36  ? 8.033   15.455  -6.891  1.00 0.00 ? 36  PHE A HZ   3  
ATOM 4996  N N    . SER A 1 37  ? 1.780   14.716  -2.630  1.00 0.00 ? 37  SER A N    3  
ATOM 4997  C CA   . SER A 1 37  ? 2.069   13.994  -1.403  1.00 0.00 ? 37  SER A CA   3  
ATOM 4998  C C    . SER A 1 37  ? 2.281   12.505  -1.692  1.00 0.00 ? 37  SER A C    3  
ATOM 4999  O O    . SER A 1 37  ? 2.553   11.710  -0.790  1.00 0.00 ? 37  SER A O    3  
ATOM 5000  C CB   . SER A 1 37  ? 0.922   14.215  -0.418  1.00 0.00 ? 37  SER A CB   3  
ATOM 5001  O OG   . SER A 1 37  ? 0.720   15.601  -0.190  1.00 0.00 ? 37  SER A OG   3  
ATOM 5002  H H    . SER A 1 37  ? 0.851   14.948  -2.834  1.00 0.00 ? 37  SER A H    3  
ATOM 5003  H HA   . SER A 1 37  ? 2.977   14.399  -0.981  1.00 0.00 ? 37  SER A HA   3  
ATOM 5004  H HB2  . SER A 1 37  ? 0.012   13.794  -0.822  1.00 0.00 ? 37  SER A HB2  3  
ATOM 5005  H HB3  . SER A 1 37  ? 1.155   13.740  0.514   1.00 0.00 ? 37  SER A HB3  3  
ATOM 5006  H HG   . SER A 1 37  ? 1.431   16.101  -0.607  1.00 0.00 ? 37  SER A HG   3  
ATOM 5007  N N    . ALA A 1 38  ? 2.180   12.145  -2.975  1.00 0.00 ? 38  ALA A N    3  
ATOM 5008  C CA   . ALA A 1 38  ? 2.399   10.771  -3.431  1.00 0.00 ? 38  ALA A CA   3  
ATOM 5009  C C    . ALA A 1 38  ? 3.861   10.352  -3.273  1.00 0.00 ? 38  ALA A C    3  
ATOM 5010  O O    . ALA A 1 38  ? 4.232   9.230   -3.624  1.00 0.00 ? 38  ALA A O    3  
ATOM 5011  C CB   . ALA A 1 38  ? 1.958   10.626  -4.884  1.00 0.00 ? 38  ALA A CB   3  
ATOM 5012  H H    . ALA A 1 38  ? 1.942   12.827  -3.633  1.00 0.00 ? 38  ALA A H    3  
ATOM 5013  H HA   . ALA A 1 38  ? 1.783   10.119  -2.828  1.00 0.00 ? 38  ALA A HA   3  
ATOM 5014  H HB1  . ALA A 1 38  ? 0.921   10.916  -4.977  1.00 0.00 ? 38  ALA A HB1  3  
ATOM 5015  H HB2  . ALA A 1 38  ? 2.071   9.597   -5.195  1.00 0.00 ? 38  ALA A HB2  3  
ATOM 5016  H HB3  . ALA A 1 38  ? 2.565   11.261  -5.513  1.00 0.00 ? 38  ALA A HB3  3  
ATOM 5017  N N    . GLU A 1 39  ? 4.677   11.258  -2.739  1.00 0.00 ? 39  GLU A N    3  
ATOM 5018  C CA   . GLU A 1 39  ? 6.093   10.994  -2.487  1.00 0.00 ? 39  GLU A CA   3  
ATOM 5019  C C    . GLU A 1 39  ? 6.256   9.690   -1.708  1.00 0.00 ? 39  GLU A C    3  
ATOM 5020  O O    . GLU A 1 39  ? 7.105   8.853   -2.028  1.00 0.00 ? 39  GLU A O    3  
ATOM 5021  C CB   . GLU A 1 39  ? 6.700   12.159  -1.690  1.00 0.00 ? 39  GLU A CB   3  
ATOM 5022  C CG   . GLU A 1 39  ? 6.508   13.517  -2.355  1.00 0.00 ? 39  GLU A CG   3  
ATOM 5023  C CD   . GLU A 1 39  ? 6.958   14.680  -1.480  1.00 0.00 ? 39  GLU A CD   3  
ATOM 5024  O OE1  . GLU A 1 39  ? 6.136   15.197  -0.692  1.00 0.00 ? 39  GLU A OE1  3  
ATOM 5025  O OE2  . GLU A 1 39  ? 8.130   15.087  -1.579  1.00 0.00 ? 39  GLU A OE2  3  
ATOM 5026  H H    . GLU A 1 39  ? 4.314   12.136  -2.500  1.00 0.00 ? 39  GLU A H    3  
ATOM 5027  H HA   . GLU A 1 39  ? 6.599   10.908  -3.439  1.00 0.00 ? 39  GLU A HA   3  
ATOM 5028  H HB2  . GLU A 1 39  ? 6.238   12.191  -0.713  1.00 0.00 ? 39  GLU A HB2  3  
ATOM 5029  H HB3  . GLU A 1 39  ? 7.761   11.987  -1.570  1.00 0.00 ? 39  GLU A HB3  3  
ATOM 5030  H HG2  . GLU A 1 39  ? 7.076   13.537  -3.276  1.00 0.00 ? 39  GLU A HG2  3  
ATOM 5031  H HG3  . GLU A 1 39  ? 5.459   13.643  -2.584  1.00 0.00 ? 39  GLU A HG3  3  
ATOM 5032  N N    . ASN A 1 40  ? 5.398   9.524   -0.705  1.00 0.00 ? 40  ASN A N    3  
ATOM 5033  C CA   . ASN A 1 40  ? 5.433   8.362   0.181   1.00 0.00 ? 40  ASN A CA   3  
ATOM 5034  C C    . ASN A 1 40  ? 5.223   7.063   -0.595  1.00 0.00 ? 40  ASN A C    3  
ATOM 5035  O O    . ASN A 1 40  ? 6.045   6.144   -0.521  1.00 0.00 ? 40  ASN A O    3  
ATOM 5036  C CB   . ASN A 1 40  ? 4.357   8.501   1.271   1.00 0.00 ? 40  ASN A CB   3  
ATOM 5037  C CG   . ASN A 1 40  ? 4.552   9.742   2.130   1.00 0.00 ? 40  ASN A CG   3  
ATOM 5038  O OD1  . ASN A 1 40  ? 5.680   10.163  2.393   1.00 0.00 ? 40  ASN A OD1  3  
ATOM 5039  N ND2  . ASN A 1 40  ? 3.454   10.346  2.556   1.00 0.00 ? 40  ASN A ND2  3  
ATOM 5040  H H    . ASN A 1 40  ? 4.720   10.214  -0.550  1.00 0.00 ? 40  ASN A H    3  
ATOM 5041  H HA   . ASN A 1 40  ? 6.406   8.333   0.653   1.00 0.00 ? 40  ASN A HA   3  
ATOM 5042  H HB2  . ASN A 1 40  ? 3.384   8.558   0.803   1.00 0.00 ? 40  ASN A HB2  3  
ATOM 5043  H HB3  . ASN A 1 40  ? 4.390   7.634   1.915   1.00 0.00 ? 40  ASN A HB3  3  
ATOM 5044  H HD21 . ASN A 1 40  ? 2.584   9.968   2.302   1.00 0.00 ? 40  ASN A HD21 3  
ATOM 5045  H HD22 . ASN A 1 40  ? 3.552   11.150  3.105   1.00 0.00 ? 40  ASN A HD22 3  
ATOM 5046  N N    . VAL A 1 41  ? 4.128   6.992   -1.353  1.00 0.00 ? 41  VAL A N    3  
ATOM 5047  C CA   . VAL A 1 41  ? 3.791   5.774   -2.087  1.00 0.00 ? 41  VAL A CA   3  
ATOM 5048  C C    . VAL A 1 41  ? 4.826   5.489   -3.168  1.00 0.00 ? 41  VAL A C    3  
ATOM 5049  O O    . VAL A 1 41  ? 5.158   4.336   -3.424  1.00 0.00 ? 41  VAL A O    3  
ATOM 5050  C CB   . VAL A 1 41  ? 2.374   5.831   -2.723  1.00 0.00 ? 41  VAL A CB   3  
ATOM 5051  C CG1  . VAL A 1 41  ? 1.322   6.154   -1.668  1.00 0.00 ? 41  VAL A CG1  3  
ATOM 5052  C CG2  . VAL A 1 41  ? 2.313   6.829   -3.880  1.00 0.00 ? 41  VAL A CG2  3  
ATOM 5053  H H    . VAL A 1 41  ? 3.540   7.771   -1.419  1.00 0.00 ? 41  VAL A H    3  
ATOM 5054  H HA   . VAL A 1 41  ? 3.805   4.955   -1.377  1.00 0.00 ? 41  VAL A HA   3  
ATOM 5055  H HB   . VAL A 1 41  ? 2.149   4.848   -3.119  1.00 0.00 ? 41  VAL A HB   3  
ATOM 5056  H HG11 . VAL A 1 41  ? 1.322   5.385   -0.908  1.00 0.00 ? 41  VAL A HG11 3  
ATOM 5057  H HG12 . VAL A 1 41  ? 0.346   6.199   -2.130  1.00 0.00 ? 41  VAL A HG12 3  
ATOM 5058  H HG13 . VAL A 1 41  ? 1.546   7.107   -1.211  1.00 0.00 ? 41  VAL A HG13 3  
ATOM 5059  H HG21 . VAL A 1 41  ? 1.312   6.848   -4.289  1.00 0.00 ? 41  VAL A HG21 3  
ATOM 5060  H HG22 . VAL A 1 41  ? 3.009   6.530   -4.652  1.00 0.00 ? 41  VAL A HG22 3  
ATOM 5061  H HG23 . VAL A 1 41  ? 2.573   7.815   -3.523  1.00 0.00 ? 41  VAL A HG23 3  
ATOM 5062  N N    . THR A 1 42  ? 5.355   6.547   -3.781  1.00 0.00 ? 42  THR A N    3  
ATOM 5063  C CA   . THR A 1 42  ? 6.339   6.403   -4.848  1.00 0.00 ? 42  THR A CA   3  
ATOM 5064  C C    . THR A 1 42  ? 7.634   5.796   -4.298  1.00 0.00 ? 42  THR A C    3  
ATOM 5065  O O    . THR A 1 42  ? 8.253   4.936   -4.930  1.00 0.00 ? 42  THR A O    3  
ATOM 5066  C CB   . THR A 1 42  ? 6.634   7.768   -5.513  1.00 0.00 ? 42  THR A CB   3  
ATOM 5067  O OG1  . THR A 1 42  ? 5.407   8.359   -5.969  1.00 0.00 ? 42  THR A OG1  3  
ATOM 5068  C CG2  . THR A 1 42  ? 7.598   7.626   -6.687  1.00 0.00 ? 42  THR A CG2  3  
ATOM 5069  H H    . THR A 1 42  ? 5.084   7.445   -3.498  1.00 0.00 ? 42  THR A H    3  
ATOM 5070  H HA   . THR A 1 42  ? 5.921   5.733   -5.597  1.00 0.00 ? 42  THR A HA   3  
ATOM 5071  H HB   . THR A 1 42  ? 7.082   8.421   -4.773  1.00 0.00 ? 42  THR A HB   3  
ATOM 5072  H HG1  . THR A 1 42  ? 4.788   8.413   -5.233  1.00 0.00 ? 42  THR A HG1  3  
ATOM 5073  H HG21 . THR A 1 42  ? 8.533   7.208   -6.341  1.00 0.00 ? 42  THR A HG21 3  
ATOM 5074  H HG22 . THR A 1 42  ? 7.779   8.596   -7.125  1.00 0.00 ? 42  THR A HG22 3  
ATOM 5075  H HG23 . THR A 1 42  ? 7.165   6.972   -7.430  1.00 0.00 ? 42  THR A HG23 3  
ATOM 5076  N N    . PHE A 1 43  ? 8.024   6.247   -3.107  1.00 0.00 ? 43  PHE A N    3  
ATOM 5077  C CA   . PHE A 1 43  ? 9.160   5.673   -2.393  1.00 0.00 ? 43  PHE A CA   3  
ATOM 5078  C C    . PHE A 1 43  ? 8.913   4.187   -2.153  1.00 0.00 ? 43  PHE A C    3  
ATOM 5079  O O    . PHE A 1 43  ? 9.777   3.346   -2.404  1.00 0.00 ? 43  PHE A O    3  
ATOM 5080  C CB   . PHE A 1 43  ? 9.356   6.410   -1.059  1.00 0.00 ? 43  PHE A CB   3  
ATOM 5081  C CG   . PHE A 1 43  ? 10.389  5.799   -0.143  1.00 0.00 ? 43  PHE A CG   3  
ATOM 5082  C CD1  . PHE A 1 43  ? 11.744  5.941   -0.404  1.00 0.00 ? 43  PHE A CD1  3  
ATOM 5083  C CD2  . PHE A 1 43  ? 10.003  5.090   0.989   1.00 0.00 ? 43  PHE A CD2  3  
ATOM 5084  C CE1  . PHE A 1 43  ? 12.690  5.391   0.442   1.00 0.00 ? 43  PHE A CE1  3  
ATOM 5085  C CE2  . PHE A 1 43  ? 10.945  4.537   1.834   1.00 0.00 ? 43  PHE A CE2  3  
ATOM 5086  C CZ   . PHE A 1 43  ? 12.289  4.688   1.560   1.00 0.00 ? 43  PHE A CZ   3  
ATOM 5087  H H    . PHE A 1 43  ? 7.531   6.990   -2.696  1.00 0.00 ? 43  PHE A H    3  
ATOM 5088  H HA   . PHE A 1 43  ? 10.044  5.795   -3.005  1.00 0.00 ? 43  PHE A HA   3  
ATOM 5089  H HB2  . PHE A 1 43  ? 9.661   7.426   -1.265  1.00 0.00 ? 43  PHE A HB2  3  
ATOM 5090  H HB3  . PHE A 1 43  ? 8.412   6.431   -0.530  1.00 0.00 ? 43  PHE A HB3  3  
ATOM 5091  H HD1  . PHE A 1 43  ? 12.061  6.489   -1.280  1.00 0.00 ? 43  PHE A HD1  3  
ATOM 5092  H HD2  . PHE A 1 43  ? 8.951   4.970   1.205   1.00 0.00 ? 43  PHE A HD2  3  
ATOM 5093  H HE1  . PHE A 1 43  ? 13.742  5.510   0.226   1.00 0.00 ? 43  PHE A HE1  3  
ATOM 5094  H HE2  . PHE A 1 43  ? 10.629  3.987   2.709   1.00 0.00 ? 43  PHE A HE2  3  
ATOM 5095  H HZ   . PHE A 1 43  ? 13.028  4.257   2.222   1.00 0.00 ? 43  PHE A HZ   3  
ATOM 5096  N N    . TRP A 1 44  ? 7.704   3.888   -1.690  1.00 0.00 ? 44  TRP A N    3  
ATOM 5097  C CA   . TRP A 1 44  ? 7.274   2.522   -1.416  1.00 0.00 ? 44  TRP A CA   3  
ATOM 5098  C C    . TRP A 1 44  ? 7.378   1.657   -2.682  1.00 0.00 ? 44  TRP A C    3  
ATOM 5099  O O    . TRP A 1 44  ? 7.796   0.500   -2.620  1.00 0.00 ? 44  TRP A O    3  
ATOM 5100  C CB   . TRP A 1 44  ? 5.836   2.556   -0.879  1.00 0.00 ? 44  TRP A CB   3  
ATOM 5101  C CG   . TRP A 1 44  ? 5.303   1.233   -0.410  1.00 0.00 ? 44  TRP A CG   3  
ATOM 5102  C CD1  . TRP A 1 44  ? 5.563   0.614   0.780   1.00 0.00 ? 44  TRP A CD1  3  
ATOM 5103  C CD2  . TRP A 1 44  ? 4.393   0.386   -1.114  1.00 0.00 ? 44  TRP A CD2  3  
ATOM 5104  N NE1  . TRP A 1 44  ? 4.872   -0.571  0.855   1.00 0.00 ? 44  TRP A NE1  3  
ATOM 5105  C CE2  . TRP A 1 44  ? 4.144   -0.734  -0.298  1.00 0.00 ? 44  TRP A CE2  3  
ATOM 5106  C CE3  . TRP A 1 44  ? 3.765   0.469   -2.358  1.00 0.00 ? 44  TRP A CE3  3  
ATOM 5107  C CZ2  . TRP A 1 44  ? 3.292   -1.763  -0.689  1.00 0.00 ? 44  TRP A CZ2  3  
ATOM 5108  C CZ3  . TRP A 1 44  ? 2.921   -0.552  -2.747  1.00 0.00 ? 44  TRP A CZ3  3  
ATOM 5109  C CH2  . TRP A 1 44  ? 2.688   -1.655  -1.913  1.00 0.00 ? 44  TRP A CH2  3  
ATOM 5110  H H    . TRP A 1 44  ? 7.073   4.620   -1.523  1.00 0.00 ? 44  TRP A H    3  
ATOM 5111  H HA   . TRP A 1 44  ? 7.926   2.113   -0.656  1.00 0.00 ? 44  TRP A HA   3  
ATOM 5112  H HB2  . TRP A 1 44  ? 5.792   3.239   -0.043  1.00 0.00 ? 44  TRP A HB2  3  
ATOM 5113  H HB3  . TRP A 1 44  ? 5.180   2.921   -1.659  1.00 0.00 ? 44  TRP A HB3  3  
ATOM 5114  H HD1  . TRP A 1 44  ? 6.218   1.010   1.541   1.00 0.00 ? 44  TRP A HD1  3  
ATOM 5115  H HE1  . TRP A 1 44  ? 4.896   -1.198  1.612   1.00 0.00 ? 44  TRP A HE1  3  
ATOM 5116  H HE3  . TRP A 1 44  ? 3.934   1.312   -3.015  1.00 0.00 ? 44  TRP A HE3  3  
ATOM 5117  H HZ2  . TRP A 1 44  ? 3.102   -2.619  -0.059  1.00 0.00 ? 44  TRP A HZ2  3  
ATOM 5118  H HZ3  . TRP A 1 44  ? 2.428   -0.504  -3.708  1.00 0.00 ? 44  TRP A HZ3  3  
ATOM 5119  H HH2  . TRP A 1 44  ? 2.020   -2.431  -2.258  1.00 0.00 ? 44  TRP A HH2  3  
ATOM 5120  N N    . LYS A 1 45  ? 7.019   2.244   -3.831  1.00 0.00 ? 45  LYS A N    3  
ATOM 5121  C CA   . LYS A 1 45  ? 7.127   1.560   -5.126  1.00 0.00 ? 45  LYS A CA   3  
ATOM 5122  C C    . LYS A 1 45  ? 8.566   1.110   -5.364  1.00 0.00 ? 45  LYS A C    3  
ATOM 5123  O O    . LYS A 1 45  ? 8.841   -0.070  -5.609  1.00 0.00 ? 45  LYS A O    3  
ATOM 5124  C CB   . LYS A 1 45  ? 6.709   2.491   -6.280  1.00 0.00 ? 45  LYS A CB   3  
ATOM 5125  C CG   . LYS A 1 45  ? 5.316   3.096   -6.140  1.00 0.00 ? 45  LYS A CG   3  
ATOM 5126  C CD   . LYS A 1 45  ? 4.218   2.042   -6.178  1.00 0.00 ? 45  LYS A CD   3  
ATOM 5127  C CE   . LYS A 1 45  ? 4.146   1.347   -7.536  1.00 0.00 ? 45  LYS A CE   3  
ATOM 5128  N NZ   . LYS A 1 45  ? 3.209   0.192   -7.533  1.00 0.00 ? 45  LYS A NZ   3  
ATOM 5129  H H    . LYS A 1 45  ? 6.667   3.158   -3.804  1.00 0.00 ? 45  LYS A H    3  
ATOM 5130  H HA   . LYS A 1 45  ? 6.480   0.696   -5.110  1.00 0.00 ? 45  LYS A HA   3  
ATOM 5131  H HB2  . LYS A 1 45  ? 7.418   3.305   -6.343  1.00 0.00 ? 45  LYS A HB2  3  
ATOM 5132  H HB3  . LYS A 1 45  ? 6.742   1.933   -7.206  1.00 0.00 ? 45  LYS A HB3  3  
ATOM 5133  H HG2  . LYS A 1 45  ? 5.258   3.620   -5.201  1.00 0.00 ? 45  LYS A HG2  3  
ATOM 5134  H HG3  . LYS A 1 45  ? 5.157   3.794   -6.949  1.00 0.00 ? 45  LYS A HG3  3  
ATOM 5135  H HD2  . LYS A 1 45  ? 4.408   1.303   -5.412  1.00 0.00 ? 45  LYS A HD2  3  
ATOM 5136  H HD3  . LYS A 1 45  ? 3.276   2.531   -5.982  1.00 0.00 ? 45  LYS A HD3  3  
ATOM 5137  H HE2  . LYS A 1 45  ? 3.813   2.063   -8.274  1.00 0.00 ? 45  LYS A HE2  3  
ATOM 5138  H HE3  . LYS A 1 45  ? 5.134   0.996   -7.801  1.00 0.00 ? 45  LYS A HE3  3  
ATOM 5139  H HZ1  . LYS A 1 45  ? 2.238   0.512   -7.348  1.00 0.00 ? 45  LYS A HZ1  3  
ATOM 5140  H HZ2  . LYS A 1 45  ? 3.481   -0.493  -6.796  1.00 0.00 ? 45  LYS A HZ2  3  
ATOM 5141  H HZ3  . LYS A 1 45  ? 3.233   -0.288  -8.455  1.00 0.00 ? 45  LYS A HZ3  3  
ATOM 5142  N N    . ALA A 1 46  ? 9.477   2.076   -5.283  1.00 0.00 ? 46  ALA A N    3  
ATOM 5143  C CA   . ALA A 1 46  ? 10.896  1.833   -5.511  1.00 0.00 ? 46  ALA A CA   3  
ATOM 5144  C C    . ALA A 1 46  ? 11.452  0.848   -4.486  1.00 0.00 ? 46  ALA A C    3  
ATOM 5145  O O    . ALA A 1 46  ? 12.339  0.051   -4.791  1.00 0.00 ? 46  ALA A O    3  
ATOM 5146  C CB   . ALA A 1 46  ? 11.660  3.152   -5.465  1.00 0.00 ? 46  ALA A CB   3  
ATOM 5147  H H    . ALA A 1 46  ? 9.181   2.985   -5.062  1.00 0.00 ? 46  ALA A H    3  
ATOM 5148  H HA   . ALA A 1 46  ? 11.009  1.412   -6.501  1.00 0.00 ? 46  ALA A HA   3  
ATOM 5149  H HB1  . ALA A 1 46  ? 11.249  3.832   -6.196  1.00 0.00 ? 46  ALA A HB1  3  
ATOM 5150  H HB2  . ALA A 1 46  ? 12.703  2.974   -5.687  1.00 0.00 ? 46  ALA A HB2  3  
ATOM 5151  H HB3  . ALA A 1 46  ? 11.571  3.588   -4.480  1.00 0.00 ? 46  ALA A HB3  3  
ATOM 5152  N N    . CYS A 1 47  ? 10.912  0.897   -3.274  1.00 0.00 ? 47  CYS A N    3  
ATOM 5153  C CA   . CYS A 1 47  ? 11.339  0.001   -2.210  1.00 0.00 ? 47  CYS A CA   3  
ATOM 5154  C C    . CYS A 1 47  ? 10.980  -1.449  -2.542  1.00 0.00 ? 47  CYS A C    3  
ATOM 5155  O O    . CYS A 1 47  ? 11.789  -2.358  -2.329  1.00 0.00 ? 47  CYS A O    3  
ATOM 5156  C CB   . CYS A 1 47  ? 10.717  0.422   -0.879  1.00 0.00 ? 47  CYS A CB   3  
ATOM 5157  S SG   . CYS A 1 47  ? 11.229  2.059   -0.310  1.00 0.00 ? 47  CYS A SG   3  
ATOM 5158  H H    . CYS A 1 47  ? 10.206  1.554   -3.090  1.00 0.00 ? 47  CYS A H    3  
ATOM 5159  H HA   . CYS A 1 47  ? 12.415  0.079   -2.129  1.00 0.00 ? 47  CYS A HA   3  
ATOM 5160  H HB2  . CYS A 1 47  ? 9.640   0.433   -0.979  1.00 0.00 ? 47  CYS A HB2  3  
ATOM 5161  H HB3  . CYS A 1 47  ? 10.994  -0.292  -0.115  1.00 0.00 ? 47  CYS A HB3  3  
ATOM 5162  H HG   . CYS A 1 47  ? 11.326  2.847   -1.371  1.00 0.00 ? 47  CYS A HG   3  
ATOM 5163  N N    . GLU A 1 48  ? 9.777   -1.667  -3.081  1.00 0.00 ? 48  GLU A N    3  
ATOM 5164  C CA   . GLU A 1 48  ? 9.370   -3.009  -3.492  1.00 0.00 ? 48  GLU A CA   3  
ATOM 5165  C C    . GLU A 1 48  ? 10.272  -3.505  -4.623  1.00 0.00 ? 48  GLU A C    3  
ATOM 5166  O O    . GLU A 1 48  ? 10.621  -4.684  -4.681  1.00 0.00 ? 48  GLU A O    3  
ATOM 5167  C CB   . GLU A 1 48  ? 7.897   -3.054  -3.921  1.00 0.00 ? 48  GLU A CB   3  
ATOM 5168  C CG   . GLU A 1 48  ? 6.913   -2.686  -2.814  1.00 0.00 ? 48  GLU A CG   3  
ATOM 5169  C CD   . GLU A 1 48  ? 5.523   -3.252  -3.067  1.00 0.00 ? 48  GLU A CD   3  
ATOM 5170  O OE1  . GLU A 1 48  ? 4.866   -2.820  -4.035  1.00 0.00 ? 48  GLU A OE1  3  
ATOM 5171  O OE2  . GLU A 1 48  ? 5.088   -4.141  -2.301  1.00 0.00 ? 48  GLU A OE2  3  
ATOM 5172  H H    . GLU A 1 48  ? 9.155   -0.916  -3.195  1.00 0.00 ? 48  GLU A H    3  
ATOM 5173  H HA   . GLU A 1 48  ? 9.503   -3.662  -2.640  1.00 0.00 ? 48  GLU A HA   3  
ATOM 5174  H HB2  . GLU A 1 48  ? 7.751   -2.370  -4.746  1.00 0.00 ? 48  GLU A HB2  3  
ATOM 5175  H HB3  . GLU A 1 48  ? 7.666   -4.055  -4.252  1.00 0.00 ? 48  GLU A HB3  3  
ATOM 5176  H HG2  . GLU A 1 48  ? 7.282   -3.073  -1.875  1.00 0.00 ? 48  GLU A HG2  3  
ATOM 5177  H HG3  . GLU A 1 48  ? 6.843   -1.608  -2.754  1.00 0.00 ? 48  GLU A HG3  3  
ATOM 5178  N N    . ARG A 1 49  ? 10.656  -2.587  -5.509  1.00 0.00 ? 49  ARG A N    3  
ATOM 5179  C CA   . ARG A 1 49  ? 11.626  -2.886  -6.565  1.00 0.00 ? 49  ARG A CA   3  
ATOM 5180  C C    . ARG A 1 49  ? 12.945  -3.355  -5.954  1.00 0.00 ? 49  ARG A C    3  
ATOM 5181  O O    . ARG A 1 49  ? 13.593  -4.271  -6.462  1.00 0.00 ? 49  ARG A O    3  
ATOM 5182  C CB   . ARG A 1 49  ? 11.890  -1.641  -7.424  1.00 0.00 ? 49  ARG A CB   3  
ATOM 5183  C CG   . ARG A 1 49  ? 10.767  -1.278  -8.387  1.00 0.00 ? 49  ARG A CG   3  
ATOM 5184  C CD   . ARG A 1 49  ? 11.055  0.044   -9.097  1.00 0.00 ? 49  ARG A CD   3  
ATOM 5185  N NE   . ARG A 1 49  ? 12.452  0.137   -9.543  1.00 0.00 ? 49  ARG A NE   3  
ATOM 5186  C CZ   . ARG A 1 49  ? 12.912  1.034   -10.415 1.00 0.00 ? 49  ARG A CZ   3  
ATOM 5187  N NH1  . ARG A 1 49  ? 12.090  1.890   -11.011 1.00 0.00 ? 49  ARG A NH1  3  
ATOM 5188  N NH2  . ARG A 1 49  ? 14.206  1.068   -10.695 1.00 0.00 ? 49  ARG A NH2  3  
ATOM 5189  H H    . ARG A 1 49  ? 10.275  -1.683  -5.452  1.00 0.00 ? 49  ARG A H    3  
ATOM 5190  H HA   . ARG A 1 49  ? 11.222  -3.672  -7.186  1.00 0.00 ? 49  ARG A HA   3  
ATOM 5191  H HB2  . ARG A 1 49  ? 12.053  -0.799  -6.767  1.00 0.00 ? 49  ARG A HB2  3  
ATOM 5192  H HB3  . ARG A 1 49  ? 12.789  -1.806  -8.005  1.00 0.00 ? 49  ARG A HB3  3  
ATOM 5193  H HG2  . ARG A 1 49  ? 10.667  -2.060  -9.126  1.00 0.00 ? 49  ARG A HG2  3  
ATOM 5194  H HG3  . ARG A 1 49  ? 9.843   -1.185  -7.832  1.00 0.00 ? 49  ARG A HG3  3  
ATOM 5195  H HD2  . ARG A 1 49  ? 10.405  0.124   -9.956  1.00 0.00 ? 49  ARG A HD2  3  
ATOM 5196  H HD3  . ARG A 1 49  ? 10.850  0.858   -8.415  1.00 0.00 ? 49  ARG A HD3  3  
ATOM 5197  H HE   . ARG A 1 49  ? 13.096  -0.498  -9.147  1.00 0.00 ? 49  ARG A HE   3  
ATOM 5198  H HH11 . ARG A 1 49  ? 11.106  1.869   -10.814 1.00 0.00 ? 49  ARG A HH11 3  
ATOM 5199  H HH12 . ARG A 1 49  ? 12.454  2.562   -11.664 1.00 0.00 ? 49  ARG A HH12 3  
ATOM 5200  H HH21 . ARG A 1 49  ? 14.839  0.421   -10.247 1.00 0.00 ? 49  ARG A HH21 3  
ATOM 5201  H HH22 . ARG A 1 49  ? 14.561  1.731   -11.359 1.00 0.00 ? 49  ARG A HH22 3  
ATOM 5202  N N    . PHE A 1 50  ? 13.316  -2.717  -4.851  1.00 0.00 ? 50  PHE A N    3  
ATOM 5203  C CA   . PHE A 1 50  ? 14.591  -2.969  -4.194  1.00 0.00 ? 50  PHE A CA   3  
ATOM 5204  C C    . PHE A 1 50  ? 14.594  -4.349  -3.534  1.00 0.00 ? 50  PHE A C    3  
ATOM 5205  O O    . PHE A 1 50  ? 15.543  -5.119  -3.682  1.00 0.00 ? 50  PHE A O    3  
ATOM 5206  C CB   . PHE A 1 50  ? 14.853  -1.863  -3.160  1.00 0.00 ? 50  PHE A CB   3  
ATOM 5207  C CG   . PHE A 1 50  ? 16.213  -1.920  -2.514  1.00 0.00 ? 50  PHE A CG   3  
ATOM 5208  C CD1  . PHE A 1 50  ? 17.345  -1.539  -3.219  1.00 0.00 ? 50  PHE A CD1  3  
ATOM 5209  C CD2  . PHE A 1 50  ? 16.356  -2.337  -1.199  1.00 0.00 ? 50  PHE A CD2  3  
ATOM 5210  C CE1  . PHE A 1 50  ? 18.591  -1.578  -2.627  1.00 0.00 ? 50  PHE A CE1  3  
ATOM 5211  C CE2  . PHE A 1 50  ? 17.601  -2.377  -0.605  1.00 0.00 ? 50  PHE A CE2  3  
ATOM 5212  C CZ   . PHE A 1 50  ? 18.721  -1.997  -1.319  1.00 0.00 ? 50  PHE A CZ   3  
ATOM 5213  H H    . PHE A 1 50  ? 12.708  -2.055  -4.462  1.00 0.00 ? 50  PHE A H    3  
ATOM 5214  H HA   . PHE A 1 50  ? 15.368  -2.939  -4.947  1.00 0.00 ? 50  PHE A HA   3  
ATOM 5215  H HB2  . PHE A 1 50  ? 14.761  -0.902  -3.645  1.00 0.00 ? 50  PHE A HB2  3  
ATOM 5216  H HB3  . PHE A 1 50  ? 14.108  -1.931  -2.379  1.00 0.00 ? 50  PHE A HB3  3  
ATOM 5217  H HD1  . PHE A 1 50  ? 17.247  -1.213  -4.244  1.00 0.00 ? 50  PHE A HD1  3  
ATOM 5218  H HD2  . PHE A 1 50  ? 15.483  -2.634  -0.636  1.00 0.00 ? 50  PHE A HD2  3  
ATOM 5219  H HE1  . PHE A 1 50  ? 19.466  -1.279  -3.187  1.00 0.00 ? 50  PHE A HE1  3  
ATOM 5220  H HE2  . PHE A 1 50  ? 17.700  -2.706  0.419   1.00 0.00 ? 50  PHE A HE2  3  
ATOM 5221  H HZ   . PHE A 1 50  ? 19.696  -2.028  -0.854  1.00 0.00 ? 50  PHE A HZ   3  
ATOM 5222  N N    . GLN A 1 51  ? 13.513  -4.662  -2.820  1.00 0.00 ? 51  GLN A N    3  
ATOM 5223  C CA   . GLN A 1 51  ? 13.394  -5.948  -2.132  1.00 0.00 ? 51  GLN A CA   3  
ATOM 5224  C C    . GLN A 1 51  ? 13.094  -7.071  -3.126  1.00 0.00 ? 51  GLN A C    3  
ATOM 5225  O O    . GLN A 1 51  ? 13.216  -8.252  -2.796  1.00 0.00 ? 51  GLN A O    3  
ATOM 5226  C CB   . GLN A 1 51  ? 12.295  -5.901  -1.062  1.00 0.00 ? 51  GLN A CB   3  
ATOM 5227  C CG   . GLN A 1 51  ? 10.896  -5.690  -1.628  1.00 0.00 ? 51  GLN A CG   3  
ATOM 5228  C CD   . GLN A 1 51  ? 9.793   -5.864  -0.595  1.00 0.00 ? 51  GLN A CD   3  
ATOM 5229  O OE1  . GLN A 1 51  ? 8.683   -6.287  -0.922  1.00 0.00 ? 51  GLN A OE1  3  
ATOM 5230  N NE2  . GLN A 1 51  ? 10.077  -5.524  0.655   1.00 0.00 ? 51  GLN A NE2  3  
ATOM 5231  H H    . GLN A 1 51  ? 12.780  -4.012  -2.753  1.00 0.00 ? 51  GLN A H    3  
ATOM 5232  H HA   . GLN A 1 51  ? 14.341  -6.155  -1.652  1.00 0.00 ? 51  GLN A HA   3  
ATOM 5233  H HB2  . GLN A 1 51  ? 12.303  -6.833  -0.513  1.00 0.00 ? 51  GLN A HB2  3  
ATOM 5234  H HB3  . GLN A 1 51  ? 12.510  -5.092  -0.379  1.00 0.00 ? 51  GLN A HB3  3  
ATOM 5235  H HG2  . GLN A 1 51  ? 10.833  -4.689  -2.032  1.00 0.00 ? 51  GLN A HG2  3  
ATOM 5236  H HG3  . GLN A 1 51  ? 10.735  -6.404  -2.425  1.00 0.00 ? 51  GLN A HG3  3  
ATOM 5237  H HE21 . GLN A 1 51  ? 10.971  -5.175  0.848   1.00 0.00 ? 51  GLN A HE21 3  
ATOM 5238  H HE22 . GLN A 1 51  ? 9.378   -5.629  1.332   1.00 0.00 ? 51  GLN A HE22 3  
ATOM 5239  N N    . GLN A 1 52  ? 12.674  -6.697  -4.335  1.00 0.00 ? 52  GLN A N    3  
ATOM 5240  C CA   . GLN A 1 52  ? 12.401  -7.667  -5.393  1.00 0.00 ? 52  GLN A CA   3  
ATOM 5241  C C    . GLN A 1 52  ? 13.704  -8.334  -5.836  1.00 0.00 ? 52  GLN A C    3  
ATOM 5242  O O    . GLN A 1 52  ? 13.701  -9.421  -6.418  1.00 0.00 ? 52  GLN A O    3  
ATOM 5243  C CB   . GLN A 1 52  ? 11.712  -6.981  -6.586  1.00 0.00 ? 52  GLN A CB   3  
ATOM 5244  C CG   . GLN A 1 52  ? 11.246  -7.941  -7.678  1.00 0.00 ? 52  GLN A CG   3  
ATOM 5245  C CD   . GLN A 1 52  ? 10.165  -8.901  -7.198  1.00 0.00 ? 52  GLN A CD   3  
ATOM 5246  O OE1  . GLN A 1 52  ? 10.459  -9.986  -6.696  1.00 0.00 ? 52  GLN A OE1  3  
ATOM 5247  N NE2  . GLN A 1 52  ? 8.909   -8.513  -7.362  1.00 0.00 ? 52  GLN A NE2  3  
ATOM 5248  H H    . GLN A 1 52  ? 12.542  -5.743  -4.518  1.00 0.00 ? 52  GLN A H    3  
ATOM 5249  H HA   . GLN A 1 52  ? 11.741  -8.424  -4.990  1.00 0.00 ? 52  GLN A HA   3  
ATOM 5250  H HB2  . GLN A 1 52  ? 10.850  -6.439  -6.224  1.00 0.00 ? 52  GLN A HB2  3  
ATOM 5251  H HB3  . GLN A 1 52  ? 12.404  -6.277  -7.028  1.00 0.00 ? 52  GLN A HB3  3  
ATOM 5252  H HG2  . GLN A 1 52  ? 10.853  -7.365  -8.503  1.00 0.00 ? 52  GLN A HG2  3  
ATOM 5253  H HG3  . GLN A 1 52  ? 12.094  -8.519  -8.018  1.00 0.00 ? 52  GLN A HG3  3  
ATOM 5254  H HE21 . GLN A 1 52  ? 8.745   -7.642  -7.778  1.00 0.00 ? 52  GLN A HE21 3  
ATOM 5255  H HE22 . GLN A 1 52  ? 8.192   -9.115  -7.062  1.00 0.00 ? 52  GLN A HE22 3  
ATOM 5256  N N    . ILE A 1 53  ? 14.820  -7.669  -5.548  1.00 0.00 ? 53  ILE A N    3  
ATOM 5257  C CA   . ILE A 1 53  ? 16.137  -8.206  -5.844  1.00 0.00 ? 53  ILE A CA   3  
ATOM 5258  C C    . ILE A 1 53  ? 16.543  -9.189  -4.743  1.00 0.00 ? 53  ILE A C    3  
ATOM 5259  O O    . ILE A 1 53  ? 16.726  -8.784  -3.596  1.00 0.00 ? 53  ILE A O    3  
ATOM 5260  C CB   . ILE A 1 53  ? 17.190  -7.078  -5.945  1.00 0.00 ? 53  ILE A CB   3  
ATOM 5261  C CG1  . ILE A 1 53  ? 16.711  -5.988  -6.918  1.00 0.00 ? 53  ILE A CG1  3  
ATOM 5262  C CG2  . ILE A 1 53  ? 18.541  -7.643  -6.385  1.00 0.00 ? 53  ILE A CG2  3  
ATOM 5263  C CD1  . ILE A 1 53  ? 17.599  -4.762  -6.952  1.00 0.00 ? 53  ILE A CD1  3  
ATOM 5264  H H    . ILE A 1 53  ? 14.753  -6.792  -5.112  1.00 0.00 ? 53  ILE A H    3  
ATOM 5265  H HA   . ILE A 1 53  ? 16.090  -8.724  -6.794  1.00 0.00 ? 53  ILE A HA   3  
ATOM 5266  H HB   . ILE A 1 53  ? 17.313  -6.643  -4.963  1.00 0.00 ? 53  ILE A HB   3  
ATOM 5267  H HG12 . ILE A 1 53  ? 16.676  -6.396  -7.917  1.00 0.00 ? 53  ILE A HG12 3  
ATOM 5268  H HG13 . ILE A 1 53  ? 15.718  -5.670  -6.632  1.00 0.00 ? 53  ILE A HG13 3  
ATOM 5269  H HG21 . ILE A 1 53  ? 18.883  -8.370  -5.662  1.00 0.00 ? 53  ILE A HG21 3  
ATOM 5270  H HG22 . ILE A 1 53  ? 19.264  -6.841  -6.456  1.00 0.00 ? 53  ILE A HG22 3  
ATOM 5271  H HG23 . ILE A 1 53  ? 18.438  -8.118  -7.351  1.00 0.00 ? 53  ILE A HG23 3  
ATOM 5272  H HD11 . ILE A 1 53  ? 17.618  -4.302  -5.974  1.00 0.00 ? 53  ILE A HD11 3  
ATOM 5273  H HD12 . ILE A 1 53  ? 17.210  -4.059  -7.672  1.00 0.00 ? 53  ILE A HD12 3  
ATOM 5274  H HD13 . ILE A 1 53  ? 18.601  -5.049  -7.234  1.00 0.00 ? 53  ILE A HD13 3  
ATOM 5275  N N    . PRO A 1 54  ? 16.679  -10.490 -5.078  1.00 0.00 ? 54  PRO A N    3  
ATOM 5276  C CA   . PRO A 1 54  ? 16.964  -11.547 -4.096  1.00 0.00 ? 54  PRO A CA   3  
ATOM 5277  C C    . PRO A 1 54  ? 18.060  -11.171 -3.092  1.00 0.00 ? 54  PRO A C    3  
ATOM 5278  O O    . PRO A 1 54  ? 17.798  -11.134 -1.888  1.00 0.00 ? 54  PRO A O    3  
ATOM 5279  C CB   . PRO A 1 54  ? 17.397  -12.723 -4.974  1.00 0.00 ? 54  PRO A CB   3  
ATOM 5280  C CG   . PRO A 1 54  ? 16.628  -12.530 -6.236  1.00 0.00 ? 54  PRO A CG   3  
ATOM 5281  C CD   . PRO A 1 54  ? 16.555  -11.037 -6.446  1.00 0.00 ? 54  PRO A CD   3  
ATOM 5282  H HA   . PRO A 1 54  ? 16.069  -11.819 -3.551  1.00 0.00 ? 54  PRO A HA   3  
ATOM 5283  H HB2  . PRO A 1 54  ? 18.465  -12.680 -5.147  1.00 0.00 ? 54  PRO A HB2  3  
ATOM 5284  H HB3  . PRO A 1 54  ? 17.141  -13.656 -4.493  1.00 0.00 ? 54  PRO A HB3  3  
ATOM 5285  H HG2  . PRO A 1 54  ? 17.147  -13.002 -7.058  1.00 0.00 ? 54  PRO A HG2  3  
ATOM 5286  H HG3  . PRO A 1 54  ? 15.635  -12.944 -6.130  1.00 0.00 ? 54  PRO A HG3  3  
ATOM 5287  H HD2  . PRO A 1 54  ? 17.371  -10.702 -7.071  1.00 0.00 ? 54  PRO A HD2  3  
ATOM 5288  H HD3  . PRO A 1 54  ? 15.606  -10.764 -6.885  1.00 0.00 ? 54  PRO A HD3  3  
ATOM 5289  N N    . ALA A 1 55  ? 19.273  -10.893 -3.597  1.00 0.00 ? 55  ALA A N    3  
ATOM 5290  C CA   . ALA A 1 55  ? 20.413  -10.487 -2.756  1.00 0.00 ? 55  ALA A CA   3  
ATOM 5291  C C    . ALA A 1 55  ? 21.717  -10.516 -3.550  1.00 0.00 ? 55  ALA A C    3  
ATOM 5292  O O    . ALA A 1 55  ? 22.560  -9.627  -3.415  1.00 0.00 ? 55  ALA A O    3  
ATOM 5293  C CB   . ALA A 1 55  ? 20.557  -11.392 -1.529  1.00 0.00 ? 55  ALA A CB   3  
ATOM 5294  H H    . ALA A 1 55  ? 19.402  -10.951 -4.570  1.00 0.00 ? 55  ALA A H    3  
ATOM 5295  H HA   . ALA A 1 55  ? 20.232  -9.473  -2.412  1.00 0.00 ? 55  ALA A HA   3  
ATOM 5296  H HB1  . ALA A 1 55  ? 21.396  -11.064 -0.932  1.00 0.00 ? 55  ALA A HB1  3  
ATOM 5297  H HB2  . ALA A 1 55  ? 20.721  -12.412 -1.849  1.00 0.00 ? 55  ALA A HB2  3  
ATOM 5298  H HB3  . ALA A 1 55  ? 19.655  -11.343 -0.937  1.00 0.00 ? 55  ALA A HB3  3  
ATOM 5299  N N    . SER A 1 56  ? 21.864  -11.543 -4.382  1.00 0.00 ? 56  SER A N    3  
ATOM 5300  C CA   . SER A 1 56  ? 23.112  -11.804 -5.098  1.00 0.00 ? 56  SER A CA   3  
ATOM 5301  C C    . SER A 1 56  ? 23.490  -10.641 -6.021  1.00 0.00 ? 56  SER A C    3  
ATOM 5302  O O    . SER A 1 56  ? 24.673  -10.364 -6.237  1.00 0.00 ? 56  SER A O    3  
ATOM 5303  C CB   . SER A 1 56  ? 22.968  -13.097 -5.904  1.00 0.00 ? 56  SER A CB   3  
ATOM 5304  O OG   . SER A 1 56  ? 22.434  -14.138 -5.095  1.00 0.00 ? 56  SER A OG   3  
ATOM 5305  H H    . SER A 1 56  ? 21.108  -12.147 -4.524  1.00 0.00 ? 56  SER A H    3  
ATOM 5306  H HA   . SER A 1 56  ? 23.894  -11.935 -4.364  1.00 0.00 ? 56  SER A HA   3  
ATOM 5307  H HB2  . SER A 1 56  ? 22.301  -12.931 -6.739  1.00 0.00 ? 56  SER A HB2  3  
ATOM 5308  H HB3  . SER A 1 56  ? 23.936  -13.404 -6.272  1.00 0.00 ? 56  SER A HB3  3  
ATOM 5309  H HG   . SER A 1 56  ? 22.173  -14.877 -5.658  1.00 0.00 ? 56  SER A HG   3  
ATOM 5310  N N    . ASP A 1 57  ? 22.484  -9.956  -6.555  1.00 0.00 ? 57  ASP A N    3  
ATOM 5311  C CA   . ASP A 1 57  ? 22.714  -8.830  -7.455  1.00 0.00 ? 57  ASP A CA   3  
ATOM 5312  C C    . ASP A 1 57  ? 23.019  -7.566  -6.662  1.00 0.00 ? 57  ASP A C    3  
ATOM 5313  O O    . ASP A 1 57  ? 22.223  -6.625  -6.631  1.00 0.00 ? 57  ASP A O    3  
ATOM 5314  C CB   . ASP A 1 57  ? 21.509  -8.610  -8.382  1.00 0.00 ? 57  ASP A CB   3  
ATOM 5315  C CG   . ASP A 1 57  ? 21.334  -9.737  -9.384  1.00 0.00 ? 57  ASP A CG   3  
ATOM 5316  O OD1  . ASP A 1 57  ? 21.920  -9.656  -10.485 1.00 0.00 ? 57  ASP A OD1  3  
ATOM 5317  O OD2  . ASP A 1 57  ? 20.619  -10.714 -9.072  1.00 0.00 ? 57  ASP A OD2  3  
ATOM 5318  H H    . ASP A 1 57  ? 21.563  -10.211 -6.334  1.00 0.00 ? 57  ASP A H    3  
ATOM 5319  H HA   . ASP A 1 57  ? 23.579  -9.066  -8.062  1.00 0.00 ? 57  ASP A HA   3  
ATOM 5320  H HB2  . ASP A 1 57  ? 20.612  -8.537  -7.786  1.00 0.00 ? 57  ASP A HB2  3  
ATOM 5321  H HB3  . ASP A 1 57  ? 21.645  -7.685  -8.927  1.00 0.00 ? 57  ASP A HB3  3  
ATOM 5322  N N    . THR A 1 58  ? 24.178  -7.561  -6.014  1.00 0.00 ? 58  THR A N    3  
ATOM 5323  C CA   . THR A 1 58  ? 24.622  -6.430  -5.213  1.00 0.00 ? 58  THR A CA   3  
ATOM 5324  C C    . THR A 1 58  ? 24.760  -5.178  -6.081  1.00 0.00 ? 58  THR A C    3  
ATOM 5325  O O    . THR A 1 58  ? 24.423  -4.071  -5.658  1.00 0.00 ? 58  THR A O    3  
ATOM 5326  C CB   . THR A 1 58  ? 25.974  -6.749  -4.537  1.00 0.00 ? 58  THR A CB   3  
ATOM 5327  O OG1  . THR A 1 58  ? 25.908  -8.045  -3.923  1.00 0.00 ? 58  THR A OG1  3  
ATOM 5328  C CG2  . THR A 1 58  ? 26.334  -5.706  -3.484  1.00 0.00 ? 58  THR A CG2  3  
ATOM 5329  H H    . THR A 1 58  ? 24.761  -8.349  -6.079  1.00 0.00 ? 58  THR A H    3  
ATOM 5330  H HA   . THR A 1 58  ? 23.885  -6.251  -4.441  1.00 0.00 ? 58  THR A HA   3  
ATOM 5331  H HB   . THR A 1 58  ? 26.748  -6.759  -5.295  1.00 0.00 ? 58  THR A HB   3  
ATOM 5332  H HG1  . THR A 1 58  ? 24.998  -8.230  -3.662  1.00 0.00 ? 58  THR A HG1  3  
ATOM 5333  H HG21 . THR A 1 58  ? 27.288  -5.952  -3.044  1.00 0.00 ? 58  THR A HG21 3  
ATOM 5334  H HG22 . THR A 1 58  ? 25.575  -5.696  -2.714  1.00 0.00 ? 58  THR A HG22 3  
ATOM 5335  H HG23 . THR A 1 58  ? 26.390  -4.730  -3.945  1.00 0.00 ? 58  THR A HG23 3  
ATOM 5336  N N    . GLN A 1 59  ? 25.238  -5.375  -7.309  1.00 0.00 ? 59  GLN A N    3  
ATOM 5337  C CA   . GLN A 1 59  ? 25.398  -4.285  -8.270  1.00 0.00 ? 59  GLN A CA   3  
ATOM 5338  C C    . GLN A 1 59  ? 24.033  -3.655  -8.563  1.00 0.00 ? 59  GLN A C    3  
ATOM 5339  O O    . GLN A 1 59  ? 23.864  -2.436  -8.496  1.00 0.00 ? 59  GLN A O    3  
ATOM 5340  C CB   . GLN A 1 59  ? 26.045  -4.826  -9.564  1.00 0.00 ? 59  GLN A CB   3  
ATOM 5341  C CG   . GLN A 1 59  ? 26.837  -3.796  -10.374 1.00 0.00 ? 59  GLN A CG   3  
ATOM 5342  C CD   . GLN A 1 59  ? 25.978  -2.704  -10.993 1.00 0.00 ? 59  GLN A CD   3  
ATOM 5343  O OE1  . GLN A 1 59  ? 25.762  -1.653  -10.394 1.00 0.00 ? 59  GLN A OE1  3  
ATOM 5344  N NE2  . GLN A 1 59  ? 25.489  -2.947  -12.199 1.00 0.00 ? 59  GLN A NE2  3  
ATOM 5345  H H    . GLN A 1 59  ? 25.500  -6.284  -7.574  1.00 0.00 ? 59  GLN A H    3  
ATOM 5346  H HA   . GLN A 1 59  ? 26.047  -3.540  -7.828  1.00 0.00 ? 59  GLN A HA   3  
ATOM 5347  H HB2  . GLN A 1 59  ? 26.720  -5.628  -9.301  1.00 0.00 ? 59  GLN A HB2  3  
ATOM 5348  H HB3  . GLN A 1 59  ? 25.266  -5.228  -10.198 1.00 0.00 ? 59  GLN A HB3  3  
ATOM 5349  H HG2  . GLN A 1 59  ? 27.559  -3.329  -9.722  1.00 0.00 ? 59  GLN A HG2  3  
ATOM 5350  H HG3  . GLN A 1 59  ? 27.360  -4.312  -11.167 1.00 0.00 ? 59  GLN A HG3  3  
ATOM 5351  H HE21 . GLN A 1 59  ? 25.702  -3.807  -12.622 1.00 0.00 ? 59  GLN A HE21 3  
ATOM 5352  H HE22 . GLN A 1 59  ? 24.939  -2.255  -12.624 1.00 0.00 ? 59  GLN A HE22 3  
ATOM 5353  N N    . GLN A 1 60  ? 23.054  -4.509  -8.861  1.00 0.00 ? 60  GLN A N    3  
ATOM 5354  C CA   . GLN A 1 60  ? 21.695  -4.062  -9.156  1.00 0.00 ? 60  GLN A CA   3  
ATOM 5355  C C    . GLN A 1 60  ? 21.103  -3.339  -7.943  1.00 0.00 ? 60  GLN A C    3  
ATOM 5356  O O    . GLN A 1 60  ? 20.464  -2.293  -8.079  1.00 0.00 ? 60  GLN A O    3  
ATOM 5357  C CB   . GLN A 1 60  ? 20.823  -5.265  -9.546  1.00 0.00 ? 60  GLN A CB   3  
ATOM 5358  C CG   . GLN A 1 60  ? 19.417  -4.896  -10.005 1.00 0.00 ? 60  GLN A CG   3  
ATOM 5359  C CD   . GLN A 1 60  ? 18.587  -6.105  -10.421 1.00 0.00 ? 60  GLN A CD   3  
ATOM 5360  O OE1  . GLN A 1 60  ? 17.367  -6.108  -10.275 1.00 0.00 ? 60  GLN A OE1  3  
ATOM 5361  N NE2  . GLN A 1 60  ? 19.238  -7.131  -10.953 1.00 0.00 ? 60  GLN A NE2  3  
ATOM 5362  H H    . GLN A 1 60  ? 23.252  -5.468  -8.876  1.00 0.00 ? 60  GLN A H    3  
ATOM 5363  H HA   . GLN A 1 60  ? 21.742  -3.372  -9.987  1.00 0.00 ? 60  GLN A HA   3  
ATOM 5364  H HB2  . GLN A 1 60  ? 21.310  -5.797  -10.351 1.00 0.00 ? 60  GLN A HB2  3  
ATOM 5365  H HB3  . GLN A 1 60  ? 20.739  -5.925  -8.694  1.00 0.00 ? 60  GLN A HB3  3  
ATOM 5366  H HG2  . GLN A 1 60  ? 18.910  -4.395  -9.195  1.00 0.00 ? 60  GLN A HG2  3  
ATOM 5367  H HG3  . GLN A 1 60  ? 19.493  -4.224  -10.848 1.00 0.00 ? 60  GLN A HG3  3  
ATOM 5368  H HE21 . GLN A 1 60  ? 20.210  -7.064  -11.056 1.00 0.00 ? 60  GLN A HE21 3  
ATOM 5369  H HE22 . GLN A 1 60  ? 18.718  -7.914  -11.226 1.00 0.00 ? 60  GLN A HE22 3  
ATOM 5370  N N    . LEU A 1 61  ? 21.341  -3.908  -6.760  1.00 0.00 ? 61  LEU A N    3  
ATOM 5371  C CA   . LEU A 1 61  ? 20.916  -3.307  -5.496  1.00 0.00 ? 61  LEU A CA   3  
ATOM 5372  C C    . LEU A 1 61  ? 21.505  -1.909  -5.339  1.00 0.00 ? 61  LEU A C    3  
ATOM 5373  O O    . LEU A 1 61  ? 20.810  -0.980  -4.937  1.00 0.00 ? 61  LEU A O    3  
ATOM 5374  C CB   . LEU A 1 61  ? 21.350  -4.188  -4.313  1.00 0.00 ? 61  LEU A CB   3  
ATOM 5375  C CG   . LEU A 1 61  ? 20.556  -5.492  -4.131  1.00 0.00 ? 61  LEU A CG   3  
ATOM 5376  C CD1  . LEU A 1 61  ? 21.284  -6.436  -3.179  1.00 0.00 ? 61  LEU A CD1  3  
ATOM 5377  C CD2  . LEU A 1 61  ? 19.149  -5.190  -3.615  1.00 0.00 ? 61  LEU A CD2  3  
ATOM 5378  H H    . LEU A 1 61  ? 21.818  -4.764  -6.738  1.00 0.00 ? 61  LEU A H    3  
ATOM 5379  H HA   . LEU A 1 61  ? 19.837  -3.234  -5.505  1.00 0.00 ? 61  LEU A HA   3  
ATOM 5380  H HB2  . LEU A 1 61  ? 22.393  -4.443  -4.448  1.00 0.00 ? 61  LEU A HB2  3  
ATOM 5381  H HB3  . LEU A 1 61  ? 21.258  -3.609  -3.404  1.00 0.00 ? 61  LEU A HB3  3  
ATOM 5382  H HG   . LEU A 1 61  ? 20.465  -5.988  -5.087  1.00 0.00 ? 61  LEU A HG   3  
ATOM 5383  H HD11 . LEU A 1 61  ? 22.253  -6.683  -3.588  1.00 0.00 ? 61  LEU A HD11 3  
ATOM 5384  H HD12 . LEU A 1 61  ? 20.706  -7.340  -3.054  1.00 0.00 ? 61  LEU A HD12 3  
ATOM 5385  H HD13 . LEU A 1 61  ? 21.412  -5.955  -2.220  1.00 0.00 ? 61  LEU A HD13 3  
ATOM 5386  H HD21 . LEU A 1 61  ? 19.211  -4.688  -2.659  1.00 0.00 ? 61  LEU A HD21 3  
ATOM 5387  H HD22 . LEU A 1 61  ? 18.600  -6.114  -3.501  1.00 0.00 ? 61  LEU A HD22 3  
ATOM 5388  H HD23 . LEU A 1 61  ? 18.634  -4.554  -4.321  1.00 0.00 ? 61  LEU A HD23 3  
ATOM 5389  N N    . ALA A 1 62  ? 22.788  -1.771  -5.667  1.00 0.00 ? 62  ALA A N    3  
ATOM 5390  C CA   . ALA A 1 62  ? 23.488  -0.495  -5.544  1.00 0.00 ? 62  ALA A CA   3  
ATOM 5391  C C    . ALA A 1 62  ? 22.832  0.571   -6.416  1.00 0.00 ? 62  ALA A C    3  
ATOM 5392  O O    . ALA A 1 62  ? 22.621  1.703   -5.979  1.00 0.00 ? 62  ALA A O    3  
ATOM 5393  C CB   . ALA A 1 62  ? 24.960  -0.661  -5.912  1.00 0.00 ? 62  ALA A CB   3  
ATOM 5394  H H    . ALA A 1 62  ? 23.278  -2.551  -6.005  1.00 0.00 ? 62  ALA A H    3  
ATOM 5395  H HA   . ALA A 1 62  ? 23.434  -0.184  -4.509  1.00 0.00 ? 62  ALA A HA   3  
ATOM 5396  H HB1  . ALA A 1 62  ? 25.042  -0.960  -6.948  1.00 0.00 ? 62  ALA A HB1  3  
ATOM 5397  H HB2  . ALA A 1 62  ? 25.406  -1.418  -5.283  1.00 0.00 ? 62  ALA A HB2  3  
ATOM 5398  H HB3  . ALA A 1 62  ? 25.478  0.277   -5.766  1.00 0.00 ? 62  ALA A HB3  3  
ATOM 5399  N N    . GLN A 1 63  ? 22.496  0.192   -7.647  1.00 0.00 ? 63  GLN A N    3  
ATOM 5400  C CA   . GLN A 1 63  ? 21.869  1.108   -8.597  1.00 0.00 ? 63  GLN A CA   3  
ATOM 5401  C C    . GLN A 1 63  ? 20.492  1.552   -8.101  1.00 0.00 ? 63  GLN A C    3  
ATOM 5402  O O    . GLN A 1 63  ? 20.191  2.750   -8.069  1.00 0.00 ? 63  GLN A O    3  
ATOM 5403  C CB   . GLN A 1 63  ? 21.754  0.446   -9.976  1.00 0.00 ? 63  GLN A CB   3  
ATOM 5404  C CG   . GLN A 1 63  ? 23.101  0.106   -10.608 1.00 0.00 ? 63  GLN A CG   3  
ATOM 5405  C CD   . GLN A 1 63  ? 23.983  1.330   -10.797 1.00 0.00 ? 63  GLN A CD   3  
ATOM 5406  O OE1  . GLN A 1 63  ? 23.936  1.990   -11.836 1.00 0.00 ? 63  GLN A OE1  3  
ATOM 5407  N NE2  . GLN A 1 63  ? 24.793  1.643   -9.797  1.00 0.00 ? 63  GLN A NE2  3  
ATOM 5408  H H    . GLN A 1 63  ? 22.676  -0.734  -7.924  1.00 0.00 ? 63  GLN A H    3  
ATOM 5409  H HA   . GLN A 1 63  ? 22.503  1.980   -8.679  1.00 0.00 ? 63  GLN A HA   3  
ATOM 5410  H HB2  . GLN A 1 63  ? 21.186  -0.467  -9.879  1.00 0.00 ? 63  GLN A HB2  3  
ATOM 5411  H HB3  . GLN A 1 63  ? 21.227  1.116   -10.643 1.00 0.00 ? 63  GLN A HB3  3  
ATOM 5412  H HG2  . GLN A 1 63  ? 23.616  -0.597  -9.970  1.00 0.00 ? 63  GLN A HG2  3  
ATOM 5413  H HG3  . GLN A 1 63  ? 22.928  -0.349  -11.574 1.00 0.00 ? 63  GLN A HG3  3  
ATOM 5414  H HE21 . GLN A 1 63  ? 24.788  1.073   -9.000  1.00 0.00 ? 63  GLN A HE21 3  
ATOM 5415  H HE22 . GLN A 1 63  ? 25.357  2.441   -9.887  1.00 0.00 ? 63  GLN A HE22 3  
ATOM 5416  N N    . GLU A 1 64  ? 19.665  0.587   -7.703  1.00 0.00 ? 64  GLU A N    3  
ATOM 5417  C CA   . GLU A 1 64  ? 18.336  0.884   -7.172  1.00 0.00 ? 64  GLU A CA   3  
ATOM 5418  C C    . GLU A 1 64  ? 18.455  1.755   -5.923  1.00 0.00 ? 64  GLU A C    3  
ATOM 5419  O O    . GLU A 1 64  ? 17.734  2.743   -5.764  1.00 0.00 ? 64  GLU A O    3  
ATOM 5420  C CB   . GLU A 1 64  ? 17.584  -0.414  -6.838  1.00 0.00 ? 64  GLU A CB   3  
ATOM 5421  C CG   . GLU A 1 64  ? 17.324  -1.317  -8.040  1.00 0.00 ? 64  GLU A CG   3  
ATOM 5422  C CD   . GLU A 1 64  ? 16.368  -0.706  -9.055  1.00 0.00 ? 64  GLU A CD   3  
ATOM 5423  O OE1  . GLU A 1 64  ? 15.142  -0.914  -8.929  1.00 0.00 ? 64  GLU A OE1  3  
ATOM 5424  O OE2  . GLU A 1 64  ? 16.834  -0.032  -9.998  1.00 0.00 ? 64  GLU A OE2  3  
ATOM 5425  H H    . GLU A 1 64  ? 19.958  -0.348  -7.763  1.00 0.00 ? 64  GLU A H    3  
ATOM 5426  H HA   . GLU A 1 64  ? 17.788  1.428   -7.929  1.00 0.00 ? 64  GLU A HA   3  
ATOM 5427  H HB2  . GLU A 1 64  ? 18.162  -0.975  -6.117  1.00 0.00 ? 64  GLU A HB2  3  
ATOM 5428  H HB3  . GLU A 1 64  ? 16.631  -0.159  -6.396  1.00 0.00 ? 64  GLU A HB3  3  
ATOM 5429  H HG2  . GLU A 1 64  ? 18.266  -1.521  -8.532  1.00 0.00 ? 64  GLU A HG2  3  
ATOM 5430  H HG3  . GLU A 1 64  ? 16.903  -2.248  -7.686  1.00 0.00 ? 64  GLU A HG3  3  
ATOM 5431  N N    . ALA A 1 65  ? 19.395  1.388   -5.054  1.00 0.00 ? 65  ALA A N    3  
ATOM 5432  C CA   . ALA A 1 65  ? 19.635  2.112   -3.811  1.00 0.00 ? 65  ALA A CA   3  
ATOM 5433  C C    . ALA A 1 65  ? 20.030  3.554   -4.093  1.00 0.00 ? 65  ALA A C    3  
ATOM 5434  O O    . ALA A 1 65  ? 19.549  4.472   -3.433  1.00 0.00 ? 65  ALA A O    3  
ATOM 5435  C CB   . ALA A 1 65  ? 20.716  1.421   -2.984  1.00 0.00 ? 65  ALA A CB   3  
ATOM 5436  H H    . ALA A 1 65  ? 19.945  0.606   -5.260  1.00 0.00 ? 65  ALA A H    3  
ATOM 5437  H HA   . ALA A 1 65  ? 18.717  2.103   -3.240  1.00 0.00 ? 65  ALA A HA   3  
ATOM 5438  H HB1  . ALA A 1 65  ? 21.643  1.410   -3.538  1.00 0.00 ? 65  ALA A HB1  3  
ATOM 5439  H HB2  . ALA A 1 65  ? 20.413  0.406   -2.770  1.00 0.00 ? 65  ALA A HB2  3  
ATOM 5440  H HB3  . ALA A 1 65  ? 20.857  1.956   -2.055  1.00 0.00 ? 65  ALA A HB3  3  
ATOM 5441  N N    . ARG A 1 66  ? 20.902  3.746   -5.081  1.00 0.00 ? 66  ARG A N    3  
ATOM 5442  C CA   . ARG A 1 66  ? 21.350  5.082   -5.459  1.00 0.00 ? 66  ARG A CA   3  
ATOM 5443  C C    . ARG A 1 66  ? 20.184  5.913   -5.987  1.00 0.00 ? 66  ARG A C    3  
ATOM 5444  O O    . ARG A 1 66  ? 20.036  7.084   -5.632  1.00 0.00 ? 66  ARG A O    3  
ATOM 5445  C CB   . ARG A 1 66  ? 22.463  5.016   -6.516  1.00 0.00 ? 66  ARG A CB   3  
ATOM 5446  C CG   . ARG A 1 66  ? 22.868  6.390   -7.042  1.00 0.00 ? 66  ARG A CG   3  
ATOM 5447  C CD   . ARG A 1 66  ? 23.923  6.318   -8.140  1.00 0.00 ? 66  ARG A CD   3  
ATOM 5448  N NE   . ARG A 1 66  ? 24.155  7.638   -8.736  1.00 0.00 ? 66  ARG A NE   3  
ATOM 5449  C CZ   . ARG A 1 66  ? 25.162  7.936   -9.558  1.00 0.00 ? 66  ARG A CZ   3  
ATOM 5450  N NH1  . ARG A 1 66  ? 26.062  7.015   -9.887  1.00 0.00 ? 66  ARG A NH1  3  
ATOM 5451  N NH2  . ARG A 1 66  ? 25.266  9.164   -10.054 1.00 0.00 ? 66  ARG A NH2  3  
ATOM 5452  H H    . ARG A 1 66  ? 21.255  2.969   -5.565  1.00 0.00 ? 66  ARG A H    3  
ATOM 5453  H HA   . ARG A 1 66  ? 21.740  5.561   -4.569  1.00 0.00 ? 66  ARG A HA   3  
ATOM 5454  H HB2  . ARG A 1 66  ? 23.334  4.544   -6.082  1.00 0.00 ? 66  ARG A HB2  3  
ATOM 5455  H HB3  . ARG A 1 66  ? 22.118  4.420   -7.351  1.00 0.00 ? 66  ARG A HB3  3  
ATOM 5456  H HG2  . ARG A 1 66  ? 21.992  6.883   -7.441  1.00 0.00 ? 66  ARG A HG2  3  
ATOM 5457  H HG3  . ARG A 1 66  ? 23.260  6.974   -6.219  1.00 0.00 ? 66  ARG A HG3  3  
ATOM 5458  H HD2  . ARG A 1 66  ? 24.847  5.952   -7.716  1.00 0.00 ? 66  ARG A HD2  3  
ATOM 5459  H HD3  . ARG A 1 66  ? 23.584  5.639   -8.909  1.00 0.00 ? 66  ARG A HD3  3  
ATOM 5460  H HE   . ARG A 1 66  ? 23.513  8.347   -8.507  1.00 0.00 ? 66  ARG A HE   3  
ATOM 5461  H HH11 . ARG A 1 66  ? 25.993  6.082   -9.517  1.00 0.00 ? 66  ARG A HH11 3  
ATOM 5462  H HH12 . ARG A 1 66  ? 26.817  7.245   -10.506 1.00 0.00 ? 66  ARG A HH12 3  
ATOM 5463  H HH21 . ARG A 1 66  ? 24.588  9.864   -9.813  1.00 0.00 ? 66  ARG A HH21 3  
ATOM 5464  H HH22 . ARG A 1 66  ? 26.025  9.402   -10.667 1.00 0.00 ? 66  ARG A HH22 3  
ATOM 5465  N N    . ASN A 1 67  ? 19.359  5.301   -6.837  1.00 0.00 ? 67  ASN A N    3  
ATOM 5466  C CA   . ASN A 1 67  ? 18.208  5.993   -7.420  1.00 0.00 ? 67  ASN A CA   3  
ATOM 5467  C C    . ASN A 1 67  ? 17.276  6.488   -6.321  1.00 0.00 ? 67  ASN A C    3  
ATOM 5468  O O    . ASN A 1 67  ? 16.850  7.643   -6.327  1.00 0.00 ? 67  ASN A O    3  
ATOM 5469  C CB   . ASN A 1 67  ? 17.437  5.071   -8.375  1.00 0.00 ? 67  ASN A CB   3  
ATOM 5470  C CG   . ASN A 1 67  ? 16.240  5.767   -9.011  1.00 0.00 ? 67  ASN A CG   3  
ATOM 5471  O OD1  . ASN A 1 67  ? 16.346  6.360   -10.087 1.00 0.00 ? 67  ASN A OD1  3  
ATOM 5472  N ND2  . ASN A 1 67  ? 15.092  5.702   -8.352  1.00 0.00 ? 67  ASN A ND2  3  
ATOM 5473  H H    . ASN A 1 67  ? 19.529  4.364   -7.079  1.00 0.00 ? 67  ASN A H    3  
ATOM 5474  H HA   . ASN A 1 67  ? 18.579  6.845   -7.974  1.00 0.00 ? 67  ASN A HA   3  
ATOM 5475  H HB2  . ASN A 1 67  ? 18.101  4.742   -9.162  1.00 0.00 ? 67  ASN A HB2  3  
ATOM 5476  H HB3  . ASN A 1 67  ? 17.082  4.210   -7.827  1.00 0.00 ? 67  ASN A HB3  3  
ATOM 5477  H HD21 . ASN A 1 67  ? 15.073  5.214   -7.501  1.00 0.00 ? 67  ASN A HD21 3  
ATOM 5478  H HD22 . ASN A 1 67  ? 14.312  6.161   -8.732  1.00 0.00 ? 67  ASN A HD22 3  
ATOM 5479  N N    . ILE A 1 68  ? 16.974  5.603   -5.376  1.00 0.00 ? 68  ILE A N    3  
ATOM 5480  C CA   . ILE A 1 68  ? 16.101  5.932   -4.252  1.00 0.00 ? 68  ILE A CA   3  
ATOM 5481  C C    . ILE A 1 68  ? 16.773  6.958   -3.334  1.00 0.00 ? 68  ILE A C    3  
ATOM 5482  O O    . ILE A 1 68  ? 16.139  7.910   -2.865  1.00 0.00 ? 68  ILE A O    3  
ATOM 5483  C CB   . ILE A 1 68  ? 15.739  4.657   -3.441  1.00 0.00 ? 68  ILE A CB   3  
ATOM 5484  C CG1  . ILE A 1 68  ? 15.041  3.626   -4.349  1.00 0.00 ? 68  ILE A CG1  3  
ATOM 5485  C CG2  . ILE A 1 68  ? 14.858  5.008   -2.242  1.00 0.00 ? 68  ILE A CG2  3  
ATOM 5486  C CD1  . ILE A 1 68  ? 14.714  2.312   -3.665  1.00 0.00 ? 68  ILE A CD1  3  
ATOM 5487  H H    . ILE A 1 68  ? 17.352  4.698   -5.435  1.00 0.00 ? 68  ILE A H    3  
ATOM 5488  H HA   . ILE A 1 68  ? 15.188  6.358   -4.649  1.00 0.00 ? 68  ILE A HA   3  
ATOM 5489  H HB   . ILE A 1 68  ? 16.658  4.227   -3.065  1.00 0.00 ? 68  ILE A HB   3  
ATOM 5490  H HG12 . ILE A 1 68  ? 14.114  4.045   -4.713  1.00 0.00 ? 68  ILE A HG12 3  
ATOM 5491  H HG13 . ILE A 1 68  ? 15.683  3.408   -5.192  1.00 0.00 ? 68  ILE A HG13 3  
ATOM 5492  H HG21 . ILE A 1 68  ? 15.389  5.685   -1.589  1.00 0.00 ? 68  ILE A HG21 3  
ATOM 5493  H HG22 . ILE A 1 68  ? 14.611  4.107   -1.699  1.00 0.00 ? 68  ILE A HG22 3  
ATOM 5494  H HG23 . ILE A 1 68  ? 13.948  5.479   -2.586  1.00 0.00 ? 68  ILE A HG23 3  
ATOM 5495  H HD11 . ILE A 1 68  ? 14.139  1.691   -4.335  1.00 0.00 ? 68  ILE A HD11 3  
ATOM 5496  H HD12 . ILE A 1 68  ? 14.140  2.501   -2.769  1.00 0.00 ? 68  ILE A HD12 3  
ATOM 5497  H HD13 . ILE A 1 68  ? 15.629  1.801   -3.404  1.00 0.00 ? 68  ILE A HD13 3  
ATOM 5498  N N    . TYR A 1 69  ? 18.068  6.763   -3.106  1.00 0.00 ? 69  TYR A N    3  
ATOM 5499  C CA   . TYR A 1 69  ? 18.857  7.635   -2.240  1.00 0.00 ? 69  TYR A CA   3  
ATOM 5500  C C    . TYR A 1 69  ? 18.800  9.080   -2.735  1.00 0.00 ? 69  TYR A C    3  
ATOM 5501  O O    . TYR A 1 69  ? 18.254  9.958   -2.069  1.00 0.00 ? 69  TYR A O    3  
ATOM 5502  C CB   . TYR A 1 69  ? 20.320  7.150   -2.201  1.00 0.00 ? 69  TYR A CB   3  
ATOM 5503  C CG   . TYR A 1 69  ? 21.212  7.907   -1.228  1.00 0.00 ? 69  TYR A CG   3  
ATOM 5504  C CD1  . TYR A 1 69  ? 21.839  9.094   -1.598  1.00 0.00 ? 69  TYR A CD1  3  
ATOM 5505  C CD2  . TYR A 1 69  ? 21.430  7.431   0.060   1.00 0.00 ? 69  TYR A CD2  3  
ATOM 5506  C CE1  . TYR A 1 69  ? 22.653  9.780   -0.718  1.00 0.00 ? 69  TYR A CE1  3  
ATOM 5507  C CE2  . TYR A 1 69  ? 22.245  8.112   0.946   1.00 0.00 ? 69  TYR A CE2  3  
ATOM 5508  C CZ   . TYR A 1 69  ? 22.853  9.285   0.552   1.00 0.00 ? 69  TYR A CZ   3  
ATOM 5509  O OH   . TYR A 1 69  ? 23.662  9.966   1.436   1.00 0.00 ? 69  TYR A OH   3  
ATOM 5510  H H    . TYR A 1 69  ? 18.512  6.003   -3.537  1.00 0.00 ? 69  TYR A H    3  
ATOM 5511  H HA   . TYR A 1 69  ? 18.441  7.585   -1.244  1.00 0.00 ? 69  TYR A HA   3  
ATOM 5512  H HB2  . TYR A 1 69  ? 20.337  6.106   -1.923  1.00 0.00 ? 69  TYR A HB2  3  
ATOM 5513  H HB3  . TYR A 1 69  ? 20.748  7.252   -3.190  1.00 0.00 ? 69  TYR A HB3  3  
ATOM 5514  H HD1  . TYR A 1 69  ? 21.680  9.481   -2.594  1.00 0.00 ? 69  TYR A HD1  3  
ATOM 5515  H HD2  . TYR A 1 69  ? 20.953  6.511   0.367   1.00 0.00 ? 69  TYR A HD2  3  
ATOM 5516  H HE1  . TYR A 1 69  ? 23.128  10.698  -1.030  1.00 0.00 ? 69  TYR A HE1  3  
ATOM 5517  H HE2  . TYR A 1 69  ? 22.401  7.724   1.941   1.00 0.00 ? 69  TYR A HE2  3  
ATOM 5518  H HH   . TYR A 1 69  ? 24.286  9.352   1.840   1.00 0.00 ? 69  TYR A HH   3  
ATOM 5519  N N    . GLN A 1 70  ? 19.319  9.297   -3.937  1.00 0.00 ? 70  GLN A N    3  
ATOM 5520  C CA   . GLN A 1 70  ? 19.506  10.641  -4.484  1.00 0.00 ? 70  GLN A CA   3  
ATOM 5521  C C    . GLN A 1 70  ? 18.207  11.214  -5.059  1.00 0.00 ? 70  GLN A C    3  
ATOM 5522  O O    . GLN A 1 70  ? 18.240  12.138  -5.873  1.00 0.00 ? 70  GLN A O    3  
ATOM 5523  C CB   . GLN A 1 70  ? 20.600  10.605  -5.563  1.00 0.00 ? 70  GLN A CB   3  
ATOM 5524  C CG   . GLN A 1 70  ? 21.951  10.113  -5.041  1.00 0.00 ? 70  GLN A CG   3  
ATOM 5525  C CD   . GLN A 1 70  ? 22.998  9.959   -6.132  1.00 0.00 ? 70  GLN A CD   3  
ATOM 5526  O OE1  . GLN A 1 70  ? 22.675  9.701   -7.294  1.00 0.00 ? 70  GLN A OE1  3  
ATOM 5527  N NE2  . GLN A 1 70  ? 24.264  10.086  -5.764  1.00 0.00 ? 70  GLN A NE2  3  
ATOM 5528  H H    . GLN A 1 70  ? 19.579  8.525   -4.484  1.00 0.00 ? 70  GLN A H    3  
ATOM 5529  H HA   . GLN A 1 70  ? 19.837  11.282  -3.680  1.00 0.00 ? 70  GLN A HA   3  
ATOM 5530  H HB2  . GLN A 1 70  ? 20.284  9.945   -6.360  1.00 0.00 ? 70  GLN A HB2  3  
ATOM 5531  H HB3  . GLN A 1 70  ? 20.733  11.601  -5.964  1.00 0.00 ? 70  GLN A HB3  3  
ATOM 5532  H HG2  . GLN A 1 70  ? 22.318  10.824  -4.314  1.00 0.00 ? 70  GLN A HG2  3  
ATOM 5533  H HG3  . GLN A 1 70  ? 21.809  9.155   -4.559  1.00 0.00 ? 70  GLN A HG3  3  
ATOM 5534  H HE21 . GLN A 1 70  ? 24.455  10.277  -4.819  1.00 0.00 ? 70  GLN A HE21 3  
ATOM 5535  H HE22 . GLN A 1 70  ? 24.960  9.983   -6.448  1.00 0.00 ? 70  GLN A HE22 3  
ATOM 5536  N N    . GLU A 1 71  ? 17.066  10.681  -4.628  1.00 0.00 ? 71  GLU A N    3  
ATOM 5537  C CA   . GLU A 1 71  ? 15.768  11.170  -5.091  1.00 0.00 ? 71  GLU A CA   3  
ATOM 5538  C C    . GLU A 1 71  ? 14.816  11.394  -3.918  1.00 0.00 ? 71  GLU A C    3  
ATOM 5539  O O    . GLU A 1 71  ? 14.042  12.355  -3.910  1.00 0.00 ? 71  GLU A O    3  
ATOM 5540  C CB   . GLU A 1 71  ? 15.156  10.186  -6.096  1.00 0.00 ? 71  GLU A CB   3  
ATOM 5541  C CG   . GLU A 1 71  ? 13.929  10.728  -6.824  1.00 0.00 ? 71  GLU A CG   3  
ATOM 5542  C CD   . GLU A 1 71  ? 13.407  9.772   -7.887  1.00 0.00 ? 71  GLU A CD   3  
ATOM 5543  O OE1  . GLU A 1 71  ? 14.114  9.551   -8.894  1.00 0.00 ? 71  GLU A OE1  3  
ATOM 5544  O OE2  . GLU A 1 71  ? 12.285  9.249   -7.730  1.00 0.00 ? 71  GLU A OE2  3  
ATOM 5545  H H    . GLU A 1 71  ? 17.097  9.944   -3.987  1.00 0.00 ? 71  GLU A H    3  
ATOM 5546  H HA   . GLU A 1 71  ? 15.929  12.118  -5.587  1.00 0.00 ? 71  GLU A HA   3  
ATOM 5547  H HB2  . GLU A 1 71  ? 15.904  9.936   -6.834  1.00 0.00 ? 71  GLU A HB2  3  
ATOM 5548  H HB3  . GLU A 1 71  ? 14.869  9.284   -5.571  1.00 0.00 ? 71  GLU A HB3  3  
ATOM 5549  H HG2  . GLU A 1 71  ? 13.146  10.905  -6.100  1.00 0.00 ? 71  GLU A HG2  3  
ATOM 5550  H HG3  . GLU A 1 71  ? 14.193  11.662  -7.300  1.00 0.00 ? 71  GLU A HG3  3  
ATOM 5551  N N    . PHE A 1 72  ? 14.879  10.509  -2.922  1.00 0.00 ? 72  PHE A N    3  
ATOM 5552  C CA   . PHE A 1 72  ? 13.998  10.595  -1.756  1.00 0.00 ? 72  PHE A CA   3  
ATOM 5553  C C    . PHE A 1 72  ? 14.789  10.865  -0.473  1.00 0.00 ? 72  PHE A C    3  
ATOM 5554  O O    . PHE A 1 72  ? 14.319  11.572  0.424   1.00 0.00 ? 72  PHE A O    3  
ATOM 5555  C CB   . PHE A 1 72  ? 13.208  9.286   -1.579  1.00 0.00 ? 72  PHE A CB   3  
ATOM 5556  C CG   . PHE A 1 72  ? 12.384  8.881   -2.779  1.00 0.00 ? 72  PHE A CG   3  
ATOM 5557  C CD1  . PHE A 1 72  ? 11.110  9.394   -2.970  1.00 0.00 ? 72  PHE A CD1  3  
ATOM 5558  C CD2  . PHE A 1 72  ? 12.882  7.976   -3.708  1.00 0.00 ? 72  PHE A CD2  3  
ATOM 5559  C CE1  . PHE A 1 72  ? 10.353  9.017   -4.062  1.00 0.00 ? 72  PHE A CE1  3  
ATOM 5560  C CE2  . PHE A 1 72  ? 12.127  7.595   -4.800  1.00 0.00 ? 72  PHE A CE2  3  
ATOM 5561  C CZ   . PHE A 1 72  ? 10.861  8.117   -4.976  1.00 0.00 ? 72  PHE A CZ   3  
ATOM 5562  H H    . PHE A 1 72  ? 15.523  9.773   -2.980  1.00 0.00 ? 72  PHE A H    3  
ATOM 5563  H HA   . PHE A 1 72  ? 13.302  11.407  -1.914  1.00 0.00 ? 72  PHE A HA   3  
ATOM 5564  H HB2  . PHE A 1 72  ? 13.902  8.483   -1.372  1.00 0.00 ? 72  PHE A HB2  3  
ATOM 5565  H HB3  . PHE A 1 72  ? 12.536  9.392   -0.738  1.00 0.00 ? 72  PHE A HB3  3  
ATOM 5566  H HD1  . PHE A 1 72  ? 10.710  10.099  -2.255  1.00 0.00 ? 72  PHE A HD1  3  
ATOM 5567  H HD2  . PHE A 1 72  ? 13.873  7.567   -3.570  1.00 0.00 ? 72  PHE A HD2  3  
ATOM 5568  H HE1  . PHE A 1 72  ? 9.361   9.426   -4.199  1.00 0.00 ? 72  PHE A HE1  3  
ATOM 5569  H HE2  . PHE A 1 72  ? 12.528  6.891   -5.515  1.00 0.00 ? 72  PHE A HE2  3  
ATOM 5570  H HZ   . PHE A 1 72  ? 10.269  7.819   -5.829  1.00 0.00 ? 72  PHE A HZ   3  
ATOM 5571  N N    . LEU A 1 73  ? 15.996  10.312  -0.396  1.00 0.00 ? 73  LEU A N    3  
ATOM 5572  C CA   . LEU A 1 73  ? 16.725  10.221  0.870   1.00 0.00 ? 73  LEU A CA   3  
ATOM 5573  C C    . LEU A 1 73  ? 17.987  11.086  0.881   1.00 0.00 ? 73  LEU A C    3  
ATOM 5574  O O    . LEU A 1 73  ? 18.802  10.992  1.802   1.00 0.00 ? 73  LEU A O    3  
ATOM 5575  C CB   . LEU A 1 73  ? 17.077  8.749   1.127   1.00 0.00 ? 73  LEU A CB   3  
ATOM 5576  C CG   . LEU A 1 73  ? 15.881  7.782   1.044   1.00 0.00 ? 73  LEU A CG   3  
ATOM 5577  C CD1  . LEU A 1 73  ? 16.331  6.333   1.199   1.00 0.00 ? 73  LEU A CD1  3  
ATOM 5578  C CD2  . LEU A 1 73  ? 14.830  8.140   2.092   1.00 0.00 ? 73  LEU A CD2  3  
ATOM 5579  H H    . LEU A 1 73  ? 16.415  9.958   -1.210  1.00 0.00 ? 73  LEU A H    3  
ATOM 5580  H HA   . LEU A 1 73  ? 16.068  10.561  1.659   1.00 0.00 ? 73  LEU A HA   3  
ATOM 5581  H HB2  . LEU A 1 73  ? 17.815  8.443   0.397   1.00 0.00 ? 73  LEU A HB2  3  
ATOM 5582  H HB3  . LEU A 1 73  ? 17.512  8.666   2.113   1.00 0.00 ? 73  LEU A HB3  3  
ATOM 5583  H HG   . LEU A 1 73  ? 15.421  7.878   0.070   1.00 0.00 ? 73  LEU A HG   3  
ATOM 5584  H HD11 . LEU A 1 73  ? 16.797  6.200   2.164   1.00 0.00 ? 73  LEU A HD11 3  
ATOM 5585  H HD12 . LEU A 1 73  ? 17.041  6.091   0.421   1.00 0.00 ? 73  LEU A HD12 3  
ATOM 5586  H HD13 . LEU A 1 73  ? 15.475  5.677   1.119   1.00 0.00 ? 73  LEU A HD13 3  
ATOM 5587  H HD21 . LEU A 1 73  ? 14.480  9.148   1.922   1.00 0.00 ? 73  LEU A HD21 3  
ATOM 5588  H HD22 . LEU A 1 73  ? 15.263  8.074   3.080   1.00 0.00 ? 73  LEU A HD22 3  
ATOM 5589  H HD23 . LEU A 1 73  ? 13.998  7.455   2.018   1.00 0.00 ? 73  LEU A HD23 3  
ATOM 5590  N N    . SER A 1 74  ? 18.134  11.934  -0.129  1.00 0.00 ? 74  SER A N    3  
ATOM 5591  C CA   . SER A 1 74  ? 19.294  12.815  -0.236  1.00 0.00 ? 74  SER A CA   3  
ATOM 5592  C C    . SER A 1 74  ? 19.059  14.135  0.494   1.00 0.00 ? 74  SER A C    3  
ATOM 5593  O O    . SER A 1 74  ? 18.030  14.315  1.159   1.00 0.00 ? 74  SER A O    3  
ATOM 5594  C CB   . SER A 1 74  ? 19.599  13.075  -1.712  1.00 0.00 ? 74  SER A CB   3  
ATOM 5595  O OG   . SER A 1 74  ? 18.425  13.426  -2.422  1.00 0.00 ? 74  SER A OG   3  
ATOM 5596  H H    . SER A 1 74  ? 17.451  11.968  -0.828  1.00 0.00 ? 74  SER A H    3  
ATOM 5597  H HA   . SER A 1 74  ? 20.141  12.315  0.213   1.00 0.00 ? 74  SER A HA   3  
ATOM 5598  H HB2  . SER A 1 74  ? 20.312  13.881  -1.798  1.00 0.00 ? 74  SER A HB2  3  
ATOM 5599  H HB3  . SER A 1 74  ? 20.013  12.184  -2.147  1.00 0.00 ? 74  SER A HB3  3  
ATOM 5600  H HG   . SER A 1 74  ? 18.591  14.225  -2.939  1.00 0.00 ? 74  SER A HG   3  
ATOM 5601  N N    . SER A 1 75  ? 20.024  15.049  0.370   1.00 0.00 ? 75  SER A N    3  
ATOM 5602  C CA   . SER A 1 75  ? 19.925  16.375  0.962   1.00 0.00 ? 75  SER A CA   3  
ATOM 5603  C C    . SER A 1 75  ? 18.733  17.133  0.374   1.00 0.00 ? 75  SER A C    3  
ATOM 5604  O O    . SER A 1 75  ? 18.851  17.784  -0.668  1.00 0.00 ? 75  SER A O    3  
ATOM 5605  C CB   . SER A 1 75  ? 21.227  17.153  0.731   1.00 0.00 ? 75  SER A CB   3  
ATOM 5606  O OG   . SER A 1 75  ? 22.349  16.409  1.183   1.00 0.00 ? 75  SER A OG   3  
ATOM 5607  H H    . SER A 1 75  ? 20.831  14.818  -0.137  1.00 0.00 ? 75  SER A H    3  
ATOM 5608  H HA   . SER A 1 75  ? 19.772  16.253  2.026   1.00 0.00 ? 75  SER A HA   3  
ATOM 5609  H HB2  . SER A 1 75  ? 21.345  17.351  -0.324  1.00 0.00 ? 75  SER A HB2  3  
ATOM 5610  H HB3  . SER A 1 75  ? 21.190  18.087  1.271   1.00 0.00 ? 75  SER A HB3  3  
ATOM 5611  H HG   . SER A 1 75  ? 22.714  15.907  0.444   1.00 0.00 ? 75  SER A HG   3  
ATOM 5612  N N    . GLN A 1 76  ? 17.578  16.948  1.013   1.00 0.00 ? 76  GLN A N    3  
ATOM 5613  C CA   . GLN A 1 76  ? 16.322  17.625  0.663   1.00 0.00 ? 76  GLN A CA   3  
ATOM 5614  C C    . GLN A 1 76  ? 15.617  16.827  -0.429  1.00 0.00 ? 76  GLN A C    3  
ATOM 5615  O O    . GLN A 1 76  ? 14.404  16.618  -0.374  1.00 0.00 ? 76  GLN A O    3  
ATOM 5616  C CB   . GLN A 1 76  ? 16.567  19.098  0.254   1.00 0.00 ? 76  GLN A CB   3  
ATOM 5617  C CG   . GLN A 1 76  ? 15.311  19.973  0.183   1.00 0.00 ? 76  GLN A CG   3  
ATOM 5618  C CD   . GLN A 1 76  ? 14.550  19.851  -1.128  1.00 0.00 ? 76  GLN A CD   3  
ATOM 5619  O OE1  . GLN A 1 76  ? 14.828  20.576  -2.085  1.00 0.00 ? 76  GLN A OE1  3  
ATOM 5620  N NE2  . GLN A 1 76  ? 13.578  18.958  -1.175  1.00 0.00 ? 76  GLN A NE2  3  
ATOM 5621  H H    . GLN A 1 76  ? 17.560  16.282  1.724   1.00 0.00 ? 76  GLN A H    3  
ATOM 5622  H HA   . GLN A 1 76  ? 15.699  17.609  1.547   1.00 0.00 ? 76  GLN A HA   3  
ATOM 5623  H HB2  . GLN A 1 76  ? 17.241  19.544  0.971   1.00 0.00 ? 76  GLN A HB2  3  
ATOM 5624  H HB3  . GLN A 1 76  ? 17.042  19.112  -0.718  1.00 0.00 ? 76  GLN A HB3  3  
ATOM 5625  H HG2  . GLN A 1 76  ? 14.647  19.692  0.988   1.00 0.00 ? 76  GLN A HG2  3  
ATOM 5626  H HG3  . GLN A 1 76  ? 15.605  21.006  0.313   1.00 0.00 ? 76  GLN A HG3  3  
ATOM 5627  H HE21 . GLN A 1 76  ? 13.395  18.426  -0.370  1.00 0.00 ? 76  GLN A HE21 3  
ATOM 5628  H HE22 . GLN A 1 76  ? 13.089  18.849  -2.018  1.00 0.00 ? 76  GLN A HE22 3  
ATOM 5629  N N    . ALA A 1 77  ? 16.406  16.354  -1.388  1.00 0.00 ? 77  ALA A N    3  
ATOM 5630  C CA   . ALA A 1 77  ? 15.938  15.437  -2.427  1.00 0.00 ? 77  ALA A CA   3  
ATOM 5631  C C    . ALA A 1 77  ? 14.858  16.053  -3.322  1.00 0.00 ? 77  ALA A C    3  
ATOM 5632  O O    . ALA A 1 77  ? 14.541  17.241  -3.224  1.00 0.00 ? 77  ALA A O    3  
ATOM 5633  C CB   . ALA A 1 77  ? 15.431  14.149  -1.782  1.00 0.00 ? 77  ALA A CB   3  
ATOM 5634  H H    . ALA A 1 77  ? 17.346  16.628  -1.392  1.00 0.00 ? 77  ALA A H    3  
ATOM 5635  H HA   . ALA A 1 77  ? 16.789  15.183  -3.042  1.00 0.00 ? 77  ALA A HA   3  
ATOM 5636  H HB1  . ALA A 1 77  ? 15.182  13.435  -2.552  1.00 0.00 ? 77  ALA A HB1  3  
ATOM 5637  H HB2  . ALA A 1 77  ? 14.553  14.361  -1.189  1.00 0.00 ? 77  ALA A HB2  3  
ATOM 5638  H HB3  . ALA A 1 77  ? 16.201  13.735  -1.146  1.00 0.00 ? 77  ALA A HB3  3  
ATOM 5639  N N    . LEU A 1 78  ? 14.314  15.229  -4.217  1.00 0.00 ? 78  LEU A N    3  
ATOM 5640  C CA   . LEU A 1 78  ? 13.214  15.637  -5.083  1.00 0.00 ? 78  LEU A CA   3  
ATOM 5641  C C    . LEU A 1 78  ? 11.891  15.344  -4.385  1.00 0.00 ? 78  LEU A C    3  
ATOM 5642  O O    . LEU A 1 78  ? 10.907  16.071  -4.543  1.00 0.00 ? 78  LEU A O    3  
ATOM 5643  C CB   . LEU A 1 78  ? 13.267  14.896  -6.432  1.00 0.00 ? 78  LEU A CB   3  
ATOM 5644  C CG   . LEU A 1 78  ? 14.487  15.201  -7.327  1.00 0.00 ? 78  LEU A CG   3  
ATOM 5645  C CD1  . LEU A 1 78  ? 15.775  14.635  -6.730  1.00 0.00 ? 78  LEU A CD1  3  
ATOM 5646  C CD2  . LEU A 1 78  ? 14.266  14.658  -8.738  1.00 0.00 ? 78  LEU A CD2  3  
ATOM 5647  H H    . LEU A 1 78  ? 14.661  14.316  -4.293  1.00 0.00 ? 78  LEU A H    3  
ATOM 5648  H HA   . LEU A 1 78  ? 13.294  16.703  -5.257  1.00 0.00 ? 78  LEU A HA   3  
ATOM 5649  H HB2  . LEU A 1 78  ? 13.255  13.832  -6.231  1.00 0.00 ? 78  LEU A HB2  3  
ATOM 5650  H HB3  . LEU A 1 78  ? 12.373  15.146  -6.987  1.00 0.00 ? 78  LEU A HB3  3  
ATOM 5651  H HG   . LEU A 1 78  ? 14.606  16.273  -7.403  1.00 0.00 ? 78  LEU A HG   3  
ATOM 5652  H HD11 . LEU A 1 78  ? 15.941  15.068  -5.754  1.00 0.00 ? 78  LEU A HD11 3  
ATOM 5653  H HD12 . LEU A 1 78  ? 16.608  14.877  -7.375  1.00 0.00 ? 78  LEU A HD12 3  
ATOM 5654  H HD13 . LEU A 1 78  ? 15.691  13.562  -6.639  1.00 0.00 ? 78  LEU A HD13 3  
ATOM 5655  H HD21 . LEU A 1 78  ? 14.133  13.586  -8.696  1.00 0.00 ? 78  LEU A HD21 3  
ATOM 5656  H HD22 . LEU A 1 78  ? 15.122  14.891  -9.352  1.00 0.00 ? 78  LEU A HD22 3  
ATOM 5657  H HD23 . LEU A 1 78  ? 13.384  15.114  -9.165  1.00 0.00 ? 78  LEU A HD23 3  
ATOM 5658  N N    . SER A 1 79  ? 11.884  14.267  -3.610  1.00 0.00 ? 79  SER A N    3  
ATOM 5659  C CA   . SER A 1 79  ? 10.717  13.864  -2.842  1.00 0.00 ? 79  SER A CA   3  
ATOM 5660  C C    . SER A 1 79  ? 11.142  13.370  -1.456  1.00 0.00 ? 79  SER A C    3  
ATOM 5661  O O    . SER A 1 79  ? 11.315  12.168  -1.239  1.00 0.00 ? 79  SER A O    3  
ATOM 5662  C CB   . SER A 1 79  ? 9.944   12.773  -3.595  1.00 0.00 ? 79  SER A CB   3  
ATOM 5663  O OG   . SER A 1 79  ? 9.587   13.207  -4.901  1.00 0.00 ? 79  SER A OG   3  
ATOM 5664  H H    . SER A 1 79  ? 12.695  13.720  -3.554  1.00 0.00 ? 79  SER A H    3  
ATOM 5665  H HA   . SER A 1 79  ? 10.078  14.729  -2.723  1.00 0.00 ? 79  SER A HA   3  
ATOM 5666  H HB2  . SER A 1 79  ? 10.559  11.889  -3.682  1.00 0.00 ? 79  SER A HB2  3  
ATOM 5667  H HB3  . SER A 1 79  ? 9.041   12.530  -3.051  1.00 0.00 ? 79  SER A HB3  3  
ATOM 5668  H HG   . SER A 1 79  ? 9.539   14.171  -4.912  1.00 0.00 ? 79  SER A HG   3  
ATOM 5669  N N    . PRO A 1 80  ? 11.358  14.301  -0.507  1.00 0.00 ? 80  PRO A N    3  
ATOM 5670  C CA   . PRO A 1 80  ? 11.787  13.956  0.852   1.00 0.00 ? 80  PRO A CA   3  
ATOM 5671  C C    . PRO A 1 80  ? 10.687  13.240  1.639   1.00 0.00 ? 80  PRO A C    3  
ATOM 5672  O O    . PRO A 1 80  ? 9.793   13.877  2.204   1.00 0.00 ? 80  PRO A O    3  
ATOM 5673  C CB   . PRO A 1 80  ? 12.121  15.317  1.482   1.00 0.00 ? 80  PRO A CB   3  
ATOM 5674  C CG   . PRO A 1 80  ? 11.283  16.294  0.725   1.00 0.00 ? 80  PRO A CG   3  
ATOM 5675  C CD   . PRO A 1 80  ? 11.201  15.761  -0.683  1.00 0.00 ? 80  PRO A CD   3  
ATOM 5676  H HA   . PRO A 1 80  ? 12.675  13.336  0.839   1.00 0.00 ? 80  PRO A HA   3  
ATOM 5677  H HB2  . PRO A 1 80  ? 11.870  15.309  2.534   1.00 0.00 ? 80  PRO A HB2  3  
ATOM 5678  H HB3  . PRO A 1 80  ? 13.174  15.526  1.361   1.00 0.00 ? 80  PRO A HB3  3  
ATOM 5679  H HG2  . PRO A 1 80  ? 10.295  16.351  1.163   1.00 0.00 ? 80  PRO A HG2  3  
ATOM 5680  H HG3  . PRO A 1 80  ? 11.753  17.267  0.732   1.00 0.00 ? 80  PRO A HG3  3  
ATOM 5681  H HD2  . PRO A 1 80  ? 10.242  15.996  -1.120  1.00 0.00 ? 80  PRO A HD2  3  
ATOM 5682  H HD3  . PRO A 1 80  ? 12.001  16.164  -1.289  1.00 0.00 ? 80  PRO A HD3  3  
ATOM 5683  N N    . VAL A 1 81  ? 10.740  11.913  1.644   1.00 0.00 ? 81  VAL A N    3  
ATOM 5684  C CA   . VAL A 1 81  ? 9.780   11.106  2.393   1.00 0.00 ? 81  VAL A CA   3  
ATOM 5685  C C    . VAL A 1 81  ? 10.109  11.121  3.886   1.00 0.00 ? 81  VAL A C    3  
ATOM 5686  O O    . VAL A 1 81  ? 11.280  11.208  4.274   1.00 0.00 ? 81  VAL A O    3  
ATOM 5687  C CB   . VAL A 1 81  ? 9.741   9.649   1.875   1.00 0.00 ? 81  VAL A CB   3  
ATOM 5688  C CG1  . VAL A 1 81  ? 9.285   9.621   0.419   1.00 0.00 ? 81  VAL A CG1  3  
ATOM 5689  C CG2  . VAL A 1 81  ? 11.101  8.968   2.036   1.00 0.00 ? 81  VAL A CG2  3  
ATOM 5690  H H    . VAL A 1 81  ? 11.437  11.465  1.122   1.00 0.00 ? 81  VAL A H    3  
ATOM 5691  H HA   . VAL A 1 81  ? 8.800   11.542  2.250   1.00 0.00 ? 81  VAL A HA   3  
ATOM 5692  H HB   . VAL A 1 81  ? 9.016   9.099   2.462   1.00 0.00 ? 81  VAL A HB   3  
ATOM 5693  H HG11 . VAL A 1 81  ? 9.249   8.598   0.072   1.00 0.00 ? 81  VAL A HG11 3  
ATOM 5694  H HG12 . VAL A 1 81  ? 9.980   10.183  -0.189  1.00 0.00 ? 81  VAL A HG12 3  
ATOM 5695  H HG13 . VAL A 1 81  ? 8.301   10.059  0.340   1.00 0.00 ? 81  VAL A HG13 3  
ATOM 5696  H HG21 . VAL A 1 81  ? 11.376  8.953   3.081   1.00 0.00 ? 81  VAL A HG21 3  
ATOM 5697  H HG22 . VAL A 1 81  ? 11.847  9.512   1.476   1.00 0.00 ? 81  VAL A HG22 3  
ATOM 5698  H HG23 . VAL A 1 81  ? 11.044  7.953   1.666   1.00 0.00 ? 81  VAL A HG23 3  
ATOM 5699  N N    . ASN A 1 82  ? 9.072   11.040  4.717   1.00 0.00 ? 82  ASN A N    3  
ATOM 5700  C CA   . ASN A 1 82  ? 9.228   11.141  6.168   1.00 0.00 ? 82  ASN A CA   3  
ATOM 5701  C C    . ASN A 1 82  ? 9.387   9.757   6.799   1.00 0.00 ? 82  ASN A C    3  
ATOM 5702  O O    . ASN A 1 82  ? 8.409   9.032   6.992   1.00 0.00 ? 82  ASN A O    3  
ATOM 5703  C CB   . ASN A 1 82  ? 8.024   11.869  6.784   1.00 0.00 ? 82  ASN A CB   3  
ATOM 5704  C CG   . ASN A 1 82  ? 8.161   12.068  8.286   1.00 0.00 ? 82  ASN A CG   3  
ATOM 5705  O OD1  . ASN A 1 82  ? 8.691   13.081  8.745   1.00 0.00 ? 82  ASN A OD1  3  
ATOM 5706  N ND2  . ASN A 1 82  ? 7.693   11.100  9.060   1.00 0.00 ? 82  ASN A ND2  3  
ATOM 5707  H H    . ASN A 1 82  ? 8.174   10.904  4.344   1.00 0.00 ? 82  ASN A H    3  
ATOM 5708  H HA   . ASN A 1 82  ? 10.122  11.718  6.365   1.00 0.00 ? 82  ASN A HA   3  
ATOM 5709  H HB2  . ASN A 1 82  ? 7.923   12.840  6.321   1.00 0.00 ? 82  ASN A HB2  3  
ATOM 5710  H HB3  . ASN A 1 82  ? 7.127   11.294  6.595   1.00 0.00 ? 82  ASN A HB3  3  
ATOM 5711  H HD21 . ASN A 1 82  ? 7.292   10.315  8.631   1.00 0.00 ? 82  ASN A HD21 3  
ATOM 5712  H HD22 . ASN A 1 82  ? 7.757   11.215  10.034  1.00 0.00 ? 82  ASN A HD22 3  
ATOM 5713  N N    . ILE A 1 83  ? 10.629  9.399   7.107   1.00 0.00 ? 83  ILE A N    3  
ATOM 5714  C CA   . ILE A 1 83  ? 10.956  8.121   7.744   1.00 0.00 ? 83  ILE A CA   3  
ATOM 5715  C C    . ILE A 1 83  ? 12.082  8.320   8.756   1.00 0.00 ? 83  ILE A C    3  
ATOM 5716  O O    . ILE A 1 83  ? 12.462  9.458   9.048   1.00 0.00 ? 83  ILE A O    3  
ATOM 5717  C CB   . ILE A 1 83  ? 11.389  7.055   6.699   1.00 0.00 ? 83  ILE A CB   3  
ATOM 5718  C CG1  . ILE A 1 83  ? 12.434  7.646   5.737   1.00 0.00 ? 83  ILE A CG1  3  
ATOM 5719  C CG2  . ILE A 1 83  ? 10.181  6.510   5.937   1.00 0.00 ? 83  ILE A CG2  3  
ATOM 5720  C CD1  . ILE A 1 83  ? 12.899  6.683   4.667   1.00 0.00 ? 83  ILE A CD1  3  
ATOM 5721  H H    . ILE A 1 83  ? 11.358  10.020  6.906   1.00 0.00 ? 83  ILE A H    3  
ATOM 5722  H HA   . ILE A 1 83  ? 10.077  7.762   8.263   1.00 0.00 ? 83  ILE A HA   3  
ATOM 5723  H HB   . ILE A 1 83  ? 11.837  6.229   7.235   1.00 0.00 ? 83  ILE A HB   3  
ATOM 5724  H HG12 . ILE A 1 83  ? 12.012  8.508   5.240   1.00 0.00 ? 83  ILE A HG12 3  
ATOM 5725  H HG13 . ILE A 1 83  ? 13.302  7.955   6.303   1.00 0.00 ? 83  ILE A HG13 3  
ATOM 5726  H HG21 . ILE A 1 83  ? 10.504  5.748   5.242   1.00 0.00 ? 83  ILE A HG21 3  
ATOM 5727  H HG22 . ILE A 1 83  ? 9.703   7.312   5.392   1.00 0.00 ? 83  ILE A HG22 3  
ATOM 5728  H HG23 . ILE A 1 83  ? 9.475   6.081   6.635   1.00 0.00 ? 83  ILE A HG23 3  
ATOM 5729  H HD11 . ILE A 1 83  ? 13.635  7.166   4.044   1.00 0.00 ? 83  ILE A HD11 3  
ATOM 5730  H HD12 . ILE A 1 83  ? 12.056  6.381   4.061   1.00 0.00 ? 83  ILE A HD12 3  
ATOM 5731  H HD13 . ILE A 1 83  ? 13.337  5.814   5.131   1.00 0.00 ? 83  ILE A HD13 3  
ATOM 5732  N N    . ASP A 1 84  ? 12.610  7.217   9.289   1.00 0.00 ? 84  ASP A N    3  
ATOM 5733  C CA   . ASP A 1 84  ? 13.729  7.267   10.232  1.00 0.00 ? 84  ASP A CA   3  
ATOM 5734  C C    . ASP A 1 84  ? 14.996  7.723   9.512   1.00 0.00 ? 84  ASP A C    3  
ATOM 5735  O O    . ASP A 1 84  ? 15.853  6.909   9.171   1.00 0.00 ? 84  ASP A O    3  
ATOM 5736  C CB   . ASP A 1 84  ? 13.972  5.887   10.870  1.00 0.00 ? 84  ASP A CB   3  
ATOM 5737  C CG   . ASP A 1 84  ? 12.706  5.249   11.418  1.00 0.00 ? 84  ASP A CG   3  
ATOM 5738  O OD1  . ASP A 1 84  ? 11.910  4.731   10.607  1.00 0.00 ? 84  ASP A OD1  3  
ATOM 5739  O OD2  . ASP A 1 84  ? 12.503  5.257   12.652  1.00 0.00 ? 84  ASP A OD2  3  
ATOM 5740  H H    . ASP A 1 84  ? 12.235  6.343   9.048   1.00 0.00 ? 84  ASP A H    3  
ATOM 5741  H HA   . ASP A 1 84  ? 13.486  7.981   11.009  1.00 0.00 ? 84  ASP A HA   3  
ATOM 5742  H HB2  . ASP A 1 84  ? 14.388  5.223   10.124  1.00 0.00 ? 84  ASP A HB2  3  
ATOM 5743  H HB3  . ASP A 1 84  ? 14.682  5.993   11.680  1.00 0.00 ? 84  ASP A HB3  3  
ATOM 5744  N N    . ARG A 1 85  ? 15.090  9.021   9.248   1.00 0.00 ? 85  ARG A N    3  
ATOM 5745  C CA   . ARG A 1 85  ? 16.232  9.585   8.537   1.00 0.00 ? 85  ARG A CA   3  
ATOM 5746  C C    . ARG A 1 85  ? 17.319  10.008  9.520   1.00 0.00 ? 85  ARG A C    3  
ATOM 5747  O O    . ARG A 1 85  ? 18.512  9.938   9.212   1.00 0.00 ? 85  ARG A O    3  
ATOM 5748  C CB   . ARG A 1 85  ? 15.790  10.777  7.676   1.00 0.00 ? 85  ARG A CB   3  
ATOM 5749  C CG   . ARG A 1 85  ? 14.782  10.405  6.590   1.00 0.00 ? 85  ARG A CG   3  
ATOM 5750  C CD   . ARG A 1 85  ? 14.402  11.600  5.720   1.00 0.00 ? 85  ARG A CD   3  
ATOM 5751  N NE   . ARG A 1 85  ? 15.558  12.160  5.013   1.00 0.00 ? 85  ARG A NE   3  
ATOM 5752  C CZ   . ARG A 1 85  ? 15.562  12.500  3.720   1.00 0.00 ? 85  ARG A CZ   3  
ATOM 5753  N NH1  . ARG A 1 85  ? 14.473  12.311  2.977   1.00 0.00 ? 85  ARG A NH1  3  
ATOM 5754  N NH2  . ARG A 1 85  ? 16.658  13.020  3.176   1.00 0.00 ? 85  ARG A NH2  3  
ATOM 5755  H H    . ARG A 1 85  ? 14.368  9.618   9.540   1.00 0.00 ? 85  ARG A H    3  
ATOM 5756  H HA   . ARG A 1 85  ? 16.631  8.819   7.887   1.00 0.00 ? 85  ARG A HA   3  
ATOM 5757  H HB2  . ARG A 1 85  ? 15.339  11.521  8.317   1.00 0.00 ? 85  ARG A HB2  3  
ATOM 5758  H HB3  . ARG A 1 85  ? 16.660  11.208  7.198   1.00 0.00 ? 85  ARG A HB3  3  
ATOM 5759  H HG2  . ARG A 1 85  ? 15.214  9.641   5.959   1.00 0.00 ? 85  ARG A HG2  3  
ATOM 5760  H HG3  . ARG A 1 85  ? 13.889  10.017  7.062   1.00 0.00 ? 85  ARG A HG3  3  
ATOM 5761  H HD2  . ARG A 1 85  ? 13.665  11.282  4.996   1.00 0.00 ? 85  ARG A HD2  3  
ATOM 5762  H HD3  . ARG A 1 85  ? 13.974  12.365  6.352   1.00 0.00 ? 85  ARG A HD3  3  
ATOM 5763  H HE   . ARG A 1 85  ? 16.381  12.297  5.538   1.00 0.00 ? 85  ARG A HE   3  
ATOM 5764  H HH11 . ARG A 1 85  ? 13.646  11.917  3.386   1.00 0.00 ? 85  ARG A HH11 3  
ATOM 5765  H HH12 . ARG A 1 85  ? 14.481  12.542  2.000   1.00 0.00 ? 85  ARG A HH12 3  
ATOM 5766  H HH21 . ARG A 1 85  ? 17.483  13.155  3.737   1.00 0.00 ? 85  ARG A HH21 3  
ATOM 5767  H HH22 . ARG A 1 85  ? 16.673  13.285  2.209   1.00 0.00 ? 85  ARG A HH22 3  
ATOM 5768  N N    . GLN A 1 86  ? 16.905  10.434  10.710  1.00 0.00 ? 86  GLN A N    3  
ATOM 5769  C CA   . GLN A 1 86  ? 17.845  10.861  11.745  1.00 0.00 ? 86  GLN A CA   3  
ATOM 5770  C C    . GLN A 1 86  ? 18.643  9.663   12.265  1.00 0.00 ? 86  GLN A C    3  
ATOM 5771  O O    . GLN A 1 86  ? 19.807  9.788   12.655  1.00 0.00 ? 86  GLN A O    3  
ATOM 5772  C CB   . GLN A 1 86  ? 17.091  11.545  12.897  1.00 0.00 ? 86  GLN A CB   3  
ATOM 5773  C CG   . GLN A 1 86  ? 18.002  12.162  13.954  1.00 0.00 ? 86  GLN A CG   3  
ATOM 5774  C CD   . GLN A 1 86  ? 18.878  13.286  13.413  1.00 0.00 ? 86  GLN A CD   3  
ATOM 5775  O OE1  . GLN A 1 86  ? 20.003  13.482  13.870  1.00 0.00 ? 86  GLN A OE1  3  
ATOM 5776  N NE2  . GLN A 1 86  ? 18.362  14.050  12.459  1.00 0.00 ? 86  GLN A NE2  3  
ATOM 5777  H H    . GLN A 1 86  ? 15.940  10.466  10.896  1.00 0.00 ? 86  GLN A H    3  
ATOM 5778  H HA   . GLN A 1 86  ? 18.530  11.570  11.300  1.00 0.00 ? 86  GLN A HA   3  
ATOM 5779  H HB2  . GLN A 1 86  ? 16.469  12.329  12.488  1.00 0.00 ? 86  GLN A HB2  3  
ATOM 5780  H HB3  . GLN A 1 86  ? 16.457  10.815  13.381  1.00 0.00 ? 86  GLN A HB3  3  
ATOM 5781  H HG2  . GLN A 1 86  ? 17.389  12.562  14.750  1.00 0.00 ? 86  GLN A HG2  3  
ATOM 5782  H HG3  . GLN A 1 86  ? 18.642  11.388  14.354  1.00 0.00 ? 86  GLN A HG3  3  
ATOM 5783  H HE21 . GLN A 1 86  ? 17.448  13.863  12.152  1.00 0.00 ? 86  GLN A HE21 3  
ATOM 5784  H HE22 . GLN A 1 86  ? 18.916  14.775  12.097  1.00 0.00 ? 86  GLN A HE22 3  
ATOM 5785  N N    . ALA A 1 87  ? 18.009  8.496   12.253  1.00 0.00 ? 87  ALA A N    3  
ATOM 5786  C CA   . ALA A 1 87  ? 18.637  7.258   12.715  1.00 0.00 ? 87  ALA A CA   3  
ATOM 5787  C C    . ALA A 1 87  ? 18.900  6.320   11.538  1.00 0.00 ? 87  ALA A C    3  
ATOM 5788  O O    . ALA A 1 87  ? 19.055  5.108   11.712  1.00 0.00 ? 87  ALA A O    3  
ATOM 5789  C CB   . ALA A 1 87  ? 17.743  6.583   13.751  1.00 0.00 ? 87  ALA A CB   3  
ATOM 5790  H H    . ALA A 1 87  ? 17.088  8.464   11.925  1.00 0.00 ? 87  ALA A H    3  
ATOM 5791  H HA   . ALA A 1 87  ? 19.580  7.505   13.186  1.00 0.00 ? 87  ALA A HA   3  
ATOM 5792  H HB1  . ALA A 1 87  ? 18.229  5.692   14.121  1.00 0.00 ? 87  ALA A HB1  3  
ATOM 5793  H HB2  . ALA A 1 87  ? 16.800  6.316   13.296  1.00 0.00 ? 87  ALA A HB2  3  
ATOM 5794  H HB3  . ALA A 1 87  ? 17.566  7.263   14.572  1.00 0.00 ? 87  ALA A HB3  3  
ATOM 5795  N N    . TRP A 1 88  ? 18.978  6.894   10.340  1.00 0.00 ? 88  TRP A N    3  
ATOM 5796  C CA   . TRP A 1 88  ? 19.099  6.108   9.117   1.00 0.00 ? 88  TRP A CA   3  
ATOM 5797  C C    . TRP A 1 88  ? 20.529  5.587   8.927   1.00 0.00 ? 88  TRP A C    3  
ATOM 5798  O O    . TRP A 1 88  ? 21.441  5.945   9.677   1.00 0.00 ? 88  TRP A O    3  
ATOM 5799  C CB   . TRP A 1 88  ? 18.660  6.948   7.909   1.00 0.00 ? 88  TRP A CB   3  
ATOM 5800  C CG   . TRP A 1 88  ? 18.358  6.123   6.697   1.00 0.00 ? 88  TRP A CG   3  
ATOM 5801  C CD1  . TRP A 1 88  ? 17.487  5.076   6.625   1.00 0.00 ? 88  TRP A CD1  3  
ATOM 5802  C CD2  . TRP A 1 88  ? 18.919  6.271   5.391   1.00 0.00 ? 88  TRP A CD2  3  
ATOM 5803  N NE1  . TRP A 1 88  ? 17.491  4.549   5.362   1.00 0.00 ? 88  TRP A NE1  3  
ATOM 5804  C CE2  . TRP A 1 88  ? 18.353  5.270   4.584   1.00 0.00 ? 88  TRP A CE2  3  
ATOM 5805  C CE3  . TRP A 1 88  ? 19.845  7.150   4.823   1.00 0.00 ? 88  TRP A CE3  3  
ATOM 5806  C CZ2  . TRP A 1 88  ? 18.685  5.120   3.248   1.00 0.00 ? 88  TRP A CZ2  3  
ATOM 5807  C CZ3  . TRP A 1 88  ? 20.171  7.000   3.489   1.00 0.00 ? 88  TRP A CZ3  3  
ATOM 5808  C CH2  . TRP A 1 88  ? 19.592  5.990   2.716   1.00 0.00 ? 88  TRP A CH2  3  
ATOM 5809  H H    . TRP A 1 88  ? 18.957  7.871   10.277  1.00 0.00 ? 88  TRP A H    3  
ATOM 5810  H HA   . TRP A 1 88  ? 18.437  5.259   9.208   1.00 0.00 ? 88  TRP A HA   3  
ATOM 5811  H HB2  . TRP A 1 88  ? 17.768  7.494   8.165   1.00 0.00 ? 88  TRP A HB2  3  
ATOM 5812  H HB3  . TRP A 1 88  ? 19.445  7.646   7.655   1.00 0.00 ? 88  TRP A HB3  3  
ATOM 5813  H HD1  . TRP A 1 88  ? 16.901  4.714   7.457   1.00 0.00 ? 88  TRP A HD1  3  
ATOM 5814  H HE1  . TRP A 1 88  ? 16.952  3.782   5.060   1.00 0.00 ? 88  TRP A HE1  3  
ATOM 5815  H HE3  . TRP A 1 88  ? 20.301  7.936   5.408   1.00 0.00 ? 88  TRP A HE3  3  
ATOM 5816  H HZ2  . TRP A 1 88  ? 18.245  4.350   2.636   1.00 0.00 ? 88  TRP A HZ2  3  
ATOM 5817  H HZ3  . TRP A 1 88  ? 20.886  7.668   3.030   1.00 0.00 ? 88  TRP A HZ3  3  
ATOM 5818  H HH2  . TRP A 1 88  ? 19.873  5.905   1.676   1.00 0.00 ? 88  TRP A HH2  3  
ATOM 5819  N N    . LEU A 1 89  ? 20.705  4.734   7.920   1.00 0.00 ? 89  LEU A N    3  
ATOM 5820  C CA   . LEU A 1 89  ? 21.992  4.101   7.642   1.00 0.00 ? 89  LEU A CA   3  
ATOM 5821  C C    . LEU A 1 89  ? 22.954  5.087   6.977   1.00 0.00 ? 89  LEU A C    3  
ATOM 5822  O O    . LEU A 1 89  ? 24.115  5.204   7.372   1.00 0.00 ? 89  LEU A O    3  
ATOM 5823  C CB   . LEU A 1 89  ? 21.800  2.864   6.743   1.00 0.00 ? 89  LEU A CB   3  
ATOM 5824  C CG   . LEU A 1 89  ? 20.926  1.729   7.323   1.00 0.00 ? 89  LEU A CG   3  
ATOM 5825  C CD1  . LEU A 1 89  ? 19.452  2.130   7.396   1.00 0.00 ? 89  LEU A CD1  3  
ATOM 5826  C CD2  . LEU A 1 89  ? 21.089  0.453   6.501   1.00 0.00 ? 89  LEU A CD2  3  
ATOM 5827  H H    . LEU A 1 89  ? 19.944  4.524   7.344   1.00 0.00 ? 89  LEU A H    3  
ATOM 5828  H HA   . LEU A 1 89  ? 22.416  3.784   8.586   1.00 0.00 ? 89  LEU A HA   3  
ATOM 5829  H HB2  . LEU A 1 89  ? 21.354  3.191   5.813   1.00 0.00 ? 89  LEU A HB2  3  
ATOM 5830  H HB3  . LEU A 1 89  ? 22.778  2.456   6.524   1.00 0.00 ? 89  LEU A HB3  3  
ATOM 5831  H HG   . LEU A 1 89  ? 21.256  1.515   8.331   1.00 0.00 ? 89  LEU A HG   3  
ATOM 5832  H HD11 . LEU A 1 89  ? 19.348  3.002   8.024   1.00 0.00 ? 89  LEU A HD11 3  
ATOM 5833  H HD12 . LEU A 1 89  ? 18.876  1.317   7.814   1.00 0.00 ? 89  LEU A HD12 3  
ATOM 5834  H HD13 . LEU A 1 89  ? 19.088  2.356   6.403   1.00 0.00 ? 89  LEU A HD13 3  
ATOM 5835  H HD21 . LEU A 1 89  ? 20.473  -0.329  6.920   1.00 0.00 ? 89  LEU A HD21 3  
ATOM 5836  H HD22 . LEU A 1 89  ? 22.124  0.142   6.521   1.00 0.00 ? 89  LEU A HD22 3  
ATOM 5837  H HD23 . LEU A 1 89  ? 20.789  0.638   5.478   1.00 0.00 ? 89  LEU A HD23 3  
ATOM 5838  N N    . GLY A 1 90  ? 22.460  5.791   5.964   1.00 0.00 ? 90  GLY A N    3  
ATOM 5839  C CA   . GLY A 1 90  ? 23.276  6.763   5.256   1.00 0.00 ? 90  GLY A CA   3  
ATOM 5840  C C    . GLY A 1 90  ? 24.112  6.125   4.163   1.00 0.00 ? 90  GLY A C    3  
ATOM 5841  O O    . GLY A 1 90  ? 23.657  5.200   3.485   1.00 0.00 ? 90  GLY A O    3  
ATOM 5842  H H    . GLY A 1 90  ? 21.533  5.647   5.690   1.00 0.00 ? 90  GLY A H    3  
ATOM 5843  H HA2  . GLY A 1 90  ? 22.626  7.503   4.811   1.00 0.00 ? 90  GLY A HA2  3  
ATOM 5844  H HA3  . GLY A 1 90  ? 23.932  7.254   5.960   1.00 0.00 ? 90  GLY A HA3  3  
ATOM 5845  N N    . GLU A 1 91  ? 25.342  6.607   4.009   1.00 0.00 ? 91  GLU A N    3  
ATOM 5846  C CA   . GLU A 1 91  ? 26.273  6.102   2.994   1.00 0.00 ? 91  GLU A CA   3  
ATOM 5847  C C    . GLU A 1 91  ? 26.597  4.619   3.211   1.00 0.00 ? 91  GLU A C    3  
ATOM 5848  O O    . GLU A 1 91  ? 27.159  3.965   2.329   1.00 0.00 ? 91  GLU A O    3  
ATOM 5849  C CB   . GLU A 1 91  ? 27.573  6.934   2.966   1.00 0.00 ? 91  GLU A CB   3  
ATOM 5850  C CG   . GLU A 1 91  ? 28.320  7.018   4.302   1.00 0.00 ? 91  GLU A CG   3  
ATOM 5851  C CD   . GLU A 1 91  ? 27.643  7.941   5.306   1.00 0.00 ? 91  GLU A CD   3  
ATOM 5852  O OE1  . GLU A 1 91  ? 27.841  9.172   5.222   1.00 0.00 ? 91  GLU A OE1  3  
ATOM 5853  O OE2  . GLU A 1 91  ? 26.883  7.446   6.166   1.00 0.00 ? 91  GLU A OE2  3  
ATOM 5854  H H    . GLU A 1 91  ? 25.632  7.334   4.595   1.00 0.00 ? 91  GLU A H    3  
ATOM 5855  H HA   . GLU A 1 91  ? 25.783  6.201   2.035   1.00 0.00 ? 91  GLU A HA   3  
ATOM 5856  H HB2  . GLU A 1 91  ? 28.244  6.499   2.237   1.00 0.00 ? 91  GLU A HB2  3  
ATOM 5857  H HB3  . GLU A 1 91  ? 27.330  7.939   2.652   1.00 0.00 ? 91  GLU A HB3  3  
ATOM 5858  H HG2  . GLU A 1 91  ? 28.381  6.027   4.729   1.00 0.00 ? 91  GLU A HG2  3  
ATOM 5859  H HG3  . GLU A 1 91  ? 29.321  7.386   4.116   1.00 0.00 ? 91  GLU A HG3  3  
ATOM 5860  N N    . GLU A 1 92  ? 26.217  4.089   4.374   1.00 0.00 ? 92  GLU A N    3  
ATOM 5861  C CA   . GLU A 1 92  ? 26.429  2.682   4.695   1.00 0.00 ? 92  GLU A CA   3  
ATOM 5862  C C    . GLU A 1 92  ? 25.707  1.810   3.673   1.00 0.00 ? 92  GLU A C    3  
ATOM 5863  O O    . GLU A 1 92  ? 26.149  0.706   3.347   1.00 0.00 ? 92  GLU A O    3  
ATOM 5864  C CB   . GLU A 1 92  ? 25.918  2.379   6.111   1.00 0.00 ? 92  GLU A CB   3  
ATOM 5865  C CG   . GLU A 1 92  ? 26.044  0.915   6.524   1.00 0.00 ? 92  GLU A CG   3  
ATOM 5866  C CD   . GLU A 1 92  ? 25.481  0.651   7.910   1.00 0.00 ? 92  GLU A CD   3  
ATOM 5867  O OE1  . GLU A 1 92  ? 24.247  0.726   8.077   1.00 0.00 ? 92  GLU A OE1  3  
ATOM 5868  O OE2  . GLU A 1 92  ? 26.267  0.377   8.844   1.00 0.00 ? 92  GLU A OE2  3  
ATOM 5869  H H    . GLU A 1 92  ? 25.771  4.656   5.030   1.00 0.00 ? 92  GLU A H    3  
ATOM 5870  H HA   . GLU A 1 92  ? 27.490  2.481   4.645   1.00 0.00 ? 92  GLU A HA   3  
ATOM 5871  H HB2  . GLU A 1 92  ? 26.479  2.977   6.816   1.00 0.00 ? 92  GLU A HB2  3  
ATOM 5872  H HB3  . GLU A 1 92  ? 24.875  2.659   6.171   1.00 0.00 ? 92  GLU A HB3  3  
ATOM 5873  H HG2  . GLU A 1 92  ? 25.507  0.305   5.811   1.00 0.00 ? 92  GLU A HG2  3  
ATOM 5874  H HG3  . GLU A 1 92  ? 27.090  0.639   6.514   1.00 0.00 ? 92  GLU A HG3  3  
ATOM 5875  N N    . VAL A 1 93  ? 24.604  2.336   3.151   1.00 0.00 ? 93  VAL A N    3  
ATOM 5876  C CA   . VAL A 1 93  ? 23.819  1.631   2.153   1.00 0.00 ? 93  VAL A CA   3  
ATOM 5877  C C    . VAL A 1 93  ? 24.616  1.470   0.861   1.00 0.00 ? 93  VAL A C    3  
ATOM 5878  O O    . VAL A 1 93  ? 24.532  0.446   0.183   1.00 0.00 ? 93  VAL A O    3  
ATOM 5879  C CB   . VAL A 1 93  ? 22.494  2.368   1.844   1.00 0.00 ? 93  VAL A CB   3  
ATOM 5880  C CG1  . VAL A 1 93  ? 21.690  1.617   0.785   1.00 0.00 ? 93  VAL A CG1  3  
ATOM 5881  C CG2  . VAL A 1 93  ? 21.675  2.561   3.120   1.00 0.00 ? 93  VAL A CG2  3  
ATOM 5882  H H    . VAL A 1 93  ? 24.314  3.226   3.444   1.00 0.00 ? 93  VAL A H    3  
ATOM 5883  H HA   . VAL A 1 93  ? 23.585  0.658   2.552   1.00 0.00 ? 93  VAL A HA   3  
ATOM 5884  H HB   . VAL A 1 93  ? 22.736  3.347   1.450   1.00 0.00 ? 93  VAL A HB   3  
ATOM 5885  H HG11 . VAL A 1 93  ? 20.782  2.158   0.569   1.00 0.00 ? 93  VAL A HG11 3  
ATOM 5886  H HG12 . VAL A 1 93  ? 21.444  0.631   1.149   1.00 0.00 ? 93  VAL A HG12 3  
ATOM 5887  H HG13 . VAL A 1 93  ? 22.278  1.529   -0.118  1.00 0.00 ? 93  VAL A HG13 3  
ATOM 5888  H HG21 . VAL A 1 93  ? 20.770  3.104   2.890   1.00 0.00 ? 93  VAL A HG21 3  
ATOM 5889  H HG22 . VAL A 1 93  ? 22.254  3.121   3.841   1.00 0.00 ? 93  VAL A HG22 3  
ATOM 5890  H HG23 . VAL A 1 93  ? 21.419  1.597   3.536   1.00 0.00 ? 93  VAL A HG23 3  
ATOM 5891  N N    . LEU A 1 94  ? 25.395  2.496   0.536   1.00 0.00 ? 94  LEU A N    3  
ATOM 5892  C CA   . LEU A 1 94  ? 26.215  2.497   -0.670  1.00 0.00 ? 94  LEU A CA   3  
ATOM 5893  C C    . LEU A 1 94  ? 27.492  1.692   -0.436  1.00 0.00 ? 94  LEU A C    3  
ATOM 5894  O O    . LEU A 1 94  ? 28.148  1.253   -1.383  1.00 0.00 ? 94  LEU A O    3  
ATOM 5895  C CB   . LEU A 1 94  ? 26.565  3.935   -1.094  1.00 0.00 ? 94  LEU A CB   3  
ATOM 5896  C CG   . LEU A 1 94  ? 25.379  4.826   -1.528  1.00 0.00 ? 94  LEU A CG   3  
ATOM 5897  C CD1  . LEU A 1 94  ? 24.545  4.136   -2.605  1.00 0.00 ? 94  LEU A CD1  3  
ATOM 5898  C CD2  . LEU A 1 94  ? 24.511  5.220   -0.334  1.00 0.00 ? 94  LEU A CD2  3  
ATOM 5899  H H    . LEU A 1 94  ? 25.431  3.272   1.134   1.00 0.00 ? 94  LEU A H    3  
ATOM 5900  H HA   . LEU A 1 94  ? 25.646  2.026   -1.461  1.00 0.00 ? 94  LEU A HA   3  
ATOM 5901  H HB2  . LEU A 1 94  ? 27.060  4.415   -0.261  1.00 0.00 ? 94  LEU A HB2  3  
ATOM 5902  H HB3  . LEU A 1 94  ? 27.264  3.884   -1.918  1.00 0.00 ? 94  LEU A HB3  3  
ATOM 5903  H HG   . LEU A 1 94  ? 25.773  5.736   -1.961  1.00 0.00 ? 94  LEU A HG   3  
ATOM 5904  H HD11 . LEU A 1 94  ? 23.741  4.789   -2.912  1.00 0.00 ? 94  LEU A HD11 3  
ATOM 5905  H HD12 . LEU A 1 94  ? 24.130  3.218   -2.212  1.00 0.00 ? 94  LEU A HD12 3  
ATOM 5906  H HD13 . LEU A 1 94  ? 25.170  3.912   -3.458  1.00 0.00 ? 94  LEU A HD13 3  
ATOM 5907  H HD21 . LEU A 1 94  ? 24.117  4.331   0.137   1.00 0.00 ? 94  LEU A HD21 3  
ATOM 5908  H HD22 . LEU A 1 94  ? 23.694  5.841   -0.671  1.00 0.00 ? 94  LEU A HD22 3  
ATOM 5909  H HD23 . LEU A 1 94  ? 25.108  5.770   0.379   1.00 0.00 ? 94  LEU A HD23 3  
ATOM 5910  N N    . ALA A 1 95  ? 27.848  1.528   0.836   1.00 0.00 ? 95  ALA A N    3  
ATOM 5911  C CA   . ALA A 1 95  ? 29.002  0.719   1.220   1.00 0.00 ? 95  ALA A CA   3  
ATOM 5912  C C    . ALA A 1 95  ? 28.729  -0.761  0.958   1.00 0.00 ? 95  ALA A C    3  
ATOM 5913  O O    . ALA A 1 95  ? 29.553  -1.460  0.362   1.00 0.00 ? 95  ALA A O    3  
ATOM 5914  C CB   . ALA A 1 95  ? 29.351  0.953   2.688   1.00 0.00 ? 95  ALA A CB   3  
ATOM 5915  H H    . ALA A 1 95  ? 27.324  1.973   1.535   1.00 0.00 ? 95  ALA A H    3  
ATOM 5916  H HA   . ALA A 1 95  ? 29.845  1.034   0.618   1.00 0.00 ? 95  ALA A HA   3  
ATOM 5917  H HB1  . ALA A 1 95  ? 30.240  0.393   2.942   1.00 0.00 ? 95  ALA A HB1  3  
ATOM 5918  H HB2  . ALA A 1 95  ? 28.530  0.627   3.311   1.00 0.00 ? 95  ALA A HB2  3  
ATOM 5919  H HB3  . ALA A 1 95  ? 29.531  2.005   2.853   1.00 0.00 ? 95  ALA A HB3  3  
ATOM 5920  N N    . GLU A 1 96  ? 27.560  -1.228  1.391   1.00 0.00 ? 96  GLU A N    3  
ATOM 5921  C CA   . GLU A 1 96  ? 27.149  -2.615  1.179   1.00 0.00 ? 96  GLU A CA   3  
ATOM 5922  C C    . GLU A 1 96  ? 25.618  -2.725  1.141   1.00 0.00 ? 96  GLU A C    3  
ATOM 5923  O O    . GLU A 1 96  ? 24.962  -2.775  2.182   1.00 0.00 ? 96  GLU A O    3  
ATOM 5924  C CB   . GLU A 1 96  ? 27.739  -3.529  2.271   1.00 0.00 ? 96  GLU A CB   3  
ATOM 5925  C CG   . GLU A 1 96  ? 27.483  -3.048  3.699   1.00 0.00 ? 96  GLU A CG   3  
ATOM 5926  C CD   . GLU A 1 96  ? 28.054  -3.991  4.747   1.00 0.00 ? 96  GLU A CD   3  
ATOM 5927  O OE1  . GLU A 1 96  ? 29.263  -3.889  5.055   1.00 0.00 ? 96  GLU A OE1  3  
ATOM 5928  O OE2  . GLU A 1 96  ? 27.301  -4.846  5.262   1.00 0.00 ? 96  GLU A OE2  3  
ATOM 5929  H H    . GLU A 1 96  ? 26.954  -0.621  1.872   1.00 0.00 ? 96  GLU A H    3  
ATOM 5930  H HA   . GLU A 1 96  ? 27.537  -2.927  0.219   1.00 0.00 ? 96  GLU A HA   3  
ATOM 5931  H HB2  . GLU A 1 96  ? 27.312  -4.517  2.166   1.00 0.00 ? 96  GLU A HB2  3  
ATOM 5932  H HB3  . GLU A 1 96  ? 28.809  -3.596  2.124   1.00 0.00 ? 96  GLU A HB3  3  
ATOM 5933  H HG2  . GLU A 1 96  ? 27.937  -2.075  3.827   1.00 0.00 ? 96  GLU A HG2  3  
ATOM 5934  H HG3  . GLU A 1 96  ? 26.415  -2.964  3.851   1.00 0.00 ? 96  GLU A HG3  3  
ATOM 5935  N N    . PRO A 1 97  ? 25.023  -2.739  -0.066  1.00 0.00 ? 97  PRO A N    3  
ATOM 5936  C CA   . PRO A 1 97  ? 23.571  -2.823  -0.225  1.00 0.00 ? 97  PRO A CA   3  
ATOM 5937  C C    . PRO A 1 97  ? 23.052  -4.256  -0.107  1.00 0.00 ? 97  PRO A C    3  
ATOM 5938  O O    . PRO A 1 97  ? 23.765  -5.220  -0.406  1.00 0.00 ? 97  PRO A O    3  
ATOM 5939  C CB   . PRO A 1 97  ? 23.358  -2.291  -1.642  1.00 0.00 ? 97  PRO A CB   3  
ATOM 5940  C CG   . PRO A 1 97  ? 24.574  -2.746  -2.374  1.00 0.00 ? 97  PRO A CG   3  
ATOM 5941  C CD   . PRO A 1 97  ? 25.710  -2.661  -1.375  1.00 0.00 ? 97  PRO A CD   3  
ATOM 5942  H HA   . PRO A 1 97  ? 23.054  -2.191  0.484   1.00 0.00 ? 97  PRO A HA   3  
ATOM 5943  H HB2  . PRO A 1 97  ? 22.453  -2.712  -2.063  1.00 0.00 ? 97  PRO A HB2  3  
ATOM 5944  H HB3  . PRO A 1 97  ? 23.287  -1.213  -1.623  1.00 0.00 ? 97  PRO A HB3  3  
ATOM 5945  H HG2  . PRO A 1 97  ? 24.438  -3.770  -2.706  1.00 0.00 ? 97  PRO A HG2  3  
ATOM 5946  H HG3  . PRO A 1 97  ? 24.764  -2.099  -3.218  1.00 0.00 ? 97  PRO A HG3  3  
ATOM 5947  H HD2  . PRO A 1 97  ? 26.390  -3.493  -1.503  1.00 0.00 ? 97  PRO A HD2  3  
ATOM 5948  H HD3  . PRO A 1 97  ? 26.237  -1.724  -1.478  1.00 0.00 ? 97  PRO A HD3  3  
ATOM 5949  N N    . ARG A 1 98  ? 21.811  -4.379  0.335   1.00 0.00 ? 98  ARG A N    3  
ATOM 5950  C CA   . ARG A 1 98  ? 21.135  -5.664  0.441   1.00 0.00 ? 98  ARG A CA   3  
ATOM 5951  C C    . ARG A 1 98  ? 19.627  -5.424  0.441   1.00 0.00 ? 98  ARG A C    3  
ATOM 5952  O O    . ARG A 1 98  ? 19.180  -4.360  0.859   1.00 0.00 ? 98  ARG A O    3  
ATOM 5953  C CB   . ARG A 1 98  ? 21.598  -6.414  1.704   1.00 0.00 ? 98  ARG A CB   3  
ATOM 5954  C CG   . ARG A 1 98  ? 21.457  -5.618  2.998   1.00 0.00 ? 98  ARG A CG   3  
ATOM 5955  C CD   . ARG A 1 98  ? 22.308  -6.215  4.116   1.00 0.00 ? 98  ARG A CD   3  
ATOM 5956  N NE   . ARG A 1 98  ? 22.279  -5.400  5.333   1.00 0.00 ? 98  ARG A NE   3  
ATOM 5957  C CZ   . ARG A 1 98  ? 23.361  -4.867  5.907   1.00 0.00 ? 98  ARG A CZ   3  
ATOM 5958  N NH1  . ARG A 1 98  ? 24.560  -5.028  5.351   1.00 0.00 ? 98  ARG A NH1  3  
ATOM 5959  N NH2  . ARG A 1 98  ? 23.243  -4.171  7.031   1.00 0.00 ? 98  ARG A NH2  3  
ATOM 5960  H H    . ARG A 1 98  ? 21.326  -3.572  0.605   1.00 0.00 ? 98  ARG A H    3  
ATOM 5961  H HA   . ARG A 1 98  ? 21.392  -6.247  -0.434  1.00 0.00 ? 98  ARG A HA   3  
ATOM 5962  H HB2  . ARG A 1 98  ? 21.017  -7.321  1.802   1.00 0.00 ? 98  ARG A HB2  3  
ATOM 5963  H HB3  . ARG A 1 98  ? 22.639  -6.681  1.582   1.00 0.00 ? 98  ARG A HB3  3  
ATOM 5964  H HG2  . ARG A 1 98  ? 21.771  -4.600  2.821   1.00 0.00 ? 98  ARG A HG2  3  
ATOM 5965  H HG3  . ARG A 1 98  ? 20.419  -5.625  3.304   1.00 0.00 ? 98  ARG A HG3  3  
ATOM 5966  H HD2  . ARG A 1 98  ? 21.930  -7.200  4.349   1.00 0.00 ? 98  ARG A HD2  3  
ATOM 5967  H HD3  . ARG A 1 98  ? 23.329  -6.297  3.769   1.00 0.00 ? 98  ARG A HD3  3  
ATOM 5968  H HE   . ARG A 1 98  ? 21.400  -5.256  5.754   1.00 0.00 ? 98  ARG A HE   3  
ATOM 5969  H HH11 . ARG A 1 98  ? 24.655  -5.548  4.503   1.00 0.00 ? 98  ARG A HH11 3  
ATOM 5970  H HH12 . ARG A 1 98  ? 25.377  -4.632  5.780   1.00 0.00 ? 98  ARG A HH12 3  
ATOM 5971  H HH21 . ARG A 1 98  ? 22.339  -4.050  7.456   1.00 0.00 ? 98  ARG A HH21 3  
ATOM 5972  H HH22 . ARG A 1 98  ? 24.052  -3.763  7.463   1.00 0.00 ? 98  ARG A HH22 3  
ATOM 5973  N N    . PRO A 1 99  ? 18.824  -6.401  -0.021  1.00 0.00 ? 99  PRO A N    3  
ATOM 5974  C CA   . PRO A 1 99  ? 17.372  -6.216  -0.224  1.00 0.00 ? 99  PRO A CA   3  
ATOM 5975  C C    . PRO A 1 99  ? 16.636  -5.831  1.060   1.00 0.00 ? 99  PRO A C    3  
ATOM 5976  O O    . PRO A 1 99  ? 15.510  -5.331  1.021   1.00 0.00 ? 99  PRO A O    3  
ATOM 5977  C CB   . PRO A 1 99  ? 16.903  -7.595  -0.723  1.00 0.00 ? 99  PRO A CB   3  
ATOM 5978  C CG   . PRO A 1 99  ? 17.962  -8.539  -0.268  1.00 0.00 ? 99  PRO A CG   3  
ATOM 5979  C CD   . PRO A 1 99  ? 19.246  -7.771  -0.363  1.00 0.00 ? 99  PRO A CD   3  
ATOM 5980  H HA   . PRO A 1 99  ? 17.176  -5.471  -0.981  1.00 0.00 ? 99  PRO A HA   3  
ATOM 5981  H HB2  . PRO A 1 99  ? 15.944  -7.838  -0.293  1.00 0.00 ? 99  PRO A HB2  3  
ATOM 5982  H HB3  . PRO A 1 99  ? 16.825  -7.583  -1.801  1.00 0.00 ? 99  PRO A HB3  3  
ATOM 5983  H HG2  . PRO A 1 99  ? 17.774  -8.839  0.755   1.00 0.00 ? 99  PRO A HG2  3  
ATOM 5984  H HG3  . PRO A 1 99  ? 17.990  -9.403  -0.913  1.00 0.00 ? 99  PRO A HG3  3  
ATOM 5985  H HD2  . PRO A 1 99  ? 19.968  -8.147  0.349   1.00 0.00 ? 99  PRO A HD2  3  
ATOM 5986  H HD3  . PRO A 1 99  ? 19.645  -7.812  -1.368  1.00 0.00 ? 99  PRO A HD3  3  
ATOM 5987  N N    . ASP A 1 100 ? 17.287  -6.050  2.196   1.00 0.00 ? 100 ASP A N    3  
ATOM 5988  C CA   . ASP A 1 100 ? 16.672  -5.802  3.497   1.00 0.00 ? 100 ASP A CA   3  
ATOM 5989  C C    . ASP A 1 100 ? 17.016  -4.405  4.005   1.00 0.00 ? 100 ASP A C    3  
ATOM 5990  O O    . ASP A 1 100 ? 16.567  -4.000  5.076   1.00 0.00 ? 100 ASP A O    3  
ATOM 5991  C CB   . ASP A 1 100 ? 17.130  -6.859  4.508   1.00 0.00 ? 100 ASP A CB   3  
ATOM 5992  C CG   . ASP A 1 100 ? 16.851  -8.276  4.032   1.00 0.00 ? 100 ASP A CG   3  
ATOM 5993  O OD1  . ASP A 1 100 ? 15.715  -8.764  4.218   1.00 0.00 ? 100 ASP A OD1  3  
ATOM 5994  O OD2  . ASP A 1 100 ? 17.769  -8.909  3.463   1.00 0.00 ? 100 ASP A OD2  3  
ATOM 5995  H H    . ASP A 1 100 ? 18.208  -6.386  2.160   1.00 0.00 ? 100 ASP A H    3  
ATOM 5996  H HA   . ASP A 1 100 ? 15.598  -5.872  3.379   1.00 0.00 ? 100 ASP A HA   3  
ATOM 5997  H HB2  . ASP A 1 100 ? 18.193  -6.754  4.674   1.00 0.00 ? 100 ASP A HB2  3  
ATOM 5998  H HB3  . ASP A 1 100 ? 16.610  -6.703  5.445   1.00 0.00 ? 100 ASP A HB3  3  
ATOM 5999  N N    . MET A 1 101 ? 17.805  -3.672  3.217   1.00 0.00 ? 101 MET A N    3  
ATOM 6000  C CA   . MET A 1 101 ? 18.252  -2.327  3.589   1.00 0.00 ? 101 MET A CA   3  
ATOM 6001  C C    . MET A 1 101 ? 17.057  -1.383  3.705   1.00 0.00 ? 101 MET A C    3  
ATOM 6002  O O    . MET A 1 101 ? 16.694  -0.948  4.796   1.00 0.00 ? 101 MET A O    3  
ATOM 6003  C CB   . MET A 1 101 ? 19.250  -1.779  2.543   1.00 0.00 ? 101 MET A CB   3  
ATOM 6004  C CG   . MET A 1 101 ? 20.540  -1.226  3.132   1.00 0.00 ? 101 MET A CG   3  
ATOM 6005  S SD   . MET A 1 101 ? 21.538  -2.500  3.930   1.00 0.00 ? 101 MET A SD   3  
ATOM 6006  C CE   . MET A 1 101 ? 23.028  -1.585  4.324   1.00 0.00 ? 101 MET A CE   3  
ATOM 6007  H H    . MET A 1 101 ? 18.096  -4.047  2.361   1.00 0.00 ? 101 MET A H    3  
ATOM 6008  H HA   . MET A 1 101 ? 18.743  -2.393  4.550   1.00 0.00 ? 101 MET A HA   3  
ATOM 6009  H HB2  . MET A 1 101 ? 19.509  -2.572  1.858   1.00 0.00 ? 101 MET A HB2  3  
ATOM 6010  H HB3  . MET A 1 101 ? 18.772  -0.987  1.984   1.00 0.00 ? 101 MET A HB3  3  
ATOM 6011  H HG2  . MET A 1 101 ? 21.121  -0.780  2.338   1.00 0.00 ? 101 MET A HG2  3  
ATOM 6012  H HG3  . MET A 1 101 ? 20.294  -0.470  3.864   1.00 0.00 ? 101 MET A HG3  3  
ATOM 6013  H HE1  . MET A 1 101 ? 22.782  -0.760  4.978   1.00 0.00 ? 101 MET A HE1  3  
ATOM 6014  H HE2  . MET A 1 101 ? 23.468  -1.202  3.415   1.00 0.00 ? 101 MET A HE2  3  
ATOM 6015  H HE3  . MET A 1 101 ? 23.731  -2.237  4.818   1.00 0.00 ? 101 MET A HE3  3  
ATOM 6016  N N    . PHE A 1 102 ? 16.430  -1.097  2.564   1.00 0.00 ? 102 PHE A N    3  
ATOM 6017  C CA   . PHE A 1 102 ? 15.306  -0.164  2.511   1.00 0.00 ? 102 PHE A CA   3  
ATOM 6018  C C    . PHE A 1 102 ? 13.999  -0.861  2.875   1.00 0.00 ? 102 PHE A C    3  
ATOM 6019  O O    . PHE A 1 102 ? 12.944  -0.232  2.900   1.00 0.00 ? 102 PHE A O    3  
ATOM 6020  C CB   . PHE A 1 102 ? 15.197  0.475   1.116   1.00 0.00 ? 102 PHE A CB   3  
ATOM 6021  C CG   . PHE A 1 102 ? 16.379  1.337   0.738   1.00 0.00 ? 102 PHE A CG   3  
ATOM 6022  C CD1  . PHE A 1 102 ? 17.313  1.725   1.690   1.00 0.00 ? 102 PHE A CD1  3  
ATOM 6023  C CD2  . PHE A 1 102 ? 16.551  1.767   -0.571  1.00 0.00 ? 102 PHE A CD2  3  
ATOM 6024  C CE1  . PHE A 1 102 ? 18.386  2.514   1.342   1.00 0.00 ? 102 PHE A CE1  3  
ATOM 6025  C CE2  . PHE A 1 102 ? 17.629  2.561   -0.917  1.00 0.00 ? 102 PHE A CE2  3  
ATOM 6026  C CZ   . PHE A 1 102 ? 18.545  2.935   0.040   1.00 0.00 ? 102 PHE A CZ   3  
ATOM 6027  H H    . PHE A 1 102 ? 16.729  -1.527  1.738   1.00 0.00 ? 102 PHE A H    3  
ATOM 6028  H HA   . PHE A 1 102 ? 15.492  0.619   3.236   1.00 0.00 ? 102 PHE A HA   3  
ATOM 6029  H HB2  . PHE A 1 102 ? 15.111  -0.309  0.375   1.00 0.00 ? 102 PHE A HB2  3  
ATOM 6030  H HB3  . PHE A 1 102 ? 14.311  1.093   1.078   1.00 0.00 ? 102 PHE A HB3  3  
ATOM 6031  H HD1  . PHE A 1 102 ? 17.197  1.399   2.715   1.00 0.00 ? 102 PHE A HD1  3  
ATOM 6032  H HD2  . PHE A 1 102 ? 15.834  1.475   -1.325  1.00 0.00 ? 102 PHE A HD2  3  
ATOM 6033  H HE1  . PHE A 1 102 ? 19.104  2.807   2.094   1.00 0.00 ? 102 PHE A HE1  3  
ATOM 6034  H HE2  . PHE A 1 102 ? 17.756  2.890   -1.937  1.00 0.00 ? 102 PHE A HE2  3  
ATOM 6035  H HZ   . PHE A 1 102 ? 19.387  3.556   -0.231  1.00 0.00 ? 102 PHE A HZ   3  
ATOM 6036  N N    . ARG A 1 103 ? 14.079  -2.160  3.167   1.00 0.00 ? 103 ARG A N    3  
ATOM 6037  C CA   . ARG A 1 103 ? 12.899  -2.940  3.536   1.00 0.00 ? 103 ARG A CA   3  
ATOM 6038  C C    . ARG A 1 103 ? 12.237  -2.332  4.770   1.00 0.00 ? 103 ARG A C    3  
ATOM 6039  O O    . ARG A 1 103 ? 11.013  -2.198  4.839   1.00 0.00 ? 103 ARG A O    3  
ATOM 6040  C CB   . ARG A 1 103 ? 13.282  -4.397  3.826   1.00 0.00 ? 103 ARG A CB   3  
ATOM 6041  C CG   . ARG A 1 103 ? 12.086  -5.343  3.928   1.00 0.00 ? 103 ARG A CG   3  
ATOM 6042  C CD   . ARG A 1 103 ? 12.442  -6.634  4.658   1.00 0.00 ? 103 ARG A CD   3  
ATOM 6043  N NE   . ARG A 1 103 ? 12.560  -6.420  6.104   1.00 0.00 ? 103 ARG A NE   3  
ATOM 6044  C CZ   . ARG A 1 103 ? 13.470  -7.007  6.886   1.00 0.00 ? 103 ARG A CZ   3  
ATOM 6045  N NH1  . ARG A 1 103 ? 14.399  -7.800  6.365   1.00 0.00 ? 103 ARG A NH1  3  
ATOM 6046  N NH2  . ARG A 1 103 ? 13.449  -6.799  8.196   1.00 0.00 ? 103 ARG A NH2  3  
ATOM 6047  H H    . ARG A 1 103 ? 14.953  -2.599  3.139   1.00 0.00 ? 103 ARG A H    3  
ATOM 6048  H HA   . ARG A 1 103 ? 12.202  -2.908  2.708   1.00 0.00 ? 103 ARG A HA   3  
ATOM 6049  H HB2  . ARG A 1 103 ? 13.926  -4.751  3.032   1.00 0.00 ? 103 ARG A HB2  3  
ATOM 6050  H HB3  . ARG A 1 103 ? 13.828  -4.434  4.759   1.00 0.00 ? 103 ARG A HB3  3  
ATOM 6051  H HG2  . ARG A 1 103 ? 11.292  -4.846  4.465   1.00 0.00 ? 103 ARG A HG2  3  
ATOM 6052  H HG3  . ARG A 1 103 ? 11.747  -5.587  2.930   1.00 0.00 ? 103 ARG A HG3  3  
ATOM 6053  H HD2  . ARG A 1 103 ? 11.668  -7.365  4.474   1.00 0.00 ? 103 ARG A HD2  3  
ATOM 6054  H HD3  . ARG A 1 103 ? 13.384  -7.005  4.277   1.00 0.00 ? 103 ARG A HD3  3  
ATOM 6055  H HE   . ARG A 1 103 ? 11.898  -5.820  6.520   1.00 0.00 ? 103 ARG A HE   3  
ATOM 6056  H HH11 . ARG A 1 103 ? 14.430  -7.969  5.374   1.00 0.00 ? 103 ARG A HH11 3  
ATOM 6057  H HH12 . ARG A 1 103 ? 15.070  -8.247  6.961   1.00 0.00 ? 103 ARG A HH12 3  
ATOM 6058  H HH21 . ARG A 1 103 ? 12.748  -6.206  8.604   1.00 0.00 ? 103 ARG A HH21 3  
ATOM 6059  H HH22 . ARG A 1 103 ? 14.131  -7.241  8.791   1.00 0.00 ? 103 ARG A HH22 3  
ATOM 6060  N N    . ALA A 1 104 ? 13.070  -1.953  5.737   1.00 0.00 ? 104 ALA A N    3  
ATOM 6061  C CA   . ALA A 1 104 ? 12.596  -1.360  6.979   1.00 0.00 ? 104 ALA A CA   3  
ATOM 6062  C C    . ALA A 1 104 ? 11.866  -0.048  6.704   1.00 0.00 ? 104 ALA A C    3  
ATOM 6063  O O    . ALA A 1 104 ? 10.766  0.182   7.213   1.00 0.00 ? 104 ALA A O    3  
ATOM 6064  C CB   . ALA A 1 104 ? 13.761  -1.140  7.937   1.00 0.00 ? 104 ALA A CB   3  
ATOM 6065  H H    . ALA A 1 104 ? 14.036  -2.076  5.608   1.00 0.00 ? 104 ALA A H    3  
ATOM 6066  H HA   . ALA A 1 104 ? 11.906  -2.056  7.441   1.00 0.00 ? 104 ALA A HA   3  
ATOM 6067  H HB1  . ALA A 1 104 ? 14.256  -2.082  8.127   1.00 0.00 ? 104 ALA A HB1  3  
ATOM 6068  H HB2  . ALA A 1 104 ? 13.393  -0.735  8.869   1.00 0.00 ? 104 ALA A HB2  3  
ATOM 6069  H HB3  . ALA A 1 104 ? 14.465  -0.448  7.497   1.00 0.00 ? 104 ALA A HB3  3  
ATOM 6070  N N    . GLN A 1 105 ? 12.478  0.796   5.877   1.00 0.00 ? 105 GLN A N    3  
ATOM 6071  C CA   . GLN A 1 105 ? 11.896  2.089   5.520   1.00 0.00 ? 105 GLN A CA   3  
ATOM 6072  C C    . GLN A 1 105 ? 10.631  1.903   4.679   1.00 0.00 ? 105 GLN A C    3  
ATOM 6073  O O    . GLN A 1 105 ? 9.695   2.698   4.766   1.00 0.00 ? 105 GLN A O    3  
ATOM 6074  C CB   . GLN A 1 105 ? 12.909  2.958   4.756   1.00 0.00 ? 105 GLN A CB   3  
ATOM 6075  C CG   . GLN A 1 105 ? 14.084  3.461   5.597   1.00 0.00 ? 105 GLN A CG   3  
ATOM 6076  C CD   . GLN A 1 105 ? 15.065  2.371   5.992   1.00 0.00 ? 105 GLN A CD   3  
ATOM 6077  O OE1  . GLN A 1 105 ? 15.999  2.073   5.250   1.00 0.00 ? 105 GLN A OE1  3  
ATOM 6078  N NE2  . GLN A 1 105 ? 14.879  1.793   7.167   1.00 0.00 ? 105 GLN A NE2  3  
ATOM 6079  H H    . GLN A 1 105 ? 13.346  0.544   5.495   1.00 0.00 ? 105 GLN A H    3  
ATOM 6080  H HA   . GLN A 1 105 ? 11.628  2.591   6.440   1.00 0.00 ? 105 GLN A HA   3  
ATOM 6081  H HB2  . GLN A 1 105 ? 13.309  2.383   3.933   1.00 0.00 ? 105 GLN A HB2  3  
ATOM 6082  H HB3  . GLN A 1 105 ? 12.392  3.820   4.356   1.00 0.00 ? 105 GLN A HB3  3  
ATOM 6083  H HG2  . GLN A 1 105 ? 14.619  4.208   5.029   1.00 0.00 ? 105 GLN A HG2  3  
ATOM 6084  H HG3  . GLN A 1 105 ? 13.694  3.915   6.498   1.00 0.00 ? 105 GLN A HG3  3  
ATOM 6085  H HE21 . GLN A 1 105 ? 14.121  2.094   7.718   1.00 0.00 ? 105 GLN A HE21 3  
ATOM 6086  H HE22 . GLN A 1 105 ? 15.515  1.099   7.450   1.00 0.00 ? 105 GLN A HE22 3  
ATOM 6087  N N    . GLN A 1 106 ? 10.617  0.839   3.879   1.00 0.00 ? 106 GLN A N    3  
ATOM 6088  C CA   . GLN A 1 106 ? 9.485   0.523   3.010   1.00 0.00 ? 106 GLN A CA   3  
ATOM 6089  C C    . GLN A 1 106 ? 8.198   0.394   3.818   1.00 0.00 ? 106 GLN A C    3  
ATOM 6090  O O    . GLN A 1 106 ? 7.231   1.124   3.595   1.00 0.00 ? 106 GLN A O    3  
ATOM 6091  C CB   . GLN A 1 106 ? 9.757   -0.786  2.259   1.00 0.00 ? 106 GLN A CB   3  
ATOM 6092  C CG   . GLN A 1 106 ? 8.607   -1.245  1.366   1.00 0.00 ? 106 GLN A CG   3  
ATOM 6093  C CD   . GLN A 1 106 ? 8.928   -2.528  0.619   1.00 0.00 ? 106 GLN A CD   3  
ATOM 6094  O OE1  . GLN A 1 106 ? 10.087  -2.805  0.307   1.00 0.00 ? 106 GLN A OE1  3  
ATOM 6095  N NE2  . GLN A 1 106 ? 7.909   -3.320  0.323   1.00 0.00 ? 106 GLN A NE2  3  
ATOM 6096  H H    . GLN A 1 106 ? 11.398  0.249   3.869   1.00 0.00 ? 106 GLN A H    3  
ATOM 6097  H HA   . GLN A 1 106 ? 9.377   1.326   2.295   1.00 0.00 ? 106 GLN A HA   3  
ATOM 6098  H HB2  . GLN A 1 106 ? 10.634  -0.655  1.639   1.00 0.00 ? 106 GLN A HB2  3  
ATOM 6099  H HB3  . GLN A 1 106 ? 9.957   -1.565  2.981   1.00 0.00 ? 106 GLN A HB3  3  
ATOM 6100  H HG2  . GLN A 1 106 ? 7.734   -1.412  1.981   1.00 0.00 ? 106 GLN A HG2  3  
ATOM 6101  H HG3  . GLN A 1 106 ? 8.395   -0.470  0.645   1.00 0.00 ? 106 GLN A HG3  3  
ATOM 6102  H HE21 . GLN A 1 106 ? 7.007   -3.045  0.601   1.00 0.00 ? 106 GLN A HE21 3  
ATOM 6103  H HE22 . GLN A 1 106 ? 8.092   -4.146  -0.167  1.00 0.00 ? 106 GLN A HE22 3  
ATOM 6104  N N    . LEU A 1 107 ? 8.196   -0.533  4.767   1.00 0.00 ? 107 LEU A N    3  
ATOM 6105  C CA   . LEU A 1 107 ? 7.017   -0.775  5.587   1.00 0.00 ? 107 LEU A CA   3  
ATOM 6106  C C    . LEU A 1 107 ? 6.763   0.418   6.510   1.00 0.00 ? 107 LEU A C    3  
ATOM 6107  O O    . LEU A 1 107 ? 5.630   0.674   6.918   1.00 0.00 ? 107 LEU A O    3  
ATOM 6108  C CB   . LEU A 1 107 ? 7.181   -2.062  6.407   1.00 0.00 ? 107 LEU A CB   3  
ATOM 6109  C CG   . LEU A 1 107 ? 5.900   -2.568  7.093   1.00 0.00 ? 107 LEU A CG   3  
ATOM 6110  C CD1  . LEU A 1 107 ? 4.877   -3.035  6.058   1.00 0.00 ? 107 LEU A CD1  3  
ATOM 6111  C CD2  . LEU A 1 107 ? 6.220   -3.683  8.090   1.00 0.00 ? 107 LEU A CD2  3  
ATOM 6112  H H    . LEU A 1 107 ? 9.005   -1.068  4.919   1.00 0.00 ? 107 LEU A H    3  
ATOM 6113  H HA   . LEU A 1 107 ? 6.169   -0.886  4.924   1.00 0.00 ? 107 LEU A HA   3  
ATOM 6114  H HB2  . LEU A 1 107 ? 7.545   -2.838  5.746   1.00 0.00 ? 107 LEU A HB2  3  
ATOM 6115  H HB3  . LEU A 1 107 ? 7.927   -1.885  7.169   1.00 0.00 ? 107 LEU A HB3  3  
ATOM 6116  H HG   . LEU A 1 107 ? 5.455   -1.750  7.639   1.00 0.00 ? 107 LEU A HG   3  
ATOM 6117  H HD11 . LEU A 1 107 ? 4.620   -2.212  5.408   1.00 0.00 ? 107 LEU A HD11 3  
ATOM 6118  H HD12 . LEU A 1 107 ? 3.987   -3.385  6.562   1.00 0.00 ? 107 LEU A HD12 3  
ATOM 6119  H HD13 . LEU A 1 107 ? 5.297   -3.840  5.471   1.00 0.00 ? 107 LEU A HD13 3  
ATOM 6120  H HD21 . LEU A 1 107 ? 6.899   -3.309  8.844   1.00 0.00 ? 107 LEU A HD21 3  
ATOM 6121  H HD22 . LEU A 1 107 ? 6.680   -4.512  7.572   1.00 0.00 ? 107 LEU A HD22 3  
ATOM 6122  H HD23 . LEU A 1 107 ? 5.307   -4.016  8.564   1.00 0.00 ? 107 LEU A HD23 3  
ATOM 6123  N N    . GLN A 1 108 ? 7.825   1.156   6.818   1.00 0.00 ? 108 GLN A N    3  
ATOM 6124  C CA   . GLN A 1 108 ? 7.722   2.322   7.688   1.00 0.00 ? 108 GLN A CA   3  
ATOM 6125  C C    . GLN A 1 108 ? 6.864   3.402   7.026   1.00 0.00 ? 108 GLN A C    3  
ATOM 6126  O O    . GLN A 1 108 ? 5.883   3.867   7.608   1.00 0.00 ? 108 GLN A O    3  
ATOM 6127  C CB   . GLN A 1 108 ? 9.118   2.870   8.014   1.00 0.00 ? 108 GLN A CB   3  
ATOM 6128  C CG   . GLN A 1 108 ? 9.143   3.889   9.153   1.00 0.00 ? 108 GLN A CG   3  
ATOM 6129  C CD   . GLN A 1 108 ? 8.831   3.281   10.518  1.00 0.00 ? 108 GLN A CD   3  
ATOM 6130  O OE1  . GLN A 1 108 ? 8.071   2.318   10.636  1.00 0.00 ? 108 GLN A OE1  3  
ATOM 6131  N NE2  . GLN A 1 108 ? 9.442   3.827   11.558  1.00 0.00 ? 108 GLN A NE2  3  
ATOM 6132  H H    . GLN A 1 108 ? 8.701   0.909   6.454   1.00 0.00 ? 108 GLN A H    3  
ATOM 6133  H HA   . GLN A 1 108 ? 7.242   2.009   8.605   1.00 0.00 ? 108 GLN A HA   3  
ATOM 6134  H HB2  . GLN A 1 108 ? 9.759   2.044   8.289   1.00 0.00 ? 108 GLN A HB2  3  
ATOM 6135  H HB3  . GLN A 1 108 ? 9.522   3.342   7.129   1.00 0.00 ? 108 GLN A HB3  3  
ATOM 6136  H HG2  . GLN A 1 108 ? 10.125  4.337   9.192   1.00 0.00 ? 108 GLN A HG2  3  
ATOM 6137  H HG3  . GLN A 1 108 ? 8.411   4.657   8.943   1.00 0.00 ? 108 GLN A HG3  3  
ATOM 6138  H HE21 . GLN A 1 108 ? 10.059  4.578   11.391  1.00 0.00 ? 108 GLN A HE21 3  
ATOM 6139  H HE22 . GLN A 1 108 ? 9.261   3.467   12.449  1.00 0.00 ? 108 GLN A HE22 3  
ATOM 6140  N N    . ILE A 1 109 ? 7.225   3.773   5.795   1.00 0.00 ? 109 ILE A N    3  
ATOM 6141  C CA   . ILE A 1 109 ? 6.482   4.784   5.038   1.00 0.00 ? 109 ILE A CA   3  
ATOM 6142  C C    . ILE A 1 109 ? 5.033   4.351   4.906   1.00 0.00 ? 109 ILE A C    3  
ATOM 6143  O O    . ILE A 1 109 ? 4.102   5.152   5.026   1.00 0.00 ? 109 ILE A O    3  
ATOM 6144  C CB   . ILE A 1 109 ? 7.104   4.998   3.627   1.00 0.00 ? 109 ILE A CB   3  
ATOM 6145  C CG1  . ILE A 1 109 ? 6.844   6.428   3.120   1.00 0.00 ? 109 ILE A CG1  3  
ATOM 6146  C CG2  . ILE A 1 109 ? 6.590   3.984   2.604   1.00 0.00 ? 109 ILE A CG2  3  
ATOM 6147  C CD1  . ILE A 1 109 ? 7.398   7.517   4.015   1.00 0.00 ? 109 ILE A CD1  3  
ATOM 6148  H H    . ILE A 1 109 ? 8.012   3.355   5.384   1.00 0.00 ? 109 ILE A H    3  
ATOM 6149  H HA   . ILE A 1 109 ? 6.529   5.716   5.586   1.00 0.00 ? 109 ILE A HA   3  
ATOM 6150  H HB   . ILE A 1 109 ? 8.154   4.837   3.722   1.00 0.00 ? 109 ILE A HB   3  
ATOM 6151  H HG12 . ILE A 1 109 ? 7.295   6.546   2.146   1.00 0.00 ? 109 ILE A HG12 3  
ATOM 6152  H HG13 . ILE A 1 109 ? 5.777   6.581   3.035   1.00 0.00 ? 109 ILE A HG13 3  
ATOM 6153  H HG21 . ILE A 1 109 ? 5.526   4.110   2.471   1.00 0.00 ? 109 ILE A HG21 3  
ATOM 6154  H HG22 . ILE A 1 109 ? 6.789   2.983   2.956   1.00 0.00 ? 109 ILE A HG22 3  
ATOM 6155  H HG23 . ILE A 1 109 ? 7.092   4.138   1.658   1.00 0.00 ? 109 ILE A HG23 3  
ATOM 6156  H HD11 . ILE A 1 109 ? 6.949   7.445   4.994   1.00 0.00 ? 109 ILE A HD11 3  
ATOM 6157  H HD12 . ILE A 1 109 ? 7.173   8.483   3.586   1.00 0.00 ? 109 ILE A HD12 3  
ATOM 6158  H HD13 . ILE A 1 109 ? 8.469   7.403   4.100   1.00 0.00 ? 109 ILE A HD13 3  
ATOM 6159  N N    . PHE A 1 110 ? 4.881   3.063   4.655   1.00 0.00 ? 110 PHE A N    3  
ATOM 6160  C CA   . PHE A 1 110 ? 3.575   2.408   4.616   1.00 0.00 ? 110 PHE A CA   3  
ATOM 6161  C C    . PHE A 1 110 ? 2.763   2.763   5.868   1.00 0.00 ? 110 PHE A C    3  
ATOM 6162  O O    . PHE A 1 110 ? 1.612   3.186   5.766   1.00 0.00 ? 110 PHE A O    3  
ATOM 6163  C CB   . PHE A 1 110 ? 3.754   0.881   4.486   1.00 0.00 ? 110 PHE A CB   3  
ATOM 6164  C CG   . PHE A 1 110 ? 2.467   0.085   4.542   1.00 0.00 ? 110 PHE A CG   3  
ATOM 6165  C CD1  . PHE A 1 110 ? 1.884   -0.254  5.759   1.00 0.00 ? 110 PHE A CD1  3  
ATOM 6166  C CD2  . PHE A 1 110 ? 1.844   -0.325  3.375   1.00 0.00 ? 110 PHE A CD2  3  
ATOM 6167  C CE1  . PHE A 1 110 ? 0.710   -0.981  5.804   1.00 0.00 ? 110 PHE A CE1  3  
ATOM 6168  C CE2  . PHE A 1 110 ? 0.668   -1.052  3.416   1.00 0.00 ? 110 PHE A CE2  3  
ATOM 6169  C CZ   . PHE A 1 110 ? 0.101   -1.379  4.630   1.00 0.00 ? 110 PHE A CZ   3  
ATOM 6170  H H    . PHE A 1 110 ? 5.696   2.538   4.461   1.00 0.00 ? 110 PHE A H    3  
ATOM 6171  H HA   . PHE A 1 110 ? 3.050   2.775   3.746   1.00 0.00 ? 110 PHE A HA   3  
ATOM 6172  H HB2  . PHE A 1 110 ? 4.228   0.668   3.538   1.00 0.00 ? 110 PHE A HB2  3  
ATOM 6173  H HB3  . PHE A 1 110 ? 4.396   0.529   5.277   1.00 0.00 ? 110 PHE A HB3  3  
ATOM 6174  H HD1  . PHE A 1 110 ? 2.359   0.057   6.678   1.00 0.00 ? 110 PHE A HD1  3  
ATOM 6175  H HD2  . PHE A 1 110 ? 2.285   -0.072  2.423   1.00 0.00 ? 110 PHE A HD2  3  
ATOM 6176  H HE1  . PHE A 1 110 ? 0.268   -1.236  6.756   1.00 0.00 ? 110 PHE A HE1  3  
ATOM 6177  H HE2  . PHE A 1 110 ? 0.194   -1.364  2.496   1.00 0.00 ? 110 PHE A HE2  3  
ATOM 6178  H HZ   . PHE A 1 110 ? -0.820  -1.944  4.662   1.00 0.00 ? 110 PHE A HZ   3  
ATOM 6179  N N    . ASN A 1 111 ? 3.382   2.614   7.041   1.00 0.00 ? 111 ASN A N    3  
ATOM 6180  C CA   . ASN A 1 111 ? 2.709   2.899   8.316   1.00 0.00 ? 111 ASN A CA   3  
ATOM 6181  C C    . ASN A 1 111 ? 2.369   4.383   8.456   1.00 0.00 ? 111 ASN A C    3  
ATOM 6182  O O    . ASN A 1 111 ? 1.336   4.734   9.033   1.00 0.00 ? 111 ASN A O    3  
ATOM 6183  C CB   . ASN A 1 111 ? 3.558   2.439   9.516   1.00 0.00 ? 111 ASN A CB   3  
ATOM 6184  C CG   . ASN A 1 111 ? 3.445   0.946   9.778   1.00 0.00 ? 111 ASN A CG   3  
ATOM 6185  O OD1  . ASN A 1 111 ? 2.550   0.500   10.498  1.00 0.00 ? 111 ASN A OD1  3  
ATOM 6186  N ND2  . ASN A 1 111 ? 4.350   0.168   9.211   1.00 0.00 ? 111 ASN A ND2  3  
ATOM 6187  H H    . ASN A 1 111 ? 4.315   2.308   7.052   1.00 0.00 ? 111 ASN A H    3  
ATOM 6188  H HA   . ASN A 1 111 ? 1.782   2.340   8.319   1.00 0.00 ? 111 ASN A HA   3  
ATOM 6189  H HB2  . ASN A 1 111 ? 4.596   2.673   9.326   1.00 0.00 ? 111 ASN A HB2  3  
ATOM 6190  H HB3  . ASN A 1 111 ? 3.235   2.965   10.403  1.00 0.00 ? 111 ASN A HB3  3  
ATOM 6191  H HD21 . ASN A 1 111 ? 5.043   0.586   8.662   1.00 0.00 ? 111 ASN A HD21 3  
ATOM 6192  H HD22 . ASN A 1 111 ? 4.286   -0.800  9.358   1.00 0.00 ? 111 ASN A HD22 3  
ATOM 6193  N N    . LEU A 1 112 ? 3.237   5.252   7.937   1.00 0.00 ? 112 LEU A N    3  
ATOM 6194  C CA   . LEU A 1 112 ? 2.994   6.697   7.975   1.00 0.00 ? 112 LEU A CA   3  
ATOM 6195  C C    . LEU A 1 112 ? 1.693   7.040   7.250   1.00 0.00 ? 112 LEU A C    3  
ATOM 6196  O O    . LEU A 1 112 ? 0.721   7.482   7.866   1.00 0.00 ? 112 LEU A O    3  
ATOM 6197  C CB   . LEU A 1 112 ? 4.175   7.477   7.352   1.00 0.00 ? 112 LEU A CB   3  
ATOM 6198  C CG   . LEU A 1 112 ? 5.330   7.836   8.312   1.00 0.00 ? 112 LEU A CG   3  
ATOM 6199  C CD1  . LEU A 1 112 ? 4.849   8.790   9.402   1.00 0.00 ? 112 LEU A CD1  3  
ATOM 6200  C CD2  . LEU A 1 112 ? 5.946   6.581   8.927   1.00 0.00 ? 112 LEU A CD2  3  
ATOM 6201  H H    . LEU A 1 112 ? 4.058   4.914   7.518   1.00 0.00 ? 112 LEU A H    3  
ATOM 6202  H HA   . LEU A 1 112 ? 2.895   6.984   9.013   1.00 0.00 ? 112 LEU A HA   3  
ATOM 6203  H HB2  . LEU A 1 112 ? 4.582   6.884   6.545   1.00 0.00 ? 112 LEU A HB2  3  
ATOM 6204  H HB3  . LEU A 1 112 ? 3.792   8.398   6.935   1.00 0.00 ? 112 LEU A HB3  3  
ATOM 6205  H HG   . LEU A 1 112 ? 6.103   8.344   7.751   1.00 0.00 ? 112 LEU A HG   3  
ATOM 6206  H HD11 . LEU A 1 112 ? 4.073   8.314   9.985   1.00 0.00 ? 112 LEU A HD11 3  
ATOM 6207  H HD12 . LEU A 1 112 ? 4.456   9.688   8.948   1.00 0.00 ? 112 LEU A HD12 3  
ATOM 6208  H HD13 . LEU A 1 112 ? 5.677   9.049   10.047  1.00 0.00 ? 112 LEU A HD13 3  
ATOM 6209  H HD21 . LEU A 1 112 ? 6.751   6.862   9.591   1.00 0.00 ? 112 LEU A HD21 3  
ATOM 6210  H HD22 . LEU A 1 112 ? 6.334   5.949   8.142   1.00 0.00 ? 112 LEU A HD22 3  
ATOM 6211  H HD23 . LEU A 1 112 ? 5.193   6.041   9.484   1.00 0.00 ? 112 LEU A HD23 3  
ATOM 6212  N N    . MET A 1 113 ? 1.668   6.789   5.946   1.00 0.00 ? 113 MET A N    3  
ATOM 6213  C CA   . MET A 1 113 ? 0.512   7.128   5.115   1.00 0.00 ? 113 MET A CA   3  
ATOM 6214  C C    . MET A 1 113 ? -0.697  6.250   5.446   1.00 0.00 ? 113 MET A C    3  
ATOM 6215  O O    . MET A 1 113 ? -1.824  6.562   5.054   1.00 0.00 ? 113 MET A O    3  
ATOM 6216  C CB   . MET A 1 113 ? 0.871   7.031   3.623   1.00 0.00 ? 113 MET A CB   3  
ATOM 6217  C CG   . MET A 1 113 ? 1.485   5.703   3.204   1.00 0.00 ? 113 MET A CG   3  
ATOM 6218  S SD   . MET A 1 113 ? 2.001   5.704   1.475   1.00 0.00 ? 113 MET A SD   3  
ATOM 6219  C CE   . MET A 1 113 ? 2.835   4.124   1.362   1.00 0.00 ? 113 MET A CE   3  
ATOM 6220  H H    . MET A 1 113 ? 2.451   6.366   5.528   1.00 0.00 ? 113 MET A H    3  
ATOM 6221  H HA   . MET A 1 113 ? 0.250   8.154   5.335   1.00 0.00 ? 113 MET A HA   3  
ATOM 6222  H HB2  . MET A 1 113 ? -0.024  7.185   3.038   1.00 0.00 ? 113 MET A HB2  3  
ATOM 6223  H HB3  . MET A 1 113 ? 1.576   7.815   3.386   1.00 0.00 ? 113 MET A HB3  3  
ATOM 6224  H HG2  . MET A 1 113 ? 2.350   5.509   3.822   1.00 0.00 ? 113 MET A HG2  3  
ATOM 6225  H HG3  . MET A 1 113 ? 0.756   4.919   3.348   1.00 0.00 ? 113 MET A HG3  3  
ATOM 6226  H HE1  . MET A 1 113 ? 2.146   3.333   1.620   1.00 0.00 ? 113 MET A HE1  3  
ATOM 6227  H HE2  . MET A 1 113 ? 3.672   4.108   2.043   1.00 0.00 ? 113 MET A HE2  3  
ATOM 6228  H HE3  . MET A 1 113 ? 3.189   3.975   0.352   1.00 0.00 ? 113 MET A HE3  3  
ATOM 6229  N N    . LYS A 1 114 ? -0.460  5.166   6.184   1.00 0.00 ? 114 LYS A N    3  
ATOM 6230  C CA   . LYS A 1 114 ? -1.530  4.265   6.624   1.00 0.00 ? 114 LYS A CA   3  
ATOM 6231  C C    . LYS A 1 114 ? -2.547  5.007   7.498   1.00 0.00 ? 114 LYS A C    3  
ATOM 6232  O O    . LYS A 1 114 ? -3.743  4.718   7.460   1.00 0.00 ? 114 LYS A O    3  
ATOM 6233  C CB   . LYS A 1 114 ? -0.927  3.085   7.401   1.00 0.00 ? 114 LYS A CB   3  
ATOM 6234  C CG   . LYS A 1 114 ? -1.942  2.054   7.891   1.00 0.00 ? 114 LYS A CG   3  
ATOM 6235  C CD   . LYS A 1 114 ? -1.256  0.901   8.620   1.00 0.00 ? 114 LYS A CD   3  
ATOM 6236  C CE   . LYS A 1 114 ? -2.258  -0.087  9.209   1.00 0.00 ? 114 LYS A CE   3  
ATOM 6237  N NZ   . LYS A 1 114 ? -3.082  0.524   10.286  1.00 0.00 ? 114 LYS A NZ   3  
ATOM 6238  H H    . LYS A 1 114 ? 0.465   4.958   6.435   1.00 0.00 ? 114 LYS A H    3  
ATOM 6239  H HA   . LYS A 1 114 ? -2.033  3.886   5.743   1.00 0.00 ? 114 LYS A HA   3  
ATOM 6240  H HB2  . LYS A 1 114 ? -0.219  2.579   6.761   1.00 0.00 ? 114 LYS A HB2  3  
ATOM 6241  H HB3  . LYS A 1 114 ? -0.399  3.474   8.261   1.00 0.00 ? 114 LYS A HB3  3  
ATOM 6242  H HG2  . LYS A 1 114 ? -2.637  2.534   8.564   1.00 0.00 ? 114 LYS A HG2  3  
ATOM 6243  H HG3  . LYS A 1 114 ? -2.481  1.660   7.038   1.00 0.00 ? 114 LYS A HG3  3  
ATOM 6244  H HD2  . LYS A 1 114 ? -0.620  0.375   7.921   1.00 0.00 ? 114 LYS A HD2  3  
ATOM 6245  H HD3  . LYS A 1 114 ? -0.651  1.305   9.420   1.00 0.00 ? 114 LYS A HD3  3  
ATOM 6246  H HE2  . LYS A 1 114 ? -2.912  -0.431  8.421   1.00 0.00 ? 114 LYS A HE2  3  
ATOM 6247  H HE3  . LYS A 1 114 ? -1.717  -0.930  9.617   1.00 0.00 ? 114 LYS A HE3  3  
ATOM 6248  H HZ1  . LYS A 1 114 ? -3.682  -0.200  10.729  1.00 0.00 ? 114 LYS A HZ1  3  
ATOM 6249  H HZ2  . LYS A 1 114 ? -3.693  1.268   9.894   1.00 0.00 ? 114 LYS A HZ2  3  
ATOM 6250  H HZ3  . LYS A 1 114 ? -2.466  0.941   11.017  1.00 0.00 ? 114 LYS A HZ3  3  
ATOM 6251  N N    . PHE A 1 115 ? -2.059  5.976   8.271   1.00 0.00 ? 115 PHE A N    3  
ATOM 6252  C CA   . PHE A 1 115 ? -2.900  6.729   9.206   1.00 0.00 ? 115 PHE A CA   3  
ATOM 6253  C C    . PHE A 1 115 ? -3.143  8.153   8.692   1.00 0.00 ? 115 PHE A C    3  
ATOM 6254  O O    . PHE A 1 115 ? -3.779  8.973   9.360   1.00 0.00 ? 115 PHE A O    3  
ATOM 6255  C CB   . PHE A 1 115 ? -2.229  6.752   10.592  1.00 0.00 ? 115 PHE A CB   3  
ATOM 6256  C CG   . PHE A 1 115 ? -3.011  7.492   11.654  1.00 0.00 ? 115 PHE A CG   3  
ATOM 6257  C CD1  . PHE A 1 115 ? -4.237  7.011   12.093  1.00 0.00 ? 115 PHE A CD1  3  
ATOM 6258  C CD2  . PHE A 1 115 ? -2.524  8.672   12.202  1.00 0.00 ? 115 PHE A CD2  3  
ATOM 6259  C CE1  . PHE A 1 115 ? -4.957  7.690   13.057  1.00 0.00 ? 115 PHE A CE1  3  
ATOM 6260  C CE2  . PHE A 1 115 ? -3.242  9.353   13.166  1.00 0.00 ? 115 PHE A CE2  3  
ATOM 6261  C CZ   . PHE A 1 115 ? -4.460  8.861   13.594  1.00 0.00 ? 115 PHE A CZ   3  
ATOM 6262  H H    . PHE A 1 115 ? -1.103  6.195   8.214   1.00 0.00 ? 115 PHE A H    3  
ATOM 6263  H HA   . PHE A 1 115 ? -3.852  6.222   9.285   1.00 0.00 ? 115 PHE A HA   3  
ATOM 6264  H HB2  . PHE A 1 115 ? -2.093  5.736   10.933  1.00 0.00 ? 115 PHE A HB2  3  
ATOM 6265  H HB3  . PHE A 1 115 ? -1.258  7.223   10.503  1.00 0.00 ? 115 PHE A HB3  3  
ATOM 6266  H HD1  . PHE A 1 115 ? -4.628  6.095   11.675  1.00 0.00 ? 115 PHE A HD1  3  
ATOM 6267  H HD2  . PHE A 1 115 ? -1.571  9.059   11.869  1.00 0.00 ? 115 PHE A HD2  3  
ATOM 6268  H HE1  . PHE A 1 115 ? -5.911  7.303   13.392  1.00 0.00 ? 115 PHE A HE1  3  
ATOM 6269  H HE2  . PHE A 1 115 ? -2.852  10.270  13.584  1.00 0.00 ? 115 PHE A HE2  3  
ATOM 6270  H HZ   . PHE A 1 115 ? -5.023  9.393   14.348  1.00 0.00 ? 115 PHE A HZ   3  
ATOM 6271  N N    . ASP A 1 116 ? -2.679  8.427   7.478   1.00 0.00 ? 116 ASP A N    3  
ATOM 6272  C CA   . ASP A 1 116 ? -2.721  9.780   6.923   1.00 0.00 ? 116 ASP A CA   3  
ATOM 6273  C C    . ASP A 1 116 ? -3.419  9.780   5.568   1.00 0.00 ? 116 ASP A C    3  
ATOM 6274  O O    . ASP A 1 116 ? -4.621  10.048  5.478   1.00 0.00 ? 116 ASP A O    3  
ATOM 6275  C CB   . ASP A 1 116 ? -1.298  10.359  6.786   1.00 0.00 ? 116 ASP A CB   3  
ATOM 6276  C CG   . ASP A 1 116 ? -0.709  10.848  8.105   1.00 0.00 ? 116 ASP A CG   3  
ATOM 6277  O OD1  . ASP A 1 116 ? -0.545  10.036  9.038   1.00 0.00 ? 116 ASP A OD1  3  
ATOM 6278  O OD2  . ASP A 1 116 ? -0.378  12.051  8.204   1.00 0.00 ? 116 ASP A OD2  3  
ATOM 6279  H H    . ASP A 1 116 ? -2.328  7.697   6.930   1.00 0.00 ? 116 ASP A H    3  
ATOM 6280  H HA   . ASP A 1 116 ? -3.289  10.403  7.601   1.00 0.00 ? 116 ASP A HA   3  
ATOM 6281  H HB2  . ASP A 1 116 ? -0.646  9.595   6.389   1.00 0.00 ? 116 ASP A HB2  3  
ATOM 6282  H HB3  . ASP A 1 116 ? -1.324  11.190  6.093   1.00 0.00 ? 116 ASP A HB3  3  
ATOM 6283  N N    . SER A 1 117 ? -2.669  9.446   4.523   1.00 0.00 ? 117 SER A N    3  
ATOM 6284  C CA   . SER A 1 117 ? -3.196  9.433   3.165   1.00 0.00 ? 117 SER A CA   3  
ATOM 6285  C C    . SER A 1 117 ? -4.362  8.457   3.053   1.00 0.00 ? 117 SER A C    3  
ATOM 6286  O O    . SER A 1 117 ? -5.410  8.786   2.498   1.00 0.00 ? 117 SER A O    3  
ATOM 6287  C CB   . SER A 1 117 ? -2.082  9.056   2.188   1.00 0.00 ? 117 SER A CB   3  
ATOM 6288  O OG   . SER A 1 117 ? -0.950  9.887   2.374   1.00 0.00 ? 117 SER A OG   3  
ATOM 6289  H H    . SER A 1 117 ? -1.729  9.207   4.666   1.00 0.00 ? 117 SER A H    3  
ATOM 6290  H HA   . SER A 1 117 ? -3.546  10.430  2.934   1.00 0.00 ? 117 SER A HA   3  
ATOM 6291  H HB2  . SER A 1 117 ? -1.790  8.028   2.352   1.00 0.00 ? 117 SER A HB2  3  
ATOM 6292  H HB3  . SER A 1 117 ? -2.437  9.173   1.174   1.00 0.00 ? 117 SER A HB3  3  
ATOM 6293  H HG   . SER A 1 117 ? -1.204  10.811  2.237   1.00 0.00 ? 117 SER A HG   3  
ATOM 6294  N N    . TYR A 1 118 ? -4.178  7.260   3.607   1.00 0.00 ? 118 TYR A N    3  
ATOM 6295  C CA   . TYR A 1 118 ? -5.215  6.235   3.598   1.00 0.00 ? 118 TYR A CA   3  
ATOM 6296  C C    . TYR A 1 118 ? -6.429  6.698   4.392   1.00 0.00 ? 118 TYR A C    3  
ATOM 6297  O O    . TYR A 1 118 ? -7.568  6.583   3.929   1.00 0.00 ? 118 TYR A O    3  
ATOM 6298  C CB   . TYR A 1 118 ? -4.677  4.926   4.185   1.00 0.00 ? 118 TYR A CB   3  
ATOM 6299  C CG   . TYR A 1 118 ? -5.712  3.817   4.265   1.00 0.00 ? 118 TYR A CG   3  
ATOM 6300  C CD1  . TYR A 1 118 ? -6.357  3.359   3.121   1.00 0.00 ? 118 TYR A CD1  3  
ATOM 6301  C CD2  . TYR A 1 118 ? -6.037  3.220   5.481   1.00 0.00 ? 118 TYR A CD2  3  
ATOM 6302  C CE1  . TYR A 1 118 ? -7.289  2.343   3.182   1.00 0.00 ? 118 TYR A CE1  3  
ATOM 6303  C CE2  . TYR A 1 118 ? -6.971  2.204   5.549   1.00 0.00 ? 118 TYR A CE2  3  
ATOM 6304  C CZ   . TYR A 1 118 ? -7.594  1.770   4.397   1.00 0.00 ? 118 TYR A CZ   3  
ATOM 6305  O OH   . TYR A 1 118 ? -8.518  0.752   4.460   1.00 0.00 ? 118 TYR A OH   3  
ATOM 6306  H H    . TYR A 1 118 ? -3.319  7.062   4.032   1.00 0.00 ? 118 TYR A H    3  
ATOM 6307  H HA   . TYR A 1 118 ? -5.510  6.066   2.571   1.00 0.00 ? 118 TYR A HA   3  
ATOM 6308  H HB2  . TYR A 1 118 ? -3.863  4.572   3.569   1.00 0.00 ? 118 TYR A HB2  3  
ATOM 6309  H HB3  . TYR A 1 118 ? -4.308  5.112   5.184   1.00 0.00 ? 118 TYR A HB3  3  
ATOM 6310  H HD1  . TYR A 1 118 ? -6.117  3.812   2.168   1.00 0.00 ? 118 TYR A HD1  3  
ATOM 6311  H HD2  . TYR A 1 118 ? -5.549  3.562   6.382   1.00 0.00 ? 118 TYR A HD2  3  
ATOM 6312  H HE1  . TYR A 1 118 ? -7.776  2.002   2.279   1.00 0.00 ? 118 TYR A HE1  3  
ATOM 6313  H HE2  . TYR A 1 118 ? -7.210  1.755   6.502   1.00 0.00 ? 118 TYR A HE2  3  
ATOM 6314  H HH   . TYR A 1 118 ? -8.443  0.205   3.669   1.00 0.00 ? 118 TYR A HH   3  
ATOM 6315  N N    . ALA A 1 119 ? -6.172  7.236   5.584   1.00 0.00 ? 119 ALA A N    3  
ATOM 6316  C CA   . ALA A 1 119 ? -7.240  7.700   6.466   1.00 0.00 ? 119 ALA A CA   3  
ATOM 6317  C C    . ALA A 1 119 ? -8.123  8.724   5.758   1.00 0.00 ? 119 ALA A C    3  
ATOM 6318  O O    . ALA A 1 119 ? -9.348  8.688   5.867   1.00 0.00 ? 119 ALA A O    3  
ATOM 6319  C CB   . ALA A 1 119 ? -6.654  8.293   7.742   1.00 0.00 ? 119 ALA A CB   3  
ATOM 6320  H H    . ALA A 1 119 ? -5.237  7.322   5.878   1.00 0.00 ? 119 ALA A H    3  
ATOM 6321  H HA   . ALA A 1 119 ? -7.843  6.844   6.738   1.00 0.00 ? 119 ALA A HA   3  
ATOM 6322  H HB1  . ALA A 1 119 ? -7.455  8.590   8.404   1.00 0.00 ? 119 ALA A HB1  3  
ATOM 6323  H HB2  . ALA A 1 119 ? -6.052  9.156   7.497   1.00 0.00 ? 119 ALA A HB2  3  
ATOM 6324  H HB3  . ALA A 1 119 ? -6.038  7.554   8.234   1.00 0.00 ? 119 ALA A HB3  3  
ATOM 6325  N N    . ARG A 1 120 ? -7.489  9.631   5.020   1.00 0.00 ? 120 ARG A N    3  
ATOM 6326  C CA   . ARG A 1 120 ? -8.209  10.666  4.288   1.00 0.00 ? 120 ARG A CA   3  
ATOM 6327  C C    . ARG A 1 120 ? -8.831  10.096  3.012   1.00 0.00 ? 120 ARG A C    3  
ATOM 6328  O O    . ARG A 1 120 ? -9.924  10.494  2.611   1.00 0.00 ? 120 ARG A O    3  
ATOM 6329  C CB   . ARG A 1 120 ? -7.267  11.824  3.937   1.00 0.00 ? 120 ARG A CB   3  
ATOM 6330  C CG   . ARG A 1 120 ? -7.960  12.989  3.234   1.00 0.00 ? 120 ARG A CG   3  
ATOM 6331  C CD   . ARG A 1 120 ? -6.973  14.073  2.821   1.00 0.00 ? 120 ARG A CD   3  
ATOM 6332  N NE   . ARG A 1 120 ? -7.647  15.206  2.186   1.00 0.00 ? 120 ARG A NE   3  
ATOM 6333  C CZ   . ARG A 1 120 ? -7.113  15.961  1.226   1.00 0.00 ? 120 ARG A CZ   3  
ATOM 6334  N NH1  . ARG A 1 120 ? -5.897  15.699  0.762   1.00 0.00 ? 120 ARG A NH1  3  
ATOM 6335  N NH2  . ARG A 1 120 ? -7.805  16.975  0.728   1.00 0.00 ? 120 ARG A NH2  3  
ATOM 6336  H H    . ARG A 1 120 ? -6.508  9.604   4.970   1.00 0.00 ? 120 ARG A H    3  
ATOM 6337  H HA   . ARG A 1 120 ? -9.000  11.038  4.925   1.00 0.00 ? 120 ARG A HA   3  
ATOM 6338  H HB2  . ARG A 1 120 ? -6.817  12.196  4.847   1.00 0.00 ? 120 ARG A HB2  3  
ATOM 6339  H HB3  . ARG A 1 120 ? -6.485  11.453  3.287   1.00 0.00 ? 120 ARG A HB3  3  
ATOM 6340  H HG2  . ARG A 1 120 ? -8.460  12.618  2.351   1.00 0.00 ? 120 ARG A HG2  3  
ATOM 6341  H HG3  . ARG A 1 120 ? -8.690  13.418  3.908   1.00 0.00 ? 120 ARG A HG3  3  
ATOM 6342  H HD2  . ARG A 1 120 ? -6.450  14.424  3.699   1.00 0.00 ? 120 ARG A HD2  3  
ATOM 6343  H HD3  . ARG A 1 120 ? -6.261  13.650  2.124   1.00 0.00 ? 120 ARG A HD3  3  
ATOM 6344  H HE   . ARG A 1 120 ? -8.555  15.421  2.501   1.00 0.00 ? 120 ARG A HE   3  
ATOM 6345  H HH11 . ARG A 1 120 ? -5.371  14.930  1.130   1.00 0.00 ? 120 ARG A HH11 3  
ATOM 6346  H HH12 . ARG A 1 120 ? -5.494  16.266  0.032   1.00 0.00 ? 120 ARG A HH12 3  
ATOM 6347  H HH21 . ARG A 1 120 ? -8.726  17.173  1.076   1.00 0.00 ? 120 ARG A HH21 3  
ATOM 6348  H HH22 . ARG A 1 120 ? -7.411  17.548  0.005   1.00 0.00 ? 120 ARG A HH22 3  
ATOM 6349  N N    . PHE A 1 121 ? -8.135  9.151   2.387   1.00 0.00 ? 121 PHE A N    3  
ATOM 6350  C CA   . PHE A 1 121 ? -8.557  8.606   1.098   1.00 0.00 ? 121 PHE A CA   3  
ATOM 6351  C C    . PHE A 1 121 ? -9.937  7.958   1.188   1.00 0.00 ? 121 PHE A C    3  
ATOM 6352  O O    . PHE A 1 121 ? -10.760 8.118   0.290   1.00 0.00 ? 121 PHE A O    3  
ATOM 6353  C CB   . PHE A 1 121 ? -7.531  7.592   0.572   1.00 0.00 ? 121 PHE A CB   3  
ATOM 6354  C CG   . PHE A 1 121 ? -7.882  7.032   -0.787  1.00 0.00 ? 121 PHE A CG   3  
ATOM 6355  C CD1  . PHE A 1 121 ? -7.861  7.845   -1.911  1.00 0.00 ? 121 PHE A CD1  3  
ATOM 6356  C CD2  . PHE A 1 121 ? -8.240  5.699   -0.936  1.00 0.00 ? 121 PHE A CD2  3  
ATOM 6357  C CE1  . PHE A 1 121 ? -8.188  7.341   -3.154  1.00 0.00 ? 121 PHE A CE1  3  
ATOM 6358  C CE2  . PHE A 1 121 ? -8.570  5.192   -2.178  1.00 0.00 ? 121 PHE A CE2  3  
ATOM 6359  C CZ   . PHE A 1 121 ? -8.544  6.013   -3.288  1.00 0.00 ? 121 PHE A CZ   3  
ATOM 6360  H H    . PHE A 1 121 ? -7.314  8.812   2.802   1.00 0.00 ? 121 PHE A H    3  
ATOM 6361  H HA   . PHE A 1 121 ? -8.612  9.432   0.403   1.00 0.00 ? 121 PHE A HA   3  
ATOM 6362  H HB2  . PHE A 1 121 ? -6.566  8.073   0.494   1.00 0.00 ? 121 PHE A HB2  3  
ATOM 6363  H HB3  . PHE A 1 121 ? -7.460  6.767   1.268   1.00 0.00 ? 121 PHE A HB3  3  
ATOM 6364  H HD1  . PHE A 1 121 ? -7.583  8.886   -1.810  1.00 0.00 ? 121 PHE A HD1  3  
ATOM 6365  H HD2  . PHE A 1 121 ? -8.263  5.054   -0.069  1.00 0.00 ? 121 PHE A HD2  3  
ATOM 6366  H HE1  . PHE A 1 121 ? -8.167  7.984   -4.022  1.00 0.00 ? 121 PHE A HE1  3  
ATOM 6367  H HE2  . PHE A 1 121 ? -8.847  4.151   -2.282  1.00 0.00 ? 121 PHE A HE2  3  
ATOM 6368  H HZ   . PHE A 1 121 ? -8.800  5.618   -4.261  1.00 0.00 ? 121 PHE A HZ   3  
ATOM 6369  N N    . VAL A 1 122 ? -10.196 7.236   2.270   1.00 0.00 ? 122 VAL A N    3  
ATOM 6370  C CA   . VAL A 1 122 ? -11.490 6.574   2.442   1.00 0.00 ? 122 VAL A CA   3  
ATOM 6371  C C    . VAL A 1 122 ? -12.568 7.566   2.894   1.00 0.00 ? 122 VAL A C    3  
ATOM 6372  O O    . VAL A 1 122 ? -13.744 7.217   2.981   1.00 0.00 ? 122 VAL A O    3  
ATOM 6373  C CB   . VAL A 1 122 ? -11.405 5.388   3.438   1.00 0.00 ? 122 VAL A CB   3  
ATOM 6374  C CG1  . VAL A 1 122 ? -10.477 4.299   2.900   1.00 0.00 ? 122 VAL A CG1  3  
ATOM 6375  C CG2  . VAL A 1 122 ? -10.946 5.857   4.817   1.00 0.00 ? 122 VAL A CG2  3  
ATOM 6376  H H    . VAL A 1 122 ? -9.507  7.139   2.964   1.00 0.00 ? 122 VAL A H    3  
ATOM 6377  H HA   . VAL A 1 122 ? -11.781 6.174   1.474   1.00 0.00 ? 122 VAL A HA   3  
ATOM 6378  H HB   . VAL A 1 122 ? -12.395 4.962   3.539   1.00 0.00 ? 122 VAL A HB   3  
ATOM 6379  H HG11 . VAL A 1 122 ? -9.483  4.702   2.769   1.00 0.00 ? 122 VAL A HG11 3  
ATOM 6380  H HG12 . VAL A 1 122 ? -10.849 3.945   1.950   1.00 0.00 ? 122 VAL A HG12 3  
ATOM 6381  H HG13 . VAL A 1 122 ? -10.441 3.476   3.600   1.00 0.00 ? 122 VAL A HG13 3  
ATOM 6382  H HG21 . VAL A 1 122 ? -9.969  6.313   4.737   1.00 0.00 ? 122 VAL A HG21 3  
ATOM 6383  H HG22 . VAL A 1 122 ? -10.892 5.009   5.486   1.00 0.00 ? 122 VAL A HG22 3  
ATOM 6384  H HG23 . VAL A 1 122 ? -11.650 6.579   5.207   1.00 0.00 ? 122 VAL A HG23 3  
ATOM 6385  N N    . LYS A 1 123 ? -12.158 8.805   3.172   1.00 0.00 ? 123 LYS A N    3  
ATOM 6386  C CA   . LYS A 1 123 ? -13.088 9.878   3.542   1.00 0.00 ? 123 LYS A CA   3  
ATOM 6387  C C    . LYS A 1 123 ? -13.057 10.990  2.488   1.00 0.00 ? 123 LYS A C    3  
ATOM 6388  O O    . LYS A 1 123 ? -13.703 12.030  2.642   1.00 0.00 ? 123 LYS A O    3  
ATOM 6389  C CB   . LYS A 1 123 ? -12.720 10.456  4.923   1.00 0.00 ? 123 LYS A CB   3  
ATOM 6390  C CG   . LYS A 1 123 ? -12.746 9.430   6.055   1.00 0.00 ? 123 LYS A CG   3  
ATOM 6391  C CD   . LYS A 1 123 ? -12.456 10.063  7.421   1.00 0.00 ? 123 LYS A CD   3  
ATOM 6392  C CE   . LYS A 1 123 ? -11.073 10.707  7.481   1.00 0.00 ? 123 LYS A CE   3  
ATOM 6393  N NZ   . LYS A 1 123 ? -10.750 11.218  8.843   1.00 0.00 ? 123 LYS A NZ   3  
ATOM 6394  H H    . LYS A 1 123 ? -11.200 9.007   3.128   1.00 0.00 ? 123 LYS A H    3  
ATOM 6395  H HA   . LYS A 1 123 ? -14.087 9.463   3.584   1.00 0.00 ? 123 LYS A HA   3  
ATOM 6396  H HB2  . LYS A 1 123 ? -11.724 10.875  4.869   1.00 0.00 ? 123 LYS A HB2  3  
ATOM 6397  H HB3  . LYS A 1 123 ? -13.418 11.246  5.166   1.00 0.00 ? 123 LYS A HB3  3  
ATOM 6398  H HG2  . LYS A 1 123 ? -13.723 8.970   6.087   1.00 0.00 ? 123 LYS A HG2  3  
ATOM 6399  H HG3  . LYS A 1 123 ? -12.001 8.672   5.855   1.00 0.00 ? 123 LYS A HG3  3  
ATOM 6400  H HD2  . LYS A 1 123 ? -13.202 10.820  7.619   1.00 0.00 ? 123 LYS A HD2  3  
ATOM 6401  H HD3  . LYS A 1 123 ? -12.518 9.294   8.179   1.00 0.00 ? 123 LYS A HD3  3  
ATOM 6402  H HE2  . LYS A 1 123 ? -10.333 9.972   7.203   1.00 0.00 ? 123 LYS A HE2  3  
ATOM 6403  H HE3  . LYS A 1 123 ? -11.040 11.531  6.782   1.00 0.00 ? 123 LYS A HE3  3  
ATOM 6404  H HZ1  . LYS A 1 123 ? -9.787  11.609  8.861   1.00 0.00 ? 123 LYS A HZ1  3  
ATOM 6405  H HZ2  . LYS A 1 123 ? -10.807 10.448  9.541   1.00 0.00 ? 123 LYS A HZ2  3  
ATOM 6406  H HZ3  . LYS A 1 123 ? -11.418 11.966  9.120   1.00 0.00 ? 123 LYS A HZ3  3  
ATOM 6407  N N    . SER A 1 124 ? -12.297 10.756  1.421   1.00 0.00 ? 124 SER A N    3  
ATOM 6408  C CA   . SER A 1 124 ? -12.083 11.749  0.368   1.00 0.00 ? 124 SER A CA   3  
ATOM 6409  C C    . SER A 1 124 ? -13.368 12.047  -0.410  1.00 0.00 ? 124 SER A C    3  
ATOM 6410  O O    . SER A 1 124 ? -14.278 11.212  -0.473  1.00 0.00 ? 124 SER A O    3  
ATOM 6411  C CB   . SER A 1 124 ? -11.012 11.242  -0.609  1.00 0.00 ? 124 SER A CB   3  
ATOM 6412  O OG   . SER A 1 124 ? -11.464 10.101  -1.326  1.00 0.00 ? 124 SER A OG   3  
ATOM 6413  H H    . SER A 1 124 ? -11.850 9.889   1.344   1.00 0.00 ? 124 SER A H    3  
ATOM 6414  H HA   . SER A 1 124 ? -11.731 12.658  0.834   1.00 0.00 ? 124 SER A HA   3  
ATOM 6415  H HB2  . SER A 1 124 ? -10.773 12.022  -1.317  1.00 0.00 ? 124 SER A HB2  3  
ATOM 6416  H HB3  . SER A 1 124 ? -10.121 10.975  -0.058  1.00 0.00 ? 124 SER A HB3  3  
ATOM 6417  H HG   . SER A 1 124 ? -10.956 9.329   -1.053  1.00 0.00 ? 124 SER A HG   3  
ATOM 6418  N N    . PRO A 1 125 ? -13.450 13.241  -1.035  1.00 0.00 ? 125 PRO A N    3  
ATOM 6419  C CA   . PRO A 1 125 ? -14.529 13.577  -1.974  1.00 0.00 ? 125 PRO A CA   3  
ATOM 6420  C C    . PRO A 1 125 ? -14.331 12.872  -3.324  1.00 0.00 ? 125 PRO A C    3  
ATOM 6421  O O    . PRO A 1 125 ? -14.560 13.451  -4.385  1.00 0.00 ? 125 PRO A O    3  
ATOM 6422  C CB   . PRO A 1 125 ? -14.402 15.100  -2.119  1.00 0.00 ? 125 PRO A CB   3  
ATOM 6423  C CG   . PRO A 1 125 ? -12.955 15.373  -1.889  1.00 0.00 ? 125 PRO A CG   3  
ATOM 6424  C CD   . PRO A 1 125 ? -12.506 14.370  -0.858  1.00 0.00 ? 125 PRO A CD   3  
ATOM 6425  H HA   . PRO A 1 125 ? -15.501 13.322  -1.574  1.00 0.00 ? 125 PRO A HA   3  
ATOM 6426  H HB2  . PRO A 1 125 ? -14.713 15.404  -3.110  1.00 0.00 ? 125 PRO A HB2  3  
ATOM 6427  H HB3  . PRO A 1 125 ? -15.018 15.590  -1.378  1.00 0.00 ? 125 PRO A HB3  3  
ATOM 6428  H HG2  . PRO A 1 125 ? -12.403 15.238  -2.809  1.00 0.00 ? 125 PRO A HG2  3  
ATOM 6429  H HG3  . PRO A 1 125 ? -12.822 16.380  -1.516  1.00 0.00 ? 125 PRO A HG3  3  
ATOM 6430  H HD2  . PRO A 1 125 ? -11.490 14.056  -1.052  1.00 0.00 ? 125 PRO A HD2  3  
ATOM 6431  H HD3  . PRO A 1 125 ? -12.587 14.786  0.137   1.00 0.00 ? 125 PRO A HD3  3  
ATOM 6432  N N    . LEU A 1 126 ? -13.909 11.611  -3.261  1.00 0.00 ? 126 LEU A N    3  
ATOM 6433  C CA   . LEU A 1 126 ? -13.673 10.793  -4.447  1.00 0.00 ? 126 LEU A CA   3  
ATOM 6434  C C    . LEU A 1 126 ? -14.178 9.379   -4.169  1.00 0.00 ? 126 LEU A C    3  
ATOM 6435  O O    . LEU A 1 126 ? -15.026 8.855   -4.896  1.00 0.00 ? 126 LEU A O    3  
ATOM 6436  C CB   . LEU A 1 126 ? -12.167 10.796  -4.791  1.00 0.00 ? 126 LEU A CB   3  
ATOM 6437  C CG   . LEU A 1 126 ? -11.761 10.188  -6.152  1.00 0.00 ? 126 LEU A CG   3  
ATOM 6438  C CD1  . LEU A 1 126 ? -10.362 10.655  -6.546  1.00 0.00 ? 126 LEU A CD1  3  
ATOM 6439  C CD2  . LEU A 1 126 ? -11.806 8.658   -6.119  1.00 0.00 ? 126 LEU A CD2  3  
ATOM 6440  H H    . LEU A 1 126 ? -13.754 11.213  -2.383  1.00 0.00 ? 126 LEU A H    3  
ATOM 6441  H HA   . LEU A 1 126 ? -14.233 11.216  -5.271  1.00 0.00 ? 126 LEU A HA   3  
ATOM 6442  H HB2  . LEU A 1 126 ? -11.826 11.821  -4.771  1.00 0.00 ? 126 LEU A HB2  3  
ATOM 6443  H HB3  . LEU A 1 126 ? -11.645 10.253  -4.015  1.00 0.00 ? 126 LEU A HB3  3  
ATOM 6444  H HG   . LEU A 1 126 ? -12.451 10.528  -6.913  1.00 0.00 ? 126 LEU A HG   3  
ATOM 6445  H HD11 . LEU A 1 126 ? -10.346 11.734  -6.605  1.00 0.00 ? 126 LEU A HD11 3  
ATOM 6446  H HD12 . LEU A 1 126 ? -10.099 10.240  -7.509  1.00 0.00 ? 126 LEU A HD12 3  
ATOM 6447  H HD13 . LEU A 1 126 ? -9.647  10.325  -5.805  1.00 0.00 ? 126 LEU A HD13 3  
ATOM 6448  H HD21 . LEU A 1 126 ? -11.506 8.268   -7.081  1.00 0.00 ? 126 LEU A HD21 3  
ATOM 6449  H HD22 . LEU A 1 126 ? -12.810 8.331   -5.899  1.00 0.00 ? 126 LEU A HD22 3  
ATOM 6450  H HD23 . LEU A 1 126 ? -11.133 8.292   -5.357  1.00 0.00 ? 126 LEU A HD23 3  
ATOM 6451  N N    . TYR A 1 127 ? -13.672 8.786   -3.086  1.00 0.00 ? 127 TYR A N    3  
ATOM 6452  C CA   . TYR A 1 127 ? -14.071 7.441   -2.660  1.00 0.00 ? 127 TYR A CA   3  
ATOM 6453  C C    . TYR A 1 127 ? -15.596 7.327   -2.591  1.00 0.00 ? 127 TYR A C    3  
ATOM 6454  O O    . TYR A 1 127 ? -16.182 6.355   -3.070  1.00 0.00 ? 127 TYR A O    3  
ATOM 6455  C CB   . TYR A 1 127 ? -13.443 7.132   -1.291  1.00 0.00 ? 127 TYR A CB   3  
ATOM 6456  C CG   . TYR A 1 127 ? -13.760 5.751   -0.741  1.00 0.00 ? 127 TYR A CG   3  
ATOM 6457  C CD1  . TYR A 1 127 ? -13.129 4.620   -1.245  1.00 0.00 ? 127 TYR A CD1  3  
ATOM 6458  C CD2  . TYR A 1 127 ? -14.685 5.582   0.287   1.00 0.00 ? 127 TYR A CD2  3  
ATOM 6459  C CE1  . TYR A 1 127 ? -13.408 3.363   -0.743  1.00 0.00 ? 127 TYR A CE1  3  
ATOM 6460  C CE2  . TYR A 1 127 ? -14.966 4.329   0.796   1.00 0.00 ? 127 TYR A CE2  3  
ATOM 6461  C CZ   . TYR A 1 127 ? -14.326 3.223   0.279   1.00 0.00 ? 127 TYR A CZ   3  
ATOM 6462  O OH   . TYR A 1 127 ? -14.606 1.972   0.786   1.00 0.00 ? 127 TYR A OH   3  
ATOM 6463  H H    . TYR A 1 127 ? -13.000 9.268   -2.554  1.00 0.00 ? 127 TYR A H    3  
ATOM 6464  H HA   . TYR A 1 127 ? -13.696 6.737   -3.390  1.00 0.00 ? 127 TYR A HA   3  
ATOM 6465  H HB2  . TYR A 1 127 ? -12.367 7.208   -1.376  1.00 0.00 ? 127 TYR A HB2  3  
ATOM 6466  H HB3  . TYR A 1 127 ? -13.787 7.863   -0.574  1.00 0.00 ? 127 TYR A HB3  3  
ATOM 6467  H HD1  . TYR A 1 127 ? -12.409 4.730   -2.044  1.00 0.00 ? 127 TYR A HD1  3  
ATOM 6468  H HD2  . TYR A 1 127 ? -15.186 6.451   0.692   1.00 0.00 ? 127 TYR A HD2  3  
ATOM 6469  H HE1  . TYR A 1 127 ? -12.905 2.498   -1.150  1.00 0.00 ? 127 TYR A HE1  3  
ATOM 6470  H HE2  . TYR A 1 127 ? -15.686 4.220   1.594   1.00 0.00 ? 127 TYR A HE2  3  
ATOM 6471  H HH   . TYR A 1 127 ? -13.785 1.489   0.914   1.00 0.00 ? 127 TYR A HH   3  
ATOM 6472  N N    . ARG A 1 128 ? -16.225 8.346   -2.012  1.00 0.00 ? 128 ARG A N    3  
ATOM 6473  C CA   . ARG A 1 128 ? -17.682 8.409   -1.889  1.00 0.00 ? 128 ARG A CA   3  
ATOM 6474  C C    . ARG A 1 128 ? -18.368 8.226   -3.247  1.00 0.00 ? 128 ARG A C    3  
ATOM 6475  O O    . ARG A 1 128 ? -19.369 7.516   -3.355  1.00 0.00 ? 128 ARG A O    3  
ATOM 6476  C CB   . ARG A 1 128 ? -18.094 9.769   -1.300  1.00 0.00 ? 128 ARG A CB   3  
ATOM 6477  C CG   . ARG A 1 128 ? -17.648 10.949  -2.164  1.00 0.00 ? 128 ARG A CG   3  
ATOM 6478  C CD   . ARG A 1 128 ? -18.289 12.266  -1.750  1.00 0.00 ? 128 ARG A CD   3  
ATOM 6479  N NE   . ARG A 1 128 ? -18.029 13.320  -2.738  1.00 0.00 ? 128 ARG A NE   3  
ATOM 6480  C CZ   . ARG A 1 128 ? -18.580 14.533  -2.710  1.00 0.00 ? 128 ARG A CZ   3  
ATOM 6481  N NH1  . ARG A 1 128 ? -19.439 14.856  -1.752  1.00 0.00 ? 128 ARG A NH1  3  
ATOM 6482  N NH2  . ARG A 1 128 ? -18.277 15.415  -3.653  1.00 0.00 ? 128 ARG A NH2  3  
ATOM 6483  H H    . ARG A 1 128 ? -15.689 9.080   -1.646  1.00 0.00 ? 128 ARG A H    3  
ATOM 6484  H HA   . ARG A 1 128 ? -18.005 7.617   -1.222  1.00 0.00 ? 128 ARG A HA   3  
ATOM 6485  H HB2  . ARG A 1 128 ? -19.172 9.799   -1.206  1.00 0.00 ? 128 ARG A HB2  3  
ATOM 6486  H HB3  . ARG A 1 128 ? -17.652 9.876   -0.320  1.00 0.00 ? 128 ARG A HB3  3  
ATOM 6487  H HG2  . ARG A 1 128 ? -16.575 11.051  -2.086  1.00 0.00 ? 128 ARG A HG2  3  
ATOM 6488  H HG3  . ARG A 1 128 ? -17.911 10.744  -3.192  1.00 0.00 ? 128 ARG A HG3  3  
ATOM 6489  H HD2  . ARG A 1 128 ? -19.358 12.122  -1.660  1.00 0.00 ? 128 ARG A HD2  3  
ATOM 6490  H HD3  . ARG A 1 128 ? -17.885 12.570  -0.795  1.00 0.00 ? 128 ARG A HD3  3  
ATOM 6491  H HE   . ARG A 1 128 ? -17.409 13.106  -3.475  1.00 0.00 ? 128 ARG A HE   3  
ATOM 6492  H HH11 . ARG A 1 128 ? -19.680 14.186  -1.042  1.00 0.00 ? 128 ARG A HH11 3  
ATOM 6493  H HH12 . ARG A 1 128 ? -19.865 15.767  -1.740  1.00 0.00 ? 128 ARG A HH12 3  
ATOM 6494  H HH21 . ARG A 1 128 ? -17.636 15.167  -4.390  1.00 0.00 ? 128 ARG A HH21 3  
ATOM 6495  H HH22 . ARG A 1 128 ? -18.683 16.333  -3.638  1.00 0.00 ? 128 ARG A HH22 3  
ATOM 6496  N N    . GLU A 1 129 ? -17.812 8.867   -4.274  1.00 0.00 ? 129 GLU A N    3  
ATOM 6497  C CA   . GLU A 1 129 ? -18.432 8.917   -5.595  1.00 0.00 ? 129 GLU A CA   3  
ATOM 6498  C C    . GLU A 1 129 ? -18.133 7.651   -6.388  1.00 0.00 ? 129 GLU A C    3  
ATOM 6499  O O    . GLU A 1 129 ? -18.915 7.254   -7.253  1.00 0.00 ? 129 GLU A O    3  
ATOM 6500  C CB   . GLU A 1 129 ? -17.960 10.172  -6.343  1.00 0.00 ? 129 GLU A CB   3  
ATOM 6501  C CG   . GLU A 1 129 ? -18.475 11.465  -5.712  1.00 0.00 ? 129 GLU A CG   3  
ATOM 6502  C CD   . GLU A 1 129 ? -17.831 12.717  -6.279  1.00 0.00 ? 129 GLU A CD   3  
ATOM 6503  O OE1  . GLU A 1 129 ? -17.992 12.981  -7.489  1.00 0.00 ? 129 GLU A OE1  3  
ATOM 6504  O OE2  . GLU A 1 129 ? -17.172 13.452  -5.512  1.00 0.00 ? 129 GLU A OE2  3  
ATOM 6505  H H    . GLU A 1 129 ? -16.946 9.306   -4.144  1.00 0.00 ? 129 GLU A H    3  
ATOM 6506  H HA   . GLU A 1 129 ? -19.503 8.984   -5.451  1.00 0.00 ? 129 GLU A HA   3  
ATOM 6507  H HB2  . GLU A 1 129 ? -16.878 10.196  -6.344  1.00 0.00 ? 129 GLU A HB2  3  
ATOM 6508  H HB3  . GLU A 1 129 ? -18.313 10.128  -7.364  1.00 0.00 ? 129 GLU A HB3  3  
ATOM 6509  H HG2  . GLU A 1 129 ? -19.541 11.527  -5.879  1.00 0.00 ? 129 GLU A HG2  3  
ATOM 6510  H HG3  . GLU A 1 129 ? -18.287 11.429  -4.648  1.00 0.00 ? 129 GLU A HG3  3  
ATOM 6511  N N    . CYS A 1 130 ? -17.005 7.017   -6.088  1.00 0.00 ? 130 CYS A N    3  
ATOM 6512  C CA   . CYS A 1 130 ? -16.694 5.709   -6.653  1.00 0.00 ? 130 CYS A CA   3  
ATOM 6513  C C    . CYS A 1 130 ? -17.633 4.658   -6.061  1.00 0.00 ? 130 CYS A C    3  
ATOM 6514  O O    . CYS A 1 130 ? -17.843 3.590   -6.638  1.00 0.00 ? 130 CYS A O    3  
ATOM 6515  C CB   . CYS A 1 130 ? -15.231 5.345   -6.382  1.00 0.00 ? 130 CYS A CB   3  
ATOM 6516  S SG   . CYS A 1 130 ? -14.049 6.502   -7.109  1.00 0.00 ? 130 CYS A SG   3  
ATOM 6517  H H    . CYS A 1 130 ? -16.362 7.443   -5.482  1.00 0.00 ? 130 CYS A H    3  
ATOM 6518  H HA   . CYS A 1 130 ? -16.856 5.759   -7.721  1.00 0.00 ? 130 CYS A HA   3  
ATOM 6519  H HB2  . CYS A 1 130 ? -15.060 5.326   -5.316  1.00 0.00 ? 130 CYS A HB2  3  
ATOM 6520  H HB3  . CYS A 1 130 ? -15.027 4.364   -6.792  1.00 0.00 ? 130 CYS A HB3  3  
ATOM 6521  H HG   . CYS A 1 130 ? -14.701 7.236   -8.003  1.00 0.00 ? 130 CYS A HG   3  
ATOM 6522  N N    . LEU A 1 131 ? -18.187 4.982   -4.894  1.00 0.00 ? 131 LEU A N    3  
ATOM 6523  C CA   . LEU A 1 131 ? -19.182 4.141   -4.237  1.00 0.00 ? 131 LEU A CA   3  
ATOM 6524  C C    . LEU A 1 131 ? -20.594 4.522   -4.692  1.00 0.00 ? 131 LEU A C    3  
ATOM 6525  O O    . LEU A 1 131 ? -21.136 3.921   -5.621  1.00 0.00 ? 131 LEU A O    3  
ATOM 6526  C CB   . LEU A 1 131 ? -19.048 4.254   -2.702  1.00 0.00 ? 131 LEU A CB   3  
ATOM 6527  C CG   . LEU A 1 131 ? -18.138 3.206   -2.038  1.00 0.00 ? 131 LEU A CG   3  
ATOM 6528  C CD1  . LEU A 1 131 ? -16.708 3.309   -2.559  1.00 0.00 ? 131 LEU A CD1  3  
ATOM 6529  C CD2  . LEU A 1 131 ? -18.173 3.352   -0.516  1.00 0.00 ? 131 LEU A CD2  3  
ATOM 6530  H H    . LEU A 1 131 ? -17.915 5.816   -4.461  1.00 0.00 ? 131 LEU A H    3  
ATOM 6531  H HA   . LEU A 1 131 ? -18.994 3.116   -4.528  1.00 0.00 ? 131 LEU A HA   3  
ATOM 6532  H HB2  . LEU A 1 131 ? -18.652 5.235   -2.474  1.00 0.00 ? 131 LEU A HB2  3  
ATOM 6533  H HB3  . LEU A 1 131 ? -20.030 4.181   -2.261  1.00 0.00 ? 131 LEU A HB3  3  
ATOM 6534  H HG   . LEU A 1 131 ? -18.506 2.219   -2.281  1.00 0.00 ? 131 LEU A HG   3  
ATOM 6535  H HD11 . LEU A 1 131 ? -16.094 2.559   -2.082  1.00 0.00 ? 131 LEU A HD11 3  
ATOM 6536  H HD12 . LEU A 1 131 ? -16.311 4.290   -2.342  1.00 0.00 ? 131 LEU A HD12 3  
ATOM 6537  H HD13 . LEU A 1 131 ? -16.702 3.150   -3.629  1.00 0.00 ? 131 LEU A HD13 3  
ATOM 6538  H HD21 . LEU A 1 131 ? -19.186 3.221   -0.165  1.00 0.00 ? 131 LEU A HD21 3  
ATOM 6539  H HD22 . LEU A 1 131 ? -17.819 4.334   -0.238  1.00 0.00 ? 131 LEU A HD22 3  
ATOM 6540  H HD23 . LEU A 1 131 ? -17.539 2.601   -0.066  1.00 0.00 ? 131 LEU A HD23 3  
ATOM 6541  N N    . LEU A 1 132 ? -21.170 5.546   -4.056  1.00 0.00 ? 132 LEU A N    3  
ATOM 6542  C CA   . LEU A 1 132 ? -22.544 5.975   -4.335  1.00 0.00 ? 132 LEU A CA   3  
ATOM 6543  C C    . LEU A 1 132 ? -22.684 7.483   -4.129  1.00 0.00 ? 132 LEU A C    3  
ATOM 6544  O O    . LEU A 1 132 ? -23.269 8.180   -4.958  1.00 0.00 ? 132 LEU A O    3  
ATOM 6545  C CB   . LEU A 1 132 ? -23.544 5.237   -3.422  1.00 0.00 ? 132 LEU A CB   3  
ATOM 6546  C CG   . LEU A 1 132 ? -23.689 3.722   -3.667  1.00 0.00 ? 132 LEU A CG   3  
ATOM 6547  C CD1  . LEU A 1 132 ? -24.613 3.090   -2.630  1.00 0.00 ? 132 LEU A CD1  3  
ATOM 6548  C CD2  . LEU A 1 132 ? -24.205 3.450   -5.079  1.00 0.00 ? 132 LEU A CD2  3  
ATOM 6549  H H    . LEU A 1 132 ? -20.645 6.042   -3.396  1.00 0.00 ? 132 LEU A H    3  
ATOM 6550  H HA   . LEU A 1 132 ? -22.768 5.740   -5.368  1.00 0.00 ? 132 LEU A HA   3  
ATOM 6551  H HB2  . LEU A 1 132 ? -23.232 5.385   -2.397  1.00 0.00 ? 132 LEU A HB2  3  
ATOM 6552  H HB3  . LEU A 1 132 ? -24.517 5.692   -3.549  1.00 0.00 ? 132 LEU A HB3  3  
ATOM 6553  H HG   . LEU A 1 132 ? -22.718 3.257   -3.571  1.00 0.00 ? 132 LEU A HG   3  
ATOM 6554  H HD11 . LEU A 1 132 ? -24.711 2.032   -2.830  1.00 0.00 ? 132 LEU A HD11 3  
ATOM 6555  H HD12 . LEU A 1 132 ? -25.587 3.556   -2.680  1.00 0.00 ? 132 LEU A HD12 3  
ATOM 6556  H HD13 . LEU A 1 132 ? -24.198 3.230   -1.643  1.00 0.00 ? 132 LEU A HD13 3  
ATOM 6557  H HD21 . LEU A 1 132 ? -25.167 3.923   -5.212  1.00 0.00 ? 132 LEU A HD21 3  
ATOM 6558  H HD22 . LEU A 1 132 ? -24.304 2.385   -5.226  1.00 0.00 ? 132 LEU A HD22 3  
ATOM 6559  H HD23 . LEU A 1 132 ? -23.506 3.847   -5.802  1.00 0.00 ? 132 LEU A HD23 3  
ATOM 6560  N N    . ALA A 1 133 ? -22.170 7.962   -2.991  1.00 0.00 ? 133 ALA A N    3  
ATOM 6561  C CA   . ALA A 1 133 ? -22.170 9.390   -2.647  1.00 0.00 ? 133 ALA A CA   3  
ATOM 6562  C C    . ALA A 1 133 ? -23.581 9.928   -2.379  1.00 0.00 ? 133 ALA A C    3  
ATOM 6563  O O    . ALA A 1 133 ? -23.759 11.128  -2.170  1.00 0.00 ? 133 ALA A O    3  
ATOM 6564  C CB   . ALA A 1 133 ? -21.483 10.214  -3.735  1.00 0.00 ? 133 ALA A CB   3  
ATOM 6565  H H    . ALA A 1 133 ? -21.771 7.331   -2.360  1.00 0.00 ? 133 ALA A H    3  
ATOM 6566  H HA   . ALA A 1 133 ? -21.590 9.499   -1.741  1.00 0.00 ? 133 ALA A HA   3  
ATOM 6567  H HB1  . ALA A 1 133 ? -21.413 11.245  -3.419  1.00 0.00 ? 133 ALA A HB1  3  
ATOM 6568  H HB2  . ALA A 1 133 ? -22.057 10.157  -4.649  1.00 0.00 ? 133 ALA A HB2  3  
ATOM 6569  H HB3  . ALA A 1 133 ? -20.491 9.824   -3.910  1.00 0.00 ? 133 ALA A HB3  3  
ATOM 6570  N N    . GLU A 1 134 ? -24.574 9.042   -2.376  1.00 0.00 ? 134 GLU A N    3  
ATOM 6571  C CA   . GLU A 1 134 ? -25.954 9.443   -2.112  1.00 0.00 ? 134 GLU A CA   3  
ATOM 6572  C C    . GLU A 1 134 ? -26.246 9.431   -0.610  1.00 0.00 ? 134 GLU A C    3  
ATOM 6573  O O    . GLU A 1 134 ? -26.483 10.480  -0.007  1.00 0.00 ? 134 GLU A O    3  
ATOM 6574  C CB   . GLU A 1 134 ? -26.940 8.531   -2.860  1.00 0.00 ? 134 GLU A CB   3  
ATOM 6575  C CG   . GLU A 1 134 ? -26.825 8.623   -4.379  1.00 0.00 ? 134 GLU A CG   3  
ATOM 6576  C CD   . GLU A 1 134 ? -27.947 7.893   -5.104  1.00 0.00 ? 134 GLU A CD   3  
ATOM 6577  O OE1  . GLU A 1 134 ? -29.012 8.514   -5.340  1.00 0.00 ? 134 GLU A OE1  3  
ATOM 6578  O OE2  . GLU A 1 134 ? -27.772 6.700   -5.442  1.00 0.00 ? 134 GLU A OE2  3  
ATOM 6579  H H    . GLU A 1 134 ? -24.377 8.105   -2.563  1.00 0.00 ? 134 GLU A H    3  
ATOM 6580  H HA   . GLU A 1 134 ? -26.076 10.455  -2.475  1.00 0.00 ? 134 GLU A HA   3  
ATOM 6581  H HB2  . GLU A 1 134 ? -26.760 7.506   -2.568  1.00 0.00 ? 134 GLU A HB2  3  
ATOM 6582  H HB3  . GLU A 1 134 ? -27.949 8.803   -2.579  1.00 0.00 ? 134 GLU A HB3  3  
ATOM 6583  H HG2  . GLU A 1 134 ? -26.852 9.665   -4.667  1.00 0.00 ? 134 GLU A HG2  3  
ATOM 6584  H HG3  . GLU A 1 134 ? -25.880 8.196   -4.684  1.00 0.00 ? 134 GLU A HG3  3  
ATOM 6585  N N    . ALA A 1 135 ? -26.207 8.247   -0.001  1.00 0.00 ? 135 ALA A N    3  
ATOM 6586  C CA   . ALA A 1 135 ? -26.540 8.108   1.418   1.00 0.00 ? 135 ALA A CA   3  
ATOM 6587  C C    . ALA A 1 135 ? -25.738 6.989   2.077   1.00 0.00 ? 135 ALA A C    3  
ATOM 6588  O O    . ALA A 1 135 ? -25.144 7.186   3.139   1.00 0.00 ? 135 ALA A O    3  
ATOM 6589  C CB   . ALA A 1 135 ? -28.033 7.856   1.583   1.00 0.00 ? 135 ALA A CB   3  
ATOM 6590  H H    . ALA A 1 135 ? -25.946 7.455   -0.510  1.00 0.00 ? 135 ALA A H    3  
ATOM 6591  H HA   . ALA A 1 135 ? -26.302 9.043   1.911   1.00 0.00 ? 135 ALA A HA   3  
ATOM 6592  H HB1  . ALA A 1 135 ? -28.295 6.918   1.115   1.00 0.00 ? 135 ALA A HB1  3  
ATOM 6593  H HB2  . ALA A 1 135 ? -28.589 8.658   1.116   1.00 0.00 ? 135 ALA A HB2  3  
ATOM 6594  H HB3  . ALA A 1 135 ? -28.280 7.815   2.634   1.00 0.00 ? 135 ALA A HB3  3  
ATOM 6595  N N    . GLU A 1 136 ? -25.733 5.814   1.445   1.00 0.00 ? 136 GLU A N    3  
ATOM 6596  C CA   . GLU A 1 136 ? -25.037 4.649   1.988   1.00 0.00 ? 136 GLU A CA   3  
ATOM 6597  C C    . GLU A 1 136 ? -23.577 4.984   2.303   1.00 0.00 ? 136 GLU A C    3  
ATOM 6598  O O    . GLU A 1 136 ? -22.915 5.698   1.544   1.00 0.00 ? 136 GLU A O    3  
ATOM 6599  C CB   . GLU A 1 136 ? -25.128 3.468   1.012   1.00 0.00 ? 136 GLU A CB   3  
ATOM 6600  C CG   . GLU A 1 136 ? -24.628 2.148   1.591   1.00 0.00 ? 136 GLU A CG   3  
ATOM 6601  C CD   . GLU A 1 136 ? -24.941 0.957   0.700   1.00 0.00 ? 136 GLU A CD   3  
ATOM 6602  O OE1  . GLU A 1 136 ? -26.122 0.544   0.649   1.00 0.00 ? 136 GLU A OE1  3  
ATOM 6603  O OE2  . GLU A 1 136 ? -24.018 0.429   0.050   1.00 0.00 ? 136 GLU A OE2  3  
ATOM 6604  H H    . GLU A 1 136 ? -26.223 5.725   0.604   1.00 0.00 ? 136 GLU A H    3  
ATOM 6605  H HA   . GLU A 1 136 ? -25.533 4.376   2.909   1.00 0.00 ? 136 GLU A HA   3  
ATOM 6606  H HB2  . GLU A 1 136 ? -26.162 3.339   0.720   1.00 0.00 ? 136 GLU A HB2  3  
ATOM 6607  H HB3  . GLU A 1 136 ? -24.543 3.696   0.131   1.00 0.00 ? 136 GLU A HB3  3  
ATOM 6608  H HG2  . GLU A 1 136 ? -23.556 2.211   1.726   1.00 0.00 ? 136 GLU A HG2  3  
ATOM 6609  H HG3  . GLU A 1 136 ? -25.098 1.992   2.553   1.00 0.00 ? 136 GLU A HG3  3  
ATOM 6610  N N    . SER A 1 1   ? -4.183  -13.306 -5.804  1.00 0.00 ? 1   SER A N    4  
ATOM 6611  C CA   . SER A 1 1   ? -5.306  -14.118 -5.295  1.00 0.00 ? 1   SER A CA   4  
ATOM 6612  C C    . SER A 1 1   ? -6.166  -14.621 -6.453  1.00 0.00 ? 1   SER A C    4  
ATOM 6613  O O    . SER A 1 1   ? -5.931  -14.264 -7.611  1.00 0.00 ? 1   SER A O    4  
ATOM 6614  C CB   . SER A 1 1   ? -6.137  -13.283 -4.315  1.00 0.00 ? 1   SER A CB   4  
ATOM 6615  O OG   . SER A 1 1   ? -6.489  -12.030 -4.879  1.00 0.00 ? 1   SER A OG   4  
ATOM 6616  H H1   . SER A 1 1   ? -3.615  -13.865 -6.471  1.00 0.00 ? 1   SER A H1   4  
ATOM 6617  H H2   . SER A 1 1   ? -3.578  -13.002 -5.019  1.00 0.00 ? 1   SER A H2   4  
ATOM 6618  H H3   . SER A 1 1   ? -4.546  -12.465 -6.294  1.00 0.00 ? 1   SER A H3   4  
ATOM 6619  H HA   . SER A 1 1   ? -4.895  -14.972 -4.774  1.00 0.00 ? 1   SER A HA   4  
ATOM 6620  H HB2  . SER A 1 1   ? -7.043  -13.815 -4.063  1.00 0.00 ? 1   SER A HB2  4  
ATOM 6621  H HB3  . SER A 1 1   ? -5.562  -13.109 -3.416  1.00 0.00 ? 1   SER A HB3  4  
ATOM 6622  H HG   . SER A 1 1   ? -6.950  -11.498 -4.218  1.00 0.00 ? 1   SER A HG   4  
ATOM 6623  N N    . MET A 1 2   ? -7.143  -15.471 -6.140  1.00 0.00 ? 2   MET A N    4  
ATOM 6624  C CA   . MET A 1 2   ? -8.049  -16.016 -7.149  1.00 0.00 ? 2   MET A CA   4  
ATOM 6625  C C    . MET A 1 2   ? -8.956  -14.923 -7.717  1.00 0.00 ? 2   MET A C    4  
ATOM 6626  O O    . MET A 1 2   ? -9.062  -13.832 -7.147  1.00 0.00 ? 2   MET A O    4  
ATOM 6627  C CB   . MET A 1 2   ? -8.895  -17.154 -6.552  1.00 0.00 ? 2   MET A CB   4  
ATOM 6628  C CG   . MET A 1 2   ? -9.807  -16.723 -5.405  1.00 0.00 ? 2   MET A CG   4  
ATOM 6629  S SD   . MET A 1 2   ? -10.711 -18.108 -4.677  1.00 0.00 ? 2   MET A SD   4  
ATOM 6630  C CE   . MET A 1 2   ? -11.649 -17.272 -3.398  1.00 0.00 ? 2   MET A CE   4  
ATOM 6631  H H    . MET A 1 2   ? -7.253  -15.746 -5.206  1.00 0.00 ? 2   MET A H    4  
ATOM 6632  H HA   . MET A 1 2   ? -7.446  -16.415 -7.951  1.00 0.00 ? 2   MET A HA   4  
ATOM 6633  H HB2  . MET A 1 2   ? -9.512  -17.577 -7.331  1.00 0.00 ? 2   MET A HB2  4  
ATOM 6634  H HB3  . MET A 1 2   ? -8.230  -17.921 -6.182  1.00 0.00 ? 2   MET A HB3  4  
ATOM 6635  H HG2  . MET A 1 2   ? -9.204  -16.264 -4.634  1.00 0.00 ? 2   MET A HG2  4  
ATOM 6636  H HG3  . MET A 1 2   ? -10.521 -16.002 -5.779  1.00 0.00 ? 2   MET A HG3  4  
ATOM 6637  H HE1  . MET A 1 2   ? -12.258 -17.990 -2.869  1.00 0.00 ? 2   MET A HE1  4  
ATOM 6638  H HE2  . MET A 1 2   ? -12.285 -16.522 -3.847  1.00 0.00 ? 2   MET A HE2  4  
ATOM 6639  H HE3  . MET A 1 2   ? -10.969 -16.796 -2.705  1.00 0.00 ? 2   MET A HE3  4  
ATOM 6640  N N    . THR A 1 3   ? -9.603  -15.224 -8.840  1.00 0.00 ? 3   THR A N    4  
ATOM 6641  C CA   . THR A 1 3   ? -10.474 -14.271 -9.512  1.00 0.00 ? 3   THR A CA   4  
ATOM 6642  C C    . THR A 1 3   ? -11.628 -13.851 -8.586  1.00 0.00 ? 3   THR A C    4  
ATOM 6643  O O    . THR A 1 3   ? -12.151 -14.676 -7.833  1.00 0.00 ? 3   THR A O    4  
ATOM 6644  C CB   . THR A 1 3   ? -11.024 -14.872 -10.829 1.00 0.00 ? 3   THR A CB   4  
ATOM 6645  O OG1  . THR A 1 3   ? -9.964  -15.541 -11.532 1.00 0.00 ? 3   THR A OG1  4  
ATOM 6646  C CG2  . THR A 1 3   ? -11.609 -13.793 -11.731 1.00 0.00 ? 3   THR A CG2  4  
ATOM 6647  H H    . THR A 1 3   ? -9.495  -16.120 -9.224  1.00 0.00 ? 3   THR A H    4  
ATOM 6648  H HA   . THR A 1 3   ? -9.884  -13.397 -9.757  1.00 0.00 ? 3   THR A HA   4  
ATOM 6649  H HB   . THR A 1 3   ? -11.800 -15.589 -10.591 1.00 0.00 ? 3   THR A HB   4  
ATOM 6650  H HG1  . THR A 1 3   ? -9.327  -14.885 -11.839 1.00 0.00 ? 3   THR A HG1  4  
ATOM 6651  H HG21 . THR A 1 3   ? -12.409 -13.284 -11.213 1.00 0.00 ? 3   THR A HG21 4  
ATOM 6652  H HG22 . THR A 1 3   ? -11.996 -14.245 -12.631 1.00 0.00 ? 3   THR A HG22 4  
ATOM 6653  H HG23 . THR A 1 3   ? -10.838 -13.081 -11.990 1.00 0.00 ? 3   THR A HG23 4  
ATOM 6654  N N    . GLU A 1 4   ? -12.014 -12.569 -8.673  1.00 0.00 ? 4   GLU A N    4  
ATOM 6655  C CA   . GLU A 1 4   ? -12.937 -11.917 -7.729  1.00 0.00 ? 4   GLU A CA   4  
ATOM 6656  C C    . GLU A 1 4   ? -12.812 -12.442 -6.304  1.00 0.00 ? 4   GLU A C    4  
ATOM 6657  O O    . GLU A 1 4   ? -13.529 -13.350 -5.871  1.00 0.00 ? 4   GLU A O    4  
ATOM 6658  C CB   . GLU A 1 4   ? -14.402 -11.925 -8.184  1.00 0.00 ? 4   GLU A CB   4  
ATOM 6659  C CG   . GLU A 1 4   ? -14.977 -13.277 -8.615  1.00 0.00 ? 4   GLU A CG   4  
ATOM 6660  C CD   . GLU A 1 4   ? -14.616 -13.662 -10.040 1.00 0.00 ? 4   GLU A CD   4  
ATOM 6661  O OE1  . GLU A 1 4   ? -14.635 -12.772 -10.922 1.00 0.00 ? 4   GLU A OE1  4  
ATOM 6662  O OE2  . GLU A 1 4   ? -14.334 -14.855 -10.289 1.00 0.00 ? 4   GLU A OE2  4  
ATOM 6663  H H    . GLU A 1 4   ? -11.666 -12.033 -9.416  1.00 0.00 ? 4   GLU A H    4  
ATOM 6664  H HA   . GLU A 1 4   ? -12.622 -10.881 -7.700  1.00 0.00 ? 4   GLU A HA   4  
ATOM 6665  H HB2  . GLU A 1 4   ? -15.013 -11.551 -7.374  1.00 0.00 ? 4   GLU A HB2  4  
ATOM 6666  H HB3  . GLU A 1 4   ? -14.483 -11.243 -9.008  1.00 0.00 ? 4   GLU A HB3  4  
ATOM 6667  H HG2  . GLU A 1 4   ? -14.600 -14.039 -7.946  1.00 0.00 ? 4   GLU A HG2  4  
ATOM 6668  H HG3  . GLU A 1 4   ? -16.055 -13.236 -8.532  1.00 0.00 ? 4   GLU A HG3  4  
ATOM 6669  N N    . GLU A 1 5   ? -11.893 -11.833 -5.588  1.00 0.00 ? 5   GLU A N    4  
ATOM 6670  C CA   . GLU A 1 5   ? -11.663 -12.139 -4.181  1.00 0.00 ? 5   GLU A CA   4  
ATOM 6671  C C    . GLU A 1 5   ? -12.607 -11.304 -3.320  1.00 0.00 ? 5   GLU A C    4  
ATOM 6672  O O    . GLU A 1 5   ? -13.388 -11.841 -2.530  1.00 0.00 ? 5   GLU A O    4  
ATOM 6673  C CB   . GLU A 1 5   ? -10.198 -11.870 -3.802  1.00 0.00 ? 5   GLU A CB   4  
ATOM 6674  C CG   . GLU A 1 5   ? -9.899  -12.053 -2.315  1.00 0.00 ? 5   GLU A CG   4  
ATOM 6675  C CD   . GLU A 1 5   ? -8.423  -11.898 -1.980  1.00 0.00 ? 5   GLU A CD   4  
ATOM 6676  O OE1  . GLU A 1 5   ? -7.786  -10.952 -2.488  1.00 0.00 ? 5   GLU A OE1  4  
ATOM 6677  O OE2  . GLU A 1 5   ? -7.899  -12.716 -1.192  1.00 0.00 ? 5   GLU A OE2  4  
ATOM 6678  H H    . GLU A 1 5   ? -11.360 -11.139 -6.025  1.00 0.00 ? 5   GLU A H    4  
ATOM 6679  H HA   . GLU A 1 5   ? -11.882 -13.187 -4.026  1.00 0.00 ? 5   GLU A HA   4  
ATOM 6680  H HB2  . GLU A 1 5   ? -9.566  -12.545 -4.361  1.00 0.00 ? 5   GLU A HB2  4  
ATOM 6681  H HB3  . GLU A 1 5   ? -9.948  -10.853 -4.074  1.00 0.00 ? 5   GLU A HB3  4  
ATOM 6682  H HG2  . GLU A 1 5   ? -10.456 -11.315 -1.755  1.00 0.00 ? 5   GLU A HG2  4  
ATOM 6683  H HG3  . GLU A 1 5   ? -10.221 -13.043 -2.017  1.00 0.00 ? 5   GLU A HG3  4  
ATOM 6684  N N    . GLN A 1 6   ? -12.542 -9.991  -3.501  1.00 0.00 ? 6   GLN A N    4  
ATOM 6685  C CA   . GLN A 1 6   ? -13.418 -9.059  -2.806  1.00 0.00 ? 6   GLN A CA   4  
ATOM 6686  C C    . GLN A 1 6   ? -13.397 -7.717  -3.549  1.00 0.00 ? 6   GLN A C    4  
ATOM 6687  O O    . GLN A 1 6   ? -12.334 -7.288  -4.001  1.00 0.00 ? 6   GLN A O    4  
ATOM 6688  C CB   . GLN A 1 6   ? -12.964 -8.896  -1.343  1.00 0.00 ? 6   GLN A CB   4  
ATOM 6689  C CG   . GLN A 1 6   ? -13.941 -8.114  -0.470  1.00 0.00 ? 6   GLN A CG   4  
ATOM 6690  C CD   . GLN A 1 6   ? -13.535 -8.068  0.996   1.00 0.00 ? 6   GLN A CD   4  
ATOM 6691  O OE1  . GLN A 1 6   ? -12.352 -8.119  1.334   1.00 0.00 ? 6   GLN A OE1  4  
ATOM 6692  N NE2  . GLN A 1 6   ? -14.518 -7.962  1.879   1.00 0.00 ? 6   GLN A NE2  4  
ATOM 6693  H H    . GLN A 1 6   ? -11.876 -9.631  -4.122  1.00 0.00 ? 6   GLN A H    4  
ATOM 6694  H HA   . GLN A 1 6   ? -14.423 -9.462  -2.828  1.00 0.00 ? 6   GLN A HA   4  
ATOM 6695  H HB2  . GLN A 1 6   ? -12.836 -9.878  -0.909  1.00 0.00 ? 6   GLN A HB2  4  
ATOM 6696  H HB3  . GLN A 1 6   ? -12.011 -8.383  -1.330  1.00 0.00 ? 6   GLN A HB3  4  
ATOM 6697  H HG2  . GLN A 1 6   ? -13.999 -7.100  -0.840  1.00 0.00 ? 6   GLN A HG2  4  
ATOM 6698  H HG3  . GLN A 1 6   ? -14.916 -8.575  -0.544  1.00 0.00 ? 6   GLN A HG3  4  
ATOM 6699  H HE21 . GLN A 1 6   ? -15.441 -7.920  1.543   1.00 0.00 ? 6   GLN A HE21 4  
ATOM 6700  H HE22 . GLN A 1 6   ? -14.285 -7.926  2.828   1.00 0.00 ? 6   GLN A HE22 4  
ATOM 6701  N N    . PRO A 1 7   ? -14.572 -7.062  -3.722  1.00 0.00 ? 7   PRO A N    4  
ATOM 6702  C CA   . PRO A 1 7   ? -14.696 -5.796  -4.475  1.00 0.00 ? 7   PRO A CA   4  
ATOM 6703  C C    . PRO A 1 7   ? -13.687 -4.720  -4.044  1.00 0.00 ? 7   PRO A C    4  
ATOM 6704  O O    . PRO A 1 7   ? -13.050 -4.826  -2.995  1.00 0.00 ? 7   PRO A O    4  
ATOM 6705  C CB   . PRO A 1 7   ? -16.143 -5.333  -4.187  1.00 0.00 ? 7   PRO A CB   4  
ATOM 6706  C CG   . PRO A 1 7   ? -16.639 -6.216  -3.086  1.00 0.00 ? 7   PRO A CG   4  
ATOM 6707  C CD   . PRO A 1 7   ? -15.882 -7.506  -3.216  1.00 0.00 ? 7   PRO A CD   4  
ATOM 6708  H HA   . PRO A 1 7   ? -14.583 -5.970  -5.537  1.00 0.00 ? 7   PRO A HA   4  
ATOM 6709  H HB2  . PRO A 1 7   ? -16.144 -4.294  -3.887  1.00 0.00 ? 7   PRO A HB2  4  
ATOM 6710  H HB3  . PRO A 1 7   ? -16.743 -5.447  -5.080  1.00 0.00 ? 7   PRO A HB3  4  
ATOM 6711  H HG2  . PRO A 1 7   ? -16.438 -5.756  -2.128  1.00 0.00 ? 7   PRO A HG2  4  
ATOM 6712  H HG3  . PRO A 1 7   ? -17.700 -6.389  -3.202  1.00 0.00 ? 7   PRO A HG3  4  
ATOM 6713  H HD2  . PRO A 1 7   ? -15.785 -7.989  -2.254  1.00 0.00 ? 7   PRO A HD2  4  
ATOM 6714  H HD3  . PRO A 1 7   ? -16.365 -8.164  -3.925  1.00 0.00 ? 7   PRO A HD3  4  
ATOM 6715  N N    . VAL A 1 8   ? -13.566 -3.670  -4.858  1.00 0.00 ? 8   VAL A N    4  
ATOM 6716  C CA   . VAL A 1 8   ? -12.586 -2.605  -4.623  1.00 0.00 ? 8   VAL A CA   4  
ATOM 6717  C C    . VAL A 1 8   ? -12.843 -1.872  -3.303  1.00 0.00 ? 8   VAL A C    4  
ATOM 6718  O O    . VAL A 1 8   ? -11.961 -1.189  -2.789  1.00 0.00 ? 8   VAL A O    4  
ATOM 6719  C CB   . VAL A 1 8   ? -12.565 -1.575  -5.783  1.00 0.00 ? 8   VAL A CB   4  
ATOM 6720  C CG1  . VAL A 1 8   ? -12.185 -2.249  -7.101  1.00 0.00 ? 8   VAL A CG1  4  
ATOM 6721  C CG2  . VAL A 1 8   ? -13.907 -0.855  -5.908  1.00 0.00 ? 8   VAL A CG2  4  
ATOM 6722  H H    . VAL A 1 8   ? -14.150 -3.613  -5.646  1.00 0.00 ? 8   VAL A H    4  
ATOM 6723  H HA   . VAL A 1 8   ? -11.610 -3.068  -4.570  1.00 0.00 ? 8   VAL A HA   4  
ATOM 6724  H HB   . VAL A 1 8   ? -11.807 -0.836  -5.559  1.00 0.00 ? 8   VAL A HB   4  
ATOM 6725  H HG11 . VAL A 1 8   ? -11.209 -2.704  -7.007  1.00 0.00 ? 8   VAL A HG11 4  
ATOM 6726  H HG12 . VAL A 1 8   ? -12.160 -1.510  -7.890  1.00 0.00 ? 8   VAL A HG12 4  
ATOM 6727  H HG13 . VAL A 1 8   ? -12.915 -3.009  -7.344  1.00 0.00 ? 8   VAL A HG13 4  
ATOM 6728  H HG21 . VAL A 1 8   ? -13.864 -0.154  -6.730  1.00 0.00 ? 8   VAL A HG21 4  
ATOM 6729  H HG22 . VAL A 1 8   ? -14.118 -0.320  -4.992  1.00 0.00 ? 8   VAL A HG22 4  
ATOM 6730  H HG23 . VAL A 1 8   ? -14.690 -1.578  -6.091  1.00 0.00 ? 8   VAL A HG23 4  
ATOM 6731  N N    . ALA A 1 9   ? -14.043 -2.032  -2.750  1.00 0.00 ? 9   ALA A N    4  
ATOM 6732  C CA   . ALA A 1 9   ? -14.392 -1.410  -1.472  1.00 0.00 ? 9   ALA A CA   4  
ATOM 6733  C C    . ALA A 1 9   ? -13.447 -1.883  -0.360  1.00 0.00 ? 9   ALA A C    4  
ATOM 6734  O O    . ALA A 1 9   ? -13.340 -1.251  0.694   1.00 0.00 ? 9   ALA A O    4  
ATOM 6735  C CB   . ALA A 1 9   ? -15.843 -1.713  -1.113  1.00 0.00 ? 9   ALA A CB   4  
ATOM 6736  H H    . ALA A 1 9   ? -14.707 -2.585  -3.207  1.00 0.00 ? 9   ALA A H    4  
ATOM 6737  H HA   . ALA A 1 9   ? -14.290 -0.338  -1.586  1.00 0.00 ? 9   ALA A HA   4  
ATOM 6738  H HB1  . ALA A 1 9   ? -16.104 -1.204  -0.196  1.00 0.00 ? 9   ALA A HB1  4  
ATOM 6739  H HB2  . ALA A 1 9   ? -15.969 -2.778  -0.982  1.00 0.00 ? 9   ALA A HB2  4  
ATOM 6740  H HB3  . ALA A 1 9   ? -16.490 -1.372  -1.910  1.00 0.00 ? 9   ALA A HB3  4  
ATOM 6741  N N    . SER A 1 10  ? -12.755 -2.994  -0.620  1.00 0.00 ? 10  SER A N    4  
ATOM 6742  C CA   . SER A 1 10  ? -11.787 -3.561  0.314   1.00 0.00 ? 10  SER A CA   4  
ATOM 6743  C C    . SER A 1 10  ? -10.714 -2.541  0.706   1.00 0.00 ? 10  SER A C    4  
ATOM 6744  O O    . SER A 1 10  ? -10.078 -2.681  1.755   1.00 0.00 ? 10  SER A O    4  
ATOM 6745  C CB   . SER A 1 10  ? -11.139 -4.801  -0.306  1.00 0.00 ? 10  SER A CB   4  
ATOM 6746  O OG   . SER A 1 10  ? -12.126 -5.740  -0.692  1.00 0.00 ? 10  SER A OG   4  
ATOM 6747  H H    . SER A 1 10  ? -12.916 -3.461  -1.468  1.00 0.00 ? 10  SER A H    4  
ATOM 6748  H HA   . SER A 1 10  ? -12.324 -3.857  1.204   1.00 0.00 ? 10  SER A HA   4  
ATOM 6749  H HB2  . SER A 1 10  ? -10.569 -4.514  -1.180  1.00 0.00 ? 10  SER A HB2  4  
ATOM 6750  H HB3  . SER A 1 10  ? -10.482 -5.265  0.418   1.00 0.00 ? 10  SER A HB3  4  
ATOM 6751  H HG   . SER A 1 10  ? -12.169 -5.785  -1.654  1.00 0.00 ? 10  SER A HG   4  
ATOM 6752  N N    . TRP A 1 11  ? -10.522 -1.516  -0.130  1.00 0.00 ? 11  TRP A N    4  
ATOM 6753  C CA   . TRP A 1 11  ? -9.570  -0.450  0.177   1.00 0.00 ? 11  TRP A CA   4  
ATOM 6754  C C    . TRP A 1 11  ? -9.881  0.145   1.546   1.00 0.00 ? 11  TRP A C    4  
ATOM 6755  O O    . TRP A 1 11  ? -8.989  0.377   2.354   1.00 0.00 ? 11  TRP A O    4  
ATOM 6756  C CB   . TRP A 1 11  ? -9.631  0.678   -0.859  1.00 0.00 ? 11  TRP A CB   4  
ATOM 6757  C CG   . TRP A 1 11  ? -9.396  0.275   -2.287  1.00 0.00 ? 11  TRP A CG   4  
ATOM 6758  C CD1  . TRP A 1 11  ? -8.737  -0.824  -2.765  1.00 0.00 ? 11  TRP A CD1  4  
ATOM 6759  C CD2  . TRP A 1 11  ? -9.815  1.020   -3.427  1.00 0.00 ? 11  TRP A CD2  4  
ATOM 6760  N NE1  . TRP A 1 11  ? -8.739  -0.806  -4.144  1.00 0.00 ? 11  TRP A NE1  4  
ATOM 6761  C CE2  . TRP A 1 11  ? -9.398  0.322   -4.570  1.00 0.00 ? 11  TRP A CE2  4  
ATOM 6762  C CE3  . TRP A 1 11  ? -10.516 2.214   -3.580  1.00 0.00 ? 11  TRP A CE3  4  
ATOM 6763  C CZ2  . TRP A 1 11  ? -9.660  0.789   -5.859  1.00 0.00 ? 11  TRP A CZ2  4  
ATOM 6764  C CZ3  . TRP A 1 11  ? -10.776 2.681   -4.846  1.00 0.00 ? 11  TRP A CZ3  4  
ATOM 6765  C CH2  . TRP A 1 11  ? -10.351 1.968   -5.978  1.00 0.00 ? 11  TRP A CH2  4  
ATOM 6766  H H    . TRP A 1 11  ? -11.032 -1.476  -0.968  1.00 0.00 ? 11  TRP A H    4  
ATOM 6767  H HA   . TRP A 1 11  ? -8.576  -0.874  0.189   1.00 0.00 ? 11  TRP A HA   4  
ATOM 6768  H HB2  . TRP A 1 11  ? -10.608 1.137   -0.813  1.00 0.00 ? 11  TRP A HB2  4  
ATOM 6769  H HB3  . TRP A 1 11  ? -8.889  1.423   -0.603  1.00 0.00 ? 11  TRP A HB3  4  
ATOM 6770  H HD1  . TRP A 1 11  ? -8.292  -1.589  -2.145  1.00 0.00 ? 11  TRP A HD1  4  
ATOM 6771  H HE1  . TRP A 1 11  ? -8.334  -1.487  -4.726  1.00 0.00 ? 11  TRP A HE1  4  
ATOM 6772  H HE3  . TRP A 1 11  ? -10.850 2.774   -2.721  1.00 0.00 ? 11  TRP A HE3  4  
ATOM 6773  H HZ2  . TRP A 1 11  ? -9.339  0.250   -6.738  1.00 0.00 ? 11  TRP A HZ2  4  
ATOM 6774  H HZ3  . TRP A 1 11  ? -11.318 3.610   -4.968  1.00 0.00 ? 11  TRP A HZ3  4  
ATOM 6775  H HH2  . TRP A 1 11  ? -10.576 2.368   -6.956  1.00 0.00 ? 11  TRP A HH2  4  
ATOM 6776  N N    . ALA A 1 12  ? -11.171 0.363   1.796   1.00 0.00 ? 12  ALA A N    4  
ATOM 6777  C CA   . ALA A 1 12  ? -11.629 1.031   3.014   1.00 0.00 ? 12  ALA A CA   4  
ATOM 6778  C C    . ALA A 1 12  ? -11.727 0.053   4.180   1.00 0.00 ? 12  ALA A C    4  
ATOM 6779  O O    . ALA A 1 12  ? -12.156 0.421   5.276   1.00 0.00 ? 12  ALA A O    4  
ATOM 6780  C CB   . ALA A 1 12  ? -12.975 1.703   2.766   1.00 0.00 ? 12  ALA A CB   4  
ATOM 6781  H H    . ALA A 1 12  ? -11.839 0.049   1.148   1.00 0.00 ? 12  ALA A H    4  
ATOM 6782  H HA   . ALA A 1 12  ? -10.911 1.800   3.263   1.00 0.00 ? 12  ALA A HA   4  
ATOM 6783  H HB1  . ALA A 1 12  ? -12.885 2.399   1.944   1.00 0.00 ? 12  ALA A HB1  4  
ATOM 6784  H HB2  . ALA A 1 12  ? -13.283 2.236   3.654   1.00 0.00 ? 12  ALA A HB2  4  
ATOM 6785  H HB3  . ALA A 1 12  ? -13.714 0.954   2.522   1.00 0.00 ? 12  ALA A HB3  4  
ATOM 6786  N N    . LEU A 1 13  ? -11.339 -1.195  3.939   1.00 0.00 ? 13  LEU A N    4  
ATOM 6787  C CA   . LEU A 1 13  ? -11.353 -2.220  4.976   1.00 0.00 ? 13  LEU A CA   4  
ATOM 6788  C C    . LEU A 1 13  ? -9.950  -2.423  5.542   1.00 0.00 ? 13  LEU A C    4  
ATOM 6789  O O    . LEU A 1 13  ? -9.787  -2.739  6.722   1.00 0.00 ? 13  LEU A O    4  
ATOM 6790  C CB   . LEU A 1 13  ? -11.893 -3.546  4.418   1.00 0.00 ? 13  LEU A CB   4  
ATOM 6791  C CG   . LEU A 1 13  ? -13.334 -3.499  3.878   1.00 0.00 ? 13  LEU A CG   4  
ATOM 6792  C CD1  . LEU A 1 13  ? -13.758 -4.868  3.347   1.00 0.00 ? 13  LEU A CD1  4  
ATOM 6793  C CD2  . LEU A 1 13  ? -14.304 -3.011  4.956   1.00 0.00 ? 13  LEU A CD2  4  
ATOM 6794  H H    . LEU A 1 13  ? -11.032 -1.432  3.039   1.00 0.00 ? 13  LEU A H    4  
ATOM 6795  H HA   . LEU A 1 13  ? -12.002 -1.883  5.772   1.00 0.00 ? 13  LEU A HA   4  
ATOM 6796  H HB2  . LEU A 1 13  ? -11.241 -3.865  3.616   1.00 0.00 ? 13  LEU A HB2  4  
ATOM 6797  H HB3  . LEU A 1 13  ? -11.852 -4.286  5.206   1.00 0.00 ? 13  LEU A HB3  4  
ATOM 6798  H HG   . LEU A 1 13  ? -13.375 -2.800  3.054   1.00 0.00 ? 13  LEU A HG   4  
ATOM 6799  H HD11 . LEU A 1 13  ? -14.762 -4.806  2.952   1.00 0.00 ? 13  LEU A HD11 4  
ATOM 6800  H HD12 . LEU A 1 13  ? -13.732 -5.594  4.148   1.00 0.00 ? 13  LEU A HD12 4  
ATOM 6801  H HD13 . LEU A 1 13  ? -13.082 -5.175  2.563   1.00 0.00 ? 13  LEU A HD13 4  
ATOM 6802  H HD21 . LEU A 1 13  ? -14.029 -2.012  5.263   1.00 0.00 ? 13  LEU A HD21 4  
ATOM 6803  H HD22 . LEU A 1 13  ? -14.262 -3.672  5.810   1.00 0.00 ? 13  LEU A HD22 4  
ATOM 6804  H HD23 . LEU A 1 13  ? -15.309 -3.000  4.560   1.00 0.00 ? 13  LEU A HD23 4  
ATOM 6805  N N    . SER A 1 14  ? -8.937  -2.238  4.697   1.00 0.00 ? 14  SER A N    4  
ATOM 6806  C CA   . SER A 1 14  ? -7.551  -2.468  5.091   1.00 0.00 ? 14  SER A CA   4  
ATOM 6807  C C    . SER A 1 14  ? -6.600  -1.658  4.201   1.00 0.00 ? 14  SER A C    4  
ATOM 6808  O O    . SER A 1 14  ? -6.755  -1.632  2.976   1.00 0.00 ? 14  SER A O    4  
ATOM 6809  C CB   . SER A 1 14  ? -7.229  -3.964  4.994   1.00 0.00 ? 14  SER A CB   4  
ATOM 6810  O OG   . SER A 1 14  ? -8.155  -4.748  5.737   1.00 0.00 ? 14  SER A OG   4  
ATOM 6811  H H    . SER A 1 14  ? -9.124  -1.932  3.783   1.00 0.00 ? 14  SER A H    4  
ATOM 6812  H HA   . SER A 1 14  ? -7.433  -2.144  6.115   1.00 0.00 ? 14  SER A HA   4  
ATOM 6813  H HB2  . SER A 1 14  ? -7.266  -4.272  3.960   1.00 0.00 ? 14  SER A HB2  4  
ATOM 6814  H HB3  . SER A 1 14  ? -6.236  -4.142  5.385   1.00 0.00 ? 14  SER A HB3  4  
ATOM 6815  H HG   . SER A 1 14  ? -8.501  -4.222  6.467   1.00 0.00 ? 14  SER A HG   4  
ATOM 6816  N N    . PHE A 1 15  ? -5.607  -1.016  4.819   1.00 0.00 ? 15  PHE A N    4  
ATOM 6817  C CA   . PHE A 1 15  ? -4.705  -0.114  4.103   1.00 0.00 ? 15  PHE A CA   4  
ATOM 6818  C C    . PHE A 1 15  ? -3.734  -0.880  3.204   1.00 0.00 ? 15  PHE A C    4  
ATOM 6819  O O    . PHE A 1 15  ? -3.595  -0.550  2.029   1.00 0.00 ? 15  PHE A O    4  
ATOM 6820  C CB   . PHE A 1 15  ? -3.929  0.774   5.087   1.00 0.00 ? 15  PHE A CB   4  
ATOM 6821  C CG   . PHE A 1 15  ? -2.947  1.710   4.418   1.00 0.00 ? 15  PHE A CG   4  
ATOM 6822  C CD1  . PHE A 1 15  ? -3.348  2.528   3.370   1.00 0.00 ? 15  PHE A CD1  4  
ATOM 6823  C CD2  . PHE A 1 15  ? -1.623  1.766   4.831   1.00 0.00 ? 15  PHE A CD2  4  
ATOM 6824  C CE1  . PHE A 1 15  ? -2.454  3.380   2.753   1.00 0.00 ? 15  PHE A CE1  4  
ATOM 6825  C CE2  . PHE A 1 15  ? -0.724  2.617   4.215   1.00 0.00 ? 15  PHE A CE2  4  
ATOM 6826  C CZ   . PHE A 1 15  ? -1.142  3.424   3.175   1.00 0.00 ? 15  PHE A CZ   4  
ATOM 6827  H H    . PHE A 1 15  ? -5.473  -1.158  5.779   1.00 0.00 ? 15  PHE A H    4  
ATOM 6828  H HA   . PHE A 1 15  ? -5.317  0.522   3.477   1.00 0.00 ? 15  PHE A HA   4  
ATOM 6829  H HB2  . PHE A 1 15  ? -4.630  1.377   5.648   1.00 0.00 ? 15  PHE A HB2  4  
ATOM 6830  H HB3  . PHE A 1 15  ? -3.378  0.144   5.773   1.00 0.00 ? 15  PHE A HB3  4  
ATOM 6831  H HD1  . PHE A 1 15  ? -4.375  2.496   3.036   1.00 0.00 ? 15  PHE A HD1  4  
ATOM 6832  H HD2  . PHE A 1 15  ? -1.294  1.136   5.644   1.00 0.00 ? 15  PHE A HD2  4  
ATOM 6833  H HE1  . PHE A 1 15  ? -2.781  4.012   1.939   1.00 0.00 ? 15  PHE A HE1  4  
ATOM 6834  H HE2  . PHE A 1 15  ? 0.304   2.649   4.547   1.00 0.00 ? 15  PHE A HE2  4  
ATOM 6835  H HZ   . PHE A 1 15  ? -0.441  4.091   2.693   1.00 0.00 ? 15  PHE A HZ   4  
ATOM 6836  N N    . GLU A 1 16  ? -3.061  -1.891  3.752   1.00 0.00 ? 16  GLU A N    4  
ATOM 6837  C CA   . GLU A 1 16  ? -2.089  -2.670  2.985   1.00 0.00 ? 16  GLU A CA   4  
ATOM 6838  C C    . GLU A 1 16  ? -2.752  -3.289  1.751   1.00 0.00 ? 16  GLU A C    4  
ATOM 6839  O O    . GLU A 1 16  ? -2.121  -3.445  0.708   1.00 0.00 ? 16  GLU A O    4  
ATOM 6840  C CB   . GLU A 1 16  ? -1.419  -3.750  3.861   1.00 0.00 ? 16  GLU A CB   4  
ATOM 6841  C CG   . GLU A 1 16  ? -2.255  -5.002  4.134   1.00 0.00 ? 16  GLU A CG   4  
ATOM 6842  C CD   . GLU A 1 16  ? -3.621  -4.707  4.733   1.00 0.00 ? 16  GLU A CD   4  
ATOM 6843  O OE1  . GLU A 1 16  ? -3.695  -4.018  5.773   1.00 0.00 ? 16  GLU A OE1  4  
ATOM 6844  O OE2  . GLU A 1 16  ? -4.628  -5.168  4.162   1.00 0.00 ? 16  GLU A OE2  4  
ATOM 6845  H H    . GLU A 1 16  ? -3.206  -2.107  4.691   1.00 0.00 ? 16  GLU A H    4  
ATOM 6846  H HA   . GLU A 1 16  ? -1.325  -1.980  2.652   1.00 0.00 ? 16  GLU A HA   4  
ATOM 6847  H HB2  . GLU A 1 16  ? -0.505  -4.065  3.378   1.00 0.00 ? 16  GLU A HB2  4  
ATOM 6848  H HB3  . GLU A 1 16  ? -1.164  -3.306  4.814   1.00 0.00 ? 16  GLU A HB3  4  
ATOM 6849  H HG2  . GLU A 1 16  ? -2.395  -5.530  3.202   1.00 0.00 ? 16  GLU A HG2  4  
ATOM 6850  H HG3  . GLU A 1 16  ? -1.711  -5.635  4.820   1.00 0.00 ? 16  GLU A HG3  4  
ATOM 6851  N N    . ARG A 1 17  ? -4.038  -3.613  1.879   1.00 0.00 ? 17  ARG A N    4  
ATOM 6852  C CA   . ARG A 1 17  ? -4.819  -4.148  0.769   1.00 0.00 ? 17  ARG A CA   4  
ATOM 6853  C C    . ARG A 1 17  ? -4.940  -3.088  -0.326  1.00 0.00 ? 17  ARG A C    4  
ATOM 6854  O O    . ARG A 1 17  ? -4.677  -3.356  -1.498  1.00 0.00 ? 17  ARG A O    4  
ATOM 6855  C CB   . ARG A 1 17  ? -6.210  -4.578  1.263   1.00 0.00 ? 17  ARG A CB   4  
ATOM 6856  C CG   . ARG A 1 17  ? -6.989  -5.446  0.276   1.00 0.00 ? 17  ARG A CG   4  
ATOM 6857  C CD   . ARG A 1 17  ? -6.263  -6.756  -0.024  1.00 0.00 ? 17  ARG A CD   4  
ATOM 6858  N NE   . ARG A 1 17  ? -5.934  -7.504  1.197   1.00 0.00 ? 17  ARG A NE   4  
ATOM 6859  C CZ   . ARG A 1 17  ? -5.339  -8.702  1.210   1.00 0.00 ? 17  ARG A CZ   4  
ATOM 6860  N NH1  . ARG A 1 17  ? -5.059  -9.327  0.072   1.00 0.00 ? 17  ARG A NH1  4  
ATOM 6861  N NH2  . ARG A 1 17  ? -5.036  -9.280  2.366   1.00 0.00 ? 17  ARG A NH2  4  
ATOM 6862  H H    . ARG A 1 17  ? -4.473  -3.497  2.752   1.00 0.00 ? 17  ARG A H    4  
ATOM 6863  H HA   . ARG A 1 17  ? -4.298  -5.009  0.374   1.00 0.00 ? 17  ARG A HA   4  
ATOM 6864  H HB2  . ARG A 1 17  ? -6.095  -5.136  2.182   1.00 0.00 ? 17  ARG A HB2  4  
ATOM 6865  H HB3  . ARG A 1 17  ? -6.796  -3.693  1.469   1.00 0.00 ? 17  ARG A HB3  4  
ATOM 6866  H HG2  . ARG A 1 17  ? -7.958  -5.673  0.699   1.00 0.00 ? 17  ARG A HG2  4  
ATOM 6867  H HG3  . ARG A 1 17  ? -7.119  -4.898  -0.647  1.00 0.00 ? 17  ARG A HG3  4  
ATOM 6868  H HD2  . ARG A 1 17  ? -6.897  -7.369  -0.650  1.00 0.00 ? 17  ARG A HD2  4  
ATOM 6869  H HD3  . ARG A 1 17  ? -5.347  -6.534  -0.556  1.00 0.00 ? 17  ARG A HD3  4  
ATOM 6870  H HE   . ARG A 1 17  ? -6.155  -7.079  2.057   1.00 0.00 ? 17  ARG A HE   4  
ATOM 6871  H HH11 . ARG A 1 17  ? -5.298  -8.906  -0.811  1.00 0.00 ? 17  ARG A HH11 4  
ATOM 6872  H HH12 . ARG A 1 17  ? -4.602  -10.218 0.087   1.00 0.00 ? 17  ARG A HH12 4  
ATOM 6873  H HH21 . ARG A 1 17  ? -5.252  -8.821  3.234   1.00 0.00 ? 17  ARG A HH21 4  
ATOM 6874  H HH22 . ARG A 1 17  ? -4.588  -10.176 2.379   1.00 0.00 ? 17  ARG A HH22 4  
ATOM 6875  N N    . LEU A 1 18  ? -5.319  -1.877  0.083   1.00 0.00 ? 18  LEU A N    4  
ATOM 6876  C CA   . LEU A 1 18  ? -5.376  -0.720  -0.817  1.00 0.00 ? 18  LEU A CA   4  
ATOM 6877  C C    . LEU A 1 18  ? -4.011  -0.472  -1.454  1.00 0.00 ? 18  LEU A C    4  
ATOM 6878  O O    . LEU A 1 18  ? -3.895  -0.266  -2.662  1.00 0.00 ? 18  LEU A O    4  
ATOM 6879  C CB   . LEU A 1 18  ? -5.806  0.533   -0.028  1.00 0.00 ? 18  LEU A CB   4  
ATOM 6880  C CG   . LEU A 1 18  ? -5.539  1.888   -0.719  1.00 0.00 ? 18  LEU A CG   4  
ATOM 6881  C CD1  . LEU A 1 18  ? -6.433  2.075   -1.938  1.00 0.00 ? 18  LEU A CD1  4  
ATOM 6882  C CD2  . LEU A 1 18  ? -5.712  3.043   0.263   1.00 0.00 ? 18  LEU A CD2  4  
ATOM 6883  H H    . LEU A 1 18  ? -5.565  -1.753  1.027   1.00 0.00 ? 18  LEU A H    4  
ATOM 6884  H HA   . LEU A 1 18  ? -6.102  -0.925  -1.590  1.00 0.00 ? 18  LEU A HA   4  
ATOM 6885  H HB2  . LEU A 1 18  ? -6.866  0.459   0.173   1.00 0.00 ? 18  LEU A HB2  4  
ATOM 6886  H HB3  . LEU A 1 18  ? -5.281  0.531   0.917   1.00 0.00 ? 18  LEU A HB3  4  
ATOM 6887  H HG   . LEU A 1 18  ? -4.514  1.906   -1.065  1.00 0.00 ? 18  LEU A HG   4  
ATOM 6888  H HD11 . LEU A 1 18  ? -6.195  3.014   -2.418  1.00 0.00 ? 18  LEU A HD11 4  
ATOM 6889  H HD12 . LEU A 1 18  ? -7.469  2.083   -1.630  1.00 0.00 ? 18  LEU A HD12 4  
ATOM 6890  H HD13 . LEU A 1 18  ? -6.270  1.265   -2.634  1.00 0.00 ? 18  LEU A HD13 4  
ATOM 6891  H HD21 . LEU A 1 18  ? -5.527  3.979   -0.246  1.00 0.00 ? 18  LEU A HD21 4  
ATOM 6892  H HD22 . LEU A 1 18  ? -5.010  2.933   1.076   1.00 0.00 ? 18  LEU A HD22 4  
ATOM 6893  H HD23 . LEU A 1 18  ? -6.720  3.039   0.655   1.00 0.00 ? 18  LEU A HD23 4  
ATOM 6894  N N    . LEU A 1 19  ? -2.989  -0.518  -0.617  1.00 0.00 ? 19  LEU A N    4  
ATOM 6895  C CA   . LEU A 1 19  ? -1.641  -0.123  -0.993  1.00 0.00 ? 19  LEU A CA   4  
ATOM 6896  C C    . LEU A 1 19  ? -0.949  -1.206  -1.824  1.00 0.00 ? 19  LEU A C    4  
ATOM 6897  O O    . LEU A 1 19  ? 0.062   -0.952  -2.475  1.00 0.00 ? 19  LEU A O    4  
ATOM 6898  C CB   . LEU A 1 19  ? -0.843  0.185   0.281   1.00 0.00 ? 19  LEU A CB   4  
ATOM 6899  C CG   . LEU A 1 19  ? 0.493   0.903   0.070   1.00 0.00 ? 19  LEU A CG   4  
ATOM 6900  C CD1  . LEU A 1 19  ? 0.296   2.190   -0.733  1.00 0.00 ? 19  LEU A CD1  4  
ATOM 6901  C CD2  . LEU A 1 19  ? 1.159   1.205   1.405   1.00 0.00 ? 19  LEU A CD2  4  
ATOM 6902  H H    . LEU A 1 19  ? -3.150  -0.830  0.296   1.00 0.00 ? 19  LEU A H    4  
ATOM 6903  H HA   . LEU A 1 19  ? -1.711  0.778   -1.587  1.00 0.00 ? 19  LEU A HA   4  
ATOM 6904  H HB2  . LEU A 1 19  ? -1.459  0.797   0.921   1.00 0.00 ? 19  LEU A HB2  4  
ATOM 6905  H HB3  . LEU A 1 19  ? -0.646  -0.748  0.791   1.00 0.00 ? 19  LEU A HB3  4  
ATOM 6906  H HG   . LEU A 1 19  ? 1.149   0.255   -0.487  1.00 0.00 ? 19  LEU A HG   4  
ATOM 6907  H HD11 . LEU A 1 19  ? -0.402  2.836   -0.216  1.00 0.00 ? 19  LEU A HD11 4  
ATOM 6908  H HD12 . LEU A 1 19  ? -0.094  1.949   -1.710  1.00 0.00 ? 19  LEU A HD12 4  
ATOM 6909  H HD13 . LEU A 1 19  ? 1.244   2.697   -0.840  1.00 0.00 ? 19  LEU A HD13 4  
ATOM 6910  H HD21 . LEU A 1 19  ? 0.509   1.828   2.003   1.00 0.00 ? 19  LEU A HD21 4  
ATOM 6911  H HD22 . LEU A 1 19  ? 2.094   1.718   1.237   1.00 0.00 ? 19  LEU A HD22 4  
ATOM 6912  H HD23 . LEU A 1 19  ? 1.348   0.279   1.928   1.00 0.00 ? 19  LEU A HD23 4  
ATOM 6913  N N    . GLN A 1 20  ? -1.493  -2.415  -1.791  1.00 0.00 ? 20  GLN A N    4  
ATOM 6914  C CA   . GLN A 1 20  ? -0.951  -3.522  -2.583  1.00 0.00 ? 20  GLN A CA   4  
ATOM 6915  C C    . GLN A 1 20  ? -1.760  -3.711  -3.870  1.00 0.00 ? 20  GLN A C    4  
ATOM 6916  O O    . GLN A 1 20  ? -1.244  -4.221  -4.867  1.00 0.00 ? 20  GLN A O    4  
ATOM 6917  C CB   . GLN A 1 20  ? -0.944  -4.820  -1.759  1.00 0.00 ? 20  GLN A CB   4  
ATOM 6918  C CG   . GLN A 1 20  ? -0.284  -6.011  -2.462  1.00 0.00 ? 20  GLN A CG   4  
ATOM 6919  C CD   . GLN A 1 20  ? 1.246   -6.019  -2.399  1.00 0.00 ? 20  GLN A CD   4  
ATOM 6920  O OE1  . GLN A 1 20  ? 1.856   -7.091  -2.401  1.00 0.00 ? 20  GLN A OE1  4  
ATOM 6921  N NE2  . GLN A 1 20  ? 1.878   -4.851  -2.351  1.00 0.00 ? 20  GLN A NE2  4  
ATOM 6922  H H    . GLN A 1 20  ? -2.268  -2.572  -1.212  1.00 0.00 ? 20  GLN A H    4  
ATOM 6923  H HA   . GLN A 1 20  ? 0.068   -3.273  -2.849  1.00 0.00 ? 20  GLN A HA   4  
ATOM 6924  H HB2  . GLN A 1 20  ? -0.417  -4.641  -0.833  1.00 0.00 ? 20  GLN A HB2  4  
ATOM 6925  H HB3  . GLN A 1 20  ? -1.967  -5.089  -1.529  1.00 0.00 ? 20  GLN A HB3  4  
ATOM 6926  H HG2  . GLN A 1 20  ? -0.642  -6.920  -2.002  1.00 0.00 ? 20  GLN A HG2  4  
ATOM 6927  H HG3  . GLN A 1 20  ? -0.583  -6.003  -3.501  1.00 0.00 ? 20  GLN A HG3  4  
ATOM 6928  H HE21 . GLN A 1 20  ? 1.347   -4.031  -2.356  1.00 0.00 ? 20  GLN A HE21 4  
ATOM 6929  H HE22 . GLN A 1 20  ? 2.865   -4.856  -2.308  1.00 0.00 ? 20  GLN A HE22 4  
ATOM 6930  N N    . ASP A 1 21  ? -3.023  -3.290  -3.846  1.00 0.00 ? 21  ASP A N    4  
ATOM 6931  C CA   . ASP A 1 21  ? -3.904  -3.425  -5.008  1.00 0.00 ? 21  ASP A CA   4  
ATOM 6932  C C    . ASP A 1 21  ? -3.460  -2.472  -6.121  1.00 0.00 ? 21  ASP A C    4  
ATOM 6933  O O    . ASP A 1 21  ? -3.186  -1.301  -5.856  1.00 0.00 ? 21  ASP A O    4  
ATOM 6934  C CB   . ASP A 1 21  ? -5.362  -3.137  -4.613  1.00 0.00 ? 21  ASP A CB   4  
ATOM 6935  C CG   . ASP A 1 21  ? -6.336  -3.382  -5.757  1.00 0.00 ? 21  ASP A CG   4  
ATOM 6936  O OD1  . ASP A 1 21  ? -6.725  -4.549  -5.970  1.00 0.00 ? 21  ASP A OD1  4  
ATOM 6937  O OD2  . ASP A 1 21  ? -6.706  -2.416  -6.455  1.00 0.00 ? 21  ASP A OD2  4  
ATOM 6938  H H    . ASP A 1 21  ? -3.372  -2.871  -3.034  1.00 0.00 ? 21  ASP A H    4  
ATOM 6939  H HA   . ASP A 1 21  ? -3.829  -4.443  -5.364  1.00 0.00 ? 21  ASP A HA   4  
ATOM 6940  H HB2  . ASP A 1 21  ? -5.635  -3.778  -3.786  1.00 0.00 ? 21  ASP A HB2  4  
ATOM 6941  H HB3  . ASP A 1 21  ? -5.447  -2.104  -4.301  1.00 0.00 ? 21  ASP A HB3  4  
ATOM 6942  N N    . PRO A 1 22  ? -3.368  -2.959  -7.376  1.00 0.00 ? 22  PRO A N    4  
ATOM 6943  C CA   . PRO A 1 22  ? -2.913  -2.141  -8.512  1.00 0.00 ? 22  PRO A CA   4  
ATOM 6944  C C    . PRO A 1 22  ? -3.725  -0.855  -8.677  1.00 0.00 ? 22  PRO A C    4  
ATOM 6945  O O    . PRO A 1 22  ? -3.165  0.243   -8.729  1.00 0.00 ? 22  PRO A O    4  
ATOM 6946  C CB   . PRO A 1 22  ? -3.108  -3.068  -9.724  1.00 0.00 ? 22  PRO A CB   4  
ATOM 6947  C CG   . PRO A 1 22  ? -3.067  -4.445  -9.155  1.00 0.00 ? 22  PRO A CG   4  
ATOM 6948  C CD   . PRO A 1 22  ? -3.685  -4.341  -7.787  1.00 0.00 ? 22  PRO A CD   4  
ATOM 6949  H HA   . PRO A 1 22  ? -1.867  -1.887  -8.414  1.00 0.00 ? 22  PRO A HA   4  
ATOM 6950  H HB2  . PRO A 1 22  ? -4.062  -2.862  -10.193 1.00 0.00 ? 22  PRO A HB2  4  
ATOM 6951  H HB3  . PRO A 1 22  ? -2.311  -2.910  -10.437 1.00 0.00 ? 22  PRO A HB3  4  
ATOM 6952  H HG2  . PRO A 1 22  ? -3.640  -5.119  -9.778  1.00 0.00 ? 22  PRO A HG2  4  
ATOM 6953  H HG3  . PRO A 1 22  ? -2.042  -4.783  -9.081  1.00 0.00 ? 22  PRO A HG3  4  
ATOM 6954  H HD2  . PRO A 1 22  ? -4.756  -4.492  -7.842  1.00 0.00 ? 22  PRO A HD2  4  
ATOM 6955  H HD3  . PRO A 1 22  ? -3.237  -5.058  -7.114  1.00 0.00 ? 22  PRO A HD3  4  
ATOM 6956  N N    . LEU A 1 23  ? -5.047  -0.996  -8.740  1.00 0.00 ? 23  LEU A N    4  
ATOM 6957  C CA   . LEU A 1 23  ? -5.928  0.152   -8.938  1.00 0.00 ? 23  LEU A CA   4  
ATOM 6958  C C    . LEU A 1 23  ? -5.945  1.016   -7.686  1.00 0.00 ? 23  LEU A C    4  
ATOM 6959  O O    . LEU A 1 23  ? -5.948  2.247   -7.767  1.00 0.00 ? 23  LEU A O    4  
ATOM 6960  C CB   . LEU A 1 23  ? -7.353  -0.305  -9.287  1.00 0.00 ? 23  LEU A CB   4  
ATOM 6961  C CG   . LEU A 1 23  ? -7.491  -1.056  -10.622 1.00 0.00 ? 23  LEU A CG   4  
ATOM 6962  C CD1  . LEU A 1 23  ? -8.939  -1.475  -10.862 1.00 0.00 ? 23  LEU A CD1  4  
ATOM 6963  C CD2  . LEU A 1 23  ? -6.976  -0.199  -11.778 1.00 0.00 ? 23  LEU A CD2  4  
ATOM 6964  H H    . LEU A 1 23  ? -5.439  -1.887  -8.623  1.00 0.00 ? 23  LEU A H    4  
ATOM 6965  H HA   . LEU A 1 23  ? -5.536  0.736   -9.759  1.00 0.00 ? 23  LEU A HA   4  
ATOM 6966  H HB2  . LEU A 1 23  ? -7.706  -0.954  -8.496  1.00 0.00 ? 23  LEU A HB2  4  
ATOM 6967  H HB3  . LEU A 1 23  ? -7.992  0.566   -9.323  1.00 0.00 ? 23  LEU A HB3  4  
ATOM 6968  H HG   . LEU A 1 23  ? -6.892  -1.954  -10.584 1.00 0.00 ? 23  LEU A HG   4  
ATOM 6969  H HD11 . LEU A 1 23  ? -9.011  -2.002  -11.803 1.00 0.00 ? 23  LEU A HD11 4  
ATOM 6970  H HD12 . LEU A 1 23  ? -9.571  -0.598  -10.893 1.00 0.00 ? 23  LEU A HD12 4  
ATOM 6971  H HD13 . LEU A 1 23  ? -9.265  -2.123  -10.061 1.00 0.00 ? 23  LEU A HD13 4  
ATOM 6972  H HD21 . LEU A 1 23  ? -5.927  0.015   -11.630 1.00 0.00 ? 23  LEU A HD21 4  
ATOM 6973  H HD22 . LEU A 1 23  ? -7.530  0.728   -11.819 1.00 0.00 ? 23  LEU A HD22 4  
ATOM 6974  H HD23 . LEU A 1 23  ? -7.105  -0.734  -12.709 1.00 0.00 ? 23  LEU A HD23 4  
ATOM 6975  N N    . GLY A 1 24  ? -5.939  0.353   -6.537  1.00 0.00 ? 24  GLY A N    4  
ATOM 6976  C CA   . GLY A 1 24  ? -5.928  1.047   -5.267  1.00 0.00 ? 24  GLY A CA   4  
ATOM 6977  C C    . GLY A 1 24  ? -4.745  1.980   -5.137  1.00 0.00 ? 24  GLY A C    4  
ATOM 6978  O O    . GLY A 1 24  ? -4.913  3.187   -4.961  1.00 0.00 ? 24  GLY A O    4  
ATOM 6979  H H    . GLY A 1 24  ? -5.943  -0.627  -6.552  1.00 0.00 ? 24  GLY A H    4  
ATOM 6980  H HA2  . GLY A 1 24  ? -6.842  1.617   -5.167  1.00 0.00 ? 24  GLY A HA2  4  
ATOM 6981  H HA3  . GLY A 1 24  ? -5.882  0.317   -4.475  1.00 0.00 ? 24  GLY A HA3  4  
ATOM 6982  N N    . LEU A 1 25  ? -3.548  1.417   -5.245  1.00 0.00 ? 25  LEU A N    4  
ATOM 6983  C CA   . LEU A 1 25  ? -2.313  2.183   -5.126  1.00 0.00 ? 25  LEU A CA   4  
ATOM 6984  C C    . LEU A 1 25  ? -2.274  3.289   -6.183  1.00 0.00 ? 25  LEU A C    4  
ATOM 6985  O O    . LEU A 1 25  ? -1.884  4.418   -5.895  1.00 0.00 ? 25  LEU A O    4  
ATOM 6986  C CB   . LEU A 1 25  ? -1.089  1.258   -5.285  1.00 0.00 ? 25  LEU A CB   4  
ATOM 6987  C CG   . LEU A 1 25  ? 0.128   1.579   -4.389  1.00 0.00 ? 25  LEU A CG   4  
ATOM 6988  C CD1  . LEU A 1 25  ? 1.330   0.730   -4.794  1.00 0.00 ? 25  LEU A CD1  4  
ATOM 6989  C CD2  . LEU A 1 25  ? 0.484   3.066   -4.418  1.00 0.00 ? 25  LEU A CD2  4  
ATOM 6990  H H    . LEU A 1 25  ? -3.494  0.452   -5.403  1.00 0.00 ? 25  LEU A H    4  
ATOM 6991  H HA   . LEU A 1 25  ? -2.294  2.634   -4.143  1.00 0.00 ? 25  LEU A HA   4  
ATOM 6992  H HB2  . LEU A 1 25  ? -1.404  0.246   -5.066  1.00 0.00 ? 25  LEU A HB2  4  
ATOM 6993  H HB3  . LEU A 1 25  ? -0.766  1.293   -6.316  1.00 0.00 ? 25  LEU A HB3  4  
ATOM 6994  H HG   . LEU A 1 25  ? -0.119  1.321   -3.368  1.00 0.00 ? 25  LEU A HG   4  
ATOM 6995  H HD11 . LEU A 1 25  ? 2.167   0.959   -4.149  1.00 0.00 ? 25  LEU A HD11 4  
ATOM 6996  H HD12 . LEU A 1 25  ? 1.599   0.946   -5.819  1.00 0.00 ? 25  LEU A HD12 4  
ATOM 6997  H HD13 . LEU A 1 25  ? 1.081   -0.317  -4.700  1.00 0.00 ? 25  LEU A HD13 4  
ATOM 6998  H HD21 . LEU A 1 25  ? 1.365   3.238   -3.815  1.00 0.00 ? 25  LEU A HD21 4  
ATOM 6999  H HD22 . LEU A 1 25  ? -0.338  3.641   -4.017  1.00 0.00 ? 25  LEU A HD22 4  
ATOM 7000  H HD23 . LEU A 1 25  ? 0.678   3.374   -5.436  1.00 0.00 ? 25  LEU A HD23 4  
ATOM 7001  N N    . ALA A 1 26  ? -2.694  2.953   -7.401  1.00 0.00 ? 26  ALA A N    4  
ATOM 7002  C CA   . ALA A 1 26  ? -2.659  3.896   -8.517  1.00 0.00 ? 26  ALA A CA   4  
ATOM 7003  C C    . ALA A 1 26  ? -3.459  5.158   -8.201  1.00 0.00 ? 26  ALA A C    4  
ATOM 7004  O O    . ALA A 1 26  ? -2.922  6.267   -8.243  1.00 0.00 ? 26  ALA A O    4  
ATOM 7005  C CB   . ALA A 1 26  ? -3.178  3.240   -9.790  1.00 0.00 ? 26  ALA A CB   4  
ATOM 7006  H H    . ALA A 1 26  ? -3.041  2.047   -7.554  1.00 0.00 ? 26  ALA A H    4  
ATOM 7007  H HA   . ALA A 1 26  ? -1.625  4.173   -8.684  1.00 0.00 ? 26  ALA A HA   4  
ATOM 7008  H HB1  . ALA A 1 26  ? -2.595  2.355   -10.003 1.00 0.00 ? 26  ALA A HB1  4  
ATOM 7009  H HB2  . ALA A 1 26  ? -3.090  3.933   -10.615 1.00 0.00 ? 26  ALA A HB2  4  
ATOM 7010  H HB3  . ALA A 1 26  ? -4.214  2.965   -9.659  1.00 0.00 ? 26  ALA A HB3  4  
ATOM 7011  N N    . TYR A 1 27  ? -4.740  4.984   -7.873  1.00 0.00 ? 27  TYR A N    4  
ATOM 7012  C CA   . TYR A 1 27  ? -5.607  6.114   -7.537  1.00 0.00 ? 27  TYR A CA   4  
ATOM 7013  C C    . TYR A 1 27  ? -5.125  6.796   -6.263  1.00 0.00 ? 27  TYR A C    4  
ATOM 7014  O O    . TYR A 1 27  ? -5.105  8.024   -6.174  1.00 0.00 ? 27  TYR A O    4  
ATOM 7015  C CB   . TYR A 1 27  ? -7.066  5.656   -7.381  1.00 0.00 ? 27  TYR A CB   4  
ATOM 7016  C CG   . TYR A 1 27  ? -7.764  5.368   -8.702  1.00 0.00 ? 27  TYR A CG   4  
ATOM 7017  C CD1  . TYR A 1 27  ? -7.376  4.296   -9.501  1.00 0.00 ? 27  TYR A CD1  4  
ATOM 7018  C CD2  . TYR A 1 27  ? -8.814  6.168   -9.150  1.00 0.00 ? 27  TYR A CD2  4  
ATOM 7019  C CE1  . TYR A 1 27  ? -8.006  4.033   -10.702 1.00 0.00 ? 27  TYR A CE1  4  
ATOM 7020  C CE2  . TYR A 1 27  ? -9.450  5.908   -10.350 1.00 0.00 ? 27  TYR A CE2  4  
ATOM 7021  C CZ   . TYR A 1 27  ? -9.042  4.841   -11.122 1.00 0.00 ? 27  TYR A CZ   4  
ATOM 7022  O OH   . TYR A 1 27  ? -9.673  4.581   -12.320 1.00 0.00 ? 27  TYR A OH   4  
ATOM 7023  H H    . TYR A 1 27  ? -5.108  4.072   -7.848  1.00 0.00 ? 27  TYR A H    4  
ATOM 7024  H HA   . TYR A 1 27  ? -5.550  6.825   -8.351  1.00 0.00 ? 27  TYR A HA   4  
ATOM 7025  H HB2  . TYR A 1 27  ? -7.091  4.751   -6.789  1.00 0.00 ? 27  TYR A HB2  4  
ATOM 7026  H HB3  . TYR A 1 27  ? -7.627  6.426   -6.867  1.00 0.00 ? 27  TYR A HB3  4  
ATOM 7027  H HD1  . TYR A 1 27  ? -6.563  3.664   -9.172  1.00 0.00 ? 27  TYR A HD1  4  
ATOM 7028  H HD2  . TYR A 1 27  ? -9.135  7.005   -8.544  1.00 0.00 ? 27  TYR A HD2  4  
ATOM 7029  H HE1  . TYR A 1 27  ? -7.687  3.196   -11.306 1.00 0.00 ? 27  TYR A HE1  4  
ATOM 7030  H HE2  . TYR A 1 27  ? -10.262 6.542   -10.678 1.00 0.00 ? 27  TYR A HE2  4  
ATOM 7031  H HH   . TYR A 1 27  ? -9.920  5.415   -12.742 1.00 0.00 ? 27  TYR A HH   4  
ATOM 7032  N N    . PHE A 1 28  ? -4.719  5.991   -5.286  1.00 0.00 ? 28  PHE A N    4  
ATOM 7033  C CA   . PHE A 1 28  ? -4.197  6.502   -4.022  1.00 0.00 ? 28  PHE A CA   4  
ATOM 7034  C C    . PHE A 1 28  ? -3.003  7.422   -4.280  1.00 0.00 ? 28  PHE A C    4  
ATOM 7035  O O    . PHE A 1 28  ? -2.840  8.450   -3.622  1.00 0.00 ? 28  PHE A O    4  
ATOM 7036  C CB   . PHE A 1 28  ? -3.810  5.325   -3.113  1.00 0.00 ? 28  PHE A CB   4  
ATOM 7037  C CG   . PHE A 1 28  ? -3.256  5.719   -1.767  1.00 0.00 ? 28  PHE A CG   4  
ATOM 7038  C CD1  . PHE A 1 28  ? -3.926  6.626   -0.958  1.00 0.00 ? 28  PHE A CD1  4  
ATOM 7039  C CD2  . PHE A 1 28  ? -2.067  5.174   -1.310  1.00 0.00 ? 28  PHE A CD2  4  
ATOM 7040  C CE1  . PHE A 1 28  ? -3.418  6.980   0.278   1.00 0.00 ? 28  PHE A CE1  4  
ATOM 7041  C CE2  . PHE A 1 28  ? -1.557  5.524   -0.076  1.00 0.00 ? 28  PHE A CE2  4  
ATOM 7042  C CZ   . PHE A 1 28  ? -2.231  6.429   0.719   1.00 0.00 ? 28  PHE A CZ   4  
ATOM 7043  H H    . PHE A 1 28  ? -4.772  5.021   -5.420  1.00 0.00 ? 28  PHE A H    4  
ATOM 7044  H HA   . PHE A 1 28  ? -4.981  7.073   -3.547  1.00 0.00 ? 28  PHE A HA   4  
ATOM 7045  H HB2  . PHE A 1 28  ? -4.687  4.718   -2.937  1.00 0.00 ? 28  PHE A HB2  4  
ATOM 7046  H HB3  . PHE A 1 28  ? -3.067  4.724   -3.617  1.00 0.00 ? 28  PHE A HB3  4  
ATOM 7047  H HD1  . PHE A 1 28  ? -4.855  7.059   -1.300  1.00 0.00 ? 28  PHE A HD1  4  
ATOM 7048  H HD2  . PHE A 1 28  ? -1.533  4.467   -1.930  1.00 0.00 ? 28  PHE A HD2  4  
ATOM 7049  H HE1  . PHE A 1 28  ? -3.948  7.690   0.896   1.00 0.00 ? 28  PHE A HE1  4  
ATOM 7050  H HE2  . PHE A 1 28  ? -0.627  5.091   0.264   1.00 0.00 ? 28  PHE A HE2  4  
ATOM 7051  H HZ   . PHE A 1 28  ? -1.833  6.704   1.685   1.00 0.00 ? 28  PHE A HZ   4  
ATOM 7052  N N    . THR A 1 29  ? -2.193  7.058   -5.267  1.00 0.00 ? 29  THR A N    4  
ATOM 7053  C CA   . THR A 1 29  ? -1.055  7.871   -5.673  1.00 0.00 ? 29  THR A CA   4  
ATOM 7054  C C    . THR A 1 29  ? -1.535  9.153   -6.360  1.00 0.00 ? 29  THR A C    4  
ATOM 7055  O O    . THR A 1 29  ? -1.074  10.247  -6.033  1.00 0.00 ? 29  THR A O    4  
ATOM 7056  C CB   . THR A 1 29  ? -0.117  7.080   -6.616  1.00 0.00 ? 29  THR A CB   4  
ATOM 7057  O OG1  . THR A 1 29  ? 0.434   5.954   -5.920  1.00 0.00 ? 29  THR A OG1  4  
ATOM 7058  C CG2  . THR A 1 29  ? 1.016   7.949   -7.153  1.00 0.00 ? 29  THR A CG2  4  
ATOM 7059  H H    . THR A 1 29  ? -2.371  6.220   -5.741  1.00 0.00 ? 29  THR A H    4  
ATOM 7060  H HA   . THR A 1 29  ? -0.499  8.137   -4.782  1.00 0.00 ? 29  THR A HA   4  
ATOM 7061  H HB   . THR A 1 29  ? -0.699  6.719   -7.453  1.00 0.00 ? 29  THR A HB   4  
ATOM 7062  H HG1  . THR A 1 29  ? -0.281  5.383   -5.620  1.00 0.00 ? 29  THR A HG1  4  
ATOM 7063  H HG21 . THR A 1 29  ? 1.596   8.337   -6.328  1.00 0.00 ? 29  THR A HG21 4  
ATOM 7064  H HG22 . THR A 1 29  ? 0.604   8.770   -7.720  1.00 0.00 ? 29  THR A HG22 4  
ATOM 7065  H HG23 . THR A 1 29  ? 1.653   7.355   -7.792  1.00 0.00 ? 29  THR A HG23 4  
ATOM 7066  N N    . GLU A 1 30  ? -2.485  9.009   -7.288  1.00 0.00 ? 30  GLU A N    4  
ATOM 7067  C CA   . GLU A 1 30  ? -3.022  10.148  -8.038  1.00 0.00 ? 30  GLU A CA   4  
ATOM 7068  C C    . GLU A 1 30  ? -3.528  11.238  -7.092  1.00 0.00 ? 30  GLU A C    4  
ATOM 7069  O O    . GLU A 1 30  ? -3.138  12.404  -7.203  1.00 0.00 ? 30  GLU A O    4  
ATOM 7070  C CB   . GLU A 1 30  ? -4.152  9.686   -8.975  1.00 0.00 ? 30  GLU A CB   4  
ATOM 7071  C CG   . GLU A 1 30  ? -3.691  8.725   -10.067 1.00 0.00 ? 30  GLU A CG   4  
ATOM 7072  C CD   . GLU A 1 30  ? -4.826  8.250   -10.964 1.00 0.00 ? 30  GLU A CD   4  
ATOM 7073  O OE1  . GLU A 1 30  ? -5.131  8.937   -11.966 1.00 0.00 ? 30  GLU A OE1  4  
ATOM 7074  O OE2  . GLU A 1 30  ? -5.415  7.185   -10.684 1.00 0.00 ? 30  GLU A OE2  4  
ATOM 7075  H H    . GLU A 1 30  ? -2.839  8.111   -7.470  1.00 0.00 ? 30  GLU A H    4  
ATOM 7076  H HA   . GLU A 1 30  ? -2.218  10.555  -8.636  1.00 0.00 ? 30  GLU A HA   4  
ATOM 7077  H HB2  . GLU A 1 30  ? -4.912  9.190   -8.385  1.00 0.00 ? 30  GLU A HB2  4  
ATOM 7078  H HB3  . GLU A 1 30  ? -4.590  10.554  -9.450  1.00 0.00 ? 30  GLU A HB3  4  
ATOM 7079  H HG2  . GLU A 1 30  ? -2.954  9.225   -10.680 1.00 0.00 ? 30  GLU A HG2  4  
ATOM 7080  H HG3  . GLU A 1 30  ? -3.235  7.863   -9.600  1.00 0.00 ? 30  GLU A HG3  4  
ATOM 7081  N N    . PHE A 1 31  ? -4.391  10.848  -6.155  1.00 0.00 ? 31  PHE A N    4  
ATOM 7082  C CA   . PHE A 1 31  ? -4.928  11.775  -5.156  1.00 0.00 ? 31  PHE A CA   4  
ATOM 7083  C C    . PHE A 1 31  ? -3.787  12.430  -4.375  1.00 0.00 ? 31  PHE A C    4  
ATOM 7084  O O    . PHE A 1 31  ? -3.730  13.653  -4.229  1.00 0.00 ? 31  PHE A O    4  
ATOM 7085  C CB   . PHE A 1 31  ? -5.850  11.042  -4.161  1.00 0.00 ? 31  PHE A CB   4  
ATOM 7086  C CG   . PHE A 1 31  ? -7.048  10.342  -4.764  1.00 0.00 ? 31  PHE A CG   4  
ATOM 7087  C CD1  . PHE A 1 31  ? -7.149  10.115  -6.131  1.00 0.00 ? 31  PHE A CD1  4  
ATOM 7088  C CD2  . PHE A 1 31  ? -8.071  9.888   -3.944  1.00 0.00 ? 31  PHE A CD2  4  
ATOM 7089  C CE1  . PHE A 1 31  ? -8.238  9.453   -6.660  1.00 0.00 ? 31  PHE A CE1  4  
ATOM 7090  C CE2  . PHE A 1 31  ? -9.164  9.229   -4.471  1.00 0.00 ? 31  PHE A CE2  4  
ATOM 7091  C CZ   . PHE A 1 31  ? -9.246  9.009   -5.829  1.00 0.00 ? 31  PHE A CZ   4  
ATOM 7092  H H    . PHE A 1 31  ? -4.682  9.911   -6.140  1.00 0.00 ? 31  PHE A H    4  
ATOM 7093  H HA   . PHE A 1 31  ? -5.494  12.540  -5.672  1.00 0.00 ? 31  PHE A HA   4  
ATOM 7094  H HB2  . PHE A 1 31  ? -5.271  10.294  -3.640  1.00 0.00 ? 31  PHE A HB2  4  
ATOM 7095  H HB3  . PHE A 1 31  ? -6.219  11.759  -3.439  1.00 0.00 ? 31  PHE A HB3  4  
ATOM 7096  H HD1  . PHE A 1 31  ? -6.363  10.462  -6.785  1.00 0.00 ? 31  PHE A HD1  4  
ATOM 7097  H HD2  . PHE A 1 31  ? -8.012  10.060  -2.878  1.00 0.00 ? 31  PHE A HD2  4  
ATOM 7098  H HE1  . PHE A 1 31  ? -8.302  9.284   -7.725  1.00 0.00 ? 31  PHE A HE1  4  
ATOM 7099  H HE2  . PHE A 1 31  ? -9.953  8.882   -3.817  1.00 0.00 ? 31  PHE A HE2  4  
ATOM 7100  H HZ   . PHE A 1 31  ? -10.098 8.489   -6.243  1.00 0.00 ? 31  PHE A HZ   4  
ATOM 7101  N N    . LEU A 1 32  ? -2.872  11.591  -3.900  1.00 0.00 ? 32  LEU A N    4  
ATOM 7102  C CA   . LEU A 1 32  ? -1.793  12.019  -3.014  1.00 0.00 ? 32  LEU A CA   4  
ATOM 7103  C C    . LEU A 1 32  ? -0.785  12.919  -3.745  1.00 0.00 ? 32  LEU A C    4  
ATOM 7104  O O    . LEU A 1 32  ? -0.064  13.701  -3.118  1.00 0.00 ? 32  LEU A O    4  
ATOM 7105  C CB   . LEU A 1 32  ? -1.109  10.777  -2.421  1.00 0.00 ? 32  LEU A CB   4  
ATOM 7106  C CG   . LEU A 1 32  ? -0.119  11.033  -1.275  1.00 0.00 ? 32  LEU A CG   4  
ATOM 7107  C CD1  . LEU A 1 32  ? -0.778  11.805  -0.139  1.00 0.00 ? 32  LEU A CD1  4  
ATOM 7108  C CD2  . LEU A 1 32  ? 0.454   9.715   -0.759  1.00 0.00 ? 32  LEU A CD2  4  
ATOM 7109  H H    . LEU A 1 32  ? -2.926  10.644  -4.151  1.00 0.00 ? 32  LEU A H    4  
ATOM 7110  H HA   . LEU A 1 32  ? -2.238  12.588  -2.209  1.00 0.00 ? 32  LEU A HA   4  
ATOM 7111  H HB2  . LEU A 1 32  ? -1.881  10.115  -2.054  1.00 0.00 ? 32  LEU A HB2  4  
ATOM 7112  H HB3  . LEU A 1 32  ? -0.581  10.271  -3.217  1.00 0.00 ? 32  LEU A HB3  4  
ATOM 7113  H HG   . LEU A 1 32  ? 0.703   11.627  -1.645  1.00 0.00 ? 32  LEU A HG   4  
ATOM 7114  H HD11 . LEU A 1 32  ? -1.600  11.229  0.264   1.00 0.00 ? 32  LEU A HD11 4  
ATOM 7115  H HD12 . LEU A 1 32  ? -1.148  12.749  -0.512  1.00 0.00 ? 32  LEU A HD12 4  
ATOM 7116  H HD13 . LEU A 1 32  ? -0.050  11.989  0.639   1.00 0.00 ? 32  LEU A HD13 4  
ATOM 7117  H HD21 . LEU A 1 32  ? 1.168   9.913   0.025   1.00 0.00 ? 32  LEU A HD21 4  
ATOM 7118  H HD22 . LEU A 1 32  ? 0.945   9.193   -1.569  1.00 0.00 ? 32  LEU A HD22 4  
ATOM 7119  H HD23 . LEU A 1 32  ? -0.346  9.100   -0.371  1.00 0.00 ? 32  LEU A HD23 4  
ATOM 7120  N N    . LYS A 1 33  ? -0.736  12.811  -5.073  1.00 0.00 ? 33  LYS A N    4  
ATOM 7121  C CA   . LYS A 1 33  ? 0.118   13.685  -5.882  1.00 0.00 ? 33  LYS A CA   4  
ATOM 7122  C C    . LYS A 1 33  ? -0.498  15.078  -5.984  1.00 0.00 ? 33  LYS A C    4  
ATOM 7123  O O    . LYS A 1 33  ? 0.215   16.078  -6.082  1.00 0.00 ? 33  LYS A O    4  
ATOM 7124  C CB   . LYS A 1 33  ? 0.344   13.100  -7.291  1.00 0.00 ? 33  LYS A CB   4  
ATOM 7125  C CG   . LYS A 1 33  ? 1.203   11.837  -7.301  1.00 0.00 ? 33  LYS A CG   4  
ATOM 7126  C CD   . LYS A 1 33  ? 1.471   11.318  -8.715  1.00 0.00 ? 33  LYS A CD   4  
ATOM 7127  C CE   . LYS A 1 33  ? 2.286   12.305  -9.546  1.00 0.00 ? 33  LYS A CE   4  
ATOM 7128  N NZ   . LYS A 1 33  ? 2.702   11.720  -10.851 1.00 0.00 ? 33  LYS A NZ   4  
ATOM 7129  H H    . LYS A 1 33  ? -1.285  12.130  -5.518  1.00 0.00 ? 33  LYS A H    4  
ATOM 7130  H HA   . LYS A 1 33  ? 1.073   13.767  -5.380  1.00 0.00 ? 33  LYS A HA   4  
ATOM 7131  H HB2  . LYS A 1 33  ? -0.616  12.860  -7.728  1.00 0.00 ? 33  LYS A HB2  4  
ATOM 7132  H HB3  . LYS A 1 33  ? 0.831   13.844  -7.905  1.00 0.00 ? 33  LYS A HB3  4  
ATOM 7133  H HG2  . LYS A 1 33  ? 2.150   12.056  -6.829  1.00 0.00 ? 33  LYS A HG2  4  
ATOM 7134  H HG3  . LYS A 1 33  ? 0.694   11.067  -6.737  1.00 0.00 ? 33  LYS A HG3  4  
ATOM 7135  H HD2  . LYS A 1 33  ? 2.016   10.389  -8.646  1.00 0.00 ? 33  LYS A HD2  4  
ATOM 7136  H HD3  . LYS A 1 33  ? 0.524   11.141  -9.207  1.00 0.00 ? 33  LYS A HD3  4  
ATOM 7137  H HE2  . LYS A 1 33  ? 1.687   13.184  -9.730  1.00 0.00 ? 33  LYS A HE2  4  
ATOM 7138  H HE3  . LYS A 1 33  ? 3.170   12.583  -8.989  1.00 0.00 ? 33  LYS A HE3  4  
ATOM 7139  H HZ1  . LYS A 1 33  ? 3.379   10.946  -10.699 1.00 0.00 ? 33  LYS A HZ1  4  
ATOM 7140  H HZ2  . LYS A 1 33  ? 3.154   12.447  -11.442 1.00 0.00 ? 33  LYS A HZ2  4  
ATOM 7141  H HZ3  . LYS A 1 33  ? 1.874   11.348  -11.360 1.00 0.00 ? 33  LYS A HZ3  4  
ATOM 7142  N N    . LYS A 1 34  ? -1.827  15.136  -5.933  1.00 0.00 ? 34  LYS A N    4  
ATOM 7143  C CA   . LYS A 1 34  ? -2.551  16.399  -6.070  1.00 0.00 ? 34  LYS A CA   4  
ATOM 7144  C C    . LYS A 1 34  ? -2.274  17.316  -4.876  1.00 0.00 ? 34  LYS A C    4  
ATOM 7145  O O    . LYS A 1 34  ? -2.067  18.520  -5.042  1.00 0.00 ? 34  LYS A O    4  
ATOM 7146  C CB   . LYS A 1 34  ? -4.058  16.135  -6.211  1.00 0.00 ? 34  LYS A CB   4  
ATOM 7147  C CG   . LYS A 1 34  ? -4.887  17.390  -6.487  1.00 0.00 ? 34  LYS A CG   4  
ATOM 7148  C CD   . LYS A 1 34  ? -6.358  17.059  -6.731  1.00 0.00 ? 34  LYS A CD   4  
ATOM 7149  C CE   . LYS A 1 34  ? -6.536  16.113  -7.915  1.00 0.00 ? 34  LYS A CE   4  
ATOM 7150  N NZ   . LYS A 1 34  ? -7.969  15.843  -8.201  1.00 0.00 ? 34  LYS A NZ   4  
ATOM 7151  H H    . LYS A 1 34  ? -2.335  14.307  -5.799  1.00 0.00 ? 34  LYS A H    4  
ATOM 7152  H HA   . LYS A 1 34  ? -2.196  16.886  -6.968  1.00 0.00 ? 34  LYS A HA   4  
ATOM 7153  H HB2  . LYS A 1 34  ? -4.211  15.444  -7.027  1.00 0.00 ? 34  LYS A HB2  4  
ATOM 7154  H HB3  . LYS A 1 34  ? -4.421  15.683  -5.299  1.00 0.00 ? 34  LYS A HB3  4  
ATOM 7155  H HG2  . LYS A 1 34  ? -4.815  18.051  -5.634  1.00 0.00 ? 34  LYS A HG2  4  
ATOM 7156  H HG3  . LYS A 1 34  ? -4.489  17.889  -7.361  1.00 0.00 ? 34  LYS A HG3  4  
ATOM 7157  H HD2  . LYS A 1 34  ? -6.764  16.590  -5.845  1.00 0.00 ? 34  LYS A HD2  4  
ATOM 7158  H HD3  . LYS A 1 34  ? -6.895  17.976  -6.929  1.00 0.00 ? 34  LYS A HD3  4  
ATOM 7159  H HE2  . LYS A 1 34  ? -6.083  16.558  -8.789  1.00 0.00 ? 34  LYS A HE2  4  
ATOM 7160  H HE3  . LYS A 1 34  ? -6.041  15.178  -7.693  1.00 0.00 ? 34  LYS A HE3  4  
ATOM 7161  H HZ1  . LYS A 1 34  ? -8.446  16.722  -8.486  1.00 0.00 ? 34  LYS A HZ1  4  
ATOM 7162  H HZ2  . LYS A 1 34  ? -8.438  15.465  -7.355  1.00 0.00 ? 34  LYS A HZ2  4  
ATOM 7163  H HZ3  . LYS A 1 34  ? -8.056  15.150  -8.972  1.00 0.00 ? 34  LYS A HZ3  4  
ATOM 7164  N N    . GLU A 1 35  ? -2.260  16.739  -3.676  1.00 0.00 ? 35  GLU A N    4  
ATOM 7165  C CA   . GLU A 1 35  ? -1.960  17.500  -2.459  1.00 0.00 ? 35  GLU A CA   4  
ATOM 7166  C C    . GLU A 1 35  ? -0.447  17.607  -2.247  1.00 0.00 ? 35  GLU A C    4  
ATOM 7167  O O    . GLU A 1 35  ? 0.016   18.278  -1.320  1.00 0.00 ? 35  GLU A O    4  
ATOM 7168  C CB   . GLU A 1 35  ? -2.609  16.838  -1.235  1.00 0.00 ? 35  GLU A CB   4  
ATOM 7169  C CG   . GLU A 1 35  ? -2.115  15.420  -0.966  1.00 0.00 ? 35  GLU A CG   4  
ATOM 7170  C CD   . GLU A 1 35  ? -2.556  14.897  0.392   1.00 0.00 ? 35  GLU A CD   4  
ATOM 7171  O OE1  . GLU A 1 35  ? -1.881  15.206  1.398   1.00 0.00 ? 35  GLU A OE1  4  
ATOM 7172  O OE2  . GLU A 1 35  ? -3.576  14.182  0.469   1.00 0.00 ? 35  GLU A OE2  4  
ATOM 7173  H H    . GLU A 1 35  ? -2.459  15.781  -3.604  1.00 0.00 ? 35  GLU A H    4  
ATOM 7174  H HA   . GLU A 1 35  ? -2.366  18.496  -2.577  1.00 0.00 ? 35  GLU A HA   4  
ATOM 7175  H HB2  . GLU A 1 35  ? -2.401  17.441  -0.362  1.00 0.00 ? 35  GLU A HB2  4  
ATOM 7176  H HB3  . GLU A 1 35  ? -3.678  16.801  -1.388  1.00 0.00 ? 35  GLU A HB3  4  
ATOM 7177  H HG2  . GLU A 1 35  ? -2.502  14.763  -1.734  1.00 0.00 ? 35  GLU A HG2  4  
ATOM 7178  H HG3  . GLU A 1 35  ? -1.034  15.414  -1.005  1.00 0.00 ? 35  GLU A HG3  4  
ATOM 7179  N N    . PHE A 1 36  ? 0.304   16.933  -3.116  1.00 0.00 ? 36  PHE A N    4  
ATOM 7180  C CA   . PHE A 1 36  ? 1.761   16.868  -3.034  1.00 0.00 ? 36  PHE A CA   4  
ATOM 7181  C C    . PHE A 1 36  ? 2.200   16.260  -1.705  1.00 0.00 ? 36  PHE A C    4  
ATOM 7182  O O    . PHE A 1 36  ? 2.569   16.967  -0.763  1.00 0.00 ? 36  PHE A O    4  
ATOM 7183  C CB   . PHE A 1 36  ? 2.412   18.246  -3.248  1.00 0.00 ? 36  PHE A CB   4  
ATOM 7184  C CG   . PHE A 1 36  ? 3.922   18.188  -3.336  1.00 0.00 ? 36  PHE A CG   4  
ATOM 7185  C CD1  . PHE A 1 36  ? 4.547   17.833  -4.524  1.00 0.00 ? 36  PHE A CD1  4  
ATOM 7186  C CD2  . PHE A 1 36  ? 4.716   18.479  -2.232  1.00 0.00 ? 36  PHE A CD2  4  
ATOM 7187  C CE1  . PHE A 1 36  ? 5.927   17.769  -4.608  1.00 0.00 ? 36  PHE A CE1  4  
ATOM 7188  C CE2  . PHE A 1 36  ? 6.095   18.417  -2.313  1.00 0.00 ? 36  PHE A CE2  4  
ATOM 7189  C CZ   . PHE A 1 36  ? 6.700   18.061  -3.501  1.00 0.00 ? 36  PHE A CZ   4  
ATOM 7190  H H    . PHE A 1 36  ? -0.143  16.450  -3.838  1.00 0.00 ? 36  PHE A H    4  
ATOM 7191  H HA   . PHE A 1 36  ? 2.089   16.210  -3.828  1.00 0.00 ? 36  PHE A HA   4  
ATOM 7192  H HB2  . PHE A 1 36  ? 2.039   18.675  -4.169  1.00 0.00 ? 36  PHE A HB2  4  
ATOM 7193  H HB3  . PHE A 1 36  ? 2.147   18.896  -2.424  1.00 0.00 ? 36  PHE A HB3  4  
ATOM 7194  H HD1  . PHE A 1 36  ? 3.945   17.603  -5.392  1.00 0.00 ? 36  PHE A HD1  4  
ATOM 7195  H HD2  . PHE A 1 36  ? 4.245   18.758  -1.300  1.00 0.00 ? 36  PHE A HD2  4  
ATOM 7196  H HE1  . PHE A 1 36  ? 6.399   17.490  -5.539  1.00 0.00 ? 36  PHE A HE1  4  
ATOM 7197  H HE2  . PHE A 1 36  ? 6.699   18.644  -1.445  1.00 0.00 ? 36  PHE A HE2  4  
ATOM 7198  H HZ   . PHE A 1 36  ? 7.778   18.011  -3.566  1.00 0.00 ? 36  PHE A HZ   4  
ATOM 7199  N N    . SER A 1 37  ? 2.080   14.947  -1.621  1.00 0.00 ? 37  SER A N    4  
ATOM 7200  C CA   . SER A 1 37  ? 2.597   14.185  -0.495  1.00 0.00 ? 37  SER A CA   4  
ATOM 7201  C C    . SER A 1 37  ? 2.821   12.738  -0.937  1.00 0.00 ? 37  SER A C    4  
ATOM 7202  O O    . SER A 1 37  ? 2.950   11.823  -0.120  1.00 0.00 ? 37  SER A O    4  
ATOM 7203  C CB   . SER A 1 37  ? 1.630   14.262  0.695   1.00 0.00 ? 37  SER A CB   4  
ATOM 7204  O OG   . SER A 1 37  ? 2.190   13.671  1.859   1.00 0.00 ? 37  SER A OG   4  
ATOM 7205  H H    . SER A 1 37  ? 1.605   14.471  -2.336  1.00 0.00 ? 37  SER A H    4  
ATOM 7206  H HA   . SER A 1 37  ? 3.550   14.610  -0.211  1.00 0.00 ? 37  SER A HA   4  
ATOM 7207  H HB2  . SER A 1 37  ? 1.408   15.297  0.909   1.00 0.00 ? 37  SER A HB2  4  
ATOM 7208  H HB3  . SER A 1 37  ? 0.715   13.744  0.449   1.00 0.00 ? 37  SER A HB3  4  
ATOM 7209  H HG   . SER A 1 37  ? 1.488   13.502  2.498   1.00 0.00 ? 37  SER A HG   4  
ATOM 7210  N N    . ALA A 1 38  ? 2.913   12.554  -2.256  1.00 0.00 ? 38  ALA A N    4  
ATOM 7211  C CA   . ALA A 1 38  ? 3.035   11.229  -2.856  1.00 0.00 ? 38  ALA A CA   4  
ATOM 7212  C C    . ALA A 1 38  ? 4.423   10.655  -2.627  1.00 0.00 ? 38  ALA A C    4  
ATOM 7213  O O    . ALA A 1 38  ? 4.692   9.500   -2.960  1.00 0.00 ? 38  ALA A O    4  
ATOM 7214  C CB   . ALA A 1 38  ? 2.729   11.296  -4.343  1.00 0.00 ? 38  ALA A CB   4  
ATOM 7215  H H    . ALA A 1 38  ? 2.935   13.341  -2.840  1.00 0.00 ? 38  ALA A H    4  
ATOM 7216  H HA   . ALA A 1 38  ? 2.307   10.581  -2.390  1.00 0.00 ? 38  ALA A HA   4  
ATOM 7217  H HB1  . ALA A 1 38  ? 1.732   11.685  -4.489  1.00 0.00 ? 38  ALA A HB1  4  
ATOM 7218  H HB2  . ALA A 1 38  ? 2.794   10.307  -4.772  1.00 0.00 ? 38  ALA A HB2  4  
ATOM 7219  H HB3  . ALA A 1 38  ? 3.441   11.947  -4.829  1.00 0.00 ? 38  ALA A HB3  4  
ATOM 7220  N N    . GLU A 1 39  ? 5.290   11.475  -2.047  1.00 0.00 ? 39  GLU A N    4  
ATOM 7221  C CA   . GLU A 1 39  ? 6.661   11.074  -1.751  1.00 0.00 ? 39  GLU A CA   4  
ATOM 7222  C C    . GLU A 1 39  ? 6.658   9.805   -0.902  1.00 0.00 ? 39  GLU A C    4  
ATOM 7223  O O    . GLU A 1 39  ? 7.549   8.963   -1.014  1.00 0.00 ? 39  GLU A O    4  
ATOM 7224  C CB   . GLU A 1 39  ? 7.422   12.197  -1.025  1.00 0.00 ? 39  GLU A CB   4  
ATOM 7225  C CG   . GLU A 1 39  ? 7.429   13.538  -1.764  1.00 0.00 ? 39  GLU A CG   4  
ATOM 7226  C CD   . GLU A 1 39  ? 6.118   14.305  -1.636  1.00 0.00 ? 39  GLU A CD   4  
ATOM 7227  O OE1  . GLU A 1 39  ? 5.910   14.959  -0.590  1.00 0.00 ? 39  GLU A OE1  4  
ATOM 7228  O OE2  . GLU A 1 39  ? 5.284   14.239  -2.565  1.00 0.00 ? 39  GLU A OE2  4  
ATOM 7229  H H    . GLU A 1 39  ? 4.994   12.379  -1.812  1.00 0.00 ? 39  GLU A H    4  
ATOM 7230  H HA   . GLU A 1 39  ? 7.154   10.863  -2.690  1.00 0.00 ? 39  GLU A HA   4  
ATOM 7231  H HB2  . GLU A 1 39  ? 6.975   12.349  -0.053  1.00 0.00 ? 39  GLU A HB2  4  
ATOM 7232  H HB3  . GLU A 1 39  ? 8.449   11.884  -0.890  1.00 0.00 ? 39  GLU A HB3  4  
ATOM 7233  H HG2  . GLU A 1 39  ? 8.224   14.149  -1.364  1.00 0.00 ? 39  GLU A HG2  4  
ATOM 7234  H HG3  . GLU A 1 39  ? 7.620   13.352  -2.813  1.00 0.00 ? 39  GLU A HG3  4  
ATOM 7235  N N    . ASN A 1 40  ? 5.623   9.677   -0.079  1.00 0.00 ? 40  ASN A N    4  
ATOM 7236  C CA   . ASN A 1 40  ? 5.443   8.511   0.778   1.00 0.00 ? 40  ASN A CA   4  
ATOM 7237  C C    . ASN A 1 40  ? 5.206   7.250   -0.057  1.00 0.00 ? 40  ASN A C    4  
ATOM 7238  O O    . ASN A 1 40  ? 5.955   6.278   0.046   1.00 0.00 ? 40  ASN A O    4  
ATOM 7239  C CB   . ASN A 1 40  ? 4.261   8.735   1.736   1.00 0.00 ? 40  ASN A CB   4  
ATOM 7240  C CG   . ASN A 1 40  ? 4.499   9.879   2.713   1.00 0.00 ? 40  ASN A CG   4  
ATOM 7241  O OD1  . ASN A 1 40  ? 5.621   10.102  3.168   1.00 0.00 ? 40  ASN A OD1  4  
ATOM 7242  N ND2  . ASN A 1 40  ? 3.445   10.619  3.026   1.00 0.00 ? 40  ASN A ND2  4  
ATOM 7243  H H    . ASN A 1 40  ? 4.957   10.396  -0.045  1.00 0.00 ? 40  ASN A H    4  
ATOM 7244  H HA   . ASN A 1 40  ? 6.346   8.380   1.357   1.00 0.00 ? 40  ASN A HA   4  
ATOM 7245  H HB2  . ASN A 1 40  ? 3.375   8.959   1.156   1.00 0.00 ? 40  ASN A HB2  4  
ATOM 7246  H HB3  . ASN A 1 40  ? 4.092   7.832   2.306   1.00 0.00 ? 40  ASN A HB3  4  
ATOM 7247  H HD21 . ASN A 1 40  ? 2.581   10.395  2.619   1.00 0.00 ? 40  ASN A HD21 4  
ATOM 7248  H HD22 . ASN A 1 40  ? 3.574   11.368  3.643   1.00 0.00 ? 40  ASN A HD22 4  
ATOM 7249  N N    . VAL A 1 41  ? 4.174   7.281   -0.905  1.00 0.00 ? 41  VAL A N    4  
ATOM 7250  C CA   . VAL A 1 41  ? 3.783   6.098   -1.673  1.00 0.00 ? 41  VAL A CA   4  
ATOM 7251  C C    . VAL A 1 41  ? 4.855   5.696   -2.676  1.00 0.00 ? 41  VAL A C    4  
ATOM 7252  O O    . VAL A 1 41  ? 5.120   4.511   -2.851  1.00 0.00 ? 41  VAL A O    4  
ATOM 7253  C CB   . VAL A 1 41  ? 2.432   6.285   -2.411  1.00 0.00 ? 41  VAL A CB   4  
ATOM 7254  C CG1  . VAL A 1 41  ? 1.301   6.467   -1.412  1.00 0.00 ? 41  VAL A CG1  4  
ATOM 7255  C CG2  . VAL A 1 41  ? 2.484   7.458   -3.388  1.00 0.00 ? 41  VAL A CG2  4  
ATOM 7256  H H    . VAL A 1 41  ? 3.672   8.113   -1.018  1.00 0.00 ? 41  VAL A H    4  
ATOM 7257  H HA   . VAL A 1 41  ? 3.661   5.286   -0.966  1.00 0.00 ? 41  VAL A HA   4  
ATOM 7258  H HB   . VAL A 1 41  ? 2.231   5.384   -2.978  1.00 0.00 ? 41  VAL A HB   4  
ATOM 7259  H HG11 . VAL A 1 41  ? 0.370   6.615   -1.941  1.00 0.00 ? 41  VAL A HG11 4  
ATOM 7260  H HG12 . VAL A 1 41  ? 1.502   7.328   -0.790  1.00 0.00 ? 41  VAL A HG12 4  
ATOM 7261  H HG13 . VAL A 1 41  ? 1.224   5.586   -0.790  1.00 0.00 ? 41  VAL A HG13 4  
ATOM 7262  H HG21 . VAL A 1 41  ? 3.260   7.285   -4.119  1.00 0.00 ? 41  VAL A HG21 4  
ATOM 7263  H HG22 . VAL A 1 41  ? 2.695   8.369   -2.847  1.00 0.00 ? 41  VAL A HG22 4  
ATOM 7264  H HG23 . VAL A 1 41  ? 1.531   7.551   -3.891  1.00 0.00 ? 41  VAL A HG23 4  
ATOM 7265  N N    . THR A 1 42  ? 5.480   6.672   -3.325  1.00 0.00 ? 42  THR A N    4  
ATOM 7266  C CA   . THR A 1 42  ? 6.504   6.380   -4.319  1.00 0.00 ? 42  THR A CA   4  
ATOM 7267  C C    . THR A 1 42  ? 7.758   5.812   -3.644  1.00 0.00 ? 42  THR A C    4  
ATOM 7268  O O    . THR A 1 42  ? 8.396   4.903   -4.176  1.00 0.00 ? 42  THR A O    4  
ATOM 7269  C CB   . THR A 1 42  ? 6.846   7.625   -5.178  1.00 0.00 ? 42  THR A CB   4  
ATOM 7270  O OG1  . THR A 1 42  ? 7.820   7.293   -6.179  1.00 0.00 ? 42  THR A OG1  4  
ATOM 7271  C CG2  . THR A 1 42  ? 7.365   8.769   -4.323  1.00 0.00 ? 42  THR A CG2  4  
ATOM 7272  H H    . THR A 1 42  ? 5.249   7.606   -3.131  1.00 0.00 ? 42  THR A H    4  
ATOM 7273  H HA   . THR A 1 42  ? 6.102   5.620   -4.981  1.00 0.00 ? 42  THR A HA   4  
ATOM 7274  H HB   . THR A 1 42  ? 5.942   7.953   -5.674  1.00 0.00 ? 42  THR A HB   4  
ATOM 7275  H HG1  . THR A 1 42  ? 8.353   8.073   -6.376  1.00 0.00 ? 42  THR A HG1  4  
ATOM 7276  H HG21 . THR A 1 42  ? 8.261   8.458   -3.807  1.00 0.00 ? 42  THR A HG21 4  
ATOM 7277  H HG22 . THR A 1 42  ? 6.614   9.047   -3.599  1.00 0.00 ? 42  THR A HG22 4  
ATOM 7278  H HG23 . THR A 1 42  ? 7.588   9.617   -4.953  1.00 0.00 ? 42  THR A HG23 4  
ATOM 7279  N N    . PHE A 1 43  ? 8.088   6.327   -2.455  1.00 0.00 ? 43  PHE A N    4  
ATOM 7280  C CA   . PHE A 1 43  ? 9.175   5.769   -1.649  1.00 0.00 ? 43  PHE A CA   4  
ATOM 7281  C C    . PHE A 1 43  ? 8.849   4.324   -1.271  1.00 0.00 ? 43  PHE A C    4  
ATOM 7282  O O    . PHE A 1 43  ? 9.696   3.432   -1.364  1.00 0.00 ? 43  PHE A O    4  
ATOM 7283  C CB   . PHE A 1 43  ? 9.396   6.618   -0.383  1.00 0.00 ? 43  PHE A CB   4  
ATOM 7284  C CG   . PHE A 1 43  ? 10.440  6.066   0.561   1.00 0.00 ? 43  PHE A CG   4  
ATOM 7285  C CD1  . PHE A 1 43  ? 11.794  6.212   0.284   1.00 0.00 ? 43  PHE A CD1  4  
ATOM 7286  C CD2  . PHE A 1 43  ? 10.068  5.400   1.722   1.00 0.00 ? 43  PHE A CD2  4  
ATOM 7287  C CE1  . PHE A 1 43  ? 12.751  5.707   1.145   1.00 0.00 ? 43  PHE A CE1  4  
ATOM 7288  C CE2  . PHE A 1 43  ? 11.023  4.893   2.584   1.00 0.00 ? 43  PHE A CE2  4  
ATOM 7289  C CZ   . PHE A 1 43  ? 12.366  5.047   2.296   1.00 0.00 ? 43  PHE A CZ   4  
ATOM 7290  H H    . PHE A 1 43  ? 7.595   7.107   -2.116  1.00 0.00 ? 43  PHE A H    4  
ATOM 7291  H HA   . PHE A 1 43  ? 10.076  5.782   -2.247  1.00 0.00 ? 43  PHE A HA   4  
ATOM 7292  H HB2  . PHE A 1 43  ? 9.710   7.611   -0.676  1.00 0.00 ? 43  PHE A HB2  4  
ATOM 7293  H HB3  . PHE A 1 43  ? 8.462   6.691   0.157   1.00 0.00 ? 43  PHE A HB3  4  
ATOM 7294  H HD1  . PHE A 1 43  ? 12.101  6.728   -0.615  1.00 0.00 ? 43  PHE A HD1  4  
ATOM 7295  H HD2  . PHE A 1 43  ? 9.019   5.277   1.951   1.00 0.00 ? 43  PHE A HD2  4  
ATOM 7296  H HE1  . PHE A 1 43  ? 13.800  5.828   0.918   1.00 0.00 ? 43  PHE A HE1  4  
ATOM 7297  H HE2  . PHE A 1 43  ? 10.720  4.380   3.484   1.00 0.00 ? 43  PHE A HE2  4  
ATOM 7298  H HZ   . PHE A 1 43  ? 13.113  4.652   2.969   1.00 0.00 ? 43  PHE A HZ   4  
ATOM 7299  N N    . TRP A 1 44  ? 7.601   4.104   -0.862  1.00 0.00 ? 44  TRP A N    4  
ATOM 7300  C CA   . TRP A 1 44  ? 7.123   2.772   -0.501  1.00 0.00 ? 44  TRP A CA   4  
ATOM 7301  C C    . TRP A 1 44  ? 7.210   1.839   -1.710  1.00 0.00 ? 44  TRP A C    4  
ATOM 7302  O O    . TRP A 1 44  ? 7.659   0.696   -1.601  1.00 0.00 ? 44  TRP A O    4  
ATOM 7303  C CB   . TRP A 1 44  ? 5.673   2.850   0.010   1.00 0.00 ? 44  TRP A CB   4  
ATOM 7304  C CG   . TRP A 1 44  ? 5.169   1.563   0.596   1.00 0.00 ? 44  TRP A CG   4  
ATOM 7305  C CD1  . TRP A 1 44  ? 5.291   1.158   1.892   1.00 0.00 ? 44  TRP A CD1  4  
ATOM 7306  C CD2  . TRP A 1 44  ? 4.462   0.518   -0.085  1.00 0.00 ? 44  TRP A CD2  4  
ATOM 7307  N NE1  . TRP A 1 44  ? 4.728   -0.081  2.056   1.00 0.00 ? 44  TRP A NE1  4  
ATOM 7308  C CE2  . TRP A 1 44  ? 4.203   -0.495  0.860   1.00 0.00 ? 44  TRP A CE2  4  
ATOM 7309  C CE3  . TRP A 1 44  ? 4.025   0.337   -1.401  1.00 0.00 ? 44  TRP A CE3  4  
ATOM 7310  C CZ2  . TRP A 1 44  ? 3.531   -1.668  0.530   1.00 0.00 ? 44  TRP A CZ2  4  
ATOM 7311  C CZ3  . TRP A 1 44  ? 3.355   -0.827  -1.726  1.00 0.00 ? 44  TRP A CZ3  4  
ATOM 7312  C CH2  . TRP A 1 44  ? 3.111   -1.815  -0.764  1.00 0.00 ? 44  TRP A CH2  4  
ATOM 7313  H H    . TRP A 1 44  ? 6.982   4.863   -0.800  1.00 0.00 ? 44  TRP A H    4  
ATOM 7314  H HA   . TRP A 1 44  ? 7.759   2.390   0.286   1.00 0.00 ? 44  TRP A HA   4  
ATOM 7315  H HB2  . TRP A 1 44  ? 5.611   3.609   0.775   1.00 0.00 ? 44  TRP A HB2  4  
ATOM 7316  H HB3  . TRP A 1 44  ? 5.023   3.123   -0.810  1.00 0.00 ? 44  TRP A HB3  4  
ATOM 7317  H HD1  . TRP A 1 44  ? 5.781   1.732   2.665   1.00 0.00 ? 44  TRP A HD1  4  
ATOM 7318  H HE1  . TRP A 1 44  ? 4.699   -0.586  2.896   1.00 0.00 ? 44  TRP A HE1  4  
ATOM 7319  H HE3  . TRP A 1 44  ? 4.202   1.090   -2.155  1.00 0.00 ? 44  TRP A HE3  4  
ATOM 7320  H HZ2  . TRP A 1 44  ? 3.336   -2.440  1.259   1.00 0.00 ? 44  TRP A HZ2  4  
ATOM 7321  H HZ3  . TRP A 1 44  ? 3.005   -0.980  -2.737  1.00 0.00 ? 44  TRP A HZ3  4  
ATOM 7322  H HH2  . TRP A 1 44  ? 2.584   -2.710  -1.065  1.00 0.00 ? 44  TRP A HH2  4  
ATOM 7323  N N    . LYS A 1 45  ? 6.793   2.355   -2.864  1.00 0.00 ? 45  LYS A N    4  
ATOM 7324  C CA   . LYS A 1 45  ? 6.809   1.603   -4.117  1.00 0.00 ? 45  LYS A CA   4  
ATOM 7325  C C    . LYS A 1 45  ? 8.237   1.285   -4.546  1.00 0.00 ? 45  LYS A C    4  
ATOM 7326  O O    . LYS A 1 45  ? 8.504   0.232   -5.128  1.00 0.00 ? 45  LYS A O    4  
ATOM 7327  C CB   . LYS A 1 45  ? 6.105   2.400   -5.226  1.00 0.00 ? 45  LYS A CB   4  
ATOM 7328  C CG   . LYS A 1 45  ? 4.591   2.500   -5.066  1.00 0.00 ? 45  LYS A CG   4  
ATOM 7329  C CD   . LYS A 1 45  ? 3.955   3.407   -6.125  1.00 0.00 ? 45  LYS A CD   4  
ATOM 7330  C CE   . LYS A 1 45  ? 4.072   2.848   -7.547  1.00 0.00 ? 45  LYS A CE   4  
ATOM 7331  N NZ   . LYS A 1 45  ? 5.480   2.820   -8.039  1.00 0.00 ? 45  LYS A NZ   4  
ATOM 7332  H H    . LYS A 1 45  ? 6.466   3.276   -2.873  1.00 0.00 ? 45  LYS A H    4  
ATOM 7333  H HA   . LYS A 1 45  ? 6.278   0.676   -3.958  1.00 0.00 ? 45  LYS A HA   4  
ATOM 7334  H HB2  . LYS A 1 45  ? 6.507   3.403   -5.241  1.00 0.00 ? 45  LYS A HB2  4  
ATOM 7335  H HB3  . LYS A 1 45  ? 6.312   1.930   -6.177  1.00 0.00 ? 45  LYS A HB3  4  
ATOM 7336  H HG2  . LYS A 1 45  ? 4.164   1.510   -5.152  1.00 0.00 ? 45  LYS A HG2  4  
ATOM 7337  H HG3  . LYS A 1 45  ? 4.370   2.900   -4.085  1.00 0.00 ? 45  LYS A HG3  4  
ATOM 7338  H HD2  . LYS A 1 45  ? 2.908   3.527   -5.890  1.00 0.00 ? 45  LYS A HD2  4  
ATOM 7339  H HD3  . LYS A 1 45  ? 4.439   4.373   -6.090  1.00 0.00 ? 45  LYS A HD3  4  
ATOM 7340  H HE2  . LYS A 1 45  ? 3.681   1.841   -7.560  1.00 0.00 ? 45  LYS A HE2  4  
ATOM 7341  H HE3  . LYS A 1 45  ? 3.484   3.466   -8.211  1.00 0.00 ? 45  LYS A HE3  4  
ATOM 7342  H HZ1  . LYS A 1 45  ? 5.948   3.727   -7.841  1.00 0.00 ? 45  LYS A HZ1  4  
ATOM 7343  H HZ2  . LYS A 1 45  ? 5.500   2.657   -9.065  1.00 0.00 ? 45  LYS A HZ2  4  
ATOM 7344  H HZ3  . LYS A 1 45  ? 6.011   2.058   -7.573  1.00 0.00 ? 45  LYS A HZ3  4  
ATOM 7345  N N    . ALA A 1 46  ? 9.145   2.209   -4.265  1.00 0.00 ? 46  ALA A N    4  
ATOM 7346  C CA   . ALA A 1 46  ? 10.551  2.042   -4.610  1.00 0.00 ? 46  ALA A CA   4  
ATOM 7347  C C    . ALA A 1 46  ? 11.165  0.885   -3.826  1.00 0.00 ? 46  ALA A C    4  
ATOM 7348  O O    . ALA A 1 46  ? 11.872  0.048   -4.386  1.00 0.00 ? 46  ALA A O    4  
ATOM 7349  C CB   . ALA A 1 46  ? 11.311  3.337   -4.357  1.00 0.00 ? 46  ALA A CB   4  
ATOM 7350  H H    . ALA A 1 46  ? 8.861   3.036   -3.816  1.00 0.00 ? 46  ALA A H    4  
ATOM 7351  H HA   . ALA A 1 46  ? 10.609  1.818   -5.668  1.00 0.00 ? 46  ALA A HA   4  
ATOM 7352  H HB1  . ALA A 1 46  ? 11.316  3.554   -3.299  1.00 0.00 ? 46  ALA A HB1  4  
ATOM 7353  H HB2  . ALA A 1 46  ? 10.829  4.148   -4.887  1.00 0.00 ? 46  ALA A HB2  4  
ATOM 7354  H HB3  . ALA A 1 46  ? 12.326  3.233   -4.710  1.00 0.00 ? 46  ALA A HB3  4  
ATOM 7355  N N    . CYS A 1 47  ? 10.874  0.831   -2.530  1.00 0.00 ? 47  CYS A N    4  
ATOM 7356  C CA   . CYS A 1 47  ? 11.357  -0.255  -1.684  1.00 0.00 ? 47  CYS A CA   4  
ATOM 7357  C C    . CYS A 1 47  ? 10.590  -1.544  -1.984  1.00 0.00 ? 47  CYS A C    4  
ATOM 7358  O O    . CYS A 1 47  ? 11.118  -2.645  -1.822  1.00 0.00 ? 47  CYS A O    4  
ATOM 7359  C CB   . CYS A 1 47  ? 11.228  0.117   -0.205  1.00 0.00 ? 47  CYS A CB   4  
ATOM 7360  S SG   . CYS A 1 47  ? 11.863  -1.142  0.925   1.00 0.00 ? 47  CYS A SG   4  
ATOM 7361  H H    . CYS A 1 47  ? 10.326  1.542   -2.133  1.00 0.00 ? 47  CYS A H    4  
ATOM 7362  H HA   . CYS A 1 47  ? 12.403  -0.415  -1.915  1.00 0.00 ? 47  CYS A HA   4  
ATOM 7363  H HB2  . CYS A 1 47  ? 11.775  1.028   -0.021  1.00 0.00 ? 47  CYS A HB2  4  
ATOM 7364  H HB3  . CYS A 1 47  ? 10.185  0.275   0.031   1.00 0.00 ? 47  CYS A HB3  4  
ATOM 7365  H HG   . CYS A 1 47  ? 11.779  -2.317  0.315   1.00 0.00 ? 47  CYS A HG   4  
ATOM 7366  N N    . GLU A 1 48  ? 9.343   -1.399  -2.429  1.00 0.00 ? 48  GLU A N    4  
ATOM 7367  C CA   . GLU A 1 48  ? 8.541   -2.539  -2.871  1.00 0.00 ? 48  GLU A CA   4  
ATOM 7368  C C    . GLU A 1 48  ? 9.189   -3.171  -4.110  1.00 0.00 ? 48  GLU A C    4  
ATOM 7369  O O    . GLU A 1 48  ? 9.125   -4.383  -4.306  1.00 0.00 ? 48  GLU A O    4  
ATOM 7370  C CB   . GLU A 1 48  ? 7.088   -2.098  -3.143  1.00 0.00 ? 48  GLU A CB   4  
ATOM 7371  C CG   . GLU A 1 48  ? 6.202   -3.155  -3.810  1.00 0.00 ? 48  GLU A CG   4  
ATOM 7372  C CD   . GLU A 1 48  ? 5.916   -4.364  -2.923  1.00 0.00 ? 48  GLU A CD   4  
ATOM 7373  O OE1  . GLU A 1 48  ? 6.700   -5.336  -2.964  1.00 0.00 ? 48  GLU A OE1  4  
ATOM 7374  O OE2  . GLU A 1 48  ? 4.899   -4.353  -2.198  1.00 0.00 ? 48  GLU A OE2  4  
ATOM 7375  H H    . GLU A 1 48  ? 8.949   -0.502  -2.458  1.00 0.00 ? 48  GLU A H    4  
ATOM 7376  H HA   . GLU A 1 48  ? 8.544   -3.269  -2.071  1.00 0.00 ? 48  GLU A HA   4  
ATOM 7377  H HB2  . GLU A 1 48  ? 6.631   -1.833  -2.198  1.00 0.00 ? 48  GLU A HB2  4  
ATOM 7378  H HB3  . GLU A 1 48  ? 7.103   -1.221  -3.770  1.00 0.00 ? 48  GLU A HB3  4  
ATOM 7379  H HG2  . GLU A 1 48  ? 5.260   -2.696  -4.074  1.00 0.00 ? 48  GLU A HG2  4  
ATOM 7380  H HG3  . GLU A 1 48  ? 6.692   -3.496  -4.712  1.00 0.00 ? 48  GLU A HG3  4  
ATOM 7381  N N    . ARG A 1 49  ? 9.845   -2.343  -4.929  1.00 0.00 ? 49  ARG A N    4  
ATOM 7382  C CA   . ARG A 1 49  ? 10.633  -2.850  -6.055  1.00 0.00 ? 49  ARG A CA   4  
ATOM 7383  C C    . ARG A 1 49  ? 11.745  -3.767  -5.551  1.00 0.00 ? 49  ARG A C    4  
ATOM 7384  O O    . ARG A 1 49  ? 11.966  -4.850  -6.098  1.00 0.00 ? 49  ARG A O    4  
ATOM 7385  C CB   . ARG A 1 49  ? 11.259  -1.703  -6.862  1.00 0.00 ? 49  ARG A CB   4  
ATOM 7386  C CG   . ARG A 1 49  ? 10.288  -0.948  -7.759  1.00 0.00 ? 49  ARG A CG   4  
ATOM 7387  C CD   . ARG A 1 49  ? 11.010  0.146   -8.539  1.00 0.00 ? 49  ARG A CD   4  
ATOM 7388  N NE   . ARG A 1 49  ? 10.178  0.737   -9.588  1.00 0.00 ? 49  ARG A NE   4  
ATOM 7389  C CZ   . ARG A 1 49  ? 10.635  1.588   -10.506 1.00 0.00 ? 49  ARG A CZ   4  
ATOM 7390  N NH1  . ARG A 1 49  ? 11.914  1.957   -10.494 1.00 0.00 ? 49  ARG A NH1  4  
ATOM 7391  N NH2  . ARG A 1 49  ? 9.816   2.057   -11.439 1.00 0.00 ? 49  ARG A NH2  4  
ATOM 7392  H H    . ARG A 1 49  ? 9.794   -1.376  -4.774  1.00 0.00 ? 49  ARG A H    4  
ATOM 7393  H HA   . ARG A 1 49  ? 9.973   -3.417  -6.696  1.00 0.00 ? 49  ARG A HA   4  
ATOM 7394  H HB2  . ARG A 1 49  ? 11.696  -0.994  -6.173  1.00 0.00 ? 49  ARG A HB2  4  
ATOM 7395  H HB3  . ARG A 1 49  ? 12.048  -2.107  -7.486  1.00 0.00 ? 49  ARG A HB3  4  
ATOM 7396  H HG2  . ARG A 1 49  ? 9.837   -1.640  -8.456  1.00 0.00 ? 49  ARG A HG2  4  
ATOM 7397  H HG3  . ARG A 1 49  ? 9.518   -0.495  -7.148  1.00 0.00 ? 49  ARG A HG3  4  
ATOM 7398  H HD2  . ARG A 1 49  ? 11.301  0.925   -7.849  1.00 0.00 ? 49  ARG A HD2  4  
ATOM 7399  H HD3  . ARG A 1 49  ? 11.897  -0.278  -8.993  1.00 0.00 ? 49  ARG A HD3  4  
ATOM 7400  H HE   . ARG A 1 49  ? 9.228   0.475   -9.616  1.00 0.00 ? 49  ARG A HE   4  
ATOM 7401  H HH11 . ARG A 1 49  ? 12.539  1.594   -9.792  1.00 0.00 ? 49  ARG A HH11 4  
ATOM 7402  H HH12 . ARG A 1 49  ? 12.264  2.597   -11.179 1.00 0.00 ? 49  ARG A HH12 4  
ATOM 7403  H HH21 . ARG A 1 49  ? 8.853   1.768   -11.455 1.00 0.00 ? 49  ARG A HH21 4  
ATOM 7404  H HH22 . ARG A 1 49  ? 10.150  2.699   -12.136 1.00 0.00 ? 49  ARG A HH22 4  
ATOM 7405  N N    . PHE A 1 50  ? 12.422  -3.324  -4.490  1.00 0.00 ? 50  PHE A N    4  
ATOM 7406  C CA   . PHE A 1 50  ? 13.545  -4.060  -3.903  1.00 0.00 ? 50  PHE A CA   4  
ATOM 7407  C C    . PHE A 1 50  ? 13.132  -5.490  -3.565  1.00 0.00 ? 50  PHE A C    4  
ATOM 7408  O O    . PHE A 1 50  ? 13.909  -6.432  -3.730  1.00 0.00 ? 50  PHE A O    4  
ATOM 7409  C CB   . PHE A 1 50  ? 14.056  -3.330  -2.643  1.00 0.00 ? 50  PHE A CB   4  
ATOM 7410  C CG   . PHE A 1 50  ? 15.381  -2.640  -2.833  1.00 0.00 ? 50  PHE A CG   4  
ATOM 7411  C CD1  . PHE A 1 50  ? 15.453  -1.392  -3.431  1.00 0.00 ? 50  PHE A CD1  4  
ATOM 7412  C CD2  . PHE A 1 50  ? 16.556  -3.245  -2.415  1.00 0.00 ? 50  PHE A CD2  4  
ATOM 7413  C CE1  . PHE A 1 50  ? 16.671  -0.762  -3.605  1.00 0.00 ? 50  PHE A CE1  4  
ATOM 7414  C CE2  . PHE A 1 50  ? 17.775  -2.618  -2.588  1.00 0.00 ? 50  PHE A CE2  4  
ATOM 7415  C CZ   . PHE A 1 50  ? 17.831  -1.378  -3.183  1.00 0.00 ? 50  PHE A CZ   4  
ATOM 7416  H H    . PHE A 1 50  ? 12.148  -2.478  -4.078  1.00 0.00 ? 50  PHE A H    4  
ATOM 7417  H HA   . PHE A 1 50  ? 14.337  -4.094  -4.638  1.00 0.00 ? 50  PHE A HA   4  
ATOM 7418  H HB2  . PHE A 1 50  ? 13.334  -2.579  -2.355  1.00 0.00 ? 50  PHE A HB2  4  
ATOM 7419  H HB3  . PHE A 1 50  ? 14.162  -4.036  -1.834  1.00 0.00 ? 50  PHE A HB3  4  
ATOM 7420  H HD1  . PHE A 1 50  ? 14.546  -0.907  -3.763  1.00 0.00 ? 50  PHE A HD1  4  
ATOM 7421  H HD2  . PHE A 1 50  ? 16.515  -4.220  -1.948  1.00 0.00 ? 50  PHE A HD2  4  
ATOM 7422  H HE1  . PHE A 1 50  ? 16.714  0.212   -4.072  1.00 0.00 ? 50  PHE A HE1  4  
ATOM 7423  H HE2  . PHE A 1 50  ? 18.683  -3.101  -2.258  1.00 0.00 ? 50  PHE A HE2  4  
ATOM 7424  H HZ   . PHE A 1 50  ? 18.784  -0.888  -3.319  1.00 0.00 ? 50  PHE A HZ   4  
ATOM 7425  N N    . GLN A 1 51  ? 11.890  -5.634  -3.122  1.00 0.00 ? 51  GLN A N    4  
ATOM 7426  C CA   . GLN A 1 51  ? 11.329  -6.931  -2.760  1.00 0.00 ? 51  GLN A CA   4  
ATOM 7427  C C    . GLN A 1 51  ? 11.409  -7.907  -3.936  1.00 0.00 ? 51  GLN A C    4  
ATOM 7428  O O    . GLN A 1 51  ? 11.721  -9.088  -3.763  1.00 0.00 ? 51  GLN A O    4  
ATOM 7429  C CB   . GLN A 1 51  ? 9.869   -6.751  -2.327  1.00 0.00 ? 51  GLN A CB   4  
ATOM 7430  C CG   . GLN A 1 51  ? 9.685   -5.772  -1.173  1.00 0.00 ? 51  GLN A CG   4  
ATOM 7431  C CD   . GLN A 1 51  ? 10.222  -6.307  0.141   1.00 0.00 ? 51  GLN A CD   4  
ATOM 7432  O OE1  . GLN A 1 51  ? 11.389  -6.105  0.487   1.00 0.00 ? 51  GLN A OE1  4  
ATOM 7433  N NE2  . GLN A 1 51  ? 9.374   -7.001  0.881   1.00 0.00 ? 51  GLN A NE2  4  
ATOM 7434  H H    . GLN A 1 51  ? 11.327  -4.836  -3.037  1.00 0.00 ? 51  GLN A H    4  
ATOM 7435  H HA   . GLN A 1 51  ? 11.899  -7.327  -1.932  1.00 0.00 ? 51  GLN A HA   4  
ATOM 7436  H HB2  . GLN A 1 51  ? 9.297   -6.389  -3.170  1.00 0.00 ? 51  GLN A HB2  4  
ATOM 7437  H HB3  . GLN A 1 51  ? 9.472   -7.711  -2.024  1.00 0.00 ? 51  GLN A HB3  4  
ATOM 7438  H HG2  . GLN A 1 51  ? 10.207  -4.853  -1.412  1.00 0.00 ? 51  GLN A HG2  4  
ATOM 7439  H HG3  . GLN A 1 51  ? 8.630   -5.563  -1.058  1.00 0.00 ? 51  GLN A HG3  4  
ATOM 7440  H HE21 . GLN A 1 51  ? 8.462   -7.125  0.542   1.00 0.00 ? 51  GLN A HE21 4  
ATOM 7441  H HE22 . GLN A 1 51  ? 9.687   -7.365  1.736   1.00 0.00 ? 51  GLN A HE22 4  
ATOM 7442  N N    . GLN A 1 52  ? 11.141  -7.395  -5.134  1.00 0.00 ? 52  GLN A N    4  
ATOM 7443  C CA   . GLN A 1 52  ? 11.097  -8.221  -6.342  1.00 0.00 ? 52  GLN A CA   4  
ATOM 7444  C C    . GLN A 1 52  ? 12.480  -8.376  -6.976  1.00 0.00 ? 52  GLN A C    4  
ATOM 7445  O O    . GLN A 1 52  ? 12.684  -9.270  -7.799  1.00 0.00 ? 52  GLN A O    4  
ATOM 7446  C CB   . GLN A 1 52  ? 10.115  -7.624  -7.364  1.00 0.00 ? 52  GLN A CB   4  
ATOM 7447  C CG   . GLN A 1 52  ? 8.643   -7.926  -7.081  1.00 0.00 ? 52  GLN A CG   4  
ATOM 7448  C CD   . GLN A 1 52  ? 8.200   -7.512  -5.687  1.00 0.00 ? 52  GLN A CD   4  
ATOM 7449  O OE1  . GLN A 1 52  ? 8.244   -8.306  -4.745  1.00 0.00 ? 52  GLN A OE1  4  
ATOM 7450  N NE2  . GLN A 1 52  ? 7.777   -6.268  -5.546  1.00 0.00 ? 52  GLN A NE2  4  
ATOM 7451  H H    . GLN A 1 52  ? 10.973  -6.432  -5.212  1.00 0.00 ? 52  GLN A H    4  
ATOM 7452  H HA   . GLN A 1 52  ? 10.742  -9.201  -6.056  1.00 0.00 ? 52  GLN A HA   4  
ATOM 7453  H HB2  . GLN A 1 52  ? 10.240  -6.550  -7.379  1.00 0.00 ? 52  GLN A HB2  4  
ATOM 7454  H HB3  . GLN A 1 52  ? 10.354  -8.013  -8.346  1.00 0.00 ? 52  GLN A HB3  4  
ATOM 7455  H HG2  . GLN A 1 52  ? 8.036   -7.399  -7.804  1.00 0.00 ? 52  GLN A HG2  4  
ATOM 7456  H HG3  . GLN A 1 52  ? 8.482   -8.990  -7.192  1.00 0.00 ? 52  GLN A HG3  4  
ATOM 7457  H HE21 . GLN A 1 52  ? 7.771   -5.686  -6.335  1.00 0.00 ? 52  GLN A HE21 4  
ATOM 7458  H HE22 . GLN A 1 52  ? 7.501   -5.969  -4.648  1.00 0.00 ? 52  GLN A HE22 4  
ATOM 7459  N N    . ILE A 1 53  ? 13.427  -7.517  -6.606  1.00 0.00 ? 53  ILE A N    4  
ATOM 7460  C CA   . ILE A 1 53  ? 14.770  -7.581  -7.184  1.00 0.00 ? 53  ILE A CA   4  
ATOM 7461  C C    . ILE A 1 53  ? 15.602  -8.647  -6.463  1.00 0.00 ? 53  ILE A C    4  
ATOM 7462  O O    . ILE A 1 53  ? 15.862  -8.529  -5.263  1.00 0.00 ? 53  ILE A O    4  
ATOM 7463  C CB   . ILE A 1 53  ? 15.510  -6.219  -7.114  1.00 0.00 ? 53  ILE A CB   4  
ATOM 7464  C CG1  . ILE A 1 53  ? 14.654  -5.101  -7.737  1.00 0.00 ? 53  ILE A CG1  4  
ATOM 7465  C CG2  . ILE A 1 53  ? 16.863  -6.312  -7.825  1.00 0.00 ? 53  ILE A CG2  4  
ATOM 7466  C CD1  . ILE A 1 53  ? 15.277  -3.722  -7.635  1.00 0.00 ? 53  ILE A CD1  4  
ATOM 7467  H H    . ILE A 1 53  ? 13.226  -6.842  -5.921  1.00 0.00 ? 53  ILE A H    4  
ATOM 7468  H HA   . ILE A 1 53  ? 14.668  -7.859  -8.226  1.00 0.00 ? 53  ILE A HA   4  
ATOM 7469  H HB   . ILE A 1 53  ? 15.693  -5.986  -6.073  1.00 0.00 ? 53  ILE A HB   4  
ATOM 7470  H HG12 . ILE A 1 53  ? 14.499  -5.315  -8.784  1.00 0.00 ? 53  ILE A HG12 4  
ATOM 7471  H HG13 . ILE A 1 53  ? 13.696  -5.068  -7.237  1.00 0.00 ? 53  ILE A HG13 4  
ATOM 7472  H HG21 . ILE A 1 53  ? 17.464  -7.082  -7.361  1.00 0.00 ? 53  ILE A HG21 4  
ATOM 7473  H HG22 . ILE A 1 53  ? 17.379  -5.364  -7.750  1.00 0.00 ? 53  ILE A HG22 4  
ATOM 7474  H HG23 . ILE A 1 53  ? 16.711  -6.556  -8.867  1.00 0.00 ? 53  ILE A HG23 4  
ATOM 7475  H HD11 . ILE A 1 53  ? 14.615  -2.994  -8.079  1.00 0.00 ? 53  ILE A HD11 4  
ATOM 7476  H HD12 . ILE A 1 53  ? 16.223  -3.714  -8.157  1.00 0.00 ? 53  ILE A HD12 4  
ATOM 7477  H HD13 . ILE A 1 53  ? 15.437  -3.476  -6.596  1.00 0.00 ? 53  ILE A HD13 4  
ATOM 7478  N N    . PRO A 1 54  ? 16.008  -9.715  -7.178  1.00 0.00 ? 54  PRO A N    4  
ATOM 7479  C CA   . PRO A 1 54  ? 16.800  -10.810 -6.598  1.00 0.00 ? 54  PRO A CA   4  
ATOM 7480  C C    . PRO A 1 54  ? 18.208  -10.362 -6.198  1.00 0.00 ? 54  PRO A C    4  
ATOM 7481  O O    . PRO A 1 54  ? 18.776  -9.451  -6.806  1.00 0.00 ? 54  PRO A O    4  
ATOM 7482  C CB   . PRO A 1 54  ? 16.864  -11.859 -7.729  1.00 0.00 ? 54  PRO A CB   4  
ATOM 7483  C CG   . PRO A 1 54  ? 15.814  -11.446 -8.707  1.00 0.00 ? 54  PRO A CG   4  
ATOM 7484  C CD   . PRO A 1 54  ? 15.728  -9.951  -8.603  1.00 0.00 ? 54  PRO A CD   4  
ATOM 7485  H HA   . PRO A 1 54  ? 16.304  -11.237 -5.737  1.00 0.00 ? 54  PRO A HA   4  
ATOM 7486  H HB2  . PRO A 1 54  ? 17.848  -11.850 -8.181  1.00 0.00 ? 54  PRO A HB2  4  
ATOM 7487  H HB3  . PRO A 1 54  ? 16.662  -12.841 -7.326  1.00 0.00 ? 54  PRO A HB3  4  
ATOM 7488  H HG2  . PRO A 1 54  ? 16.103  -11.741 -9.708  1.00 0.00 ? 54  PRO A HG2  4  
ATOM 7489  H HG3  . PRO A 1 54  ? 14.867  -11.896 -8.442  1.00 0.00 ? 54  PRO A HG3  4  
ATOM 7490  H HD2  . PRO A 1 54  ? 16.475  -9.482  -9.229  1.00 0.00 ? 54  PRO A HD2  4  
ATOM 7491  H HD3  . PRO A 1 54  ? 14.738  -9.606  -8.867  1.00 0.00 ? 54  PRO A HD3  4  
ATOM 7492  N N    . ALA A 1 55  ? 18.769  -11.025 -5.186  1.00 0.00 ? 55  ALA A N    4  
ATOM 7493  C CA   . ALA A 1 55  ? 20.119  -10.726 -4.707  1.00 0.00 ? 55  ALA A CA   4  
ATOM 7494  C C    . ALA A 1 55  ? 21.144  -10.921 -5.823  1.00 0.00 ? 55  ALA A C    4  
ATOM 7495  O O    . ALA A 1 55  ? 22.206  -10.296 -5.819  1.00 0.00 ? 55  ALA A O    4  
ATOM 7496  C CB   . ALA A 1 55  ? 20.461  -11.607 -3.509  1.00 0.00 ? 55  ALA A CB   4  
ATOM 7497  H H    . ALA A 1 55  ? 18.261  -11.742 -4.752  1.00 0.00 ? 55  ALA A H    4  
ATOM 7498  H HA   . ALA A 1 55  ? 20.141  -9.693  -4.387  1.00 0.00 ? 55  ALA A HA   4  
ATOM 7499  H HB1  . ALA A 1 55  ? 21.445  -11.354 -3.141  1.00 0.00 ? 55  ALA A HB1  4  
ATOM 7500  H HB2  . ALA A 1 55  ? 20.445  -12.646 -3.806  1.00 0.00 ? 55  ALA A HB2  4  
ATOM 7501  H HB3  . ALA A 1 55  ? 19.734  -11.448 -2.725  1.00 0.00 ? 55  ALA A HB3  4  
ATOM 7502  N N    . SER A 1 56  ? 20.809  -11.793 -6.773  1.00 0.00 ? 56  SER A N    4  
ATOM 7503  C CA   . SER A 1 56  ? 21.652  -12.057 -7.933  1.00 0.00 ? 56  SER A CA   4  
ATOM 7504  C C    . SER A 1 56  ? 21.966  -10.758 -8.676  1.00 0.00 ? 56  SER A C    4  
ATOM 7505  O O    . SER A 1 56  ? 23.079  -10.558 -9.169  1.00 0.00 ? 56  SER A O    4  
ATOM 7506  C CB   . SER A 1 56  ? 20.949  -13.051 -8.870  1.00 0.00 ? 56  SER A CB   4  
ATOM 7507  O OG   . SER A 1 56  ? 21.745  -13.348 -10.005 1.00 0.00 ? 56  SER A OG   4  
ATOM 7508  H H    . SER A 1 56  ? 19.963  -12.281 -6.685  1.00 0.00 ? 56  SER A H    4  
ATOM 7509  H HA   . SER A 1 56  ? 22.576  -12.495 -7.583  1.00 0.00 ? 56  SER A HA   4  
ATOM 7510  H HB2  . SER A 1 56  ? 20.757  -13.970 -8.337  1.00 0.00 ? 56  SER A HB2  4  
ATOM 7511  H HB3  . SER A 1 56  ? 20.013  -12.628 -9.205  1.00 0.00 ? 56  SER A HB3  4  
ATOM 7512  H HG   . SER A 1 56  ? 21.474  -12.786 -10.744 1.00 0.00 ? 56  SER A HG   4  
ATOM 7513  N N    . ASP A 1 57  ? 20.984  -9.866  -8.728  1.00 0.00 ? 57  ASP A N    4  
ATOM 7514  C CA   . ASP A 1 57  ? 21.134  -8.592  -9.419  1.00 0.00 ? 57  ASP A CA   4  
ATOM 7515  C C    . ASP A 1 57  ? 21.645  -7.527  -8.454  1.00 0.00 ? 57  ASP A C    4  
ATOM 7516  O O    . ASP A 1 57  ? 21.049  -6.457  -8.318  1.00 0.00 ? 57  ASP A O    4  
ATOM 7517  C CB   . ASP A 1 57  ? 19.799  -8.159  -10.043 1.00 0.00 ? 57  ASP A CB   4  
ATOM 7518  C CG   . ASP A 1 57  ? 19.300  -9.136  -11.097 1.00 0.00 ? 57  ASP A CG   4  
ATOM 7519  O OD1  . ASP A 1 57  ? 19.937  -9.238  -12.168 1.00 0.00 ? 57  ASP A OD1  4  
ATOM 7520  O OD2  . ASP A 1 57  ? 18.276  -9.809  -10.861 1.00 0.00 ? 57  ASP A OD2  4  
ATOM 7521  H H    . ASP A 1 57  ? 20.134  -10.064 -8.280  1.00 0.00 ? 57  ASP A H    4  
ATOM 7522  H HA   . ASP A 1 57  ? 21.866  -8.721  -10.207 1.00 0.00 ? 57  ASP A HA   4  
ATOM 7523  H HB2  . ASP A 1 57  ? 19.054  -8.081  -9.264  1.00 0.00 ? 57  ASP A HB2  4  
ATOM 7524  H HB3  . ASP A 1 57  ? 19.925  -7.191  -10.508 1.00 0.00 ? 57  ASP A HB3  4  
ATOM 7525  N N    . THR A 1 58  ? 22.762  -7.824  -7.791  1.00 0.00 ? 58  THR A N    4  
ATOM 7526  C CA   . THR A 1 58  ? 23.370  -6.902  -6.836  1.00 0.00 ? 58  THR A CA   4  
ATOM 7527  C C    . THR A 1 58  ? 23.631  -5.540  -7.490  1.00 0.00 ? 58  THR A C    4  
ATOM 7528  O O    . THR A 1 58  ? 23.413  -4.490  -6.882  1.00 0.00 ? 58  THR A O    4  
ATOM 7529  C CB   . THR A 1 58  ? 24.699  -7.472  -6.284  1.00 0.00 ? 58  THR A CB   4  
ATOM 7530  O OG1  . THR A 1 58  ? 24.535  -8.858  -5.937  1.00 0.00 ? 58  THR A OG1  4  
ATOM 7531  C CG2  . THR A 1 58  ? 25.164  -6.693  -5.055  1.00 0.00 ? 58  THR A CG2  4  
ATOM 7532  H H    . THR A 1 58  ? 23.191  -8.692  -7.950  1.00 0.00 ? 58  THR A H    4  
ATOM 7533  H HA   . THR A 1 58  ? 22.682  -6.773  -6.012  1.00 0.00 ? 58  THR A HA   4  
ATOM 7534  H HB   . THR A 1 58  ? 25.456  -7.392  -7.052  1.00 0.00 ? 58  THR A HB   4  
ATOM 7535  H HG1  . THR A 1 58  ? 23.620  -9.015  -5.664  1.00 0.00 ? 58  THR A HG1  4  
ATOM 7536  H HG21 . THR A 1 58  ? 25.332  -5.660  -5.323  1.00 0.00 ? 58  THR A HG21 4  
ATOM 7537  H HG22 . THR A 1 58  ? 26.083  -7.122  -4.685  1.00 0.00 ? 58  THR A HG22 4  
ATOM 7538  H HG23 . THR A 1 58  ? 24.407  -6.745  -4.285  1.00 0.00 ? 58  THR A HG23 4  
ATOM 7539  N N    . GLN A 1 59  ? 24.074  -5.578  -8.746  1.00 0.00 ? 59  GLN A N    4  
ATOM 7540  C CA   . GLN A 1 59  ? 24.353  -4.366  -9.513  1.00 0.00 ? 59  GLN A CA   4  
ATOM 7541  C C    . GLN A 1 59  ? 23.080  -3.535  -9.707  1.00 0.00 ? 59  GLN A C    4  
ATOM 7542  O O    . GLN A 1 59  ? 23.120  -2.301  -9.676  1.00 0.00 ? 59  GLN A O    4  
ATOM 7543  C CB   . GLN A 1 59  ? 24.963  -4.738  -10.873 1.00 0.00 ? 59  GLN A CB   4  
ATOM 7544  C CG   . GLN A 1 59  ? 26.319  -5.430  -10.763 1.00 0.00 ? 59  GLN A CG   4  
ATOM 7545  C CD   . GLN A 1 59  ? 26.810  -5.977  -12.092 1.00 0.00 ? 59  GLN A CD   4  
ATOM 7546  O OE1  . GLN A 1 59  ? 27.482  -5.283  -12.856 1.00 0.00 ? 59  GLN A OE1  4  
ATOM 7547  N NE2  . GLN A 1 59  ? 26.477  -7.229  -12.374 1.00 0.00 ? 59  GLN A NE2  4  
ATOM 7548  H H    . GLN A 1 59  ? 24.222  -6.452  -9.169  1.00 0.00 ? 59  GLN A H    4  
ATOM 7549  H HA   . GLN A 1 59  ? 25.071  -3.778  -8.957  1.00 0.00 ? 59  GLN A HA   4  
ATOM 7550  H HB2  . GLN A 1 59  ? 24.281  -5.401  -11.389 1.00 0.00 ? 59  GLN A HB2  4  
ATOM 7551  H HB3  . GLN A 1 59  ? 25.087  -3.838  -11.459 1.00 0.00 ? 59  GLN A HB3  4  
ATOM 7552  H HG2  . GLN A 1 59  ? 27.044  -4.716  -10.398 1.00 0.00 ? 59  GLN A HG2  4  
ATOM 7553  H HG3  . GLN A 1 59  ? 26.237  -6.249  -10.060 1.00 0.00 ? 59  GLN A HG3  4  
ATOM 7554  H HE21 . GLN A 1 59  ? 25.940  -7.723  -11.717 1.00 0.00 ? 59  GLN A HE21 4  
ATOM 7555  H HE22 . GLN A 1 59  ? 26.782  -7.612  -13.224 1.00 0.00 ? 59  GLN A HE22 4  
ATOM 7556  N N    . GLN A 1 60  ? 21.956  -4.224  -9.891  1.00 0.00 ? 60  GLN A N    4  
ATOM 7557  C CA   . GLN A 1 60  ? 20.659  -3.567  -10.054 1.00 0.00 ? 60  GLN A CA   4  
ATOM 7558  C C    . GLN A 1 60  ? 20.213  -2.967  -8.724  1.00 0.00 ? 60  GLN A C    4  
ATOM 7559  O O    . GLN A 1 60  ? 19.699  -1.848  -8.673  1.00 0.00 ? 60  GLN A O    4  
ATOM 7560  C CB   . GLN A 1 60  ? 19.615  -4.572  -10.567 1.00 0.00 ? 60  GLN A CB   4  
ATOM 7561  C CG   . GLN A 1 60  ? 18.218  -3.990  -10.789 1.00 0.00 ? 60  GLN A CG   4  
ATOM 7562  C CD   . GLN A 1 60  ? 18.153  -2.963  -11.913 1.00 0.00 ? 60  GLN A CD   4  
ATOM 7563  O OE1  . GLN A 1 60  ? 19.111  -2.235  -12.175 1.00 0.00 ? 60  GLN A OE1  4  
ATOM 7564  N NE2  . GLN A 1 60  ? 17.016  -2.899  -12.590 1.00 0.00 ? 60  GLN A NE2  4  
ATOM 7565  H H    . GLN A 1 60  ? 21.998  -5.202  -9.912  1.00 0.00 ? 60  GLN A H    4  
ATOM 7566  H HA   . GLN A 1 60  ? 20.774  -2.772  -10.778 1.00 0.00 ? 60  GLN A HA   4  
ATOM 7567  H HB2  . GLN A 1 60  ? 19.961  -4.982  -11.505 1.00 0.00 ? 60  GLN A HB2  4  
ATOM 7568  H HB3  . GLN A 1 60  ? 19.533  -5.377  -9.848  1.00 0.00 ? 60  GLN A HB3  4  
ATOM 7569  H HG2  . GLN A 1 60  ? 17.543  -4.800  -11.029 1.00 0.00 ? 60  GLN A HG2  4  
ATOM 7570  H HG3  . GLN A 1 60  ? 17.892  -3.518  -9.873  1.00 0.00 ? 60  GLN A HG3  4  
ATOM 7571  H HE21 . GLN A 1 60  ? 16.287  -3.506  -12.333 1.00 0.00 ? 60  GLN A HE21 4  
ATOM 7572  H HE22 . GLN A 1 60  ? 16.947  -2.249  -13.322 1.00 0.00 ? 60  GLN A HE22 4  
ATOM 7573  N N    . LEU A 1 61  ? 20.429  -3.725  -7.649  1.00 0.00 ? 61  LEU A N    4  
ATOM 7574  C CA   . LEU A 1 61  ? 20.118  -3.269  -6.296  1.00 0.00 ? 61  LEU A CA   4  
ATOM 7575  C C    . LEU A 1 61  ? 20.839  -1.957  -5.998  1.00 0.00 ? 61  LEU A C    4  
ATOM 7576  O O    . LEU A 1 61  ? 20.273  -1.049  -5.396  1.00 0.00 ? 61  LEU A O    4  
ATOM 7577  C CB   . LEU A 1 61  ? 20.527  -4.339  -5.269  1.00 0.00 ? 61  LEU A CB   4  
ATOM 7578  C CG   . LEU A 1 61  ? 19.711  -5.641  -5.310  1.00 0.00 ? 61  LEU A CG   4  
ATOM 7579  C CD1  . LEU A 1 61  ? 20.367  -6.719  -4.450  1.00 0.00 ? 61  LEU A CD1  4  
ATOM 7580  C CD2  . LEU A 1 61  ? 18.279  -5.389  -4.846  1.00 0.00 ? 61  LEU A CD2  4  
ATOM 7581  H H    . LEU A 1 61  ? 20.812  -4.620  -7.771  1.00 0.00 ? 61  LEU A H    4  
ATOM 7582  H HA   . LEU A 1 61  ? 19.052  -3.107  -6.234  1.00 0.00 ? 61  LEU A HA   4  
ATOM 7583  H HB2  . LEU A 1 61  ? 21.568  -4.585  -5.436  1.00 0.00 ? 61  LEU A HB2  4  
ATOM 7584  H HB3  . LEU A 1 61  ? 20.434  -3.913  -4.279  1.00 0.00 ? 61  LEU A HB3  4  
ATOM 7585  H HG   . LEU A 1 61  ? 19.674  -6.005  -6.326  1.00 0.00 ? 61  LEU A HG   4  
ATOM 7586  H HD11 . LEU A 1 61  ? 19.783  -7.627  -4.502  1.00 0.00 ? 61  LEU A HD11 4  
ATOM 7587  H HD12 . LEU A 1 61  ? 20.418  -6.385  -3.424  1.00 0.00 ? 61  LEU A HD12 4  
ATOM 7588  H HD13 . LEU A 1 61  ? 21.364  -6.913  -4.814  1.00 0.00 ? 61  LEU A HD13 4  
ATOM 7589  H HD21 . LEU A 1 61  ? 17.722  -6.314  -4.875  1.00 0.00 ? 61  LEU A HD21 4  
ATOM 7590  H HD22 . LEU A 1 61  ? 17.810  -4.667  -5.499  1.00 0.00 ? 61  LEU A HD22 4  
ATOM 7591  H HD23 . LEU A 1 61  ? 18.287  -5.007  -3.833  1.00 0.00 ? 61  LEU A HD23 4  
ATOM 7592  N N    . ALA A 1 62  ? 22.091  -1.868  -6.442  1.00 0.00 ? 62  ALA A N    4  
ATOM 7593  C CA   . ALA A 1 62  ? 22.904  -0.671  -6.233  1.00 0.00 ? 62  ALA A CA   4  
ATOM 7594  C C    . ALA A 1 62  ? 22.289  0.543   -6.926  1.00 0.00 ? 62  ALA A C    4  
ATOM 7595  O O    . ALA A 1 62  ? 22.162  1.615   -6.328  1.00 0.00 ? 62  ALA A O    4  
ATOM 7596  C CB   . ALA A 1 62  ? 24.326  -0.903  -6.735  1.00 0.00 ? 62  ALA A CB   4  
ATOM 7597  H H    . ALA A 1 62  ? 22.482  -2.632  -6.917  1.00 0.00 ? 62  ALA A H    4  
ATOM 7598  H HA   . ALA A 1 62  ? 22.949  -0.483  -5.169  1.00 0.00 ? 62  ALA A HA   4  
ATOM 7599  H HB1  . ALA A 1 62  ? 24.925  -0.024  -6.542  1.00 0.00 ? 62  ALA A HB1  4  
ATOM 7600  H HB2  . ALA A 1 62  ? 24.308  -1.099  -7.798  1.00 0.00 ? 62  ALA A HB2  4  
ATOM 7601  H HB3  . ALA A 1 62  ? 24.756  -1.749  -6.221  1.00 0.00 ? 62  ALA A HB3  4  
ATOM 7602  N N    . GLN A 1 63  ? 21.899  0.364   -8.184  1.00 0.00 ? 63  GLN A N    4  
ATOM 7603  C CA   . GLN A 1 63  ? 21.348  1.459   -8.976  1.00 0.00 ? 63  GLN A CA   4  
ATOM 7604  C C    . GLN A 1 63  ? 19.979  1.884   -8.448  1.00 0.00 ? 63  GLN A C    4  
ATOM 7605  O O    . GLN A 1 63  ? 19.663  3.076   -8.417  1.00 0.00 ? 63  GLN A O    4  
ATOM 7606  C CB   . GLN A 1 63  ? 21.247  1.063   -10.456 1.00 0.00 ? 63  GLN A CB   4  
ATOM 7607  C CG   . GLN A 1 63  ? 22.582  0.679   -11.086 1.00 0.00 ? 63  GLN A CG   4  
ATOM 7608  C CD   . GLN A 1 63  ? 23.672  1.714   -10.849 1.00 0.00 ? 63  GLN A CD   4  
ATOM 7609  O OE1  . GLN A 1 63  ? 24.430  1.628   -9.880  1.00 0.00 ? 63  GLN A OE1  4  
ATOM 7610  N NE2  . GLN A 1 63  ? 23.757  2.701   -11.725 1.00 0.00 ? 63  GLN A NE2  4  
ATOM 7611  H H    . GLN A 1 63  ? 21.986  -0.524  -8.591  1.00 0.00 ? 63  GLN A H    4  
ATOM 7612  H HA   . GLN A 1 63  ? 22.023  2.299   -8.887  1.00 0.00 ? 63  GLN A HA   4  
ATOM 7613  H HB2  . GLN A 1 63  ? 20.578  0.219   -10.546 1.00 0.00 ? 63  GLN A HB2  4  
ATOM 7614  H HB3  . GLN A 1 63  ? 20.839  1.896   -11.012 1.00 0.00 ? 63  GLN A HB3  4  
ATOM 7615  H HG2  . GLN A 1 63  ? 22.907  -0.262  -10.665 1.00 0.00 ? 63  GLN A HG2  4  
ATOM 7616  H HG3  . GLN A 1 63  ? 22.443  0.560   -12.151 1.00 0.00 ? 63  GLN A HG3  4  
ATOM 7617  H HE21 . GLN A 1 63  ? 23.119  2.713   -12.474 1.00 0.00 ? 63  GLN A HE21 4  
ATOM 7618  H HE22 . GLN A 1 63  ? 24.458  3.375   -11.601 1.00 0.00 ? 63  GLN A HE22 4  
ATOM 7619  N N    . GLU A 1 64  ? 19.177  0.909   -8.026  1.00 0.00 ? 64  GLU A N    4  
ATOM 7620  C CA   . GLU A 1 64  ? 17.852  1.191   -7.482  1.00 0.00 ? 64  GLU A CA   4  
ATOM 7621  C C    . GLU A 1 64  ? 17.980  1.886   -6.126  1.00 0.00 ? 64  GLU A C    4  
ATOM 7622  O O    . GLU A 1 64  ? 17.287  2.863   -5.857  1.00 0.00 ? 64  GLU A O    4  
ATOM 7623  C CB   . GLU A 1 64  ? 17.026  -0.098  -7.360  1.00 0.00 ? 64  GLU A CB   4  
ATOM 7624  C CG   . GLU A 1 64  ? 15.577  0.128   -6.917  1.00 0.00 ? 64  GLU A CG   4  
ATOM 7625  C CD   . GLU A 1 64  ? 14.791  1.028   -7.866  1.00 0.00 ? 64  GLU A CD   4  
ATOM 7626  O OE1  . GLU A 1 64  ? 14.328  0.537   -8.922  1.00 0.00 ? 64  GLU A OE1  4  
ATOM 7627  O OE2  . GLU A 1 64  ? 14.639  2.231   -7.568  1.00 0.00 ? 64  GLU A OE2  4  
ATOM 7628  H H    . GLU A 1 64  ? 19.482  -0.021  -8.087  1.00 0.00 ? 64  GLU A H    4  
ATOM 7629  H HA   . GLU A 1 64  ? 17.353  1.863   -8.168  1.00 0.00 ? 64  GLU A HA   4  
ATOM 7630  H HB2  . GLU A 1 64  ? 17.013  -0.594  -8.320  1.00 0.00 ? 64  GLU A HB2  4  
ATOM 7631  H HB3  . GLU A 1 64  ? 17.501  -0.750  -6.639  1.00 0.00 ? 64  GLU A HB3  4  
ATOM 7632  H HG2  . GLU A 1 64  ? 15.080  -0.830  -6.862  1.00 0.00 ? 64  GLU A HG2  4  
ATOM 7633  H HG3  . GLU A 1 64  ? 15.583  0.580   -5.935  1.00 0.00 ? 64  GLU A HG3  4  
ATOM 7634  N N    . ALA A 1 65  ? 18.894  1.394   -5.289  1.00 0.00 ? 65  ALA A N    4  
ATOM 7635  C CA   . ALA A 1 65  ? 19.167  2.017   -3.992  1.00 0.00 ? 65  ALA A CA   4  
ATOM 7636  C C    . ALA A 1 65  ? 19.569  3.473   -4.185  1.00 0.00 ? 65  ALA A C    4  
ATOM 7637  O O    . ALA A 1 65  ? 19.117  4.360   -3.462  1.00 0.00 ? 65  ALA A O    4  
ATOM 7638  C CB   . ALA A 1 65  ? 20.266  1.260   -3.249  1.00 0.00 ? 65  ALA A CB   4  
ATOM 7639  H H    . ALA A 1 65  ? 19.395  0.593   -5.547  1.00 0.00 ? 65  ALA A H    4  
ATOM 7640  H HA   . ALA A 1 65  ? 18.263  1.974   -3.398  1.00 0.00 ? 65  ALA A HA   4  
ATOM 7641  H HB1  . ALA A 1 65  ? 19.960  0.235   -3.099  1.00 0.00 ? 65  ALA A HB1  4  
ATOM 7642  H HB2  . ALA A 1 65  ? 20.443  1.725   -2.290  1.00 0.00 ? 65  ALA A HB2  4  
ATOM 7643  H HB3  . ALA A 1 65  ? 21.177  1.280   -3.832  1.00 0.00 ? 65  ALA A HB3  4  
ATOM 7644  N N    . ARG A 1 66  ? 20.415  3.705   -5.183  1.00 0.00 ? 66  ARG A N    4  
ATOM 7645  C CA   . ARG A 1 66  ? 20.859  5.049   -5.532  1.00 0.00 ? 66  ARG A CA   4  
ATOM 7646  C C    . ARG A 1 66  ? 19.699  5.868   -6.098  1.00 0.00 ? 66  ARG A C    4  
ATOM 7647  O O    . ARG A 1 66  ? 19.613  7.075   -5.876  1.00 0.00 ? 66  ARG A O    4  
ATOM 7648  C CB   . ARG A 1 66  ? 22.013  4.970   -6.542  1.00 0.00 ? 66  ARG A CB   4  
ATOM 7649  C CG   . ARG A 1 66  ? 22.528  6.324   -7.017  1.00 0.00 ? 66  ARG A CG   4  
ATOM 7650  C CD   . ARG A 1 66  ? 23.785  6.176   -7.867  1.00 0.00 ? 66  ARG A CD   4  
ATOM 7651  N NE   . ARG A 1 66  ? 24.903  5.627   -7.092  1.00 0.00 ? 66  ARG A NE   4  
ATOM 7652  C CZ   . ARG A 1 66  ? 25.516  4.471   -7.360  1.00 0.00 ? 66  ARG A CZ   4  
ATOM 7653  N NH1  . ARG A 1 66  ? 25.121  3.724   -8.384  1.00 0.00 ? 66  ARG A NH1  4  
ATOM 7654  N NH2  . ARG A 1 66  ? 26.530  4.073   -6.602  1.00 0.00 ? 66  ARG A NH2  4  
ATOM 7655  H H    . ARG A 1 66  ? 20.757  2.942   -5.700  1.00 0.00 ? 66  ARG A H    4  
ATOM 7656  H HA   . ARG A 1 66  ? 21.215  5.526   -4.630  1.00 0.00 ? 66  ARG A HA   4  
ATOM 7657  H HB2  . ARG A 1 66  ? 22.836  4.439   -6.085  1.00 0.00 ? 66  ARG A HB2  4  
ATOM 7658  H HB3  . ARG A 1 66  ? 21.678  4.413   -7.407  1.00 0.00 ? 66  ARG A HB3  4  
ATOM 7659  H HG2  . ARG A 1 66  ? 21.760  6.805   -7.608  1.00 0.00 ? 66  ARG A HG2  4  
ATOM 7660  H HG3  . ARG A 1 66  ? 22.756  6.936   -6.157  1.00 0.00 ? 66  ARG A HG3  4  
ATOM 7661  H HD2  . ARG A 1 66  ? 23.569  5.518   -8.698  1.00 0.00 ? 66  ARG A HD2  4  
ATOM 7662  H HD3  . ARG A 1 66  ? 24.066  7.149   -8.245  1.00 0.00 ? 66  ARG A HD3  4  
ATOM 7663  H HE   . ARG A 1 66  ? 25.218  6.158   -6.325  1.00 0.00 ? 66  ARG A HE   4  
ATOM 7664  H HH11 . ARG A 1 66  ? 24.359  4.022   -8.958  1.00 0.00 ? 66  ARG A HH11 4  
ATOM 7665  H HH12 . ARG A 1 66  ? 25.583  2.857   -8.587  1.00 0.00 ? 66  ARG A HH12 4  
ATOM 7666  H HH21 . ARG A 1 66  ? 26.832  4.643   -5.830  1.00 0.00 ? 66  ARG A HH21 4  
ATOM 7667  H HH22 . ARG A 1 66  ? 26.998  3.201   -6.789  1.00 0.00 ? 66  ARG A HH22 4  
ATOM 7668  N N    . ASN A 1 67  ? 18.804  5.191   -6.813  1.00 0.00 ? 67  ASN A N    4  
ATOM 7669  C CA   . ASN A 1 67  ? 17.620  5.827   -7.396  1.00 0.00 ? 67  ASN A CA   4  
ATOM 7670  C C    . ASN A 1 67  ? 16.656  6.281   -6.296  1.00 0.00 ? 67  ASN A C    4  
ATOM 7671  O O    . ASN A 1 67  ? 16.016  7.330   -6.409  1.00 0.00 ? 67  ASN A O    4  
ATOM 7672  C CB   . ASN A 1 67  ? 16.923  4.856   -8.363  1.00 0.00 ? 67  ASN A CB   4  
ATOM 7673  C CG   . ASN A 1 67  ? 15.595  5.381   -8.882  1.00 0.00 ? 67  ASN A CG   4  
ATOM 7674  O OD1  . ASN A 1 67  ? 15.547  6.138   -9.851  1.00 0.00 ? 67  ASN A OD1  4  
ATOM 7675  N ND2  . ASN A 1 67  ? 14.503  4.944   -8.272  1.00 0.00 ? 67  ASN A ND2  4  
ATOM 7676  H H    . ASN A 1 67  ? 18.943  4.231   -6.957  1.00 0.00 ? 67  ASN A H    4  
ATOM 7677  H HA   . ASN A 1 67  ? 17.950  6.697   -7.948  1.00 0.00 ? 67  ASN A HA   4  
ATOM 7678  H HB2  . ASN A 1 67  ? 17.570  4.680   -9.211  1.00 0.00 ? 67  ASN A HB2  4  
ATOM 7679  H HB3  . ASN A 1 67  ? 16.746  3.919   -7.855  1.00 0.00 ? 67  ASN A HB3  4  
ATOM 7680  H HD21 . ASN A 1 67  ? 14.609  4.301   -7.531  1.00 0.00 ? 67  ASN A HD21 4  
ATOM 7681  H HD22 . ASN A 1 67  ? 13.636  5.288   -8.569  1.00 0.00 ? 67  ASN A HD22 4  
ATOM 7682  N N    . ILE A 1 68  ? 16.560  5.483   -5.236  1.00 0.00 ? 68  ILE A N    4  
ATOM 7683  C CA   . ILE A 1 68  ? 15.765  5.844   -4.065  1.00 0.00 ? 68  ILE A CA   4  
ATOM 7684  C C    . ILE A 1 68  ? 16.474  6.956   -3.289  1.00 0.00 ? 68  ILE A C    4  
ATOM 7685  O O    . ILE A 1 68  ? 15.858  7.937   -2.858  1.00 0.00 ? 68  ILE A O    4  
ATOM 7686  C CB   . ILE A 1 68  ? 15.548  4.627   -3.120  1.00 0.00 ? 68  ILE A CB   4  
ATOM 7687  C CG1  . ILE A 1 68  ? 14.910  3.449   -3.882  1.00 0.00 ? 68  ILE A CG1  4  
ATOM 7688  C CG2  . ILE A 1 68  ? 14.686  5.021   -1.920  1.00 0.00 ? 68  ILE A CG2  4  
ATOM 7689  C CD1  . ILE A 1 68  ? 14.636  2.223   -3.025  1.00 0.00 ? 68  ILE A CD1  4  
ATOM 7690  H H    . ILE A 1 68  ? 17.032  4.624   -5.243  1.00 0.00 ? 68  ILE A H    4  
ATOM 7691  H HA   . ILE A 1 68  ? 14.800  6.201   -4.403  1.00 0.00 ? 68  ILE A HA   4  
ATOM 7692  H HB   . ILE A 1 68  ? 16.515  4.317   -2.745  1.00 0.00 ? 68  ILE A HB   4  
ATOM 7693  H HG12 . ILE A 1 68  ? 13.970  3.771   -4.303  1.00 0.00 ? 68  ILE A HG12 4  
ATOM 7694  H HG13 . ILE A 1 68  ? 15.569  3.150   -4.684  1.00 0.00 ? 68  ILE A HG13 4  
ATOM 7695  H HG21 . ILE A 1 68  ? 13.712  5.343   -2.263  1.00 0.00 ? 68  ILE A HG21 4  
ATOM 7696  H HG22 . ILE A 1 68  ? 15.161  5.829   -1.383  1.00 0.00 ? 68  ILE A HG22 4  
ATOM 7697  H HG23 . ILE A 1 68  ? 14.571  4.172   -1.260  1.00 0.00 ? 68  ILE A HG23 4  
ATOM 7698  H HD11 . ILE A 1 68  ? 14.165  1.459   -3.626  1.00 0.00 ? 68  ILE A HD11 4  
ATOM 7699  H HD12 . ILE A 1 68  ? 13.980  2.488   -2.207  1.00 0.00 ? 68  ILE A HD12 4  
ATOM 7700  H HD13 . ILE A 1 68  ? 15.565  1.840   -2.627  1.00 0.00 ? 68  ILE A HD13 4  
ATOM 7701  N N    . TYR A 1 69  ? 17.785  6.793   -3.144  1.00 0.00 ? 69  TYR A N    4  
ATOM 7702  C CA   . TYR A 1 69  ? 18.608  7.692   -2.347  1.00 0.00 ? 69  TYR A CA   4  
ATOM 7703  C C    . TYR A 1 69  ? 18.595  9.111   -2.917  1.00 0.00 ? 69  TYR A C    4  
ATOM 7704  O O    . TYR A 1 69  ? 18.176  10.052  -2.248  1.00 0.00 ? 69  TYR A O    4  
ATOM 7705  C CB   . TYR A 1 69  ? 20.046  7.155   -2.280  1.00 0.00 ? 69  TYR A CB   4  
ATOM 7706  C CG   . TYR A 1 69  ? 20.961  7.917   -1.336  1.00 0.00 ? 69  TYR A CG   4  
ATOM 7707  C CD1  . TYR A 1 69  ? 21.015  7.599   0.018   1.00 0.00 ? 69  TYR A CD1  4  
ATOM 7708  C CD2  . TYR A 1 69  ? 21.777  8.945   -1.797  1.00 0.00 ? 69  TYR A CD2  4  
ATOM 7709  C CE1  . TYR A 1 69  ? 21.853  8.280   0.881   1.00 0.00 ? 69  TYR A CE1  4  
ATOM 7710  C CE2  . TYR A 1 69  ? 22.616  9.631   -0.941  1.00 0.00 ? 69  TYR A CE2  4  
ATOM 7711  C CZ   . TYR A 1 69  ? 22.652  9.294   0.399   1.00 0.00 ? 69  TYR A CZ   4  
ATOM 7712  O OH   . TYR A 1 69  ? 23.491  9.969   1.257   1.00 0.00 ? 69  TYR A OH   4  
ATOM 7713  H H    . TYR A 1 69  ? 18.215  6.032   -3.590  1.00 0.00 ? 69  TYR A H    4  
ATOM 7714  H HA   . TYR A 1 69  ? 18.198  7.714   -1.349  1.00 0.00 ? 69  TYR A HA   4  
ATOM 7715  H HB2  . TYR A 1 69  ? 20.020  6.125   -1.951  1.00 0.00 ? 69  TYR A HB2  4  
ATOM 7716  H HB3  . TYR A 1 69  ? 20.483  7.194   -3.269  1.00 0.00 ? 69  TYR A HB3  4  
ATOM 7717  H HD1  . TYR A 1 69  ? 20.389  6.803   0.396   1.00 0.00 ? 69  TYR A HD1  4  
ATOM 7718  H HD2  . TYR A 1 69  ? 21.749  9.206   -2.845  1.00 0.00 ? 69  TYR A HD2  4  
ATOM 7719  H HE1  . TYR A 1 69  ? 21.880  8.014   1.929   1.00 0.00 ? 69  TYR A HE1  4  
ATOM 7720  H HE2  . TYR A 1 69  ? 23.241  10.426  -1.323  1.00 0.00 ? 69  TYR A HE2  4  
ATOM 7721  H HH   . TYR A 1 69  ? 23.409  10.915  1.109   1.00 0.00 ? 69  TYR A HH   4  
ATOM 7722  N N    . GLN A 1 70  ? 19.011  9.251   -4.169  1.00 0.00 ? 70  GLN A N    4  
ATOM 7723  C CA   . GLN A 1 70  ? 19.228  10.568  -4.774  1.00 0.00 ? 70  GLN A CA   4  
ATOM 7724  C C    . GLN A 1 70  ? 17.923  11.240  -5.216  1.00 0.00 ? 70  GLN A C    4  
ATOM 7725  O O    . GLN A 1 70  ? 17.936  12.115  -6.087  1.00 0.00 ? 70  GLN A O    4  
ATOM 7726  C CB   . GLN A 1 70  ? 20.204  10.448  -5.952  1.00 0.00 ? 70  GLN A CB   4  
ATOM 7727  C CG   . GLN A 1 70  ? 21.646  10.191  -5.521  1.00 0.00 ? 70  GLN A CG   4  
ATOM 7728  C CD   . GLN A 1 70  ? 22.602  10.003  -6.689  1.00 0.00 ? 70  GLN A CD   4  
ATOM 7729  O OE1  . GLN A 1 70  ? 23.594  9.285   -6.579  1.00 0.00 ? 70  GLN A OE1  4  
ATOM 7730  N NE2  . GLN A 1 70  ? 22.319  10.651  -7.812  1.00 0.00 ? 70  GLN A NE2  4  
ATOM 7731  H H    . GLN A 1 70  ? 19.169  8.448   -4.711  1.00 0.00 ? 70  GLN A H    4  
ATOM 7732  H HA   . GLN A 1 70  ? 19.683  11.194  -4.021  1.00 0.00 ? 70  GLN A HA   4  
ATOM 7733  H HB2  . GLN A 1 70  ? 19.887  9.633   -6.588  1.00 0.00 ? 70  GLN A HB2  4  
ATOM 7734  H HB3  . GLN A 1 70  ? 20.181  11.367  -6.523  1.00 0.00 ? 70  GLN A HB3  4  
ATOM 7735  H HG2  . GLN A 1 70  ? 21.987  11.033  -4.936  1.00 0.00 ? 70  GLN A HG2  4  
ATOM 7736  H HG3  . GLN A 1 70  ? 21.673  9.301   -4.906  1.00 0.00 ? 70  GLN A HG3  4  
ATOM 7737  H HE21 . GLN A 1 70  ? 21.517  11.215  -7.837  1.00 0.00 ? 70  GLN A HE21 4  
ATOM 7738  H HE22 . GLN A 1 70  ? 22.925  10.538  -8.575  1.00 0.00 ? 70  GLN A HE22 4  
ATOM 7739  N N    . GLU A 1 71  ? 16.805  10.859  -4.604  1.00 0.00 ? 71  GLU A N    4  
ATOM 7740  C CA   . GLU A 1 71  ? 15.528  11.516  -4.869  1.00 0.00 ? 71  GLU A CA   4  
ATOM 7741  C C    . GLU A 1 71  ? 14.747  11.734  -3.571  1.00 0.00 ? 71  GLU A C    4  
ATOM 7742  O O    . GLU A 1 71  ? 14.098  12.771  -3.397  1.00 0.00 ? 71  GLU A O    4  
ATOM 7743  C CB   . GLU A 1 71  ? 14.694  10.705  -5.875  1.00 0.00 ? 71  GLU A CB   4  
ATOM 7744  C CG   . GLU A 1 71  ? 13.392  11.394  -6.284  1.00 0.00 ? 71  GLU A CG   4  
ATOM 7745  C CD   . GLU A 1 71  ? 12.693  10.706  -7.444  1.00 0.00 ? 71  GLU A CD   4  
ATOM 7746  O OE1  . GLU A 1 71  ? 11.874  9.796   -7.203  1.00 0.00 ? 71  GLU A OE1  4  
ATOM 7747  O OE2  . GLU A 1 71  ? 12.955  11.076  -8.609  1.00 0.00 ? 71  GLU A OE2  4  
ATOM 7748  H H    . GLU A 1 71  ? 16.840  10.120  -3.965  1.00 0.00 ? 71  GLU A H    4  
ATOM 7749  H HA   . GLU A 1 71  ? 15.742  12.484  -5.301  1.00 0.00 ? 71  GLU A HA   4  
ATOM 7750  H HB2  . GLU A 1 71  ? 15.286  10.541  -6.764  1.00 0.00 ? 71  GLU A HB2  4  
ATOM 7751  H HB3  . GLU A 1 71  ? 14.448  9.747   -5.435  1.00 0.00 ? 71  GLU A HB3  4  
ATOM 7752  H HG2  . GLU A 1 71  ? 12.724  11.405  -5.435  1.00 0.00 ? 71  GLU A HG2  4  
ATOM 7753  H HG3  . GLU A 1 71  ? 13.616  12.414  -6.570  1.00 0.00 ? 71  GLU A HG3  4  
ATOM 7754  N N    . PHE A 1 72  ? 14.819  10.766  -2.655  1.00 0.00 ? 72  PHE A N    4  
ATOM 7755  C CA   . PHE A 1 72  ? 14.075  10.842  -1.393  1.00 0.00 ? 72  PHE A CA   4  
ATOM 7756  C C    . PHE A 1 72  ? 15.007  11.010  -0.193  1.00 0.00 ? 72  PHE A C    4  
ATOM 7757  O O    . PHE A 1 72  ? 14.605  11.541  0.843   1.00 0.00 ? 72  PHE A O    4  
ATOM 7758  C CB   . PHE A 1 72  ? 13.243  9.568   -1.184  1.00 0.00 ? 72  PHE A CB   4  
ATOM 7759  C CG   . PHE A 1 72  ? 12.395  9.183   -2.367  1.00 0.00 ? 72  PHE A CG   4  
ATOM 7760  C CD1  . PHE A 1 72  ? 11.293  9.942   -2.725  1.00 0.00 ? 72  PHE A CD1  4  
ATOM 7761  C CD2  . PHE A 1 72  ? 12.701  8.056   -3.118  1.00 0.00 ? 72  PHE A CD2  4  
ATOM 7762  C CE1  . PHE A 1 72  ? 10.514  9.583   -3.806  1.00 0.00 ? 72  PHE A CE1  4  
ATOM 7763  C CE2  . PHE A 1 72  ? 11.925  7.695   -4.200  1.00 0.00 ? 72  PHE A CE2  4  
ATOM 7764  C CZ   . PHE A 1 72  ? 10.831  8.459   -4.545  1.00 0.00 ? 72  PHE A CZ   4  
ATOM 7765  H H    . PHE A 1 72  ? 15.368  9.975   -2.837  1.00 0.00 ? 72  PHE A H    4  
ATOM 7766  H HA   . PHE A 1 72  ? 13.410  11.692  -1.440  1.00 0.00 ? 72  PHE A HA   4  
ATOM 7767  H HB2  . PHE A 1 72  ? 13.908  8.743   -0.970  1.00 0.00 ? 72  PHE A HB2  4  
ATOM 7768  H HB3  . PHE A 1 72  ? 12.584  9.715   -0.339  1.00 0.00 ? 72  PHE A HB3  4  
ATOM 7769  H HD1  . PHE A 1 72  ? 11.043  10.822  -2.149  1.00 0.00 ? 72  PHE A HD1  4  
ATOM 7770  H HD2  . PHE A 1 72  ? 13.559  7.456   -2.850  1.00 0.00 ? 72  PHE A HD2  4  
ATOM 7771  H HE1  . PHE A 1 72  ? 9.655   10.181  -4.074  1.00 0.00 ? 72  PHE A HE1  4  
ATOM 7772  H HE2  . PHE A 1 72  ? 12.175  6.815   -4.775  1.00 0.00 ? 72  PHE A HE2  4  
ATOM 7773  H HZ   . PHE A 1 72  ? 10.221  8.180   -5.391  1.00 0.00 ? 72  PHE A HZ   4  
ATOM 7774  N N    . LEU A 1 73  ? 16.250  10.551  -0.333  1.00 0.00 ? 73  LEU A N    4  
ATOM 7775  C CA   . LEU A 1 73  ? 17.148  10.396  0.815   1.00 0.00 ? 73  LEU A CA   4  
ATOM 7776  C C    . LEU A 1 73  ? 18.435  11.213  0.664   1.00 0.00 ? 73  LEU A C    4  
ATOM 7777  O O    . LEU A 1 73  ? 19.316  11.156  1.523   1.00 0.00 ? 73  LEU A O    4  
ATOM 7778  C CB   . LEU A 1 73  ? 17.486  8.908   0.981   1.00 0.00 ? 73  LEU A CB   4  
ATOM 7779  C CG   . LEU A 1 73  ? 16.267  7.966   0.987   1.00 0.00 ? 73  LEU A CG   4  
ATOM 7780  C CD1  . LEU A 1 73  ? 16.702  6.508   0.910   1.00 0.00 ? 73  LEU A CD1  4  
ATOM 7781  C CD2  . LEU A 1 73  ? 15.406  8.210   2.223   1.00 0.00 ? 73  LEU A CD2  4  
ATOM 7782  H H    . LEU A 1 73  ? 16.571  10.308  -1.225  1.00 0.00 ? 73  LEU A H    4  
ATOM 7783  H HA   . LEU A 1 73  ? 16.627  10.734  1.699   1.00 0.00 ? 73  LEU A HA   4  
ATOM 7784  H HB2  . LEU A 1 73  ? 18.141  8.615   0.172   1.00 0.00 ? 73  LEU A HB2  4  
ATOM 7785  H HB3  . LEU A 1 73  ? 18.017  8.780   1.914   1.00 0.00 ? 73  LEU A HB3  4  
ATOM 7786  H HG   . LEU A 1 73  ? 15.661  8.173   0.116   1.00 0.00 ? 73  LEU A HG   4  
ATOM 7787  H HD11 . LEU A 1 73  ? 17.313  6.268   1.765   1.00 0.00 ? 73  LEU A HD11 4  
ATOM 7788  H HD12 . LEU A 1 73  ? 17.272  6.349   0.006   1.00 0.00 ? 73  LEU A HD12 4  
ATOM 7789  H HD13 . LEU A 1 73  ? 15.830  5.871   0.900   1.00 0.00 ? 73  LEU A HD13 4  
ATOM 7790  H HD21 . LEU A 1 73  ? 14.558  7.540   2.210   1.00 0.00 ? 73  LEU A HD21 4  
ATOM 7791  H HD22 . LEU A 1 73  ? 15.055  9.232   2.221   1.00 0.00 ? 73  LEU A HD22 4  
ATOM 7792  H HD23 . LEU A 1 73  ? 15.993  8.032   3.113   1.00 0.00 ? 73  LEU A HD23 4  
ATOM 7793  N N    . SER A 1 74  ? 18.549  11.965  -0.426  1.00 0.00 ? 74  SER A N    4  
ATOM 7794  C CA   . SER A 1 74  ? 19.722  12.801  -0.659  1.00 0.00 ? 74  SER A CA   4  
ATOM 7795  C C    . SER A 1 74  ? 19.627  14.097  0.146   1.00 0.00 ? 74  SER A C    4  
ATOM 7796  O O    . SER A 1 74  ? 18.529  14.544  0.488   1.00 0.00 ? 74  SER A O    4  
ATOM 7797  C CB   . SER A 1 74  ? 19.868  13.093  -2.157  1.00 0.00 ? 74  SER A CB   4  
ATOM 7798  O OG   . SER A 1 74  ? 18.626  13.463  -2.735  1.00 0.00 ? 74  SER A OG   4  
ATOM 7799  H H    . SER A 1 74  ? 17.829  11.961  -1.088  1.00 0.00 ? 74  SER A H    4  
ATOM 7800  H HA   . SER A 1 74  ? 20.591  12.252  -0.324  1.00 0.00 ? 74  SER A HA   4  
ATOM 7801  H HB2  . SER A 1 74  ? 20.570  13.901  -2.301  1.00 0.00 ? 74  SER A HB2  4  
ATOM 7802  H HB3  . SER A 1 74  ? 20.235  12.209  -2.659  1.00 0.00 ? 74  SER A HB3  4  
ATOM 7803  H HG   . SER A 1 74  ? 18.780  14.068  -3.470  1.00 0.00 ? 74  SER A HG   4  
ATOM 7804  N N    . SER A 1 75  ? 20.781  14.697  0.443   1.00 0.00 ? 75  SER A N    4  
ATOM 7805  C CA   . SER A 1 75  ? 20.838  15.912  1.257   1.00 0.00 ? 75  SER A CA   4  
ATOM 7806  C C    . SER A 1 75  ? 20.011  17.030  0.622   1.00 0.00 ? 75  SER A C    4  
ATOM 7807  O O    . SER A 1 75  ? 19.460  17.885  1.317   1.00 0.00 ? 75  SER A O    4  
ATOM 7808  C CB   . SER A 1 75  ? 22.296  16.360  1.432   1.00 0.00 ? 75  SER A CB   4  
ATOM 7809  O OG   . SER A 1 75  ? 22.401  17.461  2.321   1.00 0.00 ? 75  SER A OG   4  
ATOM 7810  H H    . SER A 1 75  ? 21.619  14.313  0.107   1.00 0.00 ? 75  SER A H    4  
ATOM 7811  H HA   . SER A 1 75  ? 20.423  15.679  2.227   1.00 0.00 ? 75  SER A HA   4  
ATOM 7812  H HB2  . SER A 1 75  ? 22.876  15.540  1.830   1.00 0.00 ? 75  SER A HB2  4  
ATOM 7813  H HB3  . SER A 1 75  ? 22.699  16.648  0.472   1.00 0.00 ? 75  SER A HB3  4  
ATOM 7814  H HG   . SER A 1 75  ? 22.338  17.143  3.231   1.00 0.00 ? 75  SER A HG   4  
ATOM 7815  N N    . GLN A 1 76  ? 19.931  17.016  -0.707  1.00 0.00 ? 76  GLN A N    4  
ATOM 7816  C CA   . GLN A 1 76  ? 19.141  17.995  -1.451  1.00 0.00 ? 76  GLN A CA   4  
ATOM 7817  C C    . GLN A 1 76  ? 18.069  17.286  -2.274  1.00 0.00 ? 76  GLN A C    4  
ATOM 7818  O O    . GLN A 1 76  ? 17.817  17.637  -3.431  1.00 0.00 ? 76  GLN A O    4  
ATOM 7819  C CB   . GLN A 1 76  ? 20.050  18.842  -2.355  1.00 0.00 ? 76  GLN A CB   4  
ATOM 7820  C CG   . GLN A 1 76  ? 20.961  19.799  -1.596  1.00 0.00 ? 76  GLN A CG   4  
ATOM 7821  C CD   . GLN A 1 76  ? 20.187  20.786  -0.734  1.00 0.00 ? 76  GLN A CD   4  
ATOM 7822  O OE1  . GLN A 1 76  ? 19.791  21.856  -1.196  1.00 0.00 ? 76  GLN A OE1  4  
ATOM 7823  N NE2  . GLN A 1 76  ? 19.971  20.438  0.523   1.00 0.00 ? 76  GLN A NE2  4  
ATOM 7824  H H    . GLN A 1 76  ? 20.416  16.326  -1.203  1.00 0.00 ? 76  GLN A H    4  
ATOM 7825  H HA   . GLN A 1 76  ? 18.652  18.643  -0.737  1.00 0.00 ? 76  GLN A HA   4  
ATOM 7826  H HB2  . GLN A 1 76  ? 20.671  18.180  -2.941  1.00 0.00 ? 76  GLN A HB2  4  
ATOM 7827  H HB3  . GLN A 1 76  ? 19.432  19.424  -3.025  1.00 0.00 ? 76  GLN A HB3  4  
ATOM 7828  H HG2  . GLN A 1 76  ? 21.616  19.222  -0.958  1.00 0.00 ? 76  GLN A HG2  4  
ATOM 7829  H HG3  . GLN A 1 76  ? 21.554  20.353  -2.310  1.00 0.00 ? 76  GLN A HG3  4  
ATOM 7830  H HE21 . GLN A 1 76  ? 20.311  19.570  0.831   1.00 0.00 ? 76  GLN A HE21 4  
ATOM 7831  H HE22 . GLN A 1 76  ? 19.481  21.061  1.100   1.00 0.00 ? 76  GLN A HE22 4  
ATOM 7832  N N    . ALA A 1 77  ? 17.436  16.291  -1.659  1.00 0.00 ? 77  ALA A N    4  
ATOM 7833  C CA   . ALA A 1 77  ? 16.340  15.558  -2.284  1.00 0.00 ? 77  ALA A CA   4  
ATOM 7834  C C    . ALA A 1 77  ? 15.161  16.487  -2.570  1.00 0.00 ? 77  ALA A C    4  
ATOM 7835  O O    . ALA A 1 77  ? 15.174  17.659  -2.185  1.00 0.00 ? 77  ALA A O    4  
ATOM 7836  C CB   . ALA A 1 77  ? 15.900  14.411  -1.381  1.00 0.00 ? 77  ALA A CB   4  
ATOM 7837  H H    . ALA A 1 77  ? 17.714  16.042  -0.751  1.00 0.00 ? 77  ALA A H    4  
ATOM 7838  H HA   . ALA A 1 77  ? 16.698  15.140  -3.216  1.00 0.00 ? 77  ALA A HA   4  
ATOM 7839  H HB1  . ALA A 1 77  ? 16.732  13.741  -1.216  1.00 0.00 ? 77  ALA A HB1  4  
ATOM 7840  H HB2  . ALA A 1 77  ? 15.091  13.869  -1.849  1.00 0.00 ? 77  ALA A HB2  4  
ATOM 7841  H HB3  . ALA A 1 77  ? 15.565  14.806  -0.433  1.00 0.00 ? 77  ALA A HB3  4  
ATOM 7842  N N    . LEU A 1 78  ? 14.143  15.962  -3.248  1.00 0.00 ? 78  LEU A N    4  
ATOM 7843  C CA   . LEU A 1 78  ? 12.924  16.724  -3.505  1.00 0.00 ? 78  LEU A CA   4  
ATOM 7844  C C    . LEU A 1 78  ? 12.202  16.968  -2.183  1.00 0.00 ? 78  LEU A C    4  
ATOM 7845  O O    . LEU A 1 78  ? 11.944  18.112  -1.798  1.00 0.00 ? 78  LEU A O    4  
ATOM 7846  C CB   . LEU A 1 78  ? 12.004  15.980  -4.493  1.00 0.00 ? 78  LEU A CB   4  
ATOM 7847  C CG   . LEU A 1 78  ? 12.487  15.930  -5.959  1.00 0.00 ? 78  LEU A CG   4  
ATOM 7848  C CD1  . LEU A 1 78  ? 13.801  15.162  -6.092  1.00 0.00 ? 78  LEU A CD1  4  
ATOM 7849  C CD2  . LEU A 1 78  ? 11.413  15.316  -6.858  1.00 0.00 ? 78  LEU A CD2  4  
ATOM 7850  H H    . LEU A 1 78  ? 14.212  15.039  -3.575  1.00 0.00 ? 78  LEU A H    4  
ATOM 7851  H HA   . LEU A 1 78  ? 13.209  17.676  -3.931  1.00 0.00 ? 78  LEU A HA   4  
ATOM 7852  H HB2  . LEU A 1 78  ? 11.882  14.965  -4.140  1.00 0.00 ? 78  LEU A HB2  4  
ATOM 7853  H HB3  . LEU A 1 78  ? 11.035  16.463  -4.475  1.00 0.00 ? 78  LEU A HB3  4  
ATOM 7854  H HG   . LEU A 1 78  ? 12.663  16.941  -6.303  1.00 0.00 ? 78  LEU A HG   4  
ATOM 7855  H HD11 . LEU A 1 78  ? 14.100  15.134  -7.131  1.00 0.00 ? 78  LEU A HD11 4  
ATOM 7856  H HD12 . LEU A 1 78  ? 13.670  14.153  -5.729  1.00 0.00 ? 78  LEU A HD12 4  
ATOM 7857  H HD13 . LEU A 1 78  ? 14.568  15.655  -5.513  1.00 0.00 ? 78  LEU A HD13 4  
ATOM 7858  H HD21 . LEU A 1 78  ? 11.187  14.315  -6.522  1.00 0.00 ? 78  LEU A HD21 4  
ATOM 7859  H HD22 . LEU A 1 78  ? 11.770  15.281  -7.877  1.00 0.00 ? 78  LEU A HD22 4  
ATOM 7860  H HD23 . LEU A 1 78  ? 10.517  15.920  -6.814  1.00 0.00 ? 78  LEU A HD23 4  
ATOM 7861  N N    . SER A 1 79  ? 11.911  15.876  -1.488  1.00 0.00 ? 79  SER A N    4  
ATOM 7862  C CA   . SER A 1 79  ? 11.309  15.924  -0.164  1.00 0.00 ? 79  SER A CA   4  
ATOM 7863  C C    . SER A 1 79  ? 11.906  14.810  0.700   1.00 0.00 ? 79  SER A C    4  
ATOM 7864  O O    . SER A 1 79  ? 11.580  13.638  0.506   1.00 0.00 ? 79  SER A O    4  
ATOM 7865  C CB   . SER A 1 79  ? 9.784   15.761  -0.257  1.00 0.00 ? 79  SER A CB   4  
ATOM 7866  O OG   . SER A 1 79  ? 9.213   16.698  -1.159  1.00 0.00 ? 79  SER A OG   4  
ATOM 7867  H H    . SER A 1 79  ? 12.110  15.002  -1.879  1.00 0.00 ? 79  SER A H    4  
ATOM 7868  H HA   . SER A 1 79  ? 11.540  16.882  0.282   1.00 0.00 ? 79  SER A HA   4  
ATOM 7869  H HB2  . SER A 1 79  ? 9.550   14.764  -0.604  1.00 0.00 ? 79  SER A HB2  4  
ATOM 7870  H HB3  . SER A 1 79  ? 9.347   15.912  0.719   1.00 0.00 ? 79  SER A HB3  4  
ATOM 7871  H HG   . SER A 1 79  ? 8.341   16.387  -1.430  1.00 0.00 ? 79  SER A HG   4  
ATOM 7872  N N    . PRO A 1 80  ? 12.824  15.151  1.628   1.00 0.00 ? 80  PRO A N    4  
ATOM 7873  C CA   . PRO A 1 80  ? 13.419  14.166  2.538   1.00 0.00 ? 80  PRO A CA   4  
ATOM 7874  C C    . PRO A 1 80  ? 12.348  13.497  3.399   1.00 0.00 ? 80  PRO A C    4  
ATOM 7875  O O    . PRO A 1 80  ? 11.802  14.115  4.317   1.00 0.00 ? 80  PRO A O    4  
ATOM 7876  C CB   . PRO A 1 80  ? 14.393  14.994  3.400   1.00 0.00 ? 80  PRO A CB   4  
ATOM 7877  C CG   . PRO A 1 80  ? 13.939  16.410  3.247   1.00 0.00 ? 80  PRO A CG   4  
ATOM 7878  C CD   . PRO A 1 80  ? 13.350  16.509  1.865   1.00 0.00 ? 80  PRO A CD   4  
ATOM 7879  H HA   . PRO A 1 80  ? 13.967  13.408  1.993   1.00 0.00 ? 80  PRO A HA   4  
ATOM 7880  H HB2  . PRO A 1 80  ? 14.339  14.671  4.430   1.00 0.00 ? 80  PRO A HB2  4  
ATOM 7881  H HB3  . PRO A 1 80  ? 15.402  14.864  3.032   1.00 0.00 ? 80  PRO A HB3  4  
ATOM 7882  H HG2  . PRO A 1 80  ? 13.188  16.637  3.993   1.00 0.00 ? 80  PRO A HG2  4  
ATOM 7883  H HG3  . PRO A 1 80  ? 14.781  17.080  3.348   1.00 0.00 ? 80  PRO A HG3  4  
ATOM 7884  H HD2  . PRO A 1 80  ? 12.555  17.242  1.843   1.00 0.00 ? 80  PRO A HD2  4  
ATOM 7885  H HD3  . PRO A 1 80  ? 14.114  16.757  1.142   1.00 0.00 ? 80  PRO A HD3  4  
ATOM 7886  N N    . VAL A 1 81  ? 12.032  12.243  3.071   1.00 0.00 ? 81  VAL A N    4  
ATOM 7887  C CA   . VAL A 1 81  ? 10.972  11.506  3.756   1.00 0.00 ? 81  VAL A CA   4  
ATOM 7888  C C    . VAL A 1 81  ? 11.184  11.494  5.275   1.00 0.00 ? 81  VAL A C    4  
ATOM 7889  O O    . VAL A 1 81  ? 12.318  11.446  5.763   1.00 0.00 ? 81  VAL A O    4  
ATOM 7890  C CB   . VAL A 1 81  ? 10.832  10.058  3.215   1.00 0.00 ? 81  VAL A CB   4  
ATOM 7891  C CG1  . VAL A 1 81  ? 10.312  10.067  1.778   1.00 0.00 ? 81  VAL A CG1  4  
ATOM 7892  C CG2  . VAL A 1 81  ? 12.158  9.310   3.298   1.00 0.00 ? 81  VAL A CG2  4  
ATOM 7893  H H    . VAL A 1 81  ? 12.523  11.806  2.345   1.00 0.00 ? 81  VAL A H    4  
ATOM 7894  H HA   . VAL A 1 81  ? 10.042  12.025  3.552   1.00 0.00 ? 81  VAL A HA   4  
ATOM 7895  H HB   . VAL A 1 81  ? 10.110  9.534   3.828   1.00 0.00 ? 81  VAL A HB   4  
ATOM 7896  H HG11 . VAL A 1 81  ? 9.351   10.558  1.744   1.00 0.00 ? 81  VAL A HG11 4  
ATOM 7897  H HG12 . VAL A 1 81  ? 10.208  9.050   1.425   1.00 0.00 ? 81  VAL A HG12 4  
ATOM 7898  H HG13 . VAL A 1 81  ? 11.010  10.597  1.143   1.00 0.00 ? 81  VAL A HG13 4  
ATOM 7899  H HG21 . VAL A 1 81  ? 12.476  9.253   4.328   1.00 0.00 ? 81  VAL A HG21 4  
ATOM 7900  H HG22 . VAL A 1 81  ? 12.905  9.833   2.719   1.00 0.00 ? 81  VAL A HG22 4  
ATOM 7901  H HG23 . VAL A 1 81  ? 12.033  8.309   2.904   1.00 0.00 ? 81  VAL A HG23 4  
ATOM 7902  N N    . ASN A 1 82  ? 10.073  11.506  6.006   1.00 0.00 ? 82  ASN A N    4  
ATOM 7903  C CA   . ASN A 1 82  ? 10.064  11.739  7.456   1.00 0.00 ? 82  ASN A CA   4  
ATOM 7904  C C    . ASN A 1 82  ? 10.683  10.579  8.257   1.00 0.00 ? 82  ASN A C    4  
ATOM 7905  O O    . ASN A 1 82  ? 10.618  10.558  9.486   1.00 0.00 ? 82  ASN A O    4  
ATOM 7906  C CB   . ASN A 1 82  ? 8.613   12.005  7.905   1.00 0.00 ? 82  ASN A CB   4  
ATOM 7907  C CG   . ASN A 1 82  ? 8.483   12.370  9.377   1.00 0.00 ? 82  ASN A CG   4  
ATOM 7908  O OD1  . ASN A 1 82  ? 8.625   13.534  9.758   1.00 0.00 ? 82  ASN A OD1  4  
ATOM 7909  N ND2  . ASN A 1 82  ? 8.199   11.380  10.212  1.00 0.00 ? 82  ASN A ND2  4  
ATOM 7910  H H    . ASN A 1 82  ? 9.214   11.357  5.551   1.00 0.00 ? 82  ASN A H    4  
ATOM 7911  H HA   . ASN A 1 82  ? 10.646  12.630  7.645   1.00 0.00 ? 82  ASN A HA   4  
ATOM 7912  H HB2  . ASN A 1 82  ? 8.210   12.819  7.321   1.00 0.00 ? 82  ASN A HB2  4  
ATOM 7913  H HB3  . ASN A 1 82  ? 8.021   11.117  7.721   1.00 0.00 ? 82  ASN A HB3  4  
ATOM 7914  H HD21 . ASN A 1 82  ? 8.094   10.480  9.844   1.00 0.00 ? 82  ASN A HD21 4  
ATOM 7915  H HD22 . ASN A 1 82  ? 8.103   11.589  11.164  1.00 0.00 ? 82  ASN A HD22 4  
ATOM 7916  N N    . ILE A 1 83  ? 11.305  9.625   7.569   1.00 0.00 ? 83  ILE A N    4  
ATOM 7917  C CA   . ILE A 1 83  ? 11.952  8.498   8.241   1.00 0.00 ? 83  ILE A CA   4  
ATOM 7918  C C    . ILE A 1 83  ? 13.078  8.982   9.160   1.00 0.00 ? 83  ILE A C    4  
ATOM 7919  O O    . ILE A 1 83  ? 13.568  10.108  9.023   1.00 0.00 ? 83  ILE A O    4  
ATOM 7920  C CB   . ILE A 1 83  ? 12.538  7.485   7.227   1.00 0.00 ? 83  ILE A CB   4  
ATOM 7921  C CG1  . ILE A 1 83  ? 13.685  8.126   6.425   1.00 0.00 ? 83  ILE A CG1  4  
ATOM 7922  C CG2  . ILE A 1 83  ? 11.442  6.972   6.296   1.00 0.00 ? 83  ILE A CG2  4  
ATOM 7923  C CD1  . ILE A 1 83  ? 14.357  7.184   5.450   1.00 0.00 ? 83  ILE A CD1  4  
ATOM 7924  H H    . ILE A 1 83  ? 11.338  9.682   6.595   1.00 0.00 ? 83  ILE A H    4  
ATOM 7925  H HA   . ILE A 1 83  ? 11.205  7.991   8.837   1.00 0.00 ? 83  ILE A HA   4  
ATOM 7926  H HB   . ILE A 1 83  ? 12.921  6.638   7.780   1.00 0.00 ? 83  ILE A HB   4  
ATOM 7927  H HG12 . ILE A 1 83  ? 13.300  8.963   5.861   1.00 0.00 ? 83  ILE A HG12 4  
ATOM 7928  H HG13 . ILE A 1 83  ? 14.441  8.484   7.112   1.00 0.00 ? 83  ILE A HG13 4  
ATOM 7929  H HG21 . ILE A 1 83  ? 11.017  7.801   5.746   1.00 0.00 ? 83  ILE A HG21 4  
ATOM 7930  H HG22 . ILE A 1 83  ? 10.668  6.493   6.879   1.00 0.00 ? 83  ILE A HG22 4  
ATOM 7931  H HG23 . ILE A 1 83  ? 11.861  6.257   5.602   1.00 0.00 ? 83  ILE A HG23 4  
ATOM 7932  H HD11 . ILE A 1 83  ? 14.791  6.357   5.989   1.00 0.00 ? 83  ILE A HD11 4  
ATOM 7933  H HD12 . ILE A 1 83  ? 15.134  7.712   4.916   1.00 0.00 ? 83  ILE A HD12 4  
ATOM 7934  H HD13 . ILE A 1 83  ? 13.627  6.813   4.746   1.00 0.00 ? 83  ILE A HD13 4  
ATOM 7935  N N    . ASP A 1 84  ? 13.483  8.131   10.096  1.00 0.00 ? 84  ASP A N    4  
ATOM 7936  C CA   . ASP A 1 84  ? 14.585  8.453   11.000  1.00 0.00 ? 84  ASP A CA   4  
ATOM 7937  C C    . ASP A 1 84  ? 15.923  8.256   10.293  1.00 0.00 ? 84  ASP A C    4  
ATOM 7938  O O    . ASP A 1 84  ? 16.394  7.126   10.149  1.00 0.00 ? 84  ASP A O    4  
ATOM 7939  C CB   . ASP A 1 84  ? 14.533  7.580   12.265  1.00 0.00 ? 84  ASP A CB   4  
ATOM 7940  C CG   . ASP A 1 84  ? 13.307  7.852   13.123  1.00 0.00 ? 84  ASP A CG   4  
ATOM 7941  O OD1  . ASP A 1 84  ? 13.303  8.863   13.859  1.00 0.00 ? 84  ASP A OD1  4  
ATOM 7942  O OD2  . ASP A 1 84  ? 12.347  7.054   13.071  1.00 0.00 ? 84  ASP A OD2  4  
ATOM 7943  H H    . ASP A 1 84  ? 13.028  7.265   10.184  1.00 0.00 ? 84  ASP A H    4  
ATOM 7944  H HA   . ASP A 1 84  ? 14.490  9.493   11.286  1.00 0.00 ? 84  ASP A HA   4  
ATOM 7945  H HB2  . ASP A 1 84  ? 14.524  6.539   11.975  1.00 0.00 ? 84  ASP A HB2  4  
ATOM 7946  H HB3  . ASP A 1 84  ? 15.415  7.769   12.863  1.00 0.00 ? 84  ASP A HB3  4  
ATOM 7947  N N    . ARG A 1 85  ? 16.527  9.352   9.837   1.00 0.00 ? 85  ARG A N    4  
ATOM 7948  C CA   . ARG A 1 85  ? 17.831  9.285   9.176   1.00 0.00 ? 85  ARG A CA   4  
ATOM 7949  C C    . ARG A 1 85  ? 18.945  9.061   10.203  1.00 0.00 ? 85  ARG A C    4  
ATOM 7950  O O    . ARG A 1 85  ? 20.058  8.668   9.851   1.00 0.00 ? 85  ARG A O    4  
ATOM 7951  C CB   . ARG A 1 85  ? 18.120  10.554  8.353   1.00 0.00 ? 85  ARG A CB   4  
ATOM 7952  C CG   . ARG A 1 85  ? 17.302  10.676  7.062   1.00 0.00 ? 85  ARG A CG   4  
ATOM 7953  C CD   . ARG A 1 85  ? 15.907  11.249  7.302   1.00 0.00 ? 85  ARG A CD   4  
ATOM 7954  N NE   . ARG A 1 85  ? 15.948  12.666  7.681   1.00 0.00 ? 85  ARG A NE   4  
ATOM 7955  C CZ   . ARG A 1 85  ? 14.877  13.465  7.721   1.00 0.00 ? 85  ARG A CZ   4  
ATOM 7956  N NH1  . ARG A 1 85  ? 13.671  12.998  7.422   1.00 0.00 ? 85  ARG A NH1  4  
ATOM 7957  N NH2  . ARG A 1 85  ? 15.013  14.740  8.056   1.00 0.00 ? 85  ARG A NH2  4  
ATOM 7958  H H    . ARG A 1 85  ? 16.090  10.224  9.949   1.00 0.00 ? 85  ARG A H    4  
ATOM 7959  H HA   . ARG A 1 85  ? 17.812  8.436   8.506   1.00 0.00 ? 85  ARG A HA   4  
ATOM 7960  H HB2  . ARG A 1 85  ? 17.912  11.419  8.967   1.00 0.00 ? 85  ARG A HB2  4  
ATOM 7961  H HB3  . ARG A 1 85  ? 19.169  10.562  8.087   1.00 0.00 ? 85  ARG A HB3  4  
ATOM 7962  H HG2  . ARG A 1 85  ? 17.828  11.326  6.377   1.00 0.00 ? 85  ARG A HG2  4  
ATOM 7963  H HG3  . ARG A 1 85  ? 17.205  9.695   6.618   1.00 0.00 ? 85  ARG A HG3  4  
ATOM 7964  H HD2  . ARG A 1 85  ? 15.328  11.147  6.394   1.00 0.00 ? 85  ARG A HD2  4  
ATOM 7965  H HD3  . ARG A 1 85  ? 15.431  10.688  8.094   1.00 0.00 ? 85  ARG A HD3  4  
ATOM 7966  H HE   . ARG A 1 85  ? 16.830  13.044  7.913   1.00 0.00 ? 85  ARG A HE   4  
ATOM 7967  H HH11 . ARG A 1 85  ? 13.549  12.039  7.156   1.00 0.00 ? 85  ARG A HH11 4  
ATOM 7968  H HH12 . ARG A 1 85  ? 12.873  13.607  7.466   1.00 0.00 ? 85  ARG A HH12 4  
ATOM 7969  H HH21 . ARG A 1 85  ? 15.917  15.109  8.281   1.00 0.00 ? 85  ARG A HH21 4  
ATOM 7970  H HH22 . ARG A 1 85  ? 14.210  15.347  8.078   1.00 0.00 ? 85  ARG A HH22 4  
ATOM 7971  N N    . GLN A 1 86  ? 18.627  9.302   11.472  1.00 0.00 ? 86  GLN A N    4  
ATOM 7972  C CA   . GLN A 1 86  ? 19.595  9.161   12.561  1.00 0.00 ? 86  GLN A CA   4  
ATOM 7973  C C    . GLN A 1 86  ? 20.040  7.705   12.713  1.00 0.00 ? 86  GLN A C    4  
ATOM 7974  O O    . GLN A 1 86  ? 21.230  7.419   12.860  1.00 0.00 ? 86  GLN A O    4  
ATOM 7975  C CB   . GLN A 1 86  ? 19.001  9.666   13.889  1.00 0.00 ? 86  GLN A CB   4  
ATOM 7976  C CG   . GLN A 1 86  ? 18.687  11.163  13.925  1.00 0.00 ? 86  GLN A CG   4  
ATOM 7977  C CD   . GLN A 1 86  ? 17.566  11.570  12.980  1.00 0.00 ? 86  GLN A CD   4  
ATOM 7978  O OE1  . GLN A 1 86  ? 16.388  11.534  13.344  1.00 0.00 ? 86  GLN A OE1  4  
ATOM 7979  N NE2  . GLN A 1 86  ? 17.919  11.972  11.769  1.00 0.00 ? 86  GLN A NE2  4  
ATOM 7980  H H    . GLN A 1 86  ? 17.716  9.589   11.682  1.00 0.00 ? 86  GLN A H    4  
ATOM 7981  H HA   . GLN A 1 86  ? 20.458  9.763   12.314  1.00 0.00 ? 86  GLN A HA   4  
ATOM 7982  H HB2  . GLN A 1 86  ? 18.084  9.127   14.082  1.00 0.00 ? 86  GLN A HB2  4  
ATOM 7983  H HB3  . GLN A 1 86  ? 19.702  9.450   14.684  1.00 0.00 ? 86  GLN A HB3  4  
ATOM 7984  H HG2  . GLN A 1 86  ? 18.397  11.431  14.931  1.00 0.00 ? 86  GLN A HG2  4  
ATOM 7985  H HG3  . GLN A 1 86  ? 19.581  11.710  13.657  1.00 0.00 ? 86  GLN A HG3  4  
ATOM 7986  H HE21 . GLN A 1 86  ? 18.878  11.989  11.545  1.00 0.00 ? 86  GLN A HE21 4  
ATOM 7987  H HE22 . GLN A 1 86  ? 17.211  12.250  11.148  1.00 0.00 ? 86  GLN A HE22 4  
ATOM 7988  N N    . ALA A 1 87  ? 19.075  6.791   12.665  1.00 0.00 ? 87  ALA A N    4  
ATOM 7989  C CA   . ALA A 1 87  ? 19.345  5.361   12.821  1.00 0.00 ? 87  ALA A CA   4  
ATOM 7990  C C    . ALA A 1 87  ? 19.246  4.652   11.473  1.00 0.00 ? 87  ALA A C    4  
ATOM 7991  O O    . ALA A 1 87  ? 19.026  3.438   11.402  1.00 0.00 ? 87  ALA A O    4  
ATOM 7992  C CB   . ALA A 1 87  ? 18.368  4.754   13.824  1.00 0.00 ? 87  ALA A CB   4  
ATOM 7993  H H    . ALA A 1 87  ? 18.153  7.084   12.510  1.00 0.00 ? 87  ALA A H    4  
ATOM 7994  H HA   . ALA A 1 87  ? 20.348  5.242   13.209  1.00 0.00 ? 87  ALA A HA   4  
ATOM 7995  H HB1  . ALA A 1 87  ? 18.459  5.266   14.772  1.00 0.00 ? 87  ALA A HB1  4  
ATOM 7996  H HB2  . ALA A 1 87  ? 18.593  3.706   13.960  1.00 0.00 ? 87  ALA A HB2  4  
ATOM 7997  H HB3  . ALA A 1 87  ? 17.358  4.861   13.455  1.00 0.00 ? 87  ALA A HB3  4  
ATOM 7998  N N    . TRP A 1 88  ? 19.436  5.419   10.405  1.00 0.00 ? 88  TRP A N    4  
ATOM 7999  C CA   . TRP A 1 88  ? 19.291  4.909   9.047   1.00 0.00 ? 88  TRP A CA   4  
ATOM 8000  C C    . TRP A 1 88  ? 20.512  4.068   8.653   1.00 0.00 ? 88  TRP A C    4  
ATOM 8001  O O    . TRP A 1 88  ? 21.497  4.010   9.391   1.00 0.00 ? 88  TRP A O    4  
ATOM 8002  C CB   . TRP A 1 88  ? 19.093  6.084   8.078   1.00 0.00 ? 88  TRP A CB   4  
ATOM 8003  C CG   . TRP A 1 88  ? 18.600  5.675   6.725   1.00 0.00 ? 88  TRP A CG   4  
ATOM 8004  C CD1  . TRP A 1 88  ? 17.381  5.137   6.433   1.00 0.00 ? 88  TRP A CD1  4  
ATOM 8005  C CD2  . TRP A 1 88  ? 19.304  5.774   5.483   1.00 0.00 ? 88  TRP A CD2  4  
ATOM 8006  N NE1  . TRP A 1 88  ? 17.290  4.877   5.090   1.00 0.00 ? 88  TRP A NE1  4  
ATOM 8007  C CE2  . TRP A 1 88  ? 18.456  5.263   4.486   1.00 0.00 ? 88  TRP A CE2  4  
ATOM 8008  C CE3  . TRP A 1 88  ? 20.568  6.240   5.116   1.00 0.00 ? 88  TRP A CE3  4  
ATOM 8009  C CZ2  . TRP A 1 88  ? 18.831  5.203   3.152   1.00 0.00 ? 88  TRP A CZ2  4  
ATOM 8010  C CZ3  . TRP A 1 88  ? 20.939  6.179   3.786   1.00 0.00 ? 88  TRP A CZ3  4  
ATOM 8011  C CH2  . TRP A 1 88  ? 20.070  5.663   2.818   1.00 0.00 ? 88  TRP A CH2  4  
ATOM 8012  H H    . TRP A 1 88  ? 19.695  6.354   10.535  1.00 0.00 ? 88  TRP A H    4  
ATOM 8013  H HA   . TRP A 1 88  ? 18.411  4.279   9.021   1.00 0.00 ? 88  TRP A HA   4  
ATOM 8014  H HB2  . TRP A 1 88  ? 18.372  6.767   8.498   1.00 0.00 ? 88  TRP A HB2  4  
ATOM 8015  H HB3  . TRP A 1 88  ? 20.035  6.600   7.951   1.00 0.00 ? 88  TRP A HB3  4  
ATOM 8016  H HD1  . TRP A 1 88  ? 16.613  4.938   7.166   1.00 0.00 ? 88  TRP A HD1  4  
ATOM 8017  H HE1  . TRP A 1 88  ? 16.515  4.485   4.637   1.00 0.00 ? 88  TRP A HE1  4  
ATOM 8018  H HE3  . TRP A 1 88  ? 21.250  6.643   5.850   1.00 0.00 ? 88  TRP A HE3  4  
ATOM 8019  H HZ2  . TRP A 1 88  ? 18.174  4.805   2.393   1.00 0.00 ? 88  TRP A HZ2  4  
ATOM 8020  H HZ3  . TRP A 1 88  ? 21.914  6.532   3.479   1.00 0.00 ? 88  TRP A HZ3  4  
ATOM 8021  H HH2  . TRP A 1 88  ? 20.397  5.629   1.790   1.00 0.00 ? 88  TRP A HH2  4  
ATOM 8022  N N    . LEU A 1 89  ? 20.434  3.421   7.488   1.00 0.00 ? 89  LEU A N    4  
ATOM 8023  C CA   . LEU A 1 89  ? 21.508  2.550   7.003   1.00 0.00 ? 89  LEU A CA   4  
ATOM 8024  C C    . LEU A 1 89  ? 22.819  3.330   6.885   1.00 0.00 ? 89  LEU A C    4  
ATOM 8025  O O    . LEU A 1 89  ? 23.790  3.052   7.594   1.00 0.00 ? 89  LEU A O    4  
ATOM 8026  C CB   . LEU A 1 89  ? 21.144  1.936   5.634   1.00 0.00 ? 89  LEU A CB   4  
ATOM 8027  C CG   . LEU A 1 89  ? 19.912  1.003   5.604   1.00 0.00 ? 89  LEU A CG   4  
ATOM 8028  C CD1  . LEU A 1 89  ? 19.992  -0.051  6.700   1.00 0.00 ? 89  LEU A CD1  4  
ATOM 8029  C CD2  . LEU A 1 89  ? 18.607  1.788   5.711   1.00 0.00 ? 89  LEU A CD2  4  
ATOM 8030  H H    . LEU A 1 89  ? 19.635  3.535   6.940   1.00 0.00 ? 89  LEU A H    4  
ATOM 8031  H HA   . LEU A 1 89  ? 21.640  1.754   7.723   1.00 0.00 ? 89  LEU A HA   4  
ATOM 8032  H HB2  . LEU A 1 89  ? 20.967  2.747   4.940   1.00 0.00 ? 89  LEU A HB2  4  
ATOM 8033  H HB3  . LEU A 1 89  ? 21.997  1.373   5.283   1.00 0.00 ? 89  LEU A HB3  4  
ATOM 8034  H HG   . LEU A 1 89  ? 19.901  0.481   4.656   1.00 0.00 ? 89  LEU A HG   4  
ATOM 8035  H HD11 . LEU A 1 89  ? 19.126  -0.696  6.640   1.00 0.00 ? 89  LEU A HD11 4  
ATOM 8036  H HD12 . LEU A 1 89  ? 20.013  0.430   7.666   1.00 0.00 ? 89  LEU A HD12 4  
ATOM 8037  H HD13 . LEU A 1 89  ? 20.887  -0.641  6.570   1.00 0.00 ? 89  LEU A HD13 4  
ATOM 8038  H HD21 . LEU A 1 89  ? 18.597  2.349   6.634   1.00 0.00 ? 89  LEU A HD21 4  
ATOM 8039  H HD22 . LEU A 1 89  ? 17.771  1.105   5.696   1.00 0.00 ? 89  LEU A HD22 4  
ATOM 8040  H HD23 . LEU A 1 89  ? 18.527  2.469   4.876   1.00 0.00 ? 89  LEU A HD23 4  
ATOM 8041  N N    . GLY A 1 90  ? 22.832  4.306   5.985   1.00 0.00 ? 90  GLY A N    4  
ATOM 8042  C CA   . GLY A 1 90  ? 24.000  5.145   5.791   1.00 0.00 ? 90  GLY A CA   4  
ATOM 8043  C C    . GLY A 1 90  ? 24.441  5.171   4.343   1.00 0.00 ? 90  GLY A C    4  
ATOM 8044  O O    . GLY A 1 90  ? 23.886  4.456   3.510   1.00 0.00 ? 90  GLY A O    4  
ATOM 8045  H H    . GLY A 1 90  ? 22.040  4.451   5.431   1.00 0.00 ? 90  GLY A H    4  
ATOM 8046  H HA2  . GLY A 1 90  ? 23.762  6.151   6.102   1.00 0.00 ? 90  GLY A HA2  4  
ATOM 8047  H HA3  . GLY A 1 90  ? 24.813  4.772   6.399   1.00 0.00 ? 90  GLY A HA3  4  
ATOM 8048  N N    . GLU A 1 91  ? 25.448  5.986   4.052   1.00 0.00 ? 91  GLU A N    4  
ATOM 8049  C CA   . GLU A 1 91  ? 26.003  6.115   2.702   1.00 0.00 ? 91  GLU A CA   4  
ATOM 8050  C C    . GLU A 1 91  ? 26.587  4.781   2.222   1.00 0.00 ? 91  GLU A C    4  
ATOM 8051  O O    . GLU A 1 91  ? 26.822  4.579   1.030   1.00 0.00 ? 91  GLU A O    4  
ATOM 8052  C CB   . GLU A 1 91  ? 27.095  7.195   2.702   1.00 0.00 ? 91  GLU A CB   4  
ATOM 8053  C CG   . GLU A 1 91  ? 26.624  8.540   3.251   1.00 0.00 ? 91  GLU A CG   4  
ATOM 8054  C CD   . GLU A 1 91  ? 27.767  9.516   3.485   1.00 0.00 ? 91  GLU A CD   4  
ATOM 8055  O OE1  . GLU A 1 91  ? 28.436  9.412   4.540   1.00 0.00 ? 91  GLU A OE1  4  
ATOM 8056  O OE2  . GLU A 1 91  ? 28.001  10.391  2.628   1.00 0.00 ? 91  GLU A OE2  4  
ATOM 8057  H H    . GLU A 1 91  ? 25.836  6.525   4.771   1.00 0.00 ? 91  GLU A H    4  
ATOM 8058  H HA   . GLU A 1 91  ? 25.207  6.412   2.035   1.00 0.00 ? 91  GLU A HA   4  
ATOM 8059  H HB2  . GLU A 1 91  ? 27.924  6.853   3.306   1.00 0.00 ? 91  GLU A HB2  4  
ATOM 8060  H HB3  . GLU A 1 91  ? 27.440  7.343   1.687   1.00 0.00 ? 91  GLU A HB3  4  
ATOM 8061  H HG2  . GLU A 1 91  ? 25.932  8.980   2.546   1.00 0.00 ? 91  GLU A HG2  4  
ATOM 8062  H HG3  . GLU A 1 91  ? 26.115  8.372   4.190   1.00 0.00 ? 91  GLU A HG3  4  
ATOM 8063  N N    . GLU A 1 92  ? 26.796  3.874   3.169   1.00 0.00 ? 92  GLU A N    4  
ATOM 8064  C CA   . GLU A 1 92  ? 27.385  2.568   2.903   1.00 0.00 ? 92  GLU A CA   4  
ATOM 8065  C C    . GLU A 1 92  ? 26.492  1.740   1.985   1.00 0.00 ? 92  GLU A C    4  
ATOM 8066  O O    . GLU A 1 92  ? 26.976  0.870   1.258   1.00 0.00 ? 92  GLU A O    4  
ATOM 8067  C CB   . GLU A 1 92  ? 27.619  1.838   4.234   1.00 0.00 ? 92  GLU A CB   4  
ATOM 8068  C CG   . GLU A 1 92  ? 26.378  1.775   5.125   1.00 0.00 ? 92  GLU A CG   4  
ATOM 8069  C CD   . GLU A 1 92  ? 26.694  1.352   6.551   1.00 0.00 ? 92  GLU A CD   4  
ATOM 8070  O OE1  . GLU A 1 92  ? 27.133  2.211   7.347   1.00 0.00 ? 92  GLU A OE1  4  
ATOM 8071  O OE2  . GLU A 1 92  ? 26.515  0.160   6.883   1.00 0.00 ? 92  GLU A OE2  4  
ATOM 8072  H H    . GLU A 1 92  ? 26.536  4.087   4.085   1.00 0.00 ? 92  GLU A H    4  
ATOM 8073  H HA   . GLU A 1 92  ? 28.338  2.726   2.417   1.00 0.00 ? 92  GLU A HA   4  
ATOM 8074  H HB2  . GLU A 1 92  ? 27.942  0.827   4.028   1.00 0.00 ? 92  GLU A HB2  4  
ATOM 8075  H HB3  . GLU A 1 92  ? 28.401  2.350   4.778   1.00 0.00 ? 92  GLU A HB3  4  
ATOM 8076  H HG2  . GLU A 1 92  ? 25.922  2.755   5.152   1.00 0.00 ? 92  GLU A HG2  4  
ATOM 8077  H HG3  . GLU A 1 92  ? 25.678  1.070   4.698   1.00 0.00 ? 92  GLU A HG3  4  
ATOM 8078  N N    . VAL A 1 93  ? 25.192  2.030   2.000   1.00 0.00 ? 93  VAL A N    4  
ATOM 8079  C CA   . VAL A 1 93  ? 24.239  1.270   1.200   1.00 0.00 ? 93  VAL A CA   4  
ATOM 8080  C C    . VAL A 1 93  ? 24.454  1.525   -0.294  1.00 0.00 ? 93  VAL A C    4  
ATOM 8081  O O    . VAL A 1 93  ? 24.089  0.704   -1.136  1.00 0.00 ? 93  VAL A O    4  
ATOM 8082  C CB   . VAL A 1 93  ? 22.771  1.586   1.586   1.00 0.00 ? 93  VAL A CB   4  
ATOM 8083  C CG1  . VAL A 1 93  ? 22.406  3.031   1.251   1.00 0.00 ? 93  VAL A CG1  4  
ATOM 8084  C CG2  . VAL A 1 93  ? 21.810  0.609   0.909   1.00 0.00 ? 93  VAL A CG2  4  
ATOM 8085  H H    . VAL A 1 93  ? 24.869  2.770   2.559   1.00 0.00 ? 93  VAL A H    4  
ATOM 8086  H HA   . VAL A 1 93  ? 24.422  0.225   1.404   1.00 0.00 ? 93  VAL A HA   4  
ATOM 8087  H HB   . VAL A 1 93  ? 22.672  1.461   2.656   1.00 0.00 ? 93  VAL A HB   4  
ATOM 8088  H HG11 . VAL A 1 93  ? 22.474  3.184   0.182   1.00 0.00 ? 93  VAL A HG11 4  
ATOM 8089  H HG12 . VAL A 1 93  ? 23.088  3.701   1.752   1.00 0.00 ? 93  VAL A HG12 4  
ATOM 8090  H HG13 . VAL A 1 93  ? 21.396  3.235   1.578   1.00 0.00 ? 93  VAL A HG13 4  
ATOM 8091  H HG21 . VAL A 1 93  ? 21.894  0.701   -0.165  1.00 0.00 ? 93  VAL A HG21 4  
ATOM 8092  H HG22 . VAL A 1 93  ? 20.796  0.831   1.211   1.00 0.00 ? 93  VAL A HG22 4  
ATOM 8093  H HG23 . VAL A 1 93  ? 22.056  -0.402  1.202   1.00 0.00 ? 93  VAL A HG23 4  
ATOM 8094  N N    . LEU A 1 94  ? 25.059  2.670   -0.613  1.00 0.00 ? 94  LEU A N    4  
ATOM 8095  C CA   . LEU A 1 94  ? 25.391  3.009   -1.995  1.00 0.00 ? 94  LEU A CA   4  
ATOM 8096  C C    . LEU A 1 94  ? 26.522  2.114   -2.493  1.00 0.00 ? 94  LEU A C    4  
ATOM 8097  O O    . LEU A 1 94  ? 26.667  1.883   -3.694  1.00 0.00 ? 94  LEU A O    4  
ATOM 8098  C CB   . LEU A 1 94  ? 25.801  4.490   -2.124  1.00 0.00 ? 94  LEU A CB   4  
ATOM 8099  C CG   . LEU A 1 94  ? 24.668  5.529   -1.980  1.00 0.00 ? 94  LEU A CG   4  
ATOM 8100  C CD1  . LEU A 1 94  ? 23.548  5.257   -2.982  1.00 0.00 ? 94  LEU A CD1  4  
ATOM 8101  C CD2  . LEU A 1 94  ? 24.122  5.562   -0.555  1.00 0.00 ? 94  LEU A CD2  4  
ATOM 8102  H H    . LEU A 1 94  ? 25.294  3.299   0.102   1.00 0.00 ? 94  LEU A H    4  
ATOM 8103  H HA   . LEU A 1 94  ? 24.513  2.831   -2.601  1.00 0.00 ? 94  LEU A HA   4  
ATOM 8104  H HB2  . LEU A 1 94  ? 26.547  4.696   -1.368  1.00 0.00 ? 94  LEU A HB2  4  
ATOM 8105  H HB3  . LEU A 1 94  ? 26.261  4.628   -3.094  1.00 0.00 ? 94  LEU A HB3  4  
ATOM 8106  H HG   . LEU A 1 94  ? 25.070  6.510   -2.199  1.00 0.00 ? 94  LEU A HG   4  
ATOM 8107  H HD11 . LEU A 1 94  ? 23.120  4.282   -2.793  1.00 0.00 ? 94  LEU A HD11 4  
ATOM 8108  H HD12 . LEU A 1 94  ? 23.947  5.285   -3.986  1.00 0.00 ? 94  LEU A HD12 4  
ATOM 8109  H HD13 . LEU A 1 94  ? 22.782  6.012   -2.881  1.00 0.00 ? 94  LEU A HD13 4  
ATOM 8110  H HD21 . LEU A 1 94  ? 23.715  4.595   -0.300  1.00 0.00 ? 94  LEU A HD21 4  
ATOM 8111  H HD22 . LEU A 1 94  ? 23.345  6.311   -0.482  1.00 0.00 ? 94  LEU A HD22 4  
ATOM 8112  H HD23 . LEU A 1 94  ? 24.920  5.808   0.132   1.00 0.00 ? 94  LEU A HD23 4  
ATOM 8113  N N    . ALA A 1 95  ? 27.321  1.617   -1.556  1.00 0.00 ? 95  ALA A N    4  
ATOM 8114  C CA   . ALA A 1 95  ? 28.451  0.757   -1.879  1.00 0.00 ? 95  ALA A CA   4  
ATOM 8115  C C    . ALA A 1 95  ? 28.029  -0.710  -1.926  1.00 0.00 ? 95  ALA A C    4  
ATOM 8116  O O    . ALA A 1 95  ? 28.285  -1.406  -2.916  1.00 0.00 ? 95  ALA A O    4  
ATOM 8117  C CB   . ALA A 1 95  ? 29.573  0.960   -0.867  1.00 0.00 ? 95  ALA A CB   4  
ATOM 8118  H H    . ALA A 1 95  ? 27.141  1.833   -0.618  1.00 0.00 ? 95  ALA A H    4  
ATOM 8119  H HA   . ALA A 1 95  ? 28.825  1.046   -2.854  1.00 0.00 ? 95  ALA A HA   4  
ATOM 8120  H HB1  . ALA A 1 95  ? 30.427  0.357   -1.147  1.00 0.00 ? 95  ALA A HB1  4  
ATOM 8121  H HB2  . ALA A 1 95  ? 29.231  0.664   0.114   1.00 0.00 ? 95  ALA A HB2  4  
ATOM 8122  H HB3  . ALA A 1 95  ? 29.860  2.001   -0.849  1.00 0.00 ? 95  ALA A HB3  4  
ATOM 8123  N N    . GLU A 1 96  ? 27.378  -1.175  -0.858  1.00 0.00 ? 96  GLU A N    4  
ATOM 8124  C CA   . GLU A 1 96  ? 26.970  -2.577  -0.742  1.00 0.00 ? 96  GLU A CA   4  
ATOM 8125  C C    . GLU A 1 96  ? 25.457  -2.686  -0.520  1.00 0.00 ? 96  GLU A C    4  
ATOM 8126  O O    . GLU A 1 96  ? 24.971  -2.462  0.590   1.00 0.00 ? 96  GLU A O    4  
ATOM 8127  C CB   . GLU A 1 96  ? 27.723  -3.252  0.417   1.00 0.00 ? 96  GLU A CB   4  
ATOM 8128  C CG   . GLU A 1 96  ? 29.241  -3.177  0.291   1.00 0.00 ? 96  GLU A CG   4  
ATOM 8129  C CD   . GLU A 1 96  ? 29.960  -3.874  1.436   1.00 0.00 ? 96  GLU A CD   4  
ATOM 8130  O OE1  . GLU A 1 96  ? 30.068  -3.279  2.531   1.00 0.00 ? 96  GLU A OE1  4  
ATOM 8131  O OE2  . GLU A 1 96  ? 30.413  -5.023  1.249   1.00 0.00 ? 96  GLU A OE2  4  
ATOM 8132  H H    . GLU A 1 96  ? 27.155  -0.556  -0.129  1.00 0.00 ? 96  GLU A H    4  
ATOM 8133  H HA   . GLU A 1 96  ? 27.227  -3.081  -1.664  1.00 0.00 ? 96  GLU A HA   4  
ATOM 8134  H HB2  . GLU A 1 96  ? 27.436  -2.775  1.344   1.00 0.00 ? 96  GLU A HB2  4  
ATOM 8135  H HB3  . GLU A 1 96  ? 27.438  -4.294  0.458   1.00 0.00 ? 96  GLU A HB3  4  
ATOM 8136  H HG2  . GLU A 1 96  ? 29.536  -3.645  -0.638  1.00 0.00 ? 96  GLU A HG2  4  
ATOM 8137  H HG3  . GLU A 1 96  ? 29.539  -2.137  0.276   1.00 0.00 ? 96  GLU A HG3  4  
ATOM 8138  N N    . PRO A 1 97  ? 24.693  -3.002  -1.584  1.00 0.00 ? 97  PRO A N    4  
ATOM 8139  C CA   . PRO A 1 97  ? 23.239  -3.144  -1.508  1.00 0.00 ? 97  PRO A CA   4  
ATOM 8140  C C    . PRO A 1 97  ? 22.791  -4.584  -1.221  1.00 0.00 ? 97  PRO A C    4  
ATOM 8141  O O    . PRO A 1 97  ? 23.601  -5.516  -1.224  1.00 0.00 ? 97  PRO A O    4  
ATOM 8142  C CB   . PRO A 1 97  ? 22.818  -2.720  -2.910  1.00 0.00 ? 97  PRO A CB   4  
ATOM 8143  C CG   . PRO A 1 97  ? 23.911  -3.242  -3.790  1.00 0.00 ? 97  PRO A CG   4  
ATOM 8144  C CD   . PRO A 1 97  ? 25.180  -3.222  -2.961  1.00 0.00 ? 97  PRO A CD   4  
ATOM 8145  H HA   . PRO A 1 97  ? 22.805  -2.475  -0.778  1.00 0.00 ? 97  PRO A HA   4  
ATOM 8146  H HB2  . PRO A 1 97  ? 21.860  -3.158  -3.157  1.00 0.00 ? 97  PRO A HB2  4  
ATOM 8147  H HB3  . PRO A 1 97  ? 22.751  -1.642  -2.962  1.00 0.00 ? 97  PRO A HB3  4  
ATOM 8148  H HG2  . PRO A 1 97  ? 23.680  -4.252  -4.099  1.00 0.00 ? 97  PRO A HG2  4  
ATOM 8149  H HG3  . PRO A 1 97  ? 24.020  -2.606  -4.656  1.00 0.00 ? 97  PRO A HG3  4  
ATOM 8150  H HD2  . PRO A 1 97  ? 25.698  -4.168  -3.037  1.00 0.00 ? 97  PRO A HD2  4  
ATOM 8151  H HD3  . PRO A 1 97  ? 25.826  -2.412  -3.274  1.00 0.00 ? 97  PRO A HD3  4  
ATOM 8152  N N    . ARG A 1 98  ? 21.489  -4.757  -0.995  1.00 0.00 ? 98  ARG A N    4  
ATOM 8153  C CA   . ARG A 1 98  ? 20.910  -6.069  -0.708  1.00 0.00 ? 98  ARG A CA   4  
ATOM 8154  C C    . ARG A 1 98  ? 19.405  -6.041  -0.988  1.00 0.00 ? 98  ARG A C    4  
ATOM 8155  O O    . ARG A 1 98  ? 18.789  -4.979  -0.912  1.00 0.00 ? 98  ARG A O    4  
ATOM 8156  C CB   . ARG A 1 98  ? 21.177  -6.467  0.753   1.00 0.00 ? 98  ARG A CB   4  
ATOM 8157  C CG   . ARG A 1 98  ? 20.511  -5.551  1.775   1.00 0.00 ? 98  ARG A CG   4  
ATOM 8158  C CD   . ARG A 1 98  ? 20.825  -5.973  3.204   1.00 0.00 ? 98  ARG A CD   4  
ATOM 8159  N NE   . ARG A 1 98  ? 20.357  -7.332  3.487   1.00 0.00 ? 98  ARG A NE   4  
ATOM 8160  C CZ   . ARG A 1 98  ? 20.154  -7.817  4.712   1.00 0.00 ? 98  ARG A CZ   4  
ATOM 8161  N NH1  . ARG A 1 98  ? 20.378  -7.055  5.781   1.00 0.00 ? 98  ARG A NH1  4  
ATOM 8162  N NH2  . ARG A 1 98  ? 19.724  -9.065  4.862   1.00 0.00 ? 98  ARG A NH2  4  
ATOM 8163  H H    . ARG A 1 98  ? 20.894  -3.979  -1.029  1.00 0.00 ? 98  ARG A H    4  
ATOM 8164  H HA   . ARG A 1 98  ? 21.376  -6.791  -1.366  1.00 0.00 ? 98  ARG A HA   4  
ATOM 8165  H HB2  . ARG A 1 98  ? 20.812  -7.472  0.911   1.00 0.00 ? 98  ARG A HB2  4  
ATOM 8166  H HB3  . ARG A 1 98  ? 22.244  -6.451  0.928   1.00 0.00 ? 98  ARG A HB3  4  
ATOM 8167  H HG2  . ARG A 1 98  ? 20.861  -4.542  1.622   1.00 0.00 ? 98  ARG A HG2  4  
ATOM 8168  H HG3  . ARG A 1 98  ? 19.440  -5.585  1.628   1.00 0.00 ? 98  ARG A HG3  4  
ATOM 8169  H HD2  . ARG A 1 98  ? 21.895  -5.933  3.353   1.00 0.00 ? 98  ARG A HD2  4  
ATOM 8170  H HD3  . ARG A 1 98  ? 20.341  -5.286  3.883   1.00 0.00 ? 98  ARG A HD3  4  
ATOM 8171  H HE   . ARG A 1 98  ? 20.191  -7.920  2.715   1.00 0.00 ? 98  ARG A HE   4  
ATOM 8172  H HH11 . ARG A 1 98  ? 20.704  -6.114  5.670   1.00 0.00 ? 98  ARG A HH11 4  
ATOM 8173  H HH12 . ARG A 1 98  ? 20.221  -7.414  6.705   1.00 0.00 ? 98  ARG A HH12 4  
ATOM 8174  H HH21 . ARG A 1 98  ? 19.547  -9.640  4.055   1.00 0.00 ? 98  ARG A HH21 4  
ATOM 8175  H HH22 . ARG A 1 98  ? 19.593  -9.451  5.780   1.00 0.00 ? 98  ARG A HH22 4  
ATOM 8176  N N    . PRO A 1 99  ? 18.789  -7.201  -1.306  1.00 0.00 ? 99  PRO A N    4  
ATOM 8177  C CA   . PRO A 1 99  ? 17.358  -7.268  -1.660  1.00 0.00 ? 99  PRO A CA   4  
ATOM 8178  C C    . PRO A 1 99  ? 16.449  -6.905  -0.482  1.00 0.00 ? 99  PRO A C    4  
ATOM 8179  O O    . PRO A 1 99  ? 15.273  -6.583  -0.661  1.00 0.00 ? 99  PRO A O    4  
ATOM 8180  C CB   . PRO A 1 99  ? 17.159  -8.736  -2.072  1.00 0.00 ? 99  PRO A CB   4  
ATOM 8181  C CG   . PRO A 1 99  ? 18.248  -9.474  -1.368  1.00 0.00 ? 99  PRO A CG   4  
ATOM 8182  C CD   . PRO A 1 99  ? 19.425  -8.536  -1.341  1.00 0.00 ? 99  PRO A CD   4  
ATOM 8183  H HA   . PRO A 1 99  ? 17.129  -6.621  -2.496  1.00 0.00 ? 99  PRO A HA   4  
ATOM 8184  H HB2  . PRO A 1 99  ? 16.181  -9.079  -1.760  1.00 0.00 ? 99  PRO A HB2  4  
ATOM 8185  H HB3  . PRO A 1 99  ? 17.251  -8.828  -3.146  1.00 0.00 ? 99  PRO A HB3  4  
ATOM 8186  H HG2  . PRO A 1 99  ? 17.938  -9.718  -0.362  1.00 0.00 ? 99  PRO A HG2  4  
ATOM 8187  H HG3  . PRO A 1 99  ? 18.497  -10.375 -1.913  1.00 0.00 ? 99  PRO A HG3  4  
ATOM 8188  H HD2  . PRO A 1 99  ? 20.023  -8.704  -0.456  1.00 0.00 ? 99  PRO A HD2  4  
ATOM 8189  H HD3  . PRO A 1 99  ? 20.027  -8.653  -2.233  1.00 0.00 ? 99  PRO A HD3  4  
ATOM 8190  N N    . ASP A 1 100 ? 17.005  -6.961  0.723   1.00 0.00 ? 100 ASP A N    4  
ATOM 8191  C CA   . ASP A 1 100 ? 16.272  -6.604  1.934   1.00 0.00 ? 100 ASP A CA   4  
ATOM 8192  C C    . ASP A 1 100 ? 16.814  -5.297  2.485   1.00 0.00 ? 100 ASP A C    4  
ATOM 8193  O O    . ASP A 1 100 ? 17.603  -5.288  3.432   1.00 0.00 ? 100 ASP A O    4  
ATOM 8194  C CB   . ASP A 1 100 ? 16.382  -7.712  2.996   1.00 0.00 ? 100 ASP A CB   4  
ATOM 8195  C CG   . ASP A 1 100 ? 15.685  -8.999  2.585   1.00 0.00 ? 100 ASP A CG   4  
ATOM 8196  O OD1  . ASP A 1 100 ? 14.479  -9.142  2.866   1.00 0.00 ? 100 ASP A OD1  4  
ATOM 8197  O OD2  . ASP A 1 100 ? 16.341  -9.875  1.988   1.00 0.00 ? 100 ASP A OD2  4  
ATOM 8198  H H    . ASP A 1 100 ? 17.942  -7.237  0.798   1.00 0.00 ? 100 ASP A H    4  
ATOM 8199  H HA   . ASP A 1 100 ? 15.231  -6.467  1.672   1.00 0.00 ? 100 ASP A HA   4  
ATOM 8200  H HB2  . ASP A 1 100 ? 17.426  -7.930  3.173   1.00 0.00 ? 100 ASP A HB2  4  
ATOM 8201  H HB3  . ASP A 1 100 ? 15.936  -7.361  3.918   1.00 0.00 ? 100 ASP A HB3  4  
ATOM 8202  N N    . MET A 1 101 ? 16.420  -4.189  1.869   1.00 0.00 ? 101 MET A N    4  
ATOM 8203  C CA   . MET A 1 101 ? 16.948  -2.885  2.241   1.00 0.00 ? 101 MET A CA   4  
ATOM 8204  C C    . MET A 1 101 ? 15.864  -1.817  2.173   1.00 0.00 ? 101 MET A C    4  
ATOM 8205  O O    . MET A 1 101 ? 14.934  -1.919  1.377   1.00 0.00 ? 101 MET A O    4  
ATOM 8206  C CB   . MET A 1 101 ? 18.117  -2.513  1.318   1.00 0.00 ? 101 MET A CB   4  
ATOM 8207  C CG   . MET A 1 101 ? 18.962  -1.339  1.803   1.00 0.00 ? 101 MET A CG   4  
ATOM 8208  S SD   . MET A 1 101 ? 20.361  -1.839  2.839   1.00 0.00 ? 101 MET A SD   4  
ATOM 8209  C CE   . MET A 1 101 ? 19.556  -2.587  4.255   1.00 0.00 ? 101 MET A CE   4  
ATOM 8210  H H    . MET A 1 101 ? 15.761  -4.250  1.144   1.00 0.00 ? 101 MET A H    4  
ATOM 8211  H HA   . MET A 1 101 ? 17.310  -2.948  3.258   1.00 0.00 ? 101 MET A HA   4  
ATOM 8212  H HB2  . MET A 1 101 ? 18.765  -3.370  1.224   1.00 0.00 ? 101 MET A HB2  4  
ATOM 8213  H HB3  . MET A 1 101 ? 17.724  -2.267  0.340   1.00 0.00 ? 101 MET A HB3  4  
ATOM 8214  H HG2  . MET A 1 101 ? 19.350  -0.814  0.942   1.00 0.00 ? 101 MET A HG2  4  
ATOM 8215  H HG3  . MET A 1 101 ? 18.334  -0.668  2.372   1.00 0.00 ? 101 MET A HG3  4  
ATOM 8216  H HE1  . MET A 1 101 ? 20.302  -2.894  4.973   1.00 0.00 ? 101 MET A HE1  4  
ATOM 8217  H HE2  . MET A 1 101 ? 18.990  -3.448  3.935   1.00 0.00 ? 101 MET A HE2  4  
ATOM 8218  H HE3  . MET A 1 101 ? 18.891  -1.869  4.712   1.00 0.00 ? 101 MET A HE3  4  
ATOM 8219  N N    . PHE A 1 102 ? 15.993  -0.812  3.043   1.00 0.00 ? 102 PHE A N    4  
ATOM 8220  C CA   . PHE A 1 102 ? 15.078  0.334   3.110   1.00 0.00 ? 102 PHE A CA   4  
ATOM 8221  C C    . PHE A 1 102 ? 13.660  -0.065  3.541   1.00 0.00 ? 102 PHE A C    4  
ATOM 8222  O O    . PHE A 1 102 ? 12.807  0.801   3.736   1.00 0.00 ? 102 PHE A O    4  
ATOM 8223  C CB   . PHE A 1 102 ? 15.039  1.082   1.765   1.00 0.00 ? 102 PHE A CB   4  
ATOM 8224  C CG   . PHE A 1 102 ? 16.381  1.620   1.318   1.00 0.00 ? 102 PHE A CG   4  
ATOM 8225  C CD1  . PHE A 1 102 ? 17.420  1.800   2.225   1.00 0.00 ? 102 PHE A CD1  4  
ATOM 8226  C CD2  . PHE A 1 102 ? 16.603  1.944   -0.014  1.00 0.00 ? 102 PHE A CD2  4  
ATOM 8227  C CE1  . PHE A 1 102 ? 18.642  2.290   1.811   1.00 0.00 ? 102 PHE A CE1  4  
ATOM 8228  C CE2  . PHE A 1 102 ? 17.827  2.437   -0.429  1.00 0.00 ? 102 PHE A CE2  4  
ATOM 8229  C CZ   . PHE A 1 102 ? 18.846  2.610   0.484   1.00 0.00 ? 102 PHE A CZ   4  
ATOM 8230  H H    . PHE A 1 102 ? 16.746  -0.833  3.659   1.00 0.00 ? 102 PHE A H    4  
ATOM 8231  H HA   . PHE A 1 102 ? 15.475  1.009   3.858   1.00 0.00 ? 102 PHE A HA   4  
ATOM 8232  H HB2  . PHE A 1 102 ? 14.681  0.409   1.000   1.00 0.00 ? 102 PHE A HB2  4  
ATOM 8233  H HB3  . PHE A 1 102 ? 14.357  1.918   1.847   1.00 0.00 ? 102 PHE A HB3  4  
ATOM 8234  H HD1  . PHE A 1 102 ? 17.268  1.547   3.267   1.00 0.00 ? 102 PHE A HD1  4  
ATOM 8235  H HD2  . PHE A 1 102 ? 15.807  1.811   -0.732  1.00 0.00 ? 102 PHE A HD2  4  
ATOM 8236  H HE1  . PHE A 1 102 ? 19.439  2.425   2.527   1.00 0.00 ? 102 PHE A HE1  4  
ATOM 8237  H HE2  . PHE A 1 102 ? 17.988  2.686   -1.467  1.00 0.00 ? 102 PHE A HE2  4  
ATOM 8238  H HZ   . PHE A 1 102 ? 19.802  2.994   0.160   1.00 0.00 ? 102 PHE A HZ   4  
ATOM 8239  N N    . ARG A 1 103 ? 13.419  -1.365  3.721   1.00 0.00 ? 103 ARG A N    4  
ATOM 8240  C CA   . ARG A 1 103 ? 12.081  -1.861  4.052   1.00 0.00 ? 103 ARG A CA   4  
ATOM 8241  C C    . ARG A 1 103 ? 11.658  -1.425  5.455   1.00 0.00 ? 103 ARG A C    4  
ATOM 8242  O O    . ARG A 1 103 ? 10.470  -1.231  5.724   1.00 0.00 ? 103 ARG A O    4  
ATOM 8243  C CB   . ARG A 1 103 ? 12.022  -3.392  3.914   1.00 0.00 ? 103 ARG A CB   4  
ATOM 8244  C CG   . ARG A 1 103 ? 10.622  -3.970  4.130   1.00 0.00 ? 103 ARG A CG   4  
ATOM 8245  C CD   . ARG A 1 103 ? 10.529  -5.426  3.691   1.00 0.00 ? 103 ARG A CD   4  
ATOM 8246  N NE   . ARG A 1 103 ? 11.382  -6.311  4.488   1.00 0.00 ? 103 ARG A NE   4  
ATOM 8247  C CZ   . ARG A 1 103 ? 12.300  -7.134  3.976   1.00 0.00 ? 103 ARG A CZ   4  
ATOM 8248  N NH1  . ARG A 1 103 ? 12.547  -7.143  2.671   1.00 0.00 ? 103 ARG A NH1  4  
ATOM 8249  N NH2  . ARG A 1 103 ? 12.974  -7.950  4.773   1.00 0.00 ? 103 ARG A NH2  4  
ATOM 8250  H H    . ARG A 1 103 ? 14.148  -2.002  3.614   1.00 0.00 ? 103 ARG A H    4  
ATOM 8251  H HA   . ARG A 1 103 ? 11.393  -1.426  3.340   1.00 0.00 ? 103 ARG A HA   4  
ATOM 8252  H HB2  . ARG A 1 103 ? 12.352  -3.664  2.921   1.00 0.00 ? 103 ARG A HB2  4  
ATOM 8253  H HB3  . ARG A 1 103 ? 12.689  -3.835  4.640   1.00 0.00 ? 103 ARG A HB3  4  
ATOM 8254  H HG2  . ARG A 1 103 ? 10.378  -3.907  5.180   1.00 0.00 ? 103 ARG A HG2  4  
ATOM 8255  H HG3  . ARG A 1 103 ? 9.912   -3.386  3.561   1.00 0.00 ? 103 ARG A HG3  4  
ATOM 8256  H HD2  . ARG A 1 103 ? 9.504   -5.752  3.790   1.00 0.00 ? 103 ARG A HD2  4  
ATOM 8257  H HD3  . ARG A 1 103 ? 10.825  -5.495  2.652   1.00 0.00 ? 103 ARG A HD3  4  
ATOM 8258  H HE   . ARG A 1 103 ? 11.238  -6.315  5.460   1.00 0.00 ? 103 ARG A HE   4  
ATOM 8259  H HH11 . ARG A 1 103 ? 12.048  -6.527  2.055   1.00 0.00 ? 103 ARG A HH11 4  
ATOM 8260  H HH12 . ARG A 1 103 ? 13.231  -7.780  2.290   1.00 0.00 ? 103 ARG A HH12 4  
ATOM 8261  H HH21 . ARG A 1 103 ? 12.794  -7.955  5.761   1.00 0.00 ? 103 ARG A HH21 4  
ATOM 8262  H HH22 . ARG A 1 103 ? 13.664  -8.573  4.387   1.00 0.00 ? 103 ARG A HH22 4  
ATOM 8263  N N    . ALA A 1 104 ? 12.632  -1.259  6.343   1.00 0.00 ? 104 ALA A N    4  
ATOM 8264  C CA   . ALA A 1 104 ? 12.360  -0.783  7.696   1.00 0.00 ? 104 ALA A CA   4  
ATOM 8265  C C    . ALA A 1 104 ? 11.760  0.620   7.643   1.00 0.00 ? 104 ALA A C    4  
ATOM 8266  O O    . ALA A 1 104 ? 10.814  0.941   8.364   1.00 0.00 ? 104 ALA A O    4  
ATOM 8267  C CB   . ALA A 1 104 ? 13.639  -0.797  8.529   1.00 0.00 ? 104 ALA A CB   4  
ATOM 8268  H H    . ALA A 1 104 ? 13.554  -1.453  6.082   1.00 0.00 ? 104 ALA A H    4  
ATOM 8269  H HA   . ALA A 1 104 ? 11.647  -1.457  8.153   1.00 0.00 ? 104 ALA A HA   4  
ATOM 8270  H HB1  . ALA A 1 104 ? 14.364  -0.124  8.092   1.00 0.00 ? 104 ALA A HB1  4  
ATOM 8271  H HB2  . ALA A 1 104 ? 14.046  -1.798  8.549   1.00 0.00 ? 104 ALA A HB2  4  
ATOM 8272  H HB3  . ALA A 1 104 ? 13.417  -0.480  9.539   1.00 0.00 ? 104 ALA A HB3  4  
ATOM 8273  N N    . GLN A 1 105 ? 12.309  1.439   6.755   1.00 0.00 ? 105 GLN A N    4  
ATOM 8274  C CA   . GLN A 1 105 ? 11.843  2.807   6.561   1.00 0.00 ? 105 GLN A CA   4  
ATOM 8275  C C    . GLN A 1 105 ? 10.574  2.810   5.712   1.00 0.00 ? 105 GLN A C    4  
ATOM 8276  O O    . GLN A 1 105 ? 9.694   3.658   5.884   1.00 0.00 ? 105 GLN A O    4  
ATOM 8277  C CB   . GLN A 1 105 ? 12.937  3.650   5.889   1.00 0.00 ? 105 GLN A CB   4  
ATOM 8278  C CG   . GLN A 1 105 ? 14.191  3.845   6.742   1.00 0.00 ? 105 GLN A CG   4  
ATOM 8279  C CD   . GLN A 1 105 ? 14.973  2.562   6.988   1.00 0.00 ? 105 GLN A CD   4  
ATOM 8280  O OE1  . GLN A 1 105 ? 14.974  1.646   6.162   1.00 0.00 ? 105 GLN A OE1  4  
ATOM 8281  N NE2  . GLN A 1 105 ? 15.649  2.491   8.125   1.00 0.00 ? 105 GLN A NE2  4  
ATOM 8282  H H    . GLN A 1 105 ? 13.052  1.110   6.206   1.00 0.00 ? 105 GLN A H    4  
ATOM 8283  H HA   . GLN A 1 105 ? 11.617  3.227   7.531   1.00 0.00 ? 105 GLN A HA   4  
ATOM 8284  H HB2  . GLN A 1 105 ? 13.229  3.169   4.966   1.00 0.00 ? 105 GLN A HB2  4  
ATOM 8285  H HB3  . GLN A 1 105 ? 12.531  4.625   5.660   1.00 0.00 ? 105 GLN A HB3  4  
ATOM 8286  H HG2  . GLN A 1 105 ? 14.842  4.545   6.240   1.00 0.00 ? 105 GLN A HG2  4  
ATOM 8287  H HG3  . GLN A 1 105 ? 13.898  4.257   7.698   1.00 0.00 ? 105 GLN A HG3  4  
ATOM 8288  H HE21 . GLN A 1 105 ? 15.608  3.255   8.738   1.00 0.00 ? 105 GLN A HE21 4  
ATOM 8289  H HE22 . GLN A 1 105 ? 16.175  1.681   8.305   1.00 0.00 ? 105 GLN A HE22 4  
ATOM 8290  N N    . GLN A 1 106 ? 10.495  1.845   4.801   1.00 0.00 ? 106 GLN A N    4  
ATOM 8291  C CA   . GLN A 1 106 ? 9.324   1.657   3.952   1.00 0.00 ? 106 GLN A CA   4  
ATOM 8292  C C    . GLN A 1 106 ? 8.070   1.505   4.808   1.00 0.00 ? 106 GLN A C    4  
ATOM 8293  O O    . GLN A 1 106 ? 7.044   2.142   4.559   1.00 0.00 ? 106 GLN A O    4  
ATOM 8294  C CB   . GLN A 1 106 ? 9.514   0.409   3.077   1.00 0.00 ? 106 GLN A CB   4  
ATOM 8295  C CG   . GLN A 1 106 ? 8.323   0.090   2.181   1.00 0.00 ? 106 GLN A CG   4  
ATOM 8296  C CD   . GLN A 1 106 ? 8.445   -1.256  1.484   1.00 0.00 ? 106 GLN A CD   4  
ATOM 8297  O OE1  . GLN A 1 106 ? 9.059   -2.186  2.004   1.00 0.00 ? 106 GLN A OE1  4  
ATOM 8298  N NE2  . GLN A 1 106 ? 7.856   -1.368  0.305   1.00 0.00 ? 106 GLN A NE2  4  
ATOM 8299  H H    . GLN A 1 106 ? 11.255  1.237   4.694   1.00 0.00 ? 106 GLN A H    4  
ATOM 8300  H HA   . GLN A 1 106 ? 9.221   2.526   3.318   1.00 0.00 ? 106 GLN A HA   4  
ATOM 8301  H HB2  . GLN A 1 106 ? 10.383  0.552   2.449   1.00 0.00 ? 106 GLN A HB2  4  
ATOM 8302  H HB3  . GLN A 1 106 ? 9.691   -0.443  3.722   1.00 0.00 ? 106 GLN A HB3  4  
ATOM 8303  H HG2  . GLN A 1 106 ? 7.427   0.078   2.783   1.00 0.00 ? 106 GLN A HG2  4  
ATOM 8304  H HG3  . GLN A 1 106 ? 8.238   0.863   1.429   1.00 0.00 ? 106 GLN A HG3  4  
ATOM 8305  H HE21 . GLN A 1 106 ? 7.379   -0.589  -0.054  1.00 0.00 ? 106 GLN A HE21 4  
ATOM 8306  H HE22 . GLN A 1 106 ? 7.920   -2.227  -0.163  1.00 0.00 ? 106 GLN A HE22 4  
ATOM 8307  N N    . LEU A 1 107 ? 8.172   0.664   5.834   1.00 0.00 ? 107 LEU A N    4  
ATOM 8308  C CA   . LEU A 1 107 ? 7.051   0.402   6.728   1.00 0.00 ? 107 LEU A CA   4  
ATOM 8309  C C    . LEU A 1 107 ? 6.728   1.641   7.568   1.00 0.00 ? 107 LEU A C    4  
ATOM 8310  O O    . LEU A 1 107 ? 5.583   1.844   7.976   1.00 0.00 ? 107 LEU A O    4  
ATOM 8311  C CB   . LEU A 1 107 ? 7.354   -0.794  7.642   1.00 0.00 ? 107 LEU A CB   4  
ATOM 8312  C CG   . LEU A 1 107 ? 6.145   -1.333  8.427   1.00 0.00 ? 107 LEU A CG   4  
ATOM 8313  C CD1  . LEU A 1 107 ? 5.132   -1.981  7.484   1.00 0.00 ? 107 LEU A CD1  4  
ATOM 8314  C CD2  . LEU A 1 107 ? 6.591   -2.317  9.508   1.00 0.00 ? 107 LEU A CD2  4  
ATOM 8315  H H    . LEU A 1 107 ? 9.024   0.201   5.989   1.00 0.00 ? 107 LEU A H    4  
ATOM 8316  H HA   . LEU A 1 107 ? 6.191   0.166   6.116   1.00 0.00 ? 107 LEU A HA   4  
ATOM 8317  H HB2  . LEU A 1 107 ? 7.751   -1.594  7.033   1.00 0.00 ? 107 LEU A HB2  4  
ATOM 8318  H HB3  . LEU A 1 107 ? 8.115   -0.495  8.351   1.00 0.00 ? 107 LEU A HB3  4  
ATOM 8319  H HG   . LEU A 1 107 ? 5.650   -0.505  8.912   1.00 0.00 ? 107 LEU A HG   4  
ATOM 8320  H HD11 . LEU A 1 107 ? 4.288   -2.343  8.053   1.00 0.00 ? 107 LEU A HD11 4  
ATOM 8321  H HD12 . LEU A 1 107 ? 5.597   -2.809  6.966   1.00 0.00 ? 107 LEU A HD12 4  
ATOM 8322  H HD13 . LEU A 1 107 ? 4.792   -1.252  6.763   1.00 0.00 ? 107 LEU A HD13 4  
ATOM 8323  H HD21 . LEU A 1 107 ? 5.726   -2.672  10.051  1.00 0.00 ? 107 LEU A HD21 4  
ATOM 8324  H HD22 . LEU A 1 107 ? 7.265   -1.821  10.192  1.00 0.00 ? 107 LEU A HD22 4  
ATOM 8325  H HD23 . LEU A 1 107 ? 7.096   -3.154  9.050   1.00 0.00 ? 107 LEU A HD23 4  
ATOM 8326  N N    . GLN A 1 108 ? 7.739   2.472   7.817   1.00 0.00 ? 108 GLN A N    4  
ATOM 8327  C CA   . GLN A 1 108 ? 7.542   3.708   8.572   1.00 0.00 ? 108 GLN A CA   4  
ATOM 8328  C C    . GLN A 1 108 ? 6.668   4.674   7.773   1.00 0.00 ? 108 GLN A C    4  
ATOM 8329  O O    . GLN A 1 108 ? 5.762   5.309   8.319   1.00 0.00 ? 108 GLN A O    4  
ATOM 8330  C CB   . GLN A 1 108 ? 8.890   4.353   8.932   1.00 0.00 ? 108 GLN A CB   4  
ATOM 8331  C CG   . GLN A 1 108 ? 8.751   5.633   9.747   1.00 0.00 ? 108 GLN A CG   4  
ATOM 8332  C CD   . GLN A 1 108 ? 10.062  6.106   10.349  1.00 0.00 ? 108 GLN A CD   4  
ATOM 8333  O OE1  . GLN A 1 108 ? 11.140  5.873   9.801   1.00 0.00 ? 108 GLN A OE1  4  
ATOM 8334  N NE2  . GLN A 1 108 ? 9.977   6.772   11.489  1.00 0.00 ? 108 GLN A NE2  4  
ATOM 8335  H H    . GLN A 1 108 ? 8.634   2.250   7.485   1.00 0.00 ? 108 GLN A H    4  
ATOM 8336  H HA   . GLN A 1 108 ? 7.023   3.451   9.488   1.00 0.00 ? 108 GLN A HA   4  
ATOM 8337  H HB2  . GLN A 1 108 ? 9.471   3.645   9.507   1.00 0.00 ? 108 GLN A HB2  4  
ATOM 8338  H HB3  . GLN A 1 108 ? 9.427   4.586   8.020   1.00 0.00 ? 108 GLN A HB3  4  
ATOM 8339  H HG2  . GLN A 1 108 ? 8.371   6.414   9.104   1.00 0.00 ? 108 GLN A HG2  4  
ATOM 8340  H HG3  . GLN A 1 108 ? 8.046   5.457   10.548  1.00 0.00 ? 108 GLN A HG3  4  
ATOM 8341  H HE21 . GLN A 1 108 ? 9.086   6.919   11.877  1.00 0.00 ? 108 GLN A HE21 4  
ATOM 8342  H HE22 . GLN A 1 108 ? 10.807  7.087   11.906  1.00 0.00 ? 108 GLN A HE22 4  
ATOM 8343  N N    . ILE A 1 109 ? 6.935   4.766   6.471   1.00 0.00 ? 109 ILE A N    4  
ATOM 8344  C CA   . ILE A 1 109 ? 6.094   5.549   5.564   1.00 0.00 ? 109 ILE A CA   4  
ATOM 8345  C C    . ILE A 1 109 ? 4.688   4.951   5.519   1.00 0.00 ? 109 ILE A C    4  
ATOM 8346  O O    . ILE A 1 109 ? 3.689   5.676   5.527   1.00 0.00 ? 109 ILE A O    4  
ATOM 8347  C CB   . ILE A 1 109 ? 6.714   5.620   4.130   1.00 0.00 ? 109 ILE A CB   4  
ATOM 8348  C CG1  . ILE A 1 109 ? 7.328   7.008   3.869   1.00 0.00 ? 109 ILE A CG1  4  
ATOM 8349  C CG2  . ILE A 1 109 ? 5.689   5.283   3.044   1.00 0.00 ? 109 ILE A CG2  4  
ATOM 8350  C CD1  . ILE A 1 109 ? 8.374   7.420   4.882   1.00 0.00 ? 109 ILE A CD1  4  
ATOM 8351  H H    . ILE A 1 109 ? 7.716   4.292   6.110   1.00 0.00 ? 109 ILE A H    4  
ATOM 8352  H HA   . ILE A 1 109 ? 6.030   6.555   5.963   1.00 0.00 ? 109 ILE A HA   4  
ATOM 8353  H HB   . ILE A 1 109 ? 7.501   4.880   4.074   1.00 0.00 ? 109 ILE A HB   4  
ATOM 8354  H HG12 . ILE A 1 109 ? 7.796   7.012   2.896   1.00 0.00 ? 109 ILE A HG12 4  
ATOM 8355  H HG13 . ILE A 1 109 ? 6.542   7.751   3.886   1.00 0.00 ? 109 ILE A HG13 4  
ATOM 8356  H HG21 . ILE A 1 109 ? 6.159   5.347   2.073   1.00 0.00 ? 109 ILE A HG21 4  
ATOM 8357  H HG22 . ILE A 1 109 ? 4.866   5.982   3.091   1.00 0.00 ? 109 ILE A HG22 4  
ATOM 8358  H HG23 . ILE A 1 109 ? 5.317   4.279   3.198   1.00 0.00 ? 109 ILE A HG23 4  
ATOM 8359  H HD11 . ILE A 1 109 ? 9.167   6.687   4.897   1.00 0.00 ? 109 ILE A HD11 4  
ATOM 8360  H HD12 . ILE A 1 109 ? 7.923   7.485   5.861   1.00 0.00 ? 109 ILE A HD12 4  
ATOM 8361  H HD13 . ILE A 1 109 ? 8.782   8.382   4.608   1.00 0.00 ? 109 ILE A HD13 4  
ATOM 8362  N N    . PHE A 1 110 ? 4.633   3.621   5.491   1.00 0.00 ? 110 PHE A N    4  
ATOM 8363  C CA   . PHE A 1 110 ? 3.370   2.887   5.517   1.00 0.00 ? 110 PHE A CA   4  
ATOM 8364  C C    . PHE A 1 110 ? 2.523   3.338   6.708   1.00 0.00 ? 110 PHE A C    4  
ATOM 8365  O O    . PHE A 1 110 ? 1.364   3.721   6.548   1.00 0.00 ? 110 PHE A O    4  
ATOM 8366  C CB   . PHE A 1 110 ? 3.654   1.375   5.592   1.00 0.00 ? 110 PHE A CB   4  
ATOM 8367  C CG   . PHE A 1 110 ? 2.425   0.496   5.559   1.00 0.00 ? 110 PHE A CG   4  
ATOM 8368  C CD1  . PHE A 1 110 ? 1.701   0.229   6.716   1.00 0.00 ? 110 PHE A CD1  4  
ATOM 8369  C CD2  . PHE A 1 110 ? 2.001   -0.071  4.368   1.00 0.00 ? 110 PHE A CD2  4  
ATOM 8370  C CE1  . PHE A 1 110 ? 0.581   -0.582  6.678   1.00 0.00 ? 110 PHE A CE1  4  
ATOM 8371  C CE2  . PHE A 1 110 ? 0.883   -0.880  4.327   1.00 0.00 ? 110 PHE A CE2  4  
ATOM 8372  C CZ   . PHE A 1 110 ? 0.173   -1.136  5.481   1.00 0.00 ? 110 PHE A CZ   4  
ATOM 8373  H H    . PHE A 1 110 ? 5.474   3.116   5.448   1.00 0.00 ? 110 PHE A H    4  
ATOM 8374  H HA   . PHE A 1 110 ? 2.839   3.105   4.601   1.00 0.00 ? 110 PHE A HA   4  
ATOM 8375  H HB2  . PHE A 1 110 ? 4.279   1.096   4.756   1.00 0.00 ? 110 PHE A HB2  4  
ATOM 8376  H HB3  . PHE A 1 110 ? 4.188   1.163   6.506   1.00 0.00 ? 110 PHE A HB3  4  
ATOM 8377  H HD1  . PHE A 1 110 ? 2.018   0.665   7.652   1.00 0.00 ? 110 PHE A HD1  4  
ATOM 8378  H HD2  . PHE A 1 110 ? 2.555   0.125   3.462   1.00 0.00 ? 110 PHE A HD2  4  
ATOM 8379  H HE1  . PHE A 1 110 ? 0.028   -0.783  7.583   1.00 0.00 ? 110 PHE A HE1  4  
ATOM 8380  H HE2  . PHE A 1 110 ? 0.566   -1.313  3.389   1.00 0.00 ? 110 PHE A HE2  4  
ATOM 8381  H HZ   . PHE A 1 110 ? -0.703  -1.770  5.444   1.00 0.00 ? 110 PHE A HZ   4  
ATOM 8382  N N    . ASN A 1 111 ? 3.126   3.317   7.896   1.00 0.00 ? 111 ASN A N    4  
ATOM 8383  C CA   . ASN A 1 111 ? 2.436   3.693   9.134   1.00 0.00 ? 111 ASN A CA   4  
ATOM 8384  C C    . ASN A 1 111 ? 2.076   5.177   9.139   1.00 0.00 ? 111 ASN A C    4  
ATOM 8385  O O    . ASN A 1 111 ? 1.026   5.571   9.652   1.00 0.00 ? 111 ASN A O    4  
ATOM 8386  C CB   . ASN A 1 111 ? 3.307   3.372   10.358  1.00 0.00 ? 111 ASN A CB   4  
ATOM 8387  C CG   . ASN A 1 111 ? 3.514   1.881   10.572  1.00 0.00 ? 111 ASN A CG   4  
ATOM 8388  O OD1  . ASN A 1 111 ? 2.650   1.063   10.249  1.00 0.00 ? 111 ASN A OD1  4  
ATOM 8389  N ND2  . ASN A 1 111 ? 4.662   1.519   11.124  1.00 0.00 ? 111 ASN A ND2  4  
ATOM 8390  H H    . ASN A 1 111 ? 4.066   3.040   7.942   1.00 0.00 ? 111 ASN A H    4  
ATOM 8391  H HA   . ASN A 1 111 ? 1.524   3.114   9.192   1.00 0.00 ? 111 ASN A HA   4  
ATOM 8392  H HB2  . ASN A 1 111 ? 4.276   3.833   10.231  1.00 0.00 ? 111 ASN A HB2  4  
ATOM 8393  H HB3  . ASN A 1 111 ? 2.836   3.778   11.243  1.00 0.00 ? 111 ASN A HB3  4  
ATOM 8394  H HD21 . ASN A 1 111 ? 5.306   2.224   11.358  1.00 0.00 ? 111 ASN A HD21 4  
ATOM 8395  H HD22 . ASN A 1 111 ? 4.819   0.566   11.286  1.00 0.00 ? 111 ASN A HD22 4  
ATOM 8396  N N    . LEU A 1 112 ? 2.951   5.992   8.560   1.00 0.00 ? 112 LEU A N    4  
ATOM 8397  C CA   . LEU A 1 112 ? 2.764   7.443   8.531   1.00 0.00 ? 112 LEU A CA   4  
ATOM 8398  C C    . LEU A 1 112 ? 1.431   7.798   7.868   1.00 0.00 ? 112 LEU A C    4  
ATOM 8399  O O    . LEU A 1 112 ? 0.673   8.621   8.377   1.00 0.00 ? 112 LEU A O    4  
ATOM 8400  C CB   . LEU A 1 112 ? 3.949   8.102   7.792   1.00 0.00 ? 112 LEU A CB   4  
ATOM 8401  C CG   . LEU A 1 112 ? 4.071   9.642   7.901   1.00 0.00 ? 112 LEU A CG   4  
ATOM 8402  C CD1  . LEU A 1 112 ? 5.484   10.090  7.534   1.00 0.00 ? 112 LEU A CD1  4  
ATOM 8403  C CD2  . LEU A 1 112 ? 3.054   10.354  7.005   1.00 0.00 ? 112 LEU A CD2  4  
ATOM 8404  H H    . LEU A 1 112 ? 3.752   5.608   8.142   1.00 0.00 ? 112 LEU A H    4  
ATOM 8405  H HA   . LEU A 1 112 ? 2.746   7.794   9.555   1.00 0.00 ? 112 LEU A HA   4  
ATOM 8406  H HB2  . LEU A 1 112 ? 4.860   7.668   8.179   1.00 0.00 ? 112 LEU A HB2  4  
ATOM 8407  H HB3  . LEU A 1 112 ? 3.874   7.844   6.745   1.00 0.00 ? 112 LEU A HB3  4  
ATOM 8408  H HG   . LEU A 1 112 ? 3.883   9.939   8.924   1.00 0.00 ? 112 LEU A HG   4  
ATOM 8409  H HD11 . LEU A 1 112 ? 5.708   9.794   6.518   1.00 0.00 ? 112 LEU A HD11 4  
ATOM 8410  H HD12 . LEU A 1 112 ? 6.194   9.631   8.207   1.00 0.00 ? 112 LEU A HD12 4  
ATOM 8411  H HD13 . LEU A 1 112 ? 5.555   11.165  7.619   1.00 0.00 ? 112 LEU A HD13 4  
ATOM 8412  H HD21 . LEU A 1 112 ? 3.217   10.071  5.975   1.00 0.00 ? 112 LEU A HD21 4  
ATOM 8413  H HD22 . LEU A 1 112 ? 3.171   11.423  7.106   1.00 0.00 ? 112 LEU A HD22 4  
ATOM 8414  H HD23 . LEU A 1 112 ? 2.054   10.076  7.301   1.00 0.00 ? 112 LEU A HD23 4  
ATOM 8415  N N    . MET A 1 113 ? 1.147   7.158   6.742   1.00 0.00 ? 113 MET A N    4  
ATOM 8416  C CA   . MET A 1 113 ? -0.068  7.445   5.976   1.00 0.00 ? 113 MET A CA   4  
ATOM 8417  C C    . MET A 1 113 ? -1.141  6.383   6.216   1.00 0.00 ? 113 MET A C    4  
ATOM 8418  O O    . MET A 1 113 ? -2.221  6.440   5.622   1.00 0.00 ? 113 MET A O    4  
ATOM 8419  C CB   . MET A 1 113 ? 0.268   7.541   4.478   1.00 0.00 ? 113 MET A CB   4  
ATOM 8420  C CG   . MET A 1 113 ? 0.917   6.287   3.907   1.00 0.00 ? 113 MET A CG   4  
ATOM 8421  S SD   . MET A 1 113 ? 1.391   6.476   2.176   1.00 0.00 ? 113 MET A SD   4  
ATOM 8422  C CE   . MET A 1 113 ? 2.125   4.875   1.849   1.00 0.00 ? 113 MET A CE   4  
ATOM 8423  H H    . MET A 1 113 ? 1.771   6.473   6.413   1.00 0.00 ? 113 MET A H    4  
ATOM 8424  H HA   . MET A 1 113 ? -0.452  8.400   6.306   1.00 0.00 ? 113 MET A HA   4  
ATOM 8425  H HB2  . MET A 1 113 ? -0.644  7.729   3.928   1.00 0.00 ? 113 MET A HB2  4  
ATOM 8426  H HB3  . MET A 1 113 ? 0.943   8.371   4.326   1.00 0.00 ? 113 MET A HB3  4  
ATOM 8427  H HG2  . MET A 1 113 ? 1.803   6.060   4.483   1.00 0.00 ? 113 MET A HG2  4  
ATOM 8428  H HG3  . MET A 1 113 ? 0.219   5.467   3.986   1.00 0.00 ? 113 MET A HG3  4  
ATOM 8429  H HE1  . MET A 1 113 ? 2.961   4.719   2.512   1.00 0.00 ? 113 MET A HE1  4  
ATOM 8430  H HE2  . MET A 1 113 ? 2.465   4.839   0.825   1.00 0.00 ? 113 MET A HE2  4  
ATOM 8431  H HE3  . MET A 1 113 ? 1.388   4.101   2.010   1.00 0.00 ? 113 MET A HE3  4  
ATOM 8432  N N    . LYS A 1 114 ? -0.847  5.446   7.118   1.00 0.00 ? 114 LYS A N    4  
ATOM 8433  C CA   . LYS A 1 114 ? -1.718  4.295   7.378   1.00 0.00 ? 114 LYS A CA   4  
ATOM 8434  C C    . LYS A 1 114 ? -3.118  4.721   7.821   1.00 0.00 ? 114 LYS A C    4  
ATOM 8435  O O    . LYS A 1 114 ? -4.106  4.083   7.463   1.00 0.00 ? 114 LYS A O    4  
ATOM 8436  C CB   . LYS A 1 114 ? -1.086  3.391   8.446   1.00 0.00 ? 114 LYS A CB   4  
ATOM 8437  C CG   . LYS A 1 114 ? -1.853  2.098   8.712   1.00 0.00 ? 114 LYS A CG   4  
ATOM 8438  C CD   . LYS A 1 114 ? -1.175  1.254   9.789   1.00 0.00 ? 114 LYS A CD   4  
ATOM 8439  C CE   . LYS A 1 114 ? -1.927  -0.044  10.059  1.00 0.00 ? 114 LYS A CE   4  
ATOM 8440  N NZ   . LYS A 1 114 ? -1.304  -0.821  11.164  1.00 0.00 ? 114 LYS A NZ   4  
ATOM 8441  H H    . LYS A 1 114 ? -0.013  5.528   7.625   1.00 0.00 ? 114 LYS A H    4  
ATOM 8442  H HA   . LYS A 1 114 ? -1.802  3.735   6.458   1.00 0.00 ? 114 LYS A HA   4  
ATOM 8443  H HB2  . LYS A 1 114 ? -0.087  3.129   8.129   1.00 0.00 ? 114 LYS A HB2  4  
ATOM 8444  H HB3  . LYS A 1 114 ? -1.022  3.943   9.374   1.00 0.00 ? 114 LYS A HB3  4  
ATOM 8445  H HG2  . LYS A 1 114 ? -2.854  2.344   9.039   1.00 0.00 ? 114 LYS A HG2  4  
ATOM 8446  H HG3  . LYS A 1 114 ? -1.904  1.525   7.795   1.00 0.00 ? 114 LYS A HG3  4  
ATOM 8447  H HD2  . LYS A 1 114 ? -0.172  1.012   9.465   1.00 0.00 ? 114 LYS A HD2  4  
ATOM 8448  H HD3  . LYS A 1 114 ? -1.128  1.829   10.705  1.00 0.00 ? 114 LYS A HD3  4  
ATOM 8449  H HE2  . LYS A 1 114 ? -2.947  0.191   10.330  1.00 0.00 ? 114 LYS A HE2  4  
ATOM 8450  H HE3  . LYS A 1 114 ? -1.923  -0.645  9.161   1.00 0.00 ? 114 LYS A HE3  4  
ATOM 8451  H HZ1  . LYS A 1 114 ? -1.856  -1.681  11.355  1.00 0.00 ? 114 LYS A HZ1  4  
ATOM 8452  H HZ2  . LYS A 1 114 ? -1.271  -0.246  12.031  1.00 0.00 ? 114 LYS A HZ2  4  
ATOM 8453  H HZ3  . LYS A 1 114 ? -0.333  -1.095  10.909  1.00 0.00 ? 114 LYS A HZ3  4  
ATOM 8454  N N    . PHE A 1 115 ? -3.199  5.790   8.605   1.00 0.00 ? 115 PHE A N    4  
ATOM 8455  C CA   . PHE A 1 115 ? -4.484  6.272   9.110   1.00 0.00 ? 115 PHE A CA   4  
ATOM 8456  C C    . PHE A 1 115 ? -4.601  7.783   8.893   1.00 0.00 ? 115 PHE A C    4  
ATOM 8457  O O    . PHE A 1 115 ? -5.338  8.479   9.594   1.00 0.00 ? 115 PHE A O    4  
ATOM 8458  C CB   . PHE A 1 115 ? -4.622  5.908   10.599  1.00 0.00 ? 115 PHE A CB   4  
ATOM 8459  C CG   . PHE A 1 115 ? -6.032  6.025   11.130  1.00 0.00 ? 115 PHE A CG   4  
ATOM 8460  C CD1  . PHE A 1 115 ? -7.052  5.246   10.599  1.00 0.00 ? 115 PHE A CD1  4  
ATOM 8461  C CD2  . PHE A 1 115 ? -6.339  6.905   12.159  1.00 0.00 ? 115 PHE A CD2  4  
ATOM 8462  C CE1  . PHE A 1 115 ? -8.343  5.344   11.081  1.00 0.00 ? 115 PHE A CE1  4  
ATOM 8463  C CE2  . PHE A 1 115 ? -7.630  7.006   12.643  1.00 0.00 ? 115 PHE A CE2  4  
ATOM 8464  C CZ   . PHE A 1 115 ? -8.633  6.225   12.102  1.00 0.00 ? 115 PHE A CZ   4  
ATOM 8465  H H    . PHE A 1 115 ? -2.377  6.259   8.864   1.00 0.00 ? 115 PHE A H    4  
ATOM 8466  H HA   . PHE A 1 115 ? -5.270  5.781   8.552   1.00 0.00 ? 115 PHE A HA   4  
ATOM 8467  H HB2  . PHE A 1 115 ? -4.301  4.886   10.742  1.00 0.00 ? 115 PHE A HB2  4  
ATOM 8468  H HB3  . PHE A 1 115 ? -3.985  6.562   11.181  1.00 0.00 ? 115 PHE A HB3  4  
ATOM 8469  H HD1  . PHE A 1 115 ? -6.829  4.555   9.797   1.00 0.00 ? 115 PHE A HD1  4  
ATOM 8470  H HD2  . PHE A 1 115 ? -5.556  7.518   12.583  1.00 0.00 ? 115 PHE A HD2  4  
ATOM 8471  H HE1  . PHE A 1 115 ? -9.126  4.731   10.657  1.00 0.00 ? 115 PHE A HE1  4  
ATOM 8472  H HE2  . PHE A 1 115 ? -7.856  7.698   13.443  1.00 0.00 ? 115 PHE A HE2  4  
ATOM 8473  H HZ   . PHE A 1 115 ? -9.642  6.304   12.480  1.00 0.00 ? 115 PHE A HZ   4  
ATOM 8474  N N    . ASP A 1 116 ? -3.890  8.274   7.880   1.00 0.00 ? 116 ASP A N    4  
ATOM 8475  C CA   . ASP A 1 116 ? -3.864  9.703   7.560   1.00 0.00 ? 116 ASP A CA   4  
ATOM 8476  C C    . ASP A 1 116 ? -4.277  9.911   6.109   1.00 0.00 ? 116 ASP A C    4  
ATOM 8477  O O    . ASP A 1 116 ? -5.435  10.224  5.823   1.00 0.00 ? 116 ASP A O    4  
ATOM 8478  C CB   . ASP A 1 116 ? -2.468  10.299  7.813   1.00 0.00 ? 116 ASP A CB   4  
ATOM 8479  C CG   . ASP A 1 116 ? -2.123  10.402  9.292   1.00 0.00 ? 116 ASP A CG   4  
ATOM 8480  O OD1  . ASP A 1 116 ? -1.728  9.379   9.892   1.00 0.00 ? 116 ASP A OD1  4  
ATOM 8481  O OD2  . ASP A 1 116 ? -2.244  11.509  9.861   1.00 0.00 ? 116 ASP A OD2  4  
ATOM 8482  H H    . ASP A 1 116 ? -3.383  7.652   7.318   1.00 0.00 ? 116 ASP A H    4  
ATOM 8483  H HA   . ASP A 1 116 ? -4.583  10.203  8.198   1.00 0.00 ? 116 ASP A HA   4  
ATOM 8484  H HB2  . ASP A 1 116 ? -1.726  9.677   7.333   1.00 0.00 ? 116 ASP A HB2  4  
ATOM 8485  H HB3  . ASP A 1 116 ? -2.424  11.291  7.381   1.00 0.00 ? 116 ASP A HB3  4  
ATOM 8486  N N    . SER A 1 117 ? -3.334  9.706   5.192   1.00 0.00 ? 117 SER A N    4  
ATOM 8487  C CA   . SER A 1 117 ? -3.623  9.785   3.767   1.00 0.00 ? 117 SER A CA   4  
ATOM 8488  C C    . SER A 1 117 ? -4.678  8.742   3.401   1.00 0.00 ? 117 SER A C    4  
ATOM 8489  O O    . SER A 1 117 ? -5.588  9.012   2.621   1.00 0.00 ? 117 SER A O    4  
ATOM 8490  C CB   . SER A 1 117 ? -2.341  9.578   2.948   1.00 0.00 ? 117 SER A CB   4  
ATOM 8491  O OG   . SER A 1 117 ? -2.581  9.730   1.561   1.00 0.00 ? 117 SER A OG   4  
ATOM 8492  H H    . SER A 1 117 ? -2.421  9.509   5.482   1.00 0.00 ? 117 SER A H    4  
ATOM 8493  H HA   . SER A 1 117 ? -4.018  10.772  3.563   1.00 0.00 ? 117 SER A HA   4  
ATOM 8494  H HB2  . SER A 1 117 ? -1.600  10.306  3.250   1.00 0.00 ? 117 SER A HB2  4  
ATOM 8495  H HB3  . SER A 1 117 ? -1.958  8.583   3.127   1.00 0.00 ? 117 SER A HB3  4  
ATOM 8496  H HG   . SER A 1 117 ? -3.007  10.577  1.399   1.00 0.00 ? 117 SER A HG   4  
ATOM 8497  N N    . TYR A 1 118 ? -4.556  7.557   4.002   1.00 0.00 ? 118 TYR A N    4  
ATOM 8498  C CA   . TYR A 1 118 ? -5.555  6.498   3.859   1.00 0.00 ? 118 TYR A CA   4  
ATOM 8499  C C    . TYR A 1 118 ? -6.935  6.999   4.277   1.00 0.00 ? 118 TYR A C    4  
ATOM 8500  O O    . TYR A 1 118 ? -7.916  6.859   3.539   1.00 0.00 ? 118 TYR A O    4  
ATOM 8501  C CB   . TYR A 1 118 ? -5.148  5.289   4.716   1.00 0.00 ? 118 TYR A CB   4  
ATOM 8502  C CG   . TYR A 1 118 ? -6.235  4.242   4.908   1.00 0.00 ? 118 TYR A CG   4  
ATOM 8503  C CD1  . TYR A 1 118 ? -6.585  3.372   3.884   1.00 0.00 ? 118 TYR A CD1  4  
ATOM 8504  C CD2  . TYR A 1 118 ? -6.903  4.123   6.125   1.00 0.00 ? 118 TYR A CD2  4  
ATOM 8505  C CE1  . TYR A 1 118 ? -7.566  2.416   4.064   1.00 0.00 ? 118 TYR A CE1  4  
ATOM 8506  C CE2  . TYR A 1 118 ? -7.883  3.168   6.313   1.00 0.00 ? 118 TYR A CE2  4  
ATOM 8507  C CZ   . TYR A 1 118 ? -8.212  2.316   5.281   1.00 0.00 ? 118 TYR A CZ   4  
ATOM 8508  O OH   . TYR A 1 118 ? -9.188  1.362   5.468   1.00 0.00 ? 118 TYR A OH   4  
ATOM 8509  H H    . TYR A 1 118 ? -3.764  7.386   4.554   1.00 0.00 ? 118 TYR A H    4  
ATOM 8510  H HA   . TYR A 1 118 ? -5.584  6.203   2.819   1.00 0.00 ? 118 TYR A HA   4  
ATOM 8511  H HB2  . TYR A 1 118 ? -4.303  4.800   4.252   1.00 0.00 ? 118 TYR A HB2  4  
ATOM 8512  H HB3  . TYR A 1 118 ? -4.849  5.642   5.694   1.00 0.00 ? 118 TYR A HB3  4  
ATOM 8513  H HD1  . TYR A 1 118 ? -6.078  3.450   2.933   1.00 0.00 ? 118 TYR A HD1  4  
ATOM 8514  H HD2  . TYR A 1 118 ? -6.645  4.792   6.934   1.00 0.00 ? 118 TYR A HD2  4  
ATOM 8515  H HE1  . TYR A 1 118 ? -7.820  1.748   3.254   1.00 0.00 ? 118 TYR A HE1  4  
ATOM 8516  H HE2  . TYR A 1 118 ? -8.387  3.092   7.267   1.00 0.00 ? 118 TYR A HE2  4  
ATOM 8517  H HH   . TYR A 1 118 ? -9.918  1.739   5.970   1.00 0.00 ? 118 TYR A HH   4  
ATOM 8518  N N    . ALA A 1 119 ? -6.998  7.599   5.464   1.00 0.00 ? 119 ALA A N    4  
ATOM 8519  C CA   . ALA A 1 119 ? -8.257  8.100   6.010   1.00 0.00 ? 119 ALA A CA   4  
ATOM 8520  C C    . ALA A 1 119 ? -8.862  9.161   5.092   1.00 0.00 ? 119 ALA A C    4  
ATOM 8521  O O    . ALA A 1 119 ? -10.078 9.239   4.934   1.00 0.00 ? 119 ALA A O    4  
ATOM 8522  C CB   . ALA A 1 119 ? -8.040  8.661   7.411   1.00 0.00 ? 119 ALA A CB   4  
ATOM 8523  H H    . ALA A 1 119 ? -6.172  7.711   5.987   1.00 0.00 ? 119 ALA A H    4  
ATOM 8524  H HA   . ALA A 1 119 ? -8.943  7.266   6.082   1.00 0.00 ? 119 ALA A HA   4  
ATOM 8525  H HB1  . ALA A 1 119 ? -7.355  9.495   7.365   1.00 0.00 ? 119 ALA A HB1  4  
ATOM 8526  H HB2  . ALA A 1 119 ? -7.627  7.893   8.049   1.00 0.00 ? 119 ALA A HB2  4  
ATOM 8527  H HB3  . ALA A 1 119 ? -8.985  8.995   7.818   1.00 0.00 ? 119 ALA A HB3  4  
ATOM 8528  N N    . ARG A 1 120 ? -7.997  9.965   4.480   1.00 0.00 ? 120 ARG A N    4  
ATOM 8529  C CA   . ARG A 1 120 ? -8.429  11.052  3.602   1.00 0.00 ? 120 ARG A CA   4  
ATOM 8530  C C    . ARG A 1 120 ? -8.767  10.521  2.203   1.00 0.00 ? 120 ARG A C    4  
ATOM 8531  O O    . ARG A 1 120 ? -9.618  11.080  1.499   1.00 0.00 ? 120 ARG A O    4  
ATOM 8532  C CB   . ARG A 1 120 ? -7.328  12.122  3.543   1.00 0.00 ? 120 ARG A CB   4  
ATOM 8533  C CG   . ARG A 1 120 ? -7.697  13.376  2.754   1.00 0.00 ? 120 ARG A CG   4  
ATOM 8534  C CD   . ARG A 1 120 ? -6.727  14.522  3.041   1.00 0.00 ? 120 ARG A CD   4  
ATOM 8535  N NE   . ARG A 1 120 ? -5.337  14.175  2.727   1.00 0.00 ? 120 ARG A NE   4  
ATOM 8536  C CZ   . ARG A 1 120 ? -4.383  13.941  3.638   1.00 0.00 ? 120 ARG A CZ   4  
ATOM 8537  N NH1  . ARG A 1 120 ? -4.659  13.978  4.939   1.00 0.00 ? 120 ARG A NH1  4  
ATOM 8538  N NH2  . ARG A 1 120 ? -3.152  13.675  3.238   1.00 0.00 ? 120 ARG A NH2  4  
ATOM 8539  H H    . ARG A 1 120 ? -7.038  9.825   4.626   1.00 0.00 ? 120 ARG A H    4  
ATOM 8540  H HA   . ARG A 1 120 ? -9.319  11.491  4.032   1.00 0.00 ? 120 ARG A HA   4  
ATOM 8541  H HB2  . ARG A 1 120 ? -7.087  12.421  4.553   1.00 0.00 ? 120 ARG A HB2  4  
ATOM 8542  H HB3  . ARG A 1 120 ? -6.446  11.687  3.091   1.00 0.00 ? 120 ARG A HB3  4  
ATOM 8543  H HG2  . ARG A 1 120 ? -7.669  13.149  1.697   1.00 0.00 ? 120 ARG A HG2  4  
ATOM 8544  H HG3  . ARG A 1 120 ? -8.697  13.685  3.031   1.00 0.00 ? 120 ARG A HG3  4  
ATOM 8545  H HD2  . ARG A 1 120 ? -7.013  15.376  2.446   1.00 0.00 ? 120 ARG A HD2  4  
ATOM 8546  H HD3  . ARG A 1 120 ? -6.798  14.781  4.089   1.00 0.00 ? 120 ARG A HD3  4  
ATOM 8547  H HE   . ARG A 1 120 ? -5.089  14.133  1.769   1.00 0.00 ? 120 ARG A HE   4  
ATOM 8548  H HH11 . ARG A 1 120 ? -5.585  14.181  5.252   1.00 0.00 ? 120 ARG A HH11 4  
ATOM 8549  H HH12 . ARG A 1 120 ? -3.931  13.809  5.615   1.00 0.00 ? 120 ARG A HH12 4  
ATOM 8550  H HH21 . ARG A 1 120 ? -2.936  13.661  2.252   1.00 0.00 ? 120 ARG A HH21 4  
ATOM 8551  H HH22 . ARG A 1 120 ? -2.429  13.489  3.907   1.00 0.00 ? 120 ARG A HH22 4  
ATOM 8552  N N    . PHE A 1 121 ? -8.116  9.426   1.821   1.00 0.00 ? 121 PHE A N    4  
ATOM 8553  C CA   . PHE A 1 121 ? -8.352  8.785   0.528   1.00 0.00 ? 121 PHE A CA   4  
ATOM 8554  C C    . PHE A 1 121 ? -9.815  8.375   0.392   1.00 0.00 ? 121 PHE A C    4  
ATOM 8555  O O    . PHE A 1 121 ? -10.495 8.766   -0.555  1.00 0.00 ? 121 PHE A O    4  
ATOM 8556  C CB   . PHE A 1 121 ? -7.439  7.556   0.369   1.00 0.00 ? 121 PHE A CB   4  
ATOM 8557  C CG   . PHE A 1 121 ? -7.757  6.705   -0.840  1.00 0.00 ? 121 PHE A CG   4  
ATOM 8558  C CD1  . PHE A 1 121 ? -7.329  7.080   -2.105  1.00 0.00 ? 121 PHE A CD1  4  
ATOM 8559  C CD2  . PHE A 1 121 ? -8.481  5.526   -0.708  1.00 0.00 ? 121 PHE A CD2  4  
ATOM 8560  C CE1  . PHE A 1 121 ? -7.618  6.301   -3.211  1.00 0.00 ? 121 PHE A CE1  4  
ATOM 8561  C CE2  . PHE A 1 121 ? -8.772  4.746   -1.811  1.00 0.00 ? 121 PHE A CE2  4  
ATOM 8562  C CZ   . PHE A 1 121 ? -8.340  5.133   -3.063  1.00 0.00 ? 121 PHE A CZ   4  
ATOM 8563  H H    . PHE A 1 121 ? -7.455  9.034   2.428   1.00 0.00 ? 121 PHE A H    4  
ATOM 8564  H HA   . PHE A 1 121 ? -8.115  9.502   -0.246  1.00 0.00 ? 121 PHE A HA   4  
ATOM 8565  H HB2  . PHE A 1 121 ? -6.414  7.888   0.281   1.00 0.00 ? 121 PHE A HB2  4  
ATOM 8566  H HB3  . PHE A 1 121 ? -7.530  6.934   1.250   1.00 0.00 ? 121 PHE A HB3  4  
ATOM 8567  H HD1  . PHE A 1 121 ? -6.764  7.993   -2.227  1.00 0.00 ? 121 PHE A HD1  4  
ATOM 8568  H HD2  . PHE A 1 121 ? -8.821  5.219   0.271   1.00 0.00 ? 121 PHE A HD2  4  
ATOM 8569  H HE1  . PHE A 1 121 ? -7.279  6.607   -4.191  1.00 0.00 ? 121 PHE A HE1  4  
ATOM 8570  H HE2  . PHE A 1 121 ? -9.338  3.834   -1.694  1.00 0.00 ? 121 PHE A HE2  4  
ATOM 8571  H HZ   . PHE A 1 121 ? -8.567  4.522   -3.926  1.00 0.00 ? 121 PHE A HZ   4  
ATOM 8572  N N    . VAL A 1 122 ? -10.294 7.600   1.360   1.00 0.00 ? 122 VAL A N    4  
ATOM 8573  C CA   . VAL A 1 122 ? -11.667 7.093   1.331   1.00 0.00 ? 122 VAL A CA   4  
ATOM 8574  C C    . VAL A 1 122 ? -12.686 8.235   1.452   1.00 0.00 ? 122 VAL A C    4  
ATOM 8575  O O    . VAL A 1 122 ? -13.854 8.075   1.099   1.00 0.00 ? 122 VAL A O    4  
ATOM 8576  C CB   . VAL A 1 122 ? -11.912 6.055   2.458   1.00 0.00 ? 122 VAL A CB   4  
ATOM 8577  C CG1  . VAL A 1 122 ? -10.958 4.871   2.309   1.00 0.00 ? 122 VAL A CG1  4  
ATOM 8578  C CG2  . VAL A 1 122 ? -11.769 6.701   3.838   1.00 0.00 ? 122 VAL A CG2  4  
ATOM 8579  H H    . VAL A 1 122 ? -9.708  7.358   2.113   1.00 0.00 ? 122 VAL A H    4  
ATOM 8580  H HA   . VAL A 1 122 ? -11.814 6.594   0.373   1.00 0.00 ? 122 VAL A HA   4  
ATOM 8581  H HB   . VAL A 1 122 ? -12.924 5.682   2.362   1.00 0.00 ? 122 VAL A HB   4  
ATOM 8582  H HG11 . VAL A 1 122 ? -9.936  5.219   2.375   1.00 0.00 ? 122 VAL A HG11 4  
ATOM 8583  H HG12 . VAL A 1 122 ? -11.114 4.396   1.351   1.00 0.00 ? 122 VAL A HG12 4  
ATOM 8584  H HG13 . VAL A 1 122 ? -11.146 4.156   3.098   1.00 0.00 ? 122 VAL A HG13 4  
ATOM 8585  H HG21 . VAL A 1 122 ? -10.772 7.108   3.945   1.00 0.00 ? 122 VAL A HG21 4  
ATOM 8586  H HG22 . VAL A 1 122 ? -11.934 5.957   4.604   1.00 0.00 ? 122 VAL A HG22 4  
ATOM 8587  H HG23 . VAL A 1 122 ? -12.494 7.494   3.945   1.00 0.00 ? 122 VAL A HG23 4  
ATOM 8588  N N    . LYS A 1 123 ? -12.231 9.383   1.963   1.00 0.00 ? 123 LYS A N    4  
ATOM 8589  C CA   . LYS A 1 123 ? -13.083 10.571  2.092   1.00 0.00 ? 123 LYS A CA   4  
ATOM 8590  C C    . LYS A 1 123 ? -13.225 11.282  0.749   1.00 0.00 ? 123 LYS A C    4  
ATOM 8591  O O    . LYS A 1 123 ? -14.206 11.994  0.513   1.00 0.00 ? 123 LYS A O    4  
ATOM 8592  C CB   . LYS A 1 123 ? -12.503 11.548  3.127   1.00 0.00 ? 123 LYS A CB   4  
ATOM 8593  C CG   . LYS A 1 123 ? -12.530 11.025  4.557   1.00 0.00 ? 123 LYS A CG   4  
ATOM 8594  C CD   . LYS A 1 123 ? -11.817 11.979  5.513   1.00 0.00 ? 123 LYS A CD   4  
ATOM 8595  C CE   . LYS A 1 123 ? -11.851 11.477  6.951   1.00 0.00 ? 123 LYS A CE   4  
ATOM 8596  N NZ   . LYS A 1 123 ? -13.235 11.419  7.491   1.00 0.00 ? 123 LYS A NZ   4  
ATOM 8597  H H    . LYS A 1 123 ? -11.300 9.432   2.260   1.00 0.00 ? 123 LYS A H    4  
ATOM 8598  H HA   . LYS A 1 123 ? -14.061 10.250  2.423   1.00 0.00 ? 123 LYS A HA   4  
ATOM 8599  H HB2  . LYS A 1 123 ? -11.475 11.761  2.866   1.00 0.00 ? 123 LYS A HB2  4  
ATOM 8600  H HB3  . LYS A 1 123 ? -13.069 12.470  3.094   1.00 0.00 ? 123 LYS A HB3  4  
ATOM 8601  H HG2  . LYS A 1 123 ? -13.559 10.914  4.871   1.00 0.00 ? 123 LYS A HG2  4  
ATOM 8602  H HG3  . LYS A 1 123 ? -12.038 10.063  4.587   1.00 0.00 ? 123 LYS A HG3  4  
ATOM 8603  H HD2  . LYS A 1 123 ? -10.786 12.078  5.203   1.00 0.00 ? 123 LYS A HD2  4  
ATOM 8604  H HD3  . LYS A 1 123 ? -12.300 12.946  5.468   1.00 0.00 ? 123 LYS A HD3  4  
ATOM 8605  H HE2  . LYS A 1 123 ? -11.419 10.487  6.985   1.00 0.00 ? 123 LYS A HE2  4  
ATOM 8606  H HE3  . LYS A 1 123 ? -11.264 12.145  7.564   1.00 0.00 ? 123 LYS A HE3  4  
ATOM 8607  H HZ1  . LYS A 1 123 ? -13.226 11.039  8.461   1.00 0.00 ? 123 LYS A HZ1  4  
ATOM 8608  H HZ2  . LYS A 1 123 ? -13.829 10.806  6.897   1.00 0.00 ? 123 LYS A HZ2  4  
ATOM 8609  H HZ3  . LYS A 1 123 ? -13.656 12.369  7.508   1.00 0.00 ? 123 LYS A HZ3  4  
ATOM 8610  N N    . SER A 1 124 ? -12.230 11.097  -0.115  1.00 0.00 ? 124 SER A N    4  
ATOM 8611  C CA   . SER A 1 124 ? -12.236 11.711  -1.438  1.00 0.00 ? 124 SER A CA   4  
ATOM 8612  C C    . SER A 1 124 ? -13.415 11.194  -2.271  1.00 0.00 ? 124 SER A C    4  
ATOM 8613  O O    . SER A 1 124 ? -13.549 9.989   -2.484  1.00 0.00 ? 124 SER A O    4  
ATOM 8614  C CB   . SER A 1 124 ? -10.910 11.430  -2.154  1.00 0.00 ? 124 SER A CB   4  
ATOM 8615  O OG   . SER A 1 124 ? -9.816  11.942  -1.411  1.00 0.00 ? 124 SER A OG   4  
ATOM 8616  H H    . SER A 1 124 ? -11.473 10.528  0.144   1.00 0.00 ? 124 SER A H    4  
ATOM 8617  H HA   . SER A 1 124 ? -12.343 12.776  -1.305  1.00 0.00 ? 124 SER A HA   4  
ATOM 8618  H HB2  . SER A 1 124 ? -10.782 10.364  -2.272  1.00 0.00 ? 124 SER A HB2  4  
ATOM 8619  H HB3  . SER A 1 124 ? -10.919 11.901  -3.127  1.00 0.00 ? 124 SER A HB3  4  
ATOM 8620  H HG   . SER A 1 124 ? -9.785  11.513  -0.548  1.00 0.00 ? 124 SER A HG   4  
ATOM 8621  N N    . PRO A 1 125 ? -14.277 12.108  -2.765  1.00 0.00 ? 125 PRO A N    4  
ATOM 8622  C CA   . PRO A 1 125 ? -15.499 11.743  -3.501  1.00 0.00 ? 125 PRO A CA   4  
ATOM 8623  C C    . PRO A 1 125 ? -15.229 10.834  -4.701  1.00 0.00 ? 125 PRO A C    4  
ATOM 8624  O O    . PRO A 1 125 ? -16.082 10.032  -5.080  1.00 0.00 ? 125 PRO A O    4  
ATOM 8625  C CB   . PRO A 1 125 ? -16.067 13.098  -3.963  1.00 0.00 ? 125 PRO A CB   4  
ATOM 8626  C CG   . PRO A 1 125 ? -14.947 14.072  -3.807  1.00 0.00 ? 125 PRO A CG   4  
ATOM 8627  C CD   . PRO A 1 125 ? -14.131 13.571  -2.650  1.00 0.00 ? 125 PRO A CD   4  
ATOM 8628  H HA   . PRO A 1 125 ? -16.214 11.258  -2.849  1.00 0.00 ? 125 PRO A HA   4  
ATOM 8629  H HB2  . PRO A 1 125 ? -16.391 13.029  -4.992  1.00 0.00 ? 125 PRO A HB2  4  
ATOM 8630  H HB3  . PRO A 1 125 ? -16.908 13.365  -3.339  1.00 0.00 ? 125 PRO A HB3  4  
ATOM 8631  H HG2  . PRO A 1 125 ? -14.347 14.094  -4.709  1.00 0.00 ? 125 PRO A HG2  4  
ATOM 8632  H HG3  . PRO A 1 125 ? -15.339 15.057  -3.593  1.00 0.00 ? 125 PRO A HG3  4  
ATOM 8633  H HD2  . PRO A 1 125 ? -13.097 13.873  -2.757  1.00 0.00 ? 125 PRO A HD2  4  
ATOM 8634  H HD3  . PRO A 1 125 ? -14.536 13.928  -1.714  1.00 0.00 ? 125 PRO A HD3  4  
ATOM 8635  N N    . LEU A 1 126 ? -14.032 10.958  -5.275  1.00 0.00 ? 126 LEU A N    4  
ATOM 8636  C CA   . LEU A 1 126 ? -13.638 10.191  -6.462  1.00 0.00 ? 126 LEU A CA   4  
ATOM 8637  C C    . LEU A 1 126 ? -13.747 8.683   -6.188  1.00 0.00 ? 126 LEU A C    4  
ATOM 8638  O O    . LEU A 1 126 ? -13.912 7.880   -7.109  1.00 0.00 ? 126 LEU A O    4  
ATOM 8639  C CB   . LEU A 1 126 ? -12.200 10.588  -6.873  1.00 0.00 ? 126 LEU A CB   4  
ATOM 8640  C CG   . LEU A 1 126 ? -11.795 10.330  -8.347  1.00 0.00 ? 126 LEU A CG   4  
ATOM 8641  C CD1  . LEU A 1 126 ? -10.534 11.122  -8.703  1.00 0.00 ? 126 LEU A CD1  4  
ATOM 8642  C CD2  . LEU A 1 126 ? -11.568 8.843   -8.623  1.00 0.00 ? 126 LEU A CD2  4  
ATOM 8643  H H    . LEU A 1 126 ? -13.391 11.586  -4.885  1.00 0.00 ? 126 LEU A H    4  
ATOM 8644  H HA   . LEU A 1 126 ? -14.317 10.451  -7.262  1.00 0.00 ? 126 LEU A HA   4  
ATOM 8645  H HB2  . LEU A 1 126 ? -12.080 11.644  -6.675  1.00 0.00 ? 126 LEU A HB2  4  
ATOM 8646  H HB3  . LEU A 1 126 ? -11.510 10.050  -6.237  1.00 0.00 ? 126 LEU A HB3  4  
ATOM 8647  H HG   . LEU A 1 126 ? -12.588 10.671  -8.995  1.00 0.00 ? 126 LEU A HG   4  
ATOM 8648  H HD11 . LEU A 1 126 ? -10.714 12.176  -8.555  1.00 0.00 ? 126 LEU A HD11 4  
ATOM 8649  H HD12 . LEU A 1 126 ? -10.279 10.946  -9.738  1.00 0.00 ? 126 LEU A HD12 4  
ATOM 8650  H HD13 . LEU A 1 126 ? -9.712  10.804  -8.073  1.00 0.00 ? 126 LEU A HD13 4  
ATOM 8651  H HD21 . LEU A 1 126 ? -12.486 8.302   -8.455  1.00 0.00 ? 126 LEU A HD21 4  
ATOM 8652  H HD22 . LEU A 1 126 ? -10.801 8.463   -7.963  1.00 0.00 ? 126 LEU A HD22 4  
ATOM 8653  H HD23 . LEU A 1 126 ? -11.257 8.710   -9.650  1.00 0.00 ? 126 LEU A HD23 4  
ATOM 8654  N N    . TYR A 1 127 ? -13.689 8.314   -4.907  1.00 0.00 ? 127 TYR A N    4  
ATOM 8655  C CA   . TYR A 1 127 ? -13.795 6.918   -4.486  1.00 0.00 ? 127 TYR A CA   4  
ATOM 8656  C C    . TYR A 1 127 ? -15.051 6.267   -5.077  1.00 0.00 ? 127 TYR A C    4  
ATOM 8657  O O    . TYR A 1 127 ? -15.014 5.127   -5.555  1.00 0.00 ? 127 TYR A O    4  
ATOM 8658  C CB   . TYR A 1 127 ? -13.836 6.842   -2.950  1.00 0.00 ? 127 TYR A CB   4  
ATOM 8659  C CG   . TYR A 1 127 ? -13.661 5.444   -2.373  1.00 0.00 ? 127 TYR A CG   4  
ATOM 8660  C CD1  . TYR A 1 127 ? -14.681 4.496   -2.437  1.00 0.00 ? 127 TYR A CD1  4  
ATOM 8661  C CD2  . TYR A 1 127 ? -12.472 5.077   -1.749  1.00 0.00 ? 127 TYR A CD2  4  
ATOM 8662  C CE1  . TYR A 1 127 ? -14.518 3.231   -1.900  1.00 0.00 ? 127 TYR A CE1  4  
ATOM 8663  C CE2  . TYR A 1 127 ? -12.304 3.815   -1.213  1.00 0.00 ? 127 TYR A CE2  4  
ATOM 8664  C CZ   . TYR A 1 127 ? -13.329 2.896   -1.289  1.00 0.00 ? 127 TYR A CZ   4  
ATOM 8665  O OH   . TYR A 1 127 ? -13.165 1.641   -0.748  1.00 0.00 ? 127 TYR A OH   4  
ATOM 8666  H H    . TYR A 1 127 ? -13.575 9.006   -4.221  1.00 0.00 ? 127 TYR A H    4  
ATOM 8667  H HA   . TYR A 1 127 ? -12.922 6.391   -4.844  1.00 0.00 ? 127 TYR A HA   4  
ATOM 8668  H HB2  . TYR A 1 127 ? -13.047 7.463   -2.551  1.00 0.00 ? 127 TYR A HB2  4  
ATOM 8669  H HB3  . TYR A 1 127 ? -14.787 7.227   -2.605  1.00 0.00 ? 127 TYR A HB3  4  
ATOM 8670  H HD1  . TYR A 1 127 ? -15.612 4.760   -2.917  1.00 0.00 ? 127 TYR A HD1  4  
ATOM 8671  H HD2  . TYR A 1 127 ? -11.668 5.797   -1.687  1.00 0.00 ? 127 TYR A HD2  4  
ATOM 8672  H HE1  . TYR A 1 127 ? -15.321 2.509   -1.963  1.00 0.00 ? 127 TYR A HE1  4  
ATOM 8673  H HE2  . TYR A 1 127 ? -11.372 3.552   -0.737  1.00 0.00 ? 127 TYR A HE2  4  
ATOM 8674  H HH   . TYR A 1 127 ? -12.774 1.719   0.126   1.00 0.00 ? 127 TYR A HH   4  
ATOM 8675  N N    . ARG A 1 128 ? -16.160 7.007   -5.064  1.00 0.00 ? 128 ARG A N    4  
ATOM 8676  C CA   . ARG A 1 128 ? -17.441 6.452   -5.488  1.00 0.00 ? 128 ARG A CA   4  
ATOM 8677  C C    . ARG A 1 128 ? -17.471 6.255   -7.005  1.00 0.00 ? 128 ARG A C    4  
ATOM 8678  O O    . ARG A 1 128 ? -18.143 5.350   -7.493  1.00 0.00 ? 128 ARG A O    4  
ATOM 8679  C CB   . ARG A 1 128 ? -18.618 7.329   -5.002  1.00 0.00 ? 128 ARG A CB   4  
ATOM 8680  C CG   . ARG A 1 128 ? -18.791 8.654   -5.745  1.00 0.00 ? 128 ARG A CG   4  
ATOM 8681  C CD   . ARG A 1 128 ? -19.741 8.533   -6.937  1.00 0.00 ? 128 ARG A CD   4  
ATOM 8682  N NE   . ARG A 1 128 ? -19.669 9.704   -7.804  1.00 0.00 ? 128 ARG A NE   4  
ATOM 8683  C CZ   . ARG A 1 128 ? -20.617 10.077  -8.663  1.00 0.00 ? 128 ARG A CZ   4  
ATOM 8684  N NH1  . ARG A 1 128 ? -21.783 9.438   -8.701  1.00 0.00 ? 128 ARG A NH1  4  
ATOM 8685  N NH2  . ARG A 1 128 ? -20.394 11.108  -9.469  1.00 0.00 ? 128 ARG A NH2  4  
ATOM 8686  H H    . ARG A 1 128 ? -16.110 7.947   -4.776  1.00 0.00 ? 128 ARG A H    4  
ATOM 8687  H HA   . ARG A 1 128 ? -17.531 5.476   -5.026  1.00 0.00 ? 128 ARG A HA   4  
ATOM 8688  H HB2  . ARG A 1 128 ? -19.534 6.763   -5.106  1.00 0.00 ? 128 ARG A HB2  4  
ATOM 8689  H HB3  . ARG A 1 128 ? -18.469 7.550   -3.953  1.00 0.00 ? 128 ARG A HB3  4  
ATOM 8690  H HG2  . ARG A 1 128 ? -19.188 9.390   -5.060  1.00 0.00 ? 128 ARG A HG2  4  
ATOM 8691  H HG3  . ARG A 1 128 ? -17.825 8.984   -6.101  1.00 0.00 ? 128 ARG A HG3  4  
ATOM 8692  H HD2  . ARG A 1 128 ? -19.476 7.655   -7.510  1.00 0.00 ? 128 ARG A HD2  4  
ATOM 8693  H HD3  . ARG A 1 128 ? -20.753 8.429   -6.568  1.00 0.00 ? 128 ARG A HD3  4  
ATOM 8694  H HE   . ARG A 1 128 ? -18.838 10.230  -7.768  1.00 0.00 ? 128 ARG A HE   4  
ATOM 8695  H HH11 . ARG A 1 128 ? -21.958 8.668   -8.077  1.00 0.00 ? 128 ARG A HH11 4  
ATOM 8696  H HH12 . ARG A 1 128 ? -22.491 9.718   -9.349  1.00 0.00 ? 128 ARG A HH12 4  
ATOM 8697  H HH21 . ARG A 1 128 ? -19.515 11.596  -9.427  1.00 0.00 ? 128 ARG A HH21 4  
ATOM 8698  H HH22 . ARG A 1 128 ? -21.094 11.404  -10.122 1.00 0.00 ? 128 ARG A HH22 4  
ATOM 8699  N N    . GLU A 1 129 ? -16.733 7.091   -7.749  1.00 0.00 ? 129 GLU A N    4  
ATOM 8700  C CA   . GLU A 1 129 ? -16.626 6.940   -9.207  1.00 0.00 ? 129 GLU A CA   4  
ATOM 8701  C C    . GLU A 1 129 ? -16.017 5.583   -9.564  1.00 0.00 ? 129 GLU A C    4  
ATOM 8702  O O    . GLU A 1 129 ? -16.295 5.025   -10.627 1.00 0.00 ? 129 GLU A O    4  
ATOM 8703  C CB   . GLU A 1 129 ? -15.773 8.066   -9.837  1.00 0.00 ? 129 GLU A CB   4  
ATOM 8704  C CG   . GLU A 1 129 ? -16.532 9.365   -10.147 1.00 0.00 ? 129 GLU A CG   4  
ATOM 8705  C CD   . GLU A 1 129 ? -16.884 10.199  -8.923  1.00 0.00 ? 129 GLU A CD   4  
ATOM 8706  O OE1  . GLU A 1 129 ? -16.528 9.813   -7.798  1.00 0.00 ? 129 GLU A OE1  4  
ATOM 8707  O OE2  . GLU A 1 129 ? -17.532 11.260  -9.083  1.00 0.00 ? 129 GLU A OE2  4  
ATOM 8708  H H    . GLU A 1 129 ? -16.253 7.830   -7.310  1.00 0.00 ? 129 GLU A H    4  
ATOM 8709  H HA   . GLU A 1 129 ? -17.625 6.987   -9.616  1.00 0.00 ? 129 GLU A HA   4  
ATOM 8710  H HB2  . GLU A 1 129 ? -14.965 8.307   -9.160  1.00 0.00 ? 129 GLU A HB2  4  
ATOM 8711  H HB3  . GLU A 1 129 ? -15.347 7.700   -10.763 1.00 0.00 ? 129 GLU A HB3  4  
ATOM 8712  H HG2  . GLU A 1 129 ? -15.920 9.969   -10.801 1.00 0.00 ? 129 GLU A HG2  4  
ATOM 8713  H HG3  . GLU A 1 129 ? -17.449 9.109   -10.662 1.00 0.00 ? 129 GLU A HG3  4  
ATOM 8714  N N    . CYS A 1 130 ? -15.187 5.059   -8.669  1.00 0.00 ? 130 CYS A N    4  
ATOM 8715  C CA   . CYS A 1 130 ? -14.515 3.782   -8.896  1.00 0.00 ? 130 CYS A CA   4  
ATOM 8716  C C    . CYS A 1 130 ? -15.398 2.604   -8.476  1.00 0.00 ? 130 CYS A C    4  
ATOM 8717  O O    . CYS A 1 130 ? -15.402 1.557   -9.125  1.00 0.00 ? 130 CYS A O    4  
ATOM 8718  C CB   . CYS A 1 130 ? -13.191 3.747   -8.128  1.00 0.00 ? 130 CYS A CB   4  
ATOM 8719  S SG   . CYS A 1 130 ? -12.081 5.118   -8.520  1.00 0.00 ? 130 CYS A SG   4  
ATOM 8720  H H    . CYS A 1 130 ? -15.014 5.548   -7.835  1.00 0.00 ? 130 CYS A H    4  
ATOM 8721  H HA   . CYS A 1 130 ? -14.305 3.700   -9.953  1.00 0.00 ? 130 CYS A HA   4  
ATOM 8722  H HB2  . CYS A 1 130 ? -13.396 3.785   -7.066  1.00 0.00 ? 130 CYS A HB2  4  
ATOM 8723  H HB3  . CYS A 1 130 ? -12.672 2.826   -8.356  1.00 0.00 ? 130 CYS A HB3  4  
ATOM 8724  H HG   . CYS A 1 130 ? -12.793 6.056   -9.132  1.00 0.00 ? 130 CYS A HG   4  
ATOM 8725  N N    . LEU A 1 131 ? -16.147 2.781   -7.389  1.00 0.00 ? 131 LEU A N    4  
ATOM 8726  C CA   . LEU A 1 131 ? -16.974 1.705   -6.840  1.00 0.00 ? 131 LEU A CA   4  
ATOM 8727  C C    . LEU A 1 131 ? -18.395 1.742   -7.414  1.00 0.00 ? 131 LEU A C    4  
ATOM 8728  O O    . LEU A 1 131 ? -18.846 0.784   -8.047  1.00 0.00 ? 131 LEU A O    4  
ATOM 8729  C CB   . LEU A 1 131 ? -17.015 1.803   -5.306  1.00 0.00 ? 131 LEU A CB   4  
ATOM 8730  C CG   . LEU A 1 131 ? -17.839 0.715   -4.588  1.00 0.00 ? 131 LEU A CG   4  
ATOM 8731  C CD1  . LEU A 1 131 ? -17.313 -0.680  -4.918  1.00 0.00 ? 131 LEU A CD1  4  
ATOM 8732  C CD2  . LEU A 1 131 ? -17.834 0.949   -3.078  1.00 0.00 ? 131 LEU A CD2  4  
ATOM 8733  H H    . LEU A 1 131 ? -16.139 3.654   -6.941  1.00 0.00 ? 131 LEU A H    4  
ATOM 8734  H HA   . LEU A 1 131 ? -16.516 0.763   -7.114  1.00 0.00 ? 131 LEU A HA   4  
ATOM 8735  H HB2  . LEU A 1 131 ? -15.999 1.758   -4.938  1.00 0.00 ? 131 LEU A HB2  4  
ATOM 8736  H HB3  . LEU A 1 131 ? -17.427 2.767   -5.042  1.00 0.00 ? 131 LEU A HB3  4  
ATOM 8737  H HG   . LEU A 1 131 ? -18.864 0.769   -4.928  1.00 0.00 ? 131 LEU A HG   4  
ATOM 8738  H HD11 . LEU A 1 131 ? -17.916 -1.422  -4.413  1.00 0.00 ? 131 LEU A HD11 4  
ATOM 8739  H HD12 . LEU A 1 131 ? -16.287 -0.768  -4.590  1.00 0.00 ? 131 LEU A HD12 4  
ATOM 8740  H HD13 . LEU A 1 131 ? -17.363 -0.842  -5.985  1.00 0.00 ? 131 LEU A HD13 4  
ATOM 8741  H HD21 . LEU A 1 131 ? -18.411 0.176   -2.590  1.00 0.00 ? 131 LEU A HD21 4  
ATOM 8742  H HD22 . LEU A 1 131 ? -18.271 1.913   -2.861  1.00 0.00 ? 131 LEU A HD22 4  
ATOM 8743  H HD23 . LEU A 1 131 ? -16.818 0.925   -2.710  1.00 0.00 ? 131 LEU A HD23 4  
ATOM 8744  N N    . LEU A 1 132 ? -19.095 2.851   -7.191  1.00 0.00 ? 132 LEU A N    4  
ATOM 8745  C CA   . LEU A 1 132 ? -20.498 2.979   -7.598  1.00 0.00 ? 132 LEU A CA   4  
ATOM 8746  C C    . LEU A 1 132 ? -20.618 3.539   -9.017  1.00 0.00 ? 132 LEU A C    4  
ATOM 8747  O O    . LEU A 1 132 ? -21.635 3.341   -9.686  1.00 0.00 ? 132 LEU A O    4  
ATOM 8748  C CB   . LEU A 1 132 ? -21.271 3.890   -6.624  1.00 0.00 ? 132 LEU A CB   4  
ATOM 8749  C CG   . LEU A 1 132 ? -21.383 3.399   -5.167  1.00 0.00 ? 132 LEU A CG   4  
ATOM 8750  C CD1  . LEU A 1 132 ? -21.802 1.932   -5.109  1.00 0.00 ? 132 LEU A CD1  4  
ATOM 8751  C CD2  . LEU A 1 132 ? -20.084 3.637   -4.402  1.00 0.00 ? 132 LEU A CD2  4  
ATOM 8752  H H    . LEU A 1 132 ? -18.659 3.609   -6.749  1.00 0.00 ? 132 LEU A H    4  
ATOM 8753  H HA   . LEU A 1 132 ? -20.942 1.992   -7.578  1.00 0.00 ? 132 LEU A HA   4  
ATOM 8754  H HB2  . LEU A 1 132 ? -20.789 4.857   -6.616  1.00 0.00 ? 132 LEU A HB2  4  
ATOM 8755  H HB3  . LEU A 1 132 ? -22.273 4.018   -7.010  1.00 0.00 ? 132 LEU A HB3  4  
ATOM 8756  H HG   . LEU A 1 132 ? -22.158 3.970   -4.673  1.00 0.00 ? 132 LEU A HG   4  
ATOM 8757  H HD11 . LEU A 1 132 ? -21.049 1.321   -5.589  1.00 0.00 ? 132 LEU A HD11 4  
ATOM 8758  H HD12 . LEU A 1 132 ? -22.746 1.806   -5.618  1.00 0.00 ? 132 LEU A HD12 4  
ATOM 8759  H HD13 . LEU A 1 132 ? -21.907 1.629   -4.078  1.00 0.00 ? 132 LEU A HD13 4  
ATOM 8760  H HD21 . LEU A 1 132 ? -20.184 3.265   -3.393  1.00 0.00 ? 132 LEU A HD21 4  
ATOM 8761  H HD22 . LEU A 1 132 ? -19.871 4.695   -4.375  1.00 0.00 ? 132 LEU A HD22 4  
ATOM 8762  H HD23 . LEU A 1 132 ? -19.273 3.121   -4.896  1.00 0.00 ? 132 LEU A HD23 4  
ATOM 8763  N N    . ALA A 1 133 ? -19.573 4.238   -9.456  1.00 0.00 ? 133 ALA A N    4  
ATOM 8764  C CA   . ALA A 1 133 ? -19.547 4.906   -10.759 1.00 0.00 ? 133 ALA A CA   4  
ATOM 8765  C C    . ALA A 1 133 ? -20.625 5.990   -10.852 1.00 0.00 ? 133 ALA A C    4  
ATOM 8766  O O    . ALA A 1 133 ? -20.333 7.179   -10.712 1.00 0.00 ? 133 ALA A O    4  
ATOM 8767  C CB   . ALA A 1 133 ? -19.678 3.897   -11.898 1.00 0.00 ? 133 ALA A CB   4  
ATOM 8768  H H    . ALA A 1 133 ? -18.785 4.309   -8.881  1.00 0.00 ? 133 ALA A H    4  
ATOM 8769  H HA   . ALA A 1 133 ? -18.580 5.382   -10.852 1.00 0.00 ? 133 ALA A HA   4  
ATOM 8770  H HB1  . ALA A 1 133 ? -19.574 4.406   -12.846 1.00 0.00 ? 133 ALA A HB1  4  
ATOM 8771  H HB2  . ALA A 1 133 ? -20.648 3.423   -11.851 1.00 0.00 ? 133 ALA A HB2  4  
ATOM 8772  H HB3  . ALA A 1 133 ? -18.906 3.147   -11.808 1.00 0.00 ? 133 ALA A HB3  4  
ATOM 8773  N N    . GLU A 1 134 ? -21.872 5.575   -11.067 1.00 0.00 ? 134 GLU A N    4  
ATOM 8774  C CA   . GLU A 1 134 ? -22.989 6.510   -11.217 1.00 0.00 ? 134 GLU A CA   4  
ATOM 8775  C C    . GLU A 1 134 ? -24.012 6.320   -10.091 1.00 0.00 ? 134 GLU A C    4  
ATOM 8776  O O    . GLU A 1 134 ? -24.875 7.172   -9.871  1.00 0.00 ? 134 GLU A O    4  
ATOM 8777  C CB   . GLU A 1 134 ? -23.659 6.308   -12.586 1.00 0.00 ? 134 GLU A CB   4  
ATOM 8778  C CG   . GLU A 1 134 ? -24.683 7.383   -12.946 1.00 0.00 ? 134 GLU A CG   4  
ATOM 8779  C CD   . GLU A 1 134 ? -25.389 7.111   -14.266 1.00 0.00 ? 134 GLU A CD   4  
ATOM 8780  O OE1  . GLU A 1 134 ? -24.739 7.214   -15.328 1.00 0.00 ? 134 GLU A OE1  4  
ATOM 8781  O OE2  . GLU A 1 134 ? -26.599 6.796   -14.248 1.00 0.00 ? 134 GLU A OE2  4  
ATOM 8782  H H    . GLU A 1 134 ? -22.047 4.612   -11.129 1.00 0.00 ? 134 GLU A H    4  
ATOM 8783  H HA   . GLU A 1 134 ? -22.597 7.518   -11.162 1.00 0.00 ? 134 GLU A HA   4  
ATOM 8784  H HB2  . GLU A 1 134 ? -22.891 6.305   -13.349 1.00 0.00 ? 134 GLU A HB2  4  
ATOM 8785  H HB3  . GLU A 1 134 ? -24.157 5.348   -12.592 1.00 0.00 ? 134 GLU A HB3  4  
ATOM 8786  H HG2  . GLU A 1 134 ? -25.423 7.433   -12.159 1.00 0.00 ? 134 GLU A HG2  4  
ATOM 8787  H HG3  . GLU A 1 134 ? -24.175 8.335   -13.016 1.00 0.00 ? 134 GLU A HG3  4  
ATOM 8788  N N    . ALA A 1 135 ? -23.907 5.204   -9.377  1.00 0.00 ? 135 ALA A N    4  
ATOM 8789  C CA   . ALA A 1 135 ? -24.848 4.883   -8.307  1.00 0.00 ? 135 ALA A CA   4  
ATOM 8790  C C    . ALA A 1 135 ? -24.623 5.786   -7.095  1.00 0.00 ? 135 ALA A C    4  
ATOM 8791  O O    . ALA A 1 135 ? -23.846 5.457   -6.196  1.00 0.00 ? 135 ALA A O    4  
ATOM 8792  C CB   . ALA A 1 135 ? -24.735 3.412   -7.922  1.00 0.00 ? 135 ALA A CB   4  
ATOM 8793  H H    . ALA A 1 135 ? -23.171 4.587   -9.563  1.00 0.00 ? 135 ALA A H    4  
ATOM 8794  H HA   . ALA A 1 135 ? -25.848 5.053   -8.684  1.00 0.00 ? 135 ALA A HA   4  
ATOM 8795  H HB1  . ALA A 1 135 ? -23.745 3.213   -7.535  1.00 0.00 ? 135 ALA A HB1  4  
ATOM 8796  H HB2  . ALA A 1 135 ? -24.908 2.797   -8.794  1.00 0.00 ? 135 ALA A HB2  4  
ATOM 8797  H HB3  . ALA A 1 135 ? -25.471 3.177   -7.167  1.00 0.00 ? 135 ALA A HB3  4  
ATOM 8798  N N    . GLU A 1 136 ? -25.288 6.941   -7.108  1.00 0.00 ? 136 GLU A N    4  
ATOM 8799  C CA   . GLU A 1 136 ? -25.204 7.921   -6.022  1.00 0.00 ? 136 GLU A CA   4  
ATOM 8800  C C    . GLU A 1 136 ? -23.806 8.544   -5.946  1.00 0.00 ? 136 GLU A C    4  
ATOM 8801  O O    . GLU A 1 136 ? -22.890 8.143   -6.670  1.00 0.00 ? 136 GLU A O    4  
ATOM 8802  C CB   . GLU A 1 136 ? -25.584 7.294   -4.661  1.00 0.00 ? 136 GLU A CB   4  
ATOM 8803  C CG   . GLU A 1 136 ? -27.077 7.004   -4.481  1.00 0.00 ? 136 GLU A CG   4  
ATOM 8804  C CD   . GLU A 1 136 ? -27.614 5.932   -5.422  1.00 0.00 ? 136 GLU A CD   4  
ATOM 8805  O OE1  . GLU A 1 136 ? -28.062 6.282   -6.535  1.00 0.00 ? 136 GLU A OE1  4  
ATOM 8806  O OE2  . GLU A 1 136 ? -27.618 4.740   -5.043  1.00 0.00 ? 136 GLU A OE2  4  
ATOM 8807  H H    . GLU A 1 136 ? -25.843 7.148   -7.888  1.00 0.00 ? 136 GLU A H    4  
ATOM 8808  H HA   . GLU A 1 136 ? -25.911 8.708   -6.248  1.00 0.00 ? 136 GLU A HA   4  
ATOM 8809  H HB2  . GLU A 1 136 ? -25.047 6.363   -4.548  1.00 0.00 ? 136 GLU A HB2  4  
ATOM 8810  H HB3  . GLU A 1 136 ? -25.276 7.969   -3.874  1.00 0.00 ? 136 GLU A HB3  4  
ATOM 8811  H HG2  . GLU A 1 136 ? -27.244 6.680   -3.464  1.00 0.00 ? 136 GLU A HG2  4  
ATOM 8812  H HG3  . GLU A 1 136 ? -27.626 7.920   -4.653  1.00 0.00 ? 136 GLU A HG3  4  
ATOM 8813  N N    . SER A 1 1   ? -18.922 -7.258  10.127  1.00 0.00 ? 1   SER A N    5  
ATOM 8814  C CA   . SER A 1 1   ? -18.048 -6.162  9.659   1.00 0.00 ? 1   SER A CA   5  
ATOM 8815  C C    . SER A 1 1   ? -16.636 -6.700  9.399   1.00 0.00 ? 1   SER A C    5  
ATOM 8816  O O    . SER A 1 1   ? -16.410 -7.911  9.467   1.00 0.00 ? 1   SER A O    5  
ATOM 8817  C CB   . SER A 1 1   ? -18.019 -5.022  10.694  1.00 0.00 ? 1   SER A CB   5  
ATOM 8818  O OG   . SER A 1 1   ? -17.422 -3.845  10.158  1.00 0.00 ? 1   SER A OG   5  
ATOM 8819  H H1   . SER A 1 1   ? -18.559 -7.648  11.018  1.00 0.00 ? 1   SER A H1   5  
ATOM 8820  H H2   . SER A 1 1   ? -18.951 -8.015  9.418   1.00 0.00 ? 1   SER A H2   5  
ATOM 8821  H H3   . SER A 1 1   ? -19.888 -6.906  10.283  1.00 0.00 ? 1   SER A H3   5  
ATOM 8822  H HA   . SER A 1 1   ? -18.451 -5.788  8.728   1.00 0.00 ? 1   SER A HA   5  
ATOM 8823  H HB2  . SER A 1 1   ? -19.029 -4.788  10.996  1.00 0.00 ? 1   SER A HB2  5  
ATOM 8824  H HB3  . SER A 1 1   ? -17.452 -5.336  11.558  1.00 0.00 ? 1   SER A HB3  5  
ATOM 8825  H HG   . SER A 1 1   ? -17.762 -3.695  9.258   1.00 0.00 ? 1   SER A HG   5  
ATOM 8826  N N    . MET A 1 2   ? -15.705 -5.795  9.087   1.00 0.00 ? 2   MET A N    5  
ATOM 8827  C CA   . MET A 1 2   ? -14.315 -6.145  8.774   1.00 0.00 ? 2   MET A CA   5  
ATOM 8828  C C    . MET A 1 2   ? -14.242 -6.864  7.421   1.00 0.00 ? 2   MET A C    5  
ATOM 8829  O O    . MET A 1 2   ? -13.294 -7.600  7.131   1.00 0.00 ? 2   MET A O    5  
ATOM 8830  C CB   . MET A 1 2   ? -13.685 -6.998  9.895   1.00 0.00 ? 2   MET A CB   5  
ATOM 8831  C CG   . MET A 1 2   ? -12.167 -7.123  9.792   1.00 0.00 ? 2   MET A CG   5  
ATOM 8832  S SD   . MET A 1 2   ? -11.454 -8.128  11.113  1.00 0.00 ? 2   MET A SD   5  
ATOM 8833  C CE   . MET A 1 2   ? -9.707  -8.031  10.711  1.00 0.00 ? 2   MET A CE   5  
ATOM 8834  H H    . MET A 1 2   ? -15.967 -4.848  9.051   1.00 0.00 ? 2   MET A H    5  
ATOM 8835  H HA   . MET A 1 2   ? -13.764 -5.218  8.692   1.00 0.00 ? 2   MET A HA   5  
ATOM 8836  H HB2  . MET A 1 2   ? -13.923 -6.549  10.849  1.00 0.00 ? 2   MET A HB2  5  
ATOM 8837  H HB3  . MET A 1 2   ? -14.111 -7.991  9.859   1.00 0.00 ? 2   MET A HB3  5  
ATOM 8838  H HG2  . MET A 1 2   ? -11.919 -7.577  8.843   1.00 0.00 ? 2   MET A HG2  5  
ATOM 8839  H HG3  . MET A 1 2   ? -11.734 -6.134  9.838   1.00 0.00 ? 2   MET A HG3  5  
ATOM 8840  H HE1  . MET A 1 2   ? -9.389  -6.998  10.729  1.00 0.00 ? 2   MET A HE1  5  
ATOM 8841  H HE2  . MET A 1 2   ? -9.541  -8.441  9.726   1.00 0.00 ? 2   MET A HE2  5  
ATOM 8842  H HE3  . MET A 1 2   ? -9.140  -8.595  11.436  1.00 0.00 ? 2   MET A HE3  5  
ATOM 8843  N N    . THR A 1 3   ? -15.247 -6.613  6.590   1.00 0.00 ? 3   THR A N    5  
ATOM 8844  C CA   . THR A 1 3   ? -15.303 -7.149  5.235   1.00 0.00 ? 3   THR A CA   5  
ATOM 8845  C C    . THR A 1 3   ? -16.292 -6.332  4.407   1.00 0.00 ? 3   THR A C    5  
ATOM 8846  O O    . THR A 1 3   ? -16.095 -6.130  3.209   1.00 0.00 ? 3   THR A O    5  
ATOM 8847  C CB   . THR A 1 3   ? -15.680 -8.654  5.210   1.00 0.00 ? 3   THR A CB   5  
ATOM 8848  O OG1  . THR A 1 3   ? -15.716 -9.140  3.857   1.00 0.00 ? 3   THR A OG1  5  
ATOM 8849  C CG2  . THR A 1 3   ? -17.024 -8.909  5.881   1.00 0.00 ? 3   THR A CG2  5  
ATOM 8850  H H    . THR A 1 3   ? -15.973 -6.028  6.896   1.00 0.00 ? 3   THR A H    5  
ATOM 8851  H HA   . THR A 1 3   ? -14.317 -7.039  4.799   1.00 0.00 ? 3   THR A HA   5  
ATOM 8852  H HB   . THR A 1 3   ? -14.920 -9.203  5.753   1.00 0.00 ? 3   THR A HB   5  
ATOM 8853  H HG1  . THR A 1 3   ? -15.583 -8.403  3.245   1.00 0.00 ? 3   THR A HG1  5  
ATOM 8854  H HG21 . THR A 1 3   ? -16.986 -8.571  6.907   1.00 0.00 ? 3   THR A HG21 5  
ATOM 8855  H HG22 . THR A 1 3   ? -17.243 -9.965  5.859   1.00 0.00 ? 3   THR A HG22 5  
ATOM 8856  H HG23 . THR A 1 3   ? -17.799 -8.371  5.354   1.00 0.00 ? 3   THR A HG23 5  
ATOM 8857  N N    . GLU A 1 4   ? -17.346 -5.854  5.077   1.00 0.00 ? 4   GLU A N    5  
ATOM 8858  C CA   . GLU A 1 4   ? -18.338 -4.947  4.498   1.00 0.00 ? 4   GLU A CA   5  
ATOM 8859  C C    . GLU A 1 4   ? -18.926 -5.497  3.193   1.00 0.00 ? 4   GLU A C    5  
ATOM 8860  O O    . GLU A 1 4   ? -19.940 -6.202  3.209   1.00 0.00 ? 4   GLU A O    5  
ATOM 8861  C CB   . GLU A 1 4   ? -17.741 -3.541  4.264   1.00 0.00 ? 4   GLU A CB   5  
ATOM 8862  C CG   . GLU A 1 4   ? -16.789 -3.063  5.359   1.00 0.00 ? 4   GLU A CG   5  
ATOM 8863  C CD   . GLU A 1 4   ? -17.357 -3.191  6.764   1.00 0.00 ? 4   GLU A CD   5  
ATOM 8864  O OE1  . GLU A 1 4   ? -18.008 -2.241  7.242   1.00 0.00 ? 4   GLU A OE1  5  
ATOM 8865  O OE2  . GLU A 1 4   ? -17.134 -4.238  7.404   1.00 0.00 ? 4   GLU A OE2  5  
ATOM 8866  H H    . GLU A 1 4   ? -17.468 -6.130  6.010   1.00 0.00 ? 4   GLU A H    5  
ATOM 8867  H HA   . GLU A 1 4   ? -19.142 -4.859  5.216   1.00 0.00 ? 4   GLU A HA   5  
ATOM 8868  H HB2  . GLU A 1 4   ? -17.198 -3.543  3.330   1.00 0.00 ? 4   GLU A HB2  5  
ATOM 8869  H HB3  . GLU A 1 4   ? -18.553 -2.830  4.189   1.00 0.00 ? 4   GLU A HB3  5  
ATOM 8870  H HG2  . GLU A 1 4   ? -15.880 -3.646  5.302   1.00 0.00 ? 4   GLU A HG2  5  
ATOM 8871  H HG3  . GLU A 1 4   ? -16.551 -2.024  5.176   1.00 0.00 ? 4   GLU A HG3  5  
ATOM 8872  N N    . GLU A 1 5   ? -18.253 -5.214  2.078   1.00 0.00 ? 5   GLU A N    5  
ATOM 8873  C CA   . GLU A 1 5   ? -18.781 -5.504  0.748   1.00 0.00 ? 5   GLU A CA   5  
ATOM 8874  C C    . GLU A 1 5   ? -17.742 -6.236  -0.100  1.00 0.00 ? 5   GLU A C    5  
ATOM 8875  O O    . GLU A 1 5   ? -16.536 -6.092  0.115   1.00 0.00 ? 5   GLU A O    5  
ATOM 8876  C CB   . GLU A 1 5   ? -19.190 -4.199  0.042   1.00 0.00 ? 5   GLU A CB   5  
ATOM 8877  C CG   . GLU A 1 5   ? -20.325 -3.438  0.724   1.00 0.00 ? 5   GLU A CG   5  
ATOM 8878  C CD   . GLU A 1 5   ? -21.631 -4.218  0.746   1.00 0.00 ? 5   GLU A CD   5  
ATOM 8879  O OE1  . GLU A 1 5   ? -22.080 -4.668  -0.332  1.00 0.00 ? 5   GLU A OE1  5  
ATOM 8880  O OE2  . GLU A 1 5   ? -22.228 -4.374  1.830   1.00 0.00 ? 5   GLU A OE2  5  
ATOM 8881  H H    . GLU A 1 5   ? -17.354 -4.833  2.152   1.00 0.00 ? 5   GLU A H    5  
ATOM 8882  H HA   . GLU A 1 5   ? -19.654 -6.134  0.858   1.00 0.00 ? 5   GLU A HA   5  
ATOM 8883  H HB2  . GLU A 1 5   ? -18.329 -3.546  -0.005  1.00 0.00 ? 5   GLU A HB2  5  
ATOM 8884  H HB3  . GLU A 1 5   ? -19.502 -4.434  -0.967  1.00 0.00 ? 5   GLU A HB3  5  
ATOM 8885  H HG2  . GLU A 1 5   ? -20.031 -3.223  1.742   1.00 0.00 ? 5   GLU A HG2  5  
ATOM 8886  H HG3  . GLU A 1 5   ? -20.486 -2.508  0.196   1.00 0.00 ? 5   GLU A HG3  5  
ATOM 8887  N N    . GLN A 1 6   ? -18.230 -7.011  -1.067  1.00 0.00 ? 6   GLN A N    5  
ATOM 8888  C CA   . GLN A 1 6   ? -17.371 -7.744  -1.999  1.00 0.00 ? 6   GLN A CA   5  
ATOM 8889  C C    . GLN A 1 6   ? -16.612 -6.799  -2.956  1.00 0.00 ? 6   GLN A C    5  
ATOM 8890  O O    . GLN A 1 6   ? -15.425 -7.014  -3.216  1.00 0.00 ? 6   GLN A O    5  
ATOM 8891  C CB   . GLN A 1 6   ? -18.205 -8.754  -2.806  1.00 0.00 ? 6   GLN A CB   5  
ATOM 8892  C CG   . GLN A 1 6   ? -17.401 -9.544  -3.832  1.00 0.00 ? 6   GLN A CG   5  
ATOM 8893  C CD   . GLN A 1 6   ? -18.270 -10.464 -4.671  1.00 0.00 ? 6   GLN A CD   5  
ATOM 8894  O OE1  . GLN A 1 6   ? -18.766 -10.076 -5.729  1.00 0.00 ? 6   GLN A OE1  5  
ATOM 8895  N NE2  . GLN A 1 6   ? -18.461 -11.689 -4.203  1.00 0.00 ? 6   GLN A NE2  5  
ATOM 8896  H H    . GLN A 1 6   ? -19.203 -7.098  -1.156  1.00 0.00 ? 6   GLN A H    5  
ATOM 8897  H HA   . GLN A 1 6   ? -16.646 -8.289  -1.411  1.00 0.00 ? 6   GLN A HA   5  
ATOM 8898  H HB2  . GLN A 1 6   ? -18.659 -9.455  -2.121  1.00 0.00 ? 6   GLN A HB2  5  
ATOM 8899  H HB3  . GLN A 1 6   ? -18.987 -8.220  -3.327  1.00 0.00 ? 6   GLN A HB3  5  
ATOM 8900  H HG2  . GLN A 1 6   ? -16.898 -8.850  -4.490  1.00 0.00 ? 6   GLN A HG2  5  
ATOM 8901  H HG3  . GLN A 1 6   ? -16.664 -10.141 -3.313  1.00 0.00 ? 6   GLN A HG3  5  
ATOM 8902  H HE21 . GLN A 1 6   ? -18.039 -11.932 -3.350  1.00 0.00 ? 6   GLN A HE21 5  
ATOM 8903  H HE22 . GLN A 1 6   ? -19.016 -12.305 -4.726  1.00 0.00 ? 6   GLN A HE22 5  
ATOM 8904  N N    . PRO A 1 7   ? -17.287 -5.764  -3.531  1.00 0.00 ? 7   PRO A N    5  
ATOM 8905  C CA   . PRO A 1 7   ? -16.636 -4.801  -4.443  1.00 0.00 ? 7   PRO A CA   5  
ATOM 8906  C C    . PRO A 1 7   ? -15.414 -4.091  -3.836  1.00 0.00 ? 7   PRO A C    5  
ATOM 8907  O O    . PRO A 1 7   ? -14.978 -4.393  -2.722  1.00 0.00 ? 7   PRO A O    5  
ATOM 8908  C CB   . PRO A 1 7   ? -17.752 -3.782  -4.744  1.00 0.00 ? 7   PRO A CB   5  
ATOM 8909  C CG   . PRO A 1 7   ? -19.016 -4.537  -4.529  1.00 0.00 ? 7   PRO A CG   5  
ATOM 8910  C CD   . PRO A 1 7   ? -18.733 -5.475  -3.390  1.00 0.00 ? 7   PRO A CD   5  
ATOM 8911  H HA   . PRO A 1 7   ? -16.338 -5.284  -5.364  1.00 0.00 ? 7   PRO A HA   5  
ATOM 8912  H HB2  . PRO A 1 7   ? -17.673 -2.942  -4.066  1.00 0.00 ? 7   PRO A HB2  5  
ATOM 8913  H HB3  . PRO A 1 7   ? -17.665 -3.436  -5.765  1.00 0.00 ? 7   PRO A HB3  5  
ATOM 8914  H HG2  . PRO A 1 7   ? -19.814 -3.855  -4.270  1.00 0.00 ? 7   PRO A HG2  5  
ATOM 8915  H HG3  . PRO A 1 7   ? -19.272 -5.093  -5.420  1.00 0.00 ? 7   PRO A HG3  5  
ATOM 8916  H HD2  . PRO A 1 7   ? -18.939 -4.996  -2.444  1.00 0.00 ? 7   PRO A HD2  5  
ATOM 8917  H HD3  . PRO A 1 7   ? -19.317 -6.378  -3.490  1.00 0.00 ? 7   PRO A HD3  5  
ATOM 8918  N N    . VAL A 1 8   ? -14.905 -3.104  -4.578  1.00 0.00 ? 8   VAL A N    5  
ATOM 8919  C CA   . VAL A 1 8   ? -13.669 -2.387  -4.233  1.00 0.00 ? 8   VAL A CA   5  
ATOM 8920  C C    . VAL A 1 8   ? -13.700 -1.767  -2.830  1.00 0.00 ? 8   VAL A C    5  
ATOM 8921  O O    . VAL A 1 8   ? -12.668 -1.329  -2.324  1.00 0.00 ? 8   VAL A O    5  
ATOM 8922  C CB   . VAL A 1 8   ? -13.367 -1.273  -5.264  1.00 0.00 ? 8   VAL A CB   5  
ATOM 8923  C CG1  . VAL A 1 8   ? -13.166 -1.868  -6.658  1.00 0.00 ? 8   VAL A CG1  5  
ATOM 8924  C CG2  . VAL A 1 8   ? -14.480 -0.226  -5.272  1.00 0.00 ? 8   VAL A CG2  5  
ATOM 8925  H H    . VAL A 1 8   ? -15.377 -2.847  -5.395  1.00 0.00 ? 8   VAL A H    5  
ATOM 8926  H HA   . VAL A 1 8   ? -12.858 -3.102  -4.273  1.00 0.00 ? 8   VAL A HA   5  
ATOM 8927  H HB   . VAL A 1 8   ? -12.445 -0.783  -4.975  1.00 0.00 ? 8   VAL A HB   5  
ATOM 8928  H HG11 . VAL A 1 8   ? -12.944 -1.077  -7.361  1.00 0.00 ? 8   VAL A HG11 5  
ATOM 8929  H HG12 . VAL A 1 8   ? -14.067 -2.379  -6.966  1.00 0.00 ? 8   VAL A HG12 5  
ATOM 8930  H HG13 . VAL A 1 8   ? -12.345 -2.570  -6.636  1.00 0.00 ? 8   VAL A HG13 5  
ATOM 8931  H HG21 . VAL A 1 8   ? -14.242 0.550   -5.985  1.00 0.00 ? 8   VAL A HG21 5  
ATOM 8932  H HG22 . VAL A 1 8   ? -14.574 0.210   -4.287  1.00 0.00 ? 8   VAL A HG22 5  
ATOM 8933  H HG23 . VAL A 1 8   ? -15.415 -0.693  -5.547  1.00 0.00 ? 8   VAL A HG23 5  
ATOM 8934  N N    . ALA A 1 9   ? -14.878 -1.729  -2.206  1.00 0.00 ? 9   ALA A N    5  
ATOM 8935  C CA   . ALA A 1 9   ? -15.031 -1.176  -0.855  1.00 0.00 ? 9   ALA A CA   5  
ATOM 8936  C C    . ALA A 1 9   ? -14.037 -1.809  0.127   1.00 0.00 ? 9   ALA A C    5  
ATOM 8937  O O    . ALA A 1 9   ? -13.741 -1.237  1.179   1.00 0.00 ? 9   ALA A O    5  
ATOM 8938  C CB   . ALA A 1 9   ? -16.462 -1.374  -0.364  1.00 0.00 ? 9   ALA A CB   5  
ATOM 8939  H H    . ALA A 1 9   ? -15.666 -2.082  -2.662  1.00 0.00 ? 9   ALA A H    5  
ATOM 8940  H HA   . ALA A 1 9   ? -14.839 -0.112  -0.908  1.00 0.00 ? 9   ALA A HA   5  
ATOM 8941  H HB1  . ALA A 1 9   ? -17.150 -0.919  -1.062  1.00 0.00 ? 9   ALA A HB1  5  
ATOM 8942  H HB2  . ALA A 1 9   ? -16.579 -0.914  0.607   1.00 0.00 ? 9   ALA A HB2  5  
ATOM 8943  H HB3  . ALA A 1 9   ? -16.675 -2.432  -0.288  1.00 0.00 ? 9   ALA A HB3  5  
ATOM 8944  N N    . SER A 1 10  ? -13.513 -2.984  -0.237  1.00 0.00 ? 10  SER A N    5  
ATOM 8945  C CA   . SER A 1 10  ? -12.532 -3.694  0.583   1.00 0.00 ? 10  SER A CA   5  
ATOM 8946  C C    . SER A 1 10  ? -11.282 -2.839  0.856   1.00 0.00 ? 10  SER A C    5  
ATOM 8947  O O    . SER A 1 10  ? -10.514 -3.131  1.777   1.00 0.00 ? 10  SER A O    5  
ATOM 8948  C CB   . SER A 1 10  ? -12.135 -5.011  -0.097  1.00 0.00 ? 10  SER A CB   5  
ATOM 8949  O OG   . SER A 1 10  ? -13.253 -5.878  -0.237  1.00 0.00 ? 10  SER A OG   5  
ATOM 8950  H H    . SER A 1 10  ? -13.801 -3.386  -1.084  1.00 0.00 ? 10  SER A H    5  
ATOM 8951  H HA   . SER A 1 10  ? -13.002 -3.923  1.530   1.00 0.00 ? 10  SER A HA   5  
ATOM 8952  H HB2  . SER A 1 10  ? -11.735 -4.802  -1.079  1.00 0.00 ? 10  SER A HB2  5  
ATOM 8953  H HB3  . SER A 1 10  ? -11.382 -5.509  0.498   1.00 0.00 ? 10  SER A HB3  5  
ATOM 8954  H HG   . SER A 1 10  ? -14.069 -5.363  -0.238  1.00 0.00 ? 10  SER A HG   5  
ATOM 8955  N N    . TRP A 1 11  ? -11.080 -1.785  0.058   1.00 0.00 ? 11  TRP A N    5  
ATOM 8956  C CA   . TRP A 1 11  ? -9.955  -0.866  0.263   1.00 0.00 ? 11  TRP A CA   5  
ATOM 8957  C C    . TRP A 1 11  ? -9.961  -0.312  1.686   1.00 0.00 ? 11  TRP A C    5  
ATOM 8958  O O    . TRP A 1 11  ? -8.917  -0.202  2.326   1.00 0.00 ? 11  TRP A O    5  
ATOM 8959  C CB   . TRP A 1 11  ? -10.015 0.317   -0.713  1.00 0.00 ? 11  TRP A CB   5  
ATOM 8960  C CG   . TRP A 1 11  ? -9.906  -0.038  -2.166  1.00 0.00 ? 11  TRP A CG   5  
ATOM 8961  C CD1  . TRP A 1 11  ? -9.412  -1.186  -2.721  1.00 0.00 ? 11  TRP A CD1  5  
ATOM 8962  C CD2  . TRP A 1 11  ? -10.284 0.804   -3.256  1.00 0.00 ? 11  TRP A CD2  5  
ATOM 8963  N NE1  . TRP A 1 11  ? -9.474  -1.108  -4.093  1.00 0.00 ? 11  TRP A NE1  5  
ATOM 8964  C CE2  . TRP A 1 11  ? -10.006 0.108   -4.444  1.00 0.00 ? 11  TRP A CE2  5  
ATOM 8965  C CE3  . TRP A 1 11  ? -10.838 2.080   -3.331  1.00 0.00 ? 11  TRP A CE3  5  
ATOM 8966  C CZ2  . TRP A 1 11  ? -10.266 0.654   -5.701  1.00 0.00 ? 11  TRP A CZ2  5  
ATOM 8967  C CZ3  . TRP A 1 11  ? -11.094 2.625   -4.571  1.00 0.00 ? 11  TRP A CZ3  5  
ATOM 8968  C CH2  . TRP A 1 11  ? -10.809 1.913   -5.745  1.00 0.00 ? 11  TRP A CH2  5  
ATOM 8969  H H    . TRP A 1 11  ? -11.697 -1.625  -0.687  1.00 0.00 ? 11  TRP A H    5  
ATOM 8970  H HA   . TRP A 1 11  ? -9.038  -1.416  0.100   1.00 0.00 ? 11  TRP A HA   5  
ATOM 8971  H HB2  . TRP A 1 11  ? -10.953 0.833   -0.576  1.00 0.00 ? 11  TRP A HB2  5  
ATOM 8972  H HB3  . TRP A 1 11  ? -9.206  0.998   -0.481  1.00 0.00 ? 11  TRP A HB3  5  
ATOM 8973  H HD1  . TRP A 1 11  ? -9.037  -2.025  -2.153  1.00 0.00 ? 11  TRP A HD1  5  
ATOM 8974  H HE1  . TRP A 1 11  ? -9.183  -1.806  -4.719  1.00 0.00 ? 11  TRP A HE1  5  
ATOM 8975  H HE3  . TRP A 1 11  ? -11.064 2.643   -2.437  1.00 0.00 ? 11  TRP A HE3  5  
ATOM 8976  H HZ2  . TRP A 1 11  ? -10.050 0.117   -6.615  1.00 0.00 ? 11  TRP A HZ2  5  
ATOM 8977  H HZ3  . TRP A 1 11  ? -11.522 3.616   -4.638  1.00 0.00 ? 11  TRP A HZ3  5  
ATOM 8978  H HH2  . TRP A 1 11  ? -11.025 2.377   -6.697  1.00 0.00 ? 11  TRP A HH2  5  
ATOM 8979  N N    . ALA A 1 12  ? -11.157 0.010   2.177   1.00 0.00 ? 12  ALA A N    5  
ATOM 8980  C CA   . ALA A 1 12  ? -11.322 0.673   3.471   1.00 0.00 ? 12  ALA A CA   5  
ATOM 8981  C C    . ALA A 1 12  ? -11.067 -0.286  4.637   1.00 0.00 ? 12  ALA A C    5  
ATOM 8982  O O    . ALA A 1 12  ? -11.192 0.096   5.806   1.00 0.00 ? 12  ALA A O    5  
ATOM 8983  C CB   . ALA A 1 12  ? -12.719 1.277   3.570   1.00 0.00 ? 12  ALA A CB   5  
ATOM 8984  H H    . ALA A 1 12  ? -11.958 -0.217  1.656   1.00 0.00 ? 12  ALA A H    5  
ATOM 8985  H HA   . ALA A 1 12  ? -10.605 1.482   3.523   1.00 0.00 ? 12  ALA A HA   5  
ATOM 8986  H HB1  . ALA A 1 12  ? -12.807 1.839   4.489   1.00 0.00 ? 12  ALA A HB1  5  
ATOM 8987  H HB2  . ALA A 1 12  ? -13.457 0.488   3.560   1.00 0.00 ? 12  ALA A HB2  5  
ATOM 8988  H HB3  . ALA A 1 12  ? -12.889 1.935   2.729   1.00 0.00 ? 12  ALA A HB3  5  
ATOM 8989  N N    . LEU A 1 13  ? -10.709 -1.523  4.314   1.00 0.00 ? 13  LEU A N    5  
ATOM 8990  C CA   . LEU A 1 13  ? -10.422 -2.540  5.322   1.00 0.00 ? 13  LEU A CA   5  
ATOM 8991  C C    . LEU A 1 13  ? -8.927  -2.612  5.613   1.00 0.00 ? 13  LEU A C    5  
ATOM 8992  O O    . LEU A 1 13  ? -8.513  -2.795  6.762   1.00 0.00 ? 13  LEU A O    5  
ATOM 8993  C CB   . LEU A 1 13  ? -10.916 -3.909  4.843   1.00 0.00 ? 13  LEU A CB   5  
ATOM 8994  C CG   . LEU A 1 13  ? -12.412 -3.984  4.517   1.00 0.00 ? 13  LEU A CG   5  
ATOM 8995  C CD1  . LEU A 1 13  ? -12.754 -5.337  3.904   1.00 0.00 ? 13  LEU A CD1  5  
ATOM 8996  C CD2  . LEU A 1 13  ? -13.250 -3.720  5.767   1.00 0.00 ? 13  LEU A CD2  5  
ATOM 8997  H H    . LEU A 1 13  ? -10.636 -1.762  3.367   1.00 0.00 ? 13  LEU A H    5  
ATOM 8998  H HA   . LEU A 1 13  ? -10.946 -2.275  6.230   1.00 0.00 ? 13  LEU A HA   5  
ATOM 8999  H HB2  . LEU A 1 13  ? -10.360 -4.180  3.954   1.00 0.00 ? 13  LEU A HB2  5  
ATOM 9000  H HB3  . LEU A 1 13  ? -10.702 -4.637  5.614   1.00 0.00 ? 13  LEU A HB3  5  
ATOM 9001  H HG   . LEU A 1 13  ? -12.651 -3.222  3.788   1.00 0.00 ? 13  LEU A HG   5  
ATOM 9002  H HD11 . LEU A 1 13  ? -13.806 -5.367  3.663   1.00 0.00 ? 13  LEU A HD11 5  
ATOM 9003  H HD12 . LEU A 1 13  ? -12.522 -6.123  4.609   1.00 0.00 ? 13  LEU A HD12 5  
ATOM 9004  H HD13 . LEU A 1 13  ? -12.174 -5.479  3.004   1.00 0.00 ? 13  LEU A HD13 5  
ATOM 9005  H HD21 . LEU A 1 13  ? -14.299 -3.796  5.521   1.00 0.00 ? 13  LEU A HD21 5  
ATOM 9006  H HD22 . LEU A 1 13  ? -13.042 -2.726  6.139   1.00 0.00 ? 13  LEU A HD22 5  
ATOM 9007  H HD23 . LEU A 1 13  ? -13.006 -4.447  6.529   1.00 0.00 ? 13  LEU A HD23 5  
ATOM 9008  N N    . SER A 1 14  ? -8.117  -2.474  4.570   1.00 0.00 ? 14  SER A N    5  
ATOM 9009  C CA   . SER A 1 14  ? -6.674  -2.625  4.698   1.00 0.00 ? 14  SER A CA   5  
ATOM 9010  C C    . SER A 1 14  ? -5.945  -1.781  3.657   1.00 0.00 ? 14  SER A C    5  
ATOM 9011  O O    . SER A 1 14  ? -6.221  -1.871  2.457   1.00 0.00 ? 14  SER A O    5  
ATOM 9012  C CB   . SER A 1 14  ? -6.287  -4.099  4.560   1.00 0.00 ? 14  SER A CB   5  
ATOM 9013  O OG   . SER A 1 14  ? -7.015  -4.907  5.477   1.00 0.00 ? 14  SER A OG   5  
ATOM 9014  H H    . SER A 1 14  ? -8.496  -2.243  3.695   1.00 0.00 ? 14  SER A H    5  
ATOM 9015  H HA   . SER A 1 14  ? -6.391  -2.282  5.683   1.00 0.00 ? 14  SER A HA   5  
ATOM 9016  H HB2  . SER A 1 14  ? -6.499  -4.430  3.557   1.00 0.00 ? 14  SER A HB2  5  
ATOM 9017  H HB3  . SER A 1 14  ? -5.232  -4.213  4.760   1.00 0.00 ? 14  SER A HB3  5  
ATOM 9018  H HG   . SER A 1 14  ? -7.156  -4.409  6.293   1.00 0.00 ? 14  SER A HG   5  
ATOM 9019  N N    . PHE A 1 15  ? -5.000  -0.983  4.136   1.00 0.00 ? 15  PHE A N    5  
ATOM 9020  C CA   . PHE A 1 15  ? -4.265  -0.048  3.296   1.00 0.00 ? 15  PHE A CA   5  
ATOM 9021  C C    . PHE A 1 15  ? -3.428  -0.785  2.254   1.00 0.00 ? 15  PHE A C    5  
ATOM 9022  O O    . PHE A 1 15  ? -3.383  -0.381  1.100   1.00 0.00 ? 15  PHE A O    5  
ATOM 9023  C CB   . PHE A 1 15  ? -3.378  0.856   4.166   1.00 0.00 ? 15  PHE A CB   5  
ATOM 9024  C CG   . PHE A 1 15  ? -2.595  1.885   3.387   1.00 0.00 ? 15  PHE A CG   5  
ATOM 9025  C CD1  . PHE A 1 15  ? -3.161  2.536   2.298   1.00 0.00 ? 15  PHE A CD1  5  
ATOM 9026  C CD2  . PHE A 1 15  ? -1.296  2.204   3.747   1.00 0.00 ? 15  PHE A CD2  5  
ATOM 9027  C CE1  . PHE A 1 15  ? -2.447  3.478   1.589   1.00 0.00 ? 15  PHE A CE1  5  
ATOM 9028  C CE2  . PHE A 1 15  ? -0.578  3.146   3.041   1.00 0.00 ? 15  PHE A CE2  5  
ATOM 9029  C CZ   . PHE A 1 15  ? -1.155  3.783   1.959   1.00 0.00 ? 15  PHE A CZ   5  
ATOM 9030  H H    . PHE A 1 15  ? -4.790  -1.029  5.090   1.00 0.00 ? 15  PHE A H    5  
ATOM 9031  H HA   . PHE A 1 15  ? -4.991  0.569   2.783   1.00 0.00 ? 15  PHE A HA   5  
ATOM 9032  H HB2  . PHE A 1 15  ? -4.001  1.384   4.874   1.00 0.00 ? 15  PHE A HB2  5  
ATOM 9033  H HB3  . PHE A 1 15  ? -2.675  0.239   4.708   1.00 0.00 ? 15  PHE A HB3  5  
ATOM 9034  H HD1  . PHE A 1 15  ? -4.173  2.298   2.005   1.00 0.00 ? 15  PHE A HD1  5  
ATOM 9035  H HD2  . PHE A 1 15  ? -0.842  1.707   4.594   1.00 0.00 ? 15  PHE A HD2  5  
ATOM 9036  H HE1  . PHE A 1 15  ? -2.900  3.976   0.743   1.00 0.00 ? 15  PHE A HE1  5  
ATOM 9037  H HE2  . PHE A 1 15  ? 0.435   3.383   3.332   1.00 0.00 ? 15  PHE A HE2  5  
ATOM 9038  H HZ   . PHE A 1 15  ? -0.594  4.522   1.404   1.00 0.00 ? 15  PHE A HZ   5  
ATOM 9039  N N    . GLU A 1 16  ? -2.770  -1.864  2.672   1.00 0.00 ? 16  GLU A N    5  
ATOM 9040  C CA   . GLU A 1 16  ? -1.969  -2.688  1.769   1.00 0.00 ? 16  GLU A CA   5  
ATOM 9041  C C    . GLU A 1 16  ? -2.796  -3.141  0.565   1.00 0.00 ? 16  GLU A C    5  
ATOM 9042  O O    . GLU A 1 16  ? -2.347  -3.036  -0.574  1.00 0.00 ? 16  GLU A O    5  
ATOM 9043  C CB   . GLU A 1 16  ? -1.386  -3.892  2.536   1.00 0.00 ? 16  GLU A CB   5  
ATOM 9044  C CG   . GLU A 1 16  ? -0.697  -4.951  1.670   1.00 0.00 ? 16  GLU A CG   5  
ATOM 9045  C CD   . GLU A 1 16  ? -1.649  -6.043  1.196   1.00 0.00 ? 16  GLU A CD   5  
ATOM 9046  O OE1  . GLU A 1 16  ? -2.192  -6.772  2.057   1.00 0.00 ? 16  GLU A OE1  5  
ATOM 9047  O OE2  . GLU A 1 16  ? -1.863  -6.175  -0.027  1.00 0.00 ? 16  GLU A OE2  5  
ATOM 9048  H H    . GLU A 1 16  ? -2.812  -2.105  3.615   1.00 0.00 ? 16  GLU A H    5  
ATOM 9049  H HA   . GLU A 1 16  ? -1.151  -2.076  1.414   1.00 0.00 ? 16  GLU A HA   5  
ATOM 9050  H HB2  . GLU A 1 16  ? -0.663  -3.523  3.249   1.00 0.00 ? 16  GLU A HB2  5  
ATOM 9051  H HB3  . GLU A 1 16  ? -2.189  -4.372  3.080   1.00 0.00 ? 16  GLU A HB3  5  
ATOM 9052  H HG2  . GLU A 1 16  ? -0.264  -4.466  0.806   1.00 0.00 ? 16  GLU A HG2  5  
ATOM 9053  H HG3  . GLU A 1 16  ? 0.092   -5.412  2.250   1.00 0.00 ? 16  GLU A HG3  5  
ATOM 9054  N N    . ARG A 1 17  ? -4.014  -3.615  0.820   1.00 0.00 ? 17  ARG A N    5  
ATOM 9055  C CA   . ARG A 1 17  ? -4.884  -4.094  -0.254  1.00 0.00 ? 17  ARG A CA   5  
ATOM 9056  C C    . ARG A 1 17  ? -5.235  -2.960  -1.218  1.00 0.00 ? 17  ARG A C    5  
ATOM 9057  O O    . ARG A 1 17  ? -5.334  -3.172  -2.430  1.00 0.00 ? 17  ARG A O    5  
ATOM 9058  C CB   . ARG A 1 17  ? -6.158  -4.729  0.315   1.00 0.00 ? 17  ARG A CB   5  
ATOM 9059  C CG   . ARG A 1 17  ? -5.895  -5.955  1.189   1.00 0.00 ? 17  ARG A CG   5  
ATOM 9060  C CD   . ARG A 1 17  ? -7.169  -6.755  1.428   1.00 0.00 ? 17  ARG A CD   5  
ATOM 9061  N NE   . ARG A 1 17  ? -7.737  -7.239  0.169   1.00 0.00 ? 17  ARG A NE   5  
ATOM 9062  C CZ   . ARG A 1 17  ? -8.950  -7.777  0.039   1.00 0.00 ? 17  ARG A CZ   5  
ATOM 9063  N NH1  . ARG A 1 17  ? -9.734  -7.942  1.096   1.00 0.00 ? 17  ARG A NH1  5  
ATOM 9064  N NH2  . ARG A 1 17  ? -9.368  -8.158  -1.159  1.00 0.00 ? 17  ARG A NH2  5  
ATOM 9065  H H    . ARG A 1 17  ? -4.332  -3.641  1.744   1.00 0.00 ? 17  ARG A H    5  
ATOM 9066  H HA   . ARG A 1 17  ? -4.335  -4.850  -0.801  1.00 0.00 ? 17  ARG A HA   5  
ATOM 9067  H HB2  . ARG A 1 17  ? -6.680  -3.992  0.911   1.00 0.00 ? 17  ARG A HB2  5  
ATOM 9068  H HB3  . ARG A 1 17  ? -6.793  -5.029  -0.507  1.00 0.00 ? 17  ARG A HB3  5  
ATOM 9069  H HG2  . ARG A 1 17  ? -5.171  -6.589  0.697   1.00 0.00 ? 17  ARG A HG2  5  
ATOM 9070  H HG3  . ARG A 1 17  ? -5.500  -5.628  2.142   1.00 0.00 ? 17  ARG A HG3  5  
ATOM 9071  H HD2  . ARG A 1 17  ? -6.938  -7.601  2.060   1.00 0.00 ? 17  ARG A HD2  5  
ATOM 9072  H HD3  . ARG A 1 17  ? -7.893  -6.123  1.924   1.00 0.00 ? 17  ARG A HD3  5  
ATOM 9073  H HE   . ARG A 1 17  ? -7.177  -7.151  -0.636  1.00 0.00 ? 17  ARG A HE   5  
ATOM 9074  H HH11 . ARG A 1 17  ? -9.419  -7.671  2.010   1.00 0.00 ? 17  ARG A HH11 5  
ATOM 9075  H HH12 . ARG A 1 17  ? -10.651 -8.336  0.985   1.00 0.00 ? 17  ARG A HH12 5  
ATOM 9076  H HH21 . ARG A 1 17  ? -8.774  -8.039  -1.961  1.00 0.00 ? 17  ARG A HH21 5  
ATOM 9077  H HH22 . ARG A 1 17  ? -10.277 -8.572  -1.268  1.00 0.00 ? 17  ARG A HH22 5  
ATOM 9078  N N    . LEU A 1 18  ? -5.425  -1.764  -0.669  1.00 0.00 ? 18  LEU A N    5  
ATOM 9079  C CA   . LEU A 1 18  ? -5.651  -0.559  -1.473  1.00 0.00 ? 18  LEU A CA   5  
ATOM 9080  C C    . LEU A 1 18  ? -4.393  -0.211  -2.265  1.00 0.00 ? 18  LEU A C    5  
ATOM 9081  O O    . LEU A 1 18  ? -4.445  0.092   -3.458  1.00 0.00 ? 18  LEU A O    5  
ATOM 9082  C CB   . LEU A 1 18  ? -6.017  0.621   -0.554  1.00 0.00 ? 18  LEU A CB   5  
ATOM 9083  C CG   . LEU A 1 18  ? -5.986  2.014   -1.215  1.00 0.00 ? 18  LEU A CG   5  
ATOM 9084  C CD1  . LEU A 1 18  ? -7.114  2.168   -2.229  1.00 0.00 ? 18  LEU A CD1  5  
ATOM 9085  C CD2  . LEU A 1 18  ? -6.044  3.119   -0.164  1.00 0.00 ? 18  LEU A CD2  5  
ATOM 9086  H H    . LEU A 1 18  ? -5.413  -1.684  0.309   1.00 0.00 ? 18  LEU A H    5  
ATOM 9087  H HA   . LEU A 1 18  ? -6.467  -0.751  -2.156  1.00 0.00 ? 18  LEU A HA   5  
ATOM 9088  H HB2  . LEU A 1 18  ? -7.012  0.451   -0.167  1.00 0.00 ? 18  LEU A HB2  5  
ATOM 9089  H HB3  . LEU A 1 18  ? -5.325  0.626   0.276   1.00 0.00 ? 18  LEU A HB3  5  
ATOM 9090  H HG   . LEU A 1 18  ? -5.052  2.123   -1.751  1.00 0.00 ? 18  LEU A HG   5  
ATOM 9091  H HD11 . LEU A 1 18  ? -7.060  3.146   -2.684  1.00 0.00 ? 18  LEU A HD11 5  
ATOM 9092  H HD12 . LEU A 1 18  ? -8.066  2.057   -1.730  1.00 0.00 ? 18  LEU A HD12 5  
ATOM 9093  H HD13 . LEU A 1 18  ? -7.019  1.410   -2.994  1.00 0.00 ? 18  LEU A HD13 5  
ATOM 9094  H HD21 . LEU A 1 18  ? -5.197  3.028   0.502   1.00 0.00 ? 18  LEU A HD21 5  
ATOM 9095  H HD22 . LEU A 1 18  ? -6.960  3.033   0.404   1.00 0.00 ? 18  LEU A HD22 5  
ATOM 9096  H HD23 . LEU A 1 18  ? -6.012  4.082   -0.652  1.00 0.00 ? 18  LEU A HD23 5  
ATOM 9097  N N    . LEU A 1 19  ? -3.266  -0.290  -1.578  1.00 0.00 ? 19  LEU A N    5  
ATOM 9098  C CA   . LEU A 1 19  ? -1.988  0.183   -2.089  1.00 0.00 ? 19  LEU A CA   5  
ATOM 9099  C C    . LEU A 1 19  ? -1.389  -0.810  -3.084  1.00 0.00 ? 19  LEU A C    5  
ATOM 9100  O O    . LEU A 1 19  ? -0.511  -0.462  -3.873  1.00 0.00 ? 19  LEU A O    5  
ATOM 9101  C CB   . LEU A 1 19  ? -1.040  0.416   -0.902  1.00 0.00 ? 19  LEU A CB   5  
ATOM 9102  C CG   . LEU A 1 19  ? 0.236   1.203   -1.208  1.00 0.00 ? 19  LEU A CG   5  
ATOM 9103  C CD1  . LEU A 1 19  ? -0.096  2.539   -1.872  1.00 0.00 ? 19  LEU A CD1  5  
ATOM 9104  C CD2  . LEU A 1 19  ? 1.044   1.430   0.067   1.00 0.00 ? 19  LEU A CD2  5  
ATOM 9105  H H    . LEU A 1 19  ? -3.293  -0.684  -0.685  1.00 0.00 ? 19  LEU A H    5  
ATOM 9106  H HA   . LEU A 1 19  ? -2.158  1.124   -2.593  1.00 0.00 ? 19  LEU A HA   5  
ATOM 9107  H HB2  . LEU A 1 19  ? -1.586  0.947   -0.138  1.00 0.00 ? 19  LEU A HB2  5  
ATOM 9108  H HB3  . LEU A 1 19  ? -0.755  -0.548  -0.505  1.00 0.00 ? 19  LEU A HB3  5  
ATOM 9109  H HG   . LEU A 1 19  ? 0.843   0.629   -1.888  1.00 0.00 ? 19  LEU A HG   5  
ATOM 9110  H HD11 . LEU A 1 19  ? -0.757  3.110   -1.231  1.00 0.00 ? 19  LEU A HD11 5  
ATOM 9111  H HD12 . LEU A 1 19  ? -0.584  2.359   -2.818  1.00 0.00 ? 19  LEU A HD12 5  
ATOM 9112  H HD13 . LEU A 1 19  ? 0.814   3.097   -2.038  1.00 0.00 ? 19  LEU A HD13 5  
ATOM 9113  H HD21 . LEU A 1 19  ? 0.449   1.984   0.780   1.00 0.00 ? 19  LEU A HD21 5  
ATOM 9114  H HD22 . LEU A 1 19  ? 1.939   1.988   -0.167  1.00 0.00 ? 19  LEU A HD22 5  
ATOM 9115  H HD23 . LEU A 1 19  ? 1.319   0.476   0.493   1.00 0.00 ? 19  LEU A HD23 5  
ATOM 9116  N N    . GLN A 1 20  ? -1.866  -2.048  -3.035  1.00 0.00 ? 20  GLN A N    5  
ATOM 9117  C CA   . GLN A 1 20  ? -1.421  -3.087  -3.960  1.00 0.00 ? 20  GLN A CA   5  
ATOM 9118  C C    . GLN A 1 20  ? -2.420  -3.229  -5.113  1.00 0.00 ? 20  GLN A C    5  
ATOM 9119  O O    . GLN A 1 20  ? -2.177  -3.953  -6.080  1.00 0.00 ? 20  GLN A O    5  
ATOM 9120  C CB   . GLN A 1 20  ? -1.263  -4.426  -3.217  1.00 0.00 ? 20  GLN A CB   5  
ATOM 9121  C CG   . GLN A 1 20  ? -0.578  -5.520  -4.034  1.00 0.00 ? 20  GLN A CG   5  
ATOM 9122  C CD   . GLN A 1 20  ? 0.856   -5.174  -4.421  1.00 0.00 ? 20  GLN A CD   5  
ATOM 9123  O OE1  . GLN A 1 20  ? 1.345   -5.584  -5.477  1.00 0.00 ? 20  GLN A OE1  5  
ATOM 9124  N NE2  . GLN A 1 20  ? 1.549   -4.436  -3.560  1.00 0.00 ? 20  GLN A NE2  5  
ATOM 9125  H H    . GLN A 1 20  ? -2.531  -2.273  -2.349  1.00 0.00 ? 20  GLN A H    5  
ATOM 9126  H HA   . GLN A 1 20  ? -0.462  -2.791  -4.364  1.00 0.00 ? 20  GLN A HA   5  
ATOM 9127  H HB2  . GLN A 1 20  ? -0.679  -4.257  -2.323  1.00 0.00 ? 20  GLN A HB2  5  
ATOM 9128  H HB3  . GLN A 1 20  ? -2.244  -4.780  -2.929  1.00 0.00 ? 20  GLN A HB3  5  
ATOM 9129  H HG2  . GLN A 1 20  ? -0.564  -6.431  -3.451  1.00 0.00 ? 20  GLN A HG2  5  
ATOM 9130  H HG3  . GLN A 1 20  ? -1.149  -5.684  -4.936  1.00 0.00 ? 20  GLN A HG3  5  
ATOM 9131  H HE21 . GLN A 1 20  ? 1.108   -4.156  -2.732  1.00 0.00 ? 20  GLN A HE21 5  
ATOM 9132  H HE22 . GLN A 1 20  ? 2.471   -4.201  -3.789  1.00 0.00 ? 20  GLN A HE22 5  
ATOM 9133  N N    . ASP A 1 21  ? -3.541  -2.522  -5.004  1.00 0.00 ? 21  ASP A N    5  
ATOM 9134  C CA   . ASP A 1 21  ? -4.598  -2.585  -6.013  1.00 0.00 ? 21  ASP A CA   5  
ATOM 9135  C C    . ASP A 1 21  ? -4.283  -1.622  -7.159  1.00 0.00 ? 21  ASP A C    5  
ATOM 9136  O O    . ASP A 1 21  ? -3.963  -0.462  -6.913  1.00 0.00 ? 21  ASP A O    5  
ATOM 9137  C CB   . ASP A 1 21  ? -5.954  -2.226  -5.384  1.00 0.00 ? 21  ASP A CB   5  
ATOM 9138  C CG   . ASP A 1 21  ? -7.135  -2.566  -6.285  1.00 0.00 ? 21  ASP A CG   5  
ATOM 9139  O OD1  . ASP A 1 21  ? -7.361  -1.856  -7.286  1.00 0.00 ? 21  ASP A OD1  5  
ATOM 9140  O OD2  . ASP A 1 21  ? -7.848  -3.552  -5.987  1.00 0.00 ? 21  ASP A OD2  5  
ATOM 9141  H H    . ASP A 1 21  ? -3.656  -1.927  -4.234  1.00 0.00 ? 21  ASP A H    5  
ATOM 9142  H HA   . ASP A 1 21  ? -4.639  -3.596  -6.396  1.00 0.00 ? 21  ASP A HA   5  
ATOM 9143  H HB2  . ASP A 1 21  ? -6.064  -2.770  -4.456  1.00 0.00 ? 21  ASP A HB2  5  
ATOM 9144  H HB3  . ASP A 1 21  ? -5.978  -1.165  -5.173  1.00 0.00 ? 21  ASP A HB3  5  
ATOM 9145  N N    . PRO A 1 22  ? -4.354  -2.087  -8.421  1.00 0.00 ? 22  PRO A N    5  
ATOM 9146  C CA   . PRO A 1 22  ? -4.086  -1.237  -9.592  1.00 0.00 ? 22  PRO A CA   5  
ATOM 9147  C C    . PRO A 1 22  ? -4.950  0.026   -9.604  1.00 0.00 ? 22  PRO A C    5  
ATOM 9148  O O    . PRO A 1 22  ? -4.439  1.141   -9.743  1.00 0.00 ? 22  PRO A O    5  
ATOM 9149  C CB   . PRO A 1 22  ? -4.427  -2.147  -10.782 1.00 0.00 ? 22  PRO A CB   5  
ATOM 9150  C CG   . PRO A 1 22  ? -4.258  -3.533  -10.254 1.00 0.00 ? 22  PRO A CG   5  
ATOM 9151  C CD   . PRO A 1 22  ? -4.677  -3.474  -8.811  1.00 0.00 ? 22  PRO A CD   5  
ATOM 9152  H HA   . PRO A 1 22  ? -3.044  -0.954  -9.636  1.00 0.00 ? 22  PRO A HA   5  
ATOM 9153  H HB2  . PRO A 1 22  ? -5.445  -1.967  -11.102 1.00 0.00 ? 22  PRO A HB2  5  
ATOM 9154  H HB3  . PRO A 1 22  ? -3.748  -1.951  -11.600 1.00 0.00 ? 22  PRO A HB3  5  
ATOM 9155  H HG2  . PRO A 1 22  ? -4.891  -4.217  -10.802 1.00 0.00 ? 22  PRO A HG2  5  
ATOM 9156  H HG3  . PRO A 1 22  ? -3.223  -3.836  -10.333 1.00 0.00 ? 22  PRO A HG3  5  
ATOM 9157  H HD2  . PRO A 1 22  ? -5.738  -3.663  -8.716  1.00 0.00 ? 22  PRO A HD2  5  
ATOM 9158  H HD3  . PRO A 1 22  ? -4.112  -4.181  -8.222  1.00 0.00 ? 22  PRO A HD3  5  
ATOM 9159  N N    . LEU A 1 23  ? -6.258  -0.156  -9.439  1.00 0.00 ? 23  LEU A N    5  
ATOM 9160  C CA   . LEU A 1 23  ? -7.196  0.963   -9.420  1.00 0.00 ? 23  LEU A CA   5  
ATOM 9161  C C    . LEU A 1 23  ? -7.034  1.748   -8.127  1.00 0.00 ? 23  LEU A C    5  
ATOM 9162  O O    . LEU A 1 23  ? -7.039  2.982   -8.127  1.00 0.00 ? 23  LEU A O    5  
ATOM 9163  C CB   . LEU A 1 23  ? -8.641  0.460   -9.556  1.00 0.00 ? 23  LEU A CB   5  
ATOM 9164  C CG   . LEU A 1 23  ? -8.984  -0.204  -10.900 1.00 0.00 ? 23  LEU A CG   5  
ATOM 9165  C CD1  . LEU A 1 23  ? -10.411 -0.749  -10.887 1.00 0.00 ? 23  LEU A CD1  5  
ATOM 9166  C CD2  . LEU A 1 23  ? -8.796  0.787   -12.050 1.00 0.00 ? 23  LEU A CD2  5  
ATOM 9167  H H    . LEU A 1 23  ? -6.599  -1.064  -9.301  1.00 0.00 ? 23  LEU A H    5  
ATOM 9168  H HA   . LEU A 1 23  ? -6.965  1.611   -10.255 1.00 0.00 ? 23  LEU A HA   5  
ATOM 9169  H HB2  . LEU A 1 23  ? -8.823  -0.257  -8.765  1.00 0.00 ? 23  LEU A HB2  5  
ATOM 9170  H HB3  . LEU A 1 23  ? -9.308  1.298   -9.414  1.00 0.00 ? 23  LEU A HB3  5  
ATOM 9171  H HG   . LEU A 1 23  ? -8.314  -1.037  -11.064 1.00 0.00 ? 23  LEU A HG   5  
ATOM 9172  H HD11 . LEU A 1 23  ? -10.630 -1.213  -11.839 1.00 0.00 ? 23  LEU A HD11 5  
ATOM 9173  H HD12 . LEU A 1 23  ? -11.107 0.059   -10.713 1.00 0.00 ? 23  LEU A HD12 5  
ATOM 9174  H HD13 . LEU A 1 23  ? -10.510 -1.483  -10.101 1.00 0.00 ? 23  LEU A HD13 5  
ATOM 9175  H HD21 . LEU A 1 23  ? -7.762  1.097   -12.092 1.00 0.00 ? 23  LEU A HD21 5  
ATOM 9176  H HD22 . LEU A 1 23  ? -9.423  1.653   -11.887 1.00 0.00 ? 23  LEU A HD22 5  
ATOM 9177  H HD23 . LEU A 1 23  ? -9.067  0.314   -12.982 1.00 0.00 ? 23  LEU A HD23 5  
ATOM 9178  N N    . GLY A 1 24  ? -6.870  1.010   -7.035  1.00 0.00 ? 24  GLY A N    5  
ATOM 9179  C CA   . GLY A 1 24  ? -6.704  1.611   -5.728  1.00 0.00 ? 24  GLY A CA   5  
ATOM 9180  C C    . GLY A 1 24  ? -5.562  2.601   -5.693  1.00 0.00 ? 24  GLY A C    5  
ATOM 9181  O O    . GLY A 1 24  ? -5.774  3.788   -5.448  1.00 0.00 ? 24  GLY A O    5  
ATOM 9182  H H    . GLY A 1 24  ? -6.862  0.032   -7.121  1.00 0.00 ? 24  GLY A H    5  
ATOM 9183  H HA2  . GLY A 1 24  ? -7.620  2.115   -5.452  1.00 0.00 ? 24  GLY A HA2  5  
ATOM 9184  H HA3  . GLY A 1 24  ? -6.506  0.828   -5.011  1.00 0.00 ? 24  GLY A HA3  5  
ATOM 9185  N N    . LEU A 1 25  ? -4.356  2.115   -5.969  1.00 0.00 ? 25  LEU A N    5  
ATOM 9186  C CA   . LEU A 1 25  ? -3.154  2.942   -5.951  1.00 0.00 ? 25  LEU A CA   5  
ATOM 9187  C C    . LEU A 1 25  ? -3.295  4.099   -6.946  1.00 0.00 ? 25  LEU A C    5  
ATOM 9188  O O    . LEU A 1 25  ? -2.884  5.220   -6.662  1.00 0.00 ? 25  LEU A O    5  
ATOM 9189  C CB   . LEU A 1 25  ? -1.910  2.089   -6.292  1.00 0.00 ? 25  LEU A CB   5  
ATOM 9190  C CG   . LEU A 1 25  ? -0.597  2.478   -5.574  1.00 0.00 ? 25  LEU A CG   5  
ATOM 9191  C CD1  . LEU A 1 25  ? 0.558   1.601   -6.054  1.00 0.00 ? 25  LEU A CD1  5  
ATOM 9192  C CD2  . LEU A 1 25  ? -0.263  3.958   -5.761  1.00 0.00 ? 25  LEU A CD2  5  
ATOM 9193  H H    . LEU A 1 25  ? -4.271  1.163   -6.185  1.00 0.00 ? 25  LEU A H    5  
ATOM 9194  H HA   . LEU A 1 25  ? -3.045  3.348   -4.954  1.00 0.00 ? 25  LEU A HA   5  
ATOM 9195  H HB2  . LEU A 1 25  ? -2.132  1.060   -6.044  1.00 0.00 ? 25  LEU A HB2  5  
ATOM 9196  H HB3  . LEU A 1 25  ? -1.740  2.148   -7.358  1.00 0.00 ? 25  LEU A HB3  5  
ATOM 9197  H HG   . LEU A 1 25  ? -0.717  2.299   -4.513  1.00 0.00 ? 25  LEU A HG   5  
ATOM 9198  H HD11 . LEU A 1 25  ? 0.331   0.564   -5.853  1.00 0.00 ? 25  LEU A HD11 5  
ATOM 9199  H HD12 . LEU A 1 25  ? 1.463   1.877   -5.534  1.00 0.00 ? 25  LEU A HD12 5  
ATOM 9200  H HD13 . LEU A 1 25  ? 0.699   1.738   -7.118  1.00 0.00 ? 25  LEU A HD13 5  
ATOM 9201  H HD21 . LEU A 1 25  ? -0.147  4.174   -6.813  1.00 0.00 ? 25  LEU A HD21 5  
ATOM 9202  H HD22 . LEU A 1 25  ? 0.656   4.190   -5.242  1.00 0.00 ? 25  LEU A HD22 5  
ATOM 9203  H HD23 . LEU A 1 25  ? -1.064  4.561   -5.356  1.00 0.00 ? 25  LEU A HD23 5  
ATOM 9204  N N    . ALA A 1 26  ? -3.891  3.816   -8.105  1.00 0.00 ? 26  ALA A N    5  
ATOM 9205  C CA   . ALA A 1 26  ? -4.060  4.821   -9.158  1.00 0.00 ? 26  ALA A CA   5  
ATOM 9206  C C    . ALA A 1 26  ? -4.841  6.034   -8.648  1.00 0.00 ? 26  ALA A C    5  
ATOM 9207  O O    . ALA A 1 26  ? -4.373  7.171   -8.728  1.00 0.00 ? 26  ALA A O    5  
ATOM 9208  C CB   . ALA A 1 26  ? -4.760  4.212   -10.370 1.00 0.00 ? 26  ALA A CB   5  
ATOM 9209  H H    . ALA A 1 26  ? -4.225  2.905   -8.259  1.00 0.00 ? 26  ALA A H    5  
ATOM 9210  H HA   . ALA A 1 26  ? -3.076  5.145   -9.467  1.00 0.00 ? 26  ALA A HA   5  
ATOM 9211  H HB1  . ALA A 1 26  ? -4.191  3.364   -10.727 1.00 0.00 ? 26  ALA A HB1  5  
ATOM 9212  H HB2  . ALA A 1 26  ? -4.831  4.951   -11.157 1.00 0.00 ? 26  ALA A HB2  5  
ATOM 9213  H HB3  . ALA A 1 26  ? -5.751  3.886   -10.092 1.00 0.00 ? 26  ALA A HB3  5  
ATOM 9214  N N    . TYR A 1 27  ? -6.027  5.785   -8.110  1.00 0.00 ? 27  TYR A N    5  
ATOM 9215  C CA   . TYR A 1 27  ? -6.881  6.864   -7.620  1.00 0.00 ? 27  TYR A CA   5  
ATOM 9216  C C    . TYR A 1 27  ? -6.346  7.417   -6.298  1.00 0.00 ? 27  TYR A C    5  
ATOM 9217  O O    . TYR A 1 27  ? -6.483  8.610   -6.006  1.00 0.00 ? 27  TYR A O    5  
ATOM 9218  C CB   . TYR A 1 27  ? -8.326  6.370   -7.470  1.00 0.00 ? 27  TYR A CB   5  
ATOM 9219  C CG   . TYR A 1 27  ? -8.953  5.929   -8.786  1.00 0.00 ? 27  TYR A CG   5  
ATOM 9220  C CD1  . TYR A 1 27  ? -9.018  6.801   -9.869  1.00 0.00 ? 27  TYR A CD1  5  
ATOM 9221  C CD2  . TYR A 1 27  ? -9.473  4.647   -8.948  1.00 0.00 ? 27  TYR A CD2  5  
ATOM 9222  C CE1  . TYR A 1 27  ? -9.582  6.411   -11.069 1.00 0.00 ? 27  TYR A CE1  5  
ATOM 9223  C CE2  . TYR A 1 27  ? -10.038 4.252   -10.147 1.00 0.00 ? 27  TYR A CE2  5  
ATOM 9224  C CZ   . TYR A 1 27  ? -10.090 5.138   -11.203 1.00 0.00 ? 27  TYR A CZ   5  
ATOM 9225  O OH   . TYR A 1 27  ? -10.657 4.749   -12.397 1.00 0.00 ? 27  TYR A OH   5  
ATOM 9226  H H    . TYR A 1 27  ? -6.334  4.855   -8.031  1.00 0.00 ? 27  TYR A H    5  
ATOM 9227  H HA   . TYR A 1 27  ? -6.859  7.657   -8.357  1.00 0.00 ? 27  TYR A HA   5  
ATOM 9228  H HB2  . TYR A 1 27  ? -8.344  5.529   -6.791  1.00 0.00 ? 27  TYR A HB2  5  
ATOM 9229  H HB3  . TYR A 1 27  ? -8.933  7.167   -7.062  1.00 0.00 ? 27  TYR A HB3  5  
ATOM 9230  H HD1  . TYR A 1 27  ? -8.619  7.799   -9.764  1.00 0.00 ? 27  TYR A HD1  5  
ATOM 9231  H HD2  . TYR A 1 27  ? -9.434  3.953   -8.121  1.00 0.00 ? 27  TYR A HD2  5  
ATOM 9232  H HE1  . TYR A 1 27  ? -9.622  7.105   -11.896 1.00 0.00 ? 27  TYR A HE1  5  
ATOM 9233  H HE2  . TYR A 1 27  ? -10.438 3.254   -10.251 1.00 0.00 ? 27  TYR A HE2  5  
ATOM 9234  H HH   . TYR A 1 27  ? -10.124 5.078   -13.131 1.00 0.00 ? 27  TYR A HH   5  
ATOM 9235  N N    . PHE A 1 28  ? -5.715  6.549   -5.517  1.00 0.00 ? 28  PHE A N    5  
ATOM 9236  C CA   . PHE A 1 28  ? -5.106  6.944   -4.252  1.00 0.00 ? 28  PHE A CA   5  
ATOM 9237  C C    . PHE A 1 28  ? -3.994  7.962   -4.493  1.00 0.00 ? 28  PHE A C    5  
ATOM 9238  O O    . PHE A 1 28  ? -3.927  8.995   -3.821  1.00 0.00 ? 28  PHE A O    5  
ATOM 9239  C CB   . PHE A 1 28  ? -4.563  5.705   -3.522  1.00 0.00 ? 28  PHE A CB   5  
ATOM 9240  C CG   . PHE A 1 28  ? -3.790  6.012   -2.265  1.00 0.00 ? 28  PHE A CG   5  
ATOM 9241  C CD1  . PHE A 1 28  ? -4.426  6.545   -1.155  1.00 0.00 ? 28  PHE A CD1  5  
ATOM 9242  C CD2  . PHE A 1 28  ? -2.427  5.759   -2.194  1.00 0.00 ? 28  PHE A CD2  5  
ATOM 9243  C CE1  . PHE A 1 28  ? -3.721  6.822   -0.002  1.00 0.00 ? 28  PHE A CE1  5  
ATOM 9244  C CE2  . PHE A 1 28  ? -1.718  6.035   -1.043  1.00 0.00 ? 28  PHE A CE2  5  
ATOM 9245  C CZ   . PHE A 1 28  ? -2.365  6.567   0.055   1.00 0.00 ? 28  PHE A CZ   5  
ATOM 9246  H H    . PHE A 1 28  ? -5.659  5.612   -5.797  1.00 0.00 ? 28  PHE A H    5  
ATOM 9247  H HA   . PHE A 1 28  ? -5.873  7.401   -3.645  1.00 0.00 ? 28  PHE A HA   5  
ATOM 9248  H HB2  . PHE A 1 28  ? -5.393  5.069   -3.250  1.00 0.00 ? 28  PHE A HB2  5  
ATOM 9249  H HB3  . PHE A 1 28  ? -3.912  5.161   -4.192  1.00 0.00 ? 28  PHE A HB3  5  
ATOM 9250  H HD1  . PHE A 1 28  ? -5.488  6.745   -1.197  1.00 0.00 ? 28  PHE A HD1  5  
ATOM 9251  H HD2  . PHE A 1 28  ? -1.919  5.343   -3.052  1.00 0.00 ? 28  PHE A HD2  5  
ATOM 9252  H HE1  . PHE A 1 28  ? -4.229  7.237   0.856   1.00 0.00 ? 28  PHE A HE1  5  
ATOM 9253  H HE2  . PHE A 1 28  ? -0.658  5.835   -1.003  1.00 0.00 ? 28  PHE A HE2  5  
ATOM 9254  H HZ   . PHE A 1 28  ? -1.811  6.783   0.958   1.00 0.00 ? 28  PHE A HZ   5  
ATOM 9255  N N    . THR A 1 29  ? -3.139  7.682   -5.476  1.00 0.00 ? 29  THR A N    5  
ATOM 9256  C CA   . THR A 1 29  ? -2.023  8.562   -5.787  1.00 0.00 ? 29  THR A CA   5  
ATOM 9257  C C    . THR A 1 29  ? -2.524  9.834   -6.468  1.00 0.00 ? 29  THR A C    5  
ATOM 9258  O O    . THR A 1 29  ? -1.851  10.858  -6.430  1.00 0.00 ? 29  THR A O    5  
ATOM 9259  C CB   . THR A 1 29  ? -0.948  7.869   -6.669  1.00 0.00 ? 29  THR A CB   5  
ATOM 9260  O OG1  . THR A 1 29  ? 0.235   8.679   -6.729  1.00 0.00 ? 29  THR A OG1  5  
ATOM 9261  C CG2  . THR A 1 29  ? -1.454  7.615   -8.087  1.00 0.00 ? 29  THR A CG2  5  
ATOM 9262  H H    . THR A 1 29  ? -3.267  6.868   -6.003  1.00 0.00 ? 29  THR A H    5  
ATOM 9263  H HA   . THR A 1 29  ? -1.557  8.838   -4.848  1.00 0.00 ? 29  THR A HA   5  
ATOM 9264  H HB   . THR A 1 29  ? -0.696  6.918   -6.218  1.00 0.00 ? 29  THR A HB   5  
ATOM 9265  H HG1  . THR A 1 29  ? -0.003  9.576   -6.983  1.00 0.00 ? 29  THR A HG1  5  
ATOM 9266  H HG21 . THR A 1 29  ? -1.717  8.555   -8.552  1.00 0.00 ? 29  THR A HG21 5  
ATOM 9267  H HG22 . THR A 1 29  ? -2.323  6.976   -8.051  1.00 0.00 ? 29  THR A HG22 5  
ATOM 9268  H HG23 . THR A 1 29  ? -0.678  7.133   -8.666  1.00 0.00 ? 29  THR A HG23 5  
ATOM 9269  N N    . GLU A 1 30  ? -3.707  9.769   -7.086  1.00 0.00 ? 30  GLU A N    5  
ATOM 9270  C CA   . GLU A 1 30  ? -4.340  10.958  -7.659  1.00 0.00 ? 30  GLU A CA   5  
ATOM 9271  C C    . GLU A 1 30  ? -4.537  12.017  -6.573  1.00 0.00 ? 30  GLU A C    5  
ATOM 9272  O O    . GLU A 1 30  ? -4.014  13.127  -6.674  1.00 0.00 ? 30  GLU A O    5  
ATOM 9273  C CB   . GLU A 1 30  ? -5.681  10.595  -8.324  1.00 0.00 ? 30  GLU A CB   5  
ATOM 9274  C CG   . GLU A 1 30  ? -6.531  11.797  -8.752  1.00 0.00 ? 30  GLU A CG   5  
ATOM 9275  C CD   . GLU A 1 30  ? -5.783  12.797  -9.628  1.00 0.00 ? 30  GLU A CD   5  
ATOM 9276  O OE1  . GLU A 1 30  ? -5.242  12.396  -10.684 1.00 0.00 ? 30  GLU A OE1  5  
ATOM 9277  O OE2  . GLU A 1 30  ? -5.727  13.993  -9.259  1.00 0.00 ? 30  GLU A OE2  5  
ATOM 9278  H H    . GLU A 1 30  ? -4.157  8.899   -7.167  1.00 0.00 ? 30  GLU A H    5  
ATOM 9279  H HA   . GLU A 1 30  ? -3.670  11.354  -8.412  1.00 0.00 ? 30  GLU A HA   5  
ATOM 9280  H HB2  . GLU A 1 30  ? -5.482  9.994   -9.200  1.00 0.00 ? 30  GLU A HB2  5  
ATOM 9281  H HB3  . GLU A 1 30  ? -6.261  10.006  -7.627  1.00 0.00 ? 30  GLU A HB3  5  
ATOM 9282  H HG2  . GLU A 1 30  ? -7.384  11.433  -9.307  1.00 0.00 ? 30  GLU A HG2  5  
ATOM 9283  H HG3  . GLU A 1 30  ? -6.878  12.305  -7.863  1.00 0.00 ? 30  GLU A HG3  5  
ATOM 9284  N N    . PHE A 1 31  ? -5.261  11.658  -5.517  1.00 0.00 ? 31  PHE A N    5  
ATOM 9285  C CA   . PHE A 1 31  ? -5.493  12.582  -4.408  1.00 0.00 ? 31  PHE A CA   5  
ATOM 9286  C C    . PHE A 1 31  ? -4.189  12.889  -3.673  1.00 0.00 ? 31  PHE A C    5  
ATOM 9287  O O    . PHE A 1 31  ? -3.931  14.032  -3.290  1.00 0.00 ? 31  PHE A O    5  
ATOM 9288  C CB   . PHE A 1 31  ? -6.534  12.014  -3.435  1.00 0.00 ? 31  PHE A CB   5  
ATOM 9289  C CG   . PHE A 1 31  ? -7.924  11.964  -4.014  1.00 0.00 ? 31  PHE A CG   5  
ATOM 9290  C CD1  . PHE A 1 31  ? -8.740  13.087  -3.983  1.00 0.00 ? 31  PHE A CD1  5  
ATOM 9291  C CD2  . PHE A 1 31  ? -8.413  10.803  -4.593  1.00 0.00 ? 31  PHE A CD2  5  
ATOM 9292  C CE1  . PHE A 1 31  ? -10.014 13.050  -4.515  1.00 0.00 ? 31  PHE A CE1  5  
ATOM 9293  C CE2  . PHE A 1 31  ? -9.685  10.761  -5.126  1.00 0.00 ? 31  PHE A CE2  5  
ATOM 9294  C CZ   . PHE A 1 31  ? -10.487 11.887  -5.087  1.00 0.00 ? 31  PHE A CZ   5  
ATOM 9295  H H    . PHE A 1 31  ? -5.646  10.752  -5.481  1.00 0.00 ? 31  PHE A H    5  
ATOM 9296  H HA   . PHE A 1 31  ? -5.875  13.506  -4.825  1.00 0.00 ? 31  PHE A HA   5  
ATOM 9297  H HB2  . PHE A 1 31  ? -6.250  11.009  -3.160  1.00 0.00 ? 31  PHE A HB2  5  
ATOM 9298  H HB3  . PHE A 1 31  ? -6.564  12.629  -2.546  1.00 0.00 ? 31  PHE A HB3  5  
ATOM 9299  H HD1  . PHE A 1 31  ? -8.371  13.998  -3.534  1.00 0.00 ? 31  PHE A HD1  5  
ATOM 9300  H HD2  . PHE A 1 31  ? -7.788  9.921   -4.623  1.00 0.00 ? 31  PHE A HD2  5  
ATOM 9301  H HE1  . PHE A 1 31  ? -10.639 13.931  -4.482  1.00 0.00 ? 31  PHE A HE1  5  
ATOM 9302  H HE2  . PHE A 1 31  ? -10.053 9.850   -5.576  1.00 0.00 ? 31  PHE A HE2  5  
ATOM 9303  H HZ   . PHE A 1 31  ? -11.483 11.855  -5.505  1.00 0.00 ? 31  PHE A HZ   5  
ATOM 9304  N N    . LEU A 1 32  ? -3.356  11.869  -3.512  1.00 0.00 ? 32  LEU A N    5  
ATOM 9305  C CA   . LEU A 1 32  ? -2.092  12.004  -2.791  1.00 0.00 ? 32  LEU A CA   5  
ATOM 9306  C C    . LEU A 1 32  ? -1.113  12.907  -3.557  1.00 0.00 ? 32  LEU A C    5  
ATOM 9307  O O    . LEU A 1 32  ? -0.258  13.562  -2.961  1.00 0.00 ? 32  LEU A O    5  
ATOM 9308  C CB   . LEU A 1 32  ? -1.494  10.611  -2.544  1.00 0.00 ? 32  LEU A CB   5  
ATOM 9309  C CG   . LEU A 1 32  ? -0.302  10.536  -1.573  1.00 0.00 ? 32  LEU A CG   5  
ATOM 9310  C CD1  . LEU A 1 32  ? -0.607  11.262  -0.266  1.00 0.00 ? 32  LEU A CD1  5  
ATOM 9311  C CD2  . LEU A 1 32  ? 0.053   9.080   -1.306  1.00 0.00 ? 32  LEU A CD2  5  
ATOM 9312  H H    . LEU A 1 32  ? -3.605  10.991  -3.878  1.00 0.00 ? 32  LEU A H    5  
ATOM 9313  H HA   . LEU A 1 32  ? -2.309  12.463  -1.837  1.00 0.00 ? 32  LEU A HA   5  
ATOM 9314  H HB2  . LEU A 1 32  ? -2.279  9.976   -2.157  1.00 0.00 ? 32  LEU A HB2  5  
ATOM 9315  H HB3  . LEU A 1 32  ? -1.176  10.209  -3.496  1.00 0.00 ? 32  LEU A HB3  5  
ATOM 9316  H HG   . LEU A 1 32  ? 0.558   11.009  -2.020  1.00 0.00 ? 32  LEU A HG   5  
ATOM 9317  H HD11 . LEU A 1 32  ? -1.459  10.801  0.216   1.00 0.00 ? 32  LEU A HD11 5  
ATOM 9318  H HD12 . LEU A 1 32  ? -0.826  12.299  -0.470  1.00 0.00 ? 32  LEU A HD12 5  
ATOM 9319  H HD13 . LEU A 1 32  ? 0.253   11.200  0.387   1.00 0.00 ? 32  LEU A HD13 5  
ATOM 9320  H HD21 . LEU A 1 32  ? -0.795  8.574   -0.869  1.00 0.00 ? 32  LEU A HD21 5  
ATOM 9321  H HD22 . LEU A 1 32  ? 0.889   9.033   -0.625  1.00 0.00 ? 32  LEU A HD22 5  
ATOM 9322  H HD23 . LEU A 1 32  ? 0.321   8.597   -2.236  1.00 0.00 ? 32  LEU A HD23 5  
ATOM 9323  N N    . LYS A 1 33  ? -1.247  12.951  -4.880  1.00 0.00 ? 33  LYS A N    5  
ATOM 9324  C CA   . LYS A 1 33  ? -0.444  13.854  -5.710  1.00 0.00 ? 33  LYS A CA   5  
ATOM 9325  C C    . LYS A 1 33  ? -1.152  15.202  -5.842  1.00 0.00 ? 33  LYS A C    5  
ATOM 9326  O O    . LYS A 1 33  ? -0.522  16.229  -6.099  1.00 0.00 ? 33  LYS A O    5  
ATOM 9327  C CB   . LYS A 1 33  ? -0.137  13.207  -7.087  1.00 0.00 ? 33  LYS A CB   5  
ATOM 9328  C CG   . LYS A 1 33  ? -0.410  14.073  -8.324  1.00 0.00 ? 33  LYS A CG   5  
ATOM 9329  C CD   . LYS A 1 33  ? -1.877  14.015  -8.761  1.00 0.00 ? 33  LYS A CD   5  
ATOM 9330  C CE   . LYS A 1 33  ? -2.119  14.793  -10.050 1.00 0.00 ? 33  LYS A CE   5  
ATOM 9331  N NZ   . LYS A 1 33  ? -3.533  14.702  -10.495 1.00 0.00 ? 33  LYS A NZ   5  
ATOM 9332  H H    . LYS A 1 33  ? -1.900  12.363  -5.312  1.00 0.00 ? 33  LYS A H    5  
ATOM 9333  H HA   . LYS A 1 33  ? 0.492   14.021  -5.190  1.00 0.00 ? 33  LYS A HA   5  
ATOM 9334  H HB2  . LYS A 1 33  ? 0.908   12.932  -7.107  1.00 0.00 ? 33  LYS A HB2  5  
ATOM 9335  H HB3  . LYS A 1 33  ? -0.724  12.304  -7.178  1.00 0.00 ? 33  LYS A HB3  5  
ATOM 9336  H HG2  . LYS A 1 33  ? -0.154  15.098  -8.096  1.00 0.00 ? 33  LYS A HG2  5  
ATOM 9337  H HG3  . LYS A 1 33  ? 0.211   13.723  -9.138  1.00 0.00 ? 33  LYS A HG3  5  
ATOM 9338  H HD2  . LYS A 1 33  ? -2.156  12.982  -8.919  1.00 0.00 ? 33  LYS A HD2  5  
ATOM 9339  H HD3  . LYS A 1 33  ? -2.492  14.437  -7.978  1.00 0.00 ? 33  LYS A HD3  5  
ATOM 9340  H HE2  . LYS A 1 33  ? -1.872  15.831  -9.885  1.00 0.00 ? 33  LYS A HE2  5  
ATOM 9341  H HE3  . LYS A 1 33  ? -1.480  14.393  -10.827 1.00 0.00 ? 33  LYS A HE3  5  
ATOM 9342  H HZ1  . LYS A 1 33  ? -3.805  13.705  -10.631 1.00 0.00 ? 33  LYS A HZ1  5  
ATOM 9343  H HZ2  . LYS A 1 33  ? -3.662  15.208  -11.392 1.00 0.00 ? 33  LYS A HZ2  5  
ATOM 9344  H HZ3  . LYS A 1 33  ? -4.163  15.122  -9.780  1.00 0.00 ? 33  LYS A HZ3  5  
ATOM 9345  N N    . LYS A 1 34  ? -2.464  15.188  -5.634  1.00 0.00 ? 34  LYS A N    5  
ATOM 9346  C CA   . LYS A 1 34  ? -3.272  16.403  -5.663  1.00 0.00 ? 34  LYS A CA   5  
ATOM 9347  C C    . LYS A 1 34  ? -2.866  17.328  -4.517  1.00 0.00 ? 34  LYS A C    5  
ATOM 9348  O O    . LYS A 1 34  ? -2.843  18.554  -4.660  1.00 0.00 ? 34  LYS A O    5  
ATOM 9349  C CB   . LYS A 1 34  ? -4.758  16.039  -5.573  1.00 0.00 ? 34  LYS A CB   5  
ATOM 9350  C CG   . LYS A 1 34  ? -5.710  17.211  -5.785  1.00 0.00 ? 34  LYS A CG   5  
ATOM 9351  C CD   . LYS A 1 34  ? -7.167  16.753  -5.824  1.00 0.00 ? 34  LYS A CD   5  
ATOM 9352  C CE   . LYS A 1 34  ? -7.407  15.706  -6.910  1.00 0.00 ? 34  LYS A CE   5  
ATOM 9353  N NZ   . LYS A 1 34  ? -6.996  16.187  -8.258  1.00 0.00 ? 34  LYS A NZ   5  
ATOM 9354  H H    . LYS A 1 34  ? -2.908  14.330  -5.463  1.00 0.00 ? 34  LYS A H    5  
ATOM 9355  H HA   . LYS A 1 34  ? -3.086  16.907  -6.602  1.00 0.00 ? 34  LYS A HA   5  
ATOM 9356  H HB2  . LYS A 1 34  ? -4.973  15.289  -6.320  1.00 0.00 ? 34  LYS A HB2  5  
ATOM 9357  H HB3  . LYS A 1 34  ? -4.953  15.618  -4.594  1.00 0.00 ? 34  LYS A HB3  5  
ATOM 9358  H HG2  . LYS A 1 34  ? -5.586  17.916  -4.975  1.00 0.00 ? 34  LYS A HG2  5  
ATOM 9359  H HG3  . LYS A 1 34  ? -5.468  17.694  -6.723  1.00 0.00 ? 34  LYS A HG3  5  
ATOM 9360  H HD2  . LYS A 1 34  ? -7.429  16.328  -4.865  1.00 0.00 ? 34  LYS A HD2  5  
ATOM 9361  H HD3  . LYS A 1 34  ? -7.797  17.610  -6.019  1.00 0.00 ? 34  LYS A HD3  5  
ATOM 9362  H HE2  . LYS A 1 34  ? -6.841  14.817  -6.670  1.00 0.00 ? 34  LYS A HE2  5  
ATOM 9363  H HE3  . LYS A 1 34  ? -8.459  15.462  -6.932  1.00 0.00 ? 34  LYS A HE3  5  
ATOM 9364  H HZ1  . LYS A 1 34  ? -5.987  16.439  -8.256  1.00 0.00 ? 34  LYS A HZ1  5  
ATOM 9365  H HZ2  . LYS A 1 34  ? -7.550  17.025  -8.527  1.00 0.00 ? 34  LYS A HZ2  5  
ATOM 9366  H HZ3  . LYS A 1 34  ? -7.150  15.440  -8.968  1.00 0.00 ? 34  LYS A HZ3  5  
ATOM 9367  N N    . GLU A 1 35  ? -2.542  16.725  -3.378  1.00 0.00 ? 35  GLU A N    5  
ATOM 9368  C CA   . GLU A 1 35  ? -2.027  17.460  -2.224  1.00 0.00 ? 35  GLU A CA   5  
ATOM 9369  C C    . GLU A 1 35  ? -0.502  17.593  -2.315  1.00 0.00 ? 35  GLU A C    5  
ATOM 9370  O O    . GLU A 1 35  ? 0.117   18.345  -1.553  1.00 0.00 ? 35  GLU A O    5  
ATOM 9371  C CB   . GLU A 1 35  ? -2.422  16.745  -0.924  1.00 0.00 ? 35  GLU A CB   5  
ATOM 9372  C CG   . GLU A 1 35  ? -1.904  15.314  -0.826  1.00 0.00 ? 35  GLU A CG   5  
ATOM 9373  C CD   . GLU A 1 35  ? -2.226  14.660  0.507   1.00 0.00 ? 35  GLU A CD   5  
ATOM 9374  O OE1  . GLU A 1 35  ? -1.483  14.901  1.481   1.00 0.00 ? 35  GLU A OE1  5  
ATOM 9375  O OE2  . GLU A 1 35  ? -3.222  13.907  0.589   1.00 0.00 ? 35  GLU A OE2  5  
ATOM 9376  H H    . GLU A 1 35  ? -2.666  15.751  -3.305  1.00 0.00 ? 35  GLU A H    5  
ATOM 9377  H HA   . GLU A 1 35  ? -2.466  18.449  -2.231  1.00 0.00 ? 35  GLU A HA   5  
ATOM 9378  H HB2  . GLU A 1 35  ? -2.033  17.307  -0.086  1.00 0.00 ? 35  GLU A HB2  5  
ATOM 9379  H HB3  . GLU A 1 35  ? -3.501  16.721  -0.855  1.00 0.00 ? 35  GLU A HB3  5  
ATOM 9380  H HG2  . GLU A 1 35  ? -2.349  14.728  -1.618  1.00 0.00 ? 35  GLU A HG2  5  
ATOM 9381  H HG3  . GLU A 1 35  ? -0.829  15.324  -0.954  1.00 0.00 ? 35  GLU A HG3  5  
ATOM 9382  N N    . PHE A 1 36  ? 0.077   16.852  -3.262  1.00 0.00 ? 36  PHE A N    5  
ATOM 9383  C CA   . PHE A 1 36  ? 1.519   16.801  -3.491  1.00 0.00 ? 36  PHE A CA   5  
ATOM 9384  C C    . PHE A 1 36  ? 2.206   16.096  -2.327  1.00 0.00 ? 36  PHE A C    5  
ATOM 9385  O O    . PHE A 1 36  ? 2.802   16.728  -1.453  1.00 0.00 ? 36  PHE A O    5  
ATOM 9386  C CB   . PHE A 1 36  ? 2.131   18.198  -3.729  1.00 0.00 ? 36  PHE A CB   5  
ATOM 9387  C CG   . PHE A 1 36  ? 3.580   18.149  -4.172  1.00 0.00 ? 36  PHE A CG   5  
ATOM 9388  C CD1  . PHE A 1 36  ? 3.901   17.961  -5.510  1.00 0.00 ? 36  PHE A CD1  5  
ATOM 9389  C CD2  . PHE A 1 36  ? 4.615   18.274  -3.253  1.00 0.00 ? 36  PHE A CD2  5  
ATOM 9390  C CE1  . PHE A 1 36  ? 5.220   17.902  -5.921  1.00 0.00 ? 36  PHE A CE1  5  
ATOM 9391  C CE2  . PHE A 1 36  ? 5.936   18.214  -3.660  1.00 0.00 ? 36  PHE A CE2  5  
ATOM 9392  C CZ   . PHE A 1 36  ? 6.238   18.028  -4.995  1.00 0.00 ? 36  PHE A CZ   5  
ATOM 9393  H H    . PHE A 1 36  ? -0.496  16.296  -3.822  1.00 0.00 ? 36  PHE A H    5  
ATOM 9394  H HA   . PHE A 1 36  ? 1.675   16.203  -4.380  1.00 0.00 ? 36  PHE A HA   5  
ATOM 9395  H HB2  . PHE A 1 36  ? 1.564   18.706  -4.495  1.00 0.00 ? 36  PHE A HB2  5  
ATOM 9396  H HB3  . PHE A 1 36  ? 2.079   18.770  -2.811  1.00 0.00 ? 36  PHE A HB3  5  
ATOM 9397  H HD1  . PHE A 1 36  ? 3.108   17.862  -6.236  1.00 0.00 ? 36  PHE A HD1  5  
ATOM 9398  H HD2  . PHE A 1 36  ? 4.382   18.421  -2.209  1.00 0.00 ? 36  PHE A HD2  5  
ATOM 9399  H HE1  . PHE A 1 36  ? 5.455   17.756  -6.965  1.00 0.00 ? 36  PHE A HE1  5  
ATOM 9400  H HE2  . PHE A 1 36  ? 6.732   18.310  -2.935  1.00 0.00 ? 36  PHE A HE2  5  
ATOM 9401  H HZ   . PHE A 1 36  ? 7.269   17.980  -5.315  1.00 0.00 ? 36  PHE A HZ   5  
ATOM 9402  N N    . SER A 1 37  ? 2.047   14.783  -2.296  1.00 0.00 ? 37  SER A N    5  
ATOM 9403  C CA   . SER A 1 37  ? 2.665   13.943  -1.280  1.00 0.00 ? 37  SER A CA   5  
ATOM 9404  C C    . SER A 1 37  ? 2.804   12.505  -1.785  1.00 0.00 ? 37  SER A C    5  
ATOM 9405  O O    . SER A 1 37  ? 3.108   11.598  -1.015  1.00 0.00 ? 37  SER A O    5  
ATOM 9406  C CB   . SER A 1 37  ? 1.826   13.976  0.006   1.00 0.00 ? 37  SER A CB   5  
ATOM 9407  O OG   . SER A 1 37  ? 1.805   15.277  0.577   1.00 0.00 ? 37  SER A OG   5  
ATOM 9408  H H    . SER A 1 37  ? 1.476   14.361  -2.968  1.00 0.00 ? 37  SER A H    5  
ATOM 9409  H HA   . SER A 1 37  ? 3.650   14.336  -1.071  1.00 0.00 ? 37  SER A HA   5  
ATOM 9410  H HB2  . SER A 1 37  ? 0.811   13.683  -0.219  1.00 0.00 ? 37  SER A HB2  5  
ATOM 9411  H HB3  . SER A 1 37  ? 2.244   13.290  0.724   1.00 0.00 ? 37  SER A HB3  5  
ATOM 9412  H HG   . SER A 1 37  ? 1.479   15.906  -0.079  1.00 0.00 ? 37  SER A HG   5  
ATOM 9413  N N    . ALA A 1 38  ? 2.628   12.314  -3.098  1.00 0.00 ? 38  ALA A N    5  
ATOM 9414  C CA   . ALA A 1 38  ? 2.637   10.977  -3.702  1.00 0.00 ? 38  ALA A CA   5  
ATOM 9415  C C    . ALA A 1 38  ? 4.061   10.443  -3.838  1.00 0.00 ? 38  ALA A C    5  
ATOM 9416  O O    . ALA A 1 38  ? 4.291   9.365   -4.390  1.00 0.00 ? 38  ALA A O    5  
ATOM 9417  C CB   . ALA A 1 38  ? 1.948   11.004  -5.061  1.00 0.00 ? 38  ALA A CB   5  
ATOM 9418  H H    . ALA A 1 38  ? 2.517   13.094  -3.677  1.00 0.00 ? 38  ALA A H    5  
ATOM 9419  H HA   . ALA A 1 38  ? 2.078   10.314  -3.055  1.00 0.00 ? 38  ALA A HA   5  
ATOM 9420  H HB1  . ALA A 1 38  ? 0.943   11.382  -4.947  1.00 0.00 ? 38  ALA A HB1  5  
ATOM 9421  H HB2  . ALA A 1 38  ? 1.910   10.004  -5.469  1.00 0.00 ? 38  ALA A HB2  5  
ATOM 9422  H HB3  . ALA A 1 38  ? 2.499   11.646  -5.732  1.00 0.00 ? 38  ALA A HB3  5  
ATOM 9423  N N    . GLU A 1 39  ? 5.008   11.208  -3.328  1.00 0.00 ? 39  GLU A N    5  
ATOM 9424  C CA   . GLU A 1 39  ? 6.417   10.836  -3.353  1.00 0.00 ? 39  GLU A CA   5  
ATOM 9425  C C    . GLU A 1 39  ? 6.678   9.711   -2.350  1.00 0.00 ? 39  GLU A C    5  
ATOM 9426  O O    . GLU A 1 39  ? 7.708   9.038   -2.393  1.00 0.00 ? 39  GLU A O    5  
ATOM 9427  C CB   . GLU A 1 39  ? 7.280   12.066  -3.038  1.00 0.00 ? 39  GLU A CB   5  
ATOM 9428  C CG   . GLU A 1 39  ? 7.267   13.134  -4.140  1.00 0.00 ? 39  GLU A CG   5  
ATOM 9429  C CD   . GLU A 1 39  ? 5.863   13.520  -4.596  1.00 0.00 ? 39  GLU A CD   5  
ATOM 9430  O OE1  . GLU A 1 39  ? 5.100   14.094  -3.790  1.00 0.00 ? 39  GLU A OE1  5  
ATOM 9431  O OE2  . GLU A 1 39  ? 5.504   13.218  -5.758  1.00 0.00 ? 39  GLU A OE2  5  
ATOM 9432  H H    . GLU A 1 39  ? 4.752   12.064  -2.921  1.00 0.00 ? 39  GLU A H    5  
ATOM 9433  H HA   . GLU A 1 39  ? 6.653   10.481  -4.346  1.00 0.00 ? 39  GLU A HA   5  
ATOM 9434  H HB2  . GLU A 1 39  ? 6.918   12.521  -2.124  1.00 0.00 ? 39  GLU A HB2  5  
ATOM 9435  H HB3  . GLU A 1 39  ? 8.302   11.746  -2.886  1.00 0.00 ? 39  GLU A HB3  5  
ATOM 9436  H HG2  . GLU A 1 39  ? 7.759   14.021  -3.767  1.00 0.00 ? 39  GLU A HG2  5  
ATOM 9437  H HG3  . GLU A 1 39  ? 7.817   12.756  -4.992  1.00 0.00 ? 39  GLU A HG3  5  
ATOM 9438  N N    . ASN A 1 40  ? 5.712   9.507   -1.468  1.00 0.00 ? 40  ASN A N    5  
ATOM 9439  C CA   . ASN A 1 40  ? 5.782   8.466   -0.449  1.00 0.00 ? 40  ASN A CA   5  
ATOM 9440  C C    . ASN A 1 40  ? 5.518   7.083   -1.057  1.00 0.00 ? 40  ASN A C    5  
ATOM 9441  O O    . ASN A 1 40  ? 6.198   6.111   -0.725  1.00 0.00 ? 40  ASN A O    5  
ATOM 9442  C CB   . ASN A 1 40  ? 4.760   8.768   0.661   1.00 0.00 ? 40  ASN A CB   5  
ATOM 9443  C CG   . ASN A 1 40  ? 3.327   8.800   0.147   1.00 0.00 ? 40  ASN A CG   5  
ATOM 9444  O OD1  . ASN A 1 40  ? 3.088   8.981   -1.046  1.00 0.00 ? 40  ASN A OD1  5  
ATOM 9445  N ND2  . ASN A 1 40  ? 2.365   8.670   1.044   1.00 0.00 ? 40  ASN A ND2  5  
ATOM 9446  H H    . ASN A 1 40  ? 4.916   10.082  -1.500  1.00 0.00 ? 40  ASN A H    5  
ATOM 9447  H HA   . ASN A 1 40  ? 6.776   8.479   -0.024  1.00 0.00 ? 40  ASN A HA   5  
ATOM 9448  H HB2  . ASN A 1 40  ? 4.833   8.006   1.425   1.00 0.00 ? 40  ASN A HB2  5  
ATOM 9449  H HB3  . ASN A 1 40  ? 4.989   9.729   1.097   1.00 0.00 ? 40  ASN A HB3  5  
ATOM 9450  H HD21 . ASN A 1 40  ? 2.614   8.564   1.978   1.00 0.00 ? 40  ASN A HD21 5  
ATOM 9451  H HD22 . ASN A 1 40  ? 1.438   8.680   0.730   1.00 0.00 ? 40  ASN A HD22 5  
ATOM 9452  N N    . VAL A 1 41  ? 4.539   7.003   -1.960  1.00 0.00 ? 41  VAL A N    5  
ATOM 9453  C CA   . VAL A 1 41  ? 4.141   5.726   -2.551  1.00 0.00 ? 41  VAL A CA   5  
ATOM 9454  C C    . VAL A 1 41  ? 5.144   5.259   -3.598  1.00 0.00 ? 41  VAL A C    5  
ATOM 9455  O O    . VAL A 1 41  ? 5.355   4.058   -3.764  1.00 0.00 ? 41  VAL A O    5  
ATOM 9456  C CB   . VAL A 1 41  ? 2.721   5.778   -3.178  1.00 0.00 ? 41  VAL A CB   5  
ATOM 9457  C CG1  . VAL A 1 41  ? 1.671   6.048   -2.104  1.00 0.00 ? 41  VAL A CG1  5  
ATOM 9458  C CG2  . VAL A 1 41  ? 2.641   6.823   -4.291  1.00 0.00 ? 41  VAL A CG2  5  
ATOM 9459  H H    . VAL A 1 41  ? 4.070   7.823   -2.230  1.00 0.00 ? 41  VAL A H    5  
ATOM 9460  H HA   . VAL A 1 41  ? 4.122   4.995   -1.751  1.00 0.00 ? 41  VAL A HA   5  
ATOM 9461  H HB   . VAL A 1 41  ? 2.510   4.808   -3.611  1.00 0.00 ? 41  VAL A HB   5  
ATOM 9462  H HG11 . VAL A 1 41  ? 0.691   6.084   -2.559  1.00 0.00 ? 41  VAL A HG11 5  
ATOM 9463  H HG12 . VAL A 1 41  ? 1.878   6.994   -1.624  1.00 0.00 ? 41  VAL A HG12 5  
ATOM 9464  H HG13 . VAL A 1 41  ? 1.695   5.258   -1.367  1.00 0.00 ? 41  VAL A HG13 5  
ATOM 9465  H HG21 . VAL A 1 41  ? 1.648   6.821   -4.717  1.00 0.00 ? 41  VAL A HG21 5  
ATOM 9466  H HG22 . VAL A 1 41  ? 3.363   6.589   -5.060  1.00 0.00 ? 41  VAL A HG22 5  
ATOM 9467  H HG23 . VAL A 1 41  ? 2.855   7.802   -3.884  1.00 0.00 ? 41  VAL A HG23 5  
ATOM 9468  N N    . THR A 1 42  ? 5.766   6.203   -4.304  1.00 0.00 ? 42  THR A N    5  
ATOM 9469  C CA   . THR A 1 42  ? 6.797   5.852   -5.273  1.00 0.00 ? 42  THR A CA   5  
ATOM 9470  C C    . THR A 1 42  ? 8.044   5.351   -4.541  1.00 0.00 ? 42  THR A C    5  
ATOM 9471  O O    . THR A 1 42  ? 8.683   4.395   -4.976  1.00 0.00 ? 42  THR A O    5  
ATOM 9472  C CB   . THR A 1 42  ? 7.144   7.025   -6.226  1.00 0.00 ? 42  THR A CB   5  
ATOM 9473  O OG1  . THR A 1 42  ? 8.192   6.639   -7.122  1.00 0.00 ? 42  THR A OG1  5  
ATOM 9474  C CG2  . THR A 1 42  ? 7.559   8.270   -5.458  1.00 0.00 ? 42  THR A CG2  5  
ATOM 9475  H H    . THR A 1 42  ? 5.526   7.144   -4.173  1.00 0.00 ? 42  THR A H    5  
ATOM 9476  H HA   . THR A 1 42  ? 6.409   5.037   -5.876  1.00 0.00 ? 42  THR A HA   5  
ATOM 9477  H HB   . THR A 1 42  ? 6.262   7.261   -6.808  1.00 0.00 ? 42  THR A HB   5  
ATOM 9478  H HG1  . THR A 1 42  ? 8.446   7.394   -7.669  1.00 0.00 ? 42  THR A HG1  5  
ATOM 9479  H HG21 . THR A 1 42  ? 7.796   9.063   -6.153  1.00 0.00 ? 42  THR A HG21 5  
ATOM 9480  H HG22 . THR A 1 42  ? 8.428   8.051   -4.855  1.00 0.00 ? 42  THR A HG22 5  
ATOM 9481  H HG23 . THR A 1 42  ? 6.749   8.587   -4.817  1.00 0.00 ? 42  THR A HG23 5  
ATOM 9482  N N    . PHE A 1 43  ? 8.365   5.979   -3.405  1.00 0.00 ? 43  PHE A N    5  
ATOM 9483  C CA   . PHE A 1 43  ? 9.429   5.485   -2.529  1.00 0.00 ? 43  PHE A CA   5  
ATOM 9484  C C    . PHE A 1 43  ? 9.074   4.088   -2.017  1.00 0.00 ? 43  PHE A C    5  
ATOM 9485  O O    . PHE A 1 43  ? 9.912   3.181   -1.999  1.00 0.00 ? 43  PHE A O    5  
ATOM 9486  C CB   . PHE A 1 43  ? 9.637   6.447   -1.346  1.00 0.00 ? 43  PHE A CB   5  
ATOM 9487  C CG   . PHE A 1 43  ? 10.495  5.882   -0.238  1.00 0.00 ? 43  PHE A CG   5  
ATOM 9488  C CD1  . PHE A 1 43  ? 11.860  5.705   -0.418  1.00 0.00 ? 43  PHE A CD1  5  
ATOM 9489  C CD2  . PHE A 1 43  ? 9.935   5.526   0.983   1.00 0.00 ? 43  PHE A CD2  5  
ATOM 9490  C CE1  . PHE A 1 43  ? 12.645  5.185   0.593   1.00 0.00 ? 43  PHE A CE1  5  
ATOM 9491  C CE2  . PHE A 1 43  ? 10.717  5.006   1.997   1.00 0.00 ? 43  PHE A CE2  5  
ATOM 9492  C CZ   . PHE A 1 43  ? 12.073  4.835   1.801   1.00 0.00 ? 43  PHE A CZ   5  
ATOM 9493  H H    . PHE A 1 43  ? 7.881   6.795   -3.155  1.00 0.00 ? 43  PHE A H    5  
ATOM 9494  H HA   . PHE A 1 43  ? 10.342  5.429   -3.108  1.00 0.00 ? 43  PHE A HA   5  
ATOM 9495  H HB2  . PHE A 1 43  ? 10.113  7.350   -1.704  1.00 0.00 ? 43  PHE A HB2  5  
ATOM 9496  H HB3  . PHE A 1 43  ? 8.673   6.701   -0.925  1.00 0.00 ? 43  PHE A HB3  5  
ATOM 9497  H HD1  . PHE A 1 43  ? 12.310  5.978   -1.363  1.00 0.00 ? 43  PHE A HD1  5  
ATOM 9498  H HD2  . PHE A 1 43  ? 8.874   5.658   1.139   1.00 0.00 ? 43  PHE A HD2  5  
ATOM 9499  H HE1  . PHE A 1 43  ? 13.706  5.052   0.439   1.00 0.00 ? 43  PHE A HE1  5  
ATOM 9500  H HE2  . PHE A 1 43  ? 10.268  4.732   2.942   1.00 0.00 ? 43  PHE A HE2  5  
ATOM 9501  H HZ   . PHE A 1 43  ? 12.688  4.429   2.592   1.00 0.00 ? 43  PHE A HZ   5  
ATOM 9502  N N    . TRP A 1 44  ? 7.816   3.930   -1.615  1.00 0.00 ? 44  TRP A N    5  
ATOM 9503  C CA   . TRP A 1 44  ? 7.304   2.660   -1.108  1.00 0.00 ? 44  TRP A CA   5  
ATOM 9504  C C    . TRP A 1 44  ? 7.491   1.547   -2.142  1.00 0.00 ? 44  TRP A C    5  
ATOM 9505  O O    . TRP A 1 44  ? 8.139   0.533   -1.868  1.00 0.00 ? 44  TRP A O    5  
ATOM 9506  C CB   . TRP A 1 44  ? 5.819   2.817   -0.744  1.00 0.00 ? 44  TRP A CB   5  
ATOM 9507  C CG   . TRP A 1 44  ? 5.167   1.566   -0.228  1.00 0.00 ? 44  TRP A CG   5  
ATOM 9508  C CD1  . TRP A 1 44  ? 5.165   1.110   1.059   1.00 0.00 ? 44  TRP A CD1  5  
ATOM 9509  C CD2  . TRP A 1 44  ? 4.408   0.620   -0.991  1.00 0.00 ? 44  TRP A CD2  5  
ATOM 9510  N NE1  . TRP A 1 44  ? 4.461   -0.071  1.139   1.00 0.00 ? 44  TRP A NE1  5  
ATOM 9511  C CE2  . TRP A 1 44  ? 3.985   -0.390  -0.106  1.00 0.00 ? 44  TRP A CE2  5  
ATOM 9512  C CE3  . TRP A 1 44  ? 4.047   0.530   -2.337  1.00 0.00 ? 44  TRP A CE3  5  
ATOM 9513  C CZ2  . TRP A 1 44  ? 3.222   -1.478  -0.528  1.00 0.00 ? 44  TRP A CZ2  5  
ATOM 9514  C CZ3  . TRP A 1 44  ? 3.289   -0.546  -2.755  1.00 0.00 ? 44  TRP A CZ3  5  
ATOM 9515  C CH2  . TRP A 1 44  ? 2.882   -1.539  -1.853  1.00 0.00 ? 44  TRP A CH2  5  
ATOM 9516  H H    . TRP A 1 44  ? 7.209   4.700   -1.657  1.00 0.00 ? 44  TRP A H    5  
ATOM 9517  H HA   . TRP A 1 44  ? 7.861   2.409   -0.216  1.00 0.00 ? 44  TRP A HA   5  
ATOM 9518  H HB2  . TRP A 1 44  ? 5.728   3.574   0.018   1.00 0.00 ? 44  TRP A HB2  5  
ATOM 9519  H HB3  . TRP A 1 44  ? 5.276   3.137   -1.622  1.00 0.00 ? 44  TRP A HB3  5  
ATOM 9520  H HD1  . TRP A 1 44  ? 5.655   1.606   1.884   1.00 0.00 ? 44  TRP A HD1  5  
ATOM 9521  H HE1  . TRP A 1 44  ? 4.322   -0.598  1.958   1.00 0.00 ? 44  TRP A HE1  5  
ATOM 9522  H HE3  . TRP A 1 44  ? 4.351   1.286   -3.048  1.00 0.00 ? 44  TRP A HE3  5  
ATOM 9523  H HZ2  . TRP A 1 44  ? 2.901   -2.250  0.156   1.00 0.00 ? 44  TRP A HZ2  5  
ATOM 9524  H HZ3  . TRP A 1 44  ? 3.000   -0.627  -3.792  1.00 0.00 ? 44  TRP A HZ3  5  
ATOM 9525  H HH2  . TRP A 1 44  ? 2.290   -2.363  -2.224  1.00 0.00 ? 44  TRP A HH2  5  
ATOM 9526  N N    . LYS A 1 45  ? 6.942   1.751   -3.339  1.00 0.00 ? 45  LYS A N    5  
ATOM 9527  C CA   . LYS A 1 45  ? 7.011   0.745   -4.397  1.00 0.00 ? 45  LYS A CA   5  
ATOM 9528  C C    . LYS A 1 45  ? 8.449   0.562   -4.884  1.00 0.00 ? 45  LYS A C    5  
ATOM 9529  O O    . LYS A 1 45  ? 8.812   -0.506  -5.374  1.00 0.00 ? 45  LYS A O    5  
ATOM 9530  C CB   . LYS A 1 45  ? 6.094   1.112   -5.576  1.00 0.00 ? 45  LYS A CB   5  
ATOM 9531  C CG   . LYS A 1 45  ? 6.483   2.405   -6.281  1.00 0.00 ? 45  LYS A CG   5  
ATOM 9532  C CD   . LYS A 1 45  ? 5.676   2.640   -7.554  1.00 0.00 ? 45  LYS A CD   5  
ATOM 9533  C CE   . LYS A 1 45  ? 4.182   2.775   -7.278  1.00 0.00 ? 45  LYS A CE   5  
ATOM 9534  N NZ   . LYS A 1 45  ? 3.412   2.996   -8.531  1.00 0.00 ? 45  LYS A NZ   5  
ATOM 9535  H H    . LYS A 1 45  ? 6.478   2.597   -3.511  1.00 0.00 ? 45  LYS A H    5  
ATOM 9536  H HA   . LYS A 1 45  ? 6.671   -0.191  -3.975  1.00 0.00 ? 45  LYS A HA   5  
ATOM 9537  H HB2  . LYS A 1 45  ? 6.119   0.308   -6.300  1.00 0.00 ? 45  LYS A HB2  5  
ATOM 9538  H HB3  . LYS A 1 45  ? 5.082   1.216   -5.210  1.00 0.00 ? 45  LYS A HB3  5  
ATOM 9539  H HG2  . LYS A 1 45  ? 6.320   3.233   -5.606  1.00 0.00 ? 45  LYS A HG2  5  
ATOM 9540  H HG3  . LYS A 1 45  ? 7.530   2.353   -6.536  1.00 0.00 ? 45  LYS A HG3  5  
ATOM 9541  H HD2  . LYS A 1 45  ? 6.025   3.550   -8.024  1.00 0.00 ? 45  LYS A HD2  5  
ATOM 9542  H HD3  . LYS A 1 45  ? 5.835   1.809   -8.226  1.00 0.00 ? 45  LYS A HD3  5  
ATOM 9543  H HE2  . LYS A 1 45  ? 3.829   1.870   -6.805  1.00 0.00 ? 45  LYS A HE2  5  
ATOM 9544  H HE3  . LYS A 1 45  ? 4.022   3.614   -6.614  1.00 0.00 ? 45  LYS A HE3  5  
ATOM 9545  H HZ1  . LYS A 1 45  ? 3.555   2.198   -9.185  1.00 0.00 ? 45  LYS A HZ1  5  
ATOM 9546  H HZ2  . LYS A 1 45  ? 3.727   3.871   -8.999  1.00 0.00 ? 45  LYS A HZ2  5  
ATOM 9547  H HZ3  . LYS A 1 45  ? 2.398   3.079   -8.320  1.00 0.00 ? 45  LYS A HZ3  5  
ATOM 9548  N N    . ALA A 1 46  ? 9.266   1.606   -4.743  1.00 0.00 ? 46  ALA A N    5  
ATOM 9549  C CA   . ALA A 1 46  ? 10.678  1.532   -5.115  1.00 0.00 ? 46  ALA A CA   5  
ATOM 9550  C C    . ALA A 1 46  ? 11.387  0.484   -4.266  1.00 0.00 ? 46  ALA A C    5  
ATOM 9551  O O    . ALA A 1 46  ? 12.028  -0.428  -4.791  1.00 0.00 ? 46  ALA A O    5  
ATOM 9552  C CB   . ALA A 1 46  ? 11.348  2.894   -4.961  1.00 0.00 ? 46  ALA A CB   5  
ATOM 9553  H H    . ALA A 1 46  ? 8.912   2.447   -4.384  1.00 0.00 ? 46  ALA A H    5  
ATOM 9554  H HA   . ALA A 1 46  ? 10.735  1.240   -6.157  1.00 0.00 ? 46  ALA A HA   5  
ATOM 9555  H HB1  . ALA A 1 46  ? 12.380  2.829   -5.278  1.00 0.00 ? 46  ALA A HB1  5  
ATOM 9556  H HB2  . ALA A 1 46  ? 11.308  3.203   -3.927  1.00 0.00 ? 46  ALA A HB2  5  
ATOM 9557  H HB3  . ALA A 1 46  ? 10.831  3.621   -5.572  1.00 0.00 ? 46  ALA A HB3  5  
ATOM 9558  N N    . CYS A 1 47  ? 11.243  0.598   -2.948  1.00 0.00 ? 47  CYS A N    5  
ATOM 9559  C CA   . CYS A 1 47  ? 11.846  -0.366  -2.034  1.00 0.00 ? 47  CYS A CA   5  
ATOM 9560  C C    . CYS A 1 47  ? 11.151  -1.721  -2.163  1.00 0.00 ? 47  CYS A C    5  
ATOM 9561  O O    . CYS A 1 47  ? 11.756  -2.771  -1.928  1.00 0.00 ? 47  CYS A O    5  
ATOM 9562  C CB   . CYS A 1 47  ? 11.778  0.136   -0.590  1.00 0.00 ? 47  CYS A CB   5  
ATOM 9563  S SG   . CYS A 1 47  ? 12.522  -0.993  0.613   1.00 0.00 ? 47  CYS A SG   5  
ATOM 9564  H H    . CYS A 1 47  ? 10.715  1.346   -2.582  1.00 0.00 ? 47  CYS A H    5  
ATOM 9565  H HA   . CYS A 1 47  ? 12.884  -0.483  -2.316  1.00 0.00 ? 47  CYS A HA   5  
ATOM 9566  H HB2  . CYS A 1 47  ? 12.300  1.079   -0.518  1.00 0.00 ? 47  CYS A HB2  5  
ATOM 9567  H HB3  . CYS A 1 47  ? 10.744  0.280   -0.313  1.00 0.00 ? 47  CYS A HB3  5  
ATOM 9568  H HG   . CYS A 1 47  ? 12.293  -2.232  0.201   1.00 0.00 ? 47  CYS A HG   5  
ATOM 9569  N N    . GLU A 1 48  ? 9.881   -1.687  -2.556  1.00 0.00 ? 48  GLU A N    5  
ATOM 9570  C CA   . GLU A 1 48  ? 9.111   -2.900  -2.809  1.00 0.00 ? 48  GLU A CA   5  
ATOM 9571  C C    . GLU A 1 48  ? 9.722   -3.667  -3.985  1.00 0.00 ? 48  GLU A C    5  
ATOM 9572  O O    . GLU A 1 48  ? 9.824   -4.894  -3.960  1.00 0.00 ? 48  GLU A O    5  
ATOM 9573  C CB   . GLU A 1 48  ? 7.648   -2.531  -3.098  1.00 0.00 ? 48  GLU A CB   5  
ATOM 9574  C CG   . GLU A 1 48  ? 6.710   -3.722  -3.271  1.00 0.00 ? 48  GLU A CG   5  
ATOM 9575  C CD   . GLU A 1 48  ? 6.616   -4.594  -2.028  1.00 0.00 ? 48  GLU A CD   5  
ATOM 9576  O OE1  . GLU A 1 48  ? 6.470   -4.049  -0.914  1.00 0.00 ? 48  GLU A OE1  5  
ATOM 9577  O OE2  . GLU A 1 48  ? 6.658   -5.835  -2.161  1.00 0.00 ? 48  GLU A OE2  5  
ATOM 9578  H H    . GLU A 1 48  ? 9.445   -0.815  -2.673  1.00 0.00 ? 48  GLU A H    5  
ATOM 9579  H HA   . GLU A 1 48  ? 9.155   -3.517  -1.921  1.00 0.00 ? 48  GLU A HA   5  
ATOM 9580  H HB2  . GLU A 1 48  ? 7.277   -1.929  -2.279  1.00 0.00 ? 48  GLU A HB2  5  
ATOM 9581  H HB3  . GLU A 1 48  ? 7.613   -1.941  -4.002  1.00 0.00 ? 48  GLU A HB3  5  
ATOM 9582  H HG2  . GLU A 1 48  ? 5.721   -3.352  -3.505  1.00 0.00 ? 48  GLU A HG2  5  
ATOM 9583  H HG3  . GLU A 1 48  ? 7.068   -4.326  -4.095  1.00 0.00 ? 48  GLU A HG3  5  
ATOM 9584  N N    . ARG A 1 49  ? 10.151  -2.926  -5.006  1.00 0.00 ? 49  ARG A N    5  
ATOM 9585  C CA   . ARG A 1 49  ? 10.800  -3.516  -6.176  1.00 0.00 ? 49  ARG A CA   5  
ATOM 9586  C C    . ARG A 1 49  ? 12.279  -3.782  -5.893  1.00 0.00 ? 49  ARG A C    5  
ATOM 9587  O O    . ARG A 1 49  ? 12.927  -4.561  -6.597  1.00 0.00 ? 49  ARG A O    5  
ATOM 9588  C CB   . ARG A 1 49  ? 10.640  -2.602  -7.405  1.00 0.00 ? 49  ARG A CB   5  
ATOM 9589  C CG   . ARG A 1 49  ? 9.188   -2.432  -7.851  1.00 0.00 ? 49  ARG A CG   5  
ATOM 9590  C CD   . ARG A 1 49  ? 9.067   -1.763  -9.219  1.00 0.00 ? 49  ARG A CD   5  
ATOM 9591  N NE   . ARG A 1 49  ? 9.525   -0.370  -9.221  1.00 0.00 ? 49  ARG A NE   5  
ATOM 9592  C CZ   . ARG A 1 49  ? 9.138   0.538   -10.122 1.00 0.00 ? 49  ARG A CZ   5  
ATOM 9593  N NH1  . ARG A 1 49  ? 8.305   0.198   -11.100 1.00 0.00 ? 49  ARG A NH1  5  
ATOM 9594  N NH2  . ARG A 1 49  ? 9.588   1.782   -10.055 1.00 0.00 ? 49  ARG A NH2  5  
ATOM 9595  H H    . ARG A 1 49  ? 10.026  -1.953  -4.972  1.00 0.00 ? 49  ARG A H    5  
ATOM 9596  H HA   . ARG A 1 49  ? 10.314  -4.461  -6.380  1.00 0.00 ? 49  ARG A HA   5  
ATOM 9597  H HB2  . ARG A 1 49  ? 11.039  -1.624  -7.166  1.00 0.00 ? 49  ARG A HB2  5  
ATOM 9598  H HB3  . ARG A 1 49  ? 11.204  -3.021  -8.229  1.00 0.00 ? 49  ARG A HB3  5  
ATOM 9599  H HG2  . ARG A 1 49  ? 8.723   -3.406  -7.903  1.00 0.00 ? 49  ARG A HG2  5  
ATOM 9600  H HG3  . ARG A 1 49  ? 8.670   -1.826  -7.119  1.00 0.00 ? 49  ARG A HG3  5  
ATOM 9601  H HD2  . ARG A 1 49  ? 9.657   -2.320  -9.932  1.00 0.00 ? 49  ARG A HD2  5  
ATOM 9602  H HD3  . ARG A 1 49  ? 8.029   -1.788  -9.522  1.00 0.00 ? 49  ARG A HD3  5  
ATOM 9603  H HE   . ARG A 1 49  ? 10.158  -0.102  -8.516  1.00 0.00 ? 49  ARG A HE   5  
ATOM 9604  H HH11 . ARG A 1 49  ? 7.961   -0.741  -11.166 1.00 0.00 ? 49  ARG A HH11 5  
ATOM 9605  H HH12 . ARG A 1 49  ? 8.032   0.876   -11.790 1.00 0.00 ? 49  ARG A HH12 5  
ATOM 9606  H HH21 . ARG A 1 49  ? 10.225  2.051   -9.326  1.00 0.00 ? 49  ARG A HH21 5  
ATOM 9607  H HH22 . ARG A 1 49  ? 9.289   2.462   -10.728 1.00 0.00 ? 49  ARG A HH22 5  
ATOM 9608  N N    . PHE A 1 50  ? 12.797  -3.142  -4.847  1.00 0.00 ? 50  PHE A N    5  
ATOM 9609  C CA   . PHE A 1 50  ? 14.186  -3.319  -4.430  1.00 0.00 ? 50  PHE A CA   5  
ATOM 9610  C C    . PHE A 1 50  ? 14.382  -4.700  -3.799  1.00 0.00 ? 50  PHE A C    5  
ATOM 9611  O O    . PHE A 1 50  ? 15.356  -5.395  -4.092  1.00 0.00 ? 50  PHE A O    5  
ATOM 9612  C CB   . PHE A 1 50  ? 14.582  -2.206  -3.445  1.00 0.00 ? 50  PHE A CB   5  
ATOM 9613  C CG   . PHE A 1 50  ? 16.005  -2.282  -2.946  1.00 0.00 ? 50  PHE A CG   5  
ATOM 9614  C CD1  . PHE A 1 50  ? 17.069  -2.002  -3.790  1.00 0.00 ? 50  PHE A CD1  5  
ATOM 9615  C CD2  . PHE A 1 50  ? 16.275  -2.625  -1.627  1.00 0.00 ? 50  PHE A CD2  5  
ATOM 9616  C CE1  . PHE A 1 50  ? 18.371  -2.062  -3.332  1.00 0.00 ? 50  PHE A CE1  5  
ATOM 9617  C CE2  . PHE A 1 50  ? 17.574  -2.685  -1.165  1.00 0.00 ? 50  PHE A CE2  5  
ATOM 9618  C CZ   . PHE A 1 50  ? 18.624  -2.404  -2.017  1.00 0.00 ? 50  PHE A CZ   5  
ATOM 9619  H H    . PHE A 1 50  ? 12.228  -2.525  -4.343  1.00 0.00 ? 50  PHE A H    5  
ATOM 9620  H HA   . PHE A 1 50  ? 14.809  -3.247  -5.311  1.00 0.00 ? 50  PHE A HA   5  
ATOM 9621  H HB2  . PHE A 1 50  ? 14.456  -1.250  -3.931  1.00 0.00 ? 50  PHE A HB2  5  
ATOM 9622  H HB3  . PHE A 1 50  ? 13.924  -2.250  -2.587  1.00 0.00 ? 50  PHE A HB3  5  
ATOM 9623  H HD1  . PHE A 1 50  ? 16.874  -1.735  -4.818  1.00 0.00 ? 50  PHE A HD1  5  
ATOM 9624  H HD2  . PHE A 1 50  ? 15.456  -2.846  -0.959  1.00 0.00 ? 50  PHE A HD2  5  
ATOM 9625  H HE1  . PHE A 1 50  ? 19.192  -1.841  -4.001  1.00 0.00 ? 50  PHE A HE1  5  
ATOM 9626  H HE2  . PHE A 1 50  ? 17.770  -2.952  -0.136  1.00 0.00 ? 50  PHE A HE2  5  
ATOM 9627  H HZ   . PHE A 1 50  ? 19.641  -2.450  -1.656  1.00 0.00 ? 50  PHE A HZ   5  
ATOM 9628  N N    . GLN A 1 51  ? 13.440  -5.102  -2.945  1.00 0.00 ? 51  GLN A N    5  
ATOM 9629  C CA   . GLN A 1 51  ? 13.494  -6.420  -2.307  1.00 0.00 ? 51  GLN A CA   5  
ATOM 9630  C C    . GLN A 1 51  ? 13.183  -7.516  -3.328  1.00 0.00 ? 51  GLN A C    5  
ATOM 9631  O O    . GLN A 1 51  ? 13.476  -8.691  -3.107  1.00 0.00 ? 51  GLN A O    5  
ATOM 9632  C CB   . GLN A 1 51  ? 12.504  -6.502  -1.138  1.00 0.00 ? 51  GLN A CB   5  
ATOM 9633  C CG   . GLN A 1 51  ? 11.041  -6.468  -1.567  1.00 0.00 ? 51  GLN A CG   5  
ATOM 9634  C CD   . GLN A 1 51  ? 10.078  -6.690  -0.414  1.00 0.00 ? 51  GLN A CD   5  
ATOM 9635  O OE1  . GLN A 1 51  ? 10.401  -7.362  0.568   1.00 0.00 ? 51  GLN A OE1  5  
ATOM 9636  N NE2  . GLN A 1 51  ? 8.879   -6.155  -0.533  1.00 0.00 ? 51  GLN A NE2  5  
ATOM 9637  H H    . GLN A 1 51  ? 12.693  -4.499  -2.738  1.00 0.00 ? 51  GLN A H    5  
ATOM 9638  H HA   . GLN A 1 51  ? 14.499  -6.568  -1.932  1.00 0.00 ? 51  GLN A HA   5  
ATOM 9639  H HB2  . GLN A 1 51  ? 12.678  -7.422  -0.598  1.00 0.00 ? 51  GLN A HB2  5  
ATOM 9640  H HB3  . GLN A 1 51  ? 12.682  -5.669  -0.474  1.00 0.00 ? 51  GLN A HB3  5  
ATOM 9641  H HG2  . GLN A 1 51  ? 10.832  -5.503  -2.009  1.00 0.00 ? 51  GLN A HG2  5  
ATOM 9642  H HG3  . GLN A 1 51  ? 10.877  -7.241  -2.305  1.00 0.00 ? 51  GLN A HG3  5  
ATOM 9643  H HE21 . GLN A 1 51  ? 8.672   -5.651  -1.350  1.00 0.00 ? 51  GLN A HE21 5  
ATOM 9644  H HE22 . GLN A 1 51  ? 8.240   -6.282  0.198   1.00 0.00 ? 51  GLN A HE22 5  
ATOM 9645  N N    . GLN A 1 52  ? 12.575  -7.111  -4.441  1.00 0.00 ? 52  GLN A N    5  
ATOM 9646  C CA   . GLN A 1 52  ? 12.250  -8.025  -5.535  1.00 0.00 ? 52  GLN A CA   5  
ATOM 9647  C C    . GLN A 1 52  ? 13.532  -8.573  -6.169  1.00 0.00 ? 52  GLN A C    5  
ATOM 9648  O O    . GLN A 1 52  ? 13.535  -9.659  -6.758  1.00 0.00 ? 52  GLN A O    5  
ATOM 9649  C CB   . GLN A 1 52  ? 11.361  -7.294  -6.564  1.00 0.00 ? 52  GLN A CB   5  
ATOM 9650  C CG   . GLN A 1 52  ? 11.134  -8.030  -7.888  1.00 0.00 ? 52  GLN A CG   5  
ATOM 9651  C CD   . GLN A 1 52  ? 12.249  -7.807  -8.904  1.00 0.00 ? 52  GLN A CD   5  
ATOM 9652  O OE1  . GLN A 1 52  ? 12.537  -8.674  -9.731  1.00 0.00 ? 52  GLN A OE1  5  
ATOM 9653  N NE2  . GLN A 1 52  ? 12.887  -6.642  -8.854  1.00 0.00 ? 52  GLN A NE2  5  
ATOM 9654  H H    . GLN A 1 52  ? 12.334  -6.165  -4.528  1.00 0.00 ? 52  GLN A H    5  
ATOM 9655  H HA   . GLN A 1 52  ? 11.692  -8.852  -5.116  1.00 0.00 ? 52  GLN A HA   5  
ATOM 9656  H HB2  . GLN A 1 52  ? 10.394  -7.119  -6.114  1.00 0.00 ? 52  GLN A HB2  5  
ATOM 9657  H HB3  . GLN A 1 52  ? 11.812  -6.336  -6.786  1.00 0.00 ? 52  GLN A HB3  5  
ATOM 9658  H HG2  . GLN A 1 52  ? 11.061  -9.089  -7.690  1.00 0.00 ? 52  GLN A HG2  5  
ATOM 9659  H HG3  . GLN A 1 52  ? 10.204  -7.686  -8.322  1.00 0.00 ? 52  GLN A HG3  5  
ATOM 9660  H HE21 . GLN A 1 52  ? 12.612  -5.987  -8.175  1.00 0.00 ? 52  GLN A HE21 5  
ATOM 9661  H HE22 . GLN A 1 52  ? 13.604  -6.481  -9.499  1.00 0.00 ? 52  GLN A HE22 5  
ATOM 9662  N N    . ILE A 1 53  ? 14.620  -7.820  -6.035  1.00 0.00 ? 53  ILE A N    5  
ATOM 9663  C CA   . ILE A 1 53  ? 15.924  -8.253  -6.519  1.00 0.00 ? 53  ILE A CA   5  
ATOM 9664  C C    . ILE A 1 53  ? 16.416  -9.430  -5.669  1.00 0.00 ? 53  ILE A C    5  
ATOM 9665  O O    . ILE A 1 53  ? 16.493  -9.321  -4.442  1.00 0.00 ? 53  ILE A O    5  
ATOM 9666  C CB   . ILE A 1 53  ? 16.953  -7.094  -6.464  1.00 0.00 ? 53  ILE A CB   5  
ATOM 9667  C CG1  . ILE A 1 53  ? 16.433  -5.882  -7.259  1.00 0.00 ? 53  ILE A CG1  5  
ATOM 9668  C CG2  . ILE A 1 53  ? 18.315  -7.550  -6.995  1.00 0.00 ? 53  ILE A CG2  5  
ATOM 9669  C CD1  . ILE A 1 53  ? 17.319  -4.656  -7.169  1.00 0.00 ? 53  ILE A CD1  5  
ATOM 9670  H H    . ILE A 1 53  ? 14.545  -6.953  -5.583  1.00 0.00 ? 53  ILE A H    5  
ATOM 9671  H HA   . ILE A 1 53  ? 15.815  -8.572  -7.548  1.00 0.00 ? 53  ILE A HA   5  
ATOM 9672  H HB   . ILE A 1 53  ? 17.081  -6.806  -5.428  1.00 0.00 ? 53  ILE A HB   5  
ATOM 9673  H HG12 . ILE A 1 53  ? 16.350  -6.150  -8.302  1.00 0.00 ? 53  ILE A HG12 5  
ATOM 9674  H HG13 . ILE A 1 53  ? 15.455  -5.609  -6.886  1.00 0.00 ? 53  ILE A HG13 5  
ATOM 9675  H HG21 . ILE A 1 53  ? 18.681  -8.370  -6.394  1.00 0.00 ? 53  ILE A HG21 5  
ATOM 9676  H HG22 . ILE A 1 53  ? 19.016  -6.729  -6.948  1.00 0.00 ? 53  ILE A HG22 5  
ATOM 9677  H HG23 . ILE A 1 53  ? 18.211  -7.875  -8.021  1.00 0.00 ? 53  ILE A HG23 5  
ATOM 9678  H HD11 . ILE A 1 53  ? 18.300  -4.891  -7.555  1.00 0.00 ? 53  ILE A HD11 5  
ATOM 9679  H HD12 . ILE A 1 53  ? 17.405  -4.346  -6.137  1.00 0.00 ? 53  ILE A HD12 5  
ATOM 9680  H HD13 . ILE A 1 53  ? 16.887  -3.856  -7.750  1.00 0.00 ? 53  ILE A HD13 5  
ATOM 9681  N N    . PRO A 1 54  ? 16.769  -10.569 -6.301  1.00 0.00 ? 54  PRO A N    5  
ATOM 9682  C CA   . PRO A 1 54  ? 17.119  -11.809 -5.583  1.00 0.00 ? 54  PRO A CA   5  
ATOM 9683  C C    . PRO A 1 54  ? 18.521  -11.773 -4.960  1.00 0.00 ? 54  PRO A C    5  
ATOM 9684  O O    . PRO A 1 54  ? 19.146  -12.818 -4.787  1.00 0.00 ? 54  PRO A O    5  
ATOM 9685  C CB   . PRO A 1 54  ? 17.049  -12.869 -6.691  1.00 0.00 ? 54  PRO A CB   5  
ATOM 9686  C CG   . PRO A 1 54  ? 17.433  -12.130 -7.926  1.00 0.00 ? 54  PRO A CG   5  
ATOM 9687  C CD   . PRO A 1 54  ? 16.864  -10.742 -7.768  1.00 0.00 ? 54  PRO A CD   5  
ATOM 9688  H HA   . PRO A 1 54  ? 16.393  -12.040 -4.815  1.00 0.00 ? 54  PRO A HA   5  
ATOM 9689  H HB2  . PRO A 1 54  ? 17.740  -13.674 -6.475  1.00 0.00 ? 54  PRO A HB2  5  
ATOM 9690  H HB3  . PRO A 1 54  ? 16.043  -13.261 -6.760  1.00 0.00 ? 54  PRO A HB3  5  
ATOM 9691  H HG2  . PRO A 1 54  ? 18.511  -12.089 -8.010  1.00 0.00 ? 54  PRO A HG2  5  
ATOM 9692  H HG3  . PRO A 1 54  ? 17.008  -12.615 -8.794  1.00 0.00 ? 54  PRO A HG3  5  
ATOM 9693  H HD2  . PRO A 1 54  ? 17.533  -10.009 -8.200  1.00 0.00 ? 54  PRO A HD2  5  
ATOM 9694  H HD3  . PRO A 1 54  ? 15.888  -10.678 -8.227  1.00 0.00 ? 54  PRO A HD3  5  
ATOM 9695  N N    . ALA A 1 55  ? 19.005  -10.567 -4.639  1.00 0.00 ? 55  ALA A N    5  
ATOM 9696  C CA   . ALA A 1 55  ? 20.326  -10.363 -4.024  1.00 0.00 ? 55  ALA A CA   5  
ATOM 9697  C C    . ALA A 1 55  ? 21.469  -10.575 -5.028  1.00 0.00 ? 55  ALA A C    5  
ATOM 9698  O O    . ALA A 1 55  ? 22.462  -9.842  -5.011  1.00 0.00 ? 55  ALA A O    5  
ATOM 9699  C CB   . ALA A 1 55  ? 20.515  -11.259 -2.796  1.00 0.00 ? 55  ALA A CB   5  
ATOM 9700  H H    . ALA A 1 55  ? 18.451  -9.782  -4.818  1.00 0.00 ? 55  ALA A H    5  
ATOM 9701  H HA   . ALA A 1 55  ? 20.359  -9.334  -3.682  1.00 0.00 ? 55  ALA A HA   5  
ATOM 9702  H HB1  . ALA A 1 55  ? 21.456  -11.024 -2.318  1.00 0.00 ? 55  ALA A HB1  5  
ATOM 9703  H HB2  . ALA A 1 55  ? 20.515  -12.295 -3.100  1.00 0.00 ? 55  ALA A HB2  5  
ATOM 9704  H HB3  . ALA A 1 55  ? 19.706  -11.089 -2.099  1.00 0.00 ? 55  ALA A HB3  5  
ATOM 9705  N N    . SER A 1 56  ? 21.315  -11.573 -5.901  1.00 0.00 ? 56  SER A N    5  
ATOM 9706  C CA   . SER A 1 56  ? 22.320  -11.923 -6.901  1.00 0.00 ? 56  SER A CA   5  
ATOM 9707  C C    . SER A 1 56  ? 22.787  -10.697 -7.688  1.00 0.00 ? 56  SER A C    5  
ATOM 9708  O O    . SER A 1 56  ? 23.978  -10.530 -7.951  1.00 0.00 ? 56  SER A O    5  
ATOM 9709  C CB   . SER A 1 56  ? 21.734  -12.964 -7.859  1.00 0.00 ? 56  SER A CB   5  
ATOM 9710  O OG   . SER A 1 56  ? 21.117  -14.021 -7.142  1.00 0.00 ? 56  SER A OG   5  
ATOM 9711  H H    . SER A 1 56  ? 20.500  -12.109 -5.859  1.00 0.00 ? 56  SER A H    5  
ATOM 9712  H HA   . SER A 1 56  ? 23.166  -12.355 -6.387  1.00 0.00 ? 56  SER A HA   5  
ATOM 9713  H HB2  . SER A 1 56  ? 20.994  -12.496 -8.492  1.00 0.00 ? 56  SER A HB2  5  
ATOM 9714  H HB3  . SER A 1 56  ? 22.524  -13.373 -8.472  1.00 0.00 ? 56  SER A HB3  5  
ATOM 9715  H HG   . SER A 1 56  ? 20.640  -14.589 -7.764  1.00 0.00 ? 56  SER A HG   5  
ATOM 9716  N N    . ASP A 1 57  ? 21.842  -9.841  -8.058  1.00 0.00 ? 57  ASP A N    5  
ATOM 9717  C CA   . ASP A 1 57  ? 22.158  -8.629  -8.807  1.00 0.00 ? 57  ASP A CA   5  
ATOM 9718  C C    . ASP A 1 57  ? 22.619  -7.532  -7.853  1.00 0.00 ? 57  ASP A C    5  
ATOM 9719  O O    . ASP A 1 57  ? 21.916  -6.540  -7.646  1.00 0.00 ? 57  ASP A O    5  
ATOM 9720  C CB   . ASP A 1 57  ? 20.942  -8.151  -9.612  1.00 0.00 ? 57  ASP A CB   5  
ATOM 9721  C CG   . ASP A 1 57  ? 20.402  -9.218  -10.546 1.00 0.00 ? 57  ASP A CG   5  
ATOM 9722  O OD1  . ASP A 1 57  ? 21.015  -9.451  -11.609 1.00 0.00 ? 57  ASP A OD1  5  
ATOM 9723  O OD2  . ASP A 1 57  ? 19.367  -9.833  -10.218 1.00 0.00 ? 57  ASP A OD2  5  
ATOM 9724  H H    . ASP A 1 57  ? 20.910  -10.026 -7.821  1.00 0.00 ? 57  ASP A H    5  
ATOM 9725  H HA   . ASP A 1 57  ? 22.965  -8.858  -9.490  1.00 0.00 ? 57  ASP A HA   5  
ATOM 9726  H HB2  . ASP A 1 57  ? 20.157  -7.862  -8.929  1.00 0.00 ? 57  ASP A HB2  5  
ATOM 9727  H HB3  . ASP A 1 57  ? 21.227  -7.291  -10.204 1.00 0.00 ? 57  ASP A HB3  5  
ATOM 9728  N N    . THR A 1 58  ? 23.796  -7.722  -7.267  1.00 0.00 ? 58  THR A N    5  
ATOM 9729  C CA   . THR A 1 58  ? 24.339  -6.772  -6.304  1.00 0.00 ? 58  THR A CA   5  
ATOM 9730  C C    . THR A 1 58  ? 24.575  -5.415  -6.970  1.00 0.00 ? 58  THR A C    5  
ATOM 9731  O O    . THR A 1 58  ? 24.373  -4.364  -6.354  1.00 0.00 ? 58  THR A O    5  
ATOM 9732  C CB   . THR A 1 58  ? 25.657  -7.301  -5.687  1.00 0.00 ? 58  THR A CB   5  
ATOM 9733  O OG1  . THR A 1 58  ? 25.478  -8.661  -5.253  1.00 0.00 ? 58  THR A OG1  5  
ATOM 9734  C CG2  . THR A 1 58  ? 26.093  -6.448  -4.499  1.00 0.00 ? 58  THR A CG2  5  
ATOM 9735  H H    . THR A 1 58  ? 24.323  -8.519  -7.499  1.00 0.00 ? 58  THR A H    5  
ATOM 9736  H HA   . THR A 1 58  ? 23.614  -6.653  -5.511  1.00 0.00 ? 58  THR A HA   5  
ATOM 9737  H HB   . THR A 1 58  ? 26.433  -7.273  -6.440  1.00 0.00 ? 58  THR A HB   5  
ATOM 9738  H HG1  . THR A 1 58  ? 24.541  -8.896  -5.301  1.00 0.00 ? 58  THR A HG1  5  
ATOM 9739  H HG21 . THR A 1 58  ? 25.320  -6.459  -3.742  1.00 0.00 ? 58  THR A HG21 5  
ATOM 9740  H HG22 . THR A 1 58  ? 26.262  -5.432  -4.825  1.00 0.00 ? 58  THR A HG22 5  
ATOM 9741  H HG23 . THR A 1 58  ? 27.009  -6.847  -4.085  1.00 0.00 ? 58  THR A HG23 5  
ATOM 9742  N N    . GLN A 1 59  ? 24.969  -5.452  -8.240  1.00 0.00 ? 59  GLN A N    5  
ATOM 9743  C CA   . GLN A 1 59  ? 25.176  -4.233  -9.015  1.00 0.00 ? 59  GLN A CA   5  
ATOM 9744  C C    . GLN A 1 59  ? 23.858  -3.474  -9.183  1.00 0.00 ? 59  GLN A C    5  
ATOM 9745  O O    . GLN A 1 59  ? 23.828  -2.243  -9.126  1.00 0.00 ? 59  GLN A O    5  
ATOM 9746  C CB   . GLN A 1 59  ? 25.830  -4.553  -10.380 1.00 0.00 ? 59  GLN A CB   5  
ATOM 9747  C CG   . GLN A 1 59  ? 25.123  -5.629  -11.217 1.00 0.00 ? 59  GLN A CG   5  
ATOM 9748  C CD   . GLN A 1 59  ? 23.857  -5.143  -11.913 1.00 0.00 ? 59  GLN A CD   5  
ATOM 9749  O OE1  . GLN A 1 59  ? 23.731  -3.967  -12.253 1.00 0.00 ? 59  GLN A OE1  5  
ATOM 9750  N NE2  . GLN A 1 59  ? 22.918  -6.050  -12.143 1.00 0.00 ? 59  GLN A NE2  5  
ATOM 9751  H H    . GLN A 1 59  ? 25.131  -6.322  -8.665  1.00 0.00 ? 59  GLN A H    5  
ATOM 9752  H HA   . GLN A 1 59  ? 25.854  -3.608  -8.449  1.00 0.00 ? 59  GLN A HA   5  
ATOM 9753  H HB2  . GLN A 1 59  ? 25.865  -3.645  -10.966 1.00 0.00 ? 59  GLN A HB2  5  
ATOM 9754  H HB3  . GLN A 1 59  ? 26.845  -4.882  -10.200 1.00 0.00 ? 59  GLN A HB3  5  
ATOM 9755  H HG2  . GLN A 1 59  ? 25.809  -5.981  -11.975 1.00 0.00 ? 59  GLN A HG2  5  
ATOM 9756  H HG3  . GLN A 1 59  ? 24.864  -6.454  -10.568 1.00 0.00 ? 59  GLN A HG3  5  
ATOM 9757  H HE21 . GLN A 1 59  ? 23.086  -6.976  -11.862 1.00 0.00 ? 59  GLN A HE21 5  
ATOM 9758  H HE22 . GLN A 1 59  ? 22.093  -5.763  -12.591 1.00 0.00 ? 59  GLN A HE22 5  
ATOM 9759  N N    . GLN A 1 60  ? 22.763  -4.216  -9.352  1.00 0.00 ? 60  GLN A N    5  
ATOM 9760  C CA   . GLN A 1 60  ? 21.446  -3.606  -9.510  1.00 0.00 ? 60  GLN A CA   5  
ATOM 9761  C C    . GLN A 1 60  ? 20.988  -3.034  -8.177  1.00 0.00 ? 60  GLN A C    5  
ATOM 9762  O O    . GLN A 1 60  ? 20.352  -1.984  -8.129  1.00 0.00 ? 60  GLN A O    5  
ATOM 9763  C CB   . GLN A 1 60  ? 20.422  -4.623  -10.032 1.00 0.00 ? 60  GLN A CB   5  
ATOM 9764  C CG   . GLN A 1 60  ? 19.088  -3.989  -10.420 1.00 0.00 ? 60  GLN A CG   5  
ATOM 9765  C CD   . GLN A 1 60  ? 18.030  -5.005  -10.821 1.00 0.00 ? 60  GLN A CD   5  
ATOM 9766  O OE1  . GLN A 1 60  ? 18.338  -6.087  -11.319 1.00 0.00 ? 60  GLN A OE1  5  
ATOM 9767  N NE2  . GLN A 1 60  ? 16.769  -4.652  -10.624 1.00 0.00 ? 60  GLN A NE2  5  
ATOM 9768  H H    . GLN A 1 60  ? 22.842  -5.190  -9.365  1.00 0.00 ? 60  GLN A H    5  
ATOM 9769  H HA   . GLN A 1 60  ? 21.539  -2.797  -10.224 1.00 0.00 ? 60  GLN A HA   5  
ATOM 9770  H HB2  . GLN A 1 60  ? 20.831  -5.114  -10.905 1.00 0.00 ? 60  GLN A HB2  5  
ATOM 9771  H HB3  . GLN A 1 60  ? 20.238  -5.362  -9.266  1.00 0.00 ? 60  GLN A HB3  5  
ATOM 9772  H HG2  . GLN A 1 60  ? 18.716  -3.423  -9.578  1.00 0.00 ? 60  GLN A HG2  5  
ATOM 9773  H HG3  . GLN A 1 60  ? 19.253  -3.319  -11.253 1.00 0.00 ? 60  GLN A HG3  5  
ATOM 9774  H HE21 . GLN A 1 60  ? 16.589  -3.765  -10.234 1.00 0.00 ? 60  GLN A HE21 5  
ATOM 9775  H HE22 . GLN A 1 60  ? 16.067  -5.284  -10.875 1.00 0.00 ? 60  GLN A HE22 5  
ATOM 9776  N N    . LEU A 1 61  ? 21.328  -3.737  -7.098  1.00 0.00 ? 61  LEU A N    5  
ATOM 9777  C CA   . LEU A 1 61  ? 21.052  -3.257  -5.747  1.00 0.00 ? 61  LEU A CA   5  
ATOM 9778  C C    . LEU A 1 61  ? 21.714  -1.899  -5.531  1.00 0.00 ? 61  LEU A C    5  
ATOM 9779  O O    . LEU A 1 61  ? 21.104  -0.980  -4.989  1.00 0.00 ? 61  LEU A O    5  
ATOM 9780  C CB   . LEU A 1 61  ? 21.563  -4.262  -4.700  1.00 0.00 ? 61  LEU A CB   5  
ATOM 9781  C CG   . LEU A 1 61  ? 20.828  -5.613  -4.657  1.00 0.00 ? 61  LEU A CG   5  
ATOM 9782  C CD1  . LEU A 1 61  ? 21.544  -6.590  -3.728  1.00 0.00 ? 61  LEU A CD1  5  
ATOM 9783  C CD2  . LEU A 1 61  ? 19.377  -5.424  -4.215  1.00 0.00 ? 61  LEU A CD2  5  
ATOM 9784  H H    . LEU A 1 61  ? 21.776  -4.601  -7.215  1.00 0.00 ? 61  LEU A H    5  
ATOM 9785  H HA   . LEU A 1 61  ? 19.982  -3.149  -5.643  1.00 0.00 ? 61  LEU A HA   5  
ATOM 9786  H HB2  . LEU A 1 61  ? 22.609  -4.452  -4.900  1.00 0.00 ? 61  LEU A HB2  5  
ATOM 9787  H HB3  . LEU A 1 61  ? 21.482  -3.804  -3.723  1.00 0.00 ? 61  LEU A HB3  5  
ATOM 9788  H HG   . LEU A 1 61  ? 20.822  -6.043  -5.649  1.00 0.00 ? 61  LEU A HG   5  
ATOM 9789  H HD11 . LEU A 1 61  ? 22.557  -6.739  -4.069  1.00 0.00 ? 61  LEU A HD11 5  
ATOM 9790  H HD12 . LEU A 1 61  ? 21.023  -7.537  -3.729  1.00 0.00 ? 61  LEU A HD12 5  
ATOM 9791  H HD13 . LEU A 1 61  ? 21.558  -6.191  -2.723  1.00 0.00 ? 61  LEU A HD13 5  
ATOM 9792  H HD21 . LEU A 1 61  ? 18.874  -6.380  -4.211  1.00 0.00 ? 61  LEU A HD21 5  
ATOM 9793  H HD22 . LEU A 1 61  ? 18.875  -4.757  -4.901  1.00 0.00 ? 61  LEU A HD22 5  
ATOM 9794  H HD23 . LEU A 1 61  ? 19.353  -5.000  -3.220  1.00 0.00 ? 61  LEU A HD23 5  
ATOM 9795  N N    . ALA A 1 62  ? 22.963  -1.786  -5.974  1.00 0.00 ? 62  ALA A N    5  
ATOM 9796  C CA   . ALA A 1 62  ? 23.719  -0.544  -5.856  1.00 0.00 ? 62  ALA A CA   5  
ATOM 9797  C C    . ALA A 1 62  ? 23.052  0.577   -6.654  1.00 0.00 ? 62  ALA A C    5  
ATOM 9798  O O    . ALA A 1 62  ? 22.782  1.655   -6.122  1.00 0.00 ? 62  ALA A O    5  
ATOM 9799  C CB   . ALA A 1 62  ? 25.156  -0.753  -6.326  1.00 0.00 ? 62  ALA A CB   5  
ATOM 9800  H H    . ALA A 1 62  ? 23.392  -2.564  -6.393  1.00 0.00 ? 62  ALA A H    5  
ATOM 9801  H HA   . ALA A 1 62  ? 23.744  -0.265  -4.810  1.00 0.00 ? 62  ALA A HA   5  
ATOM 9802  H HB1  . ALA A 1 62  ? 25.720  0.159   -6.191  1.00 0.00 ? 62  ALA A HB1  5  
ATOM 9803  H HB2  . ALA A 1 62  ? 25.159  -1.024  -7.372  1.00 0.00 ? 62  ALA A HB2  5  
ATOM 9804  H HB3  . ALA A 1 62  ? 25.613  -1.547  -5.751  1.00 0.00 ? 62  ALA A HB3  5  
ATOM 9805  N N    . GLN A 1 63  ? 22.777  0.307   -7.932  1.00 0.00 ? 63  GLN A N    5  
ATOM 9806  C CA   . GLN A 1 63  ? 22.157  1.295   -8.819  1.00 0.00 ? 63  GLN A CA   5  
ATOM 9807  C C    . GLN A 1 63  ? 20.799  1.747   -8.276  1.00 0.00 ? 63  GLN A C    5  
ATOM 9808  O O    . GLN A 1 63  ? 20.513  2.947   -8.205  1.00 0.00 ? 63  GLN A O    5  
ATOM 9809  C CB   . GLN A 1 63  ? 21.978  0.725   -10.235 1.00 0.00 ? 63  GLN A CB   5  
ATOM 9810  C CG   . GLN A 1 63  ? 23.273  0.280   -10.912 1.00 0.00 ? 63  GLN A CG   5  
ATOM 9811  C CD   . GLN A 1 63  ? 24.337  1.365   -10.939 1.00 0.00 ? 63  GLN A CD   5  
ATOM 9812  O OE1  . GLN A 1 63  ? 25.193  1.439   -10.057 1.00 0.00 ? 63  GLN A OE1  5  
ATOM 9813  N NE2  . GLN A 1 63  ? 24.274  2.238   -11.931 1.00 0.00 ? 63  GLN A NE2  5  
ATOM 9814  H H    . GLN A 1 63  ? 23.000  -0.581  -8.288  1.00 0.00 ? 63  GLN A H    5  
ATOM 9815  H HA   . GLN A 1 63  ? 22.814  2.152   -8.867  1.00 0.00 ? 63  GLN A HA   5  
ATOM 9816  H HB2  . GLN A 1 63  ? 21.319  -0.131  -10.183 1.00 0.00 ? 63  GLN A HB2  5  
ATOM 9817  H HB3  . GLN A 1 63  ? 21.515  1.479   -10.856 1.00 0.00 ? 63  GLN A HB3  5  
ATOM 9818  H HG2  . GLN A 1 63  ? 23.667  -0.571  -10.379 1.00 0.00 ? 63  GLN A HG2  5  
ATOM 9819  H HG3  . GLN A 1 63  ? 23.050  -0.010  -11.930 1.00 0.00 ? 63  GLN A HG3  5  
ATOM 9820  H HE21 . GLN A 1 63  ? 23.547  2.142   -12.586 1.00 0.00 ? 63  GLN A HE21 5  
ATOM 9821  H HE22 . GLN A 1 63  ? 24.957  2.940   -11.978 1.00 0.00 ? 63  GLN A HE22 5  
ATOM 9822  N N    . GLU A 1 64  ? 19.980  0.773   -7.886  1.00 0.00 ? 64  GLU A N    5  
ATOM 9823  C CA   . GLU A 1 64  ? 18.625  1.031   -7.403  1.00 0.00 ? 64  GLU A CA   5  
ATOM 9824  C C    . GLU A 1 64  ? 18.664  1.822   -6.095  1.00 0.00 ? 64  GLU A C    5  
ATOM 9825  O O    . GLU A 1 64  ? 18.076  2.902   -5.992  1.00 0.00 ? 64  GLU A O    5  
ATOM 9826  C CB   . GLU A 1 64  ? 17.880  -0.297  -7.198  1.00 0.00 ? 64  GLU A CB   5  
ATOM 9827  C CG   . GLU A 1 64  ? 16.405  -0.144  -6.835  1.00 0.00 ? 64  GLU A CG   5  
ATOM 9828  C CD   . GLU A 1 64  ? 15.573  0.426   -7.973  1.00 0.00 ? 64  GLU A CD   5  
ATOM 9829  O OE1  . GLU A 1 64  ? 15.456  1.665   -8.073  1.00 0.00 ? 64  GLU A OE1  5  
ATOM 9830  O OE2  . GLU A 1 64  ? 15.032  -0.367  -8.775  1.00 0.00 ? 64  GLU A OE2  5  
ATOM 9831  H H    . GLU A 1 64  ? 20.298  -0.150  -7.920  1.00 0.00 ? 64  GLU A H    5  
ATOM 9832  H HA   . GLU A 1 64  ? 18.108  1.614   -8.154  1.00 0.00 ? 64  GLU A HA   5  
ATOM 9833  H HB2  . GLU A 1 64  ? 17.943  -0.875  -8.110  1.00 0.00 ? 64  GLU A HB2  5  
ATOM 9834  H HB3  . GLU A 1 64  ? 18.368  -0.850  -6.405  1.00 0.00 ? 64  GLU A HB3  5  
ATOM 9835  H HG2  . GLU A 1 64  ? 16.009  -1.117  -6.570  1.00 0.00 ? 64  GLU A HG2  5  
ATOM 9836  H HG3  . GLU A 1 64  ? 16.324  0.515   -5.980  1.00 0.00 ? 64  GLU A HG3  5  
ATOM 9837  N N    . ALA A 1 65  ? 19.380  1.282   -5.108  1.00 0.00 ? 65  ALA A N    5  
ATOM 9838  C CA   . ALA A 1 65  ? 19.486  1.908   -3.792  1.00 0.00 ? 65  ALA A CA   5  
ATOM 9839  C C    . ALA A 1 65  ? 19.995  3.338   -3.912  1.00 0.00 ? 65  ALA A C    5  
ATOM 9840  O O    . ALA A 1 65  ? 19.510  4.237   -3.229  1.00 0.00 ? 65  ALA A O    5  
ATOM 9841  C CB   . ALA A 1 65  ? 20.398  1.092   -2.880  1.00 0.00 ? 65  ALA A CB   5  
ATOM 9842  H H    . ALA A 1 65  ? 19.853  0.439   -5.273  1.00 0.00 ? 65  ALA A H    5  
ATOM 9843  H HA   . ALA A 1 65  ? 18.497  1.924   -3.351  1.00 0.00 ? 65  ALA A HA   5  
ATOM 9844  H HB1  . ALA A 1 65  ? 20.022  0.082   -2.806  1.00 0.00 ? 65  ALA A HB1  5  
ATOM 9845  H HB2  . ALA A 1 65  ? 20.420  1.539   -1.896  1.00 0.00 ? 65  ALA A HB2  5  
ATOM 9846  H HB3  . ALA A 1 65  ? 21.398  1.075   -3.291  1.00 0.00 ? 65  ALA A HB3  5  
ATOM 9847  N N    . ARG A 1 66  ? 20.969  3.541   -4.796  1.00 0.00 ? 66  ARG A N    5  
ATOM 9848  C CA   . ARG A 1 66  ? 21.549  4.861   -5.020  1.00 0.00 ? 66  ARG A CA   5  
ATOM 9849  C C    . ARG A 1 66  ? 20.507  5.812   -5.601  1.00 0.00 ? 66  ARG A C    5  
ATOM 9850  O O    . ARG A 1 66  ? 20.422  6.974   -5.203  1.00 0.00 ? 66  ARG A O    5  
ATOM 9851  C CB   . ARG A 1 66  ? 22.745  4.766   -5.975  1.00 0.00 ? 66  ARG A CB   5  
ATOM 9852  C CG   . ARG A 1 66  ? 23.561  6.052   -6.077  1.00 0.00 ? 66  ARG A CG   5  
ATOM 9853  C CD   . ARG A 1 66  ? 24.571  5.986   -7.214  1.00 0.00 ? 66  ARG A CD   5  
ATOM 9854  N NE   . ARG A 1 66  ? 25.393  4.775   -7.155  1.00 0.00 ? 66  ARG A NE   5  
ATOM 9855  C CZ   . ARG A 1 66  ? 25.433  3.853   -8.116  1.00 0.00 ? 66  ARG A CZ   5  
ATOM 9856  N NH1  . ARG A 1 66  ? 24.682  3.987   -9.202  1.00 0.00 ? 66  ARG A NH1  5  
ATOM 9857  N NH2  . ARG A 1 66  ? 26.216  2.793   -7.990  1.00 0.00 ? 66  ARG A NH2  5  
ATOM 9858  H H    . ARG A 1 66  ? 21.309  2.776   -5.313  1.00 0.00 ? 66  ARG A H    5  
ATOM 9859  H HA   . ARG A 1 66  ? 21.883  5.245   -4.065  1.00 0.00 ? 66  ARG A HA   5  
ATOM 9860  H HB2  . ARG A 1 66  ? 23.400  3.978   -5.632  1.00 0.00 ? 66  ARG A HB2  5  
ATOM 9861  H HB3  . ARG A 1 66  ? 22.383  4.514   -6.963  1.00 0.00 ? 66  ARG A HB3  5  
ATOM 9862  H HG2  . ARG A 1 66  ? 22.889  6.881   -6.252  1.00 0.00 ? 66  ARG A HG2  5  
ATOM 9863  H HG3  . ARG A 1 66  ? 24.087  6.207   -5.145  1.00 0.00 ? 66  ARG A HG3  5  
ATOM 9864  H HD2  . ARG A 1 66  ? 24.037  6.008   -8.154  1.00 0.00 ? 66  ARG A HD2  5  
ATOM 9865  H HD3  . ARG A 1 66  ? 25.219  6.851   -7.152  1.00 0.00 ? 66  ARG A HD3  5  
ATOM 9866  H HE   . ARG A 1 66  ? 25.949  4.645   -6.352  1.00 0.00 ? 66  ARG A HE   5  
ATOM 9867  H HH11 . ARG A 1 66  ? 24.073  4.780   -9.303  1.00 0.00 ? 66  ARG A HH11 5  
ATOM 9868  H HH12 . ARG A 1 66  ? 24.720  3.296   -9.926  1.00 0.00 ? 66  ARG A HH12 5  
ATOM 9869  H HH21 . ARG A 1 66  ? 26.784  2.678   -7.169  1.00 0.00 ? 66  ARG A HH21 5  
ATOM 9870  H HH22 . ARG A 1 66  ? 26.238  2.095   -8.711  1.00 0.00 ? 66  ARG A HH22 5  
ATOM 9871  N N    . ASN A 1 67  ? 19.711  5.306   -6.539  1.00 0.00 ? 67  ASN A N    5  
ATOM 9872  C CA   . ASN A 1 67  ? 18.686  6.109   -7.200  1.00 0.00 ? 67  ASN A CA   5  
ATOM 9873  C C    . ASN A 1 67  ? 17.641  6.569   -6.186  1.00 0.00 ? 67  ASN A C    5  
ATOM 9874  O O    . ASN A 1 67  ? 17.315  7.756   -6.104  1.00 0.00 ? 67  ASN A O    5  
ATOM 9875  C CB   . ASN A 1 67  ? 18.020  5.307   -8.326  1.00 0.00 ? 67  ASN A CB   5  
ATOM 9876  C CG   . ASN A 1 67  ? 17.021  6.134   -9.120  1.00 0.00 ? 67  ASN A CG   5  
ATOM 9877  O OD1  . ASN A 1 67  ? 17.384  6.804   -10.088 1.00 0.00 ? 67  ASN A OD1  5  
ATOM 9878  N ND2  . ASN A 1 67  ? 15.757  6.086   -8.728  1.00 0.00 ? 67  ASN A ND2  5  
ATOM 9879  H H    . ASN A 1 67  ? 19.812  4.361   -6.791  1.00 0.00 ? 67  ASN A H    5  
ATOM 9880  H HA   . ASN A 1 67  ? 19.169  6.980   -7.624  1.00 0.00 ? 67  ASN A HA   5  
ATOM 9881  H HB2  . ASN A 1 67  ? 18.782  4.950   -9.004  1.00 0.00 ? 67  ASN A HB2  5  
ATOM 9882  H HB3  . ASN A 1 67  ? 17.503  4.458   -7.899  1.00 0.00 ? 67  ASN A HB3  5  
ATOM 9883  H HD21 . ASN A 1 67  ? 15.531  5.526   -7.952  1.00 0.00 ? 67  ASN A HD21 5  
ATOM 9884  H HD22 . ASN A 1 67  ? 15.094  6.610   -9.228  1.00 0.00 ? 67  ASN A HD22 5  
ATOM 9885  N N    . ILE A 1 68  ? 17.133  5.616   -5.408  1.00 0.00 ? 68  ILE A N    5  
ATOM 9886  C CA   . ILE A 1 68  ? 16.172  5.906   -4.346  1.00 0.00 ? 68  ILE A CA   5  
ATOM 9887  C C    . ILE A 1 68  ? 16.801  6.855   -3.325  1.00 0.00 ? 68  ILE A C    5  
ATOM 9888  O O    . ILE A 1 68  ? 16.164  7.798   -2.845  1.00 0.00 ? 68  ILE A O    5  
ATOM 9889  C CB   . ILE A 1 68  ? 15.722  4.605   -3.628  1.00 0.00 ? 68  ILE A CB   5  
ATOM 9890  C CG1  . ILE A 1 68  ? 15.209  3.570   -4.647  1.00 0.00 ? 68  ILE A CG1  5  
ATOM 9891  C CG2  . ILE A 1 68  ? 14.646  4.907   -2.583  1.00 0.00 ? 68  ILE A CG2  5  
ATOM 9892  C CD1  . ILE A 1 68  ? 14.880  2.222   -4.035  1.00 0.00 ? 68  ILE A CD1  5  
ATOM 9893  H H    . ILE A 1 68  ? 17.414  4.686   -5.554  1.00 0.00 ? 68  ILE A H    5  
ATOM 9894  H HA   . ILE A 1 68  ? 15.305  6.379   -4.790  1.00 0.00 ? 68  ILE A HA   5  
ATOM 9895  H HB   . ILE A 1 68  ? 16.580  4.193   -3.113  1.00 0.00 ? 68  ILE A HB   5  
ATOM 9896  H HG12 . ILE A 1 68  ? 14.310  3.947   -5.116  1.00 0.00 ? 68  ILE A HG12 5  
ATOM 9897  H HG13 . ILE A 1 68  ? 15.964  3.415   -5.404  1.00 0.00 ? 68  ILE A HG13 5  
ATOM 9898  H HG21 . ILE A 1 68  ? 15.035  5.599   -1.850  1.00 0.00 ? 68  ILE A HG21 5  
ATOM 9899  H HG22 . ILE A 1 68  ? 14.355  3.991   -2.088  1.00 0.00 ? 68  ILE A HG22 5  
ATOM 9900  H HG23 . ILE A 1 68  ? 13.782  5.342   -3.066  1.00 0.00 ? 68  ILE A HG23 5  
ATOM 9901  H HD11 . ILE A 1 68  ? 14.096  2.340   -3.300  1.00 0.00 ? 68  ILE A HD11 5  
ATOM 9902  H HD12 . ILE A 1 68  ? 15.762  1.817   -3.559  1.00 0.00 ? 68  ILE A HD12 5  
ATOM 9903  H HD13 . ILE A 1 68  ? 14.548  1.548   -4.810  1.00 0.00 ? 68  ILE A HD13 5  
ATOM 9904  N N    . TYR A 1 69  ? 18.070  6.594   -3.020  1.00 0.00 ? 69  TYR A N    5  
ATOM 9905  C CA   . TYR A 1 69  ? 18.842  7.396   -2.078  1.00 0.00 ? 69  TYR A CA   5  
ATOM 9906  C C    . TYR A 1 69  ? 18.850  8.867   -2.490  1.00 0.00 ? 69  TYR A C    5  
ATOM 9907  O O    . TYR A 1 69  ? 18.378  9.734   -1.757  1.00 0.00 ? 69  TYR A O    5  
ATOM 9908  C CB   . TYR A 1 69  ? 20.283  6.856   -2.002  1.00 0.00 ? 69  TYR A CB   5  
ATOM 9909  C CG   . TYR A 1 69  ? 21.238  7.692   -1.169  1.00 0.00 ? 69  TYR A CG   5  
ATOM 9910  C CD1  . TYR A 1 69  ? 21.266  7.587   0.218   1.00 0.00 ? 69  TYR A CD1  5  
ATOM 9911  C CD2  . TYR A 1 69  ? 22.122  8.580   -1.774  1.00 0.00 ? 69  TYR A CD2  5  
ATOM 9912  C CE1  . TYR A 1 69  ? 22.142  8.342   0.975   1.00 0.00 ? 69  TYR A CE1  5  
ATOM 9913  C CE2  . TYR A 1 69  ? 22.999  9.337   -1.025  1.00 0.00 ? 69  TYR A CE2  5  
ATOM 9914  C CZ   . TYR A 1 69  ? 23.007  9.215   0.349   1.00 0.00 ? 69  TYR A CZ   5  
ATOM 9915  O OH   . TYR A 1 69  ? 23.882  9.972   1.100   1.00 0.00 ? 69  TYR A OH   5  
ATOM 9916  H H    . TYR A 1 69  ? 18.505  5.827   -3.449  1.00 0.00 ? 69  TYR A H    5  
ATOM 9917  H HA   . TYR A 1 69  ? 18.382  7.304   -1.107  1.00 0.00 ? 69  TYR A HA   5  
ATOM 9918  H HB2  . TYR A 1 69  ? 20.261  5.862   -1.578  1.00 0.00 ? 69  TYR A HB2  5  
ATOM 9919  H HB3  . TYR A 1 69  ? 20.684  6.794   -3.005  1.00 0.00 ? 69  TYR A HB3  5  
ATOM 9920  H HD1  . TYR A 1 69  ? 20.587  6.901   0.704   1.00 0.00 ? 69  TYR A HD1  5  
ATOM 9921  H HD2  . TYR A 1 69  ? 22.115  8.676   -2.851  1.00 0.00 ? 69  TYR A HD2  5  
ATOM 9922  H HE1  . TYR A 1 69  ? 22.149  8.244   2.052   1.00 0.00 ? 69  TYR A HE1  5  
ATOM 9923  H HE2  . TYR A 1 69  ? 23.675  10.021  -1.518  1.00 0.00 ? 69  TYR A HE2  5  
ATOM 9924  H HH   . TYR A 1 69  ? 24.293  9.413   1.780   1.00 0.00 ? 69  TYR A HH   5  
ATOM 9925  N N    . GLN A 1 70  ? 19.360  9.130   -3.685  1.00 0.00 ? 70  GLN A N    5  
ATOM 9926  C CA   . GLN A 1 70  ? 19.562  10.494  -4.167  1.00 0.00 ? 70  GLN A CA   5  
ATOM 9927  C C    . GLN A 1 70  ? 18.243  11.259  -4.311  1.00 0.00 ? 70  GLN A C    5  
ATOM 9928  O O    . GLN A 1 70  ? 18.214  12.482  -4.163  1.00 0.00 ? 70  GLN A O    5  
ATOM 9929  C CB   . GLN A 1 70  ? 20.304  10.471  -5.512  1.00 0.00 ? 70  GLN A CB   5  
ATOM 9930  C CG   . GLN A 1 70  ? 21.736  9.951   -5.419  1.00 0.00 ? 70  GLN A CG   5  
ATOM 9931  C CD   . GLN A 1 70  ? 22.395  9.805   -6.780  1.00 0.00 ? 70  GLN A CD   5  
ATOM 9932  O OE1  . GLN A 1 70  ? 22.320  8.751   -7.414  1.00 0.00 ? 70  GLN A OE1  5  
ATOM 9933  N NE2  . GLN A 1 70  ? 23.048  10.858  -7.242  1.00 0.00 ? 70  GLN A NE2  5  
ATOM 9934  H H    . GLN A 1 70  ? 19.605  8.380   -4.269  1.00 0.00 ? 70  GLN A H    5  
ATOM 9935  H HA   . GLN A 1 70  ? 20.177  11.008  -3.441  1.00 0.00 ? 70  GLN A HA   5  
ATOM 9936  H HB2  . GLN A 1 70  ? 19.759  9.839   -6.198  1.00 0.00 ? 70  GLN A HB2  5  
ATOM 9937  H HB3  . GLN A 1 70  ? 20.335  11.476  -5.912  1.00 0.00 ? 70  GLN A HB3  5  
ATOM 9938  H HG2  . GLN A 1 70  ? 22.320  10.645  -4.828  1.00 0.00 ? 70  GLN A HG2  5  
ATOM 9939  H HG3  . GLN A 1 70  ? 21.728  8.987   -4.931  1.00 0.00 ? 70  GLN A HG3  5  
ATOM 9940  H HE21 . GLN A 1 70  ? 23.071  11.668  -6.689  1.00 0.00 ? 70  GLN A HE21 5  
ATOM 9941  H HE22 . GLN A 1 70  ? 23.482  10.790  -8.122  1.00 0.00 ? 70  GLN A HE22 5  
ATOM 9942  N N    . GLU A 1 71  ? 17.154  10.547  -4.581  1.00 0.00 ? 71  GLU A N    5  
ATOM 9943  C CA   . GLU A 1 71  ? 15.893  11.202  -4.923  1.00 0.00 ? 71  GLU A CA   5  
ATOM 9944  C C    . GLU A 1 71  ? 14.990  11.419  -3.706  1.00 0.00 ? 71  GLU A C    5  
ATOM 9945  O O    . GLU A 1 71  ? 14.323  12.454  -3.608  1.00 0.00 ? 71  GLU A O    5  
ATOM 9946  C CB   . GLU A 1 71  ? 15.164  10.398  -6.011  1.00 0.00 ? 71  GLU A CB   5  
ATOM 9947  C CG   . GLU A 1 71  ? 13.956  11.113  -6.613  1.00 0.00 ? 71  GLU A CG   5  
ATOM 9948  C CD   . GLU A 1 71  ? 13.495  10.487  -7.922  1.00 0.00 ? 71  GLU A CD   5  
ATOM 9949  O OE1  . GLU A 1 71  ? 14.186  10.675  -8.948  1.00 0.00 ? 71  GLU A OE1  5  
ATOM 9950  O OE2  . GLU A 1 71  ? 12.443  9.812   -7.941  1.00 0.00 ? 71  GLU A OE2  5  
ATOM 9951  H H    . GLU A 1 71  ? 17.201  9.567   -4.562  1.00 0.00 ? 71  GLU A H    5  
ATOM 9952  H HA   . GLU A 1 71  ? 16.141  12.173  -5.326  1.00 0.00 ? 71  GLU A HA   5  
ATOM 9953  H HB2  . GLU A 1 71  ? 15.862  10.185  -6.808  1.00 0.00 ? 71  GLU A HB2  5  
ATOM 9954  H HB3  . GLU A 1 71  ? 14.827  9.463   -5.586  1.00 0.00 ? 71  GLU A HB3  5  
ATOM 9955  H HG2  . GLU A 1 71  ? 13.141  11.076  -5.904  1.00 0.00 ? 71  GLU A HG2  5  
ATOM 9956  H HG3  . GLU A 1 71  ? 14.218  12.146  -6.799  1.00 0.00 ? 71  GLU A HG3  5  
ATOM 9957  N N    . PHE A 1 72  ? 14.971  10.467  -2.773  1.00 0.00 ? 72  PHE A N    5  
ATOM 9958  C CA   . PHE A 1 72  ? 14.044  10.536  -1.635  1.00 0.00 ? 72  PHE A CA   5  
ATOM 9959  C C    . PHE A 1 72  ? 14.771  10.625  -0.296  1.00 0.00 ? 72  PHE A C    5  
ATOM 9960  O O    . PHE A 1 72  ? 14.225  11.143  0.683   1.00 0.00 ? 72  PHE A O    5  
ATOM 9961  C CB   . PHE A 1 72  ? 13.141  9.294   -1.611  1.00 0.00 ? 72  PHE A CB   5  
ATOM 9962  C CG   . PHE A 1 72  ? 12.417  9.032   -2.903  1.00 0.00 ? 72  PHE A CG   5  
ATOM 9963  C CD1  . PHE A 1 72  ? 11.320  9.798   -3.269  1.00 0.00 ? 72  PHE A CD1  5  
ATOM 9964  C CD2  . PHE A 1 72  ? 12.829  8.010   -3.748  1.00 0.00 ? 72  PHE A CD2  5  
ATOM 9965  C CE1  . PHE A 1 72  ? 10.652  9.550   -4.451  1.00 0.00 ? 72  PHE A CE1  5  
ATOM 9966  C CE2  . PHE A 1 72  ? 12.164  7.761   -4.930  1.00 0.00 ? 72  PHE A CE2  5  
ATOM 9967  C CZ   . PHE A 1 72  ? 11.074  8.530   -5.281  1.00 0.00 ? 72  PHE A CZ   5  
ATOM 9968  H H    . PHE A 1 72  ? 15.579  9.700   -2.855  1.00 0.00 ? 72  PHE A H    5  
ATOM 9969  H HA   . PHE A 1 72  ? 13.424  11.414  -1.755  1.00 0.00 ? 72  PHE A HA   5  
ATOM 9970  H HB2  . PHE A 1 72  ? 13.745  8.426   -1.386  1.00 0.00 ? 72  PHE A HB2  5  
ATOM 9971  H HB3  . PHE A 1 72  ? 12.400  9.414   -0.832  1.00 0.00 ? 72  PHE A HB3  5  
ATOM 9972  H HD1  . PHE A 1 72  ? 10.989  10.597  -2.620  1.00 0.00 ? 72  PHE A HD1  5  
ATOM 9973  H HD2  . PHE A 1 72  ? 13.684  7.405   -3.473  1.00 0.00 ? 72  PHE A HD2  5  
ATOM 9974  H HE1  . PHE A 1 72  ? 9.798   10.152  -4.725  1.00 0.00 ? 72  PHE A HE1  5  
ATOM 9975  H HE2  . PHE A 1 72  ? 12.495  6.963   -5.579  1.00 0.00 ? 72  PHE A HE2  5  
ATOM 9976  H HZ   . PHE A 1 72  ? 10.551  8.335   -6.205  1.00 0.00 ? 72  PHE A HZ   5  
ATOM 9977  N N    . LEU A 1 73  ? 15.994  10.115  -0.246  1.00 0.00 ? 73  LEU A N    5  
ATOM 9978  C CA   . LEU A 1 73  ? 16.651  9.835   1.029   1.00 0.00 ? 73  LEU A CA   5  
ATOM 9979  C C    . LEU A 1 73  ? 17.862  10.732  1.295   1.00 0.00 ? 73  LEU A C    5  
ATOM 9980  O O    . LEU A 1 73  ? 18.307  10.836  2.443   1.00 0.00 ? 73  LEU A O    5  
ATOM 9981  C CB   . LEU A 1 73  ? 17.059  8.360   1.050   1.00 0.00 ? 73  LEU A CB   5  
ATOM 9982  C CG   . LEU A 1 73  ? 15.887  7.377   0.854   1.00 0.00 ? 73  LEU A CG   5  
ATOM 9983  C CD1  . LEU A 1 73  ? 16.379  5.979   0.479   1.00 0.00 ? 73  LEU A CD1  5  
ATOM 9984  C CD2  . LEU A 1 73  ? 15.026  7.326   2.114   1.00 0.00 ? 73  LEU A CD2  5  
ATOM 9985  H H    . LEU A 1 73  ? 16.467  9.919   -1.082  1.00 0.00 ? 73  LEU A H    5  
ATOM 9986  H HA   . LEU A 1 73  ? 15.929  9.999   1.816   1.00 0.00 ? 73  LEU A HA   5  
ATOM 9987  H HB2  . LEU A 1 73  ? 17.784  8.196   0.267   1.00 0.00 ? 73  LEU A HB2  5  
ATOM 9988  H HB3  . LEU A 1 73  ? 17.526  8.146   2.001   1.00 0.00 ? 73  LEU A HB3  5  
ATOM 9989  H HG   . LEU A 1 73  ? 15.264  7.731   0.044   1.00 0.00 ? 73  LEU A HG   5  
ATOM 9990  H HD11 . LEU A 1 73  ? 15.531  5.328   0.324   1.00 0.00 ? 73  LEU A HD11 5  
ATOM 9991  H HD12 . LEU A 1 73  ? 16.993  5.584   1.273   1.00 0.00 ? 73  LEU A HD12 5  
ATOM 9992  H HD13 . LEU A 1 73  ? 16.960  6.033   -0.431  1.00 0.00 ? 73  LEU A HD13 5  
ATOM 9993  H HD21 . LEU A 1 73  ? 14.215  6.626   1.970   1.00 0.00 ? 73  LEU A HD21 5  
ATOM 9994  H HD22 . LEU A 1 73  ? 14.620  8.307   2.312   1.00 0.00 ? 73  LEU A HD22 5  
ATOM 9995  H HD23 . LEU A 1 73  ? 15.630  7.010   2.954   1.00 0.00 ? 73  LEU A HD23 5  
ATOM 9996  N N    . SER A 1 74  ? 18.388  11.386  0.261   1.00 0.00 ? 74  SER A N    5  
ATOM 9997  C CA   . SER A 1 74  ? 19.580  12.218  0.419   1.00 0.00 ? 74  SER A CA   5  
ATOM 9998  C C    . SER A 1 74  ? 19.278  13.431  1.307   1.00 0.00 ? 74  SER A C    5  
ATOM 9999  O O    . SER A 1 74  ? 18.113  13.777  1.518   1.00 0.00 ? 74  SER A O    5  
ATOM 10000 C CB   . SER A 1 74  ? 20.105  12.666  -0.950  1.00 0.00 ? 74  SER A CB   5  
ATOM 10001 O OG   . SER A 1 74  ? 19.121  13.392  -1.663  1.00 0.00 ? 74  SER A OG   5  
ATOM 10002 H H    . SER A 1 74  ? 17.964  11.317  -0.625  1.00 0.00 ? 74  SER A H    5  
ATOM 10003 H HA   . SER A 1 74  ? 20.339  11.617  0.904   1.00 0.00 ? 74  SER A HA   5  
ATOM 10004 H HB2  . SER A 1 74  ? 20.972  13.297  -0.816  1.00 0.00 ? 74  SER A HB2  5  
ATOM 10005 H HB3  . SER A 1 74  ? 20.381  11.796  -1.531  1.00 0.00 ? 74  SER A HB3  5  
ATOM 10006 H HG   . SER A 1 74  ? 19.098  13.089  -2.576  1.00 0.00 ? 74  SER A HG   5  
ATOM 10007 N N    . SER A 1 75  ? 20.330  14.065  1.825   1.00 0.00 ? 75  SER A N    5  
ATOM 10008 C CA   . SER A 1 75  ? 20.189  15.220  2.717   1.00 0.00 ? 75  SER A CA   5  
ATOM 10009 C C    . SER A 1 75  ? 19.280  16.296  2.116   1.00 0.00 ? 75  SER A C    5  
ATOM 10010 O O    . SER A 1 75  ? 18.585  17.008  2.841   1.00 0.00 ? 75  SER A O    5  
ATOM 10011 C CB   . SER A 1 75  ? 21.568  15.809  3.027   1.00 0.00 ? 75  SER A CB   5  
ATOM 10012 O OG   . SER A 1 75  ? 22.412  14.838  3.626   1.00 0.00 ? 75  SER A OG   5  
ATOM 10013 H H    . SER A 1 75  ? 21.234  13.741  1.612   1.00 0.00 ? 75  SER A H    5  
ATOM 10014 H HA   . SER A 1 75  ? 19.747  14.869  3.639   1.00 0.00 ? 75  SER A HA   5  
ATOM 10015 H HB2  . SER A 1 75  ? 22.029  16.149  2.111   1.00 0.00 ? 75  SER A HB2  5  
ATOM 10016 H HB3  . SER A 1 75  ? 21.460  16.643  3.705   1.00 0.00 ? 75  SER A HB3  5  
ATOM 10017 H HG   . SER A 1 75  ? 21.871  14.125  3.985   1.00 0.00 ? 75  SER A HG   5  
ATOM 10018 N N    . GLN A 1 76  ? 19.289  16.408  0.790   1.00 0.00 ? 76  GLN A N    5  
ATOM 10019 C CA   . GLN A 1 76  ? 18.435  17.366  0.094   1.00 0.00 ? 76  GLN A CA   5  
ATOM 10020 C C    . GLN A 1 76  ? 17.281  16.639  -0.590  1.00 0.00 ? 76  GLN A C    5  
ATOM 10021 O O    . GLN A 1 76  ? 16.121  16.800  -0.203  1.00 0.00 ? 76  GLN A O    5  
ATOM 10022 C CB   . GLN A 1 76  ? 19.249  18.170  -0.933  1.00 0.00 ? 76  GLN A CB   5  
ATOM 10023 C CG   . GLN A 1 76  ? 20.404  18.958  -0.319  1.00 0.00 ? 76  GLN A CG   5  
ATOM 10024 C CD   . GLN A 1 76  ? 21.119  19.863  -1.314  1.00 0.00 ? 76  GLN A CD   5  
ATOM 10025 O OE1  . GLN A 1 76  ? 21.640  20.918  -0.942  1.00 0.00 ? 76  GLN A OE1  5  
ATOM 10026 N NE2  . GLN A 1 76  ? 21.157  19.465  -2.579  1.00 0.00 ? 76  GLN A NE2  5  
ATOM 10027 H H    . GLN A 1 76  ? 19.873  15.824  0.268   1.00 0.00 ? 76  GLN A H    5  
ATOM 10028 H HA   . GLN A 1 76  ? 18.028  18.046  0.828   1.00 0.00 ? 76  GLN A HA   5  
ATOM 10029 H HB2  . GLN A 1 76  ? 19.656  17.489  -1.667  1.00 0.00 ? 76  GLN A HB2  5  
ATOM 10030 H HB3  . GLN A 1 76  ? 18.590  18.869  -1.431  1.00 0.00 ? 76  GLN A HB3  5  
ATOM 10031 H HG2  . GLN A 1 76  ? 20.018  19.572  0.482   1.00 0.00 ? 76  GLN A HG2  5  
ATOM 10032 H HG3  . GLN A 1 76  ? 21.123  18.259  0.086   1.00 0.00 ? 76  GLN A HG3  5  
ATOM 10033 H HE21 . GLN A 1 76  ? 20.731  18.612  -2.817  1.00 0.00 ? 76  GLN A HE21 5  
ATOM 10034 H HE22 . GLN A 1 76  ? 21.613  20.039  -3.233  1.00 0.00 ? 76  GLN A HE22 5  
ATOM 10035 N N    . ALA A 1 77  ? 17.620  15.822  -1.591  1.00 0.00 ? 77  ALA A N    5  
ATOM 10036 C CA   . ALA A 1 77  ? 16.635  15.050  -2.347  1.00 0.00 ? 77  ALA A CA   5  
ATOM 10037 C C    . ALA A 1 77  ? 15.674  15.960  -3.114  1.00 0.00 ? 77  ALA A C    5  
ATOM 10038 O O    . ALA A 1 77  ? 15.729  17.186  -2.993  1.00 0.00 ? 77  ALA A O    5  
ATOM 10039 C CB   . ALA A 1 77  ? 15.869  14.108  -1.418  1.00 0.00 ? 77  ALA A CB   5  
ATOM 10040 H H    . ALA A 1 77  ? 18.564  15.734  -1.829  1.00 0.00 ? 77  ALA A H    5  
ATOM 10041 H HA   . ALA A 1 77  ? 17.177  14.442  -3.061  1.00 0.00 ? 77  ALA A HA   5  
ATOM 10042 H HB1  . ALA A 1 77  ? 15.188  13.503  -1.997  1.00 0.00 ? 77  ALA A HB1  5  
ATOM 10043 H HB2  . ALA A 1 77  ? 15.311  14.688  -0.696  1.00 0.00 ? 77  ALA A HB2  5  
ATOM 10044 H HB3  . ALA A 1 77  ? 16.569  13.466  -0.900  1.00 0.00 ? 77  ALA A HB3  5  
ATOM 10045 N N    . LEU A 1 78  ? 14.814  15.355  -3.928  1.00 0.00 ? 78  LEU A N    5  
ATOM 10046 C CA   . LEU A 1 78  ? 13.779  16.098  -4.640  1.00 0.00 ? 78  LEU A CA   5  
ATOM 10047 C C    . LEU A 1 78  ? 12.573  16.270  -3.728  1.00 0.00 ? 78  LEU A C    5  
ATOM 10048 O O    . LEU A 1 78  ? 11.906  17.307  -3.732  1.00 0.00 ? 78  LEU A O    5  
ATOM 10049 C CB   . LEU A 1 78  ? 13.375  15.380  -5.940  1.00 0.00 ? 78  LEU A CB   5  
ATOM 10050 C CG   . LEU A 1 78  ? 14.422  15.407  -7.074  1.00 0.00 ? 78  LEU A CG   5  
ATOM 10051 C CD1  . LEU A 1 78  ? 15.682  14.625  -6.697  1.00 0.00 ? 78  LEU A CD1  5  
ATOM 10052 C CD2  . LEU A 1 78  ? 13.818  14.868  -8.370  1.00 0.00 ? 78  LEU A CD2  5  
ATOM 10053 H H    . LEU A 1 78  ? 14.873  14.383  -4.047  1.00 0.00 ? 78  LEU A H    5  
ATOM 10054 H HA   . LEU A 1 78  ? 14.176  17.076  -4.883  1.00 0.00 ? 78  LEU A HA   5  
ATOM 10055 H HB2  . LEU A 1 78  ? 13.161  14.346  -5.703  1.00 0.00 ? 78  LEU A HB2  5  
ATOM 10056 H HB3  . LEU A 1 78  ? 12.468  15.838  -6.310  1.00 0.00 ? 78  LEU A HB3  5  
ATOM 10057 H HG   . LEU A 1 78  ? 14.716  16.432  -7.251  1.00 0.00 ? 78  LEU A HG   5  
ATOM 10058 H HD11 . LEU A 1 78  ? 15.419  13.598  -6.482  1.00 0.00 ? 78  LEU A HD11 5  
ATOM 10059 H HD12 . LEU A 1 78  ? 16.136  15.070  -5.824  1.00 0.00 ? 78  LEU A HD12 5  
ATOM 10060 H HD13 . LEU A 1 78  ? 16.384  14.652  -7.518  1.00 0.00 ? 78  LEU A HD13 5  
ATOM 10061 H HD21 . LEU A 1 78  ? 14.562  14.895  -9.154  1.00 0.00 ? 78  LEU A HD21 5  
ATOM 10062 H HD22 . LEU A 1 78  ? 12.975  15.479  -8.657  1.00 0.00 ? 78  LEU A HD22 5  
ATOM 10063 H HD23 . LEU A 1 78  ? 13.490  13.849  -8.221  1.00 0.00 ? 78  LEU A HD23 5  
ATOM 10064 N N    . SER A 1 79  ? 12.308  15.234  -2.941  1.00 0.00 ? 79  SER A N    5  
ATOM 10065 C CA   . SER A 1 79  ? 11.262  15.260  -1.930  1.00 0.00 ? 79  SER A CA   5  
ATOM 10066 C C    . SER A 1 79  ? 11.635  14.297  -0.799  1.00 0.00 ? 79  SER A C    5  
ATOM 10067 O O    . SER A 1 79  ? 11.344  13.100  -0.868  1.00 0.00 ? 79  SER A O    5  
ATOM 10068 C CB   . SER A 1 79  ? 9.905   14.883  -2.545  1.00 0.00 ? 79  SER A CB   5  
ATOM 10069 O OG   . SER A 1 79  ? 9.601   15.706  -3.662  1.00 0.00 ? 79  SER A OG   5  
ATOM 10070 H H    . SER A 1 79  ? 12.840  14.416  -3.043  1.00 0.00 ? 79  SER A H    5  
ATOM 10071 H HA   . SER A 1 79  ? 11.205  16.264  -1.532  1.00 0.00 ? 79  SER A HA   5  
ATOM 10072 H HB2  . SER A 1 79  ? 9.929   13.853  -2.870  1.00 0.00 ? 79  SER A HB2  5  
ATOM 10073 H HB3  . SER A 1 79  ? 9.129   15.009  -1.804  1.00 0.00 ? 79  SER A HB3  5  
ATOM 10074 H HG   . SER A 1 79  ? 10.169  16.485  -3.649  1.00 0.00 ? 79  SER A HG   5  
ATOM 10075 N N    . PRO A 1 80  ? 12.338  14.802  0.236   1.00 0.00 ? 80  PRO A N    5  
ATOM 10076 C CA   . PRO A 1 80  ? 12.802  13.977  1.359   1.00 0.00 ? 80  PRO A CA   5  
ATOM 10077 C C    . PRO A 1 80  ? 11.644  13.338  2.132   1.00 0.00 ? 80  PRO A C    5  
ATOM 10078 O O    . PRO A 1 80  ? 10.761  14.034  2.635   1.00 0.00 ? 80  PRO A O    5  
ATOM 10079 C CB   . PRO A 1 80  ? 13.581  14.965  2.246   1.00 0.00 ? 80  PRO A CB   5  
ATOM 10080 C CG   . PRO A 1 80  ? 13.083  16.316  1.849   1.00 0.00 ? 80  PRO A CG   5  
ATOM 10081 C CD   . PRO A 1 80  ? 12.740  16.214  0.389   1.00 0.00 ? 80  PRO A CD   5  
ATOM 10082 H HA   . PRO A 1 80  ? 13.470  13.197  1.016   1.00 0.00 ? 80  PRO A HA   5  
ATOM 10083 H HB2  . PRO A 1 80  ? 13.382  14.759  3.289   1.00 0.00 ? 80  PRO A HB2  5  
ATOM 10084 H HB3  . PRO A 1 80  ? 14.641  14.866  2.053   1.00 0.00 ? 80  PRO A HB3  5  
ATOM 10085 H HG2  . PRO A 1 80  ? 12.203  16.567  2.426   1.00 0.00 ? 80  PRO A HG2  5  
ATOM 10086 H HG3  . PRO A 1 80  ? 13.855  17.055  2.003   1.00 0.00 ? 80  PRO A HG3  5  
ATOM 10087 H HD2  . PRO A 1 80  ? 11.922  16.879  0.144   1.00 0.00 ? 80  PRO A HD2  5  
ATOM 10088 H HD3  . PRO A 1 80  ? 13.603  16.436  -0.221  1.00 0.00 ? 80  PRO A HD3  5  
ATOM 10089 N N    . VAL A 1 81  ? 11.661  12.009  2.218   1.00 0.00 ? 81  VAL A N    5  
ATOM 10090 C CA   . VAL A 1 81  ? 10.619  11.256  2.921   1.00 0.00 ? 81  VAL A CA   5  
ATOM 10091 C C    . VAL A 1 81  ? 10.815  11.285  4.443   1.00 0.00 ? 81  VAL A C    5  
ATOM 10092 O O    . VAL A 1 81  ? 10.014  10.724  5.193   1.00 0.00 ? 81  VAL A O    5  
ATOM 10093 C CB   . VAL A 1 81  ? 10.565  9.789   2.439   1.00 0.00 ? 81  VAL A CB   5  
ATOM 10094 C CG1  . VAL A 1 81  ? 10.037  9.705   1.007   1.00 0.00 ? 81  VAL A CG1  5  
ATOM 10095 C CG2  . VAL A 1 81  ? 11.938  9.126   2.548   1.00 0.00 ? 81  VAL A CG2  5  
ATOM 10096 H H    . VAL A 1 81  ? 12.391  11.519  1.781   1.00 0.00 ? 81  VAL A H    5  
ATOM 10097 H HA   . VAL A 1 81  ? 9.667   11.719  2.691   1.00 0.00 ? 81  VAL A HA   5  
ATOM 10098 H HB   . VAL A 1 81  ? 9.885   9.254   3.082   1.00 0.00 ? 81  VAL A HB   5  
ATOM 10099 H HG11 . VAL A 1 81  ? 9.041   10.123  0.965   1.00 0.00 ? 81  VAL A HG11 5  
ATOM 10100 H HG12 . VAL A 1 81  ? 10.004  8.671   0.694   1.00 0.00 ? 81  VAL A HG12 5  
ATOM 10101 H HG13 . VAL A 1 81  ? 10.688  10.260  0.346   1.00 0.00 ? 81  VAL A HG13 5  
ATOM 10102 H HG21 . VAL A 1 81  ? 11.876  8.108   2.189   1.00 0.00 ? 81  VAL A HG21 5  
ATOM 10103 H HG22 . VAL A 1 81  ? 12.262  9.125   3.579   1.00 0.00 ? 81  VAL A HG22 5  
ATOM 10104 H HG23 . VAL A 1 81  ? 12.653  9.673   1.947   1.00 0.00 ? 81  VAL A HG23 5  
ATOM 10105 N N    . ASN A 1 82  ? 11.901  11.922  4.871   1.00 0.00 ? 82  ASN A N    5  
ATOM 10106 C CA   . ASN A 1 82  ? 12.197  12.155  6.292   1.00 0.00 ? 82  ASN A CA   5  
ATOM 10107 C C    . ASN A 1 82  ? 12.605  10.863  7.007   1.00 0.00 ? 82  ASN A C    5  
ATOM 10108 O O    . ASN A 1 82  ? 13.791  10.653  7.265   1.00 0.00 ? 82  ASN A O    5  
ATOM 10109 C CB   . ASN A 1 82  ? 11.004  12.826  7.002   1.00 0.00 ? 82  ASN A CB   5  
ATOM 10110 C CG   . ASN A 1 82  ? 11.246  13.063  8.488   1.00 0.00 ? 82  ASN A CG   5  
ATOM 10111 O OD1  . ASN A 1 82  ? 10.887  12.238  9.330   1.00 0.00 ? 82  ASN A OD1  5  
ATOM 10112 N ND2  . ASN A 1 82  ? 11.858  14.189  8.819   1.00 0.00 ? 82  ASN A ND2  5  
ATOM 10113 H H    . ASN A 1 82  ? 12.534  12.241  4.205   1.00 0.00 ? 82  ASN A H    5  
ATOM 10114 H HA   . ASN A 1 82  ? 13.037  12.835  6.329   1.00 0.00 ? 82  ASN A HA   5  
ATOM 10115 H HB2  . ASN A 1 82  ? 10.808  13.780  6.536   1.00 0.00 ? 82  ASN A HB2  5  
ATOM 10116 H HB3  . ASN A 1 82  ? 10.131  12.196  6.895   1.00 0.00 ? 82  ASN A HB3  5  
ATOM 10117 H HD21 . ASN A 1 82  ? 12.118  14.803  8.100   1.00 0.00 ? 82  ASN A HD21 5  
ATOM 10118 H HD22 . ASN A 1 82  ? 12.027  14.364  9.771   1.00 0.00 ? 82  ASN A HD22 5  
ATOM 10119 N N    . ILE A 1 83  ? 11.619  10.005  7.298   1.00 0.00 ? 83  ILE A N    5  
ATOM 10120 C CA   . ILE A 1 83  ? 11.818  8.740   8.036   1.00 0.00 ? 83  ILE A CA   5  
ATOM 10121 C C    . ILE A 1 83  ? 12.845  8.878   9.180   1.00 0.00 ? 83  ILE A C    5  
ATOM 10122 O O    . ILE A 1 83  ? 13.024  9.961   9.739   1.00 0.00 ? 83  ILE A O    5  
ATOM 10123 C CB   . ILE A 1 83  ? 12.197  7.553   7.093   1.00 0.00 ? 83  ILE A CB   5  
ATOM 10124 C CG1  . ILE A 1 83  ? 13.546  7.785   6.392   1.00 0.00 ? 83  ILE A CG1  5  
ATOM 10125 C CG2  . ILE A 1 83  ? 11.095  7.320   6.064   1.00 0.00 ? 83  ILE A CG2  5  
ATOM 10126 C CD1  . ILE A 1 83  ? 13.986  6.635   5.506   1.00 0.00 ? 83  ILE A CD1  5  
ATOM 10127 H H    . ILE A 1 83  ? 10.712  10.230  7.004   1.00 0.00 ? 83  ILE A H    5  
ATOM 10128 H HA   . ILE A 1 83  ? 10.865  8.499   8.488   1.00 0.00 ? 83  ILE A HA   5  
ATOM 10129 H HB   . ILE A 1 83  ? 12.269  6.659   7.699   1.00 0.00 ? 83  ILE A HB   5  
ATOM 10130 H HG12 . ILE A 1 83  ? 13.476  8.668   5.774   1.00 0.00 ? 83  ILE A HG12 5  
ATOM 10131 H HG13 . ILE A 1 83  ? 14.312  7.938   7.140   1.00 0.00 ? 83  ILE A HG13 5  
ATOM 10132 H HG21 . ILE A 1 83  ? 10.165  7.112   6.574   1.00 0.00 ? 83  ILE A HG21 5  
ATOM 10133 H HG22 . ILE A 1 83  ? 11.355  6.479   5.438   1.00 0.00 ? 83  ILE A HG22 5  
ATOM 10134 H HG23 . ILE A 1 83  ? 10.979  8.203   5.450   1.00 0.00 ? 83  ILE A HG23 5  
ATOM 10135 H HD11 . ILE A 1 83  ? 13.252  6.473   4.728   1.00 0.00 ? 83  ILE A HD11 5  
ATOM 10136 H HD12 . ILE A 1 83  ? 14.082  5.738   6.100   1.00 0.00 ? 83  ILE A HD12 5  
ATOM 10137 H HD13 . ILE A 1 83  ? 14.938  6.871   5.057   1.00 0.00 ? 83  ILE A HD13 5  
ATOM 10138 N N    . ASP A 1 84  ? 13.504  7.774   9.535   1.00 0.00 ? 84  ASP A N    5  
ATOM 10139 C CA   . ASP A 1 84  ? 14.440  7.738   10.665  1.00 0.00 ? 84  ASP A CA   5  
ATOM 10140 C C    . ASP A 1 84  ? 15.858  8.134   10.239  1.00 0.00 ? 84  ASP A C    5  
ATOM 10141 O O    . ASP A 1 84  ? 16.843  7.638   10.795  1.00 0.00 ? 84  ASP A O    5  
ATOM 10142 C CB   . ASP A 1 84  ? 14.455  6.324   11.271  1.00 0.00 ? 84  ASP A CB   5  
ATOM 10143 C CG   . ASP A 1 84  ? 14.962  5.269   10.291  1.00 0.00 ? 84  ASP A CG   5  
ATOM 10144 O OD1  . ASP A 1 84  ? 14.386  5.152   9.189   1.00 0.00 ? 84  ASP A OD1  5  
ATOM 10145 O OD2  . ASP A 1 84  ? 15.931  4.550   10.622  1.00 0.00 ? 84  ASP A OD2  5  
ATOM 10146 H H    . ASP A 1 84  ? 13.361  6.948   9.023   1.00 0.00 ? 84  ASP A H    5  
ATOM 10147 H HA   . ASP A 1 84  ? 14.092  8.437   11.412  1.00 0.00 ? 84  ASP A HA   5  
ATOM 10148 H HB2  . ASP A 1 84  ? 15.094  6.319   12.144  1.00 0.00 ? 84  ASP A HB2  5  
ATOM 10149 H HB3  . ASP A 1 84  ? 13.449  6.057   11.570  1.00 0.00 ? 84  ASP A HB3  5  
ATOM 10150 N N    . ARG A 1 85  ? 15.970  9.069   9.293   1.00 0.00 ? 85  ARG A N    5  
ATOM 10151 C CA   . ARG A 1 85  ? 17.280  9.473   8.769   1.00 0.00 ? 85  ARG A CA   5  
ATOM 10152 C C    . ARG A 1 85  ? 18.153  10.131  9.841   1.00 0.00 ? 85  ARG A C    5  
ATOM 10153 O O    . ARG A 1 85  ? 19.340  10.378  9.612   1.00 0.00 ? 85  ARG A O    5  
ATOM 10154 C CB   . ARG A 1 85  ? 17.135  10.416  7.568   1.00 0.00 ? 85  ARG A CB   5  
ATOM 10155 C CG   . ARG A 1 85  ? 16.490  9.776   6.347   1.00 0.00 ? 85  ARG A CG   5  
ATOM 10156 C CD   . ARG A 1 85  ? 16.503  10.719  5.150   1.00 0.00 ? 85  ARG A CD   5  
ATOM 10157 N NE   . ARG A 1 85  ? 15.960  12.040  5.479   1.00 0.00 ? 85  ARG A NE   5  
ATOM 10158 C CZ   . ARG A 1 85  ? 16.172  13.136  4.748   1.00 0.00 ? 85  ARG A CZ   5  
ATOM 10159 N NH1  . ARG A 1 85  ? 16.902  13.064  3.639   1.00 0.00 ? 85  ARG A NH1  5  
ATOM 10160 N NH2  . ARG A 1 85  ? 15.660  14.302  5.132   1.00 0.00 ? 85  ARG A NH2  5  
ATOM 10161 H H    . ARG A 1 85  ? 15.160  9.497   8.945   1.00 0.00 ? 85  ARG A H    5  
ATOM 10162 H HA   . ARG A 1 85  ? 17.777  8.574   8.436   1.00 0.00 ? 85  ARG A HA   5  
ATOM 10163 H HB2  . ARG A 1 85  ? 16.532  11.263  7.864   1.00 0.00 ? 85  ARG A HB2  5  
ATOM 10164 H HB3  . ARG A 1 85  ? 18.118  10.770  7.285   1.00 0.00 ? 85  ARG A HB3  5  
ATOM 10165 H HG2  . ARG A 1 85  ? 17.032  8.877   6.091   1.00 0.00 ? 85  ARG A HG2  5  
ATOM 10166 H HG3  . ARG A 1 85  ? 15.466  9.523   6.584   1.00 0.00 ? 85  ARG A HG3  5  
ATOM 10167 H HD2  . ARG A 1 85  ? 17.523  10.834  4.809   1.00 0.00 ? 85  ARG A HD2  5  
ATOM 10168 H HD3  . ARG A 1 85  ? 15.910  10.284  4.358   1.00 0.00 ? 85  ARG A HD3  5  
ATOM 10169 H HE   . ARG A 1 85  ? 15.416  12.112  6.300   1.00 0.00 ? 85  ARG A HE   5  
ATOM 10170 H HH11 . ARG A 1 85  ? 17.296  12.187  3.351   1.00 0.00 ? 85  ARG A HH11 5  
ATOM 10171 H HH12 . ARG A 1 85  ? 17.065  13.881  3.080   1.00 0.00 ? 85  ARG A HH12 5  
ATOM 10172 H HH21 . ARG A 1 85  ? 15.112  14.361  5.972   1.00 0.00 ? 85  ARG A HH21 5  
ATOM 10173 H HH22 . ARG A 1 85  ? 15.826  15.130  4.592   1.00 0.00 ? 85  ARG A HH22 5  
ATOM 10174 N N    . GLN A 1 86  ? 17.569  10.418  11.005  1.00 0.00 ? 86  GLN A N    5  
ATOM 10175 C CA   . GLN A 1 86  ? 18.325  10.962  12.137  1.00 0.00 ? 86  GLN A CA   5  
ATOM 10176 C C    . GLN A 1 86  ? 19.426  9.989   12.564  1.00 0.00 ? 86  GLN A C    5  
ATOM 10177 O O    . GLN A 1 86  ? 20.416  10.379  13.188  1.00 0.00 ? 86  GLN A O    5  
ATOM 10178 C CB   . GLN A 1 86  ? 17.388  11.250  13.316  1.00 0.00 ? 86  GLN A CB   5  
ATOM 10179 C CG   . GLN A 1 86  ? 16.298  12.268  12.998  1.00 0.00 ? 86  GLN A CG   5  
ATOM 10180 C CD   . GLN A 1 86  ? 15.395  12.556  14.183  1.00 0.00 ? 86  GLN A CD   5  
ATOM 10181 O OE1  . GLN A 1 86  ? 15.170  11.698  15.035  1.00 0.00 ? 86  GLN A OE1  5  
ATOM 10182 N NE2  . GLN A 1 86  ? 14.873  13.769  14.242  1.00 0.00 ? 86  GLN A NE2  5  
ATOM 10183 H H    . GLN A 1 86  ? 16.607  10.266  11.103  1.00 0.00 ? 86  GLN A H    5  
ATOM 10184 H HA   . GLN A 1 86  ? 18.783  11.888  11.816  1.00 0.00 ? 86  GLN A HA   5  
ATOM 10185 H HB2  . GLN A 1 86  ? 16.914  10.327  13.617  1.00 0.00 ? 86  GLN A HB2  5  
ATOM 10186 H HB3  . GLN A 1 86  ? 17.975  11.629  14.143  1.00 0.00 ? 86  GLN A HB3  5  
ATOM 10187 H HG2  . GLN A 1 86  ? 16.766  13.192  12.688  1.00 0.00 ? 86  GLN A HG2  5  
ATOM 10188 H HG3  . GLN A 1 86  ? 15.692  11.887  12.188  1.00 0.00 ? 86  GLN A HG3  5  
ATOM 10189 H HE21 . GLN A 1 86  ? 15.093  14.404  13.527  1.00 0.00 ? 86  GLN A HE21 5  
ATOM 10190 H HE22 . GLN A 1 86  ? 14.291  13.985  15.001  1.00 0.00 ? 86  GLN A HE22 5  
ATOM 10191 N N    . ALA A 1 87  ? 19.234  8.720   12.217  1.00 0.00 ? 87  ALA A N    5  
ATOM 10192 C CA   . ALA A 1 87  ? 20.214  7.671   12.463  1.00 0.00 ? 87  ALA A CA   5  
ATOM 10193 C C    . ALA A 1 87  ? 20.158  6.670   11.316  1.00 0.00 ? 87  ALA A C    5  
ATOM 10194 O O    . ALA A 1 87  ? 19.797  5.501   11.500  1.00 0.00 ? 87  ALA A O    5  
ATOM 10195 C CB   . ALA A 1 87  ? 19.950  6.989   13.801  1.00 0.00 ? 87  ALA A CB   5  
ATOM 10196 H H    . ALA A 1 87  ? 18.394  8.478   11.769  1.00 0.00 ? 87  ALA A H    5  
ATOM 10197 H HA   . ALA A 1 87  ? 21.199  8.122   12.491  1.00 0.00 ? 87  ALA A HA   5  
ATOM 10198 H HB1  . ALA A 1 87  ? 20.689  6.218   13.967  1.00 0.00 ? 87  ALA A HB1  5  
ATOM 10199 H HB2  . ALA A 1 87  ? 18.965  6.545   13.793  1.00 0.00 ? 87  ALA A HB2  5  
ATOM 10200 H HB3  . ALA A 1 87  ? 20.008  7.719   14.597  1.00 0.00 ? 87  ALA A HB3  5  
ATOM 10201 N N    . TRP A 1 88  ? 20.484  7.152   10.122  1.00 0.00 ? 88  TRP A N    5  
ATOM 10202 C CA   . TRP A 1 88  ? 20.320  6.371   8.901   1.00 0.00 ? 88  TRP A CA   5  
ATOM 10203 C C    . TRP A 1 88  ? 21.585  5.571   8.574   1.00 0.00 ? 88  TRP A C    5  
ATOM 10204 O O    . TRP A 1 88  ? 22.567  5.616   9.317   1.00 0.00 ? 88  TRP A O    5  
ATOM 10205 C CB   . TRP A 1 88  ? 19.934  7.301   7.740   1.00 0.00 ? 88  TRP A CB   5  
ATOM 10206 C CG   . TRP A 1 88  ? 18.961  6.671   6.794   1.00 0.00 ? 88  TRP A CG   5  
ATOM 10207 C CD1  . TRP A 1 88  ? 17.729  6.176   7.103   1.00 0.00 ? 88  TRP A CD1  5  
ATOM 10208 C CD2  . TRP A 1 88  ? 19.134  6.467   5.394   1.00 0.00 ? 88  TRP A CD2  5  
ATOM 10209 N NE1  . TRP A 1 88  ? 17.137  5.657   5.982   1.00 0.00 ? 88  TRP A NE1  5  
ATOM 10210 C CE2  . TRP A 1 88  ? 17.980  5.825   4.920   1.00 0.00 ? 88  TRP A CE2  5  
ATOM 10211 C CE3  . TRP A 1 88  ? 20.157  6.760   4.499   1.00 0.00 ? 88  TRP A CE3  5  
ATOM 10212 C CZ2  . TRP A 1 88  ? 17.824  5.470   3.586   1.00 0.00 ? 88  TRP A CZ2  5  
ATOM 10213 C CZ3  . TRP A 1 88  ? 20.002  6.408   3.176   1.00 0.00 ? 88  TRP A CZ3  5  
ATOM 10214 C CH2  . TRP A 1 88  ? 18.848  5.769   2.731   1.00 0.00 ? 88  TRP A CH2  5  
ATOM 10215 H H    . TRP A 1 88  ? 20.846  8.059   10.060  1.00 0.00 ? 88  TRP A H    5  
ATOM 10216 H HA   . TRP A 1 88  ? 19.512  5.672   9.068   1.00 0.00 ? 88  TRP A HA   5  
ATOM 10217 H HB2  . TRP A 1 88  ? 19.481  8.198   8.134   1.00 0.00 ? 88  TRP A HB2  5  
ATOM 10218 H HB3  . TRP A 1 88  ? 20.821  7.569   7.183   1.00 0.00 ? 88  TRP A HB3  5  
ATOM 10219 H HD1  . TRP A 1 88  ? 17.300  6.184   8.095   1.00 0.00 ? 88  TRP A HD1  5  
ATOM 10220 H HE1  . TRP A 1 88  ? 16.250  5.234   5.948   1.00 0.00 ? 88  TRP A HE1  5  
ATOM 10221 H HE3  . TRP A 1 88  ? 21.060  7.256   4.825   1.00 0.00 ? 88  TRP A HE3  5  
ATOM 10222 H HZ2  . TRP A 1 88  ? 16.933  4.973   3.227   1.00 0.00 ? 88  TRP A HZ2  5  
ATOM 10223 H HZ3  . TRP A 1 88  ? 20.788  6.628   2.467   1.00 0.00 ? 88  TRP A HZ3  5  
ATOM 10224 H HH2  . TRP A 1 88  ? 18.774  5.513   1.684   1.00 0.00 ? 88  TRP A HH2  5  
ATOM 10225 N N    . LEU A 1 89  ? 21.556  4.846   7.453   1.00 0.00 ? 89  LEU A N    5  
ATOM 10226 C CA   . LEU A 1 89  ? 22.636  3.922   7.088   1.00 0.00 ? 89  LEU A CA   5  
ATOM 10227 C C    . LEU A 1 89  ? 22.999  4.059   5.605   1.00 0.00 ? 89  LEU A C    5  
ATOM 10228 O O    . LEU A 1 89  ? 23.459  3.103   4.975   1.00 0.00 ? 89  LEU A O    5  
ATOM 10229 C CB   . LEU A 1 89  ? 22.216  2.466   7.396   1.00 0.00 ? 89  LEU A CB   5  
ATOM 10230 C CG   . LEU A 1 89  ? 21.057  1.891   6.546   1.00 0.00 ? 89  LEU A CG   5  
ATOM 10231 C CD1  . LEU A 1 89  ? 20.890  0.395   6.803   1.00 0.00 ? 89  LEU A CD1  5  
ATOM 10232 C CD2  . LEU A 1 89  ? 19.743  2.621   6.820   1.00 0.00 ? 89  LEU A CD2  5  
ATOM 10233 H H    . LEU A 1 89  ? 20.789  4.938   6.851   1.00 0.00 ? 89  LEU A H    5  
ATOM 10234 H HA   . LEU A 1 89  ? 23.507  4.170   7.682   1.00 0.00 ? 89  LEU A HA   5  
ATOM 10235 H HB2  . LEU A 1 89  ? 23.082  1.833   7.253   1.00 0.00 ? 89  LEU A HB2  5  
ATOM 10236 H HB3  . LEU A 1 89  ? 21.929  2.413   8.437   1.00 0.00 ? 89  LEU A HB3  5  
ATOM 10237 H HG   . LEU A 1 89  ? 21.296  2.018   5.499   1.00 0.00 ? 89  LEU A HG   5  
ATOM 10238 H HD11 . LEU A 1 89  ? 20.086  0.012   6.189   1.00 0.00 ? 89  LEU A HD11 5  
ATOM 10239 H HD12 . LEU A 1 89  ? 20.656  0.231   7.845   1.00 0.00 ? 89  LEU A HD12 5  
ATOM 10240 H HD13 . LEU A 1 89  ? 21.807  -0.119  6.554   1.00 0.00 ? 89  LEU A HD13 5  
ATOM 10241 H HD21 . LEU A 1 89  ? 19.480  2.515   7.863   1.00 0.00 ? 89  LEU A HD21 5  
ATOM 10242 H HD22 . LEU A 1 89  ? 18.960  2.198   6.208   1.00 0.00 ? 89  LEU A HD22 5  
ATOM 10243 H HD23 . LEU A 1 89  ? 19.856  3.669   6.584   1.00 0.00 ? 89  LEU A HD23 5  
ATOM 10244 N N    . GLY A 1 90  ? 22.837  5.264   5.067   1.00 0.00 ? 90  GLY A N    5  
ATOM 10245 C CA   . GLY A 1 90  ? 23.032  5.483   3.641   1.00 0.00 ? 90  GLY A CA   5  
ATOM 10246 C C    . GLY A 1 90  ? 24.430  5.160   3.174   1.00 0.00 ? 90  GLY A C    5  
ATOM 10247 O O    . GLY A 1 90  ? 24.628  4.283   2.332   1.00 0.00 ? 90  GLY A O    5  
ATOM 10248 H H    . GLY A 1 90  ? 22.605  6.022   5.648   1.00 0.00 ? 90  GLY A H    5  
ATOM 10249 H HA2  . GLY A 1 90  ? 22.332  4.866   3.096   1.00 0.00 ? 90  GLY A HA2  5  
ATOM 10250 H HA3  . GLY A 1 90  ? 22.823  6.521   3.420   1.00 0.00 ? 90  GLY A HA3  5  
ATOM 10251 N N    . GLU A 1 91  ? 25.406  5.838   3.750   1.00 0.00 ? 91  GLU A N    5  
ATOM 10252 C CA   . GLU A 1 91  ? 26.798  5.682   3.340   1.00 0.00 ? 91  GLU A CA   5  
ATOM 10253 C C    . GLU A 1 91  ? 27.260  4.227   3.495   1.00 0.00 ? 91  GLU A C    5  
ATOM 10254 O O    . GLU A 1 91  ? 28.296  3.832   2.951   1.00 0.00 ? 91  GLU A O    5  
ATOM 10255 C CB   . GLU A 1 91  ? 27.712  6.623   4.141   1.00 0.00 ? 91  GLU A CB   5  
ATOM 10256 C CG   . GLU A 1 91  ? 27.452  8.114   3.901   1.00 0.00 ? 91  GLU A CG   5  
ATOM 10257 C CD   . GLU A 1 91  ? 26.109  8.584   4.443   1.00 0.00 ? 91  GLU A CD   5  
ATOM 10258 O OE1  . GLU A 1 91  ? 25.971  8.688   5.681   1.00 0.00 ? 91  GLU A OE1  5  
ATOM 10259 O OE2  . GLU A 1 91  ? 25.182  8.841   3.643   1.00 0.00 ? 91  GLU A OE2  5  
ATOM 10260 H H    . GLU A 1 91  ? 25.184  6.460   4.475   1.00 0.00 ? 91  GLU A H    5  
ATOM 10261 H HA   . GLU A 1 91  ? 26.858  5.949   2.292   1.00 0.00 ? 91  GLU A HA   5  
ATOM 10262 H HB2  . GLU A 1 91  ? 27.579  6.424   5.195   1.00 0.00 ? 91  GLU A HB2  5  
ATOM 10263 H HB3  . GLU A 1 91  ? 28.740  6.415   3.877   1.00 0.00 ? 91  GLU A HB3  5  
ATOM 10264 H HG2  . GLU A 1 91  ? 28.233  8.683   4.386   1.00 0.00 ? 91  GLU A HG2  5  
ATOM 10265 H HG3  . GLU A 1 91  ? 27.484  8.303   2.838   1.00 0.00 ? 91  GLU A HG3  5  
ATOM 10266 N N    . GLU A 1 92  ? 26.485  3.434   4.235   1.00 0.00 ? 92  GLU A N    5  
ATOM 10267 C CA   . GLU A 1 92  ? 26.777  2.020   4.418   1.00 0.00 ? 92  GLU A CA   5  
ATOM 10268 C C    . GLU A 1 92  ? 26.188  1.206   3.268   1.00 0.00 ? 92  GLU A C    5  
ATOM 10269 O O    . GLU A 1 92  ? 26.877  0.388   2.663   1.00 0.00 ? 92  GLU A O    5  
ATOM 10270 C CB   . GLU A 1 92  ? 26.221  1.524   5.761   1.00 0.00 ? 92  GLU A CB   5  
ATOM 10271 C CG   . GLU A 1 92  ? 26.573  0.072   6.080   1.00 0.00 ? 92  GLU A CG   5  
ATOM 10272 C CD   . GLU A 1 92  ? 26.050  -0.377  7.437   1.00 0.00 ? 92  GLU A CD   5  
ATOM 10273 O OE1  . GLU A 1 92  ? 26.517  0.157   8.464   1.00 0.00 ? 92  GLU A OE1  5  
ATOM 10274 O OE2  . GLU A 1 92  ? 25.169  -1.264  7.486   1.00 0.00 ? 92  GLU A OE2  5  
ATOM 10275 H H    . GLU A 1 92  ? 25.691  3.813   4.667   1.00 0.00 ? 92  GLU A H    5  
ATOM 10276 H HA   . GLU A 1 92  ? 27.853  1.898   4.416   1.00 0.00 ? 92  GLU A HA   5  
ATOM 10277 H HB2  . GLU A 1 92  ? 26.614  2.148   6.551   1.00 0.00 ? 92  GLU A HB2  5  
ATOM 10278 H HB3  . GLU A 1 92  ? 25.143  1.616   5.748   1.00 0.00 ? 92  GLU A HB3  5  
ATOM 10279 H HG2  . GLU A 1 92  ? 26.149  -0.564  5.315   1.00 0.00 ? 92  GLU A HG2  5  
ATOM 10280 H HG3  . GLU A 1 92  ? 27.649  -0.032  6.073   1.00 0.00 ? 92  GLU A HG3  5  
ATOM 10281 N N    . VAL A 1 93  ? 24.914  1.458   2.950   1.00 0.00 ? 93  VAL A N    5  
ATOM 10282 C CA   . VAL A 1 93  ? 24.205  0.676   1.936   1.00 0.00 ? 93  VAL A CA   5  
ATOM 10283 C C    . VAL A 1 93  ? 24.798  0.884   0.539   1.00 0.00 ? 93  VAL A C    5  
ATOM 10284 O O    . VAL A 1 93  ? 24.776  -0.023  -0.291  1.00 0.00 ? 93  VAL A O    5  
ATOM 10285 C CB   . VAL A 1 93  ? 22.682  0.988   1.909   1.00 0.00 ? 93  VAL A CB   5  
ATOM 10286 C CG1  . VAL A 1 93  ? 22.411  2.435   1.500   1.00 0.00 ? 93  VAL A CG1  5  
ATOM 10287 C CG2  . VAL A 1 93  ? 21.943  0.019   0.984   1.00 0.00 ? 93  VAL A CG2  5  
ATOM 10288 H H    . VAL A 1 93  ? 24.442  2.186   3.413   1.00 0.00 ? 93  VAL A H    5  
ATOM 10289 H HA   . VAL A 1 93  ? 24.323  -0.366  2.202   1.00 0.00 ? 93  VAL A HA   5  
ATOM 10290 H HB   . VAL A 1 93  ? 22.295  0.851   2.911   1.00 0.00 ? 93  VAL A HB   5  
ATOM 10291 H HG11 . VAL A 1 93  ? 22.813  2.615   0.512   1.00 0.00 ? 93  VAL A HG11 5  
ATOM 10292 H HG12 . VAL A 1 93  ? 22.883  3.103   2.206   1.00 0.00 ? 93  VAL A HG12 5  
ATOM 10293 H HG13 . VAL A 1 93  ? 21.346  2.617   1.494   1.00 0.00 ? 93  VAL A HG13 5  
ATOM 10294 H HG21 . VAL A 1 93  ? 22.320  0.120   -0.024  1.00 0.00 ? 93  VAL A HG21 5  
ATOM 10295 H HG22 . VAL A 1 93  ? 20.886  0.243   0.997   1.00 0.00 ? 93  VAL A HG22 5  
ATOM 10296 H HG23 . VAL A 1 93  ? 22.099  -0.994  1.326   1.00 0.00 ? 93  VAL A HG23 5  
ATOM 10297 N N    . LEU A 1 94  ? 25.335  2.078   0.282   1.00 0.00 ? 94  LEU A N    5  
ATOM 10298 C CA   . LEU A 1 94  ? 25.969  2.366   -1.008  1.00 0.00 ? 94  LEU A CA   5  
ATOM 10299 C C    . LEU A 1 94  ? 27.209  1.494   -1.209  1.00 0.00 ? 94  LEU A C    5  
ATOM 10300 O O    . LEU A 1 94  ? 27.582  1.175   -2.340  1.00 0.00 ? 94  LEU A O    5  
ATOM 10301 C CB   . LEU A 1 94  ? 26.343  3.857   -1.131  1.00 0.00 ? 94  LEU A CB   5  
ATOM 10302 C CG   . LEU A 1 94  ? 25.206  4.803   -1.571  1.00 0.00 ? 94  LEU A CG   5  
ATOM 10303 C CD1  . LEU A 1 94  ? 24.528  4.280   -2.833  1.00 0.00 ? 94  LEU A CD1  5  
ATOM 10304 C CD2  . LEU A 1 94  ? 24.183  5.007   -0.458  1.00 0.00 ? 94  LEU A CD2  5  
ATOM 10305 H H    . LEU A 1 94  ? 25.301  2.777   0.970   1.00 0.00 ? 94  LEU A H    5  
ATOM 10306 H HA   . LEU A 1 94  ? 25.254  2.122   -1.781  1.00 0.00 ? 94  LEU A HA   5  
ATOM 10307 H HB2  . LEU A 1 94  ? 26.709  4.191   -0.170  1.00 0.00 ? 94  LEU A HB2  5  
ATOM 10308 H HB3  . LEU A 1 94  ? 27.148  3.947   -1.848  1.00 0.00 ? 94  LEU A HB3  5  
ATOM 10309 H HG   . LEU A 1 94  ? 25.632  5.769   -1.808  1.00 0.00 ? 94  LEU A HG   5  
ATOM 10310 H HD11 . LEU A 1 94  ? 23.776  4.985   -3.157  1.00 0.00 ? 94  LEU A HD11 5  
ATOM 10311 H HD12 . LEU A 1 94  ? 24.061  3.328   -2.626  1.00 0.00 ? 94  LEU A HD12 5  
ATOM 10312 H HD13 . LEU A 1 94  ? 25.264  4.157   -3.614  1.00 0.00 ? 94  LEU A HD13 5  
ATOM 10313 H HD21 . LEU A 1 94  ? 23.744  4.058   -0.191  1.00 0.00 ? 94  LEU A HD21 5  
ATOM 10314 H HD22 . LEU A 1 94  ? 23.407  5.679   -0.798  1.00 0.00 ? 94  LEU A HD22 5  
ATOM 10315 H HD23 . LEU A 1 94  ? 24.672  5.434   0.406   1.00 0.00 ? 94  LEU A HD23 5  
ATOM 10316 N N    . ALA A 1 95  ? 27.844  1.116   -0.106  1.00 0.00 ? 95  ALA A N    5  
ATOM 10317 C CA   . ALA A 1 95  ? 29.033  0.267   -0.152  1.00 0.00 ? 95  ALA A CA   5  
ATOM 10318 C C    . ALA A 1 95  ? 28.658  -1.206  0.018   1.00 0.00 ? 95  ALA A C    5  
ATOM 10319 O O    . ALA A 1 95  ? 29.292  -2.091  -0.555  1.00 0.00 ? 95  ALA A O    5  
ATOM 10320 C CB   . ALA A 1 95  ? 30.023  0.693   0.925   1.00 0.00 ? 95  ALA A CB   5  
ATOM 10321 H H    . ALA A 1 95  ? 27.504  1.417   0.764   1.00 0.00 ? 95  ALA A H    5  
ATOM 10322 H HA   . ALA A 1 95  ? 29.506  0.401   -1.116  1.00 0.00 ? 95  ALA A HA   5  
ATOM 10323 H HB1  . ALA A 1 95  ? 29.573  0.570   1.901   1.00 0.00 ? 95  ALA A HB1  5  
ATOM 10324 H HB2  . ALA A 1 95  ? 30.287  1.730   0.781   1.00 0.00 ? 95  ALA A HB2  5  
ATOM 10325 H HB3  . ALA A 1 95  ? 30.914  0.084   0.861   1.00 0.00 ? 95  ALA A HB3  5  
ATOM 10326 N N    . GLU A 1 96  ? 27.616  -1.455  0.800   1.00 0.00 ? 96  GLU A N    5  
ATOM 10327 C CA   . GLU A 1 96  ? 27.146  -2.809  1.085   1.00 0.00 ? 96  GLU A CA   5  
ATOM 10328 C C    . GLU A 1 96  ? 25.637  -2.905  0.851   1.00 0.00 ? 96  GLU A C    5  
ATOM 10329 O O    . GLU A 1 96  ? 24.848  -2.823  1.795   1.00 0.00 ? 96  GLU A O    5  
ATOM 10330 C CB   . GLU A 1 96  ? 27.486  -3.195  2.536   1.00 0.00 ? 96  GLU A CB   5  
ATOM 10331 C CG   . GLU A 1 96  ? 28.947  -3.580  2.758   1.00 0.00 ? 96  GLU A CG   5  
ATOM 10332 C CD   . GLU A 1 96  ? 29.273  -4.965  2.220   1.00 0.00 ? 96  GLU A CD   5  
ATOM 10333 O OE1  . GLU A 1 96  ? 28.917  -5.961  2.893   1.00 0.00 ? 96  GLU A OE1  5  
ATOM 10334 O OE2  . GLU A 1 96  ? 29.887  -5.070  1.134   1.00 0.00 ? 96  GLU A OE2  5  
ATOM 10335 H H    . GLU A 1 96  ? 27.134  -0.701  1.194   1.00 0.00 ? 96  GLU A H    5  
ATOM 10336 H HA   . GLU A 1 96  ? 27.649  -3.492  0.412   1.00 0.00 ? 96  GLU A HA   5  
ATOM 10337 H HB2  . GLU A 1 96  ? 27.257  -2.358  3.180   1.00 0.00 ? 96  GLU A HB2  5  
ATOM 10338 H HB3  . GLU A 1 96  ? 26.869  -4.034  2.827   1.00 0.00 ? 96  GLU A HB3  5  
ATOM 10339 H HG2  . GLU A 1 96  ? 29.577  -2.854  2.260   1.00 0.00 ? 96  GLU A HG2  5  
ATOM 10340 H HG3  . GLU A 1 96  ? 29.153  -3.561  3.820   1.00 0.00 ? 96  GLU A HG3  5  
ATOM 10341 N N    . PRO A 1 97  ? 25.210  -3.039  -0.419  1.00 0.00 ? 97  PRO A N    5  
ATOM 10342 C CA   . PRO A 1 97  ? 23.797  -3.140  -0.757  1.00 0.00 ? 97  PRO A CA   5  
ATOM 10343 C C    . PRO A 1 97  ? 23.270  -4.564  -0.619  1.00 0.00 ? 97  PRO A C    5  
ATOM 10344 O O    . PRO A 1 97  ? 23.977  -5.537  -0.894  1.00 0.00 ? 97  PRO A O    5  
ATOM 10345 C CB   . PRO A 1 97  ? 23.757  -2.693  -2.217  1.00 0.00 ? 97  PRO A CB   5  
ATOM 10346 C CG   . PRO A 1 97  ? 25.078  -3.119  -2.774  1.00 0.00 ? 97  PRO A CG   5  
ATOM 10347 C CD   . PRO A 1 97  ? 26.065  -3.087  -1.624  1.00 0.00 ? 97  PRO A CD   5  
ATOM 10348 H HA   . PRO A 1 97  ? 23.195  -2.471  -0.156  1.00 0.00 ? 97  PRO A HA   5  
ATOM 10349 H HB2  . PRO A 1 97  ? 22.931  -3.183  -2.720  1.00 0.00 ? 97  PRO A HB2  5  
ATOM 10350 H HB3  . PRO A 1 97  ? 23.632  -1.621  -2.268  1.00 0.00 ? 97  PRO A HB3  5  
ATOM 10351 H HG2  . PRO A 1 97  ? 25.001  -4.122  -3.173  1.00 0.00 ? 97  PRO A HG2  5  
ATOM 10352 H HG3  . PRO A 1 97  ? 25.386  -2.433  -3.550  1.00 0.00 ? 97  PRO A HG3  5  
ATOM 10353 H HD2  . PRO A 1 97  ? 26.674  -3.978  -1.625  1.00 0.00 ? 97  PRO A HD2  5  
ATOM 10354 H HD3  . PRO A 1 97  ? 26.687  -2.205  -1.688  1.00 0.00 ? 97  PRO A HD3  5  
ATOM 10355 N N    . ARG A 1 98  ? 22.022  -4.669  -0.196  1.00 0.00 ? 98  ARG A N    5  
ATOM 10356 C CA   . ARG A 1 98  ? 21.354  -5.951  -0.042  1.00 0.00 ? 98  ARG A CA   5  
ATOM 10357 C C    . ARG A 1 98  ? 19.850  -5.713  -0.088  1.00 0.00 ? 98  ARG A C    5  
ATOM 10358 O O    . ARG A 1 98  ? 19.389  -4.646  0.323   1.00 0.00 ? 98  ARG A O    5  
ATOM 10359 C CB   . ARG A 1 98  ? 21.772  -6.619  1.284   1.00 0.00 ? 98  ARG A CB   5  
ATOM 10360 C CG   . ARG A 1 98  ? 21.262  -5.897  2.529   1.00 0.00 ? 98  ARG A CG   5  
ATOM 10361 C CD   . ARG A 1 98  ? 21.985  -6.340  3.801   1.00 0.00 ? 98  ARG A CD   5  
ATOM 10362 N NE   . ARG A 1 98  ? 21.772  -7.757  4.112   1.00 0.00 ? 98  ARG A NE   5  
ATOM 10363 C CZ   . ARG A 1 98  ? 20.936  -8.204  5.054   1.00 0.00 ? 98  ARG A CZ   5  
ATOM 10364 N NH1  . ARG A 1 98  ? 20.163  -7.353  5.719   1.00 0.00 ? 98  ARG A NH1  5  
ATOM 10365 N NH2  . ARG A 1 98  ? 20.860  -9.500  5.314   1.00 0.00 ? 98  ARG A NH2  5  
ATOM 10366 H H    . ARG A 1 98  ? 21.524  -3.852  0.015   1.00 0.00 ? 98  ARG A H    5  
ATOM 10367 H HA   . ARG A 1 98  ? 21.639  -6.584  -0.872  1.00 0.00 ? 98  ARG A HA   5  
ATOM 10368 H HB2  . ARG A 1 98  ? 21.390  -7.631  1.298   1.00 0.00 ? 98  ARG A HB2  5  
ATOM 10369 H HB3  . ARG A 1 98  ? 22.851  -6.654  1.330   1.00 0.00 ? 98  ARG A HB3  5  
ATOM 10370 H HG2  . ARG A 1 98  ? 21.401  -4.831  2.401   1.00 0.00 ? 98  ARG A HG2  5  
ATOM 10371 H HG3  . ARG A 1 98  ? 20.207  -6.104  2.640   1.00 0.00 ? 98  ARG A HG3  5  
ATOM 10372 H HD2  . ARG A 1 98  ? 23.044  -6.170  3.672   1.00 0.00 ? 98  ARG A HD2  5  
ATOM 10373 H HD3  . ARG A 1 98  ? 21.628  -5.740  4.626   1.00 0.00 ? 98  ARG A HD3  5  
ATOM 10374 H HE   . ARG A 1 98  ? 22.303  -8.414  3.607   1.00 0.00 ? 98  ARG A HE   5  
ATOM 10375 H HH11 . ARG A 1 98  ? 20.199  -6.372  5.516   1.00 0.00 ? 98  ARG A HH11 5  
ATOM 10376 H HH12 . ARG A 1 98  ? 19.522  -7.689  6.416   1.00 0.00 ? 98  ARG A HH12 5  
ATOM 10377 H HH21 . ARG A 1 98  ? 21.427  -10.155 4.800   1.00 0.00 ? 98  ARG A HH21 5  
ATOM 10378 H HH22 . ARG A 1 98  ? 20.239  -9.836  6.028   1.00 0.00 ? 98  ARG A HH22 5  
ATOM 10379 N N    . PRO A 1 99  ? 19.063  -6.683  -0.589  1.00 0.00 ? 99  PRO A N    5  
ATOM 10380 C CA   . PRO A 1 99  ? 17.606  -6.527  -0.713  1.00 0.00 ? 99  PRO A CA   5  
ATOM 10381 C C    . PRO A 1 99  ? 16.946  -6.337  0.655   1.00 0.00 ? 99  PRO A C    5  
ATOM 10382 O O    . PRO A 1 99  ? 15.785  -5.937  0.754   1.00 0.00 ? 99  PRO A O    5  
ATOM 10383 C CB   . PRO A 1 99  ? 17.157  -7.841  -1.379  1.00 0.00 ? 99  PRO A CB   5  
ATOM 10384 C CG   . PRO A 1 99  ? 18.245  -8.813  -1.076  1.00 0.00 ? 99  PRO A CG   5  
ATOM 10385 C CD   . PRO A 1 99  ? 19.516  -8.008  -1.058  1.00 0.00 ? 99  PRO A CD   5  
ATOM 10386 H HA   . PRO A 1 99  ? 17.353  -5.689  -1.347  1.00 0.00 ? 99  PRO A HA   5  
ATOM 10387 H HB2  . PRO A 1 99  ? 16.214  -8.161  -0.967  1.00 0.00 ? 99  PRO A HB2  5  
ATOM 10388 H HB3  . PRO A 1 99  ? 17.054  -7.689  -2.445  1.00 0.00 ? 99  PRO A HB3  5  
ATOM 10389 H HG2  . PRO A 1 99  ? 18.074  -9.269  -0.109  1.00 0.00 ? 99  PRO A HG2  5  
ATOM 10390 H HG3  . PRO A 1 99  ? 18.291  -9.571  -1.846  1.00 0.00 ? 99  PRO A HG3  5  
ATOM 10391 H HD2  . PRO A 1 99  ? 20.229  -8.441  -0.371  1.00 0.00 ? 99  PRO A HD2  5  
ATOM 10392 H HD3  . PRO A 1 99  ? 19.938  -7.942  -2.051  1.00 0.00 ? 99  PRO A HD3  5  
ATOM 10393 N N    . ASP A 1 100 ? 17.715  -6.610  1.705   1.00 0.00 ? 100 ASP A N    5  
ATOM 10394 C CA   . ASP A 1 100 ? 17.250  -6.460  3.081   1.00 0.00 ? 100 ASP A CA   5  
ATOM 10395 C C    . ASP A 1 100 ? 17.882  -5.213  3.704   1.00 0.00 ? 100 ASP A C    5  
ATOM 10396 O O    . ASP A 1 100 ? 18.865  -5.298  4.445   1.00 0.00 ? 100 ASP A O    5  
ATOM 10397 C CB   . ASP A 1 100 ? 17.611  -7.714  3.893   1.00 0.00 ? 100 ASP A CB   5  
ATOM 10398 C CG   . ASP A 1 100 ? 16.959  -7.756  5.271   1.00 0.00 ? 100 ASP A CG   5  
ATOM 10399 O OD1  . ASP A 1 100 ? 17.388  -7.006  6.178   1.00 0.00 ? 100 ASP A OD1  5  
ATOM 10400 O OD2  . ASP A 1 100 ? 16.012  -8.549  5.452   1.00 0.00 ? 100 ASP A OD2  5  
ATOM 10401 H H    . ASP A 1 100 ? 18.634  -6.915  1.546   1.00 0.00 ? 100 ASP A H    5  
ATOM 10402 H HA   . ASP A 1 100 ? 16.175  -6.341  3.068   1.00 0.00 ? 100 ASP A HA   5  
ATOM 10403 H HB2  . ASP A 1 100 ? 17.297  -8.588  3.341   1.00 0.00 ? 100 ASP A HB2  5  
ATOM 10404 H HB3  . ASP A 1 100 ? 18.684  -7.751  4.022   1.00 0.00 ? 100 ASP A HB3  5  
ATOM 10405 N N    . MET A 1 101 ? 17.341  -4.048  3.355   1.00 0.00 ? 101 MET A N    5  
ATOM 10406 C CA   . MET A 1 101 ? 17.857  -2.773  3.858   1.00 0.00 ? 101 MET A CA   5  
ATOM 10407 C C    . MET A 1 101 ? 16.725  -1.826  4.232   1.00 0.00 ? 101 MET A C    5  
ATOM 10408 O O    . MET A 1 101 ? 16.443  -1.617  5.409   1.00 0.00 ? 101 MET A O    5  
ATOM 10409 C CB   . MET A 1 101 ? 18.771  -2.099  2.817   1.00 0.00 ? 101 MET A CB   5  
ATOM 10410 C CG   . MET A 1 101 ? 20.224  -2.544  2.883   1.00 0.00 ? 101 MET A CG   5  
ATOM 10411 S SD   . MET A 1 101 ? 20.998  -2.132  4.460   1.00 0.00 ? 101 MET A SD   5  
ATOM 10412 C CE   . MET A 1 101 ? 22.698  -2.610  4.156   1.00 0.00 ? 101 MET A CE   5  
ATOM 10413 H H    . MET A 1 101 ? 16.581  -4.045  2.738   1.00 0.00 ? 101 MET A H    5  
ATOM 10414 H HA   . MET A 1 101 ? 18.438  -2.979  4.747   1.00 0.00 ? 101 MET A HA   5  
ATOM 10415 H HB2  . MET A 1 101 ? 18.394  -2.322  1.829   1.00 0.00 ? 101 MET A HB2  5  
ATOM 10416 H HB3  . MET A 1 101 ? 18.741  -1.027  2.965   1.00 0.00 ? 101 MET A HB3  5  
ATOM 10417 H HG2  . MET A 1 101 ? 20.265  -3.613  2.746   1.00 0.00 ? 101 MET A HG2  5  
ATOM 10418 H HG3  . MET A 1 101 ? 20.773  -2.058  2.089   1.00 0.00 ? 101 MET A HG3  5  
ATOM 10419 H HE1  . MET A 1 101 ? 23.095  -2.033  3.333   1.00 0.00 ? 101 MET A HE1  5  
ATOM 10420 H HE2  . MET A 1 101 ? 22.738  -3.661  3.911   1.00 0.00 ? 101 MET A HE2  5  
ATOM 10421 H HE3  . MET A 1 101 ? 23.288  -2.424  5.042   1.00 0.00 ? 101 MET A HE3  5  
ATOM 10422 N N    . PHE A 1 102 ? 16.064  -1.273  3.221   1.00 0.00 ? 102 PHE A N    5  
ATOM 10423 C CA   . PHE A 1 102 ? 15.069  -0.216  3.433   1.00 0.00 ? 102 PHE A CA   5  
ATOM 10424 C C    . PHE A 1 102 ? 13.681  -0.785  3.743   1.00 0.00 ? 102 PHE A C    5  
ATOM 10425 O O    . PHE A 1 102 ? 12.708  -0.041  3.787   1.00 0.00 ? 102 PHE A O    5  
ATOM 10426 C CB   . PHE A 1 102 ? 14.976  0.691   2.193   1.00 0.00 ? 102 PHE A CB   5  
ATOM 10427 C CG   . PHE A 1 102 ? 16.298  1.233   1.703   1.00 0.00 ? 102 PHE A CG   5  
ATOM 10428 C CD1  . PHE A 1 102 ? 17.270  1.669   2.594   1.00 0.00 ? 102 PHE A CD1  5  
ATOM 10429 C CD2  . PHE A 1 102 ? 16.557  1.318   0.341   1.00 0.00 ? 102 PHE A CD2  5  
ATOM 10430 C CE1  . PHE A 1 102 ? 18.473  2.173   2.134   1.00 0.00 ? 102 PHE A CE1  5  
ATOM 10431 C CE2  . PHE A 1 102 ? 17.756  1.820   -0.122  1.00 0.00 ? 102 PHE A CE2  5  
ATOM 10432 C CZ   . PHE A 1 102 ? 18.715  2.249   0.775   1.00 0.00 ? 102 PHE A CZ   5  
ATOM 10433 H H    . PHE A 1 102 ? 16.255  -1.575  2.308   1.00 0.00 ? 102 PHE A H    5  
ATOM 10434 H HA   . PHE A 1 102 ? 15.393  0.380   4.275   1.00 0.00 ? 102 PHE A HA   5  
ATOM 10435 H HB2  . PHE A 1 102 ? 14.531  0.131   1.384   1.00 0.00 ? 102 PHE A HB2  5  
ATOM 10436 H HB3  . PHE A 1 102 ? 14.339  1.535   2.424   1.00 0.00 ? 102 PHE A HB3  5  
ATOM 10437 H HD1  . PHE A 1 102 ? 17.085  1.608   3.657   1.00 0.00 ? 102 PHE A HD1  5  
ATOM 10438 H HD2  . PHE A 1 102 ? 15.808  0.984   -0.363  1.00 0.00 ? 102 PHE A HD2  5  
ATOM 10439 H HE1  . PHE A 1 102 ? 19.221  2.508   2.836   1.00 0.00 ? 102 PHE A HE1  5  
ATOM 10440 H HE2  . PHE A 1 102 ? 17.943  1.880   -1.185  1.00 0.00 ? 102 PHE A HE2  5  
ATOM 10441 H HZ   . PHE A 1 102 ? 19.655  2.644   0.414   1.00 0.00 ? 102 PHE A HZ   5  
ATOM 10442 N N    . ARG A 1 103 ? 13.595  -2.095  3.981   1.00 0.00 ? 103 ARG A N    5  
ATOM 10443 C CA   . ARG A 1 103 ? 12.297  -2.764  4.154   1.00 0.00 ? 103 ARG A CA   5  
ATOM 10444 C C    . ARG A 1 103 ? 11.460  -2.135  5.277   1.00 0.00 ? 103 ARG A C    5  
ATOM 10445 O O    . ARG A 1 103 ? 10.289  -1.807  5.072   1.00 0.00 ? 103 ARG A O    5  
ATOM 10446 C CB   . ARG A 1 103 ? 12.484  -4.267  4.409   1.00 0.00 ? 103 ARG A CB   5  
ATOM 10447 C CG   . ARG A 1 103 ? 13.470  -4.597  5.525   1.00 0.00 ? 103 ARG A CG   5  
ATOM 10448 C CD   . ARG A 1 103 ? 13.482  -6.086  5.843   1.00 0.00 ? 103 ARG A CD   5  
ATOM 10449 N NE   . ARG A 1 103 ? 14.585  -6.447  6.733   1.00 0.00 ? 103 ARG A NE   5  
ATOM 10450 C CZ   . ARG A 1 103 ? 14.451  -7.133  7.867   1.00 0.00 ? 103 ARG A CZ   5  
ATOM 10451 N NH1  . ARG A 1 103 ? 13.248  -7.466  8.319   1.00 0.00 ? 103 ARG A NH1  5  
ATOM 10452 N NH2  . ARG A 1 103 ? 15.533  -7.478  8.552   1.00 0.00 ? 103 ARG A NH2  5  
ATOM 10453 H H    . ARG A 1 103 ? 14.416  -2.619  4.046   1.00 0.00 ? 103 ARG A H    5  
ATOM 10454 H HA   . ARG A 1 103 ? 11.755  -2.645  3.225   1.00 0.00 ? 103 ARG A HA   5  
ATOM 10455 H HB2  . ARG A 1 103 ? 11.526  -4.697  4.668   1.00 0.00 ? 103 ARG A HB2  5  
ATOM 10456 H HB3  . ARG A 1 103 ? 12.837  -4.732  3.499   1.00 0.00 ? 103 ARG A HB3  5  
ATOM 10457 H HG2  . ARG A 1 103 ? 14.462  -4.296  5.216   1.00 0.00 ? 103 ARG A HG2  5  
ATOM 10458 H HG3  . ARG A 1 103 ? 13.189  -4.049  6.414   1.00 0.00 ? 103 ARG A HG3  5  
ATOM 10459 H HD2  . ARG A 1 103 ? 12.546  -6.349  6.314   1.00 0.00 ? 103 ARG A HD2  5  
ATOM 10460 H HD3  . ARG A 1 103 ? 13.585  -6.639  4.918   1.00 0.00 ? 103 ARG A HD3  5  
ATOM 10461 H HE   . ARG A 1 103 ? 15.491  -6.194  6.445   1.00 0.00 ? 103 ARG A HE   5  
ATOM 10462 H HH11 . ARG A 1 103 ? 12.421  -7.199  7.812   1.00 0.00 ? 103 ARG A HH11 5  
ATOM 10463 H HH12 . ARG A 1 103 ? 13.159  -7.994  9.168   1.00 0.00 ? 103 ARG A HH12 5  
ATOM 10464 H HH21 . ARG A 1 103 ? 16.444  -7.228  8.212   1.00 0.00 ? 103 ARG A HH21 5  
ATOM 10465 H HH22 . ARG A 1 103 ? 15.446  -7.994  9.410   1.00 0.00 ? 103 ARG A HH22 5  
ATOM 10466 N N    . ALA A 1 104 ? 12.056  -1.954  6.456   1.00 0.00 ? 104 ALA A N    5  
ATOM 10467 C CA   . ALA A 1 104 ? 11.331  -1.396  7.600   1.00 0.00 ? 104 ALA A CA   5  
ATOM 10468 C C    . ALA A 1 104 ? 10.950  0.060   7.344   1.00 0.00 ? 104 ALA A C    5  
ATOM 10469 O O    . ALA A 1 104 ? 9.934   0.546   7.834   1.00 0.00 ? 104 ALA A O    5  
ATOM 10470 C CB   . ALA A 1 104 ? 12.162  -1.518  8.875   1.00 0.00 ? 104 ALA A CB   5  
ATOM 10471 H H    . ALA A 1 104 ? 13.002  -2.194  6.559   1.00 0.00 ? 104 ALA A H    5  
ATOM 10472 H HA   . ALA A 1 104 ? 10.426  -1.975  7.734   1.00 0.00 ? 104 ALA A HA   5  
ATOM 10473 H HB1  . ALA A 1 104 ? 11.593  -1.148  9.716   1.00 0.00 ? 104 ALA A HB1  5  
ATOM 10474 H HB2  . ALA A 1 104 ? 13.069  -0.941  8.772   1.00 0.00 ? 104 ALA A HB2  5  
ATOM 10475 H HB3  . ALA A 1 104 ? 12.416  -2.556  9.042   1.00 0.00 ? 104 ALA A HB3  5  
ATOM 10476 N N    . GLN A 1 105 ? 11.768  0.742   6.550   1.00 0.00 ? 105 GLN A N    5  
ATOM 10477 C CA   . GLN A 1 105 ? 11.552  2.152   6.227   1.00 0.00 ? 105 GLN A CA   5  
ATOM 10478 C C    . GLN A 1 105 ? 10.499  2.286   5.129   1.00 0.00 ? 105 GLN A C    5  
ATOM 10479 O O    . GLN A 1 105 ? 9.769   3.280   5.060   1.00 0.00 ? 105 GLN A O    5  
ATOM 10480 C CB   . GLN A 1 105 ? 12.884  2.782   5.815   1.00 0.00 ? 105 GLN A CB   5  
ATOM 10481 C CG   . GLN A 1 105 ? 13.927  2.700   6.927   1.00 0.00 ? 105 GLN A CG   5  
ATOM 10482 C CD   . GLN A 1 105 ? 15.326  3.079   6.482   1.00 0.00 ? 105 GLN A CD   5  
ATOM 10483 O OE1  . GLN A 1 105 ? 15.703  2.882   5.329   1.00 0.00 ? 105 GLN A OE1  5  
ATOM 10484 N NE2  . GLN A 1 105 ? 16.106  3.632   7.398   1.00 0.00 ? 105 GLN A NE2  5  
ATOM 10485 H H    . GLN A 1 105 ? 12.542  0.282   6.162   1.00 0.00 ? 105 GLN A H    5  
ATOM 10486 H HA   . GLN A 1 105 ? 11.189  2.646   7.119   1.00 0.00 ? 105 GLN A HA   5  
ATOM 10487 H HB2  . GLN A 1 105 ? 13.265  2.264   4.944   1.00 0.00 ? 105 GLN A HB2  5  
ATOM 10488 H HB3  . GLN A 1 105 ? 12.726  3.822   5.569   1.00 0.00 ? 105 GLN A HB3  5  
ATOM 10489 H HG2  . GLN A 1 105 ? 13.630  3.365   7.725   1.00 0.00 ? 105 GLN A HG2  5  
ATOM 10490 H HG3  . GLN A 1 105 ? 13.950  1.686   7.302   1.00 0.00 ? 105 GLN A HG3  5  
ATOM 10491 H HE21 . GLN A 1 105 ? 15.736  3.772   8.301   1.00 0.00 ? 105 GLN A HE21 5  
ATOM 10492 H HE22 . GLN A 1 105 ? 17.021  3.870   7.145   1.00 0.00 ? 105 GLN A HE22 5  
ATOM 10493 N N    . GLN A 1 106 ? 10.417  1.262   4.291   1.00 0.00 ? 106 GLN A N    5  
ATOM 10494 C CA   . GLN A 1 106 ? 9.376   1.156   3.279   1.00 0.00 ? 106 GLN A CA   5  
ATOM 10495 C C    . GLN A 1 106 ? 8.038   0.939   3.971   1.00 0.00 ? 106 GLN A C    5  
ATOM 10496 O O    . GLN A 1 106 ? 7.026   1.554   3.620   1.00 0.00 ? 106 GLN A O    5  
ATOM 10497 C CB   . GLN A 1 106 ? 9.713   0.003   2.315   1.00 0.00 ? 106 GLN A CB   5  
ATOM 10498 C CG   . GLN A 1 106 ? 8.596   -0.403  1.349   1.00 0.00 ? 106 GLN A CG   5  
ATOM 10499 C CD   . GLN A 1 106 ? 7.802   -1.611  1.827   1.00 0.00 ? 106 GLN A CD   5  
ATOM 10500 O OE1  . GLN A 1 106 ? 8.318   -2.459  2.555   1.00 0.00 ? 106 GLN A OE1  5  
ATOM 10501 N NE2  . GLN A 1 106 ? 6.559   -1.721  1.393   1.00 0.00 ? 106 GLN A NE2  5  
ATOM 10502 H H    . GLN A 1 106 ? 11.078  0.545   4.359   1.00 0.00 ? 106 GLN A H    5  
ATOM 10503 H HA   . GLN A 1 106 ? 9.344   2.087   2.728   1.00 0.00 ? 106 GLN A HA   5  
ATOM 10504 H HB2  . GLN A 1 106 ? 10.570  0.294   1.725   1.00 0.00 ? 106 GLN A HB2  5  
ATOM 10505 H HB3  . GLN A 1 106 ? 9.984   -0.867  2.901   1.00 0.00 ? 106 GLN A HB3  5  
ATOM 10506 H HG2  . GLN A 1 106 ? 7.917   0.430   1.233   1.00 0.00 ? 106 GLN A HG2  5  
ATOM 10507 H HG3  . GLN A 1 106 ? 9.034   -0.639  0.388   1.00 0.00 ? 106 GLN A HG3  5  
ATOM 10508 H HE21 . GLN A 1 106 ? 6.217   -1.027  0.793   1.00 0.00 ? 106 GLN A HE21 5  
ATOM 10509 H HE22 . GLN A 1 106 ? 6.033   -2.498  1.679   1.00 0.00 ? 106 GLN A HE22 5  
ATOM 10510 N N    . LEU A 1 107 ? 8.056   0.082   4.986   1.00 0.00 ? 107 LEU A N    5  
ATOM 10511 C CA   . LEU A 1 107 ? 6.877   -0.165  5.802   1.00 0.00 ? 107 LEU A CA   5  
ATOM 10512 C C    . LEU A 1 107 ? 6.604   1.037   6.709   1.00 0.00 ? 107 LEU A C    5  
ATOM 10513 O O    . LEU A 1 107 ? 5.469   1.271   7.114   1.00 0.00 ? 107 LEU A O    5  
ATOM 10514 C CB   . LEU A 1 107 ? 7.061   -1.436  6.642   1.00 0.00 ? 107 LEU A CB   5  
ATOM 10515 C CG   . LEU A 1 107 ? 5.790   -1.938  7.352   1.00 0.00 ? 107 LEU A CG   5  
ATOM 10516 C CD1  . LEU A 1 107 ? 4.748   -2.406  6.338   1.00 0.00 ? 107 LEU A CD1  5  
ATOM 10517 C CD2  . LEU A 1 107 ? 6.127   -3.051  8.344   1.00 0.00 ? 107 LEU A CD2  5  
ATOM 10518 H H    . LEU A 1 107 ? 8.885   -0.405  5.185   1.00 0.00 ? 107 LEU A H    5  
ATOM 10519 H HA   . LEU A 1 107 ? 6.035   -0.300  5.137   1.00 0.00 ? 107 LEU A HA   5  
ATOM 10520 H HB2  . LEU A 1 107 ? 7.421   -2.222  5.991   1.00 0.00 ? 107 LEU A HB2  5  
ATOM 10521 H HB3  . LEU A 1 107 ? 7.815   -1.241  7.391   1.00 0.00 ? 107 LEU A HB3  5  
ATOM 10522 H HG   . LEU A 1 107 ? 5.356   -1.117  7.908   1.00 0.00 ? 107 LEU A HG   5  
ATOM 10523 H HD11 . LEU A 1 107 ? 5.160   -3.204  5.734   1.00 0.00 ? 107 LEU A HD11 5  
ATOM 10524 H HD12 . LEU A 1 107 ? 4.470   -1.580  5.699   1.00 0.00 ? 107 LEU A HD12 5  
ATOM 10525 H HD13 . LEU A 1 107 ? 3.872   -2.766  6.859   1.00 0.00 ? 107 LEU A HD13 5  
ATOM 10526 H HD21 . LEU A 1 107 ? 6.816   -2.676  9.086   1.00 0.00 ? 107 LEU A HD21 5  
ATOM 10527 H HD22 . LEU A 1 107 ? 6.581   -3.879  7.819   1.00 0.00 ? 107 LEU A HD22 5  
ATOM 10528 H HD23 . LEU A 1 107 ? 5.222   -3.386  8.831   1.00 0.00 ? 107 LEU A HD23 5  
ATOM 10529 N N    . GLN A 1 108 ? 7.653   1.800   7.022   1.00 0.00 ? 108 GLN A N    5  
ATOM 10530 C CA   . GLN A 1 108 ? 7.518   3.014   7.829   1.00 0.00 ? 108 GLN A CA   5  
ATOM 10531 C C    . GLN A 1 108 ? 6.679   4.052   7.088   1.00 0.00 ? 108 GLN A C    5  
ATOM 10532 O O    . GLN A 1 108 ? 5.744   4.623   7.650   1.00 0.00 ? 108 GLN A O    5  
ATOM 10533 C CB   . GLN A 1 108 ? 8.899   3.597   8.183   1.00 0.00 ? 108 GLN A CB   5  
ATOM 10534 C CG   . GLN A 1 108 ? 8.836   4.850   9.056   1.00 0.00 ? 108 GLN A CG   5  
ATOM 10535 C CD   . GLN A 1 108 ? 8.152   4.606   10.392  1.00 0.00 ? 108 GLN A CD   5  
ATOM 10536 O OE1  . GLN A 1 108 ? 8.210   3.507   10.945  1.00 0.00 ? 108 GLN A OE1  5  
ATOM 10537 N NE2  . GLN A 1 108 ? 7.495   5.628   10.920  1.00 0.00 ? 108 GLN A NE2  5  
ATOM 10538 H H    . GLN A 1 108 ? 8.543   1.530   6.713   1.00 0.00 ? 108 GLN A H    5  
ATOM 10539 H HA   . GLN A 1 108 ? 7.006   2.745   8.744   1.00 0.00 ? 108 GLN A HA   5  
ATOM 10540 H HB2  . GLN A 1 108 ? 9.470   2.845   8.709   1.00 0.00 ? 108 GLN A HB2  5  
ATOM 10541 H HB3  . GLN A 1 108 ? 9.416   3.849   7.267   1.00 0.00 ? 108 GLN A HB3  5  
ATOM 10542 H HG2  . GLN A 1 108 ? 9.846   5.191   9.246   1.00 0.00 ? 108 GLN A HG2  5  
ATOM 10543 H HG3  . GLN A 1 108 ? 8.294   5.620   8.524   1.00 0.00 ? 108 GLN A HG3  5  
ATOM 10544 H HE21 . GLN A 1 108 ? 7.487   6.475   10.429  1.00 0.00 ? 108 GLN A HE21 5  
ATOM 10545 H HE22 . GLN A 1 108 ? 7.040   5.493   11.780  1.00 0.00 ? 108 GLN A HE22 5  
ATOM 10546 N N    . ILE A 1 109 ? 7.016   4.286   5.819   1.00 0.00 ? 109 ILE A N    5  
ATOM 10547 C CA   . ILE A 1 109 ? 6.243   5.196   4.972   1.00 0.00 ? 109 ILE A CA   5  
ATOM 10548 C C    . ILE A 1 109 ? 4.800   4.706   4.895   1.00 0.00 ? 109 ILE A C    5  
ATOM 10549 O O    . ILE A 1 109 ? 3.851   5.489   4.980   1.00 0.00 ? 109 ILE A O    5  
ATOM 10550 C CB   . ILE A 1 109 ? 6.867   5.311   3.543   1.00 0.00 ? 109 ILE A CB   5  
ATOM 10551 C CG1  . ILE A 1 109 ? 7.200   6.777   3.209   1.00 0.00 ? 109 ILE A CG1  5  
ATOM 10552 C CG2  . ILE A 1 109 ? 5.961   4.719   2.459   1.00 0.00 ? 109 ILE A CG2  5  
ATOM 10553 C CD1  . ILE A 1 109 ? 8.157   7.427   4.186   1.00 0.00 ? 109 ILE A CD1  5  
ATOM 10554 H H    . ILE A 1 109 ? 7.804   3.836   5.443   1.00 0.00 ? 109 ILE A H    5  
ATOM 10555 H HA   . ILE A 1 109 ? 6.256   6.172   5.439   1.00 0.00 ? 109 ILE A HA   5  
ATOM 10556 H HB   . ILE A 1 109 ? 7.780   4.737   3.543   1.00 0.00 ? 109 ILE A HB   5  
ATOM 10557 H HG12 . ILE A 1 109 ? 7.653   6.824   2.228   1.00 0.00 ? 109 ILE A HG12 5  
ATOM 10558 H HG13 . ILE A 1 109 ? 6.288   7.357   3.203   1.00 0.00 ? 109 ILE A HG13 5  
ATOM 10559 H HG21 . ILE A 1 109 ? 6.445   4.806   1.496   1.00 0.00 ? 109 ILE A HG21 5  
ATOM 10560 H HG22 . ILE A 1 109 ? 5.024   5.255   2.438   1.00 0.00 ? 109 ILE A HG22 5  
ATOM 10561 H HG23 . ILE A 1 109 ? 5.774   3.676   2.675   1.00 0.00 ? 109 ILE A HG23 5  
ATOM 10562 H HD11 . ILE A 1 109 ? 9.086   6.876   4.202   1.00 0.00 ? 109 ILE A HD11 5  
ATOM 10563 H HD12 . ILE A 1 109 ? 7.720   7.426   5.174   1.00 0.00 ? 109 ILE A HD12 5  
ATOM 10564 H HD13 . ILE A 1 109 ? 8.347   8.444   3.878   1.00 0.00 ? 109 ILE A HD13 5  
ATOM 10565 N N    . PHE A 1 110 ? 4.668   3.394   4.749   1.00 0.00 ? 110 PHE A N    5  
ATOM 10566 C CA   . PHE A 1 110 ? 3.369   2.728   4.743   1.00 0.00 ? 110 PHE A CA   5  
ATOM 10567 C C    . PHE A 1 110 ? 2.600   3.048   6.029   1.00 0.00 ? 110 PHE A C    5  
ATOM 10568 O O    . PHE A 1 110 ? 1.445   3.473   5.985   1.00 0.00 ? 110 PHE A O    5  
ATOM 10569 C CB   . PHE A 1 110 ? 3.570   1.209   4.597   1.00 0.00 ? 110 PHE A CB   5  
ATOM 10570 C CG   . PHE A 1 110 ? 2.289   0.415   4.493   1.00 0.00 ? 110 PHE A CG   5  
ATOM 10571 C CD1  . PHE A 1 110 ? 1.620   -0.014  5.633   1.00 0.00 ? 110 PHE A CD1  5  
ATOM 10572 C CD2  . PHE A 1 110 ? 1.759   0.092   3.252   1.00 0.00 ? 110 PHE A CD2  5  
ATOM 10573 C CE1  . PHE A 1 110 ? 0.451   -0.743  5.534   1.00 0.00 ? 110 PHE A CE1  5  
ATOM 10574 C CE2  . PHE A 1 110 ? 0.592   -0.637  3.149   1.00 0.00 ? 110 PHE A CE2  5  
ATOM 10575 C CZ   . PHE A 1 110 ? -0.062  -1.054  4.291   1.00 0.00 ? 110 PHE A CZ   5  
ATOM 10576 H H    . PHE A 1 110 ? 5.482   2.855   4.622   1.00 0.00 ? 110 PHE A H    5  
ATOM 10577 H HA   . PHE A 1 110 ? 2.808   3.097   3.894   1.00 0.00 ? 110 PHE A HA   5  
ATOM 10578 H HB2  . PHE A 1 110 ? 4.149   1.019   3.705   1.00 0.00 ? 110 PHE A HB2  5  
ATOM 10579 H HB3  . PHE A 1 110 ? 4.120   0.845   5.453   1.00 0.00 ? 110 PHE A HB3  5  
ATOM 10580 H HD1  . PHE A 1 110 ? 2.021   0.230   6.608   1.00 0.00 ? 110 PHE A HD1  5  
ATOM 10581 H HD2  . PHE A 1 110 ? 2.270   0.418   2.357   1.00 0.00 ? 110 PHE A HD2  5  
ATOM 10582 H HE1  . PHE A 1 110 ? -0.061  -1.070  6.427   1.00 0.00 ? 110 PHE A HE1  5  
ATOM 10583 H HE2  . PHE A 1 110 ? 0.190   -0.880  2.177   1.00 0.00 ? 110 PHE A HE2  5  
ATOM 10584 H HZ   . PHE A 1 110 ? -0.977  -1.625  4.210   1.00 0.00 ? 110 PHE A HZ   5  
ATOM 10585 N N    . ASN A 1 111 ? 3.270   2.870   7.168   1.00 0.00 ? 111 ASN A N    5  
ATOM 10586 C CA   . ASN A 1 111 ? 2.655   3.069   8.483   1.00 0.00 ? 111 ASN A CA   5  
ATOM 10587 C C    . ASN A 1 111 ? 2.441   4.552   8.774   1.00 0.00 ? 111 ASN A C    5  
ATOM 10588 O O    . ASN A 1 111 ? 1.666   4.910   9.662   1.00 0.00 ? 111 ASN A O    5  
ATOM 10589 C CB   . ASN A 1 111 ? 3.516   2.440   9.593   1.00 0.00 ? 111 ASN A CB   5  
ATOM 10590 C CG   . ASN A 1 111 ? 3.564   0.920   9.520   1.00 0.00 ? 111 ASN A CG   5  
ATOM 10591 O OD1  . ASN A 1 111 ? 2.628   0.278   9.041   1.00 0.00 ? 111 ASN A OD1  5  
ATOM 10592 N ND2  . ASN A 1 111 ? 4.646   0.332   10.012  1.00 0.00 ? 111 ASN A ND2  5  
ATOM 10593 H H    . ASN A 1 111 ? 4.209   2.597   7.123   1.00 0.00 ? 111 ASN A H    5  
ATOM 10594 H HA   . ASN A 1 111 ? 1.692   2.580   8.471   1.00 0.00 ? 111 ASN A HA   5  
ATOM 10595 H HB2  . ASN A 1 111 ? 4.524   2.815   9.512   1.00 0.00 ? 111 ASN A HB2  5  
ATOM 10596 H HB3  . ASN A 1 111 ? 3.112   2.721   10.557  1.00 0.00 ? 111 ASN A HB3  5  
ATOM 10597 H HD21 . ASN A 1 111 ? 5.350   0.898   10.396  1.00 0.00 ? 111 ASN A HD21 5  
ATOM 10598 H HD22 . ASN A 1 111 ? 4.700   -0.645  9.970   1.00 0.00 ? 111 ASN A HD22 5  
ATOM 10599 N N    . LEU A 1 112 ? 3.136   5.409   8.034   1.00 0.00 ? 112 LEU A N    5  
ATOM 10600 C CA   . LEU A 1 112 ? 2.996   6.855   8.190   1.00 0.00 ? 112 LEU A CA   5  
ATOM 10601 C C    . LEU A 1 112 ? 1.688   7.329   7.556   1.00 0.00 ? 112 LEU A C    5  
ATOM 10602 O O    . LEU A 1 112 ? 0.845   7.933   8.217   1.00 0.00 ? 112 LEU A O    5  
ATOM 10603 C CB   . LEU A 1 112 ? 4.194   7.575   7.552   1.00 0.00 ? 112 LEU A CB   5  
ATOM 10604 C CG   . LEU A 1 112 ? 4.195   9.109   7.682   1.00 0.00 ? 112 LEU A CG   5  
ATOM 10605 C CD1  . LEU A 1 112 ? 4.226   9.533   9.150   1.00 0.00 ? 112 LEU A CD1  5  
ATOM 10606 C CD2  . LEU A 1 112 ? 5.371   9.714   6.917   1.00 0.00 ? 112 LEU A CD2  5  
ATOM 10607 H H    . LEU A 1 112 ? 3.768   5.060   7.371   1.00 0.00 ? 112 LEU A H    5  
ATOM 10608 H HA   . LEU A 1 112 ? 2.975   7.076   9.248   1.00 0.00 ? 112 LEU A HA   5  
ATOM 10609 H HB2  . LEU A 1 112 ? 5.098   7.195   8.008   1.00 0.00 ? 112 LEU A HB2  5  
ATOM 10610 H HB3  . LEU A 1 112 ? 4.215   7.326   6.499   1.00 0.00 ? 112 LEU A HB3  5  
ATOM 10611 H HG   . LEU A 1 112 ? 3.283   9.498   7.250   1.00 0.00 ? 112 LEU A HG   5  
ATOM 10612 H HD11 . LEU A 1 112 ? 4.217   10.611  9.215   1.00 0.00 ? 112 LEU A HD11 5  
ATOM 10613 H HD12 . LEU A 1 112 ? 5.122   9.152   9.618   1.00 0.00 ? 112 LEU A HD12 5  
ATOM 10614 H HD13 . LEU A 1 112 ? 3.358   9.137   9.658   1.00 0.00 ? 112 LEU A HD13 5  
ATOM 10615 H HD21 . LEU A 1 112 ? 6.300   9.340   7.324   1.00 0.00 ? 112 LEU A HD21 5  
ATOM 10616 H HD22 . LEU A 1 112 ? 5.347   10.790  7.008   1.00 0.00 ? 112 LEU A HD22 5  
ATOM 10617 H HD23 . LEU A 1 112 ? 5.302   9.443   5.873   1.00 0.00 ? 112 LEU A HD23 5  
ATOM 10618 N N    . MET A 1 113 ? 1.518   7.025   6.273   1.00 0.00 ? 113 MET A N    5  
ATOM 10619 C CA   . MET A 1 113 ? 0.310   7.412   5.540   1.00 0.00 ? 113 MET A CA   5  
ATOM 10620 C C    . MET A 1 113 ? -0.860  6.491   5.890   1.00 0.00 ? 113 MET A C    5  
ATOM 10621 O O    . MET A 1 113 ? -2.003  6.749   5.499   1.00 0.00 ? 113 MET A O    5  
ATOM 10622 C CB   . MET A 1 113 ? 0.574   7.406   4.025   1.00 0.00 ? 113 MET A CB   5  
ATOM 10623 C CG   . MET A 1 113 ? 1.151   6.101   3.494   1.00 0.00 ? 113 MET A CG   5  
ATOM 10624 S SD   . MET A 1 113 ? 1.452   6.152   1.717   1.00 0.00 ? 113 MET A SD   5  
ATOM 10625 C CE   . MET A 1 113 ? 2.309   4.600   1.461   1.00 0.00 ? 113 MET A CE   5  
ATOM 10626 H H    . MET A 1 113 ? 2.222   6.526   5.805   1.00 0.00 ? 113 MET A H    5  
ATOM 10627 H HA   . MET A 1 113 ? 0.050   8.418   5.841   1.00 0.00 ? 113 MET A HA   5  
ATOM 10628 H HB2  . MET A 1 113 ? -0.357  7.596   3.509   1.00 0.00 ? 113 MET A HB2  5  
ATOM 10629 H HB3  . MET A 1 113 ? 1.268   8.200   3.791   1.00 0.00 ? 113 MET A HB3  5  
ATOM 10630 H HG2  . MET A 1 113 ? 2.086   5.903   3.998   1.00 0.00 ? 113 MET A HG2  5  
ATOM 10631 H HG3  . MET A 1 113 ? 0.455   5.301   3.704   1.00 0.00 ? 113 MET A HG3  5  
ATOM 10632 H HE1  . MET A 1 113 ? 1.676   3.783   1.773   1.00 0.00 ? 113 MET A HE1  5  
ATOM 10633 H HE2  . MET A 1 113 ? 3.221   4.591   2.040   1.00 0.00 ? 113 MET A HE2  5  
ATOM 10634 H HE3  . MET A 1 113 ? 2.548   4.490   0.414   1.00 0.00 ? 113 MET A HE3  5  
ATOM 10635 N N    . LYS A 1 114 ? -0.561  5.426   6.636   1.00 0.00 ? 114 LYS A N    5  
ATOM 10636 C CA   . LYS A 1 114 ? -1.567  4.467   7.100   1.00 0.00 ? 114 LYS A CA   5  
ATOM 10637 C C    . LYS A 1 114 ? -2.698  5.180   7.844   1.00 0.00 ? 114 LYS A C    5  
ATOM 10638 O O    . LYS A 1 114 ? -3.873  4.858   7.665   1.00 0.00 ? 114 LYS A O    5  
ATOM 10639 C CB   . LYS A 1 114 ? -0.902  3.440   8.034   1.00 0.00 ? 114 LYS A CB   5  
ATOM 10640 C CG   . LYS A 1 114 ? -1.819  2.319   8.525   1.00 0.00 ? 114 LYS A CG   5  
ATOM 10641 C CD   . LYS A 1 114 ? -1.141  1.487   9.618   1.00 0.00 ? 114 LYS A CD   5  
ATOM 10642 C CE   . LYS A 1 114 ? -2.023  0.343   10.112  1.00 0.00 ? 114 LYS A CE   5  
ATOM 10643 N NZ   . LYS A 1 114 ? -2.121  -0.762  9.122   1.00 0.00 ? 114 LYS A NZ   5  
ATOM 10644 H H    . LYS A 1 114 ? 0.376   5.272   6.876   1.00 0.00 ? 114 LYS A H    5  
ATOM 10645 H HA   . LYS A 1 114 ? -1.971  3.955   6.237   1.00 0.00 ? 114 LYS A HA   5  
ATOM 10646 H HB2  . LYS A 1 114 ? -0.074  2.985   7.509   1.00 0.00 ? 114 LYS A HB2  5  
ATOM 10647 H HB3  . LYS A 1 114 ? -0.516  3.964   8.899   1.00 0.00 ? 114 LYS A HB3  5  
ATOM 10648 H HG2  . LYS A 1 114 ? -2.724  2.754   8.926   1.00 0.00 ? 114 LYS A HG2  5  
ATOM 10649 H HG3  . LYS A 1 114 ? -2.065  1.673   7.693   1.00 0.00 ? 114 LYS A HG3  5  
ATOM 10650 H HD2  . LYS A 1 114 ? -0.225  1.072   9.222   1.00 0.00 ? 114 LYS A HD2  5  
ATOM 10651 H HD3  . LYS A 1 114 ? -0.907  2.135   10.454  1.00 0.00 ? 114 LYS A HD3  5  
ATOM 10652 H HE2  . LYS A 1 114 ? -1.604  -0.048  11.027  1.00 0.00 ? 114 LYS A HE2  5  
ATOM 10653 H HE3  . LYS A 1 114 ? -3.014  0.726   10.309  1.00 0.00 ? 114 LYS A HE3  5  
ATOM 10654 H HZ1  . LYS A 1 114 ? -2.531  -0.417  8.232   1.00 0.00 ? 114 LYS A HZ1  5  
ATOM 10655 H HZ2  . LYS A 1 114 ? -2.723  -1.526  9.493   1.00 0.00 ? 114 LYS A HZ2  5  
ATOM 10656 H HZ3  . LYS A 1 114 ? -1.174  -1.152  8.929   1.00 0.00 ? 114 LYS A HZ3  5  
ATOM 10657 N N    . PHE A 1 115 ? -2.337  6.161   8.667   1.00 0.00 ? 115 PHE A N    5  
ATOM 10658 C CA   . PHE A 1 115 ? -3.310  6.868   9.501   1.00 0.00 ? 115 PHE A CA   5  
ATOM 10659 C C    . PHE A 1 115 ? -3.562  8.286   8.987   1.00 0.00 ? 115 PHE A C    5  
ATOM 10660 O O    . PHE A 1 115 ? -4.095  9.127   9.711   1.00 0.00 ? 115 PHE A O    5  
ATOM 10661 C CB   . PHE A 1 115 ? -2.828  6.910   10.964  1.00 0.00 ? 115 PHE A CB   5  
ATOM 10662 C CG   . PHE A 1 115 ? -1.493  7.597   11.164  1.00 0.00 ? 115 PHE A CG   5  
ATOM 10663 C CD1  . PHE A 1 115 ? -1.420  8.971   11.366  1.00 0.00 ? 115 PHE A CD1  5  
ATOM 10664 C CD2  . PHE A 1 115 ? -0.314  6.867   11.156  1.00 0.00 ? 115 PHE A CD2  5  
ATOM 10665 C CE1  . PHE A 1 115 ? -0.201  9.596   11.552  1.00 0.00 ? 115 PHE A CE1  5  
ATOM 10666 C CE2  . PHE A 1 115 ? 0.907   7.490   11.343  1.00 0.00 ? 115 PHE A CE2  5  
ATOM 10667 C CZ   . PHE A 1 115 ? 0.963   8.855   11.540  1.00 0.00 ? 115 PHE A CZ   5  
ATOM 10668 H H    . PHE A 1 115 ? -1.390  6.417   8.717   1.00 0.00 ? 115 PHE A H    5  
ATOM 10669 H HA   . PHE A 1 115 ? -4.241  6.320   9.460   1.00 0.00 ? 115 PHE A HA   5  
ATOM 10670 H HB2  . PHE A 1 115 ? -3.561  7.433   11.560  1.00 0.00 ? 115 PHE A HB2  5  
ATOM 10671 H HB3  . PHE A 1 115 ? -2.739  5.897   11.332  1.00 0.00 ? 115 PHE A HB3  5  
ATOM 10672 H HD1  . PHE A 1 115 ? -2.330  9.555   11.377  1.00 0.00 ? 115 PHE A HD1  5  
ATOM 10673 H HD2  . PHE A 1 115 ? -0.352  5.798   11.001  1.00 0.00 ? 115 PHE A HD2  5  
ATOM 10674 H HE1  . PHE A 1 115 ? -0.161  10.666  11.707  1.00 0.00 ? 115 PHE A HE1  5  
ATOM 10675 H HE2  . PHE A 1 115 ? 1.818   6.908   11.335  1.00 0.00 ? 115 PHE A HE2  5  
ATOM 10676 H HZ   . PHE A 1 115 ? 1.917   9.343   11.685  1.00 0.00 ? 115 PHE A HZ   5  
ATOM 10677 N N    . ASP A 1 116 ? -3.211  8.539   7.727   1.00 0.00 ? 116 ASP A N    5  
ATOM 10678 C CA   . ASP A 1 116 ? -3.332  9.884   7.157   1.00 0.00 ? 116 ASP A CA   5  
ATOM 10679 C C    . ASP A 1 116 ? -3.890  9.824   5.740   1.00 0.00 ? 116 ASP A C    5  
ATOM 10680 O O    . ASP A 1 116 ? -5.097  9.954   5.539   1.00 0.00 ? 116 ASP A O    5  
ATOM 10681 C CB   . ASP A 1 116 ? -1.975  10.611  7.167   1.00 0.00 ? 116 ASP A CB   5  
ATOM 10682 C CG   . ASP A 1 116 ? -2.028  11.950  6.438   1.00 0.00 ? 116 ASP A CG   5  
ATOM 10683 O OD1  . ASP A 1 116 ? -2.550  12.931  7.013   1.00 0.00 ? 116 ASP A OD1  5  
ATOM 10684 O OD2  . ASP A 1 116 ? -1.565  12.023  5.280   1.00 0.00 ? 116 ASP A OD2  5  
ATOM 10685 H H    . ASP A 1 116 ? -2.891  7.806   7.162   1.00 0.00 ? 116 ASP A H    5  
ATOM 10686 H HA   . ASP A 1 116 ? -4.028  10.442  7.772   1.00 0.00 ? 116 ASP A HA   5  
ATOM 10687 H HB2  . ASP A 1 116 ? -1.677  10.789  8.190   1.00 0.00 ? 116 ASP A HB2  5  
ATOM 10688 H HB3  . ASP A 1 116 ? -1.234  9.986   6.687   1.00 0.00 ? 116 ASP A HB3  5  
ATOM 10689 N N    . SER A 1 117 ? -3.010  9.598   4.766   1.00 0.00 ? 117 SER A N    5  
ATOM 10690 C CA   . SER A 1 117 ? -3.397  9.577   3.360   1.00 0.00 ? 117 SER A CA   5  
ATOM 10691 C C    . SER A 1 117 ? -4.465  8.511   3.116   1.00 0.00 ? 117 SER A C    5  
ATOM 10692 O O    . SER A 1 117 ? -5.432  8.739   2.389   1.00 0.00 ? 117 SER A O    5  
ATOM 10693 C CB   . SER A 1 117 ? -2.160  9.315   2.499   1.00 0.00 ? 117 SER A CB   5  
ATOM 10694 O OG   . SER A 1 117 ? -1.080  10.142  2.907   1.00 0.00 ? 117 SER A OG   5  
ATOM 10695 H H    . SER A 1 117 ? -2.070  9.454   4.999   1.00 0.00 ? 117 SER A H    5  
ATOM 10696 H HA   . SER A 1 117 ? -3.803  10.548  3.111   1.00 0.00 ? 117 SER A HA   5  
ATOM 10697 H HB2  . SER A 1 117 ? -1.862  8.281   2.596   1.00 0.00 ? 117 SER A HB2  5  
ATOM 10698 H HB3  . SER A 1 117 ? -2.388  9.529   1.464   1.00 0.00 ? 117 SER A HB3  5  
ATOM 10699 H HG   . SER A 1 117 ? -1.414  10.863  3.458   1.00 0.00 ? 117 SER A HG   5  
ATOM 10700 N N    . TYR A 1 118 ? -4.288  7.358   3.752   1.00 0.00 ? 118 TYR A N    5  
ATOM 10701 C CA   . TYR A 1 118 ? -5.262  6.270   3.685   1.00 0.00 ? 118 TYR A CA   5  
ATOM 10702 C C    . TYR A 1 118 ? -6.601  6.716   4.270   1.00 0.00 ? 118 TYR A C    5  
ATOM 10703 O O    . TYR A 1 118 ? -7.650  6.593   3.627   1.00 0.00 ? 118 TYR A O    5  
ATOM 10704 C CB   . TYR A 1 118 ? -4.718  5.048   4.443   1.00 0.00 ? 118 TYR A CB   5  
ATOM 10705 C CG   . TYR A 1 118 ? -5.738  3.948   4.696   1.00 0.00 ? 118 TYR A CG   5  
ATOM 10706 C CD1  . TYR A 1 118 ? -6.225  3.159   3.659   1.00 0.00 ? 118 TYR A CD1  5  
ATOM 10707 C CD2  . TYR A 1 118 ? -6.197  3.689   5.985   1.00 0.00 ? 118 TYR A CD2  5  
ATOM 10708 C CE1  . TYR A 1 118 ? -7.138  2.146   3.900   1.00 0.00 ? 118 TYR A CE1  5  
ATOM 10709 C CE2  . TYR A 1 118 ? -7.110  2.683   6.232   1.00 0.00 ? 118 TYR A CE2  5  
ATOM 10710 C CZ   . TYR A 1 118 ? -7.576  1.915   5.188   1.00 0.00 ? 118 TYR A CZ   5  
ATOM 10711 O OH   . TYR A 1 118 ? -8.476  0.904   5.434   1.00 0.00 ? 118 TYR A OH   5  
ATOM 10712 H H    . TYR A 1 118 ? -3.472  7.232   4.286   1.00 0.00 ? 118 TYR A H    5  
ATOM 10713 H HA   . TYR A 1 118 ? -5.401  6.008   2.645   1.00 0.00 ? 118 TYR A HA   5  
ATOM 10714 H HB2  . TYR A 1 118 ? -3.907  4.618   3.875   1.00 0.00 ? 118 TYR A HB2  5  
ATOM 10715 H HB3  . TYR A 1 118 ? -4.337  5.377   5.402   1.00 0.00 ? 118 TYR A HB3  5  
ATOM 10716 H HD1  . TYR A 1 118 ? -5.882  3.342   2.651   1.00 0.00 ? 118 TYR A HD1  5  
ATOM 10717 H HD2  . TYR A 1 118 ? -5.831  4.293   6.803   1.00 0.00 ? 118 TYR A HD2  5  
ATOM 10718 H HE1  . TYR A 1 118 ? -7.504  1.544   3.082   1.00 0.00 ? 118 TYR A HE1  5  
ATOM 10719 H HE2  . TYR A 1 118 ? -7.454  2.503   7.240   1.00 0.00 ? 118 TYR A HE2  5  
ATOM 10720 H HH   . TYR A 1 118 ? -9.216  1.250   5.944   1.00 0.00 ? 118 TYR A HH   5  
ATOM 10721 N N    . ALA A 1 119 ? -6.548  7.262   5.484   1.00 0.00 ? 119 ALA A N    5  
ATOM 10722 C CA   . ALA A 1 119 ? -7.750  7.698   6.191   1.00 0.00 ? 119 ALA A CA   5  
ATOM 10723 C C    . ALA A 1 119 ? -8.436  8.852   5.458   1.00 0.00 ? 119 ALA A C    5  
ATOM 10724 O O    . ALA A 1 119 ? -9.638  9.068   5.606   1.00 0.00 ? 119 ALA A O    5  
ATOM 10725 C CB   . ALA A 1 119 ? -7.404  8.106   7.619   1.00 0.00 ? 119 ALA A CB   5  
ATOM 10726 H H    . ALA A 1 119 ? -5.672  7.374   5.917   1.00 0.00 ? 119 ALA A H    5  
ATOM 10727 H HA   . ALA A 1 119 ? -8.431  6.861   6.237   1.00 0.00 ? 119 ALA A HA   5  
ATOM 10728 H HB1  . ALA A 1 119 ? -6.729  8.951   7.602   1.00 0.00 ? 119 ALA A HB1  5  
ATOM 10729 H HB2  . ALA A 1 119 ? -6.928  7.278   8.124   1.00 0.00 ? 119 ALA A HB2  5  
ATOM 10730 H HB3  . ALA A 1 119 ? -8.307  8.377   8.146   1.00 0.00 ? 119 ALA A HB3  5  
ATOM 10731 N N    . ARG A 1 120 ? -7.663  9.588   4.669   1.00 0.00 ? 120 ARG A N    5  
ATOM 10732 C CA   . ARG A 1 120 ? -8.178  10.733  3.924   1.00 0.00 ? 120 ARG A CA   5  
ATOM 10733 C C    . ARG A 1 120 ? -8.802  10.286  2.600   1.00 0.00 ? 120 ARG A C    5  
ATOM 10734 O O    . ARG A 1 120 ? -9.890  10.740  2.232   1.00 0.00 ? 120 ARG A O    5  
ATOM 10735 C CB   . ARG A 1 120 ? -7.043  11.745  3.693   1.00 0.00 ? 120 ARG A CB   5  
ATOM 10736 C CG   . ARG A 1 120 ? -7.445  12.985  2.895   1.00 0.00 ? 120 ARG A CG   5  
ATOM 10737 C CD   . ARG A 1 120 ? -6.474  14.146  3.122   1.00 0.00 ? 120 ARG A CD   5  
ATOM 10738 N NE   . ARG A 1 120 ? -5.083  13.809  2.789   1.00 0.00 ? 120 ARG A NE   5  
ATOM 10739 C CZ   . ARG A 1 120 ? -4.128  13.557  3.690   1.00 0.00 ? 120 ARG A CZ   5  
ATOM 10740 N NH1  . ARG A 1 120 ? -4.411  13.541  4.989   1.00 0.00 ? 120 ARG A NH1  5  
ATOM 10741 N NH2  . ARG A 1 120 ? -2.889  13.323  3.290   1.00 0.00 ? 120 ARG A NH2  5  
ATOM 10742 H H    . ARG A 1 120 ? -6.711  9.362   4.594   1.00 0.00 ? 120 ARG A H    5  
ATOM 10743 H HA   . ARG A 1 120 ? -8.945  11.203  4.527   1.00 0.00 ? 120 ARG A HA   5  
ATOM 10744 H HB2  . ARG A 1 120 ? -6.673  12.070  4.655   1.00 0.00 ? 120 ARG A HB2  5  
ATOM 10745 H HB3  . ARG A 1 120 ? -6.240  11.247  3.164   1.00 0.00 ? 120 ARG A HB3  5  
ATOM 10746 H HG2  . ARG A 1 120 ? -7.452  12.737  1.842   1.00 0.00 ? 120 ARG A HG2  5  
ATOM 10747 H HG3  . ARG A 1 120 ? -8.436  13.292  3.199   1.00 0.00 ? 120 ARG A HG3  5  
ATOM 10748 H HD2  . ARG A 1 120 ? -6.783  14.977  2.505   1.00 0.00 ? 120 ARG A HD2  5  
ATOM 10749 H HD3  . ARG A 1 120 ? -6.526  14.439  4.162   1.00 0.00 ? 120 ARG A HD3  5  
ATOM 10750 H HE   . ARG A 1 120 ? -4.835  13.800  1.832   1.00 0.00 ? 120 ARG A HE   5  
ATOM 10751 H HH11 . ARG A 1 120 ? -5.343  13.714  5.303   1.00 0.00 ? 120 ARG A HH11 5  
ATOM 10752 H HH12 . ARG A 1 120 ? -3.681  13.368  5.662   1.00 0.00 ? 120 ARG A HH12 5  
ATOM 10753 H HH21 . ARG A 1 120 ? -2.664  13.349  2.307   1.00 0.00 ? 120 ARG A HH21 5  
ATOM 10754 H HH22 . ARG A 1 120 ? -2.170  13.111  3.962   1.00 0.00 ? 120 ARG A HH22 5  
ATOM 10755 N N    . PHE A 1 121 ? -8.124  9.374   1.905   1.00 0.00 ? 121 PHE A N    5  
ATOM 10756 C CA   . PHE A 1 121 ? -8.580  8.891   0.600   1.00 0.00 ? 121 PHE A CA   5  
ATOM 10757 C C    . PHE A 1 121 ? -9.981  8.291   0.687   1.00 0.00 ? 121 PHE A C    5  
ATOM 10758 O O    . PHE A 1 121 ? -10.859 8.634   -0.103  1.00 0.00 ? 121 PHE A O    5  
ATOM 10759 C CB   . PHE A 1 121 ? -7.604  7.848   0.033   1.00 0.00 ? 121 PHE A CB   5  
ATOM 10760 C CG   . PHE A 1 121 ? -8.096  7.184   -1.234  1.00 0.00 ? 121 PHE A CG   5  
ATOM 10761 C CD1  . PHE A 1 121 ? -8.180  7.896   -2.421  1.00 0.00 ? 121 PHE A CD1  5  
ATOM 10762 C CD2  . PHE A 1 121 ? -8.488  5.850   -1.231  1.00 0.00 ? 121 PHE A CD2  5  
ATOM 10763 C CE1  . PHE A 1 121 ? -8.639  7.294   -3.577  1.00 0.00 ? 121 PHE A CE1  5  
ATOM 10764 C CE2  . PHE A 1 121 ? -8.948  5.245   -2.384  1.00 0.00 ? 121 PHE A CE2  5  
ATOM 10765 C CZ   . PHE A 1 121 ? -9.023  5.967   -3.558  1.00 0.00 ? 121 PHE A CZ   5  
ATOM 10766 H H    . PHE A 1 121 ? -7.293  9.014   2.277   1.00 0.00 ? 121 PHE A H    5  
ATOM 10767 H HA   . PHE A 1 121 ? -8.610  9.739   -0.071  1.00 0.00 ? 121 PHE A HA   5  
ATOM 10768 H HB2  . PHE A 1 121 ? -6.663  8.330   -0.190  1.00 0.00 ? 121 PHE A HB2  5  
ATOM 10769 H HB3  . PHE A 1 121 ? -7.439  7.078   0.775   1.00 0.00 ? 121 PHE A HB3  5  
ATOM 10770 H HD1  . PHE A 1 121 ? -7.880  8.935   -2.440  1.00 0.00 ? 121 PHE A HD1  5  
ATOM 10771 H HD2  . PHE A 1 121 ? -8.430  5.283   -0.312  1.00 0.00 ? 121 PHE A HD2  5  
ATOM 10772 H HE1  . PHE A 1 121 ? -8.697  7.860   -4.496  1.00 0.00 ? 121 PHE A HE1  5  
ATOM 10773 H HE2  . PHE A 1 121 ? -9.249  4.207   -2.368  1.00 0.00 ? 121 PHE A HE2  5  
ATOM 10774 H HZ   . PHE A 1 121 ? -9.382  5.495   -4.462  1.00 0.00 ? 121 PHE A HZ   5  
ATOM 10775 N N    . VAL A 1 122 ? -10.188 7.411   1.663   1.00 0.00 ? 122 VAL A N    5  
ATOM 10776 C CA   . VAL A 1 122 ? -11.470 6.716   1.813   1.00 0.00 ? 122 VAL A CA   5  
ATOM 10777 C C    . VAL A 1 122 ? -12.605 7.686   2.177   1.00 0.00 ? 122 VAL A C    5  
ATOM 10778 O O    . VAL A 1 122 ? -13.779 7.311   2.166   1.00 0.00 ? 122 VAL A O    5  
ATOM 10779 C CB   . VAL A 1 122 ? -11.383 5.595   2.882   1.00 0.00 ? 122 VAL A CB   5  
ATOM 10780 C CG1  . VAL A 1 122 ? -10.353 4.542   2.475   1.00 0.00 ? 122 VAL A CG1  5  
ATOM 10781 C CG2  . VAL A 1 122 ? -11.057 6.179   4.259   1.00 0.00 ? 122 VAL A CG2  5  
ATOM 10782 H H    . VAL A 1 122 ? -9.461  7.220   2.298   1.00 0.00 ? 122 VAL A H    5  
ATOM 10783 H HA   . VAL A 1 122 ? -11.705 6.252   0.858   1.00 0.00 ? 122 VAL A HA   5  
ATOM 10784 H HB   . VAL A 1 122 ? -12.350 5.110   2.942   1.00 0.00 ? 122 VAL A HB   5  
ATOM 10785 H HG11 . VAL A 1 122 ? -10.639 4.102   1.530   1.00 0.00 ? 122 VAL A HG11 5  
ATOM 10786 H HG12 . VAL A 1 122 ? -10.307 3.769   3.230   1.00 0.00 ? 122 VAL A HG12 5  
ATOM 10787 H HG13 . VAL A 1 122 ? -9.381  5.003   2.376   1.00 0.00 ? 122 VAL A HG13 5  
ATOM 10788 H HG21 . VAL A 1 122 ? -11.830 6.876   4.549   1.00 0.00 ? 122 VAL A HG21 5  
ATOM 10789 H HG22 . VAL A 1 122 ? -10.107 6.696   4.218   1.00 0.00 ? 122 VAL A HG22 5  
ATOM 10790 H HG23 . VAL A 1 122 ? -11.001 5.383   4.985   1.00 0.00 ? 122 VAL A HG23 5  
ATOM 10791 N N    . LYS A 1 123 ? -12.245 8.929   2.502   1.00 0.00 ? 123 LYS A N    5  
ATOM 10792 C CA   . LYS A 1 123 ? -13.227 9.966   2.839   1.00 0.00 ? 123 LYS A CA   5  
ATOM 10793 C C    . LYS A 1 123 ? -13.378 10.949  1.683   1.00 0.00 ? 123 LYS A C    5  
ATOM 10794 O O    . LYS A 1 123 ? -14.314 11.752  1.653   1.00 0.00 ? 123 LYS A O    5  
ATOM 10795 C CB   . LYS A 1 123 ? -12.803 10.731  4.101   1.00 0.00 ? 123 LYS A CB   5  
ATOM 10796 C CG   . LYS A 1 123 ? -12.707 9.867   5.355   1.00 0.00 ? 123 LYS A CG   5  
ATOM 10797 C CD   . LYS A 1 123 ? -12.324 10.697  6.581   1.00 0.00 ? 123 LYS A CD   5  
ATOM 10798 C CE   . LYS A 1 123 ? -12.136 9.828   7.818   1.00 0.00 ? 123 LYS A CE   5  
ATOM 10799 N NZ   . LYS A 1 123 ? -11.785 10.636  9.017   1.00 0.00 ? 123 LYS A NZ   5  
ATOM 10800 H H    . LYS A 1 123 ? -11.296 9.161   2.499   1.00 0.00 ? 123 LYS A H    5  
ATOM 10801 H HA   . LYS A 1 123 ? -14.179 9.487   3.018   1.00 0.00 ? 123 LYS A HA   5  
ATOM 10802 H HB2  . LYS A 1 123 ? -11.835 11.180  3.928   1.00 0.00 ? 123 LYS A HB2  5  
ATOM 10803 H HB3  . LYS A 1 123 ? -13.522 11.517  4.289   1.00 0.00 ? 123 LYS A HB3  5  
ATOM 10804 H HG2  . LYS A 1 123 ? -13.666 9.401   5.533   1.00 0.00 ? 123 LYS A HG2  5  
ATOM 10805 H HG3  . LYS A 1 123 ? -11.958 9.103   5.197   1.00 0.00 ? 123 LYS A HG3  5  
ATOM 10806 H HD2  . LYS A 1 123 ? -11.401 11.220  6.377   1.00 0.00 ? 123 LYS A HD2  5  
ATOM 10807 H HD3  . LYS A 1 123 ? -13.108 11.416  6.775   1.00 0.00 ? 123 LYS A HD3  5  
ATOM 10808 H HE2  . LYS A 1 123 ? -13.054 9.294   8.014   1.00 0.00 ? 123 LYS A HE2  5  
ATOM 10809 H HE3  . LYS A 1 123 ? -11.341 9.120   7.629   1.00 0.00 ? 123 LYS A HE3  5  
ATOM 10810 H HZ1  . LYS A 1 123 ? -11.571 10.010  9.822   1.00 0.00 ? 123 LYS A HZ1  5  
ATOM 10811 H HZ2  . LYS A 1 123 ? -12.580 11.255  9.280   1.00 0.00 ? 123 LYS A HZ2  5  
ATOM 10812 H HZ3  . LYS A 1 123 ? -10.955 11.227  8.824   1.00 0.00 ? 123 LYS A HZ3  5  
ATOM 10813 N N    . SER A 1 124 ? -12.436 10.890  0.747   1.00 0.00 ? 124 SER A N    5  
ATOM 10814 C CA   . SER A 1 124 ? -12.438 11.772  -0.415  1.00 0.00 ? 124 SER A CA   5  
ATOM 10815 C C    . SER A 1 124 ? -13.400 11.251  -1.489  1.00 0.00 ? 124 SER A C    5  
ATOM 10816 O O    . SER A 1 124 ? -13.792 10.080  -1.465  1.00 0.00 ? 124 SER A O    5  
ATOM 10817 C CB   . SER A 1 124 ? -11.012 11.880  -0.978  1.00 0.00 ? 124 SER A CB   5  
ATOM 10818 O OG   . SER A 1 124 ? -10.110 12.369  0.003   1.00 0.00 ? 124 SER A OG   5  
ATOM 10819 H H    . SER A 1 124 ? -11.721 10.225  0.835   1.00 0.00 ? 124 SER A H    5  
ATOM 10820 H HA   . SER A 1 124 ? -12.765 12.750  -0.094  1.00 0.00 ? 124 SER A HA   5  
ATOM 10821 H HB2  . SER A 1 124 ? -10.677 10.903  -1.299  1.00 0.00 ? 124 SER A HB2  5  
ATOM 10822 H HB3  . SER A 1 124 ? -11.007 12.556  -1.821  1.00 0.00 ? 124 SER A HB3  5  
ATOM 10823 H HG   . SER A 1 124 ? -10.315 11.966  0.853   1.00 0.00 ? 124 SER A HG   5  
ATOM 10824 N N    . PRO A 1 125 ? -13.818 12.125  -2.433  1.00 0.00 ? 125 PRO A N    5  
ATOM 10825 C CA   . PRO A 1 125 ? -14.648 11.719  -3.578  1.00 0.00 ? 125 PRO A CA   5  
ATOM 10826 C C    . PRO A 1 125 ? -13.963 10.652  -4.437  1.00 0.00 ? 125 PRO A C    5  
ATOM 10827 O O    . PRO A 1 125 ? -12.894 10.149  -4.083  1.00 0.00 ? 125 PRO A O    5  
ATOM 10828 C CB   . PRO A 1 125 ? -14.831 13.022  -4.375  1.00 0.00 ? 125 PRO A CB   5  
ATOM 10829 C CG   . PRO A 1 125 ? -14.584 14.111  -3.388  1.00 0.00 ? 125 PRO A CG   5  
ATOM 10830 C CD   . PRO A 1 125 ? -13.542 13.574  -2.448  1.00 0.00 ? 125 PRO A CD   5  
ATOM 10831 H HA   . PRO A 1 125 ? -15.612 11.351  -3.253  1.00 0.00 ? 125 PRO A HA   5  
ATOM 10832 H HB2  . PRO A 1 125 ? -14.118 13.058  -5.188  1.00 0.00 ? 125 PRO A HB2  5  
ATOM 10833 H HB3  . PRO A 1 125 ? -15.836 13.070  -4.773  1.00 0.00 ? 125 PRO A HB3  5  
ATOM 10834 H HG2  . PRO A 1 125 ? -14.217 14.993  -3.895  1.00 0.00 ? 125 PRO A HG2  5  
ATOM 10835 H HG3  . PRO A 1 125 ? -15.495 14.337  -2.850  1.00 0.00 ? 125 PRO A HG3  5  
ATOM 10836 H HD2  . PRO A 1 125 ? -12.548 13.775  -2.826  1.00 0.00 ? 125 PRO A HD2  5  
ATOM 10837 H HD3  . PRO A 1 125 ? -13.664 14.000  -1.461  1.00 0.00 ? 125 PRO A HD3  5  
ATOM 10838 N N    . LEU A 1 126 ? -14.592 10.319  -5.563  1.00 0.00 ? 126 LEU A N    5  
ATOM 10839 C CA   . LEU A 1 126 ? -14.095 9.300   -6.492  1.00 0.00 ? 126 LEU A CA   5  
ATOM 10840 C C    . LEU A 1 126 ? -14.330 7.896   -5.918  1.00 0.00 ? 126 LEU A C    5  
ATOM 10841 O O    . LEU A 1 126 ? -14.872 7.025   -6.605  1.00 0.00 ? 126 LEU A O    5  
ATOM 10842 C CB   . LEU A 1 126 ? -12.607 9.535   -6.834  1.00 0.00 ? 126 LEU A CB   5  
ATOM 10843 C CG   . LEU A 1 126 ? -12.117 8.966   -8.180  1.00 0.00 ? 126 LEU A CG   5  
ATOM 10844 C CD1  . LEU A 1 126 ? -10.717 9.484   -8.498  1.00 0.00 ? 126 LEU A CD1  5  
ATOM 10845 C CD2  . LEU A 1 126 ? -12.129 7.438   -8.184  1.00 0.00 ? 126 LEU A CD2  5  
ATOM 10846 H H    . LEU A 1 126 ? -15.428 10.781  -5.783  1.00 0.00 ? 126 LEU A H    5  
ATOM 10847 H HA   . LEU A 1 126 ? -14.676 9.393   -7.401  1.00 0.00 ? 126 LEU A HA   5  
ATOM 10848 H HB2  . LEU A 1 126 ? -12.433 10.603  -6.839  1.00 0.00 ? 126 LEU A HB2  5  
ATOM 10849 H HB3  . LEU A 1 126 ? -12.007 9.101   -6.046  1.00 0.00 ? 126 LEU A HB3  5  
ATOM 10850 H HG   . LEU A 1 126 ? -12.779 9.306   -8.966  1.00 0.00 ? 126 LEU A HG   5  
ATOM 10851 H HD11 . LEU A 1 126 ? -10.387 9.077   -9.443  1.00 0.00 ? 126 LEU A HD11 5  
ATOM 10852 H HD12 . LEU A 1 126 ? -10.033 9.181   -7.717  1.00 0.00 ? 126 LEU A HD12 5  
ATOM 10853 H HD13 . LEU A 1 126 ? -10.737 10.563  -8.561  1.00 0.00 ? 126 LEU A HD13 5  
ATOM 10854 H HD21 . LEU A 1 126 ? -13.140 7.083   -8.046  1.00 0.00 ? 126 LEU A HD21 5  
ATOM 10855 H HD22 . LEU A 1 126 ? -11.506 7.068   -7.381  1.00 0.00 ? 126 LEU A HD22 5  
ATOM 10856 H HD23 . LEU A 1 126 ? -11.748 7.076   -9.129  1.00 0.00 ? 126 LEU A HD23 5  
ATOM 10857 N N    . TYR A 1 127 ? -13.937 7.681   -4.660  1.00 0.00 ? 127 TYR A N    5  
ATOM 10858 C CA   . TYR A 1 127 ? -14.200 6.416   -3.974  1.00 0.00 ? 127 TYR A CA   5  
ATOM 10859 C C    . TYR A 1 127 ? -15.691 6.075   -4.050  1.00 0.00 ? 127 TYR A C    5  
ATOM 10860 O O    . TYR A 1 127 ? -16.077 4.989   -4.488  1.00 0.00 ? 127 TYR A O    5  
ATOM 10861 C CB   . TYR A 1 127 ? -13.743 6.508   -2.507  1.00 0.00 ? 127 TYR A CB   5  
ATOM 10862 C CG   . TYR A 1 127 ? -14.026 5.259   -1.682  1.00 0.00 ? 127 TYR A CG   5  
ATOM 10863 C CD1  . TYR A 1 127 ? -13.193 4.145   -1.760  1.00 0.00 ? 127 TYR A CD1  5  
ATOM 10864 C CD2  . TYR A 1 127 ? -15.121 5.196   -0.824  1.00 0.00 ? 127 TYR A CD2  5  
ATOM 10865 C CE1  . TYR A 1 127 ? -13.445 3.010   -1.009  1.00 0.00 ? 127 TYR A CE1  5  
ATOM 10866 C CE2  . TYR A 1 127 ? -15.378 4.064   -0.072  1.00 0.00 ? 127 TYR A CE2  5  
ATOM 10867 C CZ   . TYR A 1 127 ? -14.538 2.976   -0.167  1.00 0.00 ? 127 TYR A CZ   5  
ATOM 10868 O OH   . TYR A 1 127 ? -14.794 1.847   0.580   1.00 0.00 ? 127 TYR A OH   5  
ATOM 10869 H H    . TYR A 1 127 ? -13.449 8.388   -4.182  1.00 0.00 ? 127 TYR A H    5  
ATOM 10870 H HA   . TYR A 1 127 ? -13.634 5.642   -4.474  1.00 0.00 ? 127 TYR A HA   5  
ATOM 10871 H HB2  . TYR A 1 127 ? -12.678 6.686   -2.481  1.00 0.00 ? 127 TYR A HB2  5  
ATOM 10872 H HB3  . TYR A 1 127 ? -14.248 7.339   -2.034  1.00 0.00 ? 127 TYR A HB3  5  
ATOM 10873 H HD1  . TYR A 1 127 ? -12.337 4.173   -2.420  1.00 0.00 ? 127 TYR A HD1  5  
ATOM 10874 H HD2  . TYR A 1 127 ? -15.781 6.049   -0.751  1.00 0.00 ? 127 TYR A HD2  5  
ATOM 10875 H HE1  . TYR A 1 127 ? -12.788 2.155   -1.084  1.00 0.00 ? 127 TYR A HE1  5  
ATOM 10876 H HE2  . TYR A 1 127 ? -16.233 4.037   0.587   1.00 0.00 ? 127 TYR A HE2  5  
ATOM 10877 H HH   . TYR A 1 127 ? -13.991 1.570   1.028   1.00 0.00 ? 127 TYR A HH   5  
ATOM 10878 N N    . ARG A 1 128 ? -16.522 7.033   -3.651  1.00 0.00 ? 128 ARG A N    5  
ATOM 10879 C CA   . ARG A 1 128 ? -17.973 6.861   -3.664  1.00 0.00 ? 128 ARG A CA   5  
ATOM 10880 C C    . ARG A 1 128 ? -18.480 6.674   -5.093  1.00 0.00 ? 128 ARG A C    5  
ATOM 10881 O O    . ARG A 1 128 ? -19.430 5.927   -5.328  1.00 0.00 ? 128 ARG A O    5  
ATOM 10882 C CB   . ARG A 1 128 ? -18.650 8.069   -3.000  1.00 0.00 ? 128 ARG A CB   5  
ATOM 10883 C CG   . ARG A 1 128 ? -18.214 8.271   -1.552  1.00 0.00 ? 128 ARG A CG   5  
ATOM 10884 C CD   . ARG A 1 128 ? -18.805 9.533   -0.934  1.00 0.00 ? 128 ARG A CD   5  
ATOM 10885 N NE   . ARG A 1 128 ? -18.345 9.707   0.446   1.00 0.00 ? 128 ARG A NE   5  
ATOM 10886 C CZ   . ARG A 1 128 ? -18.111 10.885  1.026   1.00 0.00 ? 128 ARG A CZ   5  
ATOM 10887 N NH1  . ARG A 1 128 ? -18.337 12.018  0.374   1.00 0.00 ? 128 ARG A NH1  5  
ATOM 10888 N NH2  . ARG A 1 128 ? -17.655 10.924  2.270   1.00 0.00 ? 128 ARG A NH2  5  
ATOM 10889 H H    . ARG A 1 128 ? -16.147 7.884   -3.338  1.00 0.00 ? 128 ARG A H    5  
ATOM 10890 H HA   . ARG A 1 128 ? -18.206 5.969   -3.095  1.00 0.00 ? 128 ARG A HA   5  
ATOM 10891 H HB2  . ARG A 1 128 ? -18.404 8.961   -3.559  1.00 0.00 ? 128 ARG A HB2  5  
ATOM 10892 H HB3  . ARG A 1 128 ? -19.721 7.925   -3.015  1.00 0.00 ? 128 ARG A HB3  5  
ATOM 10893 H HG2  . ARG A 1 128 ? -18.533 7.419   -0.970  1.00 0.00 ? 128 ARG A HG2  5  
ATOM 10894 H HG3  . ARG A 1 128 ? -17.135 8.339   -1.522  1.00 0.00 ? 128 ARG A HG3  5  
ATOM 10895 H HD2  . ARG A 1 128 ? -18.499 10.388  -1.522  1.00 0.00 ? 128 ARG A HD2  5  
ATOM 10896 H HD3  . ARG A 1 128 ? -19.882 9.457   -0.940  1.00 0.00 ? 128 ARG A HD3  5  
ATOM 10897 H HE   . ARG A 1 128 ? -18.190 8.886   0.968   1.00 0.00 ? 128 ARG A HE   5  
ATOM 10898 H HH11 . ARG A 1 128 ? -18.697 12.003  -0.562  1.00 0.00 ? 128 ARG A HH11 5  
ATOM 10899 H HH12 . ARG A 1 128 ? -18.149 12.899  0.816   1.00 0.00 ? 128 ARG A HH12 5  
ATOM 10900 H HH21 . ARG A 1 128 ? -17.493 10.070  2.777   1.00 0.00 ? 128 ARG A HH21 5  
ATOM 10901 H HH22 . ARG A 1 128 ? -17.462 11.803  2.713   1.00 0.00 ? 128 ARG A HH22 5  
ATOM 10902 N N    . GLU A 1 129 ? -17.827 7.344   -6.041  1.00 0.00 ? 129 GLU A N    5  
ATOM 10903 C CA   . GLU A 1 129 ? -18.167 7.218   -7.458  1.00 0.00 ? 129 GLU A CA   5  
ATOM 10904 C C    . GLU A 1 129 ? -17.963 5.778   -7.934  1.00 0.00 ? 129 GLU A C    5  
ATOM 10905 O O    . GLU A 1 129 ? -18.767 5.245   -8.701  1.00 0.00 ? 129 GLU A O    5  
ATOM 10906 C CB   . GLU A 1 129 ? -17.309 8.181   -8.292  1.00 0.00 ? 129 GLU A CB   5  
ATOM 10907 C CG   . GLU A 1 129 ? -17.592 8.131   -9.790  1.00 0.00 ? 129 GLU A CG   5  
ATOM 10908 C CD   . GLU A 1 129 ? -16.733 9.108   -10.578 1.00 0.00 ? 129 GLU A CD   5  
ATOM 10909 O OE1  . GLU A 1 129 ? -17.042 10.319  -10.566 1.00 0.00 ? 129 GLU A OE1  5  
ATOM 10910 O OE2  . GLU A 1 129 ? -15.747 8.674   -11.214 1.00 0.00 ? 129 GLU A OE2  5  
ATOM 10911 H H    . GLU A 1 129 ? -17.100 7.946   -5.780  1.00 0.00 ? 129 GLU A H    5  
ATOM 10912 H HA   . GLU A 1 129 ? -19.209 7.482   -7.576  1.00 0.00 ? 129 GLU A HA   5  
ATOM 10913 H HB2  . GLU A 1 129 ? -17.487 9.190   -7.948  1.00 0.00 ? 129 GLU A HB2  5  
ATOM 10914 H HB3  . GLU A 1 129 ? -16.267 7.940   -8.135  1.00 0.00 ? 129 GLU A HB3  5  
ATOM 10915 H HG2  . GLU A 1 129 ? -17.396 7.130   -10.148 1.00 0.00 ? 129 GLU A HG2  5  
ATOM 10916 H HG3  . GLU A 1 129 ? -18.632 8.373   -9.956  1.00 0.00 ? 129 GLU A HG3  5  
ATOM 10917 N N    . CYS A 1 130 ? -16.892 5.151   -7.454  1.00 0.00 ? 130 CYS A N    5  
ATOM 10918 C CA   . CYS A 1 130 ? -16.583 3.770   -7.813  1.00 0.00 ? 130 CYS A CA   5  
ATOM 10919 C C    . CYS A 1 130 ? -17.598 2.813   -7.186  1.00 0.00 ? 130 CYS A C    5  
ATOM 10920 O O    . CYS A 1 130 ? -17.850 1.726   -7.708  1.00 0.00 ? 130 CYS A O    5  
ATOM 10921 C CB   . CYS A 1 130 ? -15.163 3.405   -7.365  1.00 0.00 ? 130 CYS A CB   5  
ATOM 10922 S SG   . CYS A 1 130 ? -14.635 1.755   -7.879  1.00 0.00 ? 130 CYS A SG   5  
ATOM 10923 H H    . CYS A 1 130 ? -16.292 5.632   -6.845  1.00 0.00 ? 130 CYS A H    5  
ATOM 10924 H HA   . CYS A 1 130 ? -16.645 3.685   -8.890  1.00 0.00 ? 130 CYS A HA   5  
ATOM 10925 H HB2  . CYS A 1 130 ? -14.467 4.117   -7.784  1.00 0.00 ? 130 CYS A HB2  5  
ATOM 10926 H HB3  . CYS A 1 130 ? -15.108 3.449   -6.287  1.00 0.00 ? 130 CYS A HB3  5  
ATOM 10927 H HG   . CYS A 1 130 ? -15.719 1.081   -8.243  1.00 0.00 ? 130 CYS A HG   5  
ATOM 10928 N N    . LEU A 1 131 ? -18.169 3.227   -6.055  1.00 0.00 ? 131 LEU A N    5  
ATOM 10929 C CA   . LEU A 1 131 ? -19.211 2.450   -5.375  1.00 0.00 ? 131 LEU A CA   5  
ATOM 10930 C C    . LEU A 1 131 ? -20.607 2.859   -5.859  1.00 0.00 ? 131 LEU A C    5  
ATOM 10931 O O    . LEU A 1 131 ? -21.608 2.228   -5.508  1.00 0.00 ? 131 LEU A O    5  
ATOM 10932 C CB   . LEU A 1 131 ? -19.112 2.636   -3.848  1.00 0.00 ? 131 LEU A CB   5  
ATOM 10933 C CG   . LEU A 1 131 ? -18.052 1.776   -3.128  1.00 0.00 ? 131 LEU A CG   5  
ATOM 10934 C CD1  . LEU A 1 131 ? -16.641 2.128   -3.591  1.00 0.00 ? 131 LEU A CD1  5  
ATOM 10935 C CD2  . LEU A 1 131 ? -18.175 1.930   -1.612  1.00 0.00 ? 131 LEU A CD2  5  
ATOM 10936 H H    . LEU A 1 131 ? -17.875 4.076   -5.661  1.00 0.00 ? 131 LEU A H    5  
ATOM 10937 H HA   . LEU A 1 131 ? -19.056 1.407   -5.611  1.00 0.00 ? 131 LEU A HA   5  
ATOM 10938 H HB2  . LEU A 1 131 ? -18.891 3.675   -3.649  1.00 0.00 ? 131 LEU A HB2  5  
ATOM 10939 H HB3  . LEU A 1 131 ? -20.075 2.410   -3.415  1.00 0.00 ? 131 LEU A HB3  5  
ATOM 10940 H HG   . LEU A 1 131 ? -18.224 0.735   -3.368  1.00 0.00 ? 131 LEU A HG   5  
ATOM 10941 H HD11 . LEU A 1 131 ? -15.926 1.486   -3.094  1.00 0.00 ? 131 LEU A HD11 5  
ATOM 10942 H HD12 . LEU A 1 131 ? -16.427 3.159   -3.349  1.00 0.00 ? 131 LEU A HD12 5  
ATOM 10943 H HD13 . LEU A 1 131 ? -16.565 1.986   -4.660  1.00 0.00 ? 131 LEU A HD13 5  
ATOM 10944 H HD21 . LEU A 1 131 ? -17.423 1.326   -1.124  1.00 0.00 ? 131 LEU A HD21 5  
ATOM 10945 H HD22 . LEU A 1 131 ? -19.155 1.606   -1.294  1.00 0.00 ? 131 LEU A HD22 5  
ATOM 10946 H HD23 . LEU A 1 131 ? -18.033 2.967   -1.340  1.00 0.00 ? 131 LEU A HD23 5  
ATOM 10947 N N    . LEU A 1 132 ? -20.666 3.915   -6.664  1.00 0.00 ? 132 LEU A N    5  
ATOM 10948 C CA   . LEU A 1 132 ? -21.934 4.463   -7.138  1.00 0.00 ? 132 LEU A CA   5  
ATOM 10949 C C    . LEU A 1 132 ? -22.512 3.587   -8.252  1.00 0.00 ? 132 LEU A C    5  
ATOM 10950 O O    . LEU A 1 132 ? -22.031 3.602   -9.384  1.00 0.00 ? 132 LEU A O    5  
ATOM 10951 C CB   . LEU A 1 132 ? -21.730 5.920   -7.614  1.00 0.00 ? 132 LEU A CB   5  
ATOM 10952 C CG   . LEU A 1 132 ? -23.005 6.751   -7.887  1.00 0.00 ? 132 LEU A CG   5  
ATOM 10953 C CD1  . LEU A 1 132 ? -23.635 6.398   -9.234  1.00 0.00 ? 132 LEU A CD1  5  
ATOM 10954 C CD2  . LEU A 1 132 ? -24.019 6.576   -6.757  1.00 0.00 ? 132 LEU A CD2  5  
ATOM 10955 H H    . LEU A 1 132 ? -19.830 4.337   -6.952  1.00 0.00 ? 132 LEU A H    5  
ATOM 10956 H HA   . LEU A 1 132 ? -22.623 4.463   -6.303  1.00 0.00 ? 132 LEU A HA   5  
ATOM 10957 H HB2  . LEU A 1 132 ? -21.155 6.437   -6.859  1.00 0.00 ? 132 LEU A HB2  5  
ATOM 10958 H HB3  . LEU A 1 132 ? -21.144 5.896   -8.523  1.00 0.00 ? 132 LEU A HB3  5  
ATOM 10959 H HG   . LEU A 1 132 ? -22.734 7.797   -7.923  1.00 0.00 ? 132 LEU A HG   5  
ATOM 10960 H HD11 . LEU A 1 132 ? -23.932 5.359   -9.235  1.00 0.00 ? 132 LEU A HD11 5  
ATOM 10961 H HD12 . LEU A 1 132 ? -22.918 6.568   -10.024 1.00 0.00 ? 132 LEU A HD12 5  
ATOM 10962 H HD13 . LEU A 1 132 ? -24.503 7.019   -9.399  1.00 0.00 ? 132 LEU A HD13 5  
ATOM 10963 H HD21 . LEU A 1 132 ? -24.884 7.194   -6.950  1.00 0.00 ? 132 LEU A HD21 5  
ATOM 10964 H HD22 . LEU A 1 132 ? -23.570 6.870   -5.820  1.00 0.00 ? 132 LEU A HD22 5  
ATOM 10965 H HD23 . LEU A 1 132 ? -24.324 5.541   -6.700  1.00 0.00 ? 132 LEU A HD23 5  
ATOM 10966 N N    . ALA A 1 133 ? -23.536 2.811   -7.908  1.00 0.00 ? 133 ALA A N    5  
ATOM 10967 C CA   . ALA A 1 133 ? -24.250 1.977   -8.874  1.00 0.00 ? 133 ALA A CA   5  
ATOM 10968 C C    . ALA A 1 133 ? -25.718 1.855   -8.470  1.00 0.00 ? 133 ALA A C    5  
ATOM 10969 O O    . ALA A 1 133 ? -26.426 0.945   -8.902  1.00 0.00 ? 133 ALA A O    5  
ATOM 10970 C CB   . ALA A 1 133 ? -23.597 0.598   -8.966  1.00 0.00 ? 133 ALA A CB   5  
ATOM 10971 H H    . ALA A 1 133 ? -23.810 2.783   -6.968  1.00 0.00 ? 133 ALA A H    5  
ATOM 10972 H HA   . ALA A 1 133 ? -24.191 2.451   -9.845  1.00 0.00 ? 133 ALA A HA   5  
ATOM 10973 H HB1  . ALA A 1 133 ? -23.653 0.106   -8.005  1.00 0.00 ? 133 ALA A HB1  5  
ATOM 10974 H HB2  . ALA A 1 133 ? -22.561 0.708   -9.253  1.00 0.00 ? 133 ALA A HB2  5  
ATOM 10975 H HB3  . ALA A 1 133 ? -24.113 0.001   -9.705  1.00 0.00 ? 133 ALA A HB3  5  
ATOM 10976 N N    . GLU A 1 134 ? -26.172 2.799   -7.652  1.00 0.00 ? 134 GLU A N    5  
ATOM 10977 C CA   . GLU A 1 134 ? -27.523 2.758   -7.091  1.00 0.00 ? 134 GLU A CA   5  
ATOM 10978 C C    . GLU A 1 134 ? -28.338 3.987   -7.502  1.00 0.00 ? 134 GLU A C    5  
ATOM 10979 O O    . GLU A 1 134 ? -29.569 3.957   -7.478  1.00 0.00 ? 134 GLU A O    5  
ATOM 10980 C CB   . GLU A 1 134 ? -27.443 2.674   -5.563  1.00 0.00 ? 134 GLU A CB   5  
ATOM 10981 C CG   . GLU A 1 134 ? -26.651 3.817   -4.934  1.00 0.00 ? 134 GLU A CG   5  
ATOM 10982 C CD   . GLU A 1 134 ? -26.585 3.728   -3.420  1.00 0.00 ? 134 GLU A CD   5  
ATOM 10983 O OE1  . GLU A 1 134 ? -27.486 4.273   -2.748  1.00 0.00 ? 134 GLU A OE1  5  
ATOM 10984 O OE2  . GLU A 1 134 ? -25.632 3.113   -2.894  1.00 0.00 ? 134 GLU A OE2  5  
ATOM 10985 H H    . GLU A 1 134 ? -25.587 3.546   -7.420  1.00 0.00 ? 134 GLU A H    5  
ATOM 10986 H HA   . GLU A 1 134 ? -28.017 1.872   -7.465  1.00 0.00 ? 134 GLU A HA   5  
ATOM 10987 H HB2  . GLU A 1 134 ? -28.445 2.690   -5.157  1.00 0.00 ? 134 GLU A HB2  5  
ATOM 10988 H HB3  . GLU A 1 134 ? -26.969 1.742   -5.289  1.00 0.00 ? 134 GLU A HB3  5  
ATOM 10989 H HG2  . GLU A 1 134 ? -25.644 3.799   -5.327  1.00 0.00 ? 134 GLU A HG2  5  
ATOM 10990 H HG3  . GLU A 1 134 ? -27.121 4.753   -5.206  1.00 0.00 ? 134 GLU A HG3  5  
ATOM 10991 N N    . ALA A 1 135 ? -27.645 5.056   -7.892  1.00 0.00 ? 135 ALA A N    5  
ATOM 10992 C CA   . ALA A 1 135 ? -28.294 6.331   -8.192  1.00 0.00 ? 135 ALA A CA   5  
ATOM 10993 C C    . ALA A 1 135 ? -29.216 6.209   -9.402  1.00 0.00 ? 135 ALA A C    5  
ATOM 10994 O O    . ALA A 1 135 ? -30.424 6.441   -9.304  1.00 0.00 ? 135 ALA A O    5  
ATOM 10995 C CB   . ALA A 1 135 ? -27.251 7.420   -8.424  1.00 0.00 ? 135 ALA A CB   5  
ATOM 10996 H H    . ALA A 1 135 ? -26.676 4.981   -7.998  1.00 0.00 ? 135 ALA A H    5  
ATOM 10997 H HA   . ALA A 1 135 ? -28.885 6.612   -7.331  1.00 0.00 ? 135 ALA A HA   5  
ATOM 10998 H HB1  . ALA A 1 135 ? -26.650 7.167   -9.287  1.00 0.00 ? 135 ALA A HB1  5  
ATOM 10999 H HB2  . ALA A 1 135 ? -26.615 7.502   -7.556  1.00 0.00 ? 135 ALA A HB2  5  
ATOM 11000 H HB3  . ALA A 1 135 ? -27.747 8.364   -8.597  1.00 0.00 ? 135 ALA A HB3  5  
ATOM 11001 N N    . GLU A 1 136 ? -28.638 5.838   -10.538 1.00 0.00 ? 136 GLU A N    5  
ATOM 11002 C CA   . GLU A 1 136 ? -29.390 5.706   -11.782 1.00 0.00 ? 136 GLU A CA   5  
ATOM 11003 C C    . GLU A 1 136 ? -30.144 4.377   -11.816 1.00 0.00 ? 136 GLU A C    5  
ATOM 11004 O O    . GLU A 1 136 ? -31.344 4.340   -12.103 1.00 0.00 ? 136 GLU A O    5  
ATOM 11005 C CB   . GLU A 1 136 ? -28.445 5.816   -12.989 1.00 0.00 ? 136 GLU A CB   5  
ATOM 11006 C CG   . GLU A 1 136 ? -27.644 7.115   -13.017 1.00 0.00 ? 136 GLU A CG   5  
ATOM 11007 C CD   . GLU A 1 136 ? -26.771 7.243   -14.255 1.00 0.00 ? 136 GLU A CD   5  
ATOM 11008 O OE1  . GLU A 1 136 ? -25.676 6.642   -14.280 1.00 0.00 ? 136 GLU A OE1  5  
ATOM 11009 O OE2  . GLU A 1 136 ? -27.178 7.944   -15.211 1.00 0.00 ? 136 GLU A OE2  5  
ATOM 11010 H H    . GLU A 1 136 ? -27.678 5.644   -10.541 1.00 0.00 ? 136 GLU A H    5  
ATOM 11011 H HA   . GLU A 1 136 ? -30.108 6.514   -11.825 1.00 0.00 ? 136 GLU A HA   5  
ATOM 11012 H HB2  . GLU A 1 136 ? -27.749 4.989   -12.965 1.00 0.00 ? 136 GLU A HB2  5  
ATOM 11013 H HB3  . GLU A 1 136 ? -29.028 5.759   -13.897 1.00 0.00 ? 136 GLU A HB3  5  
ATOM 11014 H HG2  . GLU A 1 136 ? -28.333 7.948   -12.991 1.00 0.00 ? 136 GLU A HG2  5  
ATOM 11015 H HG3  . GLU A 1 136 ? -27.010 7.151   -12.142 1.00 0.00 ? 136 GLU A HG3  5  
ATOM 11016 N N    . SER A 1 1   ? 1.790   -14.629 -7.542  1.00 0.00 ? 1   SER A N    6  
ATOM 11017 C CA   . SER A 1 1   ? 0.861   -13.496 -7.339  1.00 0.00 ? 1   SER A CA   6  
ATOM 11018 C C    . SER A 1 1   ? -0.503  -13.793 -7.969  1.00 0.00 ? 1   SER A C    6  
ATOM 11019 O O    . SER A 1 1   ? -1.522  -13.798 -7.275  1.00 0.00 ? 1   SER A O    6  
ATOM 11020 C CB   . SER A 1 1   ? 1.476   -12.214 -7.923  1.00 0.00 ? 1   SER A CB   6  
ATOM 11021 O OG   . SER A 1 1   ? 2.038   -12.447 -9.208  1.00 0.00 ? 1   SER A OG   6  
ATOM 11022 H H1   . SER A 1 1   ? 1.388   -15.501 -7.145  1.00 0.00 ? 1   SER A H1   6  
ATOM 11023 H H2   . SER A 1 1   ? 2.694   -14.437 -7.070  1.00 0.00 ? 1   SER A H2   6  
ATOM 11024 H H3   . SER A 1 1   ? 1.965   -14.770 -8.555  1.00 0.00 ? 1   SER A H3   6  
ATOM 11025 H HA   . SER A 1 1   ? 0.725   -13.366 -6.273  1.00 0.00 ? 1   SER A HA   6  
ATOM 11026 H HB2  . SER A 1 1   ? 0.712   -11.456 -8.012  1.00 0.00 ? 1   SER A HB2  6  
ATOM 11027 H HB3  . SER A 1 1   ? 2.255   -11.859 -7.263  1.00 0.00 ? 1   SER A HB3  6  
ATOM 11028 H HG   . SER A 1 1   ? 3.002   -12.371 -9.150  1.00 0.00 ? 1   SER A HG   6  
ATOM 11029 N N    . MET A 1 2   ? -0.501  -14.059 -9.281  1.00 0.00 ? 2   MET A N    6  
ATOM 11030 C CA   . MET A 1 2   ? -1.718  -14.391 -10.035 1.00 0.00 ? 2   MET A CA   6  
ATOM 11031 C C    . MET A 1 2   ? -2.669  -13.194 -10.120 1.00 0.00 ? 2   MET A C    6  
ATOM 11032 O O    . MET A 1 2   ? -2.969  -12.543 -9.117  1.00 0.00 ? 2   MET A O    6  
ATOM 11033 C CB   . MET A 1 2   ? -2.447  -15.610 -9.432  1.00 0.00 ? 2   MET A CB   6  
ATOM 11034 C CG   . MET A 1 2   ? -1.682  -16.925 -9.566  1.00 0.00 ? 2   MET A CG   6  
ATOM 11035 S SD   . MET A 1 2   ? -0.193  -16.991 -8.542  1.00 0.00 ? 2   MET A SD   6  
ATOM 11036 C CE   . MET A 1 2   ? -0.910  -17.153 -6.904  1.00 0.00 ? 2   MET A CE   6  
ATOM 11037 H H    . MET A 1 2   ? 0.350   -14.023 -9.765  1.00 0.00 ? 2   MET A H    6  
ATOM 11038 H HA   . MET A 1 2   ? -1.405  -14.643 -11.040 1.00 0.00 ? 2   MET A HA   6  
ATOM 11039 H HB2  . MET A 1 2   ? -2.620  -15.427 -8.380  1.00 0.00 ? 2   MET A HB2  6  
ATOM 11040 H HB3  . MET A 1 2   ? -3.401  -15.724 -9.928  1.00 0.00 ? 2   MET A HB3  6  
ATOM 11041 H HG2  . MET A 1 2   ? -2.333  -17.736 -9.275  1.00 0.00 ? 2   MET A HG2  6  
ATOM 11042 H HG3  . MET A 1 2   ? -1.394  -17.055 -10.601 1.00 0.00 ? 2   MET A HG3  6  
ATOM 11043 H HE1  . MET A 1 2   ? -0.120  -17.189 -6.168  1.00 0.00 ? 2   MET A HE1  6  
ATOM 11044 H HE2  . MET A 1 2   ? -1.490  -18.061 -6.854  1.00 0.00 ? 2   MET A HE2  6  
ATOM 11045 H HE3  . MET A 1 2   ? -1.549  -16.304 -6.705  1.00 0.00 ? 2   MET A HE3  6  
ATOM 11046 N N    . THR A 1 3   ? -3.143  -12.906 -11.328 1.00 0.00 ? 3   THR A N    6  
ATOM 11047 C CA   . THR A 1 3   ? -4.065  -11.801 -11.555 1.00 0.00 ? 3   THR A CA   6  
ATOM 11048 C C    . THR A 1 3   ? -5.487  -12.182 -11.134 1.00 0.00 ? 3   THR A C    6  
ATOM 11049 O O    . THR A 1 3   ? -6.370  -12.389 -11.971 1.00 0.00 ? 3   THR A O    6  
ATOM 11050 C CB   . THR A 1 3   ? -4.040  -11.361 -13.039 1.00 0.00 ? 3   THR A CB   6  
ATOM 11051 O OG1  . THR A 1 3   ? -3.984  -12.520 -13.882 1.00 0.00 ? 3   THR A OG1  6  
ATOM 11052 C CG2  . THR A 1 3   ? -2.840  -10.460 -13.331 1.00 0.00 ? 3   THR A CG2  6  
ATOM 11053 H H    . THR A 1 3   ? -2.873  -13.460 -12.092 1.00 0.00 ? 3   THR A H    6  
ATOM 11054 H HA   . THR A 1 3   ? -3.739  -10.966 -10.948 1.00 0.00 ? 3   THR A HA   6  
ATOM 11055 H HB   . THR A 1 3   ? -4.946  -10.811 -13.256 1.00 0.00 ? 3   THR A HB   6  
ATOM 11056 H HG1  . THR A 1 3   ? -4.860  -12.688 -14.250 1.00 0.00 ? 3   THR A HG1  6  
ATOM 11057 H HG21 . THR A 1 3   ? -2.885  -9.583  -12.703 1.00 0.00 ? 3   THR A HG21 6  
ATOM 11058 H HG22 . THR A 1 3   ? -2.861  -10.160 -14.369 1.00 0.00 ? 3   THR A HG22 6  
ATOM 11059 H HG23 . THR A 1 3   ? -1.926  -10.999 -13.131 1.00 0.00 ? 3   THR A HG23 6  
ATOM 11060 N N    . GLU A 1 4   ? -5.685  -12.296 -9.824  1.00 0.00 ? 4   GLU A N    6  
ATOM 11061 C CA   . GLU A 1 4   ? -6.980  -12.660 -9.256  1.00 0.00 ? 4   GLU A CA   6  
ATOM 11062 C C    . GLU A 1 4   ? -7.965  -11.496 -9.374  1.00 0.00 ? 4   GLU A C    6  
ATOM 11063 O O    . GLU A 1 4   ? -9.167  -11.706 -9.562  1.00 0.00 ? 4   GLU A O    6  
ATOM 11064 C CB   . GLU A 1 4   ? -6.806  -13.062 -7.785  1.00 0.00 ? 4   GLU A CB   6  
ATOM 11065 C CG   . GLU A 1 4   ? -8.086  -13.557 -7.119  1.00 0.00 ? 4   GLU A CG   6  
ATOM 11066 C CD   . GLU A 1 4   ? -7.899  -13.843 -5.638  1.00 0.00 ? 4   GLU A CD   6  
ATOM 11067 O OE1  . GLU A 1 4   ? -7.377  -14.926 -5.297  1.00 0.00 ? 4   GLU A OE1  6  
ATOM 11068 O OE2  . GLU A 1 4   ? -8.262  -12.979 -4.810  1.00 0.00 ? 4   GLU A OE2  6  
ATOM 11069 H H    . GLU A 1 4   ? -4.929  -12.142 -9.218  1.00 0.00 ? 4   GLU A H    6  
ATOM 11070 H HA   . GLU A 1 4   ? -7.364  -13.505 -9.811  1.00 0.00 ? 4   GLU A HA   6  
ATOM 11071 H HB2  . GLU A 1 4   ? -6.068  -13.849 -7.724  1.00 0.00 ? 4   GLU A HB2  6  
ATOM 11072 H HB3  . GLU A 1 4   ? -6.446  -12.205 -7.231  1.00 0.00 ? 4   GLU A HB3  6  
ATOM 11073 H HG2  . GLU A 1 4   ? -8.853  -12.805 -7.234  1.00 0.00 ? 4   GLU A HG2  6  
ATOM 11074 H HG3  . GLU A 1 4   ? -8.403  -14.467 -7.611  1.00 0.00 ? 4   GLU A HG3  6  
ATOM 11075 N N    . GLU A 1 5   ? -7.432  -10.273 -9.275  1.00 0.00 ? 5   GLU A N    6  
ATOM 11076 C CA   . GLU A 1 5   ? -8.233  -9.044  -9.319  1.00 0.00 ? 5   GLU A CA   6  
ATOM 11077 C C    . GLU A 1 5   ? -9.085  -8.900  -8.053  1.00 0.00 ? 5   GLU A C    6  
ATOM 11078 O O    . GLU A 1 5   ? -9.117  -9.799  -7.204  1.00 0.00 ? 5   GLU A O    6  
ATOM 11079 C CB   . GLU A 1 5   ? -9.112  -8.995  -10.583 1.00 0.00 ? 5   GLU A CB   6  
ATOM 11080 C CG   . GLU A 1 5   ? -8.318  -9.028  -11.887 1.00 0.00 ? 5   GLU A CG   6  
ATOM 11081 C CD   . GLU A 1 5   ? -9.211  -9.028  -13.117 1.00 0.00 ? 5   GLU A CD   6  
ATOM 11082 O OE1  . GLU A 1 5   ? -9.578  -7.931  -13.596 1.00 0.00 ? 5   GLU A OE1  6  
ATOM 11083 O OE2  . GLU A 1 5   ? -9.554  -10.123 -13.611 1.00 0.00 ? 5   GLU A OE2  6  
ATOM 11084 H H    . GLU A 1 5   ? -6.464  -10.194 -9.161  1.00 0.00 ? 5   GLU A H    6  
ATOM 11085 H HA   . GLU A 1 5   ? -7.540  -8.214  -9.350  1.00 0.00 ? 5   GLU A HA   6  
ATOM 11086 H HB2  . GLU A 1 5   ? -9.784  -9.843  -10.574 1.00 0.00 ? 5   GLU A HB2  6  
ATOM 11087 H HB3  . GLU A 1 5   ? -9.697  -8.086  -10.566 1.00 0.00 ? 5   GLU A HB3  6  
ATOM 11088 H HG2  . GLU A 1 5   ? -7.675  -8.161  -11.925 1.00 0.00 ? 5   GLU A HG2  6  
ATOM 11089 H HG3  . GLU A 1 5   ? -7.709  -9.923  -11.900 1.00 0.00 ? 5   GLU A HG3  6  
ATOM 11090 N N    . GLN A 1 6   ? -9.762  -7.761  -7.925  1.00 0.00 ? 6   GLN A N    6  
ATOM 11091 C CA   . GLN A 1 6   ? -10.548 -7.452  -6.734  1.00 0.00 ? 6   GLN A CA   6  
ATOM 11092 C C    . GLN A 1 6   ? -11.471 -6.258  -6.988  1.00 0.00 ? 6   GLN A C    6  
ATOM 11093 O O    . GLN A 1 6   ? -11.197 -5.437  -7.867  1.00 0.00 ? 6   GLN A O    6  
ATOM 11094 C CB   . GLN A 1 6   ? -9.611  -7.151  -5.551  1.00 0.00 ? 6   GLN A CB   6  
ATOM 11095 C CG   . GLN A 1 6   ? -8.543  -6.107  -5.865  1.00 0.00 ? 6   GLN A CG   6  
ATOM 11096 C CD   . GLN A 1 6   ? -7.649  -5.798  -4.679  1.00 0.00 ? 6   GLN A CD   6  
ATOM 11097 O OE1  . GLN A 1 6   ? -7.431  -6.641  -3.808  1.00 0.00 ? 6   GLN A OE1  6  
ATOM 11098 N NE2  . GLN A 1 6   ? -7.118  -4.588  -4.643  1.00 0.00 ? 6   GLN A NE2  6  
ATOM 11099 H H    . GLN A 1 6   ? -9.730  -7.104  -8.652  1.00 0.00 ? 6   GLN A H    6  
ATOM 11100 H HA   . GLN A 1 6   ? -11.150 -8.318  -6.496  1.00 0.00 ? 6   GLN A HA   6  
ATOM 11101 H HB2  . GLN A 1 6   ? -10.201 -6.794  -4.718  1.00 0.00 ? 6   GLN A HB2  6  
ATOM 11102 H HB3  . GLN A 1 6   ? -9.114  -8.067  -5.260  1.00 0.00 ? 6   GLN A HB3  6  
ATOM 11103 H HG2  . GLN A 1 6   ? -7.925  -6.473  -6.672  1.00 0.00 ? 6   GLN A HG2  6  
ATOM 11104 H HG3  . GLN A 1 6   ? -9.031  -5.193  -6.175  1.00 0.00 ? 6   GLN A HG3  6  
ATOM 11105 H HE21 . GLN A 1 6   ? -7.329  -3.970  -5.380  1.00 0.00 ? 6   GLN A HE21 6  
ATOM 11106 H HE22 . GLN A 1 6   ? -6.522  -4.357  -3.900  1.00 0.00 ? 6   GLN A HE22 6  
ATOM 11107 N N    . PRO A 1 7   ? -12.595 -6.164  -6.244  1.00 0.00 ? 7   PRO A N    6  
ATOM 11108 C CA   . PRO A 1 7   ? -13.488 -4.998  -6.299  1.00 0.00 ? 7   PRO A CA   6  
ATOM 11109 C C    . PRO A 1 7   ? -12.905 -3.812  -5.526  1.00 0.00 ? 7   PRO A C    6  
ATOM 11110 O O    . PRO A 1 7   ? -12.063 -3.998  -4.652  1.00 0.00 ? 7   PRO A O    6  
ATOM 11111 C CB   . PRO A 1 7   ? -14.769 -5.514  -5.633  1.00 0.00 ? 7   PRO A CB   6  
ATOM 11112 C CG   . PRO A 1 7   ? -14.293 -6.540  -4.660  1.00 0.00 ? 7   PRO A CG   6  
ATOM 11113 C CD   . PRO A 1 7   ? -13.089 -7.192  -5.297  1.00 0.00 ? 7   PRO A CD   6  
ATOM 11114 H HA   . PRO A 1 7   ? -13.696 -4.701  -7.318  1.00 0.00 ? 7   PRO A HA   6  
ATOM 11115 H HB2  . PRO A 1 7   ? -15.280 -4.700  -5.135  1.00 0.00 ? 7   PRO A HB2  6  
ATOM 11116 H HB3  . PRO A 1 7   ? -15.419 -5.950  -6.379  1.00 0.00 ? 7   PRO A HB3  6  
ATOM 11117 H HG2  . PRO A 1 7   ? -14.016 -6.064  -3.728  1.00 0.00 ? 7   PRO A HG2  6  
ATOM 11118 H HG3  . PRO A 1 7   ? -15.070 -7.273  -4.487  1.00 0.00 ? 7   PRO A HG3  6  
ATOM 11119 H HD2  . PRO A 1 7   ? -12.342 -7.416  -4.546  1.00 0.00 ? 7   PRO A HD2  6  
ATOM 11120 H HD3  . PRO A 1 7   ? -13.378 -8.092  -5.821  1.00 0.00 ? 7   PRO A HD3  6  
ATOM 11121 N N    . VAL A 1 8   ? -13.378 -2.600  -5.824  1.00 0.00 ? 8   VAL A N    6  
ATOM 11122 C CA   . VAL A 1 8   ? -12.826 -1.385  -5.210  1.00 0.00 ? 8   VAL A CA   6  
ATOM 11123 C C    . VAL A 1 8   ? -13.038 -1.381  -3.692  1.00 0.00 ? 8   VAL A C    6  
ATOM 11124 O O    . VAL A 1 8   ? -12.364 -0.657  -2.957  1.00 0.00 ? 8   VAL A O    6  
ATOM 11125 C CB   . VAL A 1 8   ? -13.440 -0.098  -5.824  1.00 0.00 ? 8   VAL A CB   6  
ATOM 11126 C CG1  . VAL A 1 8   ? -13.207 -0.054  -7.334  1.00 0.00 ? 8   VAL A CG1  6  
ATOM 11127 C CG2  . VAL A 1 8   ? -14.929 0.015   -5.495  1.00 0.00 ? 8   VAL A CG2  6  
ATOM 11128 H H    . VAL A 1 8   ? -14.117 -2.520  -6.466  1.00 0.00 ? 8   VAL A H    6  
ATOM 11129 H HA   . VAL A 1 8   ? -11.761 -1.374  -5.406  1.00 0.00 ? 8   VAL A HA   6  
ATOM 11130 H HB   . VAL A 1 8   ? -12.934 0.755   -5.387  1.00 0.00 ? 8   VAL A HB   6  
ATOM 11131 H HG11 . VAL A 1 8   ? -12.144 -0.070  -7.536  1.00 0.00 ? 8   VAL A HG11 6  
ATOM 11132 H HG12 . VAL A 1 8   ? -13.634 0.851   -7.742  1.00 0.00 ? 8   VAL A HG12 6  
ATOM 11133 H HG13 . VAL A 1 8   ? -13.672 -0.912  -7.798  1.00 0.00 ? 8   VAL A HG13 6  
ATOM 11134 H HG21 . VAL A 1 8   ? -15.454 -0.842  -5.889  1.00 0.00 ? 8   VAL A HG21 6  
ATOM 11135 H HG22 . VAL A 1 8   ? -15.331 0.916   -5.935  1.00 0.00 ? 8   VAL A HG22 6  
ATOM 11136 H HG23 . VAL A 1 8   ? -15.061 0.054   -4.422  1.00 0.00 ? 8   VAL A HG23 6  
ATOM 11137 N N    . ALA A 1 9   ? -13.977 -2.199  -3.227  1.00 0.00 ? 9   ALA A N    6  
ATOM 11138 C CA   . ALA A 1 9   ? -14.272 -2.308  -1.799  1.00 0.00 ? 9   ALA A CA   6  
ATOM 11139 C C    . ALA A 1 9   ? -13.090 -2.897  -1.025  1.00 0.00 ? 9   ALA A C    6  
ATOM 11140 O O    . ALA A 1 9   ? -12.982 -2.720  0.189   1.00 0.00 ? 9   ALA A O    6  
ATOM 11141 C CB   . ALA A 1 9   ? -15.522 -3.155  -1.582  1.00 0.00 ? 9   ALA A CB   6  
ATOM 11142 H H    . ALA A 1 9   ? -14.488 -2.742  -3.861  1.00 0.00 ? 9   ALA A H    6  
ATOM 11143 H HA   . ALA A 1 9   ? -14.473 -1.309  -1.429  1.00 0.00 ? 9   ALA A HA   6  
ATOM 11144 H HB1  . ALA A 1 9   ? -15.345 -4.157  -1.943  1.00 0.00 ? 9   ALA A HB1  6  
ATOM 11145 H HB2  . ALA A 1 9   ? -16.350 -2.719  -2.122  1.00 0.00 ? 9   ALA A HB2  6  
ATOM 11146 H HB3  . ALA A 1 9   ? -15.758 -3.189  -0.528  1.00 0.00 ? 9   ALA A HB3  6  
ATOM 11147 N N    . SER A 1 10  ? -12.196 -3.583  -1.737  1.00 0.00 ? 10  SER A N    6  
ATOM 11148 C CA   . SER A 1 10  ? -11.055 -4.249  -1.116  1.00 0.00 ? 10  SER A CA   6  
ATOM 11149 C C    . SER A 1 10  ? -10.126 -3.239  -0.441  1.00 0.00 ? 10  SER A C    6  
ATOM 11150 O O    . SER A 1 10  ? -9.419  -3.571  0.514   1.00 0.00 ? 10  SER A O    6  
ATOM 11151 C CB   . SER A 1 10  ? -10.281 -5.045  -2.171  1.00 0.00 ? 10  SER A CB   6  
ATOM 11152 O OG   . SER A 1 10  ? -9.857  -4.201  -3.227  1.00 0.00 ? 10  SER A OG   6  
ATOM 11153 H H    . SER A 1 10  ? -12.299 -3.633  -2.713  1.00 0.00 ? 10  SER A H    6  
ATOM 11154 H HA   . SER A 1 10  ? -11.432 -4.933  -0.368  1.00 0.00 ? 10  SER A HA   6  
ATOM 11155 H HB2  . SER A 1 10  ? -9.412  -5.499  -1.717  1.00 0.00 ? 10  SER A HB2  6  
ATOM 11156 H HB3  . SER A 1 10  ? -10.919 -5.816  -2.578  1.00 0.00 ? 10  SER A HB3  6  
ATOM 11157 H HG   . SER A 1 10  ? -8.898  -4.221  -3.293  1.00 0.00 ? 10  SER A HG   6  
ATOM 11158 N N    . TRP A 1 11  ? -10.143 -2.008  -0.944  1.00 0.00 ? 11  TRP A N    6  
ATOM 11159 C CA   . TRP A 1 11  ? -9.282  -0.948  -0.429  1.00 0.00 ? 11  TRP A CA   6  
ATOM 11160 C C    . TRP A 1 11  ? -9.532  -0.705  1.058   1.00 0.00 ? 11  TRP A C    6  
ATOM 11161 O O    . TRP A 1 11  ? -8.596  -0.541  1.837   1.00 0.00 ? 11  TRP A O    6  
ATOM 11162 C CB   . TRP A 1 11  ? -9.523  0.353   -1.200  1.00 0.00 ? 11  TRP A CB   6  
ATOM 11163 C CG   . TRP A 1 11  ? -9.345  0.238   -2.686  1.00 0.00 ? 11  TRP A CG   6  
ATOM 11164 C CD1  . TRP A 1 11  ? -8.671  -0.733  -3.374  1.00 0.00 ? 11  TRP A CD1  6  
ATOM 11165 C CD2  . TRP A 1 11  ? -9.849  1.147   -3.670  1.00 0.00 ? 11  TRP A CD2  6  
ATOM 11166 N NE1  . TRP A 1 11  ? -8.737  -0.485  -4.724  1.00 0.00 ? 11  TRP A NE1  6  
ATOM 11167 C CE2  . TRP A 1 11  ? -9.456  0.664   -4.928  1.00 0.00 ? 11  TRP A CE2  6  
ATOM 11168 C CE3  . TRP A 1 11  ? -10.599 2.323   -3.601  1.00 0.00 ? 11  TRP A CE3  6  
ATOM 11169 C CZ2  . TRP A 1 11  ? -9.791  1.316   -6.112  1.00 0.00 ? 11  TRP A CZ2  6  
ATOM 11170 C CZ3  . TRP A 1 11  ? -10.930 2.971   -4.775  1.00 0.00 ? 11  TRP A CZ3  6  
ATOM 11171 C CH2  . TRP A 1 11  ? -10.525 2.467   -6.017  1.00 0.00 ? 11  TRP A CH2  6  
ATOM 11172 H H    . TRP A 1 11  ? -10.746 -1.809  -1.692  1.00 0.00 ? 11  TRP A H    6  
ATOM 11173 H HA   . TRP A 1 11  ? -8.256  -1.255  -0.568  1.00 0.00 ? 11  TRP A HA   6  
ATOM 11174 H HB2  . TRP A 1 11  ? -10.534 0.687   -1.015  1.00 0.00 ? 11  TRP A HB2  6  
ATOM 11175 H HB3  . TRP A 1 11  ? -8.837  1.103   -0.841  1.00 0.00 ? 11  TRP A HB3  6  
ATOM 11176 H HD1  . TRP A 1 11  ? -8.169  -1.569  -2.911  1.00 0.00 ? 11  TRP A HD1  6  
ATOM 11177 H HE1  . TRP A 1 11  ? -8.331  -1.042  -5.430  1.00 0.00 ? 11  TRP A HE1  6  
ATOM 11178 H HE3  . TRP A 1 11  ? -10.919 2.725   -2.652  1.00 0.00 ? 11  TRP A HE3  6  
ATOM 11179 H HZ2  . TRP A 1 11  ? -9.486  0.939   -7.076  1.00 0.00 ? 11  TRP A HZ2  6  
ATOM 11180 H HZ3  . TRP A 1 11  ? -11.510 3.883   -4.738  1.00 0.00 ? 11  TRP A HZ3  6  
ATOM 11181 H HH2  . TRP A 1 11  ? -10.806 3.007   -6.910  1.00 0.00 ? 11  TRP A HH2  6  
ATOM 11182 N N    . ALA A 1 12  ? -10.808 -0.709  1.442   1.00 0.00 ? 12  ALA A N    6  
ATOM 11183 C CA   . ALA A 1 12  ? -11.211 -0.384  2.811   1.00 0.00 ? 12  ALA A CA   6  
ATOM 11184 C C    . ALA A 1 12  ? -10.850 -1.503  3.787   1.00 0.00 ? 12  ALA A C    6  
ATOM 11185 O O    . ALA A 1 12  ? -11.044 -1.368  5.001   1.00 0.00 ? 12  ALA A O    6  
ATOM 11186 C CB   . ALA A 1 12  ? -12.706 -0.091  2.858   1.00 0.00 ? 12  ALA A CB   6  
ATOM 11187 H H    . ALA A 1 12  ? -11.500 -0.943  0.788   1.00 0.00 ? 12  ALA A H    6  
ATOM 11188 H HA   . ALA A 1 12  ? -10.685 0.515   3.104   1.00 0.00 ? 12  ALA A HA   6  
ATOM 11189 H HB1  . ALA A 1 12  ? -12.933 0.726   2.188   1.00 0.00 ? 12  ALA A HB1  6  
ATOM 11190 H HB2  . ALA A 1 12  ? -12.989 0.182   3.865   1.00 0.00 ? 12  ALA A HB2  6  
ATOM 11191 H HB3  . ALA A 1 12  ? -13.257 -0.969  2.555   1.00 0.00 ? 12  ALA A HB3  6  
ATOM 11192 N N    . LEU A 1 13  ? -10.333 -2.608  3.259   1.00 0.00 ? 13  LEU A N    6  
ATOM 11193 C CA   . LEU A 1 13  ? -9.923  -3.734  4.090   1.00 0.00 ? 13  LEU A CA   6  
ATOM 11194 C C    . LEU A 1 13  ? -8.552  -3.473  4.709   1.00 0.00 ? 13  LEU A C    6  
ATOM 11195 O O    . LEU A 1 13  ? -8.365  -3.652  5.917   1.00 0.00 ? 13  LEU A O    6  
ATOM 11196 C CB   . LEU A 1 13  ? -9.892  -5.034  3.269   1.00 0.00 ? 13  LEU A CB   6  
ATOM 11197 C CG   . LEU A 1 13  ? -11.240 -5.464  2.663   1.00 0.00 ? 13  LEU A CG   6  
ATOM 11198 C CD1  . LEU A 1 13  ? -11.084 -6.749  1.852   1.00 0.00 ? 13  LEU A CD1  6  
ATOM 11199 C CD2  . LEU A 1 13  ? -12.296 -5.638  3.754   1.00 0.00 ? 13  LEU A CD2  6  
ATOM 11200 H H    . LEU A 1 13  ? -10.218 -2.664  2.287   1.00 0.00 ? 13  LEU A H    6  
ATOM 11201 H HA   . LEU A 1 13  ? -10.648 -3.841  4.884   1.00 0.00 ? 13  LEU A HA   6  
ATOM 11202 H HB2  . LEU A 1 13  ? -9.181  -4.906  2.462   1.00 0.00 ? 13  LEU A HB2  6  
ATOM 11203 H HB3  . LEU A 1 13  ? -9.541  -5.831  3.908   1.00 0.00 ? 13  LEU A HB3  6  
ATOM 11204 H HG   . LEU A 1 13  ? -11.584 -4.691  1.988   1.00 0.00 ? 13  LEU A HG   6  
ATOM 11205 H HD11 . LEU A 1 13  ? -12.038 -7.029  1.431   1.00 0.00 ? 13  LEU A HD11 6  
ATOM 11206 H HD12 . LEU A 1 13  ? -10.729 -7.542  2.495   1.00 0.00 ? 13  LEU A HD12 6  
ATOM 11207 H HD13 . LEU A 1 13  ? -10.374 -6.588  1.054   1.00 0.00 ? 13  LEU A HD13 6  
ATOM 11208 H HD21 . LEU A 1 13  ? -13.231 -5.939  3.305   1.00 0.00 ? 13  LEU A HD21 6  
ATOM 11209 H HD22 . LEU A 1 13  ? -12.436 -4.702  4.275   1.00 0.00 ? 13  LEU A HD22 6  
ATOM 11210 H HD23 . LEU A 1 13  ? -11.973 -6.396  4.454   1.00 0.00 ? 13  LEU A HD23 6  
ATOM 11211 N N    . SER A 1 14  ? -7.603  -3.034  3.882   1.00 0.00 ? 14  SER A N    6  
ATOM 11212 C CA   . SER A 1 14  ? -6.226  -2.820  4.323   1.00 0.00 ? 14  SER A CA   6  
ATOM 11213 C C    . SER A 1 14  ? -5.502  -1.847  3.390   1.00 0.00 ? 14  SER A C    6  
ATOM 11214 O O    . SER A 1 14  ? -5.655  -1.918  2.164   1.00 0.00 ? 14  SER A O    6  
ATOM 11215 C CB   . SER A 1 14  ? -5.469  -4.155  4.364   1.00 0.00 ? 14  SER A CB   6  
ATOM 11216 O OG   . SER A 1 14  ? -6.127  -5.099  5.193   1.00 0.00 ? 14  SER A OG   6  
ATOM 11217 H H    . SER A 1 14  ? -7.838  -2.831  2.951   1.00 0.00 ? 14  SER A H    6  
ATOM 11218 H HA   . SER A 1 14  ? -6.253  -2.397  5.318   1.00 0.00 ? 14  SER A HA   6  
ATOM 11219 H HB2  . SER A 1 14  ? -5.403  -4.560  3.365   1.00 0.00 ? 14  SER A HB2  6  
ATOM 11220 H HB3  . SER A 1 14  ? -4.473  -3.991  4.750   1.00 0.00 ? 14  SER A HB3  6  
ATOM 11221 H HG   . SER A 1 14  ? -6.622  -4.629  5.880   1.00 0.00 ? 14  SER A HG   6  
ATOM 11222 N N    . PHE A 1 15  ? -4.698  -0.957  3.974   1.00 0.00 ? 15  PHE A N    6  
ATOM 11223 C CA   . PHE A 1 15  ? -3.915  0.008   3.202   1.00 0.00 ? 15  PHE A CA   6  
ATOM 11224 C C    . PHE A 1 15  ? -3.033  -0.717  2.191   1.00 0.00 ? 15  PHE A C    6  
ATOM 11225 O O    . PHE A 1 15  ? -2.892  -0.280  1.056   1.00 0.00 ? 15  PHE A O    6  
ATOM 11226 C CB   . PHE A 1 15  ? -3.056  0.878   4.134   1.00 0.00 ? 15  PHE A CB   6  
ATOM 11227 C CG   . PHE A 1 15  ? -2.247  1.944   3.424   1.00 0.00 ? 15  PHE A CG   6  
ATOM 11228 C CD1  . PHE A 1 15  ? -2.788  2.662   2.364   1.00 0.00 ? 15  PHE A CD1  6  
ATOM 11229 C CD2  . PHE A 1 15  ? -0.949  2.232   3.823   1.00 0.00 ? 15  PHE A CD2  6  
ATOM 11230 C CE1  . PHE A 1 15  ? -2.053  3.639   1.721   1.00 0.00 ? 15  PHE A CE1  6  
ATOM 11231 C CE2  . PHE A 1 15  ? -0.211  3.210   3.182   1.00 0.00 ? 15  PHE A CE2  6  
ATOM 11232 C CZ   . PHE A 1 15  ? -0.764  3.914   2.131   1.00 0.00 ? 15  PHE A CZ   6  
ATOM 11233 H H    . PHE A 1 15  ? -4.630  -0.949  4.954   1.00 0.00 ? 15  PHE A H    6  
ATOM 11234 H HA   . PHE A 1 15  ? -4.609  0.643   2.668   1.00 0.00 ? 15  PHE A HA   6  
ATOM 11235 H HB2  . PHE A 1 15  ? -3.702  1.376   4.843   1.00 0.00 ? 15  PHE A HB2  6  
ATOM 11236 H HB3  . PHE A 1 15  ? -2.368  0.240   4.673   1.00 0.00 ? 15  PHE A HB3  6  
ATOM 11237 H HD1  . PHE A 1 15  ? -3.797  2.450   2.040   1.00 0.00 ? 15  PHE A HD1  6  
ATOM 11238 H HD2  . PHE A 1 15  ? -0.512  1.683   4.644   1.00 0.00 ? 15  PHE A HD2  6  
ATOM 11239 H HE1  . PHE A 1 15  ? -2.486  4.189   0.897   1.00 0.00 ? 15  PHE A HE1  6  
ATOM 11240 H HE2  . PHE A 1 15  ? 0.798   3.423   3.504   1.00 0.00 ? 15  PHE A HE2  6  
ATOM 11241 H HZ   . PHE A 1 15  ? -0.189  4.678   1.629   1.00 0.00 ? 15  PHE A HZ   6  
ATOM 11242 N N    . GLU A 1 16  ? -2.455  -1.833  2.620   1.00 0.00 ? 16  GLU A N    6  
ATOM 11243 C CA   . GLU A 1 16  ? -1.645  -2.687  1.755   1.00 0.00 ? 16  GLU A CA   6  
ATOM 11244 C C    . GLU A 1 16  ? -2.406  -3.060  0.481   1.00 0.00 ? 16  GLU A C    6  
ATOM 11245 O O    . GLU A 1 16  ? -1.859  -3.011  -0.621  1.00 0.00 ? 16  GLU A O    6  
ATOM 11246 C CB   . GLU A 1 16  ? -1.246  -3.961  2.515   1.00 0.00 ? 16  GLU A CB   6  
ATOM 11247 C CG   . GLU A 1 16  ? -0.428  -4.952  1.693   1.00 0.00 ? 16  GLU A CG   6  
ATOM 11248 C CD   . GLU A 1 16  ? -0.139  -6.237  2.451   1.00 0.00 ? 16  GLU A CD   6  
ATOM 11249 O OE1  . GLU A 1 16  ? -1.042  -7.099  2.533   1.00 0.00 ? 16  GLU A OE1  6  
ATOM 11250 O OE2  . GLU A 1 16  ? 0.985   -6.388  2.980   1.00 0.00 ? 16  GLU A OE2  6  
ATOM 11251 H H    . GLU A 1 16  ? -2.564  -2.086  3.559   1.00 0.00 ? 16  GLU A H    6  
ATOM 11252 H HA   . GLU A 1 16  ? -0.752  -2.140  1.488   1.00 0.00 ? 16  GLU A HA   6  
ATOM 11253 H HB2  . GLU A 1 16  ? -0.663  -3.679  3.381   1.00 0.00 ? 16  GLU A HB2  6  
ATOM 11254 H HB3  . GLU A 1 16  ? -2.146  -4.460  2.850   1.00 0.00 ? 16  GLU A HB3  6  
ATOM 11255 H HG2  . GLU A 1 16  ? -0.978  -5.198  0.795   1.00 0.00 ? 16  GLU A HG2  6  
ATOM 11256 H HG3  . GLU A 1 16  ? 0.511   -4.489  1.421   1.00 0.00 ? 16  GLU A HG3  6  
ATOM 11257 N N    . ARG A 1 17  ? -3.681  -3.400  0.643   1.00 0.00 ? 17  ARG A N    6  
ATOM 11258 C CA   . ARG A 1 17  ? -4.489  -3.914  -0.459  1.00 0.00 ? 17  ARG A CA   6  
ATOM 11259 C C    . ARG A 1 17  ? -4.923  -2.785  -1.398  1.00 0.00 ? 17  ARG A C    6  
ATOM 11260 O O    . ARG A 1 17  ? -5.319  -3.034  -2.535  1.00 0.00 ? 17  ARG A O    6  
ATOM 11261 C CB   . ARG A 1 17  ? -5.705  -4.673  0.090   1.00 0.00 ? 17  ARG A CB   6  
ATOM 11262 C CG   . ARG A 1 17  ? -6.372  -5.593  -0.931  1.00 0.00 ? 17  ARG A CG   6  
ATOM 11263 C CD   . ARG A 1 17  ? -7.406  -6.503  -0.279  1.00 0.00 ? 17  ARG A CD   6  
ATOM 11264 N NE   . ARG A 1 17  ? -7.897  -7.525  -1.206  1.00 0.00 ? 17  ARG A NE   6  
ATOM 11265 C CZ   . ARG A 1 17  ? -8.369  -8.717  -0.830  1.00 0.00 ? 17  ARG A CZ   6  
ATOM 11266 N NH1  . ARG A 1 17  ? -8.379  -9.059  0.455   1.00 0.00 ? 17  ARG A NH1  6  
ATOM 11267 N NH2  . ARG A 1 17  ? -8.801  -9.581  -1.744  1.00 0.00 ? 17  ARG A NH2  6  
ATOM 11268 H H    . ARG A 1 17  ? -4.094  -3.294  1.526   1.00 0.00 ? 17  ARG A H    6  
ATOM 11269 H HA   . ARG A 1 17  ? -3.872  -4.605  -1.019  1.00 0.00 ? 17  ARG A HA   6  
ATOM 11270 H HB2  . ARG A 1 17  ? -5.386  -5.276  0.930   1.00 0.00 ? 17  ARG A HB2  6  
ATOM 11271 H HB3  . ARG A 1 17  ? -6.438  -3.957  0.434   1.00 0.00 ? 17  ARG A HB3  6  
ATOM 11272 H HG2  . ARG A 1 17  ? -6.862  -4.988  -1.681  1.00 0.00 ? 17  ARG A HG2  6  
ATOM 11273 H HG3  . ARG A 1 17  ? -5.613  -6.204  -1.400  1.00 0.00 ? 17  ARG A HG3  6  
ATOM 11274 H HD2  . ARG A 1 17  ? -6.954  -6.989  0.573   1.00 0.00 ? 17  ARG A HD2  6  
ATOM 11275 H HD3  . ARG A 1 17  ? -8.241  -5.901  0.054   1.00 0.00 ? 17  ARG A HD3  6  
ATOM 11276 H HE   . ARG A 1 17  ? -7.869  -7.310  -2.166  1.00 0.00 ? 17  ARG A HE   6  
ATOM 11277 H HH11 . ARG A 1 17  ? -8.028  -8.423  1.152   1.00 0.00 ? 17  ARG A HH11 6  
ATOM 11278 H HH12 . ARG A 1 17  ? -8.732  -9.957  0.737   1.00 0.00 ? 17  ARG A HH12 6  
ATOM 11279 H HH21 . ARG A 1 17  ? -8.774  -9.346  -2.722  1.00 0.00 ? 17  ARG A HH21 6  
ATOM 11280 H HH22 . ARG A 1 17  ? -9.157  -10.477 -1.461  1.00 0.00 ? 17  ARG A HH22 6  
ATOM 11281 N N    . LEU A 1 18  ? -4.863  -1.550  -0.903  1.00 0.00 ? 18  LEU A N    6  
ATOM 11282 C CA   . LEU A 1 18  ? -5.103  -0.364  -1.735  1.00 0.00 ? 18  LEU A CA   6  
ATOM 11283 C C    . LEU A 1 18  ? -3.799  0.107   -2.378  1.00 0.00 ? 18  LEU A C    6  
ATOM 11284 O O    . LEU A 1 18  ? -3.762  0.485   -3.549  1.00 0.00 ? 18  LEU A O    6  
ATOM 11285 C CB   . LEU A 1 18  ? -5.732  0.768   -0.883  1.00 0.00 ? 18  LEU A CB   6  
ATOM 11286 C CG   . LEU A 1 18  ? -5.784  2.177   -1.534  1.00 0.00 ? 18  LEU A CG   6  
ATOM 11287 C CD1  . LEU A 1 18  ? -6.972  2.981   -1.012  1.00 0.00 ? 18  LEU A CD1  6  
ATOM 11288 C CD2  . LEU A 1 18  ? -4.491  2.955   -1.276  1.00 0.00 ? 18  LEU A CD2  6  
ATOM 11289 H H    . LEU A 1 18  ? -4.669  -1.430  0.054   1.00 0.00 ? 18  LEU A H    6  
ATOM 11290 H HA   . LEU A 1 18  ? -5.797  -0.640  -2.517  1.00 0.00 ? 18  LEU A HA   6  
ATOM 11291 H HB2  . LEU A 1 18  ? -6.743  0.472   -0.638  1.00 0.00 ? 18  LEU A HB2  6  
ATOM 11292 H HB3  . LEU A 1 18  ? -5.171  0.843   0.038   1.00 0.00 ? 18  LEU A HB3  6  
ATOM 11293 H HG   . LEU A 1 18  ? -5.901  2.069   -2.603  1.00 0.00 ? 18  LEU A HG   6  
ATOM 11294 H HD11 . LEU A 1 18  ? -6.934  3.029   0.068   1.00 0.00 ? 18  LEU A HD11 6  
ATOM 11295 H HD12 . LEU A 1 18  ? -7.892  2.509   -1.320  1.00 0.00 ? 18  LEU A HD12 6  
ATOM 11296 H HD13 . LEU A 1 18  ? -6.933  3.983   -1.417  1.00 0.00 ? 18  LEU A HD13 6  
ATOM 11297 H HD21 . LEU A 1 18  ? -3.658  2.431   -1.721  1.00 0.00 ? 18  LEU A HD21 6  
ATOM 11298 H HD22 . LEU A 1 18  ? -4.330  3.048   -0.211  1.00 0.00 ? 18  LEU A HD22 6  
ATOM 11299 H HD23 . LEU A 1 18  ? -4.569  3.939   -1.714  1.00 0.00 ? 18  LEU A HD23 6  
ATOM 11300 N N    . LEU A 1 19  ? -2.729  0.058   -1.597  1.00 0.00 ? 19  LEU A N    6  
ATOM 11301 C CA   . LEU A 1 19  ? -1.443  0.634   -1.978  1.00 0.00 ? 19  LEU A CA   6  
ATOM 11302 C C    . LEU A 1 19  ? -0.711  -0.253  -2.984  1.00 0.00 ? 19  LEU A C    6  
ATOM 11303 O O    . LEU A 1 19  ? 0.078   0.230   -3.797  1.00 0.00 ? 19  LEU A O    6  
ATOM 11304 C CB   . LEU A 1 19  ? -0.591  0.846   -0.716  1.00 0.00 ? 19  LEU A CB   6  
ATOM 11305 C CG   . LEU A 1 19  ? 0.773   1.514   -0.933  1.00 0.00 ? 19  LEU A CG   6  
ATOM 11306 C CD1  . LEU A 1 19  ? 0.617   2.869   -1.622  1.00 0.00 ? 19  LEU A CD1  6  
ATOM 11307 C CD2  . LEU A 1 19  ? 1.510   1.671   0.394   1.00 0.00 ? 19  LEU A CD2  6  
ATOM 11308 H H    . LEU A 1 19  ? -2.803  -0.389  -0.732  1.00 0.00 ? 19  LEU A H    6  
ATOM 11309 H HA   . LEU A 1 19  ? -1.633  1.595   -2.436  1.00 0.00 ? 19  LEU A HA   6  
ATOM 11310 H HB2  . LEU A 1 19  ? -1.160  1.452   -0.026  1.00 0.00 ? 19  LEU A HB2  6  
ATOM 11311 H HB3  . LEU A 1 19  ? -0.424  -0.120  -0.259  1.00 0.00 ? 19  LEU A HB3  6  
ATOM 11312 H HG   . LEU A 1 19  ? 1.372   0.882   -1.569  1.00 0.00 ? 19  LEU A HG   6  
ATOM 11313 H HD11 . LEU A 1 19  ? 0.012   3.520   -1.008  1.00 0.00 ? 19  LEU A HD11 6  
ATOM 11314 H HD12 . LEU A 1 19  ? 0.143   2.733   -2.581  1.00 0.00 ? 19  LEU A HD12 6  
ATOM 11315 H HD13 . LEU A 1 19  ? 1.592   3.315   -1.764  1.00 0.00 ? 19  LEU A HD13 6  
ATOM 11316 H HD21 . LEU A 1 19  ? 1.660   0.699   0.841   1.00 0.00 ? 19  LEU A HD21 6  
ATOM 11317 H HD22 . LEU A 1 19  ? 0.927   2.288   1.063   1.00 0.00 ? 19  LEU A HD22 6  
ATOM 11318 H HD23 . LEU A 1 19  ? 2.470   2.137   0.222   1.00 0.00 ? 19  LEU A HD23 6  
ATOM 11319 N N    . GLN A 1 20  ? -0.968  -1.551  -2.923  1.00 0.00 ? 20  GLN A N    6  
ATOM 11320 C CA   . GLN A 1 20  ? -0.361  -2.496  -3.858  1.00 0.00 ? 20  GLN A CA   6  
ATOM 11321 C C    . GLN A 1 20  ? -1.301  -2.740  -5.046  1.00 0.00 ? 20  GLN A C    6  
ATOM 11322 O O    . GLN A 1 20  ? -0.961  -3.453  -5.992  1.00 0.00 ? 20  GLN A O    6  
ATOM 11323 C CB   . GLN A 1 20  ? -0.017  -3.805  -3.130  1.00 0.00 ? 20  GLN A CB   6  
ATOM 11324 C CG   . GLN A 1 20  ? 0.840   -4.773  -3.946  1.00 0.00 ? 20  GLN A CG   6  
ATOM 11325 C CD   . GLN A 1 20  ? 1.438   -5.893  -3.103  1.00 0.00 ? 20  GLN A CD   6  
ATOM 11326 O OE1  . GLN A 1 20  ? 1.636   -7.009  -3.579  1.00 0.00 ? 20  GLN A OE1  6  
ATOM 11327 N NE2  . GLN A 1 20  ? 1.753   -5.591  -1.848  1.00 0.00 ? 20  GLN A NE2  6  
ATOM 11328 H H    . GLN A 1 20  ? -1.576  -1.887  -2.231  1.00 0.00 ? 20  GLN A H    6  
ATOM 11329 H HA   . GLN A 1 20  ? 0.554   -2.051  -4.230  1.00 0.00 ? 20  GLN A HA   6  
ATOM 11330 H HB2  . GLN A 1 20  ? 0.520   -3.563  -2.224  1.00 0.00 ? 20  GLN A HB2  6  
ATOM 11331 H HB3  . GLN A 1 20  ? -0.937  -4.308  -2.866  1.00 0.00 ? 20  GLN A HB3  6  
ATOM 11332 H HG2  . GLN A 1 20  ? 0.226   -5.214  -4.717  1.00 0.00 ? 20  GLN A HG2  6  
ATOM 11333 H HG3  . GLN A 1 20  ? 1.647   -4.220  -4.405  1.00 0.00 ? 20  GLN A HG3  6  
ATOM 11334 H HE21 . GLN A 1 20  ? 1.587   -4.679  -1.536  1.00 0.00 ? 20  GLN A HE21 6  
ATOM 11335 H HE22 . GLN A 1 20  ? 2.142   -6.293  -1.288  1.00 0.00 ? 20  GLN A HE22 6  
ATOM 11336 N N    . ASP A 1 21  ? -2.477  -2.117  -4.995  1.00 0.00 ? 21  ASP A N    6  
ATOM 11337 C CA   . ASP A 1 21  ? -3.468  -2.222  -6.068  1.00 0.00 ? 21  ASP A CA   6  
ATOM 11338 C C    . ASP A 1 21  ? -3.324  -1.039  -7.027  1.00 0.00 ? 21  ASP A C    6  
ATOM 11339 O O    . ASP A 1 21  ? -3.342  0.116   -6.600  1.00 0.00 ? 21  ASP A O    6  
ATOM 11340 C CB   . ASP A 1 21  ? -4.885  -2.260  -5.479  1.00 0.00 ? 21  ASP A CB   6  
ATOM 11341 C CG   . ASP A 1 21  ? -5.968  -2.399  -6.541  1.00 0.00 ? 21  ASP A CG   6  
ATOM 11342 O OD1  . ASP A 1 21  ? -6.021  -3.455  -7.204  1.00 0.00 ? 21  ASP A OD1  6  
ATOM 11343 O OD2  . ASP A 1 21  ? -6.781  -1.467  -6.696  1.00 0.00 ? 21  ASP A OD2  6  
ATOM 11344 H H    . ASP A 1 21  ? -2.684  -1.558  -4.220  1.00 0.00 ? 21  ASP A H    6  
ATOM 11345 H HA   . ASP A 1 21  ? -3.283  -3.143  -6.605  1.00 0.00 ? 21  ASP A HA   6  
ATOM 11346 H HB2  . ASP A 1 21  ? -4.962  -3.100  -4.804  1.00 0.00 ? 21  ASP A HB2  6  
ATOM 11347 H HB3  . ASP A 1 21  ? -5.059  -1.347  -4.924  1.00 0.00 ? 21  ASP A HB3  6  
ATOM 11348 N N    . PRO A 1 22  ? -3.166  -1.307  -8.338  1.00 0.00 ? 22  PRO A N    6  
ATOM 11349 C CA   . PRO A 1 22  ? -2.939  -0.253  -9.338  1.00 0.00 ? 22  PRO A CA   6  
ATOM 11350 C C    . PRO A 1 22  ? -4.138  0.683   -9.493  1.00 0.00 ? 22  PRO A C    6  
ATOM 11351 O O    . PRO A 1 22  ? -3.977  1.870   -9.782  1.00 0.00 ? 22  PRO A O    6  
ATOM 11352 C CB   . PRO A 1 22  ? -2.684  -1.038  -10.637 1.00 0.00 ? 22  PRO A CB   6  
ATOM 11353 C CG   . PRO A 1 22  ? -3.338  -2.361  -10.418 1.00 0.00 ? 22  PRO A CG   6  
ATOM 11354 C CD   . PRO A 1 22  ? -3.193  -2.652  -8.949  1.00 0.00 ? 22  PRO A CD   6  
ATOM 11355 H HA   . PRO A 1 22  ? -2.065  0.333   -9.094  1.00 0.00 ? 22  PRO A HA   6  
ATOM 11356 H HB2  . PRO A 1 22  ? -3.119  -0.512  -11.478 1.00 0.00 ? 22  PRO A HB2  6  
ATOM 11357 H HB3  . PRO A 1 22  ? -1.619  -1.146  -10.792 1.00 0.00 ? 22  PRO A HB3  6  
ATOM 11358 H HG2  . PRO A 1 22  ? -4.385  -2.303  -10.688 1.00 0.00 ? 22  PRO A HG2  6  
ATOM 11359 H HG3  . PRO A 1 22  ? -2.841  -3.121  -11.005 1.00 0.00 ? 22  PRO A HG3  6  
ATOM 11360 H HD2  . PRO A 1 22  ? -4.038  -3.223  -8.589  1.00 0.00 ? 22  PRO A HD2  6  
ATOM 11361 H HD3  . PRO A 1 22  ? -2.270  -3.180  -8.754  1.00 0.00 ? 22  PRO A HD3  6  
ATOM 11362 N N    . LEU A 1 23  ? -5.337  0.148   -9.291  1.00 0.00 ? 23  LEU A N    6  
ATOM 11363 C CA   . LEU A 1 23  ? -6.563  0.930   -9.419  1.00 0.00 ? 23  LEU A CA   6  
ATOM 11364 C C    . LEU A 1 23  ? -6.687  1.860   -8.207  1.00 0.00 ? 23  LEU A C    6  
ATOM 11365 O O    . LEU A 1 23  ? -6.928  3.069   -8.341  1.00 0.00 ? 23  LEU A O    6  
ATOM 11366 C CB   . LEU A 1 23  ? -7.776  -0.021  -9.528  1.00 0.00 ? 23  LEU A CB   6  
ATOM 11367 C CG   . LEU A 1 23  ? -8.987  0.498   -10.336 1.00 0.00 ? 23  LEU A CG   6  
ATOM 11368 C CD1  . LEU A 1 23  ? -10.006 -0.622  -10.554 1.00 0.00 ? 23  LEU A CD1  6  
ATOM 11369 C CD2  . LEU A 1 23  ? -9.650  1.685   -9.646  1.00 0.00 ? 23  LEU A CD2  6  
ATOM 11370 H H    . LEU A 1 23  ? -5.400  -0.800  -9.034  1.00 0.00 ? 23  LEU A H    6  
ATOM 11371 H HA   . LEU A 1 23  ? -6.490  1.528   -10.319 1.00 0.00 ? 23  LEU A HA   6  
ATOM 11372 H HB2  . LEU A 1 23  ? -7.439  -0.938  -9.990  1.00 0.00 ? 23  LEU A HB2  6  
ATOM 11373 H HB3  . LEU A 1 23  ? -8.115  -0.253  -8.528  1.00 0.00 ? 23  LEU A HB3  6  
ATOM 11374 H HG   . LEU A 1 23  ? -8.646  0.825   -11.309 1.00 0.00 ? 23  LEU A HG   6  
ATOM 11375 H HD11 . LEU A 1 23  ? -10.841 -0.244  -11.128 1.00 0.00 ? 23  LEU A HD11 6  
ATOM 11376 H HD12 . LEU A 1 23  ? -10.362 -0.982  -9.599  1.00 0.00 ? 23  LEU A HD12 6  
ATOM 11377 H HD13 . LEU A 1 23  ? -9.540  -1.434  -11.093 1.00 0.00 ? 23  LEU A HD13 6  
ATOM 11378 H HD21 . LEU A 1 23  ? -10.442 2.070   -10.273 1.00 0.00 ? 23  LEU A HD21 6  
ATOM 11379 H HD22 . LEU A 1 23  ? -8.918  2.462   -9.481  1.00 0.00 ? 23  LEU A HD22 6  
ATOM 11380 H HD23 . LEU A 1 23  ? -10.062 1.371   -8.700  1.00 0.00 ? 23  LEU A HD23 6  
ATOM 11381 N N    . GLY A 1 24  ? -6.475  1.281   -7.031  1.00 0.00 ? 24  GLY A N    6  
ATOM 11382 C CA   . GLY A 1 24  ? -6.538  2.024   -5.790  1.00 0.00 ? 24  GLY A CA   6  
ATOM 11383 C C    . GLY A 1 24  ? -5.520  3.133   -5.735  1.00 0.00 ? 24  GLY A C    6  
ATOM 11384 O O    . GLY A 1 24  ? -5.873  4.299   -5.550  1.00 0.00 ? 24  GLY A O    6  
ATOM 11385 H H    . GLY A 1 24  ? -6.274  0.322   -7.006  1.00 0.00 ? 24  GLY A H    6  
ATOM 11386 H HA2  . GLY A 1 24  ? -7.528  2.445   -5.680  1.00 0.00 ? 24  GLY A HA2  6  
ATOM 11387 H HA3  . GLY A 1 24  ? -6.356  1.343   -4.972  1.00 0.00 ? 24  GLY A HA3  6  
ATOM 11388 N N    . LEU A 1 25  ? -4.256  2.771   -5.921  1.00 0.00 ? 25  LEU A N    6  
ATOM 11389 C CA   . LEU A 1 25  ? -3.164  3.733   -5.864  1.00 0.00 ? 25  LEU A CA   6  
ATOM 11390 C C    . LEU A 1 25  ? -3.353  4.808   -6.939  1.00 0.00 ? 25  LEU A C    6  
ATOM 11391 O O    . LEU A 1 25  ? -2.946  5.949   -6.751  1.00 0.00 ? 25  LEU A O    6  
ATOM 11392 C CB   . LEU A 1 25  ? -1.803  3.023   -6.030  1.00 0.00 ? 25  LEU A CB   6  
ATOM 11393 C CG   . LEU A 1 25  ? -0.642  3.589   -5.180  1.00 0.00 ? 25  LEU A CG   6  
ATOM 11394 C CD1  . LEU A 1 25  ? 0.634   2.790   -5.412  1.00 0.00 ? 25  LEU A CD1  6  
ATOM 11395 C CD2  . LEU A 1 25  ? -0.398  5.068   -5.467  1.00 0.00 ? 25  LEU A CD2  6  
ATOM 11396 H H    . LEU A 1 25  ? -4.052  1.825   -6.091  1.00 0.00 ? 25  LEU A H    6  
ATOM 11397 H HA   . LEU A 1 25  ? -3.196  4.207   -4.892  1.00 0.00 ? 25  LEU A HA   6  
ATOM 11398 H HB2  . LEU A 1 25  ? -1.931  1.981   -5.767  1.00 0.00 ? 25  LEU A HB2  6  
ATOM 11399 H HB3  . LEU A 1 25  ? -1.514  3.076   -7.071  1.00 0.00 ? 25  LEU A HB3  6  
ATOM 11400 H HG   . LEU A 1 25  ? -0.900  3.493   -4.135  1.00 0.00 ? 25  LEU A HG   6  
ATOM 11401 H HD11 . LEU A 1 25  ? 0.920   2.857   -6.452  1.00 0.00 ? 25  LEU A HD11 6  
ATOM 11402 H HD12 . LEU A 1 25  ? 0.463   1.755   -5.154  1.00 0.00 ? 25  LEU A HD12 6  
ATOM 11403 H HD13 . LEU A 1 25  ? 1.427   3.186   -4.793  1.00 0.00 ? 25  LEU A HD13 6  
ATOM 11404 H HD21 . LEU A 1 25  ? -0.163  5.201   -6.513  1.00 0.00 ? 25  LEU A HD21 6  
ATOM 11405 H HD22 . LEU A 1 25  ? 0.429   5.419   -4.866  1.00 0.00 ? 25  LEU A HD22 6  
ATOM 11406 H HD23 . LEU A 1 25  ? -1.285  5.634   -5.222  1.00 0.00 ? 25  LEU A HD23 6  
ATOM 11407 N N    . ALA A 1 26  ? -3.986  4.443   -8.055  1.00 0.00 ? 26  ALA A N    6  
ATOM 11408 C CA   . ALA A 1 26  ? -4.256  5.397   -9.135  1.00 0.00 ? 26  ALA A CA   6  
ATOM 11409 C C    . ALA A 1 26  ? -5.059  6.592   -8.621  1.00 0.00 ? 26  ALA A C    6  
ATOM 11410 O O    . ALA A 1 26  ? -4.627  7.743   -8.728  1.00 0.00 ? 26  ALA A O    6  
ATOM 11411 C CB   . ALA A 1 26  ? -4.995  4.715   -10.281 1.00 0.00 ? 26  ALA A CB   6  
ATOM 11412 H H    . ALA A 1 26  ? -4.276  3.510   -8.158  1.00 0.00 ? 26  ALA A H    6  
ATOM 11413 H HA   . ALA A 1 26  ? -3.305  5.749   -9.510  1.00 0.00 ? 26  ALA A HA   6  
ATOM 11414 H HB1  . ALA A 1 26  ? -5.954  4.357   -9.933  1.00 0.00 ? 26  ALA A HB1  6  
ATOM 11415 H HB2  . ALA A 1 26  ? -4.410  3.882   -10.642 1.00 0.00 ? 26  ALA A HB2  6  
ATOM 11416 H HB3  . ALA A 1 26  ? -5.146  5.422   -11.084 1.00 0.00 ? 26  ALA A HB3  6  
ATOM 11417 N N    . TYR A 1 27  ? -6.224  6.320   -8.042  1.00 0.00 ? 27  TYR A N    6  
ATOM 11418 C CA   . TYR A 1 27  ? -7.080  7.391   -7.532  1.00 0.00 ? 27  TYR A CA   6  
ATOM 11419 C C    . TYR A 1 27  ? -6.517  7.950   -6.224  1.00 0.00 ? 27  TYR A C    6  
ATOM 11420 O O    . TYR A 1 27  ? -6.647  9.142   -5.935  1.00 0.00 ? 27  TYR A O    6  
ATOM 11421 C CB   . TYR A 1 27  ? -8.519  6.890   -7.345  1.00 0.00 ? 27  TYR A CB   6  
ATOM 11422 C CG   . TYR A 1 27  ? -9.205  6.536   -8.656  1.00 0.00 ? 27  TYR A CG   6  
ATOM 11423 C CD1  . TYR A 1 27  ? -9.072  5.269   -9.216  1.00 0.00 ? 27  TYR A CD1  6  
ATOM 11424 C CD2  . TYR A 1 27  ? -9.977  7.470   -9.338  1.00 0.00 ? 27  TYR A CD2  6  
ATOM 11425 C CE1  . TYR A 1 27  ? -9.687  4.947   -10.411 1.00 0.00 ? 27  TYR A CE1  6  
ATOM 11426 C CE2  . TYR A 1 27  ? -10.596 7.152   -10.534 1.00 0.00 ? 27  TYR A CE2  6  
ATOM 11427 C CZ   . TYR A 1 27  ? -10.448 5.889   -11.063 1.00 0.00 ? 27  TYR A CZ   6  
ATOM 11428 O OH   . TYR A 1 27  ? -11.060 5.567   -12.254 1.00 0.00 ? 27  TYR A OH   6  
ATOM 11429 H H    . TYR A 1 27  ? -6.511  5.381   -7.948  1.00 0.00 ? 27  TYR A H    6  
ATOM 11430 H HA   . TYR A 1 27  ? -7.082  8.186   -8.267  1.00 0.00 ? 27  TYR A HA   6  
ATOM 11431 H HB2  . TYR A 1 27  ? -8.509  6.007   -6.723  1.00 0.00 ? 27  TYR A HB2  6  
ATOM 11432 H HB3  . TYR A 1 27  ? -9.104  7.660   -6.861  1.00 0.00 ? 27  TYR A HB3  6  
ATOM 11433 H HD1  . TYR A 1 27  ? -8.475  4.528   -8.703  1.00 0.00 ? 27  TYR A HD1  6  
ATOM 11434 H HD2  . TYR A 1 27  ? -10.095 8.459   -8.920  1.00 0.00 ? 27  TYR A HD2  6  
ATOM 11435 H HE1  . TYR A 1 27  ? -9.571  3.957   -10.827 1.00 0.00 ? 27  TYR A HE1  6  
ATOM 11436 H HE2  . TYR A 1 27  ? -11.192 7.894   -11.046 1.00 0.00 ? 27  TYR A HE2  6  
ATOM 11437 H HH   . TYR A 1 27  ? -11.457 4.688   -12.182 1.00 0.00 ? 27  TYR A HH   6  
ATOM 11438 N N    . PHE A 1 28  ? -5.864  7.087   -5.457  1.00 0.00 ? 28  PHE A N    6  
ATOM 11439 C CA   . PHE A 1 28  ? -5.237  7.486   -4.203  1.00 0.00 ? 28  PHE A CA   6  
ATOM 11440 C C    . PHE A 1 28  ? -4.170  8.550   -4.458  1.00 0.00 ? 28  PHE A C    6  
ATOM 11441 O O    . PHE A 1 28  ? -4.117  9.571   -3.768  1.00 0.00 ? 28  PHE A O    6  
ATOM 11442 C CB   . PHE A 1 28  ? -4.619  6.262   -3.515  1.00 0.00 ? 28  PHE A CB   6  
ATOM 11443 C CG   . PHE A 1 28  ? -3.973  6.554   -2.182  1.00 0.00 ? 28  PHE A CG   6  
ATOM 11444 C CD1  . PHE A 1 28  ? -4.749  6.752   -1.049  1.00 0.00 ? 28  PHE A CD1  6  
ATOM 11445 C CD2  . PHE A 1 28  ? -2.591  6.621   -2.060  1.00 0.00 ? 28  PHE A CD2  6  
ATOM 11446 C CE1  . PHE A 1 28  ? -4.162  7.011   0.174   1.00 0.00 ? 28  PHE A CE1  6  
ATOM 11447 C CE2  . PHE A 1 28  ? -2.001  6.880   -0.839  1.00 0.00 ? 28  PHE A CE2  6  
ATOM 11448 C CZ   . PHE A 1 28  ? -2.788  7.075   0.279   1.00 0.00 ? 28  PHE A CZ   6  
ATOM 11449 H H    . PHE A 1 28  ? -5.806  6.152   -5.740  1.00 0.00 ? 28  PHE A H    6  
ATOM 11450 H HA   . PHE A 1 28  ? -6.004  7.903   -3.564  1.00 0.00 ? 28  PHE A HA   6  
ATOM 11451 H HB2  . PHE A 1 28  ? -5.393  5.526   -3.352  1.00 0.00 ? 28  PHE A HB2  6  
ATOM 11452 H HB3  . PHE A 1 28  ? -3.866  5.840   -4.166  1.00 0.00 ? 28  PHE A HB3  6  
ATOM 11453 H HD1  . PHE A 1 28  ? -5.827  6.703   -1.128  1.00 0.00 ? 28  PHE A HD1  6  
ATOM 11454 H HD2  . PHE A 1 28  ? -1.973  6.468   -2.934  1.00 0.00 ? 28  PHE A HD2  6  
ATOM 11455 H HE1  . PHE A 1 28  ? -4.779  7.161   1.048   1.00 0.00 ? 28  PHE A HE1  6  
ATOM 11456 H HE2  . PHE A 1 28  ? -0.925  6.931   -0.759  1.00 0.00 ? 28  PHE A HE2  6  
ATOM 11457 H HZ   . PHE A 1 28  ? -2.328  7.278   1.236   1.00 0.00 ? 28  PHE A HZ   6  
ATOM 11458 N N    . THR A 1 29  ? -3.337  8.319   -5.471  1.00 0.00 ? 29  THR A N    6  
ATOM 11459 C CA   . THR A 1 29  ? -2.261  9.243   -5.796  1.00 0.00 ? 29  THR A CA   6  
ATOM 11460 C C    . THR A 1 29  ? -2.819  10.494  -6.469  1.00 0.00 ? 29  THR A C    6  
ATOM 11461 O O    . THR A 1 29  ? -2.182  11.544  -6.448  1.00 0.00 ? 29  THR A O    6  
ATOM 11462 C CB   . THR A 1 29  ? -1.171  8.598   -6.694  1.00 0.00 ? 29  THR A CB   6  
ATOM 11463 O OG1  . THR A 1 29  ? -0.016  9.446   -6.747  1.00 0.00 ? 29  THR A OG1  6  
ATOM 11464 C CG2  . THR A 1 29  ? -1.678  8.357   -8.112  1.00 0.00 ? 29  THR A CG2  6  
ATOM 11465 H H    . THR A 1 29  ? -3.453  7.513   -6.012  1.00 0.00 ? 29  THR A H    6  
ATOM 11466 H HA   . THR A 1 29  ? -1.794  9.538   -4.864  1.00 0.00 ? 29  THR A HA   6  
ATOM 11467 H HB   . THR A 1 29  ? -0.888  7.648   -6.262  1.00 0.00 ? 29  THR A HB   6  
ATOM 11468 H HG1  . THR A 1 29  ? -0.253  10.283  -7.160  1.00 0.00 ? 29  THR A HG1  6  
ATOM 11469 H HG21 . THR A 1 29  ? -0.901  7.891   -8.702  1.00 0.00 ? 29  THR A HG21 6  
ATOM 11470 H HG22 . THR A 1 29  ? -1.954  9.300   -8.563  1.00 0.00 ? 29  THR A HG22 6  
ATOM 11471 H HG23 . THR A 1 29  ? -2.542  7.708   -8.081  1.00 0.00 ? 29  THR A HG23 6  
ATOM 11472 N N    . GLU A 1 30  ? -4.007  10.381  -7.073  1.00 0.00 ? 30  GLU A N    6  
ATOM 11473 C CA   . GLU A 1 30  ? -4.682  11.550  -7.627  1.00 0.00 ? 30  GLU A CA   6  
ATOM 11474 C C    . GLU A 1 30  ? -4.839  12.609  -6.536  1.00 0.00 ? 30  GLU A C    6  
ATOM 11475 O O    . GLU A 1 30  ? -4.267  13.696  -6.627  1.00 0.00 ? 30  GLU A O    6  
ATOM 11476 C CB   . GLU A 1 30  ? -6.054  11.182  -8.213  1.00 0.00 ? 30  GLU A CB   6  
ATOM 11477 C CG   . GLU A 1 30  ? -6.790  12.373  -8.818  1.00 0.00 ? 30  GLU A CG   6  
ATOM 11478 C CD   . GLU A 1 30  ? -8.141  12.009  -9.410  1.00 0.00 ? 30  GLU A CD   6  
ATOM 11479 O OE1  . GLU A 1 30  ? -8.178  11.523  -10.563 1.00 0.00 ? 30  GLU A OE1  6  
ATOM 11480 O OE2  . GLU A 1 30  ? -9.172  12.235  -8.744  1.00 0.00 ? 30  GLU A OE2  6  
ATOM 11481 H H    . GLU A 1 30  ? -4.427  9.496   -7.155  1.00 0.00 ? 30  GLU A H    6  
ATOM 11482 H HA   . GLU A 1 30  ? -4.057  11.951  -8.416  1.00 0.00 ? 30  GLU A HA   6  
ATOM 11483 H HB2  . GLU A 1 30  ? -5.917  10.437  -8.984  1.00 0.00 ? 30  GLU A HB2  6  
ATOM 11484 H HB3  . GLU A 1 30  ? -6.669  10.765  -7.427  1.00 0.00 ? 30  GLU A HB3  6  
ATOM 11485 H HG2  . GLU A 1 30  ? -6.940  13.114  -8.045  1.00 0.00 ? 30  GLU A HG2  6  
ATOM 11486 H HG3  . GLU A 1 30  ? -6.174  12.798  -9.600  1.00 0.00 ? 30  GLU A HG3  6  
ATOM 11487 N N    . PHE A 1 31  ? -5.585  12.261  -5.486  1.00 0.00 ? 31  PHE A N    6  
ATOM 11488 C CA   . PHE A 1 31  ? -5.761  13.153  -4.336  1.00 0.00 ? 31  PHE A CA   6  
ATOM 11489 C C    . PHE A 1 31  ? -4.406  13.500  -3.717  1.00 0.00 ? 31  PHE A C    6  
ATOM 11490 O O    . PHE A 1 31  ? -4.078  14.669  -3.511  1.00 0.00 ? 31  PHE A O    6  
ATOM 11491 C CB   . PHE A 1 31  ? -6.652  12.497  -3.268  1.00 0.00 ? 31  PHE A CB   6  
ATOM 11492 C CG   . PHE A 1 31  ? -8.089  12.291  -3.685  1.00 0.00 ? 31  PHE A CG   6  
ATOM 11493 C CD1  . PHE A 1 31  ? -8.431  11.293  -4.585  1.00 0.00 ? 31  PHE A CD1  6  
ATOM 11494 C CD2  . PHE A 1 31  ? -9.101  13.092  -3.167  1.00 0.00 ? 31  PHE A CD2  6  
ATOM 11495 C CE1  . PHE A 1 31  ? -9.746  11.098  -4.960  1.00 0.00 ? 31  PHE A CE1  6  
ATOM 11496 C CE2  . PHE A 1 31  ? -10.418 12.899  -3.539  1.00 0.00 ? 31  PHE A CE2  6  
ATOM 11497 C CZ   . PHE A 1 31  ? -10.741 11.900  -4.437  1.00 0.00 ? 31  PHE A CZ   6  
ATOM 11498 H H    . PHE A 1 31  ? -6.028  11.380  -5.484  1.00 0.00 ? 31  PHE A H    6  
ATOM 11499 H HA   . PHE A 1 31  ? -6.234  14.061  -4.684  1.00 0.00 ? 31  PHE A HA   6  
ATOM 11500 H HB2  . PHE A 1 31  ? -6.242  11.529  -3.017  1.00 0.00 ? 31  PHE A HB2  6  
ATOM 11501 H HB3  . PHE A 1 31  ? -6.649  13.118  -2.382  1.00 0.00 ? 31  PHE A HB3  6  
ATOM 11502 H HD1  . PHE A 1 31  ? -7.657  10.663  -4.997  1.00 0.00 ? 31  PHE A HD1  6  
ATOM 11503 H HD2  . PHE A 1 31  ? -8.849  13.875  -2.465  1.00 0.00 ? 31  PHE A HD2  6  
ATOM 11504 H HE1  . PHE A 1 31  ? -9.996  10.315  -5.661  1.00 0.00 ? 31  PHE A HE1  6  
ATOM 11505 H HE2  . PHE A 1 31  ? -11.194 13.527  -3.127  1.00 0.00 ? 31  PHE A HE2  6  
ATOM 11506 H HZ   . PHE A 1 31  ? -11.768 11.747  -4.730  1.00 0.00 ? 31  PHE A HZ   6  
ATOM 11507 N N    . LEU A 1 32  ? -3.613  12.462  -3.458  1.00 0.00 ? 32  LEU A N    6  
ATOM 11508 C CA   . LEU A 1 32  ? -2.340  12.596  -2.751  1.00 0.00 ? 32  LEU A CA   6  
ATOM 11509 C C    . LEU A 1 32  ? -1.350  13.498  -3.502  1.00 0.00 ? 32  LEU A C    6  
ATOM 11510 O O    . LEU A 1 32  ? -0.467  14.101  -2.890  1.00 0.00 ? 32  LEU A O    6  
ATOM 11511 C CB   . LEU A 1 32  ? -1.731  11.203  -2.522  1.00 0.00 ? 32  LEU A CB   6  
ATOM 11512 C CG   . LEU A 1 32  ? -0.426  11.164  -1.711  1.00 0.00 ? 32  LEU A CG   6  
ATOM 11513 C CD1  . LEU A 1 32  ? -0.626  11.752  -0.318  1.00 0.00 ? 32  LEU A CD1  6  
ATOM 11514 C CD2  . LEU A 1 32  ? 0.101   9.736   -1.619  1.00 0.00 ? 32  LEU A CD2  6  
ATOM 11515 H H    . LEU A 1 32  ? -3.899  11.568  -3.746  1.00 0.00 ? 32  LEU A H    6  
ATOM 11516 H HA   . LEU A 1 32  ? -2.549  13.043  -1.790  1.00 0.00 ? 32  LEU A HA   6  
ATOM 11517 H HB2  . LEU A 1 32  ? -2.465  10.597  -2.008  1.00 0.00 ? 32  LEU A HB2  6  
ATOM 11518 H HB3  . LEU A 1 32  ? -1.541  10.757  -3.488  1.00 0.00 ? 32  LEU A HB3  6  
ATOM 11519 H HG   . LEU A 1 32  ? 0.320   11.760  -2.216  1.00 0.00 ? 32  LEU A HG   6  
ATOM 11520 H HD11 . LEU A 1 32  ? -0.971  12.772  -0.404  1.00 0.00 ? 32  LEU A HD11 6  
ATOM 11521 H HD12 . LEU A 1 32  ? 0.316   11.737  0.213   1.00 0.00 ? 32  LEU A HD12 6  
ATOM 11522 H HD13 . LEU A 1 32  ? -1.355  11.167  0.223   1.00 0.00 ? 32  LEU A HD13 6  
ATOM 11523 H HD21 . LEU A 1 32  ? 0.277   9.351   -2.614  1.00 0.00 ? 32  LEU A HD21 6  
ATOM 11524 H HD22 . LEU A 1 32  ? -0.623  9.113   -1.116  1.00 0.00 ? 32  LEU A HD22 6  
ATOM 11525 H HD23 . LEU A 1 32  ? 1.029   9.728   -1.063  1.00 0.00 ? 32  LEU A HD23 6  
ATOM 11526 N N    . LYS A 1 33  ? -1.488  13.595  -4.822  1.00 0.00 ? 33  LYS A N    6  
ATOM 11527 C CA   . LYS A 1 33  ? -0.573  14.420  -5.613  1.00 0.00 ? 33  LYS A CA   6  
ATOM 11528 C C    . LYS A 1 33  ? -1.145  15.821  -5.827  1.00 0.00 ? 33  LYS A C    6  
ATOM 11529 O O    . LYS A 1 33  ? -0.416  16.745  -6.181  1.00 0.00 ? 33  LYS A O    6